2BEWB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
336
Chain Sequence
AHFTFQPEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 125
structure length 336
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bewB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bewB01
1U5BA 1X7WA 2YICA 5EJ9A 2O1SA 1YHYA 1X7YB 4XEUA 5HGXA 2YIDA 1QS0B 4RJKA 1V5FA 2BEVA 3DVAB 2UZAA 3AHHA 5K3SA 2BFBB 5EXDA 4ZP1A 4JD5A 1TRKA 3M34A 2G25A 1PO7A 2JI6A 2IEAA 1T9BA 2JI8A 2JIBA 5K2OA 2WVGA 3AHJA 4RJIA 1OZGA 3EXHA 4GM1A 2EZ8A 3F6BX 2BFDA 5HJEA 2QTCA 2PGNA 1V1RA 1YBHA 5K6RA 1YI1A 2IHVA 4GP9A 4KXWA 2C3MA 2VK1A 3DUFA 3EXIB 3E9YA 1Q6ZA 3EXFA 3ZHTA 2VJYA 2OZLB 3IAFA 2JGDA 5EJ5A 2EZ4A 5DEIA 1X80B 3HWWA 2O1XA 4JUAA 2DJIA 4JUBA 5ESDA 4K9MA 3ZHSA 2J9FB 1OLSA 1NI4A 1AY0A 3EY9A 4C7XA 5HYVA 5EJ8A 4JUFA 2Q5OA 2BFCB 1X7YA 2Q5QA 1L8AA 5HHTA 4K9QA 1UPCA 1PVDA 4GM4A 1Z8NA 2BEWA 1V11B 1QS0A 1OLXB 2VK4A 1W88B 3DVAA 2BFFB 1DTWA 2BFBA 3EXEA 2C3PA 2VK8A 1RP7A 1OLUB 1UMCA 3IAEA 1OZFA 2EZTA 5I5EA 1V16A 1NGSA 1UPAA 5DGDA 1R9JA 1TKBA 2UZ1A 4QQ8A 1X7ZA 2BEUA 2R8PA 5C4IA 1TKCA 4JUCA 4K9KA 2BFEA 1X7XB 1U5BB 1X7WB 3DV0A 2NXWA 1OVMA 2PANA 1YD7A 5IMSA 2AG0A 2Q27A 1UM9B 5DGTA 4JUDX 5EJMA 3F6EX 2JI7A 1UMDA 4FEGA 4MZXA 2BEVB 4Q9DA 1B0PA 1KEKA 1WCIA 4MPJA 4JU8A 2R8OA 1YHZA 3EXIA 2WVAA 3UPTA 4D5GA 3AHGA 1JSCA 4KXVA 2E6KA 2PGOA 4QPZA 1TKAA 2G28A 3AHFA 2OZLA 3JU3A 1UMBB 1MCZA 3FZNA 3M7IA 4K9OA 4RJJA 3AI7A 2EZ9A 4K9LA 3EYAA 1T9CA 2WVHA 4KGDA 1W85A 4FEEA 3RIMA 2J9FA 4COKA 1ITZA 4K9PA 2BP7A 3ZHUA 5FEMA 1OZHA 2C3OA 1V5GA 5EJAA 5AHKA 3L84A 5EXEA 3OOYA 1QGDA 5K6TA 4KXUA 1ZPDA 2IHUA 1GPUA 3DUFB 2QTAA 2R5NA 1OLXA 2V3WA 1POXA 1QPBA 1BFDA 2BFFA 2C31A 1YNOA 2IHTA 2C3YA 3EXFB 1T9AA 1V1MB 1OLUA 1T9DA 1PYDA 3AHEA 3M49A 2JGDB 3HYLA 3EXHC 2Q28A 2XT9A 2Q29A 1V5EA 3LQ2A 3EXG2 1OLSB 1IK6A 3D7KA 1NI4B 3OE1A 1UPBA 3ZHVA 2XT6A 5I4IA 3FLMA 1UM9A 3ZHRA 2EZUA 3LQ1A 2VBIA 4KXXA 1POWA 2Y0PA 2BEWB 3LPLA 1DTWB 3EXEB 4WBXC 3FSJX 5EJ6A 1UMCB 3AHCA 3UK1A 2X7JA 3AHIA 1V16B 2Q5JA 1PI3A 1UMBA 4MQ5A 5EJ4A 2UZ1B 1X7ZB 2AG1A 2BEUB 2JLAA 2BFEB 3AHDA 2VBGA 3DV0B 3ZHQA 3HWX1 1X80A 5I51A 2VBFA 5ERYA 5EJ7A 3EXHB 1UMDB 4QELA 3MOSA 4MPPA 5ERXA 2BFDB 2JI9A 4GPEA 5I5GA 1WCIB 1YI0A 4GM0A 1V1RB 3KOMA 2BFCA 1V1MA 4JU9A 4D5EA 2JLCA 1V11A 2XTAA 1W88A 2FWNA 4KXYA 2C42A 3M6LA 3EA4A 4GG1A 2PDAA 4C7VA 1W85B 2Q5LA 3EXG1 2G67A 2BP7B 3LQ4A 4K9NA 1N0HA 2FN3A 1Y9DA 2C3UA 4MPRA 2W93A 1X7XA
chains in the Genus database with same CATH superfamily
3G2NA 5HUQA 1FSGA 4U00A 2V7PA 5TQ2B 1A5ZA 2HH9A 3LDUA 2YICA 4EUFA 4R31A 3EQ2A 1N0VC 4NBTA 1XHFA 4FCVA 4Q15A 4PBTA 1M10A 3EFHA 1E2GA 1R0YA 1YQTA 2O2CA 4I2NA 4Q93A 1EGMB 2NO6A 4RDHA 2O1SA 3JQDA 421PA 4YAWA 3GLGA 4L85A 1NUUA 1ZOOA 1JX6A 5FJIA 1TECE 4BRWA 2XMSA 4EFNA 5AKZA 3ZEAA 1X7YB 3LTNC 3DD5A 4AKHA 3HQ4O 4CKBB 5HJ5A 1HX7A 1Q21A 1WZCA 1P74A 2OENG 2QRHA 3NC1C 3RJ5A 4RXMA 1R88A 1U5AA 1REQB 3AW8A 3QTBA 4C6RA 3ILVA 2BMVA 3TPFA 3UWDA 3KXLA 5FOTA 4F1KA 4K81B 4QGGA 3IR7A 2OWEA 2VXOA 1YS6A 2QP4A 4H1VA 1AHPA 1OSNA 2OHHA 1HLPA 1PK8A 1N2XA 1DX4A 2CNWD 2OORA 1UBTS 1PJAA 2XE8A 2IUFA 1H9BA 3GHYA 4ZAZA 3TLXA 2E9SA 2Q6IA 3GFGA 2W11A 3NLLA 1MJ5A 4DA9A 3KE8A 4P4NA 3GLFB 4LYGA 1ORVA 4XFJA 1K5DA 4OA5A 4ZQEA 5FUYA 2BIFA 4GKKB 1T9GR 3JQFA 4HB2A 4HZUA 1IN8A 1G7CA 1QTNA 3KE9A 3VSEA 2QRPA 3N2KB 4JASB 4KK4A 1BA3A 3C16C 1DAFA 3FJOA 4LXUA 2LBPA 5BSKA 2B3DA 4RLSA 1FFXA 3VYUB 2NYVA 4JBIA 4QHTA 1P44A 1YZKA 2J7PA 2Y67A 4N7JA 1PR9A 3PQEA 4URVR 4BFYA 1T36B 3CW2A 2V65A 3P7MA 1CUZA 2J30A 4BDTA 4F91B 1LV8A 2LIPA 1Z7GA 4MKZA 1QIHA 1U1FA 2FPOA 3B8EA 3COWA 4KO3S 4DA8A 2D2VA 1YE8A 3NC0C 4CV3A 4EPWA 2ZBVA 3BA1A 2IS2A 4HDOB 1N2BA 1KKMA 5DTMA 1RRCA 1C7FA 1E59A 3EJWA 2J5KA 3NAZA 3NTXA 4Q9LA 4HQRA 1ADGA 3VHQA 3DC2A 3GK3A 5KSWB 1GNRA 1MQ9A 3JQRA 3A6PC 3OAAD 5H83A 1X13A 3UH0A 1JA0A 1ES9A 1SUIA 3V33A 5D3QA 1L3BA 4P84A 1N2CA 4RZ3A 5A71A 1Z82A 1YBHA 4XWTA 3R20A 3PFGA 2FGKA 4JJ4A 5FTMA 5EMNA 3T6KA 1GZUA 2G06A 3IEKA 2MR5A 2EEPA 3MW8A 3N3BC 3RIXA 3IV7A 4Y2PA 3VDRA 4BVEA 3BWBA 4BGDA 4ZTZB 4NYIQ 2P90A 5F3DA 3ROPA 5JYCA 5JDCC 4Z49A 1DKPA 3QLVC 2CUKA 4NQZA 1OFGA 3JVIA 3FVRA 4UDOA 1LUAA 5DN9A 1DCTA 4QDOA 2QJRA 1Q6ZA 2VPYA 2QU7A 3G2QA 4JCOA 4NCIA 4U2GA 4BTLA 4CLOB 3VR6A 2VHTA 2OXFA 4XLTA 3SYNA 2GK3A 1N8KA 3EEFA 4E30A 1DKRA 1H42A 4KMMA 3Q15C 4DCMA 1R0WA 4NMWA 1SQ6A 3CX4A 1LDEA 3HUTA 3QLEA 4PONA 1L5KA 3WAKA 1NSYA 1RJDA 5FWAA 1JR3E 4G9BA 3WP1B 1NASA 4NV1A 4IUDS 2ZBEA 2NUTB 3CHYA 1JQBA 1PTJC 3RVPA 4G56A 3K73O 3THYB 1UC4B 4LTDA 4PZZA 3CPJB 4W5NA 2K7ZA 1PFUA 1SCJA 3DS8A 4EW6A 3LP8A 2VPIA 3SKVA 2NTEA 3JWHA 3RREA 4AULA 1ZO8A 4DY4A 1E60A 1A95A 3GJ0A 3DOFA 3K71B 3T1HB 5TARA 2EKBA 2Z43A 1BG6A 3ELWA 4HQNA 3GRAA 4W1PA 4MLCA 1KJYA 3PRHA 2X15A 4KPUB 4LX0A 1XTSA 1SBTA 2VHQA 2Y6VA 4E14A 5KYXB 4M7RA 1TAUA 1J90A 2YV3A 2X22A 2XQIA 3OQ1A 4JFAA 4YK7A 5TPZD 5MN5A 2CFSA 3LHDA 3QA9A 1JG7A 3Q0TA 4TV9A 1SKMA 1UFVA 2A4KA 2V74B 4E13A 5LZ2A 1XNGA 5HR5A 2P4EA 2HSEA 4P4UA 4KGZA 1J06A 3F4BA 3CV3A 1VE3A 4YN3A 3WJAA 4HNAB 2NAFA 3DF9A 5F7XA 2O3JA 3CY6A 4AWXA 