2BEWB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
336
Chain Sequence
AHFTFQPEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
total genus 125
structure length 336
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bewB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bewB01
4KXXA 3RIMA 1UMCA 3EXIB 1V5GA 4MPPA 4GM4A 4QPZA 3FZNA 1WCIA 4D5GA 2C3OA 2YIDA 1NI4B 1DTWA 1W88B 1X7ZB 2PANA 1UMDB 4C7VA 1R9JA 2VK4A 1V1RA 3F6EX 3EXFB 4GPEA 4MZXA 1DTWB 1OLUA 2AG0A 5DGTA 4K9PA 1WCIB 5IMSA 3EXEA 1U5BA 2BFBA 3JU3A 4MPJA 1X80A 1U5BB 2BFBB 2G67A 3EXEB 2Q29A 3DUFA 2FWNA 2Q5LA 1OLUB 5ESDA 1Y9DA 3EXFA 2OZLA 2J9FA 2X7JA 2V3WA 1POWA 3M34A 5EJ9A 1ITZA 1L8AA 3AHFA 1QS0B 1BFDA 3EXG1 1NI4A 2O1SA 1X7WB 1YI0A 4K9KA 1MCZA 3UPTA 1UMCB 5EJ6A 2BFEA 5I5EA 3EXHB 4GM1A 4JUCA 1W85B 4D5EA 5EJMA 1V11A 1YHYA 3FLMA 3LQ4A 4GP9A 4FEEA 4Q9DA 2PGOA 3ZHTA 2UZ1A 4K9LA 2BFCB 1UM9B 1V16B 3HYLA 3LPLA 1V5FA 1X7XA 1TKAA 1YI1A 2JI9A 2PGNA 2BEUB 3AHIA 3HWWA 2UZAA 2VBFA 1X7XB 3DVAB 4C7XA 1TKCA 1OLSB 1RP7A 3AHCA 1OVMA 1YBHA 5EJ8A 1N0HA 5K3SA 2Q28A 2BFDB 2JGDA 5FEMA 3EXHA 4MQ5A 2AG1A 1QPBA 2JGDB 2VBGA 3AHEA 2R8OA 3IAFA 3ZHSA 4K9NA 5HYVA 5EJAA 1UPBA 4XEUA 2BEVB 1OLSA 2WVGA 4KGDA 5ERXA 5AHKA 2E6KA 2XT9A 3KOMA 5DEIA 2J9FB 2OZLB 1OZGA 2Q27A 3ZHUA 3LQ2A 2IHUA 5K6RA 2UZ1B 4RJKA 2BEWB 2QTCA 5EJ5A 3DUFB 3M6LA 2C3YA 2EZUA 2JLCA 2Q5OA 1X80B 3ZHRA 4MPRA 1UMBB 3HWX1 2VK1A 4KXUA 2R8PA 1T9AA 4K9QA 4JUBA 1IK6A 1X7WA 2C31A 2VK8A 1QS0A 1V5EA 1X7YB 3EXG2 3EY9A 3ZHQA 5DGDA 1YNOA 1X7YA 4QQ8A 1PI3A 3AI7A 2FN3A 2YICA 1POXA 1T9CA 2NXWA 3EXHC 3LQ1A 1PO7A 1AY0A 3DV0A 2WVAA 3EXIA 3AHDA 4K9MA 5K6TA 2VJYA 4QELA 3IAEA 4KXYA 5ERYA 