2BEWB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
336
Chain Sequence
AHFTFQPEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 125
structure length 336
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bewB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bewB01
1POWA 1X80A 4FEGA 5EJ5A 2EZTA 1U5BB 2PGOA 3AHGA 1V5EA 4ZP1A 4QQ8A 4GM0A 5ERXA 2QTAA 1YD7A 2BFFA 1TKBA 2Q5JA 3ZHTA 3DV0A 2C42A 1X7XA 2WVHA 3ZHRA 2IHVA 5ERYA 4GM1A 1NI4A 1UPBA 2OZLB 4C7XA 2BFBA 2J9FB 4JUDX 4Q9DA 1V1RA 4D5GA 3EXHA 3DVAA 1B0PA 1X7WB 5HJEA 2C31A 4XEUA 2YIDA 1MCZA 3OOYA 3MOSA 5I51A 2G67A 3IAEA 4MPRA 1V16B 1QS0B 1OLXA 5I5EA 2X7JA 2Y0PA 1UMCB 4JD5A 1V5GA 5ESDA 2BEUB 3DUFB 3EXIA 1IK6A 1V1MA 4K9QA 1PYDA 1Z8NA 1W85A 2AG1A 5IMSA 4D5EA 1N0HA 1OLUB 5EJ9A 2VBIA 2R8PA 4RJJA 1V11A 3EA4A 2BFDA 5AHKA 1T9CA 4RJKA 1TKAA 3JU3A 4GG1A 2Q27A 2BFEA 1YBHA 4K9LA 1U5BA 3F6EX 2Q5QA 2VK1A 3ZHVA 5EJ4A 4K9PA 3LPLA 1OLSA 1RP7A 2E6KA 1TKCA 1OZFA 4K9OA 5DGTA 3F6BX 2WVGA 3EXFB 2OZLA 4WBXC 3OE1A 5EJ6A 4MQ5A 2J9FA 3FSJX 2G25A 1X7WA 5I4IA 2Q5OA 3IAFA 2UZ1B 3KOMA 1YNOA 1V16A 2BFCB 3AHJA 1QS0A 1T9BA 2C3MA 1BFDA 1UM9A 3UK1A 1UMCA 1W88B 1UPAA 3E9YA 1UMDB 2BEUA 2IEAA 3FLMA 1Y9DA 2BEWB 4K9MA 1R9JA 1ZPDA 4GM4A 3AHCA 3EY9A 5EXEA 2O1SA 4RJIA 1X7YB 5K6TA 4GPEA 2C3OA 3EXG2 2W93A 2EZUA 1QGDA 2Q5LA 5DEIA 2NXWA 2JGDB 2VBFA 2C3UA 5HHTA 1PI3A 4GP9A 2YICA 3M34A 3EXFA 1OZGA 2R8OA 1WCIB 4KXYA 3M49A 4MPJA 3LQ1A 1YI0A 5EJ8A 5C4IA 4K9NA 2UZ1A 5K2OA 2QTCA 2BP7B 4C7VA 2XT6A 2C3PA 1DTWB 4JUBA 2BFCA 5K6RA 5I5GA 5K3SA 1JSCA 2C3YA 1W88A 2O1XA 3UPTA 1PVDA 4JUFA 2EZ4A 3ZHSA 1NGSA 1UMDA 2BEVB 3ZHUA 1Q6ZA 2JI6A 4KGDA 2BEWA 1ITZA 3ZHQA 1GPUA 2G28A 4QPZA 5FEMA 3D7KA 4JUAA 2JIBA 3AHEA 1X7YA 2JLAA 2FN3A 1UMBB 1L8AA 2VJYA 2IHTA 4K9KA 3LQ4A 4KXVA 2JGDA 1T9AA 3M6LA 2BFEB 3DUFA 3HWWA 4MZXA 4KXWA 2PANA 4FEEA 2WVAA 4JUCA 2JLCA 2R5NA 3HWX1 1OLUA 2Q28A 4JU9A 5EJAA 3EXEB 1YI1A 3HYLA 3LQ2A 1OLSB 1X7ZB 2UZAA 2IHUA 1OVMA 1WCIA 5HGXA 2VK4A 1TRKA 5EJ7A 2BP7A 1X80B 5HYVA 1DTWA 1PO7A 1T9DA 3AI7A 2VBGA 2VK8A 3M7IA 4KXUA 3RIMA 2XTAA 1UM9B 2FWNA 3AHIA 2BEVA 2BFFB 2AG0A 2PGNA 3EYAA 2JI9A 3DV0B 1X7XB 3FZNA 1NI4B 3EXHC 2BFBB 2DJIA 5EJMA 1V1RB 3EXHB 3DVAB 3L84A 1UMBA 1QPBA 2PDAA 2V3WA 1OLXB 5EXDA 4MPPA 1YHZA 2JI7A 3AHHA 2Q29A 1KEKA 4COKA 3EXEA 3EXIB 1V1MB 2EZ8A 2XT9A 1X7ZA 3AHFA 1W85B 1UPCA 1AY0A 1OZHA 5DGDA 4QELA 3AHDA 1V11B 1YHYA 1POXA 4KXXA 2EZ9A 2BFDB 1V5FA 3EXG1 4JU8A 2JI8A
chains in the Genus database with same CATH superfamily
2I1LA 4MZDA 1CUAA 1POWA 2XA2A 3S5JA 5JYBA 3GT7A 4D82A 2GILA 1A50B 2BKAA 4UQPA 4I9NA 1ANKA 3UHPA 1VLJA 2H1WA 2PS9A 1Y1QA 4PHHA 5ER6A 1TEXA 5FNVF 4LGYA 1XU7A 1ISJA 3LC2O 4O4JF 1SXGA 1G8JA 1Q3HA 3FWKA 3S40A 2I91A 4UBLA 1EGMB 3V46A 3R09A 1K5HA 1PJSA 4GMXA 3NIWA 5CEJA 5JNSA 1DNPA 2V0NA 3PE6A 4RD0A 5AI5A 2ZIFA 5IAAA 1XDBA 1E1DA 4Q9NA 3EARA 5LA6F 1GYQA 1GL6A 2BFFA 5HOEA 5K09A 1P9NA 1G8HA 1XZEA 2Q5JA 3P27A 2G4LA 2Z4SA 1MEEA 1NUPA 2F3RA 3A3OA 3ZGVA 4BBPA 2GN1A 4CKYA 1MRZA 4WNAA 1JECA 5DJ5A 4GGMX 3UF0A 4BNIA 4MB2A 2X5KO 5C7LO 5LDGA 1EVLA 3W8EA 4LJLA 2ZXUA 1ZGJA 2Y4OA 3NAMA 1M2GA 1NJFA 2C2KA 4BWYA 5C52B 1YFKA 2ZUBA 3BFJA 3G2NA 1V45E 2HDWA 4H16A 5HZGA 2R6JA 1ESZA 1SXPA 1IBSA 2NUAB 2VR1A 4XJXA 5EUMA 4KNYA 3VZBA 2WP8J 3PR1A 3JQ9C 4C0HA 1BGXT 4D0GA 4PG7A 2GETA 1ICEA 2VSYA 2YTZA 3FDIA 1S1CA 3IPRA 4GQBA 4NFLA 5LP6C 1PEYA 5GOTA 3HKDB 1KDVA 1AQJA 2AQ8A 3DS8A 5FBLB 1A95A 3B13B 1M2OA 3BWXA 3H9UA 3HVHA 3CZMA 3GWZA 1RYYA 3AF1A 1GRNA 3HE3A 4A23A 3OU2A 4KOAA 4IV5A 1RIFA 5DBIA 2WIDA 3SE0A 3H87A 5CYPA 2P0YA 5DYNA 1YB5A 3C8HA 1L4NA 1UXKA 1V16B 5HEKA 1KGSA 3LF2A 3DZBA 3INRA 4H3KB 2FEXA 3SKXA 4X64B 1Q1BA 4FLMA 2RGGA 1R0YA 4B47A 4CF7A 1WBBA 3SC2A 1BMFA 1NSTA 5J2UF 2EW1A 2WF6A 2JK1A 5ETJA 1MKYA 1YOBA 3T38A 3IP1A 3VOAA 2PT7A 1O1YA 4BQSA 3H5OA 4CG1A 2AFHB 1RAFA 3BXXA 1S8NA 4H4DA 4K87A 1RXWA 1MXFA 4IQFA 5K0NA 3I5XA 1D0SA 2ZVPX 3EXIA 1EPUA 3OWHA 4MQBA 1R8QA 4GGPA 4QOSA 4WXHA 4UPEA 4FHEA 3CE6A 3DBHB 1W85A 3TXAA 5FCDA 1YQDA 3QG1A 2WMDA 3GFGA 4JC0A 2PD6A 1MB3A 3TK1A 3URMA 3CLSC 4BNDB 1AQYA 1UPUA 1XEXB 2IXDA 4W1RA 3X2FA 1N2XA 1PHRA 3TE7A 1TVMA 2ZDHA 3HSKA 4LNAA 1IH8A 4OQXA 1NN1A 2E3JA 1UODA 2W4QA 5CURA 3VR6D 1NVDA 2XCRB 4WZBA 3E5RA 1MV8A 3IV9A 2PKEA 2FMUA 2BDEA 2OXTA 2J85A 2B82A 1BE8A 4BNZA 5EKDA 3AVPA 2GCNA 3JU3A 1U99A 2BTQA 1JEEA 4F91B 1NQOA 1Y37A 2V7PA 4CR7A 2ZJ7A 1CQPA 2FR8C 3EDRA 4HF7A 4AKTA 1W36D 4EKYA 1EFRD 5E9QA 2JBWA 3L0YA 3TVTA 4XGNA 5DPMA 4DNPA 2ZYUX 5HUHA 1M2KA 2H5EA 2Q9BA 2BFEA 1XQ6A 1CU1A 1NBWB 2HIGA 2ZJ6A 3COZA 2G8LA 3H8VA 3KQOA 3NTQA 1YQQA 2XSZD 3E5HA 4K6HA 4NZPA 2GLXA 4BMNA 3B1WA 1NLMA 1FNBA 4N3NA 4KITB 1CRQA 1PYGA 2JNWA 3SY8A 3QSYA 2C03A 3BDVA 3K30A 1MJGM 4P9NA 3M4YA 3N5CA 1QE3A 2DBQA 1CV2A 1V41E 5F33A 2EP5A 3CUVA 5FWYB 4PU0A 2DVMA 4DV5B 4Q16A 4K9PA 3UUFA 1D1PA 1G7SA 3LWDA 3G0OA 1LJ8A 4LQDA 4BQOA 4L8FA 2PQ0A 5H82A 3KQHA 1QK5A 1K27A 2R8XA 1LC0A 4PGFA 1RKVA 4GR4A 2WINI 3LVRE 1M75A 2GSWA 2QMQA 4G0OA 3M70A 5I8PA 2O57A 4G67A 2PZ8A 1NRIA 1LEHA 2NXEA 4PFKA 1VB5A 3R6LA 2GD6A 1E1QD 3EH2A 2UDPA 