1G21E 5KTMA 2WA1A 3D8SA 2LVBA 3T1QA 3GFPA 1SOWA 2HLPA 3E22A 2G5GX 2I4TA 3L0OA 3RH0A 5ISMA 1PT9A 1SKQA 3TIXB 1FVXA 4BX0A 1OLUB 2AMVA 1FTYA 1G1MA 2ZPUA 2GEVA 3IE2A 1H8HA 4OGWA 3ZWQA 1KIAA 3TKYA 3OA2A 4G4GA 1JBKA 1YVDA 3CH7A 4ARUA 4OHOA 2JFUA 1O6FA 3SZ3A 3WYEA 1RWWA 1DEKA 1KI8A 1YDWA 2YXEA 3QK7A 3ZGYA 5IJ9A 5JI2E 2JJ2A 1GPBA 3A3PA 5I7UA 4X84A 3M82A 3LBAA 2H0QA 2UVQA 1QKKA 2XE7A 3HB4X 3U3MA 2UZ1A 4AKGA 1NSFA 1HT0A 1ZM4A 1NBWB 4PSKA 3SS7X 4HDNA 2W8ZA 3MGGA 3ADDA 4O3MA 3DAPA 4U3JA 5ITVA 4UD6A 2XODA 4FYXA 3U48A 5A4DA 3KL2A 2RHHA 4UTRA 2AMYA 3L9XA 3W8EA 5JZOA 4R2MA 4NICA 1RZUA 3MJRA 2XV1A 3FYHA 3ELUA 2W6ID 1WMFA 4Q03A 3W77A 4CR6A 2DEUA 3L6OO 4HNQA 5KTNA 2C54A 1BVHA 1GADO 3C5CA 2OBFA 4FDVA 4OFWA 4QODA 4ZARA 3JZDA 5JMTA 2C7PA 2OFOA 2JEOA 1ZJ4A 4BVGA 3DT8A 3HVUA 2Z5VA 4KXMA 4DQKA 1N2OA 4YRZA 2AG6A 1IH8A 1IJKA 1L7QA 3QHAA 1KH3A 4EY7A 5I8WA 2AC4A 1SVOA 4BQSA 4DNQA 4NCBA 1E5DA 2P2SA 4X44A 2C8KA 2I65A 1GAWA 3IKMB 3QU9A 2ISSD 1E1QD 3ZHCA 3M1LA 2VK2A 4QGSA 1P72A 2NO7A 5EI5A 3BWEA 1EGQA 1H0SA 3NIGB 1D2MA 1K7FB 1H2HA 3UV3A 2V7QD 2JK0A 4HV4A 4OQMA 2E6KA 1BFUA 4M7PA 2QHXA 5AW1A 4LJAA 4LZLA 4JL5A 4NJOA 2OCXA 3D0KA 3LFUA 3V34A 4NBVA 4ZK2A 1QX4A 4D96A 1MAVA 5IFKA 1GFZA 3LRTA 3Q87B 1Z8FA 1IXKA 1QPGA 4IEIA 5DT9A 1WW3A 4A82A 6GPBA 3KAJA 3PUWA 4GNRA 3GLKA 5F1PA 1JI3A 3JQ7B 3U1BA 4FB4A 4QPPA 1KDOA 3RSOA 4GX1A 3ZGLA 3O8LA 1WL8A 5IARA 3M9XA 2NSDA 5F9FA 5AT1A 2FOIA 3PQ5A 4G09A 2HFJA 5KX5F 4CCSA 2QLJA 4G6ZA 4INJA 4DN6A 5KYTA 1KZ1A 3RU2A 3GQVA 5G1OA 2LR0A 3PIIA 3VHXB 2Q2OA 3THOA 4DR3B 1UQUA 2IUEA 2C9CA 1TQ8A 3C14C 5EYPB 1BHJA 2VKTA 1OZHA 3U7JA 3LKVA 1XCGB 1R8YA 2R4UA 3I5UA 1R8JA 4O2AA 4TTJA 1Q3TA 3FPEA 3CISA 1PJCA 3ACDA 3E7XA 4GZ6A 5A4JA 2VT3A 4EBBA 2ACEA 1E2HA 4DC9A 3DMNA 4R5MA 1WMSA 3JAWB 1HRDA 1ODLA 4TYPA 4RCZA 1IL0A 3UJAA 3U5ZB 2IU0A 1QVWA 3PQ3A 4L02A 4R4JA 2GA8A 2QUBA 2OZEA 4ZICA 1QGDA 4JODA 4EI2A 3QF4B 1PSWA 3G82C 1CJUC 3MWFA 3OCZA 3E6AA 2PEZA 4MYSA 1YC2A 2IWHA 4BBAA 4BNMA 4E5UA 1E1CB 2AYXA 4G0ZA 1O5IA 1K0UA 3FW1A 4QC2A 4HO1X 2YOGA 3V8QA 4BNXA 4FHCA 4OXYA 1E0SA 2O1WA 2ODBA 3DKIA 1AN9A 5LMNB 4HGNA 2H4XA 1ICIA 1GGVA 3HA2A 3FDZB 4ZJPA 1XAGA 4BLRA 4IDEA 5I6DA 3TLCA 2F1IA 1YMQA 1O94C 4O29A 1ESZA 3I9V6 5F4BA 4ZVOA 1GITA 1R4NA 2PX2A 3CG0A 2YW2A 1X74A 1LX7A 1O77A 3DOJA 4NZZA 1XDDA 4QYIB 1U8CB 4O4HF 5BSGA 4NH0A 1DJLA 1II8A 2AJBA 4GDMA 4MVWA 2C58A 4I5EA 1CYEA 3KLMX 2YINC 4H0CA 4G97A 4LBZA 1MPTA 5BPFA 1YTUA 3MIZA 2X8JB 3IMFA 1WEKA 5AVQA 5CCEA 2OWDA 5LNK1 4QASA 4QQKA 1NR5A 3AILA 5EKXA 2D06A 4GXNA 4TT3A 3ADBA 3JQAA 3SLRA 3FYSA 5E6SB 3PXCX 4K6OA 4US1R 3UMYA 1X94A 5LP6F 3K6JA 1U3GA 1CUBA 3CF0A 5A2QA 1TZBA 3FLMA 3NYWA 3ESCA 4PRKA 1MOQA 1M7GA 4G8CA 5TQVA 2POQX 3EIXA 4KXQA 1FE8A 4CMIA 1IN4A 4IJWA 3OU6A 1G0OA 3QPAA 3R5JA 5JHHB 2QBYB 2VDWB 1HY3A 1VL5A 3L8CA 4RMHA 3Q2IA 1OTHA 2I3GA 4M7WA 5GPBA 3TPCA 3UQYS 5HFNA 1BHSA 4EYGA 2WSIA 1FS4A 2R87A 1FQOA 1Q7CA 3FDJA 1GGEA 2ONZA 3K8QA 4BVHA 2GCGA 4M9RA 1GQFA 2OGSA 4G63A 1ADBA 2RI1A 4JLWA 3ZGNA 3GELA 3AIIA 2TMYA 2VJCA 1SXQA 5ENVA 2H2HA 3FH0A 1D6MA 1T4CB 1OXKB 1T15A 3B1VA 5F64A 1KPIA 2JH3A 5CLGA 1XLWA 3COYA 3DEFA 2EGGA 3AWIA 3JWGA 1K4KA 3PVCA 1GEGA 4FILA 2Q3EA 3RG2A 3C8HA 2VNJA 3WGVA 1OLOA 1N5DA 1M6WA 2FR8A 2QX6A 5FA5A 4B7CA 1G63A 3I01M 4OL0A 2JLRA 1P45A 2PJDA 1J39A 3TZQA 1ZCJA 3DV9A 3UJ9A 2FWBA 3OPYA 4Q19A 3L4JA 1QH0A 3UK1A 1F0NA 3ERCA 2JFNA 3QOFA 2QTRA 4ZCMA 1TOAA 3ZNPA 4D4JA 4OUDB 1LTQA 4B81A 1PJSA 2QQ0A 1KMMA 3AFMA 3MUEA 3JAKA 1LZLA 4RMIA 4WUVA 1Y89A 4HTFA 4L75A 2P5YA 5FP0A 3BL8A 1O6ZA 1S1CA 2X0JA 1GTVA 3SD7A 4F6CA 3ZZ0A 4NFHA 5FI5A 4C7OA 3K1JA 5DGCA 5T4HA 1JW9B 2W98A 4YMTA 1LI7A 3W0LB 4V0QA 5IABA 3ZBTA 2DJ5A 1M0EA 2VHWA 3JD3A 2EKPA 1E66A 1FYWA 2OT3B 3U9SA 4B6QA 2Q2QA 4HLNA 4BQRA 5F78A 2ILTA 3RRZA 1DRWA 1TD1A 2H9AA 3LVFO 5D00A 1U8XX 3PJGA 2F64A 3TR6A 4IHJF 2XWJI 4HWGA 5EWJB 1W46A 3RKUA 3WL6A 1XZMA 1YZQA 2J6CA 1U2RA 4N5DA 4P0PB 3CZ5A 2GGSA 2Y71A 5IEJA 1IN6A 5KHLB 5E7QA 2GETA 2XIJA 5I47A 1KH1A 4QELA 2HLDD 2PD6A 4NZ9A 5ICFA 1U2QA 2OFPA 5GGYA 1DOAA 1JVSA 1UKAA 2I2DA 2AN3A 2FWJA 2WIFA 5EJIA 1TF5A 3Q2OA 4OHFA 3W9BA 4M60A 1Z2NX 4GI7A 3GAFA 4RETA 3KPYA 3HLYA 3VJLA 2GM4A 4IG9A 4EG8A 2NACA 3GNLA 2X1VA 3G8YA 3CB4A 3HFSA 1Q11A 3LG2A 3RVSA 4RHYA 2XIQA 4RVHA 1PVOA 4HJXA 4XIYA 2IPNA 2CLSA 3R7NA 2VDQB 3PV0A 1A2OA 1O5OA 4QJ3A 3ZC3A 4CM8B 4C29A 1X0XA 4L28A 2WMYA 1CRQA 4MITA 4Y1FA 5D5QA 1QZXA 4TLLB 3SXUA 3K8ZA 1WULS 2JLCA 2XQVA 3GT4A 4MCIA 1CVLA 1I0LA 2QG4A 1U7PA 2HTFA 1TZ2A 4F92B 4LECA 1KO7A 4YJ3A 4L72A 4HWTA 3GLFE 3TDNA 2XOKD 3DKKA 4GG1A 5EZQA 4YFYA 4BU0A 4NYIR 4KHZA 1SUBA 1XMIA 4FGZA 1L1QA 2MTBA 3HDVA 3Q0IA 2XHZA 3WQRA 2I03A 2FDRA 2UV8A 3HXPA 3O7MA 4P53A 5J1TB 1OXBB 2AC7A 2QKYA 1XJ0A 1NVXQ 1QIIA 4LCBA 4A0SA 4AKSA 5ALVA 3TTWA 1HDYA 1SIUA 3BXOA 4W5TA 1B6TA 4KGXA 1NYQA 1Y9DA 2TECE 4DV1B 2PRSA 4FR0A 4RANA 3UAGA 5JADA 4HLQB 3AF3A 4DMCA 1B2RA 2I6GA 1Z29A 4KOAA 2EW8A 2VNSA 2HA5A 2YZGA 3QTTA 3WTCA 3ANTA 5I4CA 2WD7A 3QEMB 4RTJA 1URPA 4RF2A 2CNLA 2PYDA 1AQ6A 2P30A 4XASA 3AINA 1RYFA 4JJEA 4YJFA 1X2BA 2FZGA 2AQ8A 2W93A 4PLYA 