3DV0B 1Z8NA 2BEWA 5I4IA 4RJIA 3AHJA 2QTAA 3EYAA 5EJ4A 5K2OA 2C3UA 1V1RB 1OZHA 5EXDA 3F6BX 1UMDA 1B0PA 1PVDA 1V1MA 5I5GA 1GPUA 2IEAA 4KXWA 1Q6ZA 5I51A 1W88A 1X7ZA 2BEVA 2EZTA 1ZPDA 3FSJX 1YHZA 2O1XA 2IHVA 2Q5QA 1W85A 2C42A 2G25A 1KEKA 5EXEA 1UMBA 2DJIA 4JUFA 3OOYA 1T9DA 3E9YA 2G28A 2WVHA 2BP7A 2Y0PA 4GG1A 1OLXB 2C3PA 3M49A 1T9BA 3AHGA 5HHTA 2EZ4A 2JI8A 3DVAA 5HJEA 1YD7A 3UK1A 2BFFA 2BEUA 1QGDA 2JIBA 2JI7A 2JI6A 2BFFB 2Q5JA 2W93A 3D7KA 4FEGA 4JUDX 2BFCA 4JUAA 4K9OA 5EJ7A 3OE1A 5HGXA 4JD5A 2BP7B 3ZHVA 4RJJA 4JU8A 1V11B 4JU9A 4WBXC 3L84A 2VBIA 2BFEB 2BFDA 1TRKA 2JLAA 3EA4A 3M7IA 2XT6A 1V1MB 1UPCA 1TKBA 1NGSA 1OZFA 2XTAA 2EZ8A 2EZ9A 1UPAA 4GM0A 1PYDA 4KXVA 5C4IA 1JSCA 1OLXA 1UM9A 1V16A 4COKA 2IHTA 2C3MA 2PDAA 3MOSA 4ZP1A 2R5NA 3AHHA
chains in the Genus database with same CATH superfamily
1BE6A 2ZOSA 4J6EA 3STWA 5D00A 5BURA 3EIUA 5FTLA 1XYVA 3VPGA 4GC5A 1HEUA 5FA5A 3MJEA 1DOZA 2HLDA 1MV8A 3KT0A 2JFPA 2Q9UA 1DFHA 3IAUA 1B2RA 4I81A 5T4HA 3ZWPA 3DGFC 1BDMA 3HL0A 5JBIA 3SI7A 2A0FA 4NMXB 4F4JA 1LPPA 4IHJA 4G4SP 1RMTA 2WLSA 5B3JC 1V3TA 1BWRA 3MWGA 3AEUB 4FE7A 5JEDA 1VBMA 2FQ1A 1A9TA 1XJ5A 5DLDA 5HQ3B 2R8XA 1LC3A 1UF9A 2ZITA 3FDZA 4N5NA 3RYFA 5JI3E 3DT8A 4MUKA 2M1ZA 2JZNA 2PGDA 3GZNB 5INTA 4EDHA 1ZHOA 4YRPA 4AZ3A 1L7DA 4KG7A 4NENA 2Z2IA 4IG9A 1W29A 5C1PA 1QTQA 2IEDA 3BD9A 3ICCA 4NDAA 4RENA 3VSBA 4D3YA 5BN5A 3I6ZA 4MV7A 3Q8KA 2JI9A 1QH9A 3EC7A 5H02A 4BO3A 1FTGA 1IG0A 2BKVA 2UKDA 1XRLA 3CNOA 4Y2QA 3BTVA 1BXRA 3K92A 5EKUA 5SZKB 3F6CA 3VDMA 4UC0A 1M66A 1ML4A 3TZHA 2YHAA 3UMRA 1OT3A 5C52B 1JDJA 2Y68A 5FBLB 4P0TA 3UM9A 4OGWA 5DEIA 4AF7A 1Y80A 3W7AA 2IHUA 3JQCA 5E2BA 5FTKA 3SZUA 