3GHYA 3NWEA 3ORHA 1UUFA 5F5XA 3UFXA 2IY7A 5E7MA 4B2LA 2AQHA 1OXBB 3JR3A 1L5GB 3T0FA 3T1TA 4X65B 5BUZA 3UG6A 3M3DA 4FIDA 3DXFA 4Q7QA 2XE8A 2E1RA 1WCXA 1BS2A 1ZGBA 1M34E 2BV3A 2JL1A 2I8AA 2QXTA 3IAFA 4TT3A 4BFTA 2XUKA 1KYWA 2PQ6A 3QI7A 3WLLA 3D5TA 5JJKA 3H2HA 1YBFA 2KX7A 3AJAA 3OA0A 1ZXXA 3PNOA 4KRYA 1DG3A 4I66A 4ZQIA 3ZWXA 5C8DA 2INGX 4M8LA 2OD7A 3NLLA 4OPMA 2FWIA 3LP5A 3AESB 2SBTA 3V4LA 3P26A 3HPRA 3V7YA 5CFMA 5TNXA 3UK1A 1LTQA 5EHXA 4MDHA 2GBLA 4HRAA 5HZMA 1N3LA 1QZZA 1TM3E 3I12A 1EK0A 4O33A 2IZOA 3VU9B 2AC7A 3MZ0A 3OZSA 4I81A 1VHJA 1OR8A 1JLLA 3S1AA 4YMTA 4Y8VA 1V8PA 1M2VA 1XZ8A 2WD9A 3OM9A 3EN0A 5H81A 2VAMA 4HEHA 1M2FA 4WOCA 4TYMA 4U02A 1R10A 2YN2A 4OXNA 5DTIA 1Y9DA 2ECOA 2FR1A 5DX8A 3ULKA 2MSLA 1YRWA 4AJPA 4JMLA 4CLXA 1AK9A 2PRSA 5IHXA 5TF0A 1NXTA 2MSEB 4XRRA 5KYXA 1U98A 4QNRA 3FKSA 1N3IA 2ZPTX 3MHPA 4G56A 2GJKA 1C9EA 2I6UA 4YDHB 1C9MA 3CZPA 1KRXA 2Q1XA 2QG6A 5NLLA 3EW7A 7ADHA 1W48A 4MW7A 4CKCB 3WBKA 4C6HA 1QQTA 2E4WA 3I6MA 3FLEA 2J30A 4RL4A 2PXHA 1ZC4A 3JQGA 3VI3B 2O1EA 4BMPB 3A6EA 4RXTA 4DSOA 2KE5A 2QG9A 4H7KA 5C8VA 3T3NA 3A9UA 4QA9A 4P83A 5EFZA 1HYEA 2EZUA 2E1PA 3EZ9A 4E2WA 3GJ7A 1YFLA 3N7TA 2NXJA 3GNTA 3IV7A 3IVGA 4YUXA 1JLSA 2HK6A 4F5DA 3PLAE 2IUTA 1R16A 3IA2A 1T43A 4UUNA 3ZZ1A 4BFYA 3UWOA 3VPDA 1KS9A 1PDWA 5FBHA 4EITA 4EJ0A 1GZSA 1E66A 3C39A 1OI7A 4IDQA 5DEIA 3GLIA 3D9QX 1ODJA 1SOMA 5FNVA 2C9BA 4BFUA 4IDBA 5KQPA 4O4JA 3CW9A 1Y8RA 2PQMA 2B99A 4YALA 4YBRA 1H3EA 3VKGA 1L8XA 1N5IA 4DJFC 5LQUA 1ZBQA 1CUXA 2VZLA 1ZMXA 2IZZA 1A9TA 4R2WA 1M8JA 4BZQA 1XRSB 3I5YA 1TEHA 3RIHA 1KAOA 5AUOB 5JZVA 3KQNA 4X1YA 1JPVA 1FS4A 5LA6A 3TLGB 2QM0A 4J7AA 5D3KA 1S8AA 4G5OA 5DGCA 5MF6A 1VJTA 1DUSA 4TTAA 5DYGA 2IUYA 3FDFA 1TIKA 5KYVA 3ROQA 5JADA 3PX7A 3SXUB 1J4AA 1YSCA 1ZNZA 3G8CA 1FYEA 1WCIB 2AYZA 2FLKA 2Y99A 3I9V1 4HN2A 1WLYA 5BR4A 4X6XA 1YJQA 3QE4A 4IQ8A 5A1TA 5LKRA 1TM4E 1T8TA 4YI5A 5C5CA 2HGZA 4U3JB 4NX2A 3MGGA 5INTA 1RAAA 2JBHA 2BBWA 3DAGA 1EQ2A 4YONB 1E63A 3R6GA 4ME6A 3SJAA 1IJFA 2WUEA 2AOWA 2EX1A 5DHTA 3OKFA 4ZAFA 5TMPA 3PLRA 4PQEA 3TTXA 3FOEC 1V7PC 1ILEA 2WC1A 3BB4A 3NTVA 2Z8ZA 4Y2UA 3UK7A 3MWGA 2ZUWA 1IAQA 1F0KA 1L4UA 1QAQA 1XLTC 2HU8A 4GMDA 5FPPA 5ILQA 4XUDA 1EESA 3HADA 3TF5A 2RGDA 2X3UA 1GUZA 1XZPA 2I7CA 2JLWA 1XJQA 3AI2A 5A5GA 3KD2A 4P3KA 3R44A 1RHUA 4QXMA 3ZNPA 4C7KA 1L8OA 3C3CA 2DCMA 4WWHA 2GBFA 2HMYB 4DVGA 4PO9A 3M6AA 5FORA 3VJMA 8ATCA 1Y6FA 3CLTC 2I34A 3VSBA 4WVLA 3LK7A 1JPJA 3MWJA 5FLEX 5ICFA 3RB8A 2JCVA 3PNKA 2OPBA 3BWBA 5CA0B 3VHQA 1ITZA 3T1YB 5HZHA 5CIYA 2PR2A 2WKQA 5F9MA 1GYRA 2P68A 4TKZA 3MXTA 4EG4A 1LFAA 5J4KA 1AK2A 3DB1A 5IT0A 3EG9B 4U6SA 4N7JA 5H59A 3OTQA 5CDFA 4GNRA 5DLYA 2LP4Y 5G4KB 4DA9A 1VQ1A 3PT9A 4C0AC 4D2IA 4Z1MA 4HNAB 5P21A 5JARA 1KH3A 1TC1A 3IKMB 1R27A 3SS7X 1LI5A 2NTVA 2RHRA 4N3AA 4YC7A 1BCRA 2WTXA 2WFLB 2GYUA 4JJEA 4Q4JB 4MGHA 2BT4A 3DE7X 3KSDO 4UPVA 2J07A 5H7XA 4HYQA 3U60B 2AZDA 3DZFA 4GVLA 4S3MA 1IZ8A 1CY8A 3KX2A 4D3FA 1K0FA 1QC5B 2J5BA 2P30A 1P2VA 2AN5A 1FP4A 2DHEA 2XXAA 1ZA1A 2C84A 1P5FA 1YZQA 2HD4A 5JFOA 3L8ZA 1D2GA 1U90A 3TL6A 3VMMA 4DA0A 2JJMA 4Q6BA 4MSUA 4YGXB 1Z12A 2PANA 2Z9BA 3CLUC 1IUOA 3DA8A 1KR5A 5IUJC 1U3UA 3HUFA 4LXGA 3W6ZA 1RM5A 3GLSA 4HMOA 1JA1A 4NOLA 3W34A 5A4AA 1IBKB 2HH9A 1EDOA 3DGFC 4A1FA 1KGDA 1Y33E 3ZDDA 3GLQA 2RD2A 1ODTC 2IBTA 3VJRA 5G4LA 3T3EA 1B41A 2WU1A 4LZAA 4UPDA 5DOZA 5I7RA 5LKAA 4HT3B 2JLUA 3MLAA 1DARA 1Z6QA 3OQMA 1YFJA 1RTTA 3T15A 1DCFA 4XFJA 1YJ8A 1TRKA 2CW5A 1XJCA 3CR3C 1T6NA 2PJUA 1CQJA 2HJHA 2QW8A 3K1AA 4DRZA 2AUMA 4K6KA 4BB9A 4YCSA 3PTAA 2JVIA 4PYMA 3JVIA 1LDBA 2OAP1 4POAA 2ZCJA 3BT7A 1EFPB 4LTDA 1UKAA 5K8UA 3AETA 1SD1A 2OLJA 1XTBA 5MFPA 5BN4B 3WGQA 1YOVA 3QX8A 4P54A 5IC5A 2IY8A 3TSAA 2IEDA 2CJWB 4AJHA 3S1LA 2PS3A 2WI8A 3EIHA 3QJGA 3MUOA 2AR7A 3D4BA 4X6LA 1Y4SA 3L7JA 4L02A 5ULLA 2X2PA 5B57C 1R6BX 4KRFA 1BNCA 5AK4A 3PRYA 2VUTA 3K9FC 3DVQX 1B4DA 4FHGA 4MV5A 1Y8QB 5TSDA 3TNJA 1E6EA 2IKQA 3A4TA 3TGPA 1K92A 3V1TC 3IILA 2ZANA 2W6ZA 3SXPA 2C94A 3HN2A 4C01A 4QGAA 1SC3A 2I76A 2IK8A 2WM3A 1P3DA 3A0RB 2WQZA 3EGIA 3O03A 2H0AA 2QKYA 1N1GA 2XCUA 2JI9A 2QAJA 3V48A 3QVKA 5EP2A 1X7XB 1ZMTA 1XLVA 2XNSA 4XASA 3R3UA 3A2LA 4DLVA 4H77A 3EMKA 1BE1A 1VJ1A 2F9LA 4PIVA 1KY3A 1BHJA 2QX9A 2X8WA 3HUTA 3UTCA 9ABPA 5L3SA 2P5YA 3RI3A 2C2BA 3H6HA 1B6RA 1W76A 3VX3A 4WI1A 2FKAA 1KJ9A 2GI4A 1AV6A 2VYNA 2AD5A 1NMXA 1GR0A 3ANTA 4YJ3B 3T5DA 3P94A 1WOMA 5EMJA 2C7OA 1CF4A 2FJUA 2X4GA 4G36A 3WHKA 4O08A 1V3TA 2TYSB 4GX2A 4OHWA 4WRRA 2QTVB 1I6LA 4TOIA 3R7FA 1C7FA 4JR1A 1UWCA 1ISIA 2CCJA 2G36A 5K3EA 4EX6A 1MQ8B 4RVUA 5J2TB 1BWRA 1NHWA 2XE6A 3NHYA 1G6OA 1RYBA 3P19A 1G5QA 3Q9SA 4X5OA 2GYWA 4M60A 4YXWA 3AUXA 1TGYA 5JSQA 1P5RA 1KI8A 2AD1A 1GAEO 3PDWA 4W5NA 1I5EA 5FPQA 1DIAA 1FFSA 1U7PA 1YQWA 1F8UA 2FWRA 3KWMA 3Q88A 2XVZA 5KKNB 4Q7KA 4XTCS 3W1EA 4JQSA 4BKUA 1CW2B 3K96A 1H8ED 4N65A 3B48A 1ZN2A 5EXPA 2J08A 4TMZA 3C48A 2HRBA 4I4NA 1REQA 4QHTA 3BGOS 3T54A 4A2WA 2Q41A 1F0YA 5K3BA 3DWIA 4EHKA 5HILA 3IDSA 4GMKA 4NU8X 4UNQA 2B6HA 2OBXA 2RHMA 3H3FA 4FI3F 4UNIA 1QCDA 1AY0A 2EWMA 1KAEA 1UKBA 4J49A 