2BEWB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
336
Chain Sequence
b'AHFTFQPEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 125
structure length 336
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bewB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bewB01
3E9YA 2C3MA 1V5EA 2JGDB 4FEGA 1V16B 4RJKA 2W93A 2EZ8A 1YI1A 2O1XA 4KXXA 2Y0PA 4COKA 5DGDA 2AG1A 1R9JA 3JU3A 4K9KA 1PO7A 1X7ZB 4KXWA 2UZ1B 3HWX1 1V16A 4JUDX 2VBIA 1B0PA 4JU9A 1IK6A 1UM9B 2BFFB 3ZHVA 2IHTA 3AHIA 4D5GA 1X7ZA 2UZ1A 4K9MA 1YHYA 2OZLB 4JUBA 4JUCA 5EJ6A 1V5GA 2EZUA 4K9QA 4MQ5A 1RP7A 1UM9A 2BFFA 1W88B 2X7JA 2PGOA 2JI7A 2BFDB 1Y9DA 4GM4A 1OLSB 4XEUA 3AHHA 3KOMA 1X7XA 4D5EA 2FN3A 2OZLA 3EA4A 2BEVA 2PDAA 3IAFA 1PVDA 2C3PA 3EXHB 5ERYA 1DTWB 3DV0B 5K6RA 1UMBB 2BFDA 3F6EX 2C3UA 1OLXB 2XT9A 3ZHRA 1OLSA 1YHZA 1W85B 3AHJA 2C3OA 2O1SA 1DTWA 2NXWA 2FWNA 1UMBA 3EXEB 1V11B 4GM0A 5ESDA 4FEEA 4MPJA 2EZ9A 1TKCA 3RIMA 2BFBB 2Q29A 1T9AA 5FEMA 1YNOA 1BFDA 2G28A 3UPTA 3HYLA 2J9FB 3EXEA 3AHDA 2IHVA 1QPBA 5EJ8A 5I4IA 4JD5A 4K9PA 1YD7A 2JGDA 1V5FA 3F6BX 2J9FA 4K9LA 1T9CA 1TRKA 5I51A 4KXVA 2YIDA 5EXDA 1N0HA 3M34A 3D7KA 2R8PA 1UPAA 2UZAA 3M49A 5EJ4A 4GPEA 3LPLA 4KGDA 3FZNA 3EXG1 1OVMA 2E6KA 5HJEA 1X7YB 1NGSA 2EZ4A 1QGDA 2PANA 3EYAA 1U5BB 2Q5JA 3LQ4A 1AY0A 2C42A 1OZHA 1L8AA 1V1MB 4KXYA 1TKBA 1UMDB 5ERXA 3L84A 1X7YA 3AHGA 1W88A 1OZGA 1YBHA 4QPZA 3EXG2 1Z8NA 3OOYA 1GPUA 5I5GA 2Q5OA 2V3WA 1U5BA 2C31A 4QELA 4MZXA 1X7WB 3M7IA 2JIBA 3EXHA 4GM1A 2WVAA 1T9BA 3DV0A 1OLXA 1NI4B 5I5EA 5EXEA 1W85A 1OZFA 5EJMA 2JLCA 3IAEA 1ZPDA 2IHUA 4JU8A 3EXIB 1POXA 1V11A 5HHTA 4C7VA 1MCZA 3FSJX 2BFBA 3ZHUA 1UMCB 4MPRA 2R8OA 4RJJA 5HYVA 2BFEB 3HWWA 2JI6A 2JLAA 3DUFB 3EXIA 2QTCA 5K2OA 2BEUB 3AHCA 4Q9DA 2Q27A 2PGNA 2JI8A 3LQ1A 2G67A 1POWA 1JSCA 1UMCA 5DGTA 5IMSA 1PYDA 3EY9A 2BFEA 5K6TA 3DUFA 5AHKA 4C7XA 2AG0A 2BEUA 3ZHTA 2BEWB 4K9NA 2Q28A 2VK1A 2EZTA 3UK1A 4KXUA 1Q6ZA 2BFCB 2QTAA 1PI3A 3EXFB 4JUAA 5EJ9A 3AHEA 2XT6A 2VK8A 1X7XB 2WVGA 2WVHA 2JI9A 2BEVB 2BEWA 2VK4A 1YI0A 1KEKA 3DVAB 2BFCA 3AI7A 1WCIB 3MOSA 3EXFA 2VJYA 3OE1A 2Q5LA 2IEAA 4K9OA 3AHFA 4WBXC 2VBGA 1V1MA 1V1RB 1OLUB 5EJ5A 1X80B 1UPBA 1UMDA 1ITZA 5EJAA 2R5NA 3LQ2A 5DEIA 3DVAA 3M6LA 5EJ7A 1QS0B 1TKAA 1WCIA 4GG1A 4JUFA 2C3YA 2BP7B 2G25A 3ZHQA 1X7WA 2DJIA 1V1RA 1OLUA 5K3SA 4GP9A 1X80A 3ZHSA 5HGXA 2YICA 1T9DA 2XTAA 2VBFA 1QS0A 5C4IA 4RJIA 1UPCA 3EXHC 1NI4A 2Q5QA 4ZP1A 3FLMA 4QQ8A 4MPPA 2BP7A
chains in the Genus database with same CATH superfamily
5ADUS 4E5KA 1U3WA 2HH9A 3AG6A 1L5RA 3JAKA 4ED9A 1P7VA 3CBQA 5BV2P 2C4MA 2PFGA 3DM9B 2YZ2A 4M1YA 4E08A 5ISMA 3URMA 1JA0A 1YJCA 3KQQA 1GPH1 5ITWA 2I4OA 1U3CA 4M1TA 5BR1A 4RTSA 1LDGA 3A32A 2OGTA 3JR7A 2JRLA 1JFSA 4QG3A 3G9UA 2QYSA 1LDEA 2D1QA 3ESBA 2KX7A 4V0RA 3IJPA 4UZEA 1HETA 4JJ4A 4KMOA 5D1HA 2VF4X 1I4DD 1L7MA 3GCGA 4QYMA 1GG9A 2ZWAA 1D1TA 1AZLA 1LLCA 2EP7A 4G9BA 3CF2A 4M9CA 3SLGA 4DMGA 2W6ZA 4RD3A 4OTZA 2JLWA 1ACJA 3IHLA 4B6GA 1KQFA 4EBBA 3PHLA 3OIVA 5AJYA 1IIBA 4JVLA 2WPDD 3KR0A 5FPKA 1ZIYA 1JH8A 2Q3FA 5LZ5A 5JADA 1SVLA 3MCZA 621PA 4P9NA 1WU8A 3EZGA 4HMOA 4V0MA 4Q37A 3VR5A 4AP9A 1F06A 1L4BA 2WKSA 1O6FA 3EVDA 1XCBA 1GTZA 1V8BA 4QBHA 2FW9A 1G1MA 2AJCA 4RCYA 1EXNA 2VT2A 3UTCA 1T5IA 2ZB3A 5A0TA 3G0OA 4NK4A 3DW3X 3F67A 2P11A 3VH3A 4BJ6A 4F2HA 1UPUA 4KC0A 3HA5A 3RPEA 4A03A 2PS1A 1Q1GA 2BFOA 4U7JA 5AOAA 5AXAA 4P58A 4O4JB 3SBXA 4ZA2A 4UM9D 1N1MA 1FDOA 4BB5A 4DA6A 4K9RA 4O4HF 1Q83A 3LT0A 421PA 1RLMA 2QVCA 5ER6A 3CSDA 4YJ2F 1XFDA 4EF5A 2PUBA 3WA6A 1KIFA 4TZ0A 3PD7A 1XB2A 5K51A 3V1YA 3G23A 4PHHA 1C4KA 4A5OA 1M10A 2C9YA 3TTYA 1UFKA 3NC1C 3WKAA 3OTQA 1IN6A 1R8SA 4OHPA 3ZU4A 3GRCA 1OIXA 3LECA 1TK2A 4RGVA 2R60A 3WISA 2DBZA 1LK5A 4X8HA 4XPIB 1BE6A 3EZYA 2ZK7A 1DG9A 1VCIA 4UM9B 3EEQA 1ARZA 3E4CA 1AQLA 3A6DA 3LBIA 3U4HA 4FGJA 1Y1LA 1E5DA 5AW0A 5EQDA 3ESYA 4P81A 3X1YA 5C34B 2JJ2D 3A1FA 1JDNA 2EIHA 1GQYA 3B7PA 3DPSA 1R0CA 4HX9A 2OCIA 3DC7A 1GM5A 1C0IA 4AYWA 4AN4A 2F43A 3IPXA 3IUYA 3K4QA 2P2NA 3FRIA 4I6GA 4QUBA 2QTTA 4GPAA 1RLTA 3KJGA 4DA0A 2R85A 3A36A 3N76A 3NTQA 4LRTB 1VG8A 4FZRA 4OHXA 4EB6B 2RJNA 4KQFA 2UXCB 3FWHA 1K7FB 2HBYA 3AHHA 3HADA 4G0MA 1DV1A 2CLEB 2WLTA 1CSEE 2GBGA 4O0MA 1MOPA 3HH8A 3TZEA 3GG9A 1QZ3A 3HKDB 2JAQA 3LM8A 5EJFA 2ZT6A 3R5XA 1N75A 1FNMA 4YREA 3MMXA 5CJJA 2VTEA 3IAAA 2XQGA 4KQWA 1CY4A 1JVBA 3LZCA 1J20A 3RANA 3TQOA 3GLHA 5G0TA 3B9RA 3E70C 5K01A 2OCAA 4DABA 4AECA 1ZWLA 1OLXB 2DJ5A 2C3UA 2G76A 3HR4A 3N3AC 1MZVA 1KC1A 2BMAA 1Y5NA 2JAUA 2RG1A 2HEIA 4HMPA 3TZ6A 3DBVO 4L4ZA 3HPQA 2DFKB 4MO2A 1NATA 1UAAA 3EIFA 4AMZA 1W85B 2ZIUB 3RS3A 3VO2A 2ZYRA 2LP4Y 4BNIA 4DC9A 5BNWA 1G55A 1H5QA 4TKUA 5DHPA 5I45A 4WACA 3IVCA 1T3SA 4DKXA 1Z28A 2IYRA 1NX9A 2C3OA 3EUAA 1OX5A 1RHQA 5FORA 4M1ZA 1FVXA 4G1EB 3HTXA 1E1QD 3PUYA 3WMEA 5TQ2A 1SZCA 3RC2A 4HVTA 4OI1A 4RHUA 4JOQA 3LPCA 3O1JC 3H11A 4DCVA 3K72B 1MU0A 4HWOA 2OUIA 4S1VA 5DXFA 1HLGA 1W0JD 2DLCX 1Y9AA 1D2EA 3TIVA 1GPJA 2WNSA 3E84A 3QXJA 1F4PA 2XQKA 3GG2A 2XV1A 1XTBA 3AFOA 1OB2A 2O8CA 4GI5A 1KMCA 5FTWA 2JVKA 2Q29A 1T9AA 5CFZA 1A5TA 2OHJA 