4ETNA 1Y8QB 3FB1A 2F2TA 1BGXT 3JQ7A 2R6CA 2Q9AA 2V03A 3CWCA 5EIEA 3ZHCA 5IJAA 1LNSA 2BFWA 4YUYA 3B1XA 3JQFC 1SOWA 5F9HA 1T5LA 1Y1LA 3VOBA 4AIIA 1OFUA 5KCZA 4L6CA 4RPGA 4TTQA 4ZT2A 4MEAA 5JRZA 3BXPA 1F38A 4BC1A 3ME5A 2WU1A 4RVNA 1YIOA 4KSCA 1W46A 1I2AA 1V7QA 3LYAA 5BSKA 2MHCA 4ITRC 4XKJA 2I76A 4D4MA 1E99A 1RJDA 1HF3A 3RK4A 1KJWA 4LWZA 4CW7A 2A9FA 3EDMA 2GLTA 4YYZA 3A6PC 3RRBA 4CYMA 2GD2A 2VCHA 3L1IA 1TYAE 2JEOA 2XH8A 3KQQA 4IIJB 2EZTA 1J8DA 3H2GA 3NJRA 1A8QA 4PX2A 5CX1B 2AFIA 1Y5NA 5C7YA 1N2GA 4EG7A 2G25A 4Y6OA 2PT7A 4KIJA 5BT9A 3T3HA 5BOVA 5JARA 2P7HA 5JNLA 2K2WA 2JFQA 1JS1X 2YZ2A 3KWMA 3QTBA 4CQLB 2ZWIA 3TRDA 1I51A 3QY0A 4DSNA 1OBFO 3KLMX 3FA2A 1DDGA 1RCTE 5JSHA 2WJPA 4C87A 3G8DA 3T9EA 5M34A 1M6NA 1MO6A 1E2IA 4N0EA 4RS4A 1EX7A 2QYHA 4QLBA 4S1OA 2WTNA 5JS2A 3OTGA 3WK8A 2V7PA 2RB5A 5L4SA 4RD0A 3IPLA 1DBQA 3NBQA 3PXAA 3HB9A 4O2AB 4BS9A 1SQGA 1YDEA 4HEHA 1T1IA 3PRHA 1EE2A 3H5IA 4PRKA 2XRFA 5ENVA 5DCYA 5L4LA 4GI1A 1Z0ZA 4I55A 4JBLA 3RF7A 4FUTA 4I9FA 5K03A 2IUSA 4RADA 4D6PA 3LY5A 3EDRA 1Q50A 1KSFX 3MS2A 5TMPA 2X8WA 3IVXA 1SXJC 2QW1A 3SVLA 4A8HA 3QUAA 1FJGB 2PVPA 3G5LA 5TQVA 3UJHA 4F72A 4Q16A 2XUFA 3PZRA 3VZBA 3PF8A 1Z2PX 3I5UA 1XTIA 5I9MA 4PO8A 2PR2A 1O03A 4Q1DA 4A15A 3BORA 1DKMA 4RDCA 3L01A 3HRHA 4FC7A 4XA8A 4YHBA 5LA6A 2HWUA 5ESDA 4A23A 2OV2A 4DLPA 2OZLA 1GAWA 2L17A 3GCWA 4ZK6A 3BICA 1TTTA 3DM5A 4WD3A 4U02A 1USIA 3RBAA 5BQPA 5JXWA 3X1MA 5B7NA 5J23A 3LHIA 1UDAA 1ZOIA 4CV1A 2VRCA 5AOVA 3B5JA 3ND9A 4M46A 1XAIA 6AT1A 1MPTA 4AJNA 1YQTA 2NU6B 1O6GA 3BL6A 3DCNA 3UWMA 3ZY4A 4DV5B 4NE9A 2WZDA 3QJGA 1PGQA 1T8WA 1E98A 2IXAA 2OV8A 2Z8YM 3BH6A 2FG7C 3PPIA 3S29A 2AYXA 2CC2A 3AEKA 