4PSDA 2H2FA 4QELA 4KR6A 5IDWA 2G5PA 1EFUA 2WJWA 3V4SA 4UU8A 4KQ1A 4AICA 3ZTWA 4L73A 4KXXA 2PX8A 1R5BA 3MF4A 4JYPA 4YYZA 3ETCA 3JAWA 2PUDA 1K6JA 2FK7A 4LSZA 1JQDA 1A8IA 2BI4A 2QYHA 5HFNA 3K35A 2X9NA 2DGDA 1AD2A 1X80A 1H05A 4Z9YA 3LPDA 3DKPA 4HLQB 4EO4A 3B9PA 1S2IA 2HLHA 4OGFA 3TI7A 3GFOA 2QRKA 5FBZA 4B7ZA 2W42A 3FGNA 2VNSA 1PYOA 3IP8A 4PCLA 5E6UA 4H7FA 3MRTA 2W0MA 3EIWA 3O0DA 3EC1A 3EGXA 3M0EA 1P75A 1YK0A 3R0QA 1KJJA 4YCDA 2HEGA 3AHGA 2KI5A 3E3LA 2Y1EA 5K3CA 4BC1A 3EVBA 4RWEA 3OEED 3X44A 1O9GA 1VLMA 2EEPA 5DVZA 2H1IA 3OTGA 4L8GA 4OLFA 4RMHA 4AXBA 4KE9A 4LXYA 4YV0A 2HWYA 1UJ6A 1GDDA 4J3JA 4AJNA 5CD1A 1SXIA 1R0SA 3RBXA 1N2ZA 1N5LA 1UWLA 5BUSA 1Z15A 3TLYA 4WQMA 3NBZC 4YRPA 2O8DA 5FFFA 4XGRA 4QD3A 5DYIA 1NW4A 1VL5A 2WOOA 4ZK2A 4C43A 3OZXA 1Q3KA 3BIFA 3A3YA 4WINA 1XZAA 3RBZA 3UOGA 5F3WB 4FOLA 1XTSA 2F3UA 4BO5A 2ZBQA 4BB0A 3AJRA 3MRXA 4QUKA 4YP0A 1VYTA 5DNAA 4NV0A 4TS4A 3MTAA 3EXHA 1KMCA 5TPWA 1IDOA 1HZJA 1X7WB 3ZW8A 2W2KA 1KQPA 1JIVA 2HLDD 4IEEA 3CONA 1I01A 1Z34A 4RKQA 3SZMA 3QKSB 3EJ6A 5HCNA 4B09A 2F1HA 2R68A 4MR8A 4TLCA 5JOQA 3MW8A 3KNZA 4MGIR 1EBBA 2A9OA 2RB4A 4B9AA 4MPTA 2R1TB 4DDTA 1TAHA 4YS6A 3TSYA 3IJPA 1GQQA 3ZJYA 4EO9A 5AJHA 4EENA 1MVNA 1EFVA 3PUIA 4V1CA 4TZ6A 3DKKA 3VR5A 5A3JA 2G80A 4W5JA 3QXCA 3RRXA 2NU7A 1UMCB 1W25A 2ZRQA 4RK7A 5LP1A 4C7OA 1PD1A 1U7TA 3L7MA 3OY2A 1PWHA 5AOVA 1OX5A 5JSYA 1W9HA 2CEAA 1FA9A 4EMSA 2WD8A 1J42A 4LJ7A 1KC1A 1SURA 3ZLTA 1JI3A 4YJ2F 1SBTA 2N75A 1TJPB 2F1IA 4AZ0B 1WSDA 1QOZA 2I6QA 4J0HA 1P0FA 4O5OA 3KKZA 2DR3A 3NV9A 4KMOA 3O4HA 1NFRA 4JYBA 3N7UA 4L07A 5I9MA 7ABPA 5K7SA 4M8SA 4RPKA 1HE5A 2E4XA 1T3LA 2QA5A 4P98A 3FNGA 3PGVA 3UKJA 1SQ0A 3DH0A 3EPRA 3C5CA 4N82A 2CXTA 4ARZA 1E3LA 3NAZA 2N47A 3BWYA 2XPCA 2DT5A 1WU8A 3OSZA 5EPUA 4KWTA 3GT3A 2ID9A 1IXSB 1LH0A 4H0NA 3S27A 1LX7A 3M9WA 1NZFA 2X14A 2EYUA 3I6YA 4FBLA 4BJHB 1N5OX 1WQ3A 2XUHA 2WWGA 1J39A 3MVEA 3CKMA 1NHGA 2P2NA 3INTA 1R0CA 2V6BA 5M5BA 3BYZA 2OK8A 1P7YA 4PLWA 1F17A 4BZPA 1C1HA 421PA 3A4MA 2GBIA 4UM8B 3E7XA 3WA6A 3RK1A 3C6KA 5FLKA 2AR9A 2ZM5A 3F46A 4KGXA 1KJQA 3P9ZA 4ZOCA 4LFBB 1PHPA 1IWOA 2QRVB 1AZSC 1BH6A 1K8XB 1GUAA 2QG4A 2ADOA 2XYPA 2P7IA 1ZEJA 1QMGA 4I2VA 5EJ4A 1I2MA 5E3JA 4LNUB 1SVIA 1ETHA 3NPMA 2Q4OA 3R7BA 5HQ3B 3PNYA 1SG0A 1GG9A 5J43A 1GCOA 1NQAO 4N3GA 3LZ6A 2JIOA 3HJTA 4KN5A 3L0PA 2NQ8A 3F2IA 4TLLB 1YI8A 1KJ8A 5H02A 1K7FB 1WETA 1W8IA 1KS2A 1XKQA 2IW3A 3PC4A 3PHLA 2GZ2A 1DEOA 3JALB 3R4VA 2GT1A 4G4SP 4Z0TA 2OZLA 5EJ6A 5DYTA 4YCMA 4MQ5A 1J00A 2H5JA 3T7TA 1Z29A 1T2UA 3B82A 1YQTA 4BOYA 4NK4A 4DBVO 2WHQA 1CF9A 3P2EA 4ML3A 1VTKA 5CM9C 3ZWAA 2F43A 3OE5A 5I4IA 2ADMA 1AKVA 3W2IA 2UUBB 4TTJA 4FOOA 5BQXA 2WF9A 4F46A 4UAGA 5IJ0A 3T3PB 1H69A 4JBLA 4YMLA 4TRRA 1YNOA 1G291 4KSBA 1E2LA 1ULTA 4MPDA 4JBIA 1AV7A 4O3FA 4ND1A 2GVNA 1ZC3A 2IU6A 2C4UA 3E48A 3G82C 4KYTA 5H3CA 3FCEA 1ZD4A 2C3MA 4L4XA 4RAOA 2AKYA 4L57A 3V97A 1EJ0A 3O31A 2CF5A 1PF7E 5ALYA 2RFLA 2VI5A 3TLEA 3GFFA 5U4QA 4DXHA 4MI3A 1NN3A 4UNSA 2XNHA 1EIZA 2A9RA 2FPPB 3PQDA 1IVSA 1IWBB 4R2KA 2ES4A 4K86A 4QTUB 5IPFA 1WY7A 3C97A 4RLSA 4NV1A 2WNSA 4M55A 4YP7A 3X0DA 5FUQA 1K88A 1K3TA 5FTJA 1IZYA 4O4IB 4E5UA 4IGAA 3B6KA 2BGKA 4M87A 3MAJA 3OIDA 4NZ9A 4NH0A 1G8GA 3F96A 3RIYA 4JLJA 1P2DA 5E6RA 1RJFA 5TEVA 3EY9A 4MW0A 5D6NA 3C0KA 2VF5X 1YC5A 1AXEA 4NENB 3SIPA 5JWRA 3EEOA 2VDPB 1F0PA 1A69A 4QM6A 3QXXA 2BFOA 3GU3A 2G0AA 2HPVA 4LHEA 3RC1A 5T5QA 4Y9DA 3U5TA 1YS1X 1EDBA 2FH5B 4OQNA 3STWA 2P4EA 5T8KC 1CUVA 4EHIA 3X1XA 1II8B 4YMWA 2O6HA 4MWTA 4ZD6A 4F8EA 2C54A 2O07A 3AVQA 821PA 1SCQA 2MSCB 4A8PA 3KTAB 3LKDA 5ICMA 3O1HB 2Q7XA 4TSFA 5JS1A 3CZRA 1V8ZA 2ZYVX 2AGVA 4GYKA 2BMDA 1VL6A 4A8HA 3E2IA 2FZGA 1XTRA 5TPZD 4DABA 1IYZA 4E6EA 4L9RA 2Q99A 1Q50A 1EDEA 4DMLA 3D1VA 2PKCA 3GJ0A 1YJXA 1VE1A 3N05A 3GW8A 4I4TF 4NCJA 3GLHB 4QUJA 1UK7A 3RU7A 3V8PA 4GL2A 3PL5A 2HPZA 3WYBA 1IM8A 4KODA 4OJNA 4YLYA 1CRWG 2BFAA 2X5XA 4FE4A 5CFLA 4P5PA 3ER9A 1E4EA 3JQ8A 1ZGCA 4G8JA 3BTVA 4TGLA 4X1KA 2NGRA 4RX1A 2FZLA 2R00A 4DAEA 4GVXA 2I3GA 3KYBA 4FKMA 3UYLA 4N76A 4RO0A 5TQ0A 3K8ZA 2FN7A 3WLMA 3TKAA 3V9PA 4NECA 5T64A 2R11A 3U4IA 4ZICA 3ISTA 4F4CA 1G2PA 2DHRA 2BELA 2IOFA 4WXRA 1FVFA 1IY2A 1N77A 3EJWA 3QNMA 2EJWA 4BP1A 2M2IA 5IF9A 2W0SA 5B4VA 5JG7A 2XHEA 2ZI6A 3IUMA 5K0BA 1JF8A 2JGAA 1BDJA 1RDFA 4KQGA 3FROA 3SHVA 4H3HB 1XMSA 3GPLA 1Q0LA 1OA1A 1OAOA 2ZYTX 2YNMD 3SM3A 4J4HA 5E4FA 5HKOA 2OC9A 3O75A 2J87A 4R2LA 2J6IA 4WVFA 1PGJA 3ZU3A 3B78A 4C7VA 2APJA 5B2EA 3ZD9A 3BL8A 4XWYA 3EFOB 3E9DA 4ZHSA 3QPUA 3I37X 3GEHA 3T7DA 1V6SA 3CNBA 1J0EA 3EWSA 3L1KA 3LAWA 2GVZC 2JHGA 3A70A 4MHTA 3CBGA 4Z7JA 4MQMA 1L4YA 3RJ5A 1WU7A 2DTDA 5EFOA 3R6DA 5KO2A 1OVGA 3C3MA 4V0MA 7REQB 1XTIA 2G1KA 2JGIA 3DO8A 5IJ9A 2F3SA 4RNCA 1Z2NX 1SXJD 1T3HA 2WB4A 1MH9A 2RB5A 2WIAA 2PZEA 2GPTA 3KQTA 1WW2A 3PF9A 4E22A 4QT4A 4X90A 5KNBH 1SD2A 4FMDB 3ZZTA 3EGVA 5TV2A 3WMWA 1JQEA 2HJGA 4P4NA 4YJ2A 2Y92A 3ZHQA 5HRCA 1H2EA 1Y3BE 1ZNYA 1XWWA 2R62A 2IKSA 2IXEA 3QM1A 4MVJF 4MV1A 3UMVA 2OQVA 3EZNA 4QO7A 1ZNQO 4RFSA 1O9HA 4RTOA 3F90A 3JVVA 3FPCA 3JZDA 2WG1A 5K3AA 4XE5A 2V5VA 