4U7JA 2V8OA 2WU8A 1UWKA 1PHRA 4XJTA 2R2AA 3R3HA 2B7CA 2IV3A 1U5BA 4CL0A 3G85A 1RYNA 3KVRA 2SNIE 3FE2A 1MD9A 1YTLA 2P9YA 2F1KA 3QVVA 3TMKA 2Z8YA 5D6OA 2XGGA 1CR0A 1NBEA 3DTVD 4S0ZA 5IYZB 5CT9A 2GWRA 2I78A 4ICIA 1JSLA 1U3UA 2VJMB 4HTAA 4HX5A 4EUSA 5BWLA 4Z3DA 1RMQA 4AVYA 2IXGA 1J0XO 1ICEA 5CLIA 4YP6A 3U49A 4QKQA 3E9ZA 3Q7IA 1MBZA 1D5CA 1DQSA 4ZU1X 1P7YA 3ZCUA 2GTPA 2GN8A 2GQ0A 4KBFA 4HXEB 1VP9A 4XEUA 4AJOA 1KEZA 2Q5CA 5LMUB 4A6XA 5JNTA 3MJTA 4HWOA 2RHCA 4DWWA 1AN0A 3OQ6A 3LPMA 4PZLA 2YFHA 3DXYA 4LHEA 4LV5B 2B4TO 5F5XA 2HFKA 3LF1A 3FMIA 3NUQA 5IAJA 4L5IA 4S2EA 1JAIA 3L7AA 3ZLUA 3KPVA 4G0WA 1K68A 4NJMA 1M1UA 2R6R1 2G25A 3PWSA 1BDBA 3DTNA 3PQ7A 3C39A 4MUBA 5HQJA 3R3XA 2XUFA 3HY4A 2JI6A 4MKXA 2BYTA 4DZZA 1W35A 5FNZA 3ZR4B 3PS9A 1LLFA 1ORDA 1W52X 2VC2B 1B3RA 1ISRA 3OQPA 1K7YA 4MMXB 3A9RA 3GVHA 2Y92A 1QDUA 2HJSA 1MO3A 1TMOA 1T3LA 2OAGA 2XUZA 4TKVB 2P7HA 2C04A 3RIGA 1RVDA 2GBPA 1BS2A 1EA7A 1L5MA 3HJGA 1QYWA 3DE1X 2ZSJA 4WNCA 5AOCA 1N33B 4YAUA 2WVGA 2DUUA 2OBXA 4YGYA 4BP1A 4CKCB 2EF1A 4G1CA 3K0FA 1RAEA 3HJAA 3IB6A 4GMDA 1OW3B 3MLBA 1BS9A 4UZSA 3UNXA 3CFYA 1J56A 5KYVA 3W2GA 1MQ8B 4D7AA 5DW0A 4FHDA 5B7QA 1T8TA 3EUAA 1QH8A 1PDWA 5DSXA 2YC4C 3SS9X 1O3YA 4QUJA 4O63O 4AURA 5IVHA 5KWVA 3INGA 1Q0UA 3TLEA 4RTNA 4FOSA 2YX1A 2ZB8A 2DECA 3R7BA 3TRDA 4WBNF 1OILA 1H6AA 4U7PB 1HT2E 1LPSA 1JNYA 2HU7A 4HFMA 2V54A 3CO5A 4PSCA 3CUWA 1P1IA 4Q7MB 4QVKA 5U4QA 5EHGA 2DHCA 3IQGX 4KR9A 1EZ1A 4YCLA 3K2IA 5K6RA 1ZN8A 3SEQA 1P2GA 1EBFA 3IV6A 1S2OA 2YMMA 2DWPA 2NVUB 3TLMA 3WVNA 4KXWA 2D2FA 1GIAA 3D8BA 5AQEA 1U7XA 3PHHA 3UENA 1MEOA 5TT1A 4B71A 2VS1A 5ADUS 5SZIA 1RCFA 1HNWB 1XRRA 3O4JA 4IDHA 4DLNA 4ZI7F 3EXIB 4CV0A 3MOIA 1G60A 2GBIA 2PM8A 3AONB 1MOPA 4IMJB 5EEGA 1LA2A 2LCIA 5BNZA 2WAOA 4XM0A 1QCYA 2NTYC 3AUSA 3CKMA 1N7GA 2C9DA 1BXGB 4MKRA 4S1VA 1EJ6A 5B4VA 5KJ1A 2VJYA 5LBIA 2P69A 2B98A 4EKIA 3JD4A 3GF4A 4N40A 1GG9A 4GIBA 4XEHA 5HKBA 3EF0A 2XCRB 5DEIA 1VSUA 2DERA 2C7GA 1YIOA 3KEMA 2PIDA 4S1PA 2HMYB 4OL9A 2AJTA 3RV4A 1GL6A 4AZWA 5CLFA 3BFXA 4BYGA 2NO5A 2OVBA 1TEHA 5ESDA 3VR6D 3ZHSA 4J4HA 4EFMA 1BGVA 2PMEA 3FCUB 1OLSA 3FOWA 3MWYW 4PPFA 5IBPA 1XMVA 4TRMA 3M5WA 1CNEA 4YPFA 3ZBUA 4N0MA 2BSXA 3PX7A 3G7NA 1UDCA 2JHGA 4RZHA 1R12A 3HZRA 4W9NA 4EPVA 2JKZA 1ZJZA 2L2QA 4B2IA 4HCJA 3FPBA 3JQCA 4ZGBA 3U4IA 3CTMA 2BSAA 4YAEA 4NNOA 1W2HA 5ARCA 1QYIA 3MJSA 3VR5H 1KP3A 4YV2A 1KRXA 1VSVA 2R11A 2TYSB 3NQ41 4PNPA 1WUHS 2G9UA 3AYXB 3T5CA 2Z9BA 3G6KA 1DQNA 1T4GA 3BSYA 1KWGA 5GADl 3W6PA 1QP4A 1EWYA 3KVVA 1DWPA 3F3MA 2V55B 4HRVA 3ISJA 5EIHA 3R9KA 6AT1A 4X85A 2O19A 4CMCA 1W59A 1HDGO 4GM4A 1FNDA 4F2PA 4FGSA 2NT4A 4EW1A 1IMOA 2PCJA 5K45A 4MO2A 1V11B 4UQPA 1PJQA 4ID9A 5SYNA 4C6SA 1VECA 1DX6A 1JE1A 1DTWA 2OUIA 1KDVA 3B5EA 3O03A 3T54A 4BMDA 3P4UA 1KVRA 3F5QA 3O2NA 3W7AA 3HJCA 3N76A 3E9CA 1RP7A 3PSHA 2G4CA 3TNLA 4POOA 3OE4A 1SCAA 4J6FA 4V0RA 1WBDA 4R8VA 5E7MA 1YSCA 2JDID 3ADKA 3AJRA 3FGNA 4ZDJA 5LFAA 2J0UA 3IAS6 1J1ZA 1Z4QA 2OO3A 3IE0A 1NLYA 4I1UA 1OB5A 4IFIA 3ZJTA 5CDUA 1N8NA 1Q57A 2YVLA 3V7UA 1ZS9A 1R37A 2VP5A 3S0JA 2H1WA 5KNCH 2VCYA 3FIUA 2NZ2A 1LPNA 4YQYA 5CB4A 3ZD7A 4J29A 4MP3A 4CBVA 4IRMA 4DYVA 1MF7A 1JEDA 1II0A 4EAQA 3HWSA 3KB8A 4MW4A 4M22A 3LGXA 3JWJA 3PC6A 2D5CA 4OSPA 3I45A 5LZ5A 5K05A 5C4IA 1H8HD 2WYUA 3IMGA 4M1SA 4DR2B 3FG9A 3C7TA 1G1AA 1JEJA 2FEKA 2QSUA 4CFSA 1X7HA 4RHCA 5CITA 3LK6A 2YY5A 3A4TA 3MT7A 4HEA1 4Z9FA 1CY0A 1RRVA 2IOQA 2ZXEA 2AK3A 3UO8B 4R5HA 1UM9B 5CEEA 1S2NA 1THZA 4HWRA 1ZOIA 2EBHX 3IDAA 1NIPA 3F96A 2EW2A 2ZJYA 3NHAA 2XE6A 4UDXX 5DTEA 1G4UR 5KSPA 1G8KA 3M6VA 5FL7D 3SJBA 1GU1A 1M9NA 2FETA 3GA0A 1ZNXA 1PEDA 4EYOA 4CMBA 3AQ4A 3DYIA 4EFKA 2EVWX 2XBMA 1WUTA 1NOKA 1YQUA 3QKIA 1FFYA 3QWAA 3PVSA 1XZLA 1ZL0A 1XAIA 1JYEA 1C7IA 1BROA 2VQ6A 3LA8A 4KN5A 4RS3A 4J0EA 5EJ2A 4H1WA 1X3SA 2SHKA 2ZYVX 3MA0A 1X1QA 4R7GA 1MA0A 1DCKA 4RKQA 2PWAA 3JW8A 3GCGA 3HTXA 1NN3A 4II3A 4G9EA 5G0VA 4ZZ0A 5ALJA 3RBVA 5E9AA 4EB8A 1IXZA 1I10A 1RE1A 4RKWA 3ZE2B 4RJTA 1SBQA 5BUQA 3JQ9A 5FPPA 4QAJA 4BTVA 3QBEA 4DBVO 3KG2A 3EAGA 1GLNA 16PKA 4HNVA 4NDZA 5BT9A 4RAOA 1UMBB 4JWKA 2CYCA 3KZMA 3TIVA 1GPH1 1I14A 4JC4A 2C5LA 4JK3A 4D8TA 1VHQA 2YHUA 1BQ3A 3EN0A 1AMUA 2GZMA 3BQ9A 3ZYCA 4GQBA 3RSHA 3MINB 4BVKA 3BDIA 5IVKA 1CF9A 3TD6A 2P9QA 4RZXA 2IYAA 4X92A 1N1EA 4WESB 1IPEA 1K08A 4H7HA 4COKA 5JY6A 1EXMA 3RVLA 1NQTA 3MSXA 2GBLC 1QDEA 1S01A 3FWZA 4AK9A 1K06A 1BH2A 1PJ3A 1E1LA 1ACLA 1P2SA 3TMAA 1L5FA 1RI5A 3D8UA 3JRWA 4PIVA 3BT7A 1S2LA 4UU8A 3C15C 2ZT6A 1XOIA 1VC2A 3M33A 3R44A 1T5HX 4LZPA 3LUHA 4U9UA 5BVHA 4IBOA 1MX3A 3LBYA 2A33A 3ZJ4A 4KQMA 2QVCA 1ST3A 1PAUA 4F7WA 4JLNA 3EEIA 4JYBA 4RY0A 3AVPA 5IUKC 1ZOPA 1L7BA 4DTCA 1RFLA 2NZUG 1O87A 5JMOA 5KZMB 4CEHA 3EDMA 3WWYA 4JOSA 3NIWA 4PYKA 5C8YA 1D1TA 3I28A 3PRJA 1XXHE 4PS0A 2VIIA 5LYJA 3VC7A 2XUQA 3EGCA 3QVOA 1YQWA 3L1IA 2QXYA 2QT9A 4BJ3A 5H3HA 1FF9A 2L42A 1ZLYA 4XGNA 2ZVJA 1M0SA 1KK1A 4XOUA 1H4QA 5A05A 1P4RA 4NHEA 1QCZA 5JCPA 1Z4IA 3EE6A 2C2KA 1G5HA 3X1JA 3U09A 2HR1A 1DXHA 1EHIA 3GEHA 3TZKA 1QRRA 1GUZA 2N75A 2GPBA 3P2KA 2O3QA 3MCTA 3KJGA 4EARA 4A91A 