3BFJA 2NUPA 3O93A 3VXKA 7ADHA 5JO0A 1FTGA 5G4KA 4PNEA 1NXQA 1JF8A 2LNDA 2NZ8A 3DBLB 4KR6A 1KJ8A 1T0PA 2A30A 2B8TA 2GB4A 2MMGA 4L5JA 1Z4LA 3HFJA 4YRMA 4EGSA 1JRLA 1IDN1 4U8GA 4V24A 4GC9A 3OJOA 2J9FB 4YWHA 3PUWA 4DPMA 1EP2B 2NSHA 2QORA 2JLQA 4I0WB 2ZRGA 4TQUS 2IHVA 4MHOA 4IZHA 1OXKB 4LTDA 3QVGA 4PU0A 5IN5A 4DGQA 4BB6A 3HXOA 4JD5A 1Z33A 4AO8A 2O2ZA 3P2KA 3HV2A 4N7RA 4DMMA 2QRUA 4E14A 5B2EA 2CV2A 4CTJA 3X2EA 1A76A 2OCXA 5GM2A 3KDPA 3OQIA 3F9IA 4B6PA 1K1EA 1PT5A 2NAFA 4HGPA 1QF7A 2XEXA 4QFMA 4ZAFA 3UAGA 5I7WA 2W37A 3MTAA 2XXAA 3KO8A 3K5HA 3PF8A 4RD2A 1CZKA 3ZE1B 1Z45A 2IF2A 5IFKA 2IXBA 3NOXA 4IDOA 1VPVA 5KTKA 2CJPA 3AFHA 2V7QD 4Y9UA 1TRKA 5LA6A 3ZU3A 4BHTA 1BU5A 1UKCA 4HDMA 1IZ7A 4JBLA 4RLSA 4YYEA 4H1WA 2FETA 1A1VA 3AT1A 3DEAA 3E03A 1LI4A 2A86A 3EK2A 3Q3CA 3WGKA 5HRAA 1Z73A 5FOUA 2ZM6B 2E6UX 4RF3A 3KBBA 5AP9A 3W5SA 2HA0A 3NHRA 2AFHB 2P9GA 4J75A 5D3MA 2NUAB 3WYEA 5BR4A 1ATIA 3KL4A 4GOMD 1Y1RA 1RLIA 1R9MA 4CT4B 3OWOA 3V1NA 1UPAA 1GGEA 1NJ2A 2Q1YA 4AUMA 1F7VA 4BDSA 1C0EA 1XJCA 1X13A 4IDGA 3MBIA 2AL7A 5B1SA 2OFWA 3NAGA 4C0JA 2PMBA 4NE7A 1BE1A 3LWNA 1N2CE 3SOZA 1O3YA 4GOJA 1BVHA 5E1MA 1WAMA 1A9RA 1ZJ4A 1VCNA 3CX7A 1SUWA 3CZ9A 1UPXA 4MUEA 2QN3A 4CF4A 3MXTA 2BBSA 2QN1A 3EA0A 1C7FA 3OO1A 4N65A 4PBRA 4WLFA 5FHRA 2V59A 3ZK8A 5GV7A 2VPTA 3V4PB 4NBUA 5BQXA 2A57A 4LI0A 5ALXA 4C5BA 3DAPA 3O2SB 4RPCA 1YT5A 4KI7A 3RVJA 1D09A 3C7AA 3PHBE 2XCLA 5L7YA 3WLIA 4B79A 4D8YA 3NKLA 3EIQA 2X8WA 3QA9A 4X6XA 1A77A 2VBCA 4EJMA 1ZRMA 1QXSA 1V8OA 4M1QA 4BMNA 4UULA 1G8PA 1GL6A 1QJCA 3I8XA 4UHKA 4W5NA 3A31A 3AQIA 1EWTA 1GIAA 4F8JA 3M0EA 1O03A 4HLUC 2O1EA 1L4FA 3DMHA 3WAGA 5HR5A 1NP7A 1PL7A 3PU6A 1OZGA 3QPCA 3TZCA 2OYRA 2RGYA 1KEPA 5ELMA 1Z2OX 3K2QA 4K1XA 4YFYA 3ABRB 1N25A 2IPXA 3QLVC 1V9LA 4LQCA 3G6WA 3WA7A 5DOVA 1PBNA 2H0AA 2C99A 3MUOA 4HOYA 4IH4A 5JWHA 1ZNWA 1ZZEA 3IV7A 4O29A 4FI3C 2ERCA 4RWEA 4D97A 5C7OO 1QKJA 5E8RA 1OI2A 4M9RA 5EERA 1IBSA 4M87A 3TVTA 3ZXYA 1PVVA 1HBJA 1KY4A 2B1RA 4IINA 4REMA 5TXGA 3N2IA 2PLRA 5TJHA 4MR8A 1Q74A 5I3ZA 4DLAA 5JFGA 1GCAA 2OCYC 5IZ4A 1XZDA 3NANA 3PXEA 2HW8A 1ULHA 4IVPA 4CF5A 4DHEA 4ZANA 3DYBA 3QKRA 2CN1A 3LQQA 2O3TA 3PLRA 4LY0A 1YQUA 1KY3A 1R6DA 1JZTA 1DDOA 4FP9A 4P5EA 3ZCTA 5KYXB 2CJYA 3R2JA 2O48X 4CCYA 2OMKA 1ZU4A 4YLEA 1G63A 1QQTA 1RXEA 5BRAA 4HZGA 1ZM9A 4GUAA 3RSQA 3DYVA 1G20A 4OHKA 5IDVA 4CLHA 4U00A 3IB6A 3RBAA 1C8LA 2FNAA 4L02A 4LMRA 5ALKA 1EUYA 3PDCA 4KWEA 3N8IA 3ROPA 2VH5R 2G9RA 3PYLA 1KGDA 5KHAA 4Z1OA 2Z04A 1GNTA 2G40A 3DPIA 3DKPA 1J21A 1XEWX 1Z8HA 4UAUA 4X54A 1MX1A 3TLEA 4EVQA 3SVTA 3BEDA 2GRAA 3KCQA 1GTL1 1NSFA 3SLRA 1DX6A 4CM7A 3OBBA 4EQZA 1BYUA 2OV8A 1NMYA 1K9VF 2IXAA 5D2CA 5FUYA 5BSTA 5G53C 4WBNF 2H85A 1QWSA 2UVPB 4KCGA 1W5SA 1XKQA 1ODKA 4JI4B 4AXBA 3F97A 1XDDA 2N3ZA 4G97A 3RASA 1JGTA 2VEDA 3N9IA 4C4PA 3V55A 3QF4B 5IVPA 3D6TB 1C7JA 3ZVMA 4R2IA 4G5OA 4MV1A 1W1IA 4JZKA 4QUEA 5HYVA 2I80A 5CAEB 3S8YA 4XB2A 2VZ8A 4CLEA 3ZTYA 2EBHX 2R4QA 2AFHE 4L08A 4CG3A 3CKMA 1J8VA 4PGFA 2HBRA 1C0PA 4IJQA 3FOCA 2EGGA 2DY1A 1YDGA 1UCFA 3VKGA 1KH3A 4MIKA 2PRKA 4UBMA 1QB7A 1AQUA 1NQUA 1BROA 3MGAA 3HZZA 3RARA 4YP5A 3PA6A 3UHPA 3U37A 1F0PA 4LVNA 1J23A 4O4IF 2GJAA 2XAUA 3W6OA 1KI6A 1EX6A 2I4RA 2I6QA 4LRUA 3PPVA 2K7ZA 2O8NA 1FDUA 5ETJA 4ZDKA 1ADGA 2DR2A 2ZTSA 3T7CA 4RM2A 1EUDB 1NBHA 1BJKA 2H54A 3IEXA 2PX4A 4U3JA 2NZVG 1UFRA 4TTQA 4OVKA 4MI9A 2ZKLA 4ZZIA 1KI9A 2JBAB 5JQGB 4HXYA 4ZFNA 1UZUA 3NFYA 3PGKA 2CDNA 4J8PA 3EVBA 1M5TA 2HI0A 5CA1B 4OSEA 1RQLA 3UXHA 4U0KA 3PPYA 2BEWB 2G1UA 2BRUC 5G0VA 3W2IA 4Z4CA 4MV4A 1MA0A 3A04A 3PUKA 4E7OA 1VI5A 2GWRA 1BWQA 4OP3A 4BXOA 3KZOA 2D8AA 1MAAA 3DDNA 1S2IA 4MW2A 2WG0A 4QX6A 3ZIDA 1TAUA 3M4NA 2I3ZA 1FRZA 3LX4A 3GUVA 2I1LA 2GM3A 2BBOA 3LCVB 4BNDA 3ZDDA 2B30A 2FUCA 4BEVA 3FD8A 4ECAA 4H0FA 2PBFA 4IQ0A 1NG9A 1X1BA 3R5HA 2WVGA 3AF0A 3BZWA 2NVBA 1LBSA 5K05A 2P2SA 1EVQA 3CPHA 1VJCA 3JQEA 1UOQA 2B9VA 4H9GA 4DDTA 4NAVA 5DI3B 1FP4B 3O3MB 1P9RA 1SCDA 1UPFA 1X3SA 4TXHA 5EPUA 4B9EA 4CPDA 1EFLA 3ZDZB 1VKZA 4HYEA 4UEKA 4AX4A 5JYEA 3Q5DA 3QY0A 3LKVA 3G5UA 4R83A 4XWOA 5F51A 2QTNA 1T0JB 3HKBB 1FMLA 2QUKA 3HC7A 3V4OA 4F4FA 3GELA 2QJWA 3PQ7A 2C0PA 2R8ZA 3TLZA 1T3GA 1ZD5A 4CRWB 3E9CA 3FPLA 5J5VA 1DQZA 2F48A 2BFCA 5K1ZA 3F8WA 1KF0A 1O77A 1WLYA 2GD2A 3OPYI 1Z3CA 2NQTA 5FWXA 4WMLA 3OG9A 2IPLA 1T8PA 3AUTA 3REGA 2DFVA 1C3OA 2PGAA 2R6HA 4DQLA 1RRGA 2A5LA 4BC0A 1WETA 2HJVA 2OMEA 2PEYA 3OT4A 3AVPA 2Y4OA 4ZYYA 1A9XB 5D5PA 1C1DB 2CKDA 3K0CC 1EDEA 3GVXA 5HA5A 4W1RA 3ET4A 4ENQA 1W25A 3X1KA 1CY7A 4PY2A 3VR4A 1J99A 1S01A 3EOAI 3FB4A 4I50F 3U4QA 2H4ZA 4PRLA 3IMFA 4Q03A 4UTNA 1RRKA 2C00A 2WF9A 5IXYA 3K15A 3P9ZA 2A92A 2W2NA 4AJOA 5JPCA 5LP1A 1PHPA 3CRZA 1R4AA 3OLXA 1Q5PA 4ZO4A 4O5AA 1DQNA 2I7DA 4YCAA 3KSAC 4BPRA 1MTZA 3KAPA 2WY2D 1P7CA 3TVDA 3GPCA 3L0YA 2ZTHA 1RXIA 1UZLA 5AKXA 3B6ZA 1VHLA 3LP8A 1X19A 2XBUA 3OQ6A 2PWZA 3UVEA 3HXLA 1XZJA 2V45A 5HKLA 1JR6A 2QOEA 1VL2A 2RHGB 5KU1A 4KDCA 4LSZA 4BX9A 2W00A 5IJ9A 1QF6A 3MWEA 3QPUA 1NUSA 1WCV1 2P9QA 5AXDA 4RK1A 2VBFA 5CFRA 5FPHA 3SX4A 3L0SA 1Z34A 3ZQUA 3WKEA 2QAIA 2Q5QA 3G2KA 