3WE7A 3ZR4B 5JD6A 1G38A 4CNBA 2VBCA 3HY3A 1H3NA 3ZXSA 5B7QA 3KQPA 4PTYA 1YR7A 1BJTA 1MOPA 1XJ0A 1TNDA 3D8HA 3FZGA 3PHIA 4PSKA 4PX5A 5BWCA 1BRTA 1UMBB 3NT2A 2B8EA 1QRTA 4W8HA 1CY2A 2EKQA 4UZEA 5FWAA 1WMFA 4UTPA 1QQBA 2ZK7A 5GJWC 3VPGA 1XPUA 1KXJA 4KQ2A 5IH7A 3MLEA 3PNLA 3LLMA 1M0EA 2H1RA 3R3HA 1RE0A 4O4HB 4ZMRA 1U1DA 2EU8A 4YAIA 1EGAA 2GCOA 4RY2A 3TQOA 3M5CA 2OV1A 1RCFA 1XYGA 2AA3A 3HJNA 4RIEA 4D4LA 5J4YA 3AEYA 1K86A 3N2KA 1FMTA 4LJ8A 3FH0A 4UMDA 1XTTA 1QRRA 3JTMA 3A1FA 4A27A 1FJGB 1IUKA 2GN9A 3QPAA 3R74A 4ZEMA 4OBBA 2VZEA 4URUR 3CUEF 3QU5A 4MQEA 2REQB 5IARA 4EDHA 3TLBA 4JU9A 3QXJA 4R5HA 1JWLA 4UOEA 4XVRA 1XTJA 3HYLA 5AW0A 2QQ0A 5CT5A 3W2GA 1OLSB 1WUJS 2QLBA 3KHUA 3QUAA 4DC9A 1QU2A 4WFJA 4YRGA 4ZKDA 3VTAA 1RKUA 1UBHS 1XTPA 3FGOA 4HAUA 4UHEA 2NU8B 4DWJA 4R8MA 1G6Q1 1QF7A 2W2TA 1FSFA 1S1MA 5JSHA 3G1WA 2FG7C 3PFBA 4FR2A 5FPHA 4LWZA 2IODA 1Z07A 3WGOA 3OT5A 1KKUA 2W6MA 2OCLA 2W98A 5BSVA 1JWBB 4UQLA 4NAUA 3U2QA 4URVR 1NJGA 2V3VA 2D5BA 2H18A 3K9WA 3M5WA 4LXTA 2HAEA 1CDZA 3BGWA 3GT0A 4RVGA 5DBHX 5EWLB 3TIXB 1VIDA 4AVYA 4D9NA 3ZVMA 1GQOA 3UANA 4INOA 2CMHA 4F93B 3B9QA 5AKLA 5KBYA 1H2AS 1W2HA 5L7WA 1CY7A 4AKSA 1BKYA 5EZYF 1GARA 1ZH6A 1MZPA 1XAJA 2QV7A 1NPYA 1QOPB 4B0PA 2CHQA 3AVOA 1CNMA 1Q0UA 2OY0A 3B2EA 1FUKA 5KTSA 3BXOA 3N0WA 1Q0SA 2LVBA 3NKVA 1MAVA 4E88A 1I3CA 3WL5A 3CEHA 4ZC1A 4KQJA 1TO2E 2WE7A 4PF1A 8AT1A 1WHSB 2HRDA 3IHWA 1Y42X 2XTAA 3K31A 3QPDA 1KVUA 4U2FA 4X93A 5CTJA 3DPUA 3H2JA 5HCUA 4F8JA 5LZ9A 2QLMA 4LMAA 4WKPA 1LD3A 5FPKA 4C22A 2TMDA 1X1RA 3FB4A 3PEVA 4Y6OA 3VX4A 3AJDA 2ZIVB 4MA0A 7YASA 3AKZA 3L6OO 1E8NA 1NXVA 3DT8A 3NBUA 4IG9A 1CC1S 4DCJA 1LKZA 1KFBB 1PUIA 2BCGY 3FZNA 2EKLA 4GVPA 2ZE7A 4O6VA 4QZVA 3O8DA 2VTDA 1NF8A 1NJ6A 4GRAA 1KO7A 5JR3A 1BMFD 4RH0A 1NJSA 4BRUA 3NBQA 5D3ZA 1K8YB 3Q0EA 1V8DA 4JEIA 4MRRA 4R68A 2B9VA 5TRTA 1I9GA 1VPVA 1W5SA 4IF6A 4IKOA 1PFKA 2DLDA 3S6JA 4EW1A 1MGOA 4KX5A 3R9IA 5B1YA 2V7QA 1FEZA 2IOHA 3IT3A 3KR0A 5FD8A 2YN0A 3FNEA 2JG3A 2BC9A 3A4IA 4QQNA 4R5MA 1ZS9A 5EIFA 1CXZA 1PZXA 1W6RA 1GZ7A 2PRKA 3IUSA 3N87A 4WUVA 2Q3LA 2AS0A 5TR9A 3DW3X 1RT9A 3SQOA 2HI0A 1U3WA 3OJCA 3C3EA 2O2CA 1FUUA 2AYXA 2GARA 9MHTA 2R87A 2D5AA 1P4SA 4PZYA 1J22A 3K0BA 4JX8A 4XQCA 5IKEA 1W94A 4DB4A 2FSUA 3PKZA 4ARBA 1L1EA 4R2XA 1IEQA 1B8OA 3LT0A 3I8OA 1I1HA 5FTKA 1H9CA 4M1TA 5EPEA 1C3OB 2A0YA 1K8RA 3CW2A 3TQFA 3OZTA 4RL6A 2BZ0A 2I55A 1CJVC 5I7FA 2VCHA 2J09A 3GLFE 3KC2A 3MNFA 4I4TA 3IR6A 1DI0A 1TMKA 1Z7BA 4UDXX 1S9HA 1VL1A 4Q9IA 4ZRMA 3DXZA 4NCXA 1Z4LA 1YVUA 1ZZEA 1IG3A 1X7HA 3NPAA 4O3MA 2HCRA 3R3VA 1AVTA 5FOXA 2EKZA 2UXBB 2P9EA 3QVXA 4BY9E 221PA 1TVEA 1XHLA 2R96A 1T5BA 1I94B 5LVAA 4UTXA 4MRSA 4FWTA 2FF5A 1J0AA 1B8NA 1J24A 3EF1A 3AJEA 1IZ7A 2XOEA 3N8GA 4PCAA 1XRPA 5BNIA 3X1DA 2MU1A 3OOHA 4I50B 4YMVA 4BO2A 4WY8A 2KBFA 3CF0A 1NG1A 1VMDA 1HX7A 3C6YA 4TWRA 1O8BA 4TPKA 1THZA 3WGKA 2QR5A 4FZ3A 2O3SA 1QV7A 1P80A 5IC4A 3PSHA 4OOEA 1J8VA 4EOGA 1SUSA 1WLSA 3HZOA 4J0CA 4JSTA 2JHAA 4QUHA 3UO8B 1CQXA 1WM1A 8ABPA 4W9NC 3AC0A 4QQ8A 4R7TA 1XN4A 2ZRAA 2QUKA 2QTAA 4HP8A 1ZU4A 4FYYA 1Z39A 4REQB 5THXA 1E3MA 4OH1A 3PGLA 1R7RA 2J4CA 4TT3D 4D9MA 4TKUB 1SM4A 1GPDG 1TKBA 3CWCA 3DFKA 1BOOA 4Z7OB 5K0FA 3G2PA 4NV3A 4JA0A 5FTLA 5ITZA 1A8SA 4TVBA 2CNDA 1QIFA 3OPMA 4C4AA 2J0QA 1PTKA 3G0DA 4RFLA 3CT6A 5A7HA 5A3QA 2A86A 3AM3A 5H16A 3ZHRA 1YXMA 4EGQA 3G13A 4GM1A 5AW6A 1UPBA 2FOLA 5D1HA 1ACMA 4MVJA 4WFQA 1PTJC 2RGWA 4BGEA 2V1XA 2ZE5A 3D4IA 2Q8PA 3LGAA 4P53A 1AGRA 1GILA 1V25A 3N2GB 4PQRA 3DEHA 4RZXA 4XEHA 5TARA 1B8VA 1M1YB 3NONA 3BMOA 2J9RA 3ENVA 3WWPA 2PLFA 1Z88A 1AGYA 1PJ3A 1WD7A 2Y9MB 3QVTA 1UBCA 2VK2A 4GOLD 1ADFA 3EVCA 4PWYA 4ZODA 5ARBA 3O4GA 2V7EA 3CYFA 4J7UA 4YRBA 4JJFA 5GVRA 2O2YA 2JGFA 3HFGA 3AF2A 3GRYA 4CPDA 1TJ4A 1IJBA 1UKCA 3GRVA 5CX1B 5JDCA 3VPHA 3UKOA 5C1BA 1QGAA 1GNRA 3ZLUA 5A6SB 1VECA 3AUYA 3AKEA 3PNPA 4KUHA 5C31A 4H17A 4HNVA 1EFHA 3E9NA 2OVFA 2BZSA 3IP3A 2ACEA 3WMXA 3TVDA 4OVKA 3USZA 4B4DA 1WD5A 1KEEA 3K9GA 2LKDA 1UC5B 2OSVA 3HB0A 3FSGA 5JI2E 1KBQA 1EFDN 4YI3A 3SR3A 1H5NA 3ELBA 5A0VA 1RWXA 3CH4B 2QZPA 4Y2JA 1FU4A 3R7WB 2JGLA 3DUFB 3S55A 1S2MA 4AJKA 4DPMA 4ZI7F 5IVKA 2A9VA 1IWPB 4N5IX 1U1GA 3LDUA 4RDCA 2WMOB 2H8GA 1KYVA 3LXMA 4IGEA 4D1YA 4NWIA 1WB6A 2FUG6 3KCQA 2GZDA 3L1HA 3MB5A 1HI9A 2VBIA 3Q5DA 4D8UA 5L6MB 3DOIA 1RHJA 3M4XA 2PSDA 3SS8A 5JALA 1RM3A 3EA4A 2BPOA 1P0QA 1XMXA 2DPYA 3P2OA 4Y1RB 3AJ9A 3QMVA 2BBSA 1Y34E 3AB3A 1DDIA 2UVDA 3GCDA 3B7WA 1CY4A 2A94A 3LHKA 3PQ7A 2A1TR 2X0EA 4AP6A 2HT1A 4HOYA 5KVCA 4B6EA 2JIQA 1R5JA 4MW2A 1P60A 2VT7A 5SYNA 4A16A 2ZUFA 1NURA 4HQOA 2XR1A 1GAXA 3AF3A 1X0XA 1N1DA 3L6BA 2RI6A 2OXRA 2BGLA 4CT4B 4ZZ0A 3GA0A 3IO3A 3IO5A 4KDCA 1JHMA 3ET4A 3JW8A 3F6EX 4KQEA 4V0NA 1ZXLA 4Q9HA 4YMGA 5K20A 2AEMA 3WIUA 3HG7A 1NWHA 2PR7A 3JQAA 5L53A 1ZWLA 3TOCA 4UOZA 1E9BA 3I8SA 3AFGA 4DCSA 4KV9A 1D1SA 5JH7F 3ENWA 4OM7A 1YZYA 2FSIA 2NVOA 1XRRA 4EYQA 4WCFC 1YRAA 2IF2A 4JC5A 4JOSA 5LUBA 5AVUA 3FPFA 3MPOA 1OPXA 1VE6A 3B1ZA 4D42A 3OO1A 1GZHB 4Y6RA 3UXYA 4W1SA 1SQ6A 2X6QA 4OHRA 1M74A 1QTNA 4ZJZA 3S1SA 2WSLA 1Z5VA 3L0DA 4MWZA 