1FLAA 3GX1A 3TIIA 5A6SA 1ULHA 3NHYA 1NYTA 2V7GA 4QNRA 1N0HA 2I99A 3A6KA 3I0NA 3JARB 3L6RA 4FPXA 4O4LA 3RW9A 2IF0A 3OPYI 2I6XA 3S0JA 3AW8A 3D3WB 3JASA 1USKA 4JXZA 2HU7A 4FFPA 5EXPA 2QM8A 1U0EA 2QE7D 3CVJA 3EVAA 3B8EA 2JGLA 5CRIA 2H18A 2O1EA 1GILA 1C0EA 4Q7KA 3QFRA 4ZEMA 5ERXA 3A4NA 4PHCA 2WJYA 1P2UA 3O1IC 2UUCB 2XQVA 3HJBA 4HZIA 2HQOA 1B4DA 4F21A 1DKUA 2DUMA 5ALGA 2Y9PB 1Q2XA 4FEYA 3ORHA 1FY2A 1JECA 2PLFA 4P3XA 4RVHA 5DYTA 4DNPA 2VATA 3SX4A 1EUDA 2C5EA 3TQRA 3K20A 1S9HA 1T9CA 1SQ6A 1NQTA 1YUMA 2OD2A 3SS7X 3TPCA 5IKMA 3BILA 5AXDA 4TTVA 2H4ZA 2CHQA 3AF5A 1P1KA 4IV8A 4DA8A 4OSEA 1P72A 1YHNA 2FU5C 2R8YA 3CUSA 3IGFA 1BMFA 1V1RB 2I2WA 4E5PA 4M1OA 4ONEA 5CCBA 1CPYA 1G5PA 2BGNA 5JI2E 4AC9A 4QGBA 4TLAA 3BA1A 3FDXA 3QLUA 1NE7A 2FR8A 4XLZA 1QDLB 1MO2A 4RVOA 3FNBA 2BCEA 3L9WA 4GMKA 4PSUA 2QSYA 3OZRA 5EIXA 1U04A 4KH0A 1LDGA 1GPH1 2NXEA 2ZRAA 5FOQA 4QNNA 2VP9A 4LZNA 1PEKE 2GEVA 4BP1A 5JATA 1KP9A 3AO0B 1C9DB 4PY2A 1T34A 3ZZ0A 1P75A 2CWWA 2RGNA 4JHLA 4QAJA 2OV4A 1AHPA 1RTTA 1EWTA 4B3TB 2AW5A 2JLRA 3D3JA 1MRNA 2N47A 5AUPB 4QRHA 3FDZB 1C0IA 4BQPA 1F7VA 3D3EA 1OVGA 1IY2A 1JIJA 4IRUB 2G8LA 4H3KB 4GZ3A 4COKA 3FDIA 2H2HA 2NQ2C 4BXOA 8GPBA 2E4AA 2HBRA 4FGSA 1FFDA 3K0SA 1F12A 4MQFB 4A91A 3Q4GA 1B42A 4TTRA 4WW0A 1P2BA 1U7TA 1C3XA 2C3OA 4FBMA 4CV0A 5LLDA 2Y4NA 2IQ5A 5LKRA 5J2TF 4OGLA 4MW0A 1WHSA 5LYJF 4KO8A 1Y33E 1NVEA 2FPWA 3GPLA 2CV0A 5AJXA 1H8HA 3KV3O 5E3IA 1TLLA 5BSTA 1MV5A 3NTXA 3RC7A 4AJHA 5A2GA 4NEQA 3RM3A 4ZDJA 2EOAA 4Q3EA 3QMPA 2Q5LA 1EP3B 5D2CA 5AVYA 1V8OA 1MJGM 3ZQUA 3D4PA 2GCPA 2OFWA 1RACA 2OO3A 2ZSIA 4PQEA 5CLGA 5ILGA 4AKHA 1XIVA 4M8SA 1AK1A 1LWNA 1HRDA 1P60A 5ICMA 1MC8A 5E8RA 