1U7UA 4GBED 4AUEA 2A5DA 1R9GA 1DKQA 1R4NA 3NTUA 4EQ6B 2Q5HA 2WDZA 4FHZA 4ERNA 1GGVA 5EGNA 2YV5A 3E9YA 1YJ5A 3T7EA 5DP1A 2IXGA 1UAGA 4KLRA 3OQMA 3RS5A 4EY3A 4MLCA 1BJRE 2VJCA 2O2HA 1RC1A 2CVPA 3G2QA 1H2YA 2DQSA 1Y3CE 4C7OA 1KMHA 4WJZA 4EP1A 3ANYB 3PEEA 4A26A 5BV0A 1OUMA 1KWKA 2EF0A 3SF8A 1CQJA 1KEEB 2WA2A 4IDEA 4Y6LA 1G9SA 2J5BA 1KORA 2MYNA 2PYDA 2W93A 1US8B 3FUWA 4IOLA 1YE5A 3RTAA 2E48A 2FQYA 3GLIA 4RD6A 1E79A 4ZAZA 2E55A 1TAGA 3KNZA 1TYZA 2C2MA 1WSWA 4TTSA 2ERXA 2P5TB 1M2WA 1RI4A 1RLOA 2PH5A 3IV9A 3B6KA 4Y2JA 5CLGA 4A0QA 2QU7A 4Z54A 2DWUA 1DJNA 2QD4A 4YAIA 1FFGA 5ED0A 1CC1S 5HK9A 1QHYA 3Q7RA 3S1AA 2FZEA 4EPVA 1XZAA 2YZGA 3EH2A 1X7ZB 2NWQA 2QGFA 4I5DA 1AKTA 1R9NA 2BD0A 4X63A 2V98A 2FSHA 4D9JA 2AJ8A 2JL1A 3BWXA 3LUAA 2ZREA 4H16A 4URVR 3A6FA 1OYWA 2DPHA 4X92A 1WV1A 2G5CA 2XGMA 4CIAA 4MYRA 1LBQA 2YYYA 4JU9A 3PNVA 2Y67A 5EMMA 4XKJA 1LVHA 1UM9B 5LJLA 4MUJA 2WU4A 1XJ5A 3HACA 3JVEA 4QGSA 3WJ7A 4MKIA 3Q11A 4NZMA 4XTRA 1XJWA 2NYUA 2XOKD 3BWEA 5D7NA 2P9YA 4DRXB 3GDFA 3AUFA 4PZUA 2GEDA 2FB9A 2FU5C 1O08A 1MOSA 3LZ6A 4KO2S 5GVSA 2GZDA 3A58B 1S8FA 3MBKA 3RQIA 3D2CA 4MMZB 2PNJA 3GP5A 2FMTA 3RREA 4D92A 3RC7A 1ZL2A 1IMJA 1M0TA 3IALA 3IQGX 3U3KA 3V9AA 3CZMA 1SVUA 3V2GA 1E3MA 1XA4A 3O7MA 3NHJA 4MUXA 4PQEA 5DGXA 4B44A 1RT9A 1G3QA 5CVJA 4LJ8A 4IIUA 1OROA 3PC8A 1FP1D 4TXMA 1TUBA 1LSUA 2OQ2A 4A0SA 2EZUA 1UZAA 3ER9A 4GOOD 1BE0A 4E5UA 2BFFA 1EJBA 2B4QA 1J0CA 1CUFA 4M0KA 4ZCLA 3AETB 3LLSA 3MUFA 3O8CA 3FJ1A 1NT2A 1IM5A 3IMGA 1NUQA 3OWHA 4KX5A 2QDXA 4ARBA 1YR2A 4ESHA 1KOGA 1Y9DA 2BTQA 2GHQA 4UMFA 3WWEA 5ESRA 1QUEA 5KPDA 5AVJA 5GADl 1VMKA 4IL5A 4BCBA 4J7CA 4ZODA 4RTRA 2W22A 2BSQA 1OTYA 4A82A 1PG5A 4MHSA 2V0GA 1MB0A 2FJPA 2YHIA 3E0QA 3QHQA 2VATA 3STTA 2AR0A 4D0LB 1PVDA 1HDGO 3PTAA 1DUSA 4F56A 3C6ZA 3I9V6 4KQ2A 2I1WA 5JRDS 1JECA 1ZGCA 4YXWD 4I9GA 4CV0A 1IG0A 3WI7A 3PWKA 2QVLA 4RDCA 5DT9A 4J0JA 1JT9A 2FZVA 2ZP1A 4LWPA 1MTOA 2D00A 1XVAA 4Z9AA 4MRAA 1ZU5A 2BTEA 2IS6A 2P9JA 2F62A 1Z06A 2R00C 2Y77A 3AHJA 2VHYA 4G5RA 4E4TA 1VSBA 1BOFA 3VQTA 2YL2A 2XYGA 5EHQA 4CLOA 2ZAMA 4L4SA 4NYMQ 3NBKA 2VQDA 5EMLA 1P45A 1VM6A 2POCA 3R5SA 5DBHX 5LLSA 3ZBQA 5HPYB 4NZNA 4A7PA 3KU4A 2B8WA 3UGQA 4C6TA 3B7WA 1NXOA 1ESEA 1SCJA 3A1CA 5JCOA 3L0CA 4HDCA 4OQQA 1K5DA 2GPJA 2RHCA 4M38A 1WKBA 5BSKA 3DLCA 3FY4A 2DOKA 3CIOA 5AD1A 2OHFA 4KR2A 4DXAA 1XK7A 5JXWA 3KJEA 3QW4B 5GONF 3KOOA 3KOUA 4HNAB 2ISQA 4N3CA 3AKZA 3OFKA 2Z2KA 3UJBA 2JH3A 1CUZA 2IL1A 4KKVA 4LGCA 2Q4EA 3IR5A 3BGOS 3NHWA 1ZMOA 5LQMA 2DGDA 5BWBA 2QMEA 3P2EA 2G28A 1L5OA 4U2DA 2P4EA 4RVHA 1XRQA 3RTCA 4YUWA 4EYKA 1UQRA 5CM9C 3DZCA 1TQDA 3GJTA 4JI7B 2XB8A 5E7IA 3THXA 1SCUA 1PP4A 4XUEA 2PVCA 3TQFA 5JSHA 1NPDA 4NPAA 1W75A 5FAXA 3SZOA 5D8DA 2V4UA 1IWBB 4M1EA 4UQLA 5EJ8A 1D4ZA 3LNCA 4KPUB 3HDQA 3D4BA 4EKEA 1XTZA 1SG0A 2JGLA 1JHOA 4MPTA 2CCKA 3LOUA 1ZK2A 1FNNA 2ZI3A 3EUFA 3B6EA 3LC1O 5JSYA 1G9XA 1TLTA 5KYTA 4RO0A 1H2RS 4DWOA 3COJA 4URXR 4KSYA 4MUNA 1ZD4A 4N5LA 4ENVA 3A6KA 3ZWNA 4C3VA 5A4MS 4TZ6A 1SIBE 5TQVA 4MCIA 5FYQA 3ZD8A 5C7LO 1AURA 1MEJA 3P9YA 1VBNA 1USIA 4Z4GA 1EGHA 3PQCA 5EWJB 3E3AA 5TV2A 5K0CA 3UIEA 3UHOA 1XMSA 4NHOA 3HZHA 2GERA 1E0JA 4OJMX 1Q0RA 2QUZA 4RK4A 2DWQA 2EDAA 3THSA 5TGDA 4XH9B 2QUBA 5HBGA 1XD2B 4CQMA 1H3EA 4I1SA 1FTQA 2Z2XA 4ND5A 2CVFA 4WX2B 5I8ZA 1D4FA 4RK5A 5JARA 1L4GA 4P4UA 1LRLA 1KYWA 1OBVA 1VP9A 5LYJF 3BT7A 2VNHA 2O19A 4JGGA 1JBEA 4JI6B 2OHGA 1F2DA 2QVGA 5LP6F 1ODTC 5MGNA 3MF4A 1XJ0A 3Q8WA 3V7NA 5EJ4A 3HVUA 3KEGA 1V8DA 2IE8A 1SC3A 2NO1A 4R8SA 4RF2A 1FJ2A 3C6MA 1T5LA 2O6HA 4KGDA 4BO0A 2YVQA 3HCPA 1CVIA 1GRNA 3F6SA 3ZCRA 1A2QA 1E9CA 5E6SA 2Q4DA 4RV5A 5E3IA 4EITA 1OWPA 1N6LA 1W9MA 3V2IA 5BRJA 3Q8XB 1XRPA 4C7KA 1KNXA 5D87A 2JJ1A 4V0KA 3GMTA 1V96A 3FPCA 1Q19A 2CK3A 2J45A 4IIYA 3MINB 4TRMA 2YXNA 1N0VC 4HGYA 3EARA 2H5JA 3I5MA 3W2GA 1BHSA 4OP1A 3ZZTA 4YQEA 5KJFA 1PLJA 1PD1A 3VMFA 3PX2A 3B70A 1L8AA 4LRQA 4BMXA 4E6EA 3EIEA 4EG7A 1T13A 4M6WA 4NAHA 2ZIWB 4B2YA 3UWOA 3DFIA 4FSDA 4KPYA 1A2BA 1U2DA 2QM0A 4JMPA 1MB9A 2JEZA 3L84A 4QTXA 4GX0A 3P9SA 3HG7A 4O59O 1P2BA 3VH1A 4CODB 1M2KA 2OK7A 3RJ5A 2PUGA 1IN1A 1Z26A 2IBTA 3H2ZA 3DB1A 4NOMA 5J9FA 4PSVA 2GN8A 4KN9S 2Q5OA 3EGDB 3FLBA 3O8NA 3PGXA 2VYNA 3NBUA 2H92A 2KE5A 4RLHA 5E2IA 4BQRA 4ZOQI 4BY9E 3KVVA 3SQNA 3K30A 4K5QA 1L5SA 4G4SP 1I6WA 4O2AA 2I6SA 1F0NA 2GEKA 4GO1A 4IBOA 3QLEA 3RSGA 1XQYA 5KNDD 4R3NA 2DZDA 2JZNA 2IYTA 1J8YF 3RIYA 2NSYA 1Z5WA 2HJSA 5E6UB 3TRFA 3DOUA 1TXGA 4F72A 4DV4B 2WVAA 2G1PA 2DG2A 1KL7A 1XQWA 4PS0A 3VVLA 1ODFA 2Q6IA 4IAOA 3QX7A 1XLTA 2B5VA 2HK7A 4EHNA 3LFTA 1MAVA 4DDHA 1JSLA 4FOSA 4G25A 3P20A 4BWVA 3BQ9A 1P4AA 1JEQB 4NPCA 2ONKA 5AKZA 5FF9A 3Q8LA 1DCTA 2WJVA 4P92A 3R4CA 4RA9B 1JI0A 2IK8A 3MHTA 1XO1A 4DMKA 3T5TA 1LLUA 1WXQA 1X94A 2A59A 3DNPA 1C4WA 3FG9A 3MYYA 3BPSA 4PLTA 2FZCA 4UNSA 1PJ4A 1B2RA 1OFTA 3RV3A 1JDZA 1WCYA 3K1JA 1DQYA 2Q62A 3W4IA 1ZGAA 5E7MA 3OCXA 4OKIA 4HZUA 3KCNA 4JMLA 4N0EA 5DHUA 5FR2A 4F5ZA 3ZUPA 2QD1A 4DIMA 3TRJA 1K7XB 1KKMA 2H4XA 1DBRA 4GOND 3BDIA 3GN1A 1PNRA 1NQXA 2J4FA 1UKZA 3EWNA 1NYQA 4RA6A 1X7GA 5AK6A 3AEXA 3C7KA 