3KZVA 4HCJA 3O1LA 4OQ4A 3W06A 5JQGF 3CTMA 3LUBA 5HWSA 3I39X 4E2YA 4LYJA 1W4ZA 2OO5A 2GKGA 5DTJA 3WMRA 1R1DA 2QTFA 2JF0A 4X62B 2I9KA 3C1OA 1JL3A 3CVYA 4U0JA 3ZXXA 4XWWA 3JCZA 5LYYA 1RZUA 3GO4A 4ER3A 4BMZA 2ZIAA 1Z7GA 3MOIA 1QQ6A 4O2AB 1QO7A 1JV2B 2CMKA 1AGXA 4JJIA 4IILA 4Q1AA 4LYAA 2DE0X 4QLBA 4BE7B 1GZ3A 1X70A 1NBAA 6REQB 3R7AA 4OJYA 4B35A 3T3IA 1AIPA 2Q1UA 3U39A 5ECYA 2J3EA 3AR6A 1YS9A 1BEEA 1ZFNA 1IC6A 2O2ZA 4FUTA 3NYRA 4PXAA 4CMHA 4E5KA 1WTAA 1ENPA 1C0PA 3DMDA 1W0KA 4KXMA 1CUYA 3AUTA 4N7BA 5CFZA 3Q8KA 1O95A 4Z1MD 1YZNA 1IMJA 2ZJYA 4BZWA 1UPAA 3DQQA 3ZNOA 4BUZA 2C8KA 1YBVA 3KXIA 4HRVA 3SHTA 2FDCA 1Y80A 5LQDA 1CUUA 3HNPA 3U37A 3UV7A 4ECAA 2FVXA 4TTQA 3SP1A 3DYBA 4BECA 3E9YA 4ENVA 1W4LA 1FFWA 2RH8A 3ZY5A 4Z2AA 3C3KA 2EWVA 1NBIA 5B1IA 3I5UA 2IT1A 2WAYA 5ESWA 1DWOA 3NB0A 1UXJA 3MC1A 1JSRA 5BWOA 1N34B 1GL3A 5CVJA 5LD2C 4O0LA 3W4JA 1R9JA 2FYTA 5JNUA 1GL9B 1GTZA 3NC0C 2Z9CA 1CB0A 2Q46A 4NH4A 4R01A 1GG5A 2Q3MA 1ENOA 1W75A 4GLFA 2FGKA 3VPCA 3WV4A 3C3WA 1GGEA 4ZGBA 4YIKA 1RJEA 1KL7A 5GY7A 3GLGA 2A9KA 4PQGA 1JKMA 1WUTA 1Z68A 2XJ4A 2UKDA 4MA5A 3I01A 1JQLB 2ANCA 2C0CA 2COUA 2ZIWB 3FHJA 2G9VA 3THRA 3UGTA 3DWEX 4DV1B 5A2QA 5KMGA 2LV8A 2W5UA 2C3OA 2HREA 1XTQA 2CHGA 3EXG2 2DPGA 1DKQA 3HP1A 3I9MA 1QGDA 2PU7A 4RMNA 3UWKA 1NW3A 4EYGA 1RKXA 3WNZA 3IQEA 1PFUA 2PLAA 1V3VA 3QZUA 4CLEA 1AMUA 2PLWA 5EMKA 1GEGA 2P4UA 3QLTA 4UE2A 1VPEA 1QXSA 4J03A 4YVFA 3RS0A 4EB3A 2ETXA 1GGHA 4X63A 4RENA 4Q6WA 2C5SA 2YW2A 4QDUA 5LBIA 1DBPA 2NXNA 3F0TA 4QRHA 4AYXA 4PGHA 3PGA1 4E30A 5EMMA 3QEBZ 1L5QA 5HHTA 3ZIDA 3C3DA 4J1TA 4LOLA 5KSYA 4WZBE 1Z2DA 2XCTB 2XI4A 2XLCA 5SV2A 3K6KA 4WGGA 2PZFA 2CCKA 2DPXA 1ZN9A 1KF0A 1XX6A 3HMKA 1Y1RA 3H9CA 3ZE9A 3DLTA 4RJ2A 3WWDA 5A06A 5EVJA 3V4FA 2GJ8A 3IEUA 1HKHA 4JLBA 4UTZA 3VKHA 1HEIA 1STOA 1N6RA 2VOJA 4IOJA 1Q7CA 1J70A 1R0LA 2WZBA 2X0NA 2X1LA 4ANFA 2HDNB 1C1DB 2PXAA 5J5VA 1RRVA 2WWYA 2V6MA 4K2HA 1XMQB 5FO0A 4BKMA 1GTVA 4GOND 2FN4A 3M49A 5IAEA 3JQFC 2O8CA 4EPWA 3QFCA 4ZQFA 3QU2A 2VRCA 2ZSIA 1SIBE 4PZEA 4V0OA 5DM0A 4MQUA 1XJ5A 1A9XA 2AQKA 3AF6A 4ZC8A 3PUWA 4Z4FA 1A9ZA 3LT2A 4DSNA 4BUCA 3TX6A 1EXDA 3EEYA 3BS4A 2QAGC 3DTVA 3HJCA 1ZSYA 5IKOA 3CSSA 3AFIA 3HVKA 1P1CA 2ZJFA 3LS2A 3BKWA 3NWBA 2C2OA 4XSVA 5BQPA 1L7MA 4NMLA 1PS0A 1UOPA 1CUFA 1P2GA 2VPTA 1QFXA 2ZI5A 3NBKA 3BH7A 3Q3VA 4TT8A 3TAUA 1NVTA 4N0EA 4BQFA 2YXDA 3ZU5A 4B3MB 3R5FA 5K3SA 3N2IA 1MFZA 3U3MA 4H35A 3T4EA 5DGHA 3A6ZA 5EHIA 1W88A 3IIMA 2FRVA 2C2GA 3VSEA 3RTCA 1KOGA 1P29A 5LSAA 3NW9A 1TIPA 2ZOSA 3H9BA 4QBTA 4NKRA 4DQ0A 4F7WA 1Q6ZA 1ZU5A 1ENZA 1PG5A 4RV9A 2P9ZA 5GZ1A 2WHEA 1OT3A 5KPDA 1H4SA 3QLUA 5JAMA 3TPCA 3VYRB 2D7CA 5B12A 1XVTA 3GJ8A 3H5LA 4YAWA 3WP0A 3EHDA 5JFGA 3K9HA 3X1JA 5FEMA 3A06A 4IIVA 2QM7A 3GRFA 3FOAA 1EHCA 3MLBA 5KYUB 3N86A 4UM9B 1OWPA 1F4PA 1OKKD 1OQAA 3GDFA 1E4OA 3P52A 2EARA 4X0EA 2WJ4A 4GYYA 5E8RA 4DILA 1IAVA 2XWPA 3C6ZA 2WUWE 4QXQA 4FYHA 2GCGA 3VHLB 4LHXA 2ZWAA 4AWAA 3QVSA 4DQKA 1P0PA 3OZWA 2QTNA 3L92A 4YX9A 2FEAA 4JOQA 1KYYA 1USUA 3OMWA 4P3XA 1E6LA 1NXOA 1G3MA 1UM8A 2JA1A 3ZD8A 3W2TA 1KAHA 3NRBA 1NBOA 1LZKA 2XRFA 2YWJA 4FNGA 4ZV7A 1QMPA 1W6UA 2G72A 3ET5A 3V33A 1C0IA 1VMKA 2YY6A 1FDTA 4BNWA 1C9YA 2E85A 3I04M 4MYUA 2DHCA 4K03A 4NZYA 3O3NB 4PWZA 1I4EB 4O25A 4JNKA 4WOBA 3GF4A 5DK4A 3VVMA 2CHFA 4ARSA 4XWOA 2XT0A 4HEA6 2XCLA 4FLFA 1II0A 3DDWA 3EGOA 4M8KA 3SYKA 5IABA 2FUNB 3A10A 1GQ2A 4R05A 2JCBA 2ZE8A 3RGGA 2QN2A 3HWX1 3LXUX 1KZGB 2BGIA 4OFWA 3ORQA 5DN9A 3GLIE 5JH7A 5A4DA 3BHJA 5BVGB 4U7DA 1P72A 2OD9A 3G2JA 4PANA 3JATA 4ESOA 1PNRA 4N41A 3KWLA 5DHUA 2G83A 4XM0A 3F5SA 3VJLA 1TYEB 4MUJA 3PV0A 4EJMA 1IXZA 1OVMA 1KIMA 2C61A 2H0QA 2QX4A 3HLTA 3I9FA 4IHAA 4R1NA 2AMFA 3K9QO 1I2AA 1KK1A 2WF8A 4L5JA 4F4JA 1AH2A 2VXYA 1KTVA 3V8BA 3DR5A 5JQGA 3HS3A 4OQDA 3LHSA 5EESA 1TT5A 4QBIA 2Q6TA 5I7HA 3HHPA 5P8WA 1MC4A 2GLTA 5FHRA 5KJCA 2L18A 1TXGA 2H4XA 1AUOA 1IEXA 1VRVA 1O5IA 4RDIA 1C8VB 4FJ1A 1J8FA 1ZDMA 3FPAA 1LPMA 2ECKA 2RGYA 1PGQA 4GLOA 4YPOA 1MAAA 1SAYA 3BL6A 2CCGA 1MX1A 1QNFA 4UD6A 3GCZA 3KXDA 1OZ0A 2VXOA 4D44A 4BNVA 3W77A 2IF0A 2DEUA 3Q3EA 3GLUA 1YUBA 2IOQA 1USVA 3OQBA 3PTLA 2WWRA 4Q9JA 1YONA 3HA5A 1KEZA 3GIDA 4JBGA 4YRAA 2GB4A 1YF3A 4NEHB 1P7PA 5KNCD 3D1JA 1IHXA 1PU2A 1A96A 1N2HA 1J8MF 2PPLA 3TB6A 1LLCA 2GAJA 2BGRA 4L5BA 4MYRA 4TZKA 4U9IS 2NAPA 1IM2A 1T15A 4FYIA 4K9SA 4KQHA 1UM9B 3W3AH 1Z13A 3K0FA 3H75A 3I2HA 4BBJA 2I66A 1AHIA 4KLCA 4IIYA 3U7JA 4YQFA 3FTQA 4D43A 1XRQA 3E82A 1J2TA 3MAGA 3AF0A 2CVOA 1XPRA 3RYIB 3T5TA 2VF7A 3ZE2B 2J0UB 3VR5D 3WLRA 3MTGA 4TSKA 2BFBB 1S2NA 1LLDA 2EKDA 3HCWA 3ELWA 4B8ZA 3R5JA 4BGIA 1OB2A 3EGEA 3UMBA 3AY7A 3ZVLA 3MBOA 3O0TA 1V1RB 1O08A 2IA5A 3TJRA 2C29D 3AXTA 3BDAA 3L84A 1F8GA 4BJ3A 4M76B 3ZDAA 2PWAA 5CLHA 1TTHA 2AJ8A 1QPGA 2DAPA 3QIAA 1Q16A 2IXGA 4X1OA 3RJMA 1LRJA 2B5WA 4NU5A 5E7IA 5CDFE 3VPAA 1B6TA 1QHGA 3JY6A 2ZT8A 3QYPA 1J09A 3EPPA 1EZ4A 2YXLA 4HS9A 5D7NA 5BSHA 2ZW9A 3FYUC 2QXYA 4G09A 3ISJA 4CMKA 5LQRA 5EJFA 1LK7A 5JHHB 5KINB 1Q1AA 4J6EA 4UEQA 2QRGA 2CXRA 3IBCA 4IJ5A 5JYEA 1XDGA 2G06A 2PSEA 3UC9A 5FWDA 4KO3S 5DSZA 4EVRA 