3FCSB 3NXSA 3SF8A 3SEQA 5ER9A 3TVYA 4ZV7A 4DSZA 1Z13A 2PSJA 1U80A 4U39A 4S1VA 2D13A 2XMPA 3VSAA 1CERA 4JJ7A 2P67A 2WM3A 5AKXA 1Q7TA 3ADOA 3GNSA 3LI2A 4TWBA 3QSYA 3DW3X 1X7XB 3OEHA 1KU6A 3SHFA 5DP1A 4BLVA 2D1YA 4DCOA 3X43A 3B8HA 1MQ8B 3NU1A 2WDPA 1FNBA 2IEZA 3OLZA 5FRDA 3VO9A 4DCJA 2AN5A 3IMCA 3JD4A 4D0GA 4XCQA 3LY8A 1P5HA 1ZJJA 4HD8A 2C7QA 3JYQA 4IQ4A 1IHOA 4Q3CA 2MMCA 4QBHA 4TLLB 2QW0X 3ZLTA 4BNLA 2AC2A 5ECDA 3ST7A 2W98A 4MZDA 3RVKA 1T26A 3OQBA 3RRFA 2R6HA 4DLXA 5C37A 4ZAVA 3BBLA 5FWYB 1U0SY 3PEVA 3RVMA 1XN1A 3H0CA 4D9KA 4D25A 4EYQA 4FFWA 2M6SA 5L53A 3GRYA 3BCRA 3GT3A 3LQ1A 3DDWA 3QBEA 1XMJA 1XTVA 1ZOPA 5KX5B 2CMDA 2UZ4A 3Q9LA 5AVRA 4PLGA 1JTFA 2R1TB 2O8CA 2FMKA 1Q0LA 1WD7A 1PR6A 2NV6A 2R6JA 3ZW8A 4V1CI 4UM5A 2QI9F 3HI4A 4AZ0A 1W88A 1E96A 4GBED 1MABA 1QIJA 1E3EA 2CHGA 3AETA 4FYVA 5IUNC 4U0JA 2GCEA 3WYCA 3TUZC 4K87A 1UMBA 1B76A 2XECA 3TMKA 3TVDA 1PDVA 1T8SA 1MNQA 1ORDA 4U4AA 3N87A 5LZ9A 2IYPA 1UEIA 2AEEA 4IJUA 1YA4A 5TQ2B 1SCIA 3FYTA 2QSJA 2MDTA 1BFUA 3GNTA 5B1SA 3IQHX 4BB6A 5HKBA 5SZIA 1IB0A 1S2OA 2BELA 3FWYA 3H4IA 2JAQA 2Q4BA 3U4AA 3ZCTA 4FDUA 4H7EA 4JI5B 1DCKA 4AKIA 3GJYA 4LZJA 4D8VA 4PLTA 1M1NA 3ABIA 1JQ3A 2FPGB 2FTKE 2RB4A 3WIDA 4Z7JA 4IY1A 1WV0A 2XKBA 4MPPA 3E3LA 5B55A 4NNJA 3LA6A 1LRLA 2QY6A 4MVJG 3SKVA 2BJVA 2Z2ZA 4M1SA 3HCAA 3M3PA 3BFPA 1YFZA 5JFGA 5HQ3A 2CHVA 4B6PA 3G2MA 3LO8A 3SSOA 3ZGXA 4ZYXA 1P91A 5CFZA 4I50A 4EAQA 2B4YA 2ZJ2A 3ICVA 3UUFA 2EFEB 2X0FA 2ZJ5A 2F67A 2X3UA 1JDZA 1VKJA 3GAZA 4ID9A 1GRNA 1VRCA 1ZWKA 2I2DA 4PSVA 3OTOB 2PIAA 1EFVA 3JR7A 4HFRA 2ZXEA 5K09A 4ZCTA 2PCJA 4UAUA 1Q7GA 4RGVA 4R1TA 4RV9A 1W0JA 3FNRA 3JRXA 1SIBE 1YQXA 4JVLA 4ZGWA 