2ALJA 3HCWA 4YDHB 2PJRA 1Z37A 1UEXC 3IO3A 1NC3A 1ARZA 1P4SA 2AR9A 2XRFA 4P81A 4Q1CA 1MW8X 3K30A 3ZIUA 5JCOA 2HRCA 4PCAA 1T13A 3DMRA 4UZEA 3OE1A 1M33A 4P31A 4UPVA 2FJ0A 2W2VA 1XZGA 1K6EA 3SEFA 3OTIA 3O8QB 5GIOE 2YQ5A 5FI1B 2IYFA 4MA0A 1LK7A 3PI7A 1U1EA 1IEWA 3BN3A 1OROA 4L78A 5IG2A 4FYMA 3I5YA 1FC0A 3FM9A 1SC6A 1QF7A 1D09A 1LDGA 2XYRA 3EGVA 4ZOLA 3OZFA 3OUUA 1AOXA 3X2FA 4CQMA 3FFTA 2EQAA 1SQSA 4AWBA 2JJ8A 3IOYA 2EU8A 1FA9A 4UDNA 2JS7A 3RTBA 4D43A 4G41A 1H1DA 1Z0ZA 4WADA 2P2DA 1P5RA 4I55A 2X8WA 4Q7QA 4LDPA 4CNBA 4TT3D 1POWA 1UBGA 4JQSA 1KOLA 4RULA 3E3MA 2VA8A 1K8XB 3ONEA 2V0GA 3A04A 3PNKA 4ER5A 5JXIA 1FQKA 3OJFA 2WIJA 1UKZA 4B3XA 4D97A 1KORA 2KS6A 2C7QA 4BRSA 1V2HE 2R8XA 4KKXB 2O9JA 3WMWA 1KL7A 1U1GA 2FSGA 1AURA 2D0IA 3U31A 2NM0A 2RKBA 4Q3CA 4AD8A 2OD7A 4PLTA 4N3GA 4HDRB 1E7QA 3D8HA 2SKDA 2V58A 4U1RA 1A2KC 3DP7A 1QFSA 1NJ6A 1X9HA 2FX5A 3INTA 4DARA 2H1RA 4BNIA 2ENUA 3N0XA 5L3SA 3WJ7A 1RZRD 3U9TA 1HKHA 3OE7D 2I7VA 2AYYA 5IJ9B 2PRYA 4HZGA 1YXMA 3G1WA 1FVOA 3KFLA 3GMDA 2P7IA 5CP8A 4DV0B 1PI3A 3JD2A 4D3XA 2PZEA 3BORA 2UZ1B 2O8FB 5DWQA 4YRTA 1BGWA 3UB2A 3TAUA 3ECAA 4HDNB 3SHWA 4DM7A 4XB1A 5C51B 4U3JB 3NETA 4L8VA 3LO5A 4IL5A 4AN1A 2V6IA 3SOPA 2Y9MB 3AUYA 3G8AA 3VAAA 1VOTA 4W5OA 1J21A 3H0EA 4BMNA 5JAMA 2N1BA 1KZ6A 2GKOA 4RHTA 3T61A 1JHAA 1Q19A 3O2JA 5HOQA 2PRZA 2JBWA 4G0QA 2EXXA 1BX0A 2PQMA 1DVRA 2DUWA 3VU1A 1CY2A 5ILQA 1MB2A 2IC5A 2ZWMA 2WINI 5ALQA 2YWXA 1DAHA 1KBOA 2CVQA 1E4VA 2PS1A 4B32A 4BN4A 1GILA 2CFCA 1IWOA 1YB5A 1ESDA 2D00A 3FIJA 2A1IA 4EO4A 1J49A 4D4IA 1APBA 1MTZA 3HFGA 3PKZA 4M1KA 4OQEA 4J3JA 2JJMA 2EWVA 1H2WA 1Y4DE 3CEJA 5I7RA 1TEVA 3VQTA 2FN8A 1RHKA 5JRDS 3CRRA 4US2R 5LIPA 2P4QA 1NT4A 1LW6E 1S0UA 3N70A 1INLA 1MX5A 3EGXA 3ND9A 3SN6A 4YRIA 3DZKA 3KZCA 3NWPA 4XD2A 2ZBFA 1KFKB 3DTYA 3IUEA 4FI3C 1BWPA 5AHOA 4X65B 1O9BA 1RM3A 3H5AA 4Q3DA 1GAXA 2GJKA 1M8GA 1OR8A 2Y76A 4C0LA 1QHYA 4GKAA 3GJ5A 3A2KA 1NHGA 1Y98A 2W6MA 3K2EA 4I4TA 4C0AC 1I7QB 3TF5A 4GPZA 2Q7XA 2I4MA 4KNYA 1M2EA 3OZTA 1W88A 2AK2A 4GGOA 3W34A 1TCUA 1QHSA 1KH2A 4UQOA 1C1YA 4V3BA 5EHNA 4DCVA 1Y3HA 4E2WA 4Z54A 2E4UA 4ZJUA 1U6IA 1VLHA 3EMVA 5EZSA 3E9QA 4E5MA 2Q5LA 4E31A 4YAOA 4F60A 4QT4A 1Q0PA 1VJ1A 5EKUA 4DILA 4UM9B 2CUTA 1R8XA 2HMSA 4RXUA 1NE7A 1AGPA 2YOHA 3U4DA 5CDSA 1XE3A 1Z22A 4O2AB 3VAYA 5BW6B 3NHWA 1UDXA 3V55A 1GPLA 3FWKA 3QUCA 3AH8A 5AKYA 2J0SA 3GOQA 4MKIA 5DYYA 4IZHA 2W00A 5CVVA 3T9DA 1XDZA 3PNMA 4NK4A 1G6HA 1UBKS 3A9SA 3KSMA 4J0FA 1H65A 2GN9A 5B7GA 4BEWA 4DIEA 5C7YA 1DJOA 3TN7A 3PFIA 3FTPA 3PT9A 4GMXA 4P93A 1F17A 4ZYXA 2NPOA 1FVHA 2WFMA 5KWJA 2AWNA 2QW8A 1NBHA 1BJTA 3EGWA 1VRWA 2O05A 2NQ8A 2Z2IA 3IEPA 4J8PA 4UEOA 4BVLA 2IPMA 2XMQA 4MYHA 3UEOA 5D3MA 1BCSB 3TSWA 5A4AA 3HXQA 3C6QA 1EUCA 4IHQA 4TZ0A 3SKXA 1PS8A 2PHZA 2CB9A 1QHGA 1R4NB 2J9XB 4JP8A 1K8QA 3NDJA 4X7RA 3VSBA 2C5EA 1KQNA 1ADFA 1BW9A 3W8RA 4MAMA 2BEVA 1U7OA 3PHGA 3DVAB 1Y5MA 3DR5A 1OAKA 2DQYA 2GD0A 2H06A 4O0MA 3SZGA 2W2XA 2IHKA 2G72A 3WGHA 2QIPA 5EUMA 3VU8A 4IVNA 1E1KA 4NABA 3QM1A 3EFBA 4XPZA 2CVFA 3F6PA 5CHEA 1LD3A 2EJUA 1TIPA 3H7IA 4FC6A 3ZU6A 2JFOA 1CUEA 2IHYA 4UTOA 3JQAB 2OV2A 2JCXA 4PX5A 1FRZA 3X1ZA 1I1NA 1PWEA 3HYNA 1T9BA 2E21A 3GGPA 4XRRA 1EVZA 4JSYA 4NAHA 5IN5A 4K6MA 1KAHA 3UJCA 1NMZA 4NCXA 4WOPA 1FJHA 1N6OA 4FVTA 2C4NA 5B6IA 4LJ5A 5IKOA 1FZQA 3VSDA 3RJZA 4OHVA 4JI0B 5GINE 3OJCA 4Q4JB 1E8DA 2CXRA 1TYDE 1TIBA 4UUAA 4P3KA 4ER0A 1QIFA 2PWBA 2OLJA 4JGIA 4LA4A 4PSVA 4ZT4A 3UFBA 2H4FA 1W5FA 2J48A 4OJKA 5CJPA 5DLPA 1XF9A 3FUUA 3LLMA 1HM5A 3WISA 4YCCA 2GXAA 4CEIA 5SICE 1D07A 1R8QA 2X13A 5AIBA 2NU7B 4P7FA 1RWXA 4F12A 1G38A 3TINA 4CM1A 4ZVRA 4QG7A 3DMTC 3M4XA 2Z4TA 3HB0A 2O8VA 1W2GA 3IIEA 4MB0A 4WLUA 1SCUA 2ODAA 3TJMA 3DAOA 3OPYB 4F4UA 4PYOA 3OG9A 5KNBA 4Y7DA 1V8FA 4UBIA 2GXQA 1NBOA 1QE5A 1XALA 1VFPA 2J32A 3S99A 1MJGM 4KXNA 1C0IA 1YO6A 3JD1A 1LSOA 2IHVA 2QS9A 4KU4A 3R75A 3ZQUA 1K8YB 1NBIA 2BBSA 5IWCA 5LNK6 1IM2A 4HTFB 3BZWA 4FFOA 3VKUA 5AVRA 4DCNA 2HF2A 1OH5A 3DZCA 4H7PA 1E79A 1DGQA 2BGNA 4IFEA 1E99A 5LSAA 2DWCA 5AESA 5D8DA 2F3TA 3N39C 1JU9A 4KLZA 4YONB 4ZVMA 4Z2YA 3VYTB 3DXZA 4RD6A 4DL9A 4JX9A 3LECA 5BV1A 4RZQA 2NUPA 4ZALA 3ZQKA 2IL1A 1C8LA 1AF4A 3FNRA 4KC0A 4TROA 5AHXA 5D7NA 1EJ2A 1QLHA 2FUG6 2VDJA 5EIOA 4RZIA 3LYLA 3VZPA 2V7WA 3PQ4A 1PFWA 2WT9A 2XMPA 1RHJA 1XZCA 1JDPA 3A14A 4FEYA 2XR1A 5DBOA 2QYHA 3VBCA 5EJ5A 3R0JA 2PA0A 1A98A 1H8EA 3F1KA 1I36A 4LKRA 1VXOA 2R68A 3DBLA 3TZLA 1J7JA 2BFAA 4HEJA 4IUBS 4X62B 2O1XA 4W5WA 3I39X 3O26A 5HF6A 3TRHA 4DCGA 1MH9A 4INZA 4L2IA 1MVNA 4KV7A 5HUHA 4OQZA 1HGXA 3RD5A 4HGYA 4Y9UA 2WWXA 3GBPA 3VO1A 2CJXA 5H82A 1ZD3A 2H2WA 3ZE8A 4TXNA 4B6EA 4B6GA 2HRQA 3R09A 4DQDA 5H4HA 2ZB4A 4C08A 5J4KA 2C4HA 4P2GA 1CIJA 3EWNA 3G7UA 5BQ5A 4EI7A 3OP1A 1KF0A 3DV2A 4HMPA 3VYRB 1SR8A 4OMUA 2J9YB 3G7SA 1XQVA 2X6TA 4QNMA 3RFXA 3GLGE 1KKLA 3UJ6A 1NF3A 1HL3A 1YR3A 3CLVA 6ADHA 4Z8YA 3VPBA 1IEXA 2HI0A 2IEZA 2R6JA 4CM9D 3L7NA 2QROA 4GX2A 4UQLA 2PWYA 3C1OA 1UODA 4KX3A 5ALDA 3C6KA 3T7DA 3D8RA 4IGFA 3A32A 2WPNA 4MV6A 2ZTMA 3B2NA 3D4BA 3EZLA 4WL0A 5BOSB 1YBFA 4Z4CA 3AB3A 4JBXA 