3QNUA 4US2R 3LRPA 4QYWA 3TMYA 5AO9A 2BCJQ 4J1TC 3QELA 1YVEI 2VH2A 3BH6A 2NUBA 3CRQA 4RKFA 4R0NA 1GDTA 2FPXA 2ORWA 1RI4A 1R9MA 2NV2B 4WCDA 1TC2A 1O0SA 1TYBE 4PEVA 2O4UX 1QVAA 4DFDA 1U2PA 1OFTA 3U0VA 2CBXA 4IVNA 3FVTA 3PPYA 4KLRA 2D3WA 4G1VA 3HY6A 3TOZA 3KPJA 4O5AA 4B3CA 1CBUA 1OZHA 4AX4A 4L75A 3HB1A 1O97C 4PNZA 1EB8A 1V11B 2HMSA 3V9AA 1R4NA 4B2IA 5SZIA 3A6DA 2BFDB 3INYA 5BVHA 1A2OA 2HT6A 2PFSA 3M6VA 2CUZA 2VRWA 1QQAA 4C3ZA 4FOTA 3TFQA 3M6XA 4K26A 2KWIA 4MYHA 2GHIA 2PMKA 3H65A 2ZBFA 4GMFA 4FGSA 1THTA 2GPJA 4UD2A 3W1VA 1YR1A 3U6KA 2VYQA 5B53A 2G88A 4BJ6A 2XUAA 2ZVJA 4KUEA 1TDJA 2PGOA 2FWMX 2WNHA 4R2MA 2SCUA 4BO8A 4DQXA 2VF2A 3AWDA 4DR7B 1WX1A 2ZJ4A 4EJ2A 1R15A 1GUFA 5C46F 1YZLA 2DM6A 1WF6A 2JFGA 3RTBA 5AW4A 2WPDA 4R16A 1T1GA 1Q0HA 1AKEA 2Q4EA 3IURA 2QX6A 3CH6A 2W9XA 3OCVA 4AG3A 4GPTA 1C0KA 3PXUA 4HVLA 1RQXA 5IN5A 3IKTA 1I4DD 4YAJA 1E5LA 4C76A 1SVLA 3B2NA 4WMLA 3EPKA 1HFWA 3W5AA 4UBMA 4B4OA 4XVCA 2WVHA 2WWVD 1VXRA 1VHWA 1UBKS 1EDDA 1NVGA 3GCXA 5BRJA 3GVXA 2VQFB 1G21A 3DOFA 3D4PA 1I0ZA 3X2SA 2NP7A 1UEIA 1DC3A 2KJQA 2P2YA 2FPIB 3PI6A 4DLSA 3S8YA 1YNSA 5AJYA 4Z9AA 1QB8A 2E4VA 3R3SA 4JUDX 5H9VA 3QWFA 3OJWA 4M1MA 1ZJJA 2ZUCA 3HH8A 3NUQA 1CIVA 1J5XA 3ZHCA 4A0GA 2QGZA 1M1ZA 2JLBA 4JODA 2Z6QA 4MCIA 5BSFA 1C9NA 2AOUA 4JELA 1X1CA 4D80A 4I9HA 3GRPA 1ADCA 1MCZA 1NULA 2UZIR 2YY5A 3GUZA 4BFWA 3D54D 4I6JA 4TYWA 5KNBA 1J06A 2EV9A 5A71A 3SF0A 4CM4A 3B20A 3ME5A 5EIBC 1AKTA 1J21A 2HYIC 3GELA 2XJ9A 3H5VA 4N4AA 2RHDA 2P8SA 4BGVA 4HQRA 3HHEA 5J63A 5L9AA 5AW2A 2OCPA 1JEQA 3IIJA 2AYYA 2YV1A 1LS1A 3VC1A 3U4QB 4HBZA 4IHQA 2WLSA 2WG2A 1GNPA 1NMEA 1B6GA 3ICVA 5DE3A 1V1MA 2CLMB 2TMKA 4TKVA 4PBSA 5EYPB 1A5TA 1DRUA 3EF3A 1OASA 4TSFD 2WTUA 3VAZA 1XTVA 2I71A 2GRAA 1XN1A 3T5AA 1RD4A 4MQ6A 1QQ7A 1U0SY 4NMWA 5CCBA 3QY9A 7AT1A 1IY0A 3M3HA 2O52A 3ICCA 2ZBGA 3R0ZA 4DGSA 3U7HB 4JOCA 1UEXC 3NBMA 1M6NA 2XKAA 4B7XA 5UKDA 4KIGA 5F1KA 1CZKA 5B3LA 9LDTA 5IM4F 3VR1A 1B1CA 2H4FA 1J56A 2XKKA 1EIWA 1CE8A 3UMCA 1T9CA 3KVNA 4BP8A 3I1JA 3LPNA 3PC8C 2QYTA 3U3ZA 5CH5A 2CV2A 4OBXA 1O0CA 1H0KA 1KAMA 2A67A 4GG1A 4HYEA 5E0KB 1Y9ZA 4HLDA 1UK6A 5EN4A 1N5RA 2V97A 3KR9A 3QKUA 2I2BA 1U2DA 5ALMA 4TYNA 2HV8A 2ZBVA 4S1OA 1NKTA 3QHQA 2P91A 3L4BA 4K9LA 1OTHA 2R1VB 3QE0A 3GVCA 1IHDA 4IUBS 4R3WA 4US0R 4JEUA 4DCGA 2QL5A 2EATA 5HDQA 4YYEA 5FI3A 3D02A 4ZRNA 2FZVA 4EQZA 4EUHA 3C1UA 1KI6B 1SUEA 3FFWA 2H9YA 3TQSA 2HDOA 3MJHA 3GJ4A 4Z7QB 1NP3A 5ENDA 4LGMA 1Y9EA 1L6RA 5LNK6 5K4AA 3T95A 4MW5A 1G64A 1E96A 1JMKC 1NOKA 5F64A 5G1PA 3VTZA 2VP6A 2A8YA 4H2DA 2Q2VA 3NIFB 4HLCA 1SXHA 1ZI9A 4Y98A 2OBNA 3AUFA 4A03A 1ORIA 1X15A 2XF2A 4UBIA 4KRGA 4WBXC 5IVHA 3KZMA 2NUAA 4Q0MA 4C3VA 3EIEA 4GIBA 3RASA 4AMZA 4H1WA 5A4FS 1KKMA 1WMBA 1IN4A 1MO5A 2RGUA 1WS6A 1VSVA 2QJWA 4Q02A 3HKDA 4INZA 3LECA 4B6SA 1A4RA 3IPLA 4RHTA 2DR0A 2NZVG 2LD4A 2I8CA 1XMPA 3D8SA 4BVJA 1L4KA 2BD0A 1EVYA 1EUCB 4NY1A 5K45A 4DJEC 1Q2UA 2FQWA 3M81A 2G9ZA 2H4JA 2XQKA 3NIBA 2XWBF 4ROTA 5TT0A 1NUUA 4IJMA 1V16A 5BT8A 2W11A 4FFSA 3DOJA 2H7CA 2X7XA 4DLPA 1P77A 2OQIA 3FJYA 2UXDB 1H66A 4F4FA 2NPOA 4HTAA 3LOQA 4QWMA 2V9CA 3C3YA 5DCYA 1RC1A 3NWOA 2G82A 4FFDA 1XFDA 2QDXA 1V3QE 1GFZA 1TO1E 4MV7A 4KR0A 1B15A 1SUDA 5H3HA 1Y6ZA 2AFHA 1DADA 2CSUA 3FDZB 3G9XA 2WTMA 4DVJA 5JD4A 5CA0F 1T8YA 3I58A 4IHKA 4OMUA 2D1QA 4LRYA 5MGBA 3IQXA 1VI5A 4Q34A 5AVVA 1BJKA 5LIPA 1NW8A 2BEWB 3DBHA 4R2IA 1PJ2A 2PNFA 1XE3A 3NU1A 4NYIR 4Z0PA 4MWEA 2EJVA 5KYNA 4NL4H 4CWAA 3AG5A 3GUVA 4Q39A 1XEXA 4BNDA 2QVBA 3A28A 3KUDA 4KQIA 2VG8A 2BFNA 4ALNA 2AUNA 1YJAA 2QRHA 3AIOA 1K2VN 2FZKA 3JQEA 4KI7A 4PZ0A 5IZCA 3GP8A 3D8UA 3EAFA 3QK7A 3UK6A 2EP7A 1DQYA 2XB6A 2H16A 4MUBA 1PQPA 1U0HC 4H18A 3SHFA 3V3KA 1GPKA 1IM5A 4WLVA 5CVCA 1P1KA 5F3DA 1TA4A 3BGSA 4ZAYA 3IMCA 1HKUA 1ESCA 2WRZA 5JJ5A 4IUDS 4RANA 3RW9A 4EKNB 1T4DA 3D6AA 3C16C 1Z7YA 2NM0A 4JJ8A 4U0KA 2XMDA 1QVVA 4XYGA 3KJHA 1KK3A 5CGQB 2OXFA 2R6ZA 3EGDB 2Q5LA 2D62A 4QATA 1BE6A 1DRWA 2JEZA 4UQOA 1KYQA 4WK0B 4CG0A 5FWYA 5TMDA 2C96A 3KAJA 2B25A 3OQVA 3S29A 1Z36A 3CR8A 4G0WA 2A5DA 4DEXA 4BV9A 1U7XA 3QLVA 1DIGA 1N6IA 1P31A 2J0VA 4LV8B 3QFFA 2HUNA 1OXVA 5G1OA 3OBBA 2OAQ1 1DELA 3L4EA 3PVCA 4S24A 3IVRA 1DZIA 1B26A 2VDNB 3A9RA 1NIJA 2ZTMA 1GN9A 1UJ4A 3FNIA 2NUTA 1IZZA 1W44A 3FVVA 4EVSA 3MS7A 4YRDA 2IBMA 2JJ8A 1AQUA 1PE0A 4HDMA 1GPLA 4JKIA 3ECSA 2Z8XA 5KNDA 4DR6B 1O58A 1P4JA 3HO1A 4EG7A 3ITKA 2OGWA 1NY6A 1Q0QA 3I53A 2Q21A 3HZHA 3IV6A 4DUZB 1NYTA 4F2WA 3IOEA 3RS7A 3K0AB 5JY1A 4EEXA 1HT2E 1Y5RA 3T34A 2LIPA 1YR6A 2XMQA 3B8EA 1NXPA 3P9QA 4XR9A 1R0RE 1XXHB 3CPHA 4HWRA 2FP3A 4EF5A 5K8CA 2JRCA 4IH9A 3KHSA 3A6LA 3QJYA 2JPDA 2B34A 3GEGA 4NBVA 2Q62A 3ZIAA 4J90A 3X2EA 1VPWA 3FB1A 3I9JA 1JDBC 1M2OB 3KEOA 3ILXA 1FFAA 2R2AA 3OZUA 2VSQA 1Z33A 5T4HA 4DBZA 2FHSA 1ZL0A 2Z5VA 1ISHA 2O1XA 4O8CA 2BVNA 4AIRA 3RSZA 3UPTA 4M83A 5L6LB 4F2GA 2Q5HA 2V7QD 1L5HB 2BZGA 4XA8A 1XZGA 4Q12A 1V48A 2GEDA 4YFVA 4U5XA 3DDCA 3M4NA 3FRJA 3TRKA 1DKLA 1ULUA 1ZW1A 2QRZA 2H1HA 3E7DA 3ZOKA 1HLFA 1ZG3A 3IR5A 2ATCA 3AB7A 5JAPA 4UHKA 4C21A 2ZYDA 4CETA 1NLUA 5ISMA 1RRFA 1XROA 2C4MA 