5K0BA 1VZ3A 5CX4A 3TEMA 2Z56A 2PS9A 1LXCA 4MHOA 3K9QO 4JT8A 5EY5B 3UJ3X 3H18A 3HU1A 2F1KA 3IUSA 1PEAA 4R0NA 4XLLA 3OZEA 2O7QA 1NW9B 4C3VA 2PD4A 1AF7A 5C1IA 2W37A 3L93A 1WO8A 2XWBF 4WA7A 1ISSA 1SUAA 1W4RA 2RHLA 3DWGA 3F5SA 4J43A 1BCRB 5H83A 1ZNZA 2VP5A 4LHWA 1GO2A 2J3IA 4ZPJA 4RXMA 1CHNA 3EG9A 3SSNA 3DNPA 3QF4A 3JALB 2QTWB 4NV1A 5E6UB 1PX0A 4PC3A 4C0KA 5KTYA 4F4CA 5IAAA 5LP6B 4DA4A 1T36B 3NX4A 4N1AA 4U7JA 2HJWA 4G1CA 4IJMA 3PNBA 4OIMA 4XAQA 3ZD6A 5JFTA 2QLTA 3AG6A 4EVIA 3IPCA 4YN3A 3K16A 2Z04A 3OZCA 4MO9A 5DM1A 1M5UA 1AN9A 4DLUA 2WPNA 1WSBA 3NHFA 4HGRA 4HQLA 1O96A 3WA6A 5IDYA 3F9IA 1BVRA 4MW5A 3SGLA 1NL3A 3FOCA 3BJRA 3F4LA 3T5BA 4DV0B 1ZM7A 1W9HA 1GRQA 4P7FA 4OHRA 1DGQA 1JLMA 4QUAA 5F7XA 3DV0B 4RJIA 4HH3C 3SZLA 1W581 4EY3A 3WRWA 4GR4A 4M9CA 4H59A 1VGRA 1PVDA 2BKUA 4TRMA 3R8FA 3I12A 1WF3A 4K8OA 3ACBA 3VU8A 3LIIA 4ZTBA 1OTYA 5C18A 2OXTA 3O2JA 4IGEA 3ONEA 5HTKA 1WSDA 2Z8YA 1HMPA 2C95A 1KKLA 3GWGA 3OOYA 3QPDA 1G2OA 2OB2A 3B53X 2JIDA 3QPAA 4P2BA 3WQQA 3P94A 3PD0A 1OA0A 3DZHA 4EI8A 5ITZA 2ORIA 4QUGA 2C96A 2H16A 3L18A 3OE7A 4FFLA 5DX1A 2CEKA 4MS3A 4PZ0A 3TJMA 1ZH2A 3K4QA 4M0UA 4GVLA 1WTCA 2AFIE 1LPBB 2CGEA 3LQKA 4JOCA 3VR5H 1VE9A 2AN1A 3KJNA 4X6UA 7MDHA 1ORIA 3VR3D 4GICA 3FPHA 2ATIA 5GZ6A 4AZVA 2PKEA 2H4FA 3P96A 4UBJA 3T52A 4DWOA 2K4MA 2QS9A 2B25A 3HJGA 4CM1A 5BYJA 2ZYDA 5E9AA 1CY2A 1GP2A 3B3JA 4CMBA 2IV2X 3CLUD 2A86A 4I9HA 5BQXA 2DPYA 3NHZA 2KBFA 3NM6B 3G2JA 1OI3A 5ILOA 4QUKA 2IZ1A 1O94A 2E0IA 4JLKA 2WJWA 3GJ0A 4PSCA 5GM1A 4CF5A 4DLWA 4F12A 1ZJWA 3EC1A 1QGED 3EGOA 3R75A 4Z3OA 4DDMA 5FP0A 2RBEA 3R9XB 3AM1A 4OY3A 1TQ2A 3BMCB 3FYUB 4TXNA 1DU4A 1RAEA 3FJOA 3LLSA 2FHSA 3NM5A 