5CYGA 1EP9A 3AUTA 4HPXB 4QUHA 4JI8B 3LE8A 3LM8A 1QS0A 2BC9A 2HIAA 3FWPA 4R1NA 4W1SA 3SE0A 3VH2A 1M2GA 1OC2A 1GUAA 3NRBA 1RXVA 1EUDA 1ZESA 2FK8A 4YJ3B 5C31A 3KALA 4QGBA 3ZWCA 4QU0A 4E12A 1A7JA 5I3ZA 1G8FA 2YJ5A 1E9VA 2QNBA 2YRXA 3UGJA 2Q6KA 3DDCA 2X0EA 4KQEA 5F73A 3RSSA 3T0FA 2B9EA 4WH0A 1Q17A 1EZ4A 1T1SA 5B58T 4EG7A 3TTVA 3NHKA 3ROGA 2A84A 1JIXA 4KLRA 4PLVA 4X94A 3U9LA 4U5XA 1ST2A 1TJPB 1MU0A 1TZMA 1CZNA 5L3RA 5I7EA 1DIAA 4MINA 1ZGAA 4QQ8A 1D0VA 5HTKA 5LQKA 4YJFB 2BEUA 3CWZA 4WNAB 3RVBA 1AA6A 1U28A 4WA8A 3CKYA 5HZMA 1U5BB 3WLKX 1CY4A 4RPIA 3HRHA 2XUKA 4HQFA 3RUAA 4EYSA 1OH7A 2CF5A 2QPLA 4KQ9A 1H94A 4A0HA 3HZZA 1P2FA 2RG7A 5IMSA 2KSQA 4JGGA 1IBRA 4D4LA 1DXQA 2AD5A 3PPXA 1G20B 2WTAA 4YUZA 1QK3A 2IOHA 2AOVA 3ER8A 4R1OA 1OXTA 4W8GA 5HMLA 4ITVA 3ZNQA 3IALA 4AT1A 2XOEA 3C1AA 1VBNA 2M98A 3PKJA 5BR1A 3UCXA 3QMWA 3K2BA 3QUAA 1TE2A 5E9QA 2CNKA 1G3UA 4WFIA 3IODA 3JYHA 2YQZA 4IDPA 4RTKA 4EENA 4KQCA 4HH4A 4HGZA 2MU1A 3ZE7A 5DBEX 1JSRA 3IT0A 1BC5A 1ZGZA 4RUKA 3F5DA 4OFXA 1R16A 1N77A 1F60A 4L4SA 3AR5A 5KYYB 1A9XA 4NJMB 4HWPA 5EIBD 3WK5A 5E8RA 4EB0A 5BWBA 1Y3BE 4AYXA 4ZIRB 3IQZA 4F2WA 2G1JA 1R0BA 4ER6A 4EHDA 2H8GA 1U7TA 4CLRA 2F4NA 3K0CA 4TZTA 3STTA 3T06B 4HLCA 4IICA 3EZ6A 3ZPXA 1A3CA 2J5RA 2GZ2A 1T2CA 3H2KA 3H3XA 4YJGA 1A8IA 3B51X 5ECGC 1RMYA 2Q4EA 1BE0A 2Q3BA 3LPAA 2OYCA 3VUFA 4TL8A 1HURA 3JTMA 4M49A 1CE8B 4AUMA 2D1SA 1NY5A 3AM4A 5TVKA 4UJ5A 3CUVA 1G8PA 2ZUUA 3W5VA 1EIZA 3TDKA 3K0FB 3KQQA 3UAXA 4EJSC 4ARZA 5L7TA 2XRZA 1QJCA 4YUXA 4IRXA 5A6SB 4QZVA 1Q0RA 1YF3A 3TFOA 4R9RA 4BEVA 1RQXA 1VKHA 2O23A 2QQEA 4K9PA 5EZYA 4ZVNA 1CVRA 4GBMA 1SK8A 1JPJA 2WKWA 5DPMA 2WUEA 4XUGB 4BFXA 2NYAA 1PNOA 2ACKA 1H4TA 2P11A 1JHXA 3DL2A 3NGXA 2W2TA 4FU0A 4P7JA 4W5QA 4PX9A 3T4EA 4JJAA 3LPNA 4I36A 3N07A 3DBIA 1QGOA 1SCNE 4XGRA 1PR6A 3ETLA 2ZUEA 4IJVA 3ESYA 2E5FA 2XVXA 1Y1SA 3N8KA 3VZDA 3UV7A 3LYHA 3NM4A 3PPYA 4UKDA 3FYCA 3KTOA 4PAGA 3DD1A 4RHFA 1D4AA 1L8LA 4HNSA 5DXAA 5TS2A 3PUXA 4PNZA 1WHSA 3S2EA 1U7UA 2EARA 1V9SA 1JGTA 2WTXA 3F97A 1TFUA 3BKXA 2A94A 3KUUA 1I2ZA 3NOXA 3O4GA 2C8LA 5AI5A 2CGEA 2QMZA 4LGVA 4OM7A 2ZYWX 2ZRHA 2I6XA 3W7VA 4JLBA 3WO0A 3R77A 4DSZA 4WKOA 3ZV3A 4EY8A 2ZIGA 4UFPA 2PSEA 3Q3GE 3HSSA 2ZQZA 3IQEA 4W63A 3NKFA 2ZAMA 2PUHA 2AEMA 1AUXA 3LUPA 4R2XA 3ZW8A 4RKYA 1GFWA 1V1MB 4EL0A 5L7WA 1Y6GA 1ZK3A 4A9AA 4RFSB 1JIVA 4EA9A 1QTIA 1T9DA 2BH2A 4HGQA 2ZTHA 2OHIA 3GGCA 2HSJA 1N78A 4M88A 5CFPA 4NE9A 2SBTA 4JFRA 3VGPA 2B1GA 1V5EA 2OG1A 1UADA 1CK4A 3ZV7A 2Q3HA 3LOQA 3N86A 1KEEB 1O6CA 1PU2A 1G9XA 2Q0HA 3EC2A 4OQNA 4YJHA 1C3OB 3AL3A 3CZPA 1KR5A 3NP9A 1OLSB 1Y7IA 2O4CA 2ZYTX 3D7KA 4LCEA 2I87A 2I62A 1YDHA 3EFEA 4HN9A 4KRGA 1ZIXA 1OFVA 2OV4A 3I01A 4C5BA 4EHKA 1UPBA 2J5BA 2XZOA 2FPXA 3I9OA 4YRAA 1KFBB 2GSWA 1YS1X 4IJMA 4X0EA 1GRVA 2XT6A 2DHDA 2W6JA 2IPAB 3GGOA 3SYRA 4G1BA 2BHNA 3BILA 5EC8A 2OLKA 2V59A 1U0OC 3O74A 3EVFA 1JQJC 2Y77A 2DHRA 3BMNA 4PC7A 2RONA 2LXNA 3LQFA 3WB2A 2P2ZA 2HLNA 4RTLA 3CRW1 3FY4A 4BQEA 2H8KA 5KOYA 2ZIWB 3SSNA 4LRWA 4YHBA 5LD2C 1C0EA 5BYKA 5DI9A 3L7KA 5IK2D 2G77B 4HDAA 3HXMA 3DCYA 3ZCTA 4V1CA 1F4LA 3C3AA 2VQ3A 3O84A 3OPXA 4PGHA 1ADYA 1ZK0A 1G2IA 1PQWA 1DTWB 4X5OA 5FXMA 5I9TA 4CQMD 4D9HA 2IPOA 4EP1A 4KN9S 3ZDAA 2V6MA 3RODA 1U2EA 3WRXA 2PH5A 1RPZA 5ETJA 2ZRNA 2GCIA 1CJBA 1XCBA 1C1XA 4AC9A 2J0UB 1P31A 3PQ8A 2WT8A 1LDMA 3NHYA 4JP3A 4RGQA 4J1NA 4NS1A 3LUGA 1A9SA 3QPWA 3F4KA 4FYWA 4Y6LA 3R7WA 4OHYA 5CB4B 2WLSA 4QBTA 1T3ZA 4LXXA 1J97A 2O0MA 3M81A 1AG9A 4R05A 3ZWOA 1EXDA 1SXJB 2JIOA 3DW1X 1U3TA 3MQ2A 4OHRA 2PXCA 4UBKA 3ZY2A 4M6WA 2HGZA 5HRUA 1Z4KA 1QC5A 3BXGA 1EK1A 3IQDB 3IXLA 5HMMA 2H48A 3ICOA 4UAGA 3JASB 5AM2A 3MJ4A 2OLEA 3AFNA 4L15A 4HVCA 1Z6YA 1H85A 1JU4A 4G37A 5BUZA 4D57A 1X9GA 3Q2KA 4DY6A 3WDMA 1M1YA 1L5YA 1AH2A 1PGPA 4MVXA 1TTPB 1I7LA 1O08A 1XWIA 3L79A 1H4VB 2VRCA 4ENRA 4D8XA 4ZYWA 1C80A 2VBFA 1FFDA 3EXHB 2Q3DA 2CHQA 4P1ZA 5EHXA 2XAUA 3MOSA 4UM7A 5ERXA 4O5AA 4TSFD 2AI1A 4ZU6X 4DLWA 4CMJA 3QVJA 3M5PA 3MRXA 5DZSA 3U5TA 2P9GA 1N92A 1XLTC 1ZSNA 1RT9A 1W0CA 4UBLA 3PJFA 1YB2A 3EVAA 2FF7A 3LZDA 1UC9A 2PMWB 2H1FA 2WJ4A 5ES4B 5HGJA 1E94E 3S2YA 1GNLA 3K9BA 2HNKA 3T3HA 4TRRA 5FWNA 1J7KA 3JPWA 4IIDA 2Z1MA 1F6WA 5ADWA 2F6RA 2RHGB 5HWSA 1YA8A 5LLDA 3NO4A 1DO8A 1Q1AA 3Q6NA 4UEWA 2HF7A 4LOHA 1FNNA 3AF6A 3QEAZ 1U8ZA 3F7MA 4R16A 2D5BA 2QAJA 1YJAA 4IF4A 4MW1A 2FLKA 1MEEA 2CCGA 3FZEA 1PHPA 3KUCA 1DAPA 3DZHA 4G23A 4X7PA 2GR9A 5FBHA 5K3FA 1RRGA 3OLCX 4DFDA 6NULA 3G2IA 3L4BC 3TRJA 1OAOA 1FTQA 2R7LA 4FTWA 4U6QA 2PKRA 2VHUA 1P73A 2VPTA 3K9HA 4JA2A 4YP0A 5JO9A 2WICA 3M4ZA 2AOUB 2YXPX 3OKFA 3PUVA 4MARA 2RAFA 3WBJA 4E1BA 5I8PA 3R0ZA 1IPFA 1LRJA 4S1OA 5FUXA 5JDIC 2KLBA 2L19A 5G0UA 5JYBA 1N6PA 3MTGA 5GMOA 3DBOB 4G0YA 3UB4A 4OUKX 1FP4A 2AJLI 1DWOA 2HHCA 2ZCUA 3OU2A 2YKGA 1I2BA 3LLCA 2A9VA 5EE5B 4Y9SA 1PGOA 2N0SA 1S7CA 2ZVPX 4ZCQA 5J63A 1DO2A 1VE5A 1E3TA 2CUZA 3JZAA 3N0TA 4PIMA 2HMVA 2Y68A 4M36A 3RC3A 2ZWAA 3R3SA 3EDOA 2D3WA 1AQIA 3FTDA 5L45A 4RH0A 4EGQA 4R98A 3ZE0B 4B1FA 4D0NA 3NXSA 4MYCA 5GJBA 1O57A 3THXA 5F9MA 3HJHA 4GZ5A 5EJFA 1GGHA 2C4WA 4B3IA 