3AR2A 5BWNA 1DKOA 2P0AA 3A7DA 1U04A 2CFSA 2COKA 4HVAA 1Q1ZA 4HQKA 3CN9A 4B6OA 2A92A 3BTSA 4DDUA 4F92B 5JRJA 5I9BA 3SC6A 4N5LA 4BUJA 1LI4A 3RGWS 4WDRA 4YJ3F 4CKCA 2AC2A 1SUBA 5E6SB 4JI2B 1XO1A 1A76A 1P2TA 2YWFA 1I3MA 4Z53A 1H2HA 3HUEA 4UDYX 3RSQA 2GM5A 2WF7A 5DNCA 5IM4A 1AZLA 3C7DB 3GROA 3L1IA 2J7KA 1BYIA 3PWTA 4ZOAA 2BWJA 4A0SA 3TM5A 4OHFA 1G7TA 2DWOA 2IH4A 4TS9A 2UXCB 5J2TF 1EEHA 2OHGA 4JSRA 1Z4QA 3CB4A 1YE8A 3EC7A 4UVHA 2ODPA 1JA0A 3EWNA 1JW9B 4FMPA 3N70A 1Q0PA 1Q15A 3RVKA 4RDXA 3OOWA 4CV3A 2W48A 1WJGA 4AIIA 4C2AA 1FJXA 2BFEB 2OL4A 2O14A 2Q9AA 3GJRA 2LZ0A 2VDRB 2WZCA 4I4CA 3KQYA 4MZXA 1DVRA 2HLNA 3JRWA 4Q5IA 4RWZA 2PX4A 2RHGB 4WZ6A 4RVCA 4BO0A 3G2QA 2IYXA 4Z51A 4D3SA 2IZ6A 3WB2A 4NYMR 3F2VA 3QOYA 2CFCA 3TLGA 3PK0A 1J33A 2J1LA 4O59O 4X94A 1EG2A 1JG2A 3RVMA 4B6JA 4ZCMA 3LUAA 1E1YA 4RHCA 1JZTA 3CUYA 1AT1A 4ZAZA 3GYBA 4E31A 1Z6YA 1R9NA 4LA4A 4LXUA 1C3LA 3SXUA 1FTGA 4GPAA 3DL4A 1WCIA 2QP4A 1RXSA 3CRRA 4FMBB 1GG8A 3K0CA 4MVYA 4QUEA 3QA3E 1CZOA 3B3GA 1NSYA 4HK4A 1ZHOA 5C4GB 1Y3CE 1VCIA 3EZLA 3PL1A 4U3JA 5C8XA 2VPYA 2CDCA 1KNQA 2AN4A 2Y6UA 3D6UA 2F59A 3ZV4A 4EM6A 4UUQA 1JU3A 1LSJA 3QUTA 4QL3A 1K9VF 3WXBA 2NZXA 3CURA 1HXHA 5IK2D 2JAPA 3OOJA 4LX8A 4KMRA 4N01A 1NR5A 1AU9A 3G5TA 1UZUA 4PSCA 4MVJD 4LNHA 1T6YA 1UK9A 2QD5A 4J0GA 4XIIA 3GLRA 2BGGA 3LUGA 3MAAC 2B8WA 2OMEA 4URYR 4IIXA 5BV1A 2WAMA 1JYEA 1X1EA 1VG0B 4U6NA 4FD2A 1PBTA 4YWHA 4ZU1X 2B3DA 4L0CA 4ZVLA 3RUDA 4ZI2A 2FPLA 2XB9A 4Z1OA 3HCPA 2A14A 4RPHA 5CNMA 3TQTA 3G6KA 4LVOA 3HFRA 2A59A 1WIWA 1F5SA 4GOKA 5HNKA 1BS9A 2A0WA 3EYAA 4QAJA 4W7HA 4EA7A 4EI7A 3BK7A 5CA0A 3K8YA 1DLIA 1JLLB 1KJZA 1LVUA 3PHCA 9ATCA 3R41A 4EO7A 4V0ME 1GG2A 3OCXA 1JAHA 3B1JA 4I9UA 4LJ4A 5KDDA 1PJ8A 1AXGA 3BILA 4LSMA 2DB3A 4IY1A 2GHTA 4LY0A 3PPVA 3EG9A 3KP1A 4NZOA 1TJYA 2AG6A 3I4FA 5IG2A 2ERXA 3RPEA 3NCHA 2IEZA 5G4KA 4EA8A 1NUHA 2QQFA 4EA9A 1JT2A 3SNHA 4IF4A 5J58A 5KYXB 4HNAA 5H8WA 5D86A 3S28A 4UKDA 3TG2A 1E2NA 3FSGD 3R2JA 2QGFA 1CS0B 4PRYA 3TZKA 3OA2A 5KQMA 1G3UA 2CL5A 2VHEA 3U80A 2O3UA 2WFLA 3B60A 4GOMD 4Q4JA 1XSEA 4L8LA 4UW9A 5ALPA 5ESXA 1H9AA 4C4SA 1ST2A 4NXNB 5JCOC 1I10A 5B37A 4WSOA 2A6PA 2AFIB 2H54A 3IYLW 1J2YA 1T5LA 1PZFA 5EPOA 4JC4A 1TCVA 2OCYC 1I7NA 1OV6A 1QC5A 3HK2A 3G68A 3HXTA 4EFNA 1K75A 1V0JA 5SY4A 2ANBA 3BA1A 5B58C 4WJZA 4L3VA 4QVKA 1Z4PX 4GWGA 5EXDA 1K68A 4TXJA 2V0GA 1Q21A 5F7OA 5HIKA 3MTDA 5MFZA 2Y4NA 2J8ZA 5ALNA 1H2XA 1ESEA 1JU9A 2M1ZA 3QLVC 4J91A 2ZTSA 2GZRA 3A9VA 3C45A 1YIDA 1DAHA 2VUHB 3LP8A 4LMPA 3W0LB 5C5EA 1KEKA 1FRVA 4QM7A 4J76A 2W2OA 4JEHA 2WF5A 4QJ3A 4IDEA 3W9YA 1XZHA 3L04A 4K9MA 1JKJB 4JVNA 3MJCA 1WR8A 3W5DA 3ONEA 1Z16A 1Q6YA 4QECA 2BKVA 4ZVOA 1BHQ1 4ZQEA 1Q1EA 4EY3A 4ZA2A 4LI3X 1ZCZA 2YZNA 3NYWA 1V9CA 4OOFA 2MYPA 1YL5A 2HY7A 1KZ7B 4KN6A 1EFPA 3DHEA 5HKKA 5KHLB 4AJIA 4PLHA 4S04A 3ICPA 4RVFA 3C2QA 4ND4A 2DH5A 3Q0IA 1SCKA 4RM3A 1B42A 1OPRA 2ONYA 5LQSA 4DMKA 4CTOA 1W96A 2FSFA 2XAUA 5A0TA 3QYFA 4CFZA 1ISGA 1P91A 2HCFA 1OGJA 2WU8A 3N39C 5EQDA 3RCBA 1S2LA 3H17A 4DMFA 1J49A 1FS5A 4KR9A 1NBHA 1P74A 3NHAA 3R5HA 5CT6A 1G16A 4ZT4A 1PR3A 1NT2A 4BDTA 4MVWA 1GT6A 1U0NA 1Y8QA 5KDOA 1JGTA 1V5EA 1RRCA 4GM0A 4IMPA 2O0JA 1LV8A 1YS6A 3ERCA 1LVHA 4PRLA 3U0BA 4IDPA 2X1HA 3STXA 2FMXA 4NZMA 2CHVA 3G1UA 3RUIA 4PC7A 3KLPX 5LR6A 5JZBA 1F6WA 3GEPA 2LR0A 4H9GA 3IERA 2QI9C 3VYUB 1DG1G 5L7TA 2IXBA 4NE7A 2ZEJA 3OT1B 1XALA 2DBYA 3HVIA 3TZHA 1RLOA 1X7XA 1OFUX 1KJYA 2CFRA 3IKJA 1PG0A 4OMCA 2JD1A 1OFUA 4IAOA 3ROMA 1ZOPA 3FCCA 3FGZA 3MYRA 4MKGA 2F4NA 4B71A 4D57A 3C6MA 5HFJA 2P6MA 3BA6A 5DCLA 5K1ZA 4C1BA 4DLZA 2G1JA 2FG5A 2JAHA 2CL7X 3PRKE 2QRUA 4GW3A 4IG4A 4UU0A 4XDHA 4F97A 5GVSA 1F51E 3OX2A 5AVKA 1BAPA 3F7MA 3GRAA 4YJ3A 1MPXA 3WY9A 1R8XA 2O0KA 4B34A 3KOXA 4GUAA 1ZBDA 2X0KA 3ZWOA 1M8PA 2ZI3A 3IAS1 2GEFA 4HDKB 5E1OA 4BJ5A 1ETUA 4HRXA 2XADA 4P82A 3BGIA 1AUXA 1U2ZA 2QTVA 1UADA 2BR3A 2E4YA 2YIDA 3C74A 1N2CE 3OTWA 4OGWA 5BO5A 3KQSA 4DUGA 2XDWA 3BQ9A 3KU1A 3FTFA 3C3JA 4NBKA 4LOJA 5IAGA 5J2TA 4CM7A 5B1EA 1E1LA 2FEMA 3ROEA 3M5DA 2GTPA 4PCUA 3SKYA 4YPVA 5ECGC 2X7JA 1VI2A 4F3YA 3NKFA 1BIFA 2I1QA 3SQMA 3ORYA 2PT5A 1ZNXA 5HR5A 1XNHA 4C4XA 4ODIA 1FFGA 3VKVA 4G9BA 2D5CA 1JKXA 1CULC 3LTEA 4O4IF 4D4MA 5AM1A 1R6AA 1Y1LA 1YDHA 3ONWA 4DMRA 1SC9A 4EYKA 4H4EA 1YIAA 1GLNA 5CMLA 3ZE8A 1M34B 4IMRA 3V1LA 1PLJA 2YWRA 3I45A 2IH5A 2IZ7A 2WV7A 1QPZA 1Z45A 1V3UA 3D2LA 3JSAA 2W70A 5LQMA 3HB9A 1ATIA 4IH4A 4V0KA 1C8BA 3RG2A 4KBFA 3DEAA 3JYQA 3VO2A 2UYOA 2ZR0A 4LWPA 4JQCA 4QPJC 3V2IA 3VPXA 8LDHA 3K0CC 4I3GA 3RBAA 4HFJA 1G17A 2NXCA 3H5IA 1GAQA 2P3SA 4WJKB 5EXXA 4XX0B 4RKRA 2DECA 5FBKA 2HF2A 5AHKA 4ZXFA 3H2ZA 5B1DA 5FUYA 1RJ9A 5D2CA 1TKAA 1MQSA 2VSXA 2XMSA 3KQQA 1ECPA 1OXMA 2PV0A 3DKRA 3LQYA 1L7RA 3IBGA 4TXNA 3U3RA 5K4GA 2YHSA 2FSSA 3TJMA 1TQ8A 2YXEA 2JGNA 3GGOA 4LRTB 4URZR 4B5LA 3VYVA 3E0QA 2DFTA 1UPTA 3H4VA 3I05A 4QOHA 1FRFS 3JQBA 2GPYA 3DOCA 3KVRA 3TZ6A 3A1VA 2UYHA 1MX3A 1CUCA 1I14A 1KC3A 2Q5FA 1EP9A 3HU5A 3QVOA 4ID3A 4BRSA 3H13A 4BX9A 3QW2A 4UULA 1KEWA 1YRQA 2ADFA 2BBOA 4OU5A 1S0UA 2OFXA 4JDPA 3ZEAA 2VK1A 2KB0A 4EQ6B 3OAAA 