2FMUA 1LK7A 3CNNA 4G0PA 4H59A 3DBHB 4OGKA 2YOFA 3LU1A 2Y2UA 3DYIA 2ZJYA 1TJ3A 2WSBA 1MQ9A 4N48A 1SU7A 1Y4UA 4BN4A 2NOAA 2VYFA 1DNPA 3OOSA 4MPRA 3BWBA 3HB9A 4DUGA 5BSVA 3UPDA 4UBNA 3DZ8A 3RVDA 3FVWA 4ZJYA 4ZYUA 1BRMA 1E2IA 5AOBA 3C7CB 5E95A 1ML4A 4XWGA 2BHLA 2RGUA 3LSTA 3W5HA 3ZJ4A 3ZCUA 4BTEA 4DJFC 5F7XA 3P8ZA 2DWPA 2BGLA 1EXWA 1ICEA 1EGMB 2VTBB 3MWYW 3HCOA 3EF3A 5K2OA 1I9CA 2FF7A 4MVJM 4JQZA 4X8OA 4Q9DA 4WCVA 3FPAA 1PJSA 3NKFA 3W0LB 3D8BA 5BW5A 2JI8A 4XFDA 5HRUA 4G0VA 1GKKA 3GJZA 3RSSA 4MDEA 4RH0A 1T0UA 5CVUA 3LC0A 1UMCA 3WLOA 2CHEA 1WHSA 2FPGA 1M6WA 3S7TA 2QTFA 5J2TB 3FYTA 3OPQA 5IH7A 1TJ4A 3WGUA 4BNYA 2HADA 2CYAA 4ZT5A 4LBWA 2BBTA 3FPKA 1NR5A 3IDAA 3PFWO 3PUIA 3MT8A 3W5AA 3DUFA 4IQ8A 2CE7A 5AHKA 5EXSA 1V4BA 1U7PA 2CT8A 5A0VA 5DEOA 1NDUA 3DE6X 3TQHA 3AR6A 4BECA 3VNUA 2RGAA 1EK6A 2BEUA 4L85A 5FBWB 3R8XA 4BQOA 2Q4OA 3RF7A 4DLBA 4LCJA 3NBZC 3U2QA 4PO9A 3KKPA 2A1UA 4P3OA 3L43A 3UAVA 1NAHA 1AF7A 3FWNA 1X2EA 3QTTA 1FFDA 1NWHA 1Y4SA 4FGWA 3REQB 5YASA 3TIGA 4DYDA 3ZGVA 3DP9A 4F93B 1UL1X 1ETHA 3FNHA 3MLEA 2B4TO 3R9IA 4P4NA 4PYRA 3DONA 3ILVA 3EEIA 2YYSA 3EC1A 4RC9A 1SD1A 2HO5A 4LCBA 4CW7A 3WE7A 4Q3CA 1RLJA 4TVBA 3NORA 3L6RA 4OUKX 2DBVO 3GLSA 1EBUA 1RAAA 2QW0X 3MVEA 2VPQA 5HZGA 3QHAA 4I99A 1G2QA 2IHZA 4KIUA 1ACMA 1LF5A 2OQRA 2OM6A 1J07A 1QGZA 1I6LA 3IILA 2YN2A 4KE6A 3WZMA 5LD2B 1E8NA 2WIDA 4QGGA 4DQXA 1TQHA 3QF7A 5ARDA 2PX2A 3LTNC 3OVMA 4ISCA 4DLXA 1C7ZA 1FRFS 1VI6A 3E05A 3IO5A 2OAGA 3P5BA 1CJCA 4HDNB 5B1DA 5L3VA 5MFPA 2FOXA 3HXMA 4R84A 4KRFA 5BNFA 3KVOA 3RYCB 4GRAA 2JK1A 2D62A 3MS2A 5CU7A 3X2FA 4HG2A 4KGXA 4UVIA 4A16A 5CDUA 4IJ5A 1L5LA 4PC3A 4BWGA 2VG8A 1XUOA 2EJVA 5EIHA 3RAPR 1KBOA 3VR2D 2VJPA 1ZHFA 4UZFA 4KP7A 3LQ2A 4O0LA 2R96A 4J0CA 4OPMA 5BN4B 3AZQA 2EFHB 1UFVA 4HLQB 1FS4A 1W9HA 1TCVA 2AK2A 2H2IA 3TEFA 1ZGBA 4GI3A 3ETLA 4RCVA 4TROA 4POAA 1ZAKA 3V80A 5I6DA 4M8KA 5FULA 2K2WA 1UBEA 2P91A 2YS7A 4XGQA 3ADBA 2PUCA 2BM8A 3RRXA 3T35A 1PR0A 4IVQA 3AONB 2JAHA 3JAKB 4NCKA 2IP2A 2PL5A 1S9DA 1Z29A 4AK9A 5JD4A 3HCEA 1GQ2A 1QB8A 1BGVA 3CBGA 2YICA 3H8JA 4OSPA 5AUQA 4D6PA 1BW9A 3PICA 5I01A 1IULA 3F2IA 3OCYA 2C8VA 2A35A 3DV9A 4DSTA 1O5OA 2YMPA 1R3UA 1G4UR 2CJFA 1YDHA 2HRZA 5FI1B 2P9CA 5L4SA 1ODIA 2GPYA 4ZYTA 1EDDA 1N6KA 1ULUA 1IY9A 1RE0A 4RY2A 5KYWA 3H2IA 4PQYA 3IAHA 4V0OA 3VR5D 1NI4A 2QUJA 2H1HA 1MQAA 1TM5E 3GFQA 4IUDS 2AI2A 3MN1A 4Y3UA 1XPOA 3CLTC 2BM9A 5LBTA 5B6PA 5ALEA 1Y6JA 4X3CA 3KQYA 3BX1A 3KFVA 4CF7A 3UJAA 1DOZA 2H17A 4GPZA 5ESXA 2OE2A 1W2WB 1A04A 1QFSA 2BVNA 5CLLA 1TC2A 4JLWA 2ZI7A 2HA5A 1DAKA 1UXKA 1SXJC 2R86A 2B1QA 3O2NA 3ZJUA 1KEZA 1ZITA 2WA1A 3KYJB 4PXSA 1XHFA 3VYRB 3RS4A 1CQIB 4RZ3A 1ZMBA 1SHZA 3IS3A 4DLNA 2P68A 1WD7A 5GAJA 1N77A 3ZDAA 4AP5A 1YI1A 4EB0A 4I1VA 1CFJA 3D6FA 4MVJA 3VFDA 4DLTA 5I4BA 4WNCA 3KQUA 3TNFA 2FEPA 1NZJA 4JHLA 3A1UA 3VKUA 1ISIA 3R3VA 3SYRA 4OQPA 2ZRAA 2EYQA 1XTSA 4NS4A 5JTUA 4ESOA 5C9ZA 1G41A 1KR2A 1WXIA 2P1ZA 3QVKA 4IHJF 3C3BA 1KJJA 1KMQA 2ZCVA 4PHCA 2TMDA 3EA5A 2PMEA 1HTTA 4DIFA 5LOVA 4ITVA 1E0SA 1ENPA 3IAUA 5A6SA 4MP8A 1SOUA 2AOUA 3KRTA 5LMNB 4EFMA 4LHYA 1XAJA 1NQOA 2OXFA 1PJTA 2QMYA 4QYXA 4YVFA 3ORHA 3NAZA 1R6AA 3UT0A 5HGJA 3R5TA 4ZDWA 4RMJA 4YAKA 5IANA 4BBZA 1JB1A 5DE3A 1GQOA 2INGX 4JXKA 1JHQA 4DMHA 4N39A 4KIWA 3SHWA 4P34A 4Y2RA 4R5HA 1T0HB 1BKYA 1B26A 4LMAA 3TOZA 3ZG6A 2BONA 2WOJA 5IEJA 4TZKA 2WYVA 1FDTA 4UMDA 3IBYA 5JZMA 4QEDA 1JKIA 4G85A 4D9KA 3J7TA 4M55A 2FRVA 6REQA 4TPKA 1DEHA 4ZEVA 3SQLA 1AE1A 4UPDA 3AUJB 5ES4B 1Z4OA 4PR3A 4INPA 1SN7A 5CIQA 2DT8A 1U8YA 4X0EA 2RGXA 3KTAA 2FZ5A 4ITRC 2I3AA 5EIXA 1RXSA 1WTAA 4GR9A 2BE7A 3HHPA 3O4VA 3V6LA 5AW7A 1GL9B 2WP0A 3WB9A 5AM4A 2P6MA 2YQZA 1T1GA 5TPZD 3CVVA 1VPWA 2GEBA 3TSYA 1E3QA 3ANMA 4ZOBA 2ZIGA 4RVDA 4NH4A 2HA2A 4IMJB 1PKEA 4V0NA 3X1MA 3PR1A 5CT9A 3SZUA 3G89A 3CLKA 1LW7A 4TXNA 3N05A 3FOEC 3B9QA 3BMQB 1FOEB 1KYYA 4UCQA 1W4BA 1B93A 1NWCA 1CYDA 3KB8A 1MLDA 5CPBA 1T4MA 1P75A 2D6FA 1QLWA 4QTZA 3CLRC 1RXWA 4QT4A 1XNRB 2DY0A 2C5GA 3RNOA 4EO4A 5TQ2B 2O7QA 3MSXA 2J6HA 1BAPA 3Q2OA 5TEVA 1G16A 2AQ8A 4HPJB 1VIMA 4UBOA 3H11B 4PFQA 5JSQA 1E6MA 2ZYWX 1HRKA 4LGVA 3C15C 1HI9A 4HDSB 1TEVA 3RVQA 4E7PA 2HCJB 3L06A 3AW8A 2P77A 2O8CB 4EHKA 4RK7A 4ZEOA 1SXJB 2E4WA 1II8A 1T4GA 1M0SA 3IEIA 4RHFA 3WIBA 3WGOA 1GQSA 2Z5FA 2GASA 1GUYA 1SNYA 3OA2A 4HDKA 2QAJA 5G4KB 3E2MA 3IP7A 1KZGB 2NZJA 1Z7BA 1Y7IA 3HGMA 1UR5A 3LYLA 4R41A 4RVSA 1JIKA 3SAJA 3CINA 4HT3B 5B4UA 3C5VA 1JFRA 1NXVA 3TBHA 4J91A 1GD1O 2VRBA 2HDNB 4B43A 2A0UA 2PM8A 4ESEA 1UMBA 5EPEA 2UYOA 4OX9B 2H8KA 3BMOA 4V0ME 4A5SA 5GZ1A 1X15A 3EMKA 2EKLA 1YBVA 3UKDA 3OX2A 3AF3A 3H97A 3LIIA 4JCCA 3U1TA 4O3MA 7REQA 3NHMA 4MA0A 2WD9A 1XQ6A 4NXMB 4RS4A 1XJQA 2AQKA 1DINA 1AV6A 4R98A 2XY4A 2VKTA 5BSEA 1FFCA 1DFHA 3KALA 3B38A 3LT1A 5JMTA 5TEWA 2WTMA 3BJRA 4MWEA 2GDJA 3RKSA 1Z6GA 3ZKWA 3IKMB 3KT3A 1Z74A 1YUMA 1JHAA 4OJYA 3OQIB 4KOEC 3RB8A 4D9HA 2AX3A 1DELA 3BMXA 3C14C 1F6WA 4MJLA 3SJZA 2AQIA 4KRXA 2Z9DA 4OQZA 5FUVA 1KQNA 1G8YA 4EABA 4Y9DA 5EG5A 1J2YA 4AULA 3AHDA 4B7ZA 5LA6B 2UU9B 2NO6A 2PX8A 2B8JA 2WHEA 1P3DA 4XCVA 5ILQA 