3ZGXA 3L46A 5FLXA 3QG1A 1UZMA 4YIKA 2XYVA 3E7PA 4CEHB 3SZLA 3WNDA 2DC1A 2JEZA 3QI2A 4KSBA 4O2BF 4WOBA 3U0BA 4OB8A 4XAQA 2OXCA 3ZV6A 1KAOA 4LXIA 3ONWA 1E3IA 1BXZA 3I6BA 5H68A 3EWAA 2XF2A 4M9SA 1Y8QA 2JG3A 1DU4A 1Q50A 1UJBA 5TXGA 1ML4A 2DM6A 3H5WA 3T7CA 2JGKA 1MIOA 1W4CA 3KJZA 1EB8A 4KG7A 1OFHA 4X24A 1YZFA 3L82B 2E85A 5T67A 4AM8A 4AJ1A 1JLMA 1KP2A 4EI9A 1GN8A 2WRZA 3NR2A 3T3DA 3W5DA 3WL7A 1SVUA 1EDOA 2H54A 1KI9A 2WFZA 1DCMA 3MTBA 4FWBA 2BCGY 4TUYA 1CBUA 1OI2A 1RAIA 2DY0A 2G82A 1AVTA 3E5NA 5CLHA 4PYRA 3E05A 4ZP1A 3V80A 1GYQA 3WGGA 2GM5A 1RMTA 3GBSA 4WECA 4B8YA 4D4GA 4O4LA 4X1KA 5CD1A 3KDAA 3WA6A 4BBZA 2JFFA 2PUEA 2DFTA 2HWUA 2JARA 5KVSA 5L4SA 2P5SA 2ZKIA 3SFVA 4M2LA 1LPOA 2JAPA 3IOCA 4UW9A 1L5WA 5LXTA 2CEAA 4JMLA 2VXYA 2BMJA 3C5EA 1FTSA 3DBRA 4GX0A 5ELLA 4GYKA 1OFIA 2G76A 2QZSA 1XPJA 4R9VA 3CZ4A 1MJHA 4OI1A 3WGNA 2ZIEA 2PZFA 4DLXA 3O8OA 2WUVA 1EWRA 3PNQA 4DWOA 4EM6A 5KJFA 3O8BA 1JKXA 1JHOA 4C4SA 4OQQA 2F8MA 3OZRA 1F0PA 1LK0A 1GT91 4TTVA 1QIKA 4LN1A 4KVAA 4I55B 2AOXA 2G63A 3W79A 4C4XA 5KQSA 1E64A 1FDSA 3CM0A 3GI1A 2QRGA 3MBIA 3GW8A 2HT1A 3ADOA 2XMDA 4MLPA 4S0XA 1FUUA 1FXWF 3Q1LA 4IIVA 1UDBA 4JITA 2VHCA 4JVNA 1YR2A 3WK8A 3UMSA 2WYVA 5H70A 3FHOA 5D2CA 3BTSA 3KRTA 5CH5A 5HJEA 2IZ0A 3BSSA 2O8DA 5BXYA 2QTCA 1CNFA 1YJXA 2CMKA 3EUFA 3I9LA 8ADHA 3D4OA 4D82A 3DZGA 3KAKA 1TM7E 3OLWA 5B3KA 3HUDA 3RKRA 3EASA 5L3SB 5E6RA 4K3UA 1SZCA 2A3NA 1DINA 3CLUC 4Q0MA 4PZCA 4PN7A 2DXIA 3STVA 4RFVA 4KV9A 3GP5A 1VSTA 4E32A 2I66A 5ANRB 2IT1A 4NFLA 3ZHBA 4A26A 4GICA 3GRZA 4NATA 5H81A 3DHNA 4DEVA 4BPBA 4BZPA 1TLLA 3F5FA 3PENA 2AF3C 3JCZA 2QG6A 1U90A 3H5IA 5BN4A 4RTRA 3AEUA 5KNBD 1X1EA 3O75A 4PBRA 3OCYA 4F8EA 3NALA 4X1IA 4GQAA 3EIHA 1OI3A 4YB8A 2YVQA 1W87A 3G8CA 3NVDA 2IGTA 3P97A 2X0DA 1LBHA 1HZJA 3HH8A 1GM5A 1N5RA 3ZWPA 2DB3A 4IHAA 4F46A 2BLLA 3IAFA 1VHTA 4PC3A 4X71A 5CDYA 4OCZA 3TAXA 1A8HA 1EH5A 1BHQ1 2RSLA 1Q91A 4NZOA 4AMBA 1E79D 3QA3E 4DIOA 3SVZA 2OB1A 1GXSA 1P5JA 3A6ZA 3TNJA 2I3ZA 1GNQA 2BF7A 4Z6KA 4WV3A 3VNBA 2IS6A 2O20A 4HB3A 3HEBA 2W6CX 4OJYA 3L1JA 1E5QA 2ZUBA 4OKNA 5FBRB 2KW5A 3KIPA 3W5IA 2P9JA 2UKDA 1V3QE 1J8YF 2ZIFA 3E84A 2NO4A 4FYYA 4JR2A 1V6CA 4Q1DA 3T4PA 3RS4A 3BQMB 3DT6A 1K5GA 1A72A 1NI4A 2HJ9A 2FMUA 2QENA 3B9BA 3UJ8A 1M6YA 2R1VA 4JZKA 4BRUA 2C0QA 4UNRA 1HKUA 1CETA 1H23A 1RWBA 3D3KA 4DLRA 5LKAA 2VYQA 2PLRA 3PJEA 4FWTA 4DB2A 2CJWA 4W82A 1DC5A 1G42A 2OEPA 2RH4A 4XQGA 4ES6A 4YY3B 4RXTA 1JEAA 3NGLA 1C3EA 3A05A 1M0WA 3TSOA 4KRYA 5JS1A 1W0JD 3IBCA 1J07A 1UPCA 3FCCA 5T8KA 3SLGA 3VTZA 3STWA 5CAEB 3QKRA 5EPOA 3DZDA 3IDZA 1EX6A 4OHZA 3MCZA 4B0PA 3M1IA 4N0PA 3R0IA 3KZNA 1PTKA 2YR0A 1P19A 2X41A 1W88B 4RHXA 3LV8A 4MO9A 4D3FA 2TMDA 3ME5A 2AFVA 1RLUA 3DLBA 1GY8A 4OQ4A 1XFAA 1YS9A 1D6NA 1H9AA 1V3VA 4ZT6A 4Y67A 1E7RA 2E4YA 4RY9A 4NOKA 2GMWA 3UXMA 5CA1F 5GZ3A 2OKCA 2QYOA 1I5EA 1YE5A 4C78A 1DQZA 1Z73A 3FUCA 2CLDX 3JZMA 4LWPA 5DLDA 2DH6A 5A3SA 2MSWA 3W6NA 3MVEA 2ZM5A 3LRPA 3PC2A 4XYGA 1XQWA 3BD8A 4ZT3A 1VIYA 2XCQA 2IYVA 3VOSA 1WXQA 4UTPA 1A9PA 1V47A 5G02A 1QF9A 4DJ5X 2FEMA 2ZRPA 4OXXA 5EFOA 3ONVA 3CVOA 1TKCA 5IM4A 1DPGA 3H9UA 1N2HA 4NBUA 4DREA 4YV1A 4QE3A 5JXGA 1LDYA 1RM0A 2GM9A 3CF4G 3Q3HA 2ZUFA 3PSAA 4M1TA 1B1AA 6YASA 4JV5B 4FSHA 3PRYA 4FXPA 3IILA 3L6BA 2GILA 3LWNA 4G4SO 5JPCA 4AIIA 3VR6H 3AVOA 1JJ7A 1ONBA 5D3MB 4LE2A 2Q5FA 1QX3A 2JEYA 4PQEA 4XD7D 4A10A 3U60B 2P78A 2FW1A 1V43A 1VIMA 3PQFA 4HY3A 1XUOA 2ECOA 3PNYA 3F6YA 3C8ZA 4TTQA 3IAUA 3PC4A 3R7DA 3V1LA 2M6RA 3B89A 3GFVA 2Q3MA 4WY8A 2BWJA 1BW9B 3CUYA 1OV6A 2YHIA 1TPYA 2BEVB 3WE7A 1ZM7A 3ZZUA 2PR2A 1K4MA 5EUQB 4F3TA 1N5MA 1J99A 4XUCA 3PNBA 3E27A 3PEWA 3OZIA 4OLHA 4DV7B 1TU4A 1UKBA 3LYUA 1YHZA 1Z47A 3C98A 3L43A 1DC8A 5H1YA 4IYRA 4NX2A 1V7PC 1MV8A 3SFZA 2DQSA 2QT0A 2BUAA 5B3AA 5KTSA 5FLEX 1HDCA 2PGOA 1VI6A 2PT9A 3AUXA 4RK5A 3WKDA 5CFNA 3L8FA 3AR9A 4ND6A 4Z0TA 4EH1A 1EM8A 2OZLA 3CSSA 3J80A 2HK6A 1GQYA 2W2PA 3D6UA 1JT9A 5JBIA 2QDKA 1WU7A 3DOUA 4PAMA 3AL0C 1BMDA 4CG0A 4Q1EA 3MWJA 3RABA 1JKJA 4G01B 1BEEA 4NXMB 5ALPA 3UCEA 1JPVA 2K4MA 5CT5A 1I4TD 3NS7A 4FEEA 2RB4A 1XEWX 4WW0A 5JWHA 3JD0A 4CLXA 3BHIA 1KXJA 1C3XA 1XBTA 2R1TB 1PNVA 4C07A 1X2EA 2B2NA 4NI5A 4X97A 4QM6A 2M32A 4ILEA 4Q24A 4LZWA 1XTVA 2R00A 3A9CA 1E5VA 2HDOA 3JQ6A 3P4YA 4L76A 4FYJA 1FS5A 4MR9A 4H16A 5CPFA 1OFUA 5ELXA 1BN6A 1PL0A 2PGLA 1V5GA 5B1YA 1ULAA 2A0XA 2G4LA 2OD9A 2CHFA 1GLVA 1GNVA 1GDDA 4XVHA 1PN3A 2F7SA 2JB9A 3OMLA 1RQ7A 3W7BA 1Y9AA 2IVZA 2VJQA 2ZI4A 4AG6A 3M0EA 4CDMA 5DNAA 1CB7A 1COWD 1L4GA 3PGJA 4RZ2A 4DC0A 1G5TA 1C8VB 2HA7A 4ZN6A 3L8MA 3SZMA 4Z5XA 2REOA 4J2OA 1JDSA 1U0GA 3TG2A 5IULC 5AI6A 1X7DA 1BJKA 1ZIPA 1I0ZA 3G2LA 3RAPR 3R76A 2G9VA 1XDBA 5AUPB 2E4XA 5DNVA 3J81A 2JA1A 4W5HA 4WK2B 1PS9A 1U1CA 1OI7A 4MROA 2D1QA 3GG9A 5CXSA 1AHIA 4Z3KA 1NUQA 3MT0A 3WK6A 3ENZA 3K8OE 1SUCA 4Y2JA 1UANA 1X38A 2VNHA 3OZWA 3JY6A 4IZIA 4LRXA 4QUGA 2AKAB 1IY8A 2WU0A 3CZ9A 5ECDA 2EJCA 3EBLA 1CHNA 2O7RA 3PR1A 4HADA 1XDUA 1T3TA 5C7LO 1MO2A 1AUPA 4BLSA 4L2IB 2IHNA 3KWJA 4E11A 5IX8A 4CF3A 4D81A 3PE6A 4RY8A 2PX8A 4QFDA 5ALKA 2GPSA 1DAKA 5K0EA 4P5PA 