3JZIA 1HT1E 1U7HA 1O57A 3WLKX 4CMBA 3AL0C 3ABIA 3VPSA 4C0BA 3EQ6A 1XL0A 4FGUA 4XCVA 5KTKA 3RAFC 3DTVD 3KZKA 2CMFA 2FXIA 5KWVA 2A5YB 3P0IA 4B3SB 3MIIA 1JTFA 1HNXB 1NVBA 5JJCA 1JFFB 1AE1A 3AQ4A 3QFHA 3K1ZA 3NTLA 3CXRA 3KXPA 3AR5A 1QX3A 3P4XA 2IEBA 3K16A 2C97A 4MUGA 3EXFB 2F9FA 1OJLA 4NJMB 3TINA 3AR4A 4F6CA 5IKXA 1K7EB 4GPIB 4MWGA 4MUKA 4P38A 1JIUA 3SFTA 3LX4A 1DXQA 1ZM7A 2RH9B 4GKJB 2H17A 3DMTA 3G5MA 2Q5IA 5AI0A 4FFVA 1QRDA 1X7WA 3NBFA 5IW8A 3IBSA 3VZRA 3E15A 1NPDA 3QKSA 4FFMA 4R1PA 2FDXA 1UANA 3N2YA 5B7GA 4YRJA 1DS6A 1TM5E 2UZ1B 2IS4A 4EJSC 3KOMA 1O6BA 4KHPB 1T0IA 1X77A 2XZLA 3UH0A 1CQIB 1SOAA 2R1TA 4MVCA 3VZPA 2DKOA 1MJNA 1SUFA 3LO5A 3V8VA 4DQLA 3T1QA 2H51A 2HJ9A 3QX7A 3WIOA 3JQ6A 3EHEA 2XGJA 4G01B 1EX6A 4JYZA 3HKBB 1UMCA 2PY6A 1KTIA 3N0RA 5EE5B 1PN3A 3NIDB 2ZBRA 2YJGA 3P5SA 2ZS7A 5GP1A 3W2EA 8ADHA 4MWBA 5BP7A 3DTTA 4FMDF 3NUZA 5JXWA 4Z0NA 5JAZA 4WBNB 2HNKA 4AZ0A 5FDFA 4MDYA 2C7GA 3BXHA 3USCS 4P8RA 2FPWA 3E58A 1PQ4A 1VYUA 3FYCA 1FYDA 2D00A 2NMVA 5AKEA 2A4KA 1CY1A 3BMNB 4G5FA 2PWBA 3P0RA 2PUWA 3GUHA 2QVLA 2C5EA 3AH8A 2VT6A 4K40A 3UT6A 4GI3A 4BFXA 5BUCA 4BV3A 3FMVA 3DMFA 3UMRA 1E2BA 3PQ5A 4ZVKA 1LWNA 2B92A 2HMUA 3VQTA 2GH1A 4LGVA 4ND3A 3CCCA 2R86A 2YFHA 3EISA 4ZAGA 1RPZA 1SCBA 3T4UA 4HAVA 3F5DA 1E99A 2Q2QA 2FA9A 1RYMA 3R75A 4XM1A 2C07A 3BXFA 3PFNA 4O4HF 4UVEA 4R7GA 1MX5A 3I34X 2OB1A 1IQUA 4OGLA 3Q12A 2PVSA 4YJ2B 5TY0A 4RTKA 2V0CA 3DMGA 1QDLB 3NANA 4YO8A 4EPRA 3IQGX 5L7YA 4Y1GA 4EGAA 3FVWA 1GSOA 3OT4A 3PIIA 3QUQA 5GPBA 1ZJZA 2QRVA 3BC1A 5DYYA 5EIWA 5BW5A 4Q3KA 3IMEA 4TXLA 1E2HA 3M6UA 1U0RA 3DE4X 1HF3A 1JSZA 3KVOA 3L79A 3OG9A 3FLBA 3X1WA 2BGTA 3GJTA 4QG3A 1CPYA 2CBGA 2Y1KA 3ESYA 4LNUA 1RIIA 3P8ZA 5HQ3A 1QOQB 4ENUA 4BVKA 3K1TA 2GK7A 2JA2A 4MKRA 3KYIB 3ZWVA 1XTUA 3BOSA 3QKRB 5BQ5A 5FWXB 1SU8A 2OCDA 3N07A 4E7PA 1C9DB 1SULA 3DEFA 1NW9B 1RHRA 1W0JA 1ZI8A 1PX0A 2EQAA 3JALA 4MA4A 1ZNWA 1WKCA 3HXLA 1N0UA 3AL3A 4OK6A 4AJ1A 1H6DA 2TRSB 4E2ZA 1I1QB 1G8AA 1L4FA 2AXQA 3O2JA 3QOWA 4FE3A 4KXYA 4P93A 1VYHA 4K0KB 5DFAA 4MVJG 3EVNA 3V2GA 5TQVA 1E20A 3VBCA 3OPNA 4MI9A 4L22A 1HG0A 3S8MA 3BRWA 4UXJA 2OORA 4JLNA 2JFUA 2V7UA 2Q8NA 3NC4A 1TJNA 2NT4A 2O2IA 4Y9UA 2Y8EA 4O63O 5JROA 3ZVNA 4S1PA 4IFBA 3LYAA 2I7TA 1D2CA 1RI2A 3FPBA 3KSMA 2ACWA 4HWOA 4NNPA 4PPGA 2NSLA 3DWGA 5DMHA 1JJAA 2GXQA 5FR2A 3COVA 2XT6A 3I2YX 4RZ3A 3FBTA 5G0SA 1SC1A 1YA8A 3TWOA 1S4MA 2CHUA 3OFJA 4MLDA 2Z4RA 2X3YA 4OJQA 3SYMA 1HWYA 3E03A 1GGNA 2H7XA 2NIPA 3G8DA 4Y2YA 3O6VA 2QOEA 4TLEA 3RSHA 2ZAYA 2IZ5A 3REQB 4DQUA 2CNBA 4R6XA 4BLVA 3PEYA 2HNAA 2QIOA 2VHCA 3A2MA 2CLIB 2EZ4A 1VI6A 2FPPA 3CLRD 3ZHSA 3WYDA 1EBUA 2B4QA 5G3ZA 1UKVY 5H83A 4MGZR 2WUVA 3GBVA 3IA7A 4KDRA 1CP2A 2PX0A 4QDOA 4UNNA 4CGYA 2B98A 2WWHA 4YXFA 2A3RA 2C04A 3KB6A 4O4IA 2Q3CA 3DLBA 1ZGAA 4Y6LA 2JIRA 2VP2A 4HO1X 4AUEA 1V9SA 3DB2A 4OH7A 2HJWA 4KJXA 3CKKA 3WK6A 4AKHA 1T1JA 5ALXA 1JHXA 4G84A 1SBQA 5D5QA 1Y5LA 3TE6A 3WXMA 2EX0A 3B70A 4CCSA 3O9ZA 2IGBA 1T2NA 3CRMA 3IKLA 4GXTA 4NJOA 2OHIA 4DSZA 5KSWB 2B61A 4NENA 5CH3A 4B2PA 1QONA 1HT3A 3SJZA 1NPTO 1QYXA 4OHPA 1H6CA 2TECE 3CCFA 3ODGA 5J59A 2FPGB 2P2GA 4B4KA 2BMAA 3O4RA 3D6FA 4JGGA 4Z3DA 3QY0A 4U7WA 3ENZA 4J75A 1II8A 2H4HA 3N9IA 3I09A 2JAWA 3BBPA 5CTAA 3T8YA 4AD8A 3UB4A 3WYAA 3KTAA 4LF4B 2YWBA 1ZUWA 2ZP1A 1Z0KA 4ZQGA 3VSAA 3GLGE 1Q20A 2IHTA 3ESQA 2H57A 3OE7A 4QXOA 2ZULA 3LWNA 3HN7A 3QG5A 2HIMA 4X71A 4M8NE 2RARA 2Z83A 1Y4UA 4I08A 3GLHA 3IQDB 4N54A 4RTQA 1Y1SA 3LA6A 2E4UA 4LOIA 2XVXA 5L8VA 1QKJA 4F5WA 1GRVA 3A7EA 1AS3A 3FZYA 3UAOA 1MV5A 4E11A 2ZZKA 2EP8A 3IQWA 4XIFA 4Z4IA 5GJBA 1N75A 5AH0A 2IOYA 1M10A 2HRZA 5CHEA 2XYVA 2Z2JA 4HB4A 4QGGA 3VYSB 3WAKA 2R5FA 1Z5GA 3CW8X 5DYWA 3TLCA 3ED1A 2CLOB 1XKLA 2E2WA 4HDNB 3MERA 3P5BA 3GD7A 4ZQBA 4LVUA 3OKPA 4B85A 4DTCA 4JNCA 4XB2A 3VNSA 4HLUC 1SBYA 2XX3A 4I50F 4NFHA 2WPDD 3ABQB 1RQ7A 5DWQA 3UC5A 2C0PA 1HZZA 2QHXA 2JHCA 1T2FA 4G4IA 3GFSA 4DF3A 1BX3A 5CB4B 2UYGA 1W5BA 3ELYA 4NQRA 1OXUA 4JWKA 3L5KA 3KB1A 1Y4AE 3MTQA 4AJLA 1SELA 4C0XA 1PO7A 1VGQA 1XMIA 2P6PA 2ZS9A 1JN0A 4Q18A 3V34A 4E15A 5G2OA 5B58T 3SZRA 1H0HA 1VRCA 1YFZA 3JRXA 4Q9AA 4U7FA 4RZIA 5ALTA 1U3DA 3RIMA 2IITA 2ZYAA 4EELA 4NOKA 3ND8A 3WLEA 4OB6A 1EHIA 4QYIB 3UJDA 1XP8A 2DWPA 4GXQA 5F4BA 1PLKA 2GXUA 4CDNA 7REQA 4RHUA 5CXXA 7GPBA 5LQKA 3OLYA 5IN4A 4TL9A 1Y3IA 2RSLA 2ZSBA 4RF2A 4XSGA 1MOZA 4BZZA 1FXWF 3FM9A 3QMWA 2XVMA 4Q3LA 1ODFA 3FUVA 3M1LA 2P9QA 2CLSA 1ZQ1A 2JHPA 2VS1A 1K6XA 1GRCA 3I4CA 3UUGA 3FOZA 1OBCA 1EGVB 4KUGA 1P3JA 2ZWMA 2IYAA 1XFAA 1FY2A 1VLLA 4MXDA 2H5IA 2VAXA 3MJTA 4NXMB 2O3QA 2AX4A 3QPCA 1KI4A 4QWWA 4R3UC 1CF2O 2D2IA 1UMBA 2ASVA 4M0EA 4KWEA 3E2MA 4LK3A 3CV3A 2ZSEA 3OTHA 5JECA 4HNTA 4N1AA 2EW2A 2GNAA 2G09A 2H3HA 1T2EA 4F4IA 5L40A 2XMRA 1VJCA 4HX2A 4OL0A 4RQTA 3HM2A 4R71A 4O4HA 2YOHA 4EFDA 1KA9H 5G0TA 3UKDA 1OOEA 2R1ZA 3L7OA 3N0VA 4DUYB 3VZQA 1PR1A 4Y2SA 1M67A 5BMVB 4OHMA 3GGSA 3CZAA 3MINA 5EERA 2RBGA 1QZ3A 2HPHA 4I9GA 1NSFA 1ZUIA 3TZEA 4L9WA 3HXKA 5JRDS 1DDOA 2REQA 4YBZA 3C87A 3AM4A 5FFMA 4IDFA 4KVAA 4H7DA 4B4WA 4D74A 1FOEB 3H7IA 3CM0A 4CZ2A 2EZ8A 4PIMA