3I2GA 4Q9KA 3GW8A 4QGHA 1GJRA 1WDWB 2J0VA 1XD8A 1CR6A 2FKNA 3KKQA 3LO5A 2HDOA 4R1MA 3Q3HA 5D3MB 4ATNA 1QOPB 2XA9A 3UCXA 5K0TA 4NCNA 1G1AA 1SPXA 3GL9A 3RVLA 3V7UA 5BWCA 3F6BX 1XI2A 4I1RA 3P7MA 4MUMA 3FHOA 4LY3A 2XBMA 3M3PA 4LXUA 5J59A 3W90A 5FTMA 1WWKA 1L6IA 2FYTA 2CHQA 2P8SA 2Y6VA 2HO4A 1WE2A 1SIWA 2IUEA 3CLRD 3IP9A 3JVUA 2PS3A 2HMYB 4HQOA 2PLWA 4NRDA 5C31A 4DEVA 2PEZA 3SNHA 4JP1A 5BOVA 4BLRA 2QNBA 2Z8YM 5DM4A 1Y5RA 4IJKA 4E33A 2H63A 3VVMA 1DC6A 1GR1A 2IX9A 2VSXA 4HJRA 2HTFA 3U7QB 5BYKA 1UWLA 1VDZA 3M81A 3I2KA 3JD4A 2J0UA 5JH7F 4IO1A 2WWRA 1E2UA 1KQGA 5JAPA 2P5YA 4P4SA 2H5IA 1RKXA 3GLHE 3NTOA 1F1JA 1KE2A 3ZTTA 4UHFA 1KJZA 4NG4A 4S35A 1G38A 4YMGA 3TI7A 2HF2A 1U1FA 4GLFA 4G0NA 1WDKA 4PFSA 2QROA 1S3GA 3NHZA 1NVWQ 2FSVA 4TTPA 4U7HA 2ZAGA 3R20A 5B3LA 5ALHA 2CHVA 3UJPA 4Q48A 4AMYA 1UK8A 3LVFO 5KYGA 5LDHA 3ZHCA 1G2IA 2X40A 4WFKA 3ZGLA 2VJBA 3TD2A 4W5HA 2Y0BA 3L0ZA 4Z53A 4N5HX 1B16A 1USVA 5BUSA 3VJRA 2FFQA 2I2DA 4DT1A 3TLMA 4UOEA 4LXTA 3KVYA 4EAQA 3U4MA 5E9JA 3ORSA 3QE9Y 3U3OA 5DLYA 3KOYA 3VUEA 4BX8A 1Q16A 2ZKIA 1MVNA 3IOCA 1KP9A 3LHIA 4FOLA 4XLZA 3AV0B 1GSAA 3RVOA 1WOMA 3T34A 5IKOA 3T3NA 5EIFA 2YIJA 1CCWA 4MTLA 4MR8B 1H4SA 2IFTA 3G3EA 1W88A 4UM7A 1E2LA 1H66A 3RYIA 1GCOA 4PC6A 4F85A 2C54A 4GIBA 1A9PA 1NVMB 4QPZA 5DK6A 3RBXA 3VISA 4A2PA 4AQ7A 1FZQA 2FPMA 2XCSB 1Y9JA 2WAOA 4WVFA 2WE8A 4GI1A 3QKRB 2DAPA 3PC2A 1FS6A 1EP9A 1UFOA 3I5UA 1U0EA 1XVLA 2O2JA 3TNDA 4JB2A 2TMKA 1NN0A 2IOYA 4G07A 4D44A 2H52A 3LOQA 2GI4A 1JEOA 1U04A 5CNIA 3T1QA 1SOMA 3QMMA 4DMRA 4IZ6A 3SZMA 3SDBA 1QE3A 2GTPA 1YVRA 1TTTA 3ICWA 4DSZA 2OD2A 2H2GA 4IQ4A 4QOEA 4L3WA 4QU9A 3DO5A 2VI5A 1ZFNA 5DNDA 1P1RA 3C0KA 1HEYA 4CNQA 4OJNA 4O33A 1MVOA 4CDMA 5KREA 4QYIB 3K9GA 4N3NA 1BN6A 1EAYA 2I4LA 1UBOS 2Q5IA 4I1UA 3BHMA 1SY7A 3CF6R 5ADVA 4M53A 2PT9A 4YUVA 3VZCA 5A5EA 2P4QA 4HFRA 2XRYA 4HH0A 2QE6A 3DDHA 2ZWMA 1UQTA 1THGA 3DFZA 4ZT3A 2CXUA 5TC4A 3U62A 1OZFA 2QG4A 5D7BA 2JLCA 5ALJA 1KZYC 2CMGA 4NJOA 5TVKA 4DM4A 4Y2PA 1YZLA 3LWDA 4TQ9A 2ZBGA 4C5CA 3H17A 4GZ6A 3FJOA 3HCWA 4JLUA 4ML3A 1QH1B 3P97A 2EHJA 2ZSIA 3PI7A 5DOZA 3P96A 1TQ8A 3SSOA 4B87A 2W4MA 2YWHA 3COVA 4RMGA 4FXOA 2QTRA 2R8BA 4LZLA 2YIVX 5HCNA 2ZXEA 2IU4A 1ULZA 2WIGA 2ABWA 1PR5A 4LPSA 4H1UA 4OMFG 3G5MA 2WD7A 2FXVA 4ZKEA 2H5EA 1V11A 4ILKA 2IHYA 3HDHA 4DWVA 5LNK1 1XG5A 1JIJA 3QU2A 4J3FA 3PDHA 4JEHA 3BF7A 5DYGA 2HJ9A 4B5KA 2ZRPA 4IUCS 4OHOA 3Q5GA 1MRZA 1V7ZA 4B33A 3ZDBA 5C1DA 1ST2A 3E53A 4IIJF 2RKOA 4D9EA 4R9SA 4ZC1A 1KI6B 4OHWA 2W0MA 4HD8A 3ED1A 4YJ3F 5JV5A 2C4HA 2YBEA 4OF4A 1Y8RA 2C9DA 2JI6A 2GHRA 3NVDA 5AMXA 3EGCA 1KK3A 3M6UA 2FJ0A 4U3JB 5D84A 3D8NA 4TMWA 1OBFO 2P65A 1L4NA 4JBWA 4TUYF 4RAQA 3W5DA 1DXQA 1PZHA 1BN7A 4QUHA 5FUWA 2GLXA 3UGKA 1XROA 2P3LA 3JQ8A 2FG6C 3H75A 1POWA 3CWQA 3OF3A 4LJ7A 4FNMA 3K0SA 2IPAB 1JFLA 4PYIA 2Z8YA 2QTWB 3T3OA 4BXOB 4TV8A 2IH2A 4NCIA 2QVBA 5BO5A 3LDUA 4C0XA 1UJBA 4A27A 1HT3A 1FMJA 1QX3A 2H11A 3DVQX 3FOBA 1JDUA 1G7TA 1IHOA 2JANA 4WEOA 1LV8A 2G80A 1P9NA 1JJBA 1T34A 3SP1A 1VMEA 1GPMA 2B7BA 4RYLA 4YK7A 1HFEL 5CB4F 1T3HA 3L6CA 5AVTA 1IOWA 2QD5A 4X20A 1E5LA 2C4TA 4TSRA 2VWGA 3CEMA 3VR6H 1W35A 3TDKA 3MRVA 4JAVC 2YUTA 4P0TA 5D3ZA 5EJIA 1LCIA 4E3ZA 3HDYA 3ECAA 3NTXA 3UJHA 1TM7E 2HLPA 4U2GA 1UBHS 1GU7A 2EBUA 3AP1A 3WLTA 1YS9A 1HYBA 3LRTA 4ENRA 4GX2A 1KAQA 1YFZA 5EIEA 1BHJA 4N5NA 4KFSA 4L6IA 2C83A 3PZBA 1I3OA 2BFCB 5ALRA 3VR4D 1XZGA 2EWWA 4W7HA 2NIPA 1SUAA 3AK4A 4FJ0A 1TZMA 5FWXB 1E2HA 4FDVA 2EW1A 3A6GA 4FLEA 3RC9A 5H81A 3D6JA 2AYYA 1WZNA 1CDZA 3CRW1 4ZV4A 1VIAA 2BF7A 2Q1UA 2Z3WA 3G8BA 1CZRA 1K97A 4U2FA 2X8BA 3HJAA 4NBVA 1MQ8B 3S8MA 2Z2YA 5DGIA 2OYSA 2QYOA 1G20E 5ALGA 3T41A 4A36A 1ULAA 2Q41A 4DAOA 4DNFA 4BKPA 3IP6A 3ZZ1A 3U4QB 2IS1A 4ZHQF 5JJKA 5EZYA 2PMKA 4AFNA 1AOXA 4A6PA 2QHXA 4FILA 3W5UA 1XCJA 4AZSA 3WO0A 3KK0A 1NNUA 4ZHQA 3A1DA 4G81A 3Q7TA 4XVRA 4GP6A 4PIVA 1NRWA 1KETA 2N0SA 3A0UA 4EG4A 1RE1A 4W9MC 1M5UA 2CNDA 1CZLA 1Q7GA 4POOA 4K9OA 3BS4A 3HWRA 3GT0A 1I1NA 1IHUA 1LY1A 2VUTA 4GX1A 4NG5A 3ABSB 2A6PA 2UKDA 2XE4A 2NPOA 2SHKA 3HJBA 4L4XA 3BB3A 3E5RA 1Z8DA 4NE2A 3S2SA 4I50B 4UEQA 4BJHB 1RM3A 2E37A 5FBZA 4OY3A 3OPNA 4IDDA 2OTCA 5DEIA 1P0PA 1RPZA 5IJ9B 4EX7A 4PG8A 3GUZA 2J08A 4OQDA 2WAXA 3BXZA 1L5FA 1BKDR 1QHHB 3GIWA 4R8RA 5HKKA 3PEVA 3ND9A 1W2HA 3LI2A 5JAQA 2ZXFA 4ZQHA 3RVPA 3TOVA 3VOSA 1EWRA 3OHMA 1JLLA 2IGBA 3ANTA 3CYFA 4PYKA 1P1CA 3WQBA 4ZZ1A 5BP7A 2I4TA 1P2FA 4FDTA 4TOIA 3RT7A 3MILA 1VSTA 2V6JA 5IF3A 3GVHA 4X1IA 2JF0A 3OTOB 2B5WA 3HKCA 1LJLA 1UKEA 2G77B 2MR5A 5FB3A 3OAAA 2ZVDA 1Y1SA 1SKMA 4C7OB 2CDBA 4FD2A 4GGPA 1Q50A 3SF8B 2A9PA 1ZW1A 1CQJB 3S2ZA 1E7MA 4XCQA 1TMYA 3SYTA 1XL0A 1KI2A 3FCAA 5B6JA 5LQRA 5IW8A 3VZQA 5CG2A 4LCEA 4K6MA 3GLIB 2JIRA 5SICE 3MMPA 4QQ8A 3PXCX 2JLUA 1Q44A 2I22A 3QPVA 3ONWA 2I55A 1OHHA 4Q02A 1QP4A 4QKQA 4FJ1A 2MJLA 2O06A 4HNVA 1PHRA 5K8CA 3QXHA 4NV0A 3S1AB 1GUFA 1RRVA 2YFKA 3AY7A 4CM8B 3COWA 2J3LA 4HQFA 3RRZA 2X5KO 5I9NA 1W76A 5JZVA 5A4IS 1UDWA 3V7WA 2H00A 4R40A 1TZBA 1TYEB 5JMPA 4LG1A 3PA8A 4UE6A 2RAUA 2CF5A 3GZTB 2G17A 3FVRA 3QPWA 2UYHA 2HLDA 3IUQA 