1L9KA 1NVUQ 2P62A 3RFCA 1F8FA 2QD5A 1CB0A 2B21A 3EZXA 4X7BA 2A5GA 3ZHXA 1J20A 1HH4A 5DWDA 5I48A 1PR2A 2WJAA 3TR0A 4EPXA 3PNLA 4MH0R 4YAIA 3WWDA 3M6FA 2GZHA 4D4MA 1JG6A 1FUIA 1OWPA 1JSZA 1SH7A 3V4FA 3FTFA 3KWMA 3UGKA 2GAAA 4TTAA 2O0HA 5BWCA 4O2RA 2OAQ1 3PA8A 3D6NB 3E2IA 3M8KA 2OBNA 4D9MA 3DEJA 3TBKA 4JENA 2XNCA 1ZD9A 1NRJB 2ON6A 4AF7A 2RGBA 3UK6A 4RVUA 4XGQA 4PR3A 1EUDB 3C6ZA 2J6IA 2NXNA 5JVDA 1U2TA 1J09A 5E2AA 3HVHA 4IQ4A 1GPWB 3S3TA 3A11A 5EJ6A 1YU6A 4EPRA 4V38A 3BDAA 1WY5A 3JQPA 1Q84A 4L22A 2Z1DA 1P0CA 4J0JA 2VF8A 1VXRA 1VCNA 4MUGA 3AHIA 3DB2A 4N0EA 3KYDA 4HPJB 5IC6A 1P0IA 4UOZA 1QONA 2DFVA 3REOA 2BMDA 2Y1CA 3KEQA 2RGNA 3EODA 1A77A 1SUFA 1YT5A 2Q5JA 2XCOA 4G5SA 5KYUA 5EERA 3ZK7A 5FPTA 4AJ2A 2A67A 2ZITA 2QUKA 4E7PA 5KTOA 4ZV7A 1N0WA 2IU3A 4QTYA 4EBFA 4A36A 5JSQA 2FG7C 4W6ZA 4BX2A 2BEUB 2WIKA 4FKBA 4V24A 3KQUA 4BNJA 3FPHA 2YY6A 2Z5LA 5EMJA 3UPDA 1LU9A 5ALIA 1FNMA 4MS4A 1MZPA 4CTOA 1RM5A 4KQ2A 2ZJ4A 3QVMA 1IEQA 4OB7A 3A6EA 5A3JA 1PBNA 6LDHA 4GHWA 3T34A 3B6EA 1KU6A 3PC3A 2YZMA 5DCYA 4Q6WA 5ELMA 4E3ZA 2W71A 5K3EA 1DKUA 3EEYA 3OQOA 1EWQA 3EC1A 1KZGB 2OHVA 4I50A 2JLQA 4ND2A 2FPRA 2HV8A 3R2JA 5FHRA 2Y0DA 2OHJA 1Z39A 1TYZA 3VR3A 1CC1S 5ERYA 1N2GA 4BB9A 2ZK7A 3QIAA 1F8YA 1K7XB 3GDOA 2WI8A 5KVAA 1H05A 3GU3A 3QKSA 1NKTA 1MC5A 3OTOB 3X0DA 3PC8C 5HEKA 3M6WA 4BFVA 1D8TA 1G7SA 3DA8A 4CTKA 5JV5A 1A9OA 3K1YA 2WFLA 4QRDA 3RYHA 3U4HA 4K1LA 3SQLA 4AMYA 2OL4A 1QP7A 5IVIA 3H5OA 3A4MA 1QR6A 4K0RA 3EUWA 4N7BA 3OTGA 4K9RA 1Z07A 1Z5NA 2VJNA 3A6FA 3BERA 3NNSA 1ZVJA 4JJFA 2VQFB 4H7EA 1I9GA 3CLTD 1VRCA 2XYPA 5EIFA 4CLRB 2FEAA 3IRVA 5JJ5A 2D6FA 5KWEA 5CDTA 5JW6A 2JZOA 4YJGB 5ALWA 1XN1A 3C5VA 4CIDA 3OCWA 4D5EA 2NOAA 2A57A 4MR8A 3ED5A 4Y2UA 3OCCA 1JYFA 1AGYA 4OM8A 5CA0F 3I04M 4I9HA 5TF0A 2FV8A 4UPDA 2Y0BA 3E4CA 2OCKA 1L7EA 2VAPA 3ZHZA 2DOKA 5E4FA 2ATIA 2G71A 4RIGA 3BIOA 2QMOA 1P1FA 2PX4A 2HKIA 4GC9A 3TTXA 4EAAA 5FV4A 2B4KA 2ST1A 5AK5A 2EDCA 3V4VB 3HU1A 3JSAA 2BCJQ 2X2PA 4ZAFA 1IYZA 4RBNA 1VCHA 1GPDG 1Q1ZA 4ND5A 1N0HA 3RUIA 1U9YA 3SIRA 3MUOA 2FMTA 1Y5IA 1TF7A 1UPXA 3JYQA 2ODWA 5HX7A 3WQBA 3WIEA 2TMKA 2DPHA 3KJIA 4ZGWA 3NRCA 1AZWA 4Q39A 2NVOA 2PSJA 2Q4BA 4EWLA 3OQJA 4B5LA 3IEMA 4ENQA 3NTUA 4HKTA 3EAQA 3TCXB 1WHSB 2CXPA 1Z7EA 2GPYA 3ZIAD 2WSSA 3BAZA 2BEKA 4DCJA 1CY7A 2X7HA 2EC5A 3PGVA 2RGUA 1LJ8A 2BGRA 3EWSA 4JJ8A 1ONPA 1SUEA 3A70A 5DXFA 4IM7A 4FGLA 2QZ4A 5HCIA 1USVA 4MQLA 4RD4A 4B4KA 1FBTA 3JQ8A 3P9ZA 1IFXA 1VSBA 4H27A 3GX1A 3NOVA 2CHGA 3QP9A 1XTUA 4G0NA 4WBSA 4ALLA 5KX5B 4FFLA 1FXUA 4YTEA 2YZ7A 3KKMA 3NIBA 1AS3A 3RIHA 2DT8A 2FSVC 4DRXA 4GXTA 1GQ2A 4GXQA 1G8SA 1JBEA 1HLGA 2WJWA 4NU6A 5K1ZA 5JAUA 4OX9Y 1BDMA 4H77A 5BRJA 4QSHA 2JD1A 2CLHB 1ZSVA 3HJUA 2MYUA 3B12A 3BDVA 5BMVA 2HRBA 3A3OA 1LVGA 1RVV1 3M34A 5DIFA 2A9JA 4R54A 1ZGCA 4B85A 1M5RA 3W4IA 1JTVA 3VFDA 1Q7EA 3SFTA 1E4EA 5IF9A 1J24A 5LB4A 3IBSA 2WUFA 4WCDA 1XZ8A 1JU3A 1B42A 1ORHA 3IP9A 2PVPA 2QAGC 2X40A 1UXJA 1QZ3A 2D4HA 2Q6TA 3O82A 4TRJA 5A5VA 4HUJA 1JL3A 1XTBA 3OPVA 3QFSA 5DCLA 3S55A 3WZ2A 5IXJA 3U19A 1MJGA 2MR6A 2RGWA 5B58C 4MHTA 1IBKB 1EFPA 1EG7A 4XRGA 2KMLA 1MX9A 3DG9A 4DIDA 1VL8A 1XG5A 1VZ3A 1Z38A 5DN6A 4TMTA 5K0TA 1L4MA 3LFTA 4XQ0A 5J47A 3A0RB 2RJOA 2ZTVA 3OZ7A 2GH1A 2C7VA 3RK1A 3WMGA 1LTKA 5GQSA 3HJNA 2BKLA 1XMPA 4GM1A 4NY1A 4EY5A 1CUGA 2DZDA 4Q02A 1IZ9A 1Z6AA 2JFYA 2RHMA 1G64A 3E70C 2BHTA 1A8QA 3GFOA 1M8KA 3DKVA 4PRLA 2E1PA 2PUTA 4KYUA 2V7GA 5E3IA 3UHFA 4HVTA 5KAMA 4UTVA 5KMGA 2WHYA 4EGJA 3RUEA 3CVWA 1KBQA 2I99A 1CW2B 1I3NA 2PNFA 3GZ4A 3X43A 3NDRA 5K2MA 1L9XA 2XTZA 5HDBB 1V1RA 2R8EA 4EEXA 2OHFA 2P91A 3CPEA 1YVUA 2I55A 3C41J 4NFSA 5DM2A 5DW3A 3BXXA 1C1XB 2PZBA 3MXTA 4FR2A 2X1HA 3DLPX 2W2LA 1NAHA 3I05A 4LXTA 1U0LA 3I32A 5DV9A 5PGMA 3S1LA 1SBYA 2P1DA 5KVCA 4IKEA 3R7WB 3QFCA 4CM3A 5A3QA 3HKDB 1MIHA 4OBBA 2JAUA 2NZ8A 4QDJA 4Q9JA 3AEZA 3FNIA 3GUVA 5CVUA 3T7KA 1FJGB 2G70A 1LS1A 1WF3A 3QXGA 1P9LA 1KQGA 2E49A 2Y1GA 5FKJA 3VR4D 1RJFA 1WO8A 4M6WB 2H7CA 4U6NA 3SQOA 3PFWO 4LSMA 5EMLA 3U80A 3CH4B 5JJCA 1CLEA 2VHYA 3EHDA 4UXJA 2I9PA 4D26A 2PWZA 1PX2A 1DTEA 1QG0A 3TOSA 4WIAA 4F1JA 3F3YA 3X1KA 4W5RA 4M1YA 4M0DA 4IIXA 4MWSA 2RH8A 4Y6PA 1M1YB 3QLUC 4N65A 2BMAA 1EPUA 2KBFA 1U5CA 3AESA 1WTCA 4WCFC 4DLZA 1W6UA 1OT3A 4B4UA 5BORA 4N82A 4CF5A 1XPOA 5G1PA 3NB0A 3WLAA 4NCJA 5EY5B 1G2QA 3SR4A 1VP3A 3WBFA 1CQIA 3TUZC 4WGFA 3ZZMA 2X5JO 3FB1A 4IMRA 2G08A 3KUXA 5JPDA 3N1UA 2WUDA 4DMHA 4JLKA 4A8JA 3MERA 4I4IA 2H16A 4EKGA 4WGGA 1C8BA 1G8JA 4IUCS 3BYZA 4IIYA 3RSLA 4BNZA 4FW8A 2XJ4A 1UBJS 1SD1A 3PWKA 3DL7A 2SKEA 4QUIA 4P3YA 2DPMA 5CNMA 3R6WA 2JCGA 4DF3A 10MHA 4UATA 4G0MA 2UYQA 4NV3A 3Q3JB 1LBTA 5I7VA 4QOSA 5M3BA 1SJ9A 1YRWA 2C20A 3B9QA 3OLYA 5CM9C 5LQDA 5E6UB 4RTSA 4DTIA 5K3FB 1QF6A 3A1FA 3KQSA 4YAKA 1XTQA 2R1ZA 1IE3A 4MW5A 3H4MA 2C99A 4IHJB 4QD3A 4C6HA 3QVXA 1NMEA 2ZWOA 3QVSA 4KBYA 3ELBA 2P5UA 1XJWA 1SOMA 1KI3A 2HPAA 3EZFA 4AXBA 2RIRA 1QO7A 4C88A 1XCLA 1YACA 2H4YA 4S2UA 2BZSA 3H9EO 1UIMA 4QL3A 5KKAA 1Z0AA 3LUAA 4QEZA 4I19A 4WFJA 1L5LA 1DT5A 1IHOA 1HDOA 1FP4B 3JVEA 4AJ9A 4EK9A 1E2NA 5JSHA 4G85A 