2P9YA 3FWPA 4IGIA 2J3HA 2VJQA 4NYMR 2WOOA 5E7IA 3SJUA 3PC2A 2IYEA 3E5RA 2RI0A 5A9SB 1J56A 2IOQA 3IFSA 3H2IA 3TTXA 2J3LA 1GTVA 3PGA1 4HQNA 1PG5A 1P5RA 1OC4A 4AMUA 1ZKMA 8MHTA 3M33A 1BX1A 1P81A 2CNDA 4QA9A 4XYEA 2GWHA 3WAJA 3TNLA 1HYQA 2JKYA 4D43A 2O3SA 2XCLA 1GTZA 2I4RA 3GBSA 5HZMA 1P2VA 4P4SB 1E7MA 1HG1A 3LY7A 4LJYA 1AQLA 1KVUA 2JIZA 4WHMA 3HBMA 4HXFB 4XR4A 5BV0A 3NV9A 3LPDA 2GERA 1JTEA 2VH2A 1KOJA 1C0LA 5BSFA 3ZUPA 4L5YA 4BVEA 4DLNA 1E20A 1OY1A 4AJ2A 1NI3A 3RV4A 3SJZA 2O5RA 4OVKA 1QXSA 3HCDA 4F60A 2B20A 4DMCA 3IMKA 4MV9A 1NBMA 3E5HA 3EQ8A 3QKWA 1JBKA 2BGTA 3WA7A 1O5OA 4G36A 4I5DA 4C01A 4YRCA 5F2OA 2IYNA 2FOIA 4IFEA 3DD1A 4R54A 5K0TA 2VNSA 2DVMA 2EV9A 4NCNA 4OQDA 1V2HE 1WRBA 4UEQA 3ODPA 1XCOA 1T24A 3AFIA 4ESHA 4QQ8A 1QP7A 2JPDA 3MTJA 1R64A 2Z3VA 1DXYA 1ECJA 2IK8A 2O4UX 1HRKA 1T1RA 4FK8A 1YR7A 1RXYA 1TQ8A 4V0LA 3ZC3A 3A1UA 3LP6A 5ALLA 1OYOA 4NCBA 4ZIRB 3GI1A 3BMQA 4NBLA 3MJSA 4YMHA 5K5EA 2VDKB 2X7HA 5ALIA 3ETLA 2VAVA 3C41J 2FPGA 1YBAA 2ZI6A 1HE3A 2W70A 3KL4A 3VNBA 1O08A 1E0KA 1TZ2A 2YVAA 3D1VA 2ID7A 3ESRA 3LJKA 4P80A 4U9IS 3ROEA 3FSJX 2QM3A 1OH6A 4DIUA 2I4IA 1N2BA 1DRVA 1UK6A 2F3RA 3LUBA 4WECA 3V46A 1XX6A 1XXHE 3RBZA 1GYQA 3MFYA 3JARA 4C04A 1UH5A 5HF9A 4PQGA 1JF8A 1RQ2A 1Z12A 2PEYA 3QU5A 3GDOA 1JHRA 3T5CA 5HJEA 4W1QA 3QXJA 1HY3A 2IW1A 3I9OA 2WIGA 3TSCA 2F3QA 1QO9A 2LPMA 3PA8A 2PCLA 2NTNA 3A25A 3N6RA 1OB2A 3G85A 1HETA 2O07A 1IDOA 1F14A 1OXVA 4LRYA 1ZO8A 1XWIA 4FFSA 1HE2A 4LVOA 3SBDA 5D85A 1SEVA 5K3AA 4D98A 1SUCA 3HYNA 3UJCA 3P9IA 4Q34A 5SY9A 2AOUB 3BHIA 5C80A 2IDMA 4B2LA 3UAVA 1IQ0A 1VIYA 2VJPA 1CRPA 3ZCXA 4WCFC 5FO1A 5IW8A 1RQPA 2ZBVA 3FYHA 4G4JA 3ZPXA 4YRSA 3NT4