3A26A 4TS3A 3SMQA 4FFVA 2WFMA 1GAQA 3G2JA 3C8ZA 1ZXBA 4JR1A 4JUIA 5IDYA 1PS9A 2XZOA 4ID3A 3EXAA 4KXXA 4BFWA 3C3AA 5CVCA 1NPYA 1PZFA 3O5AA 4YRFA 3ETGA 1JNYA 3MRSA 4H2DA 3Q7QA 3BD6A 1I4TD 3BE4A 4ASUA 3ZN2A 4FSXA 4IILA 1HDEA 3LLMA 1PO7A 4MDHA 4ZT2A 3RAJA 2O4CA 4FHGA 4YRBA 2XNHA 5KQLA 3H2GA 4GXQA 1JHVA 4I9NA 4KMSA 1E6LA 4MI1A 4OGFA 5MGBA 2PRJA 2VDLB 1U9YA 1VKJA 3ILXA 3ROQA 4AJ4A 3KLOA 2J4CA 3TIXB 5CDFA 5KX5A 3L8GA 3AM1A 1G64A 4TWIA 1ZM7A 2GFHA 1GNPA 4JJAA 1N8NA 2ASVA 1T5OA 1SZPA 4DE5A 1Y89A 3SBDA 2BFFB 3PP8A 4EG5A 5LZ4A 2REQA 2CWWA 2HHAA 2RK6A 1CR2A 1J2UA 2E82A 3I0NA 3HA2A 4JLDA 4KZPA 1B8UA 2P90A 1P3Y1 2QRGA 1HH4A 4MB6A 4MGEA 4OK6A 5E4FA 3ESQA 5BVHA 2JFPA 2WJZB 3WC4A 1EA7A 1RHKA 5L95A 2R6JA 4GMHA 5AQEA 3HVIA 1OY1A 3UK0A 2AUMA 4FFBA 5P21A 1OIWA 2IE0A 1G18A 3S40A 2AN5A 2VXBA 3F5DA 4JFRA 4O4LA 1Z0ZA 3AM4A 1G5TA 1NBOA 3AGQA 2SKDA 4R8KA 2IEDA 2XZDA 4L3VA 3RU7A 1I7SB 3WGJA 5IU6A 1T29A 1ZH4A 5DYWA 3HCNA 3N0WA 4FGUA 2FXIA 1XF9A 2B99A 3DQPA 3EH1A 1E2EA 4HS9A 1XMJA 5ICSA 2HM7A 2AS0A 2IOFK 3E6AA 3IBTA 4L1KA 1SJ9A 4X93A 1CF2O 3LHSA 4EHHA 1E7YA 1XYYA 2GYUA 1AD2A 1JYFA 2QDKA 4JWKA 5E9AA 3V8PA 4LF4B 4KACA 5I9IA 2H2AA 4EPTA 3QH4A 2VNKA 4O2LA 1N7JA 3P0HA 1ZG3A 4EUHA 2PUDA 4RZUA 4RF5A 3JYQA 3MJ4A 5C32A 2OGZA 4BLTA 3PDJA 4IRMA 2XTMA 1N6IA 1QCZA 4YEDA 5F5LA 2A0WA 3DOHA 3ZK7A 1ONBA 3CQ9A 5KEIA 1HZJA 2HMSA 4LYHA 3VOTA 1SVSA 4HDAA 2WB2A 4IKPA 5H3LA 2IHJA 3CVXA 2QRVA 3ED5A 1W2GA 4RVUA 5EMJA 3JR3A 2APJA 1JHUA 3F5MA 1CQZA 2AEMA 5NULA 4QDTA 1H6BA 4TS9A 4D3ZA 3IL2A 1GKUB 3KQWA 1FTWA 4OA5A 3TW4A 4DNXA 2W2KA 2BN4A 4BGVA 3D8TA 3ERCA 1XDUA 1GSHA 2D13A 3NAMA 3SX2A 4ZQEA 2O1WA 1GGJA 4JB0A 1U2DC 4DLRA 4KFRA 4E2WA 2OBBA 1H0SA 3PCRB 3N2LA 4PZAA 2WC1A 2B0JA 5L7WA 2XWPA 1N4DA 4IRXA 5G41A 4TQAA 4ZZ2A 1SU6A 5F3DA 5I8WA 2PFKA 3KPWA 5TX7A 2UZ0A 2OV4A 1JSZA 3WR5A 1GFSA 4P36A 1S2NA 2X1VA 4P3PA 5K2MA 3VC2A 3NIGB 3ZY6A 3DDSA 1VKOA 3GUYA 3H2BA 5HKBA 5KKNB 1QYRA 1WEHA 4QJIA 3ELYA 1BKSB 3OSZA 3U26A 3WHLA 4BZZA 2NUAA 4MJ7A 3SSNA 5K0EA 2CBGA 2VHQA 3E8SA 2HF8A 4PPYA 4ZIRA 1HE4A 1O0SA 3ZEIA 3OZ7A 3THXB 1SCUB 1T2NA 4DSOA 4DBLC 1BDHA 3NKVA 4Q4JB 3OCWA 4KSCA 4FEEA 4Z99A 4RPGA 3DFUA 4MW7A 3ZJYA 2PWBA 3H9GA 3LJKA 3GMIA 4MPJA 1YJBA 3F98A 1L7VC 3T61A 3NEAA 1BQEA 1D7OA 1YDMA 3C2QA 3F3MA 1E3WA 1LH0A 1XLTC 1WZUA 2A9KA 2GK6A 3C8MA 3IPYA 4X24A 4XYMA 4KQHA 3TLJA 3FIUA 3L7DA 1H2ZA 2R5FA 5K9ZA 2WINI 3M82A 2O8EB 4M7PA 1TA4A 4PZYA 2PD6A 5U9CA 3DZBA 4CQMD 1XRLA 4G5YA 5JVDF 3L7JA 3EFBA 5HSGA 1RWMA 2EV9A 3GQVA 2PPLA 5I7RA 4OGGA 2D4HA 1OX4B 4FT4A 5DPMA 1BMFD 2Z43A 2VNAA 5DBEX 1SOAA 1KRXA 1DEAA 2OOKA 2ZJ1A 2PUFA 3L8EA 3K5IA 4DV3B 4YMTA 3UWKA 4Q12A 1PT7A 1II9A 2ADMA 1JEYA 1EZ4A 1NQVA 4B7UA 2OXCA 5EINA 5AESA 1SH7A 4Q1VA 5DP2A 5KZMB 4LFBB 3LOPA 3P2YA 5JI3E 2WTEA 4RQAA 3FKJA 3RAFC 3KQSA 1I6KA 4M36A 4CQMB 3C3MA 1QYWA 3O75A 1VRVA 2DHDA 3PDWA 5L3SB 2Q2QA 2X4DA 4QAJA 4ND2A 4ZREA 3THWA 3AF5A 1T1SA 4Z2AA 1AK1A 1H65A 1RZUA 4DA7A 1P7ZA 5EHIA 3OM8A 2JJ1D 3TM5A 4BFCA 5EP4A 2CK3D 5CHEA 1BXRA 2RIRA 4UNQA 2IV7A 5FAKA 1DRUA 3AV3A 4MDYA 5DGCA 1J49A 4U7FA 2WV7A 4XZ3A 4L22A 5E1OA 5SY6A 4AJHA 2BSXA 5KOJB 1G17A 4KRGA 5E6SB 5F12A 2YIDA 1EGAA 1LSJA 2GEVA 4B7AA 3C1AA 1JBQA 2NAPA 1B76A 2ECFA 1G7CA 4TL7A 2X58A 4UATA 1G7SA 1PL0A 2GSWA 2JFHA 3D7KA 4RCZA 3DZDA 4EECA 1ISMA 3AFNA 5IKEA 5KO2A 2Q2WA 1CJSA 5C1IA 2UZAA 2V55B 3QKSB 4IVNA 4KE7A 2WU8A 1G5QA 3BMCA 1XZBA 1NLZA 3LP6A 4GXRA 3TDMA 4S1NA 3RF6A 3EVGA 1CBUA 4DRYA 3K73O 2FX5A 2VYND 4QUAA 1X9IA 3FX2A 1NFFA 2SECE 3HCCA 4D7AA 1ZXLA 2A3NA 3SS8A 2VSQA 3V8BA 2J9ZB 2ODPA 1HDCA 3WB2A 3ROGA 1F5NA 4QO8A 1ZDMA 3A2NA 4FIZA 4C0AC 4DIKA 3USZA 4YC7A 4WZBA 2WJHA 1QGDA 3QUQA 1LPSA 3KELA 2O7NA 3EYAA 3M4YA 3NGMA 3T3GA 6ADHA 1PEYA 4FSHA 2DERA 4L8GA 1IFXA 4J1QA 3IDSA 3T52A 1AY0A 5DTJA 3BFKA 3QWHA 4NATA 2QXTA 1PDOA 3L6DA 3S29A 1RWPA 2ONZA 3REFA 1J56A 3FYDA 4D8XA 2HU8A 5CB0A 3QTLA 1GRQA 2H2WA 2GBPA 2H6EA 4FGSA 4LF6B 2C9BA 4E4YA 1AKRA 1C29B 2BZGA 3TL3A 4S1PA 2OFXA 5JRZA 2JVJA 1JVSA 5LBUA 3U0VA 2IPOA 3U7HB 1CJUC 1IM2A 1MB4A 1QV7A 1VYUA 4J49A 4INOA 3IMCA 2UYCA 3H1AA 1ZXXA 5K0SA 2XQFA 3DF9A 2H1IA 4JVNA 1ZEJA 3GLUA 5JY1A 3SIRA 4MYUA 3GEIA 4CQLA 2QQFA 5TMBA 1J00A 1WD5A 1N1DA 1T2VA 4XQ0A 5TT0A 1J1UA 3EBLA 4P8RA 3QMWA 3HCDA 1B6GA 2O0MA 3PNOA 4EEKA 1PGOA 2Q3MA 1TYAE 3LZDA 1QK5A 4IM7A 3TTUA 4MKRA 4HZUB 4GLJA 1JQAA 2VOEA 5C18A 4DUGD 3IGFA 1GPYA 4W5QA 1KK1A 2V97A 1KU0A 2QTHA 1E2MA 3LLUA 1WM1A 1OBCA 3L07A 2YOHA 2L69A 2BZSA 5AJZA 4DF3A 4JNCA 3ANSA 1K2WA 1XZ8A 4PINA 4RA6B 1AKWA 2HMUA 3IQHX 1SRQA 3JZMA 1YVDA 4OFXA 2MSNA 1QVVA 4HFJA 4EHAA 5BY2A 3HY3A 1Q95A 1NQTA 3WGIA 1G8JA 1BMTA 1REQA 2RHRA 2RD2A 5A9RA 4J0GA 2AVDA 5JCJA 1I2CA 3K5PA 4IDCA 5CLQA 2H29A 2O0KA 1Z0FA 4HTAA 5L6LB 3TGLA 1GLVA 2BZ0A 3UWPA 3DOJA 3OF2A 2GPAA 4QQRA 1FL9A 4AP6A 2EFDB 2X6QA 3RTEA 2IHUA 3RWBA 3TQRA 3C8DA 3WIVA 3Q7EA 1RSZA 4F4DA 2JFQA 3DHNA 2W6CX 1FRQA 2PMFA 3GJSA 4PO8A 2A4KA 5IBRA 3V4FA 4D8UA 1MB2A 2PHZA 3HGQA 4XSGA 4EGJA 3H13A 3CMMA 2Q6OA 3RS0A 4KEAA 4DIDA 1IN7A 1ZZGA 2VA9A 1P5HA 1EZZA 4Q1DA 1NUHA 3M2PA 3KV3O 1T3TA 3JQDA 