3ZTWA 1XTZA 2EGHA 5LN1A 1NGSA 3MEQA 4JC0A 1P2UA 3ZUPA 2IBTA 2AG8A 2C4KA 1EU1A 3ABSB 5LQSA 1YUNA 3A3NA 3QZUA 1GPKA 2AFHA 2D5IA 1C0LA 4FJ2A 2GF0A 5JFTA 4EUNA 1QGZA 3THXB 4RD1A 3U4MA 3MTEA 1BCRA 1EI9A 4OP3A 4RV4A 2OMEA 4TYQA 4PZ0A 5DHQA 5JG7A 3RFUA 1HETA 3A2MA 4DM4A 2BRUC 1QAOA 3KJXA 4UCFA 3T35A 5KC9A 4RESA 3EZ9A 1CUXA 2AG5A 1UOOA 5TPWB 5DKFA 1P7CA 1EG2A 3L01A 2IYLD 3OI7A 3VUEA 5J2UA 4P36A 1P6XA 3IPXA 1E6WA 2BBOA 2VTBB 4YLEA 1WPQA 2ZR7A 3WSVA 3WGYA 1T2UA 4GI1A 5DGTA 3A9VA 4F4HA 2CY0A 3PXUA 4W4TA 2C7RA 1QQBA 1A8UA 5P8WA 5CXUA 4ZAVA 1MIOB 3LFHA 5DVZA 4D1YA 3UYKA 3JVDA 3EDQA 5AM0A 5BN5B 4OREX 1EGVB 4MUJA 4BO3A 1NJ1A 1XP8A 4FEGA 5H16A 3INNA 3TVTA 4Z1MD 3S81A 4FYHA 3NH9A 4TTRA 4QUBA 3QPCA 5JARA 2VTKA 2JGIA 3L0IB 4TUYB 4EUHA 2C5SA 1QQ7A 3ROEA 2PVCA 4PE5B 2JNWA 1USWA 1R64A 1R4ZA 2JBHA 2QXTA 1O2DA 2WVAA 5LZ8A 1P4JA 3S1SA 1VLLA 4MV3A 3S8EA 4MWTA 3NKLA 3TR5A 1JSCA 1RSZA 2QE6A 1L5HA 1W36C 2WKPA 2XSZA 4O4JA 3UUWA 1HQDA 4MKHA 3C4JA 3IB3A 3OIYA 2JHAA 4AZVA 4Y0VA 3O8RA 2QZ9A 3CKLA 4DG8A 3JU3A 1ISIA 2RHBA 2CFIA 2PZGA 1KDZA 3E3LA 3TL3A 5AKXA 5BSEA 3I92A 5JC8A 1C1DA 2VQEB 1X39A 1H69A 3NTVA 5C8DA 3Q1KA 2IFTA 3NWJA 2R8RA 3IFSA 3DFMA 4HLUC 3BE8A 2P35A 5F1YA 1K6JA 1XKLA 3DZJA 1ZG3A 3I83A 4D2IA 4MVJG 1VHLA 4ER7A 2X9LA 3WQSB 4NOJA 1P9NA 3CWQA 1DBIA 2IUSA 1UXOA 3DDUA 3MRTA 4F2GA 3C7KA 2XB8A 4C3OB 3DO6A 1PK7A 5IWAB 3AIKA 5L8VA 2O8DB 5DBFA 5JZBA 1SHZA 4DKXA 4FD2A 2X3UA 3C5WP 1RRMA 3FRIA 4BB6A 4EHIA 4DQVA 2G9RA 4LF4B 2AHRA 3OLQA 3UFXA 4MX8A 4XVQA 5J4YA 5DGXA 1E61A 3QQPA 2UUAB 1P77A 3PXAA 3ZWBA 3N7AA 4PEVA 4AZ0A 4L4YA 1TB4A 4JXXA 4UUQA 4PG5A 3DZ8A 1O89A 2AJ8A 2GARA 5GV7A 2J3IA 2AEJA 1KE1A 5C5EA 1HRKA 4NBSA 4Q3NA 1MP0A 4MK4A 3KOWA 1P3JA 4FI3F 2NNWB 4TKUB 4TZKA 5IEBA 5A0VA 3K9CA 3RWBA 2V3WA 2IE8A 3D2BA 1Z33A 4AJPA 1UQRA 4V0OA 2WAMA 3E2MA 1BFDA 1U02A 4TTSA 2QM3A 2VYCA 3H5RA 3ML1A 4QULA 4TS4A 4U2DA 2P5TB 5BN4B 2JLZA 4RMJA 1GRQA 4B75A 3GNTA 4KO1S 4X1IB 2G83A 3R5HA 3AR3A 2Q4TA 5DGHA 1RQGA 4NEHB 2NX2A 1RRKA 1ACJA 3OOHA 5ADVA 4MB2A 5L9AA 3WB9A 3FA2A 1GXSB 2VDRB 3U81A 4MVJM 4EMUA 3KELA 2CL0X 2IYOA 1OXVA 4ND3A 4DE5A 2GA9A 1JR3A 2QMQA 5JAIA 3G5LA 3F71A 5LP6C 4N9WA 1O7JA 1D1QA 1H2XA 1EWKA 1NXTA 1YOBA 3LLSA 1PX0A 2QX4A 3KTAA 1T0JB 2NLOA 1NI4B 2XDQA 5KYGA 2XRYA 3ILSA 2YVUA 4Y7CA 4ZV9A 2FWRA 1K66A 4ZD6A 4CTMA 3FXAA 2FQXA 1CUYA 2E0IA 3G2HA 2X5NA 4X6XA 5DTIA 2Q1YA 1WM1A 2XUOA 2Q4DA 4WY5A 2YV4A 2GHRA 2FUEA 1DUVG 4P83A 3ND5A 2WEKA 4FWIB 4I1OA 1JWLA 2P3LA 2QZZA 3L06A 1ZN7A 2HMWA 2PZLA 4ZEOA 5EMHA 2VPZA 3K70D 1Y3DE 4X61A 3B52X 3C70A 4QX6A 2F1JA 4LHWA 2VAXA 2IXDA 3GROA 1FK8A 1WCV1 5K8UA 1YRYE 5IDWA 1FU4A 2B2CA 3CG4A 1OASA 3PNVA 1CPYA 1I6KA 1NKSA 1SM4A 3TB6A 4OU5A 7AT1A 2ZBUA 3F6CA 1H6BA 1FUKA 1GUYA 4QICA 2ZJ5A 2OOKA 1THTA 4P80A 3RFTA 3OQNA 1NVVQ 3VMMA 1G21A 1BDHA 3NBAA 4H6WA 3AYZB 2BGTA 4TMKA 2ZPTX 1Q22A 4FJ0A 5CYPA 3IKLA 4AQDA 4FMBB 4FFNA 4RS4A 3UXHA 2R47A 1CDZA 2JVKA 4OYHA 4ZXPA 3HY6A 5F35A 1NG9A 4JL8A 1P2VA 1QB7A 2REXB 3DOIA 4WASA 1HE5A 3EC7A 4BB5A 4D6YA 1YB1A 1OFUX 2DE0X 4DUPA 3V8VA 1SZJG 2FFJA 4G8BA 1AX9A 3AT1A 2A1TS 3PGMA 4H15A 4NOMA 1CS0A 2VSFA 1PCXA 4PFJA 1AE1A 2C2ZA 1IHYA 1H1TA 3WRVA 3BTOA 4N7RA 1RACA 3D7SA 5EQJB 3ZUGA 1TZCA 4WFKA 1L1EA 3AM3A 3LWDA 5JS8A 3WYGA 5CNIA 3WHPA 2UZ4A 3IUJA 3AHDA 3IPRA 3FUWA 3OFNA 3DEKA 1QV7A 2LIVA 1Q7BA 1P17A 1NBME 5AQ1A 2GZ3A 2WJZB 4I3GA 2X58A 4KFTA 1C30A 2ZJFA 1B8PA 4UU7A 4W7SA 3T5BA 5HQ3A 5ITZA 1HG0A 2PVSA 4ZREA 3D64A 5EP3A 5B1DA 3DKPA 4IUYA 4BZWA 4D0LB 1PJTA 2BZ1A 1LFDB 2IIPA 5BYJA 5J4VA 3HHEA 1JKFA 2CDNA 4ZQGA 4AFNA 1MDFA 3P2MA 3R6GA 4RYDA 4TTIA 4H2DA 4M9ZA 1LEHA 3MWDA 2HJGA 1OPXA 4WJKB 5WRFA 1DXOA 5EXXA 5DEOA 1QHFA 3A3YA 3UMFA 4GVXA 2EV9A 2PA3A 4R2HA 4LGYA 5BW8A 5G3YA 5JJBA 2ZZKA 3PI6A 3H05A 1RAHA 2V45A 2CLOB 2ISQA 3DE5X 3GMSA 4OHCA 3B2EA 3N5CA 3TG8A 3S7ZA 3H42B 2AXQA 3A58B 1LLDA 1AV6A 2EFJA 4QPJC 2Q9CA 2ZFUA 5ITWA 4BL5A 1GSIA 2J59A 2DR3A 2C5FA 2HO4A 3PEEA 3VR3D 2E5LB 4YHHB 4DV6B 2FRDC 4IYJA 3RFVA 3HGMA 3H2JA 1C9EA 1MFZA 4MRMB 3MAAC 4AXXA 1VYHA 4P86A 2GB4A 3WWEA 2AV6A 1UXIA 7YASA 4I1YA 4OXQA 3G5UA 4ZGGA 4HUQA 1HT3A 3P9IA 4F4IA 3ESXA 2CHEA 3QEJA 4IIFA 2QN9A 4AIRA 2PT6A 1UDAA 2ZBRA 3WI7A 1XRMA 4RM2A 3SP1A 5KTYA 4RVDA 4U0JA 1TJ4A 1JKJB 3UW3A 3BL6A 3W2HA 4PZUA 3CH5A 1S4QA 1RJGA 1VKRA 1YCFA 2BTQB 4L8WB 1TI7A 3DBVO 4KAAA 4WCVA 1EQ2A 3RAJA 2VDVE 2VTEA 1VM6A 2PX3A 4A8HA 3SAJA 2C8VA 4JN6B 3L7JA 4JBHA 3LQ4A 4ZCPA 2BKXA 4D56A 5GVSA 2PV0A 2QJWA 1UOPA 4J7AA 4MR9B 4EO9A 2A6PA 2YDYA 3KOYA 1VPWA 3LJKA 1ULUA 5JO0A 4IGIA 1CIVA 3HB1A 1QFMA 1HDZA 1UINA 1DDGA 2ZSHA 4HEHA 3T1VA 4QPNA 2YWJA 4E2ZA 3B1FA 3R9WA 1WSBA 1FFWA 4WFQA 5DOVA 5JDCA 1MT0A 4FKMA 3T15A 1DQYA 2KYRA 1W4ZA 1KNQA 2ZJ7A 1T1GA 4RY2A 3WJ1A 2QW0X 3MCAA 4NULA 2ZRFA 1V25A 2DG2A 4MAFA 4ZVQA 1L7XA 1DBSA 1ZMRA 1SQ5A 1YB7A 1YQQA 2E6UX 1CX9B 4S3MA 2PS3A 4RU1A 2XOXA 3QTLA 1NFQA 1A71A 4G4JA 4MPTA 4LYHA 4CDNA 3DDZX 3FX2A 1NWHA 3WX0A 4D9FA 1DG9A 1N32B 4ROSA 2EG5A 2WE8A 2Z6UA 3H99A 5EE9A 2PMFA 4J75A 1Z4NA 1JLSA 4K28A 1KFEB 3O8CA 1YQXA 4L7QA 4LZAA 2QQGA 1FDVA 1M83A 1R0ZA 1FTWA </