4H3VA 1A8HA 4L8LA 2FVYA 3ZIAA 2FWJA 2F90A 2O2XA 2VDQB 3ZHUA 1UMCB 1SFRA 1UOEA 2FPGB 2POQX 3EF1A 1H2EA 3EYWA 3IPCA 3KHSA 1XT6A 2FEXA 3KZVA 4P38A 1JR3A 4WEQA 5EIAA 2XSZA 1NKVA 2NLOA 3W9SA 1F2VA 4I2NA 2YWBA 2R4TA 1TVKA 3EMBA 2H18A 3WMGA 5JJCA 1EXDA 2YJNA 2IH4A 2X3FA 4BFXA 4BNXA 1CE8A 5IBQA 1KP3A 5HMLA 3DUFB 2JJQA 4PZCA 1RWXA 2XTJA 1DG3A 2QTCA 3EXIA 4J0KA 3U3XA 2BEUB 4WDQA 2BH2A 3AEZA 3ENVA 4EJFA 2RGWA 1ESCA 2I4IA 1V7CA 5A9SA 2PZBA 1RFLA 4AO7A 3A9SA 2ZCJA 4W6ZA 4GC5A 2A1UB 4N12A 1HE3A 4E0BA 3ITNA 4IO0A 6Q21A 3CUUA 5A3QA 1XTUA 4J2OA 4YRRA 3W06A 2RJOA 4L5IA 4Z0TA 3BHIA 4RFLA 3V8EA 3Q6NA 1DMRA 2ZR8A 4FYYA 1I9GA 2KBEA 3PQ2A 5FWAA 4LFCB 721PA 1HV8A 2BUAA 4H3HB 4EMBA 1SUCA 1JXAA 4X1OA 3IUEA 4ND6A 4OAPA 5AHRA 5B2FA 2PTHA 3OJXA 5JAMA 2B3TA 2I2FA 1H4VB 4TWJA 5BSRA 4A2QA 4HAYA 1QKKA 2IA5A 1I10A 3HEBA 1TMKA 2GEJA 1VL6A 1GFIA 2J5KA 4ZPJA 1JHPA 4DCTA 4G65A 9GPBA 4FKMA 3O9VA 4MR9A 5C51B 1NBEA 2GT1A 2VK1A 3CF0A 3MOGA 5GOZA 1D9XA 3F73A 4GL2A 3L79A 4C08A 4CQJA 1SURA 5A2QA 3WYAA 1TQ4A 2VPPA 2VSFA 4IXMA 2XNDA 4C0HA 5CEEA 2GGSA 4LAFA 4ECEA 2WFZA 4ZVLA 1MO6A 3A7EA 3TZKA 4HUQA 3E7FA 2ZAOA 3N2GA 1YZUA 1M34A 1HYGA 4JI1B 5B7QA 5ADWA 4D74A 1FSGA 3WRYA 4IF4A 1GRVA 2WVHA 2ZR0A 5DCWA 2SKCA 1SHLA 3DDCA 3VPCA 2DBQA 1G291 2WHXA 1IPHA 1ZN2A 2LCIA 3P94A 2YVLA 4UAGA 4BOYA 4F0JA 3SHTA 3WNQA 2UUOA 3ASZA 4ZEWA 4C29A 5AH0A 3ZJ5A 2VCEA 2ORIA 1KGSA 4BZQA 2DUMA 3K9CA 3AERA 3IKJA 3W1VA 2Q6VA 3FZEA 5EWLA 2JCVA 1ZSYA 1FVFA 4YB8A 4F4JA 5HZKA 1B14A 4PGAA 4JDPA 4OFWA 2O07A 1DCMA 2QGNA 2WJAA 3JARB 3EXFA 2JH8A 2JHPA 4LBYA 3TSWA 2A94A 2IEAA 3EEBA 4HP8A 4KLAA 2HSDA 1EKXA 3FUXA 4KK4A 4QLBA 4G86A 3B5JA 4Y98A 5EJ5A 3VHRA 1L7QA 1A7JA 2W2LA 4PYMA 1NOIA 3N0RA 1B8VA 1UMDA 5J2UA 1P0CA 3HCFA 1RKUA 2BR4A 2EYUA 2YC4C 3JVDA 1PZGA 1AT1A 5DT2A 1QHEA 3RVKA 2R6FA 1NQAO 3HUDA 4WLEA 1V4NA 1X8LA 4OFZA 4EMTA 3EPLA 1P17A 3HLTA 1KEUA 3O0DA 3NV9A 4BKUA 5KYWB 2ZRJA 1TKAA 3P9CA 3T8YA 2X0FA 3B3GA 3CVJA 3QPDA 1GU1A 5JJLA 1BWSA 1QANA 5A7FA 2LRHA 2C3YA 3UAZA 4FJ2A 5EWMA 1HNZB 3FSEA 1T1RA 2FZKA 1YHNA 3T1VA 2ORWA 4JBNA 4MVJD 1QYVA 4AW9A 1N6PA 2XVZA 2A84A 1ZHHA 1QHFA 5HZMA 5JWOA 1L7DA 4M8IA 3ZC3A 1YK0A 2ZRMA 2ZS7A 3BA6A 3JWGA 5CPFA 2FW8A 1SBQA 1J9GA 1B73A 1MO2A 3H0KA 2HYDA 4AX8A 4NFYA 5C4IA 1FYDA 3G1TA 5CFMA 3TSOA 4CMIA 4F5EA 5A5VA 2YOGA 3DW1X 1Y4ZA 4AJNA 1RZRA 4Z4IA 1EFDN 4GKJB 1XA0A 2DPXA 1U9IA 4YY3B 1QPZA 3WK7A 1KXZA 4V1CA 1ADJA 1G60A 1N2BA 1PTKA 2GJ4A 2WHQA 3KKMA 4G56A 4OYRA 5KAMA 2JGDB 1KMNA 2Z8XA 3ER6A 5T3UA 2IZ1A 3V42A 5JNUA 1EDZA 5AW3A 2V0CA 3A9WA 4WKCA 3CN7A 3MQFA 5EQTA 1YGYA 5KJ1A 4OLAA 3TSCA 1Q7BA 3LCUA 3PXBA 1U1GA 2AMVA 3CEPB 4FK8A 1C5KA 3H5RA 4JWTA 3RFTA 4CLXA 2FR8A 4NARA 2XUKA 5A6SB 3VAYA 4Y6OA 2AOUB 1RACA 2MSWA 4PX2A 4N40A 3WTCA 1Z9BA 3MPUA 4KTTE 1LLDA 2ZUDA 4Q9AA 4A6DA 4B4KA 1T8WA 5LCXA 1QPGA 2Z1MA 4U0JA 2FPPA 3MWFA 2DPGA 1K6EA 3S2IA 1CUIA 4RZSA 5DGDA 3G0HA 2XYPA 3O8DA 1Y8ZA 4C20A 4JELA 2OR3A 3KT6A 4KL8S 1D6JA 1SUIA 2DU8A 2XMPA 1C1XA 3FBWA 3STYA 4IHJB 3B1VA 3A4TA 4FGZA 3KOXA 3B60A 4KO1S 4Y6SA 3NHFA 1EJ0A 3ROTA 4FZVA 5JD6A 3UMFA 4ZQBA 3HCBA 3S2GA 3UV3A 2IXFA 1EVJA 2YWGA 1Z0JA 4RHXA 1V16A 4BLUA 5LU8A 3JQRA 4I2VA 3FPGA 4M37A 3USES 2OGUA 1DDGA 2IUSA 3OX1A 5GOTA 4PSDA 4B4DA 4FX5A 4TTIA 3U56A 1T9GR 1QX4A 3BG5A 1QG4A 2RGRA 1LSSA 1ZH2A 5LUBA 2HZ7A 2O3JA 3A1TA 3TVYA 1DBIA 5AW4A 4QM7A 3SXPA 1RYHA 3EAGA 3SC2A 3WFZA 4KVAA 1LNZA 4KUHA 4M8LA 4N8DA 5KDOA 5JASA 3KQHA 5EE5B 4Z86A 2A9VA 2NVUB 1IY8A 2YW9A 1OR8A 3KZ1E 3Q98A 4YCJA 2QMUA 2VNIA 3GFSA 4AC9A 3N0VA 1YQQA 3W2HA 1GDTA 3X1WA 3NPAA 5G0UA 3L4BC 1YZTA 1O87A 2WIFA 3H0EA 3KEQA 1LW6E 2PIDA 4LK3A 1NJ5A 4UFOA 2QRHA 5CNJA 5HE8A 1N6OA 3PENA 4GVLA 3NHYA 2PSDA 4J0FA 2XZLA 1E6CA 1QC5B 2MSCB 3BK1A 5DTIA 2DQ4A 5A71A 1TM1E 2FSVC 1QDLB 1TM3E 2PBLA 3CF4G 2ZB2A 3UV7A 4CEJA 4UUBA 1JQDA 3LK6A 3UF0A 2EKQA 2GD6A 4QYTA 4JITA 5HJ7A 1A72A 2H9AA 3KDAA 4TV9B 4W82A 1BMQA 4U2EA 5AJUA 3OQ1A 2GILA 4GF5A 3S44A 4KQCA 4XEUA 5AKLA 1II8B 2GXSA 1EFRD 1IEWA 1IATA 3BKXA 4J1TA 1Q1BA 3RRYA 1R8JA 5IKXA 2CV1A 3DEIA 1MW8X 4NEHB 2PSJA 3K70C 2A88A 3IE0A 3WBBA 4XB1A 4IDNA 4K6KA 1GPWB 2IUFA 3GGDA 4GKAA 1KAHA 4JASB 4L4UA 6LDHA 1O6BA 3GEMA 4RQTA 3S6JA 5IFLA 1W94A 2A9OA 1VE7A 4P3NA 3U1BA 1WZ2A 1RZVA 2CXHA 1EUQA 1UMBB 4AT1A 2RHLA 3VU3A 1NP6A 2BFDA 1EHIA 3BMOB 2RAPA 1RHMA 4DA8A 1B7GO 2CNLA 3HJHA 4J29A 4ENPA 1UIMA 3H6KA 1WBJB 3A0RB 5FD8A 3QVSA 7REQB 3FTDA 4GQIA 2CLMB 4XWYA 2O57A 1M2OB 2RHBA 2JNWA 4W8HA 3V8MA 1V7QA 3NVAA 1Z13A 5EFOA 1B43A 3ONFA 2OENG 5IJAA 3H04A 2NT4A 2W2QA 4H1TA 3WAKA 4ETWA 3WLFA 4Q4HA 4JR0A 1PTJC 3ZKWB 3I6IA 5C5EA 5JZOA 5AVVA 5F98A 1JLKA 1L4LA 2JFGA 2P41A 3ZE8A 2QR5A 4KV9A 3H1GA 1AA6A 1VPDA 1PR1A 1P3JA 1Z6PA 3QXSA 3UATA 1WLSA 4IX1A 5A4FS 3TXAA 5THQA 3LDAA 3MUNA 2OV1A 3LKBA 1R00A 4QPNA 1QO7A 1QG0A 1E3JA 4ZJUA 5FWNA 3A7DA 3DG9A 3FLAA 2QSYA 5CT4A 2K7FA 1R0SA 2O5EA 3V5NA 2NX2A 4HF7A 3ZWOA 4CIXA 3LCJA 2B2CA 4DR7B 1FLVA 4XVQA 2NQ8A 1HFKA 4BAZA 1GYQA 2J87A 3NU1A 3V2UA 1Q1QA 2GZRA 3TLCA 3OEHA 1M74A 1HE5A 1A0OA 1AS3A 4G2NA 3RFFA 3SK0A 4NZPA 1M8JA 4ZOAA 2G70A 4ZI7F 1JIXA 2QLNA 4WY5A 2PSFA 3UB2A 3HYLA 1JHZA 1X86B 4M60A 3IKLA 1JHMA 3OIWA 2HNBA 2PPVA 4UHJA 4OGLA 4OQMA 4B40A 1LU9A 3KXIA 3HPRA 4WZAA 5FIUA 4DN6A 4JN6B 4M0UA 3NLLA 3RVMA 4HQRA 1B0AA 2WILA 3K8OE 5EZ6B 3C5CA 4YNBA 3IUSA 2MYUA 3ZY4A 4ISBA 1T2EA 3K20A 4LZJA 1QFXA 1DO8A 3DE1X 2JG3A 4B4OA 2QVXX 1SKYB 2Z8ZA 4DW8A 4GT1A 4EB3A 3Q8MA 2J0UB 4YUYA 1UC5B 1DOAA 3K9QO 3BD7A 3EVCA 5SZKB 2XT0A 2E5LB 4CMEC 4JC0A 1XZFA 4P4SB 3KUDA 5FWYA 1NTOA 4JXJA 2TMGA 5KQMA 3OEEA 1HL3A 2GVDC 4QOIA 4UQOA 3DOFA 5DLPA 4ZAGA 1K75A 3FVQA 4OYLA 3ZY3A 3K70D 1EWQA 1KBQA 2J9YB 3BCRA 4U7PB 2B21A 4JI3B 4EG3A 3LW8A 1Z68A 1CVRA 4US2R 4GH5A 5FOQA 1XRMA 4JH0A 1FSPA 4I14A 4FYKA 1YZYA 5DCUA 3DCJA 1O5IA 3I58A 1PFWA 1V43A 5EZ5A 3RS9A 3QXXA 3EQ9A 4NLLA 4R31A 3EDCA 1J1IA 1JIQA 2JGJA 3R5FA 5I7UA 3AJAA 1H9BA 3EGOA 1IZYA 1IUNA 2ZS8A 1ORWA 3ZS9A 1EK2A 1UBLS 4UTRA 3K70B 2QEQA 1RPAA 4FVTA 2MINA 4NC9A 4DLSA 4FOTA 2QN9A 3A4VA 1KO7A 3C3DA 3TFQA 1KS9A 4K28A 2QSZA 4GZLA 1QHIA 2C98A 3SVZA 2O14A 3CX6A 1MT0A 3UT5A 3HHEA 2YZKA 2PZKA 1OXTA 4BX3A 4FOOA 3UGJA 2E6KA 4G8CA 3FWYA 3G2OA 1Q84A 4Q15A 1KTIA 5L8VA 1Q0QA 3RYIB 1L3CA 1ZJYA 1U8ZA 2HAEA 1NGSA 3QEOA 4J0HA 1N33B 3JZAA 3R6TA 3LQRA 2XGSA 2PJDA 2A9FA 4FGKA 4QO7A 5KYVA 4E32A 2OLEA 3GT7A 3SC3A 4EFDA 3PJEA 1BXZA 3ABOB 1U8EA 1RXYA 3QFSA 2FMFA 4ETNA 5K0NA 2Y05A 4G1MB 1CY0A 3USCS 2H16A 4F1WA 3SXUB 4ZVUA 3K1YA 4YAGA 1VGRA 3HU1A 3FUTA 3H0CA 4XIYA 3D59A 5DCLA 1ZHOA 1TYBE 1XAGA 3RJMA 3JYLA 3OCVA 2YWDA 3T7AA 1WXXA 3CSSA 4L15A 4BP9A 1KFEB 1LV7A 2C61A 2FWAA 2X8LA 1R10A 2D1RA 2GLUA 2VDRB 2NYVA 3B85A 1CZNA 1DZIA 3CW9A 3FYUA 3L4EA 4IJ6A 3TR0A 1SXPA 2O2IA 3F5QA 4QXOA 1ODCA 2YTZA 3LA8A 1BHO1 2FWBA 5CM2Z 3ZI7A 2H4FA 3N3BC 3DWFA 4HX2A 3UJ8A 4EW2A 1TM2A 5FL3A 4LJSA 1SOWA 1Q0PA 5D5QA 1G21E 3W77A 3KAJA 4DAEA 4YXFA 4HVLA 5LN1A 3P0IA 1IXSB 1EE2A 2RARA 1SBHA 5F2KA 2CV0A 4ZQCB 1K6XA 3QG1A 2WZDA 1LRJA 4LA4A 1XTVA 3M7IA 3WMXA 1QVWA 3QSYA 4C6RA 1DUVG 1P61B 1Z17A 1BO6A 3KLMX 1CUEA 4TKLA 3CE9A 2CBZA 2CD7A 3DXFA 3N2ZB 4FMCF 5G40A 4BMPB 4QM6A 4DR5B 1R2QA 3WIOA 1X1TA 3DV0A 1M83A 4IJMA 5A5FA 3WL3A 1G4HA 4WZ6A 1NW4A 1NDHA 4KQEA 3ZXXA 1W5AA 1O9HA 3MMNA 4PXAA 5KJ6A 2WWIA 4ZVVA 1IPFA 1TUEA 4F71A 2GF0A 3GXBA 2ZATA 5JYCA 4IHAA 4GD3Q 1EX7A 4MLZA 2VPWA 3C8UA 3VPGA 3VR6A 1E4EA 1XPJA 4RV4A 3W3ZB 1QNLA 1ZC4A 3ELDA 3MB8A 3X2SA 2X15A 1J24A 1ZRNA 5HS6A 4U5QA 1L7XA 1ICIA 2PGJA 4GHWA 5CM8B 2OXTA 4R2JA 2KHZA 1WF6A 2C78A 2OSVA 2Y8EA 4KH0A 2CL7X 4IGKA 4MMYB 2ADFA 4P84A 4RXTA 2IV3A 3ZLVA 4BCDA 2Z95A 3RCBA 3EJ6A 2H31A 4UZSA 2Y1OA 4QJ5A 3ZDXB 2GN9A 1W52X 4G9EA 2QW1A 4R3UC 2O4UX 4CFSA 3UMYA 4AJ2A 1P73A 4HQLA 2Y1CA 4YRQA 3V1LA 4HWGA 1L4EA 2DT5A 3CN9A 3DHVA 3ZWAA 3WG9A 2OSBA 4CCWA 5F1OA 1ZIPA 1O8BA 2H08A 1A8UA 1CS0A 2PWYA 3BIOA 3JQ8B 3NR2A 1JDVA 4E12A 4HWPA 2QN8A 1GSOA 1T43A 3LUGA 1WUHS 4LGMA 4YBRA 4BU1A 3V1KA 4ZTUB 2X77A 3THOA 3OQPA 3QMPA 4ETIA 4W9RA 2CLFB 5B1EA 3B2QA 3JSAA 3OI7A 4J9UE 4DBVO 4OXQA 4GMDA 3OY7A 4FIDA 5EIWA 2EATA 3PDIA 2FPOA 1LVUA 1ULTA 3WNDA 4TUYB 2Z30A 1XVVA 5AKKA 4RW0A 1P2GA 4F5DA 2FRDA 5I7FA 3MOIA 1CY2A 2W8BB 4Y7CA 4K0KB 3UAXA 4X20B 1QHXA 3RM3A 2PGNA 1DI0A 2ETVA 2CL0X 3CONA 2EL7A 5BURA 3PGMA 5AVRA 4X45A 3BF8A 5CX4A 2ZOSA 2QRQA 4M7WA 3PPXA 5THKA 5AT1A 3VHXB 3EZ6A 3KXDA 1ND6A 4W9NC 1NLUA 3G68A 4ZYLA 3LKZA 2GF2A 1JFTA 2GPBA 2OD9A 5CNMA 2VTBA 3ZDCA 4G0UA 1PDVA 1CUXA 3I53A 1ENOA 5CYOA 4HGQA 2ZYSA 1RAHA 4G37A 3LXMA 3NP9A 2Q45A 3QVLA 4KQ9A 4P83A 5HUQA 1HLFA 4CKBB 4R2XA 3UBMA 1Z82A 1X8KA 2PMWB 5LLDA 3KHKA 5KYYA 2H0RA 3DNFA 1BS2A 3HVRA 1L5QA 1KVUA 1NG1A 5LQDA 1QZZA 5BW6B 3DZIA 2XUGA 4P7KA 2PQ0A 4EHBA 3M6WA 5IM4A 4O4JF 4F45A 1YE3A 3ZNQA 2VCHA 2Q8QA 4LSWA 2I2XB 1CJMA 4LISA 4XUGB 3QMVA 3KOWA 4ER5A 5AVUA 1Q6ZA 5LKRA 4D9IA 3IVMA 4ZHQB 3RYFA 5K4HA 4PG4A 1KNQA 4TS4A 4AWBA 1H8ED 4B6EA 5HS4A 2GA8A 1P6XA 3RQSA 4UTPA 3WGZA 5U4QA 1GVNB 2R2AA 3DOCA 1V37A 4JKYA 3TQQA 2J7KA 2BEVB 3E5MA 3UHFA 4A91A 1U9CA 2HJHA 4B35A 4KRYA 4RKRA 1EK5A 4NV1A 2VQSA 2VRNA 4CUZA 4FINA 2QN6A 4ARAA 5DW0A 2VK4A 1E0DA 3C3PA 4REQA 5FI0B 1RQNA 6AT1A 2PLAA 2XRMA 1KZ9A 3D5EA 3HSSA 3O6VA 3ROXA 3EQ8A 1U9ZA 4RPJA 4RSGA 2WZBA 3OAAD 5DNUA 2NTEA 4UARA 2Z98A 3CKKA 3RS8A 2HQOA 3GJ6A 3ZY5A 5HBRA 4DZTA 3MOSA 1CW2B 3CW2A 1JG2A 3DL2A 4FMPA 2W5UA 3PQFA 1SB9A 4PYOA 2Z6VA 3TECE 4MKHA 1UJ2A 3K94A 1YR9A 3ZU2A 2GHIA 5ITVA 5K3AA 3DMYA 5HNKA 1SCKA 4Z3OA 3G17A 3HKCB 3NDIA 5EJAA 2WR8A 3R09A 2CZQA 1OHHD 3H5NA 3LRXA 3LVBA 5CUQA 2V7UA 1WXWA 2ZZKA 1KHTA 1M6HA 1IIRA 3D8RA 2EQBA 3TRHA 4EPRA 1OYVA 1NW9B 3CURA 3GFFA 5LB4A 4FBMA 4PWZA 5C2JB 5COQA 1N2CA 1CUWA 1NASA 3IE1A 2DQKA 3ROEA 2WD8A 3ILHA 3D4LA 3H9UA 4RXUA 2HLDD 1DPGA 2PUVA 4EY6A 1P44A 2WQZA 3UC9A 4B80A 4WHMA 4WL0A 2WAYA 3JD0A 2TYSB 2PS0A 1A5BB 4NF2A 5IJXA 4AKTA 4DLLA 5CCEA 3QIAA 2PN1A 1OILA 2ICAA 4K9DA 3T3MB 4YHHB 2R6ZA 4E09A 4MS3B 2XTAA 3PWTA 1NN1A 2AXQA 4PVDA 4ASUD 3L4KA 3CLUC 3NCTA 1IZ0A 4F06A 4B3CA 1K3TA 3R0JA 5CLFA 2ADOA 4WN3A 2IEBA 3SHFA 2C04A 3T95A 2GK4A 1MV8A 1UZMA 1DRWA 1T36B 1PLKA 2ST1A 3Q6IA 5AK5A 5JC1A 3FLMA 1NMEA 2QV0A 2BHRA 2HK6A 3PVZA 4U6NA 1GTSA 1CK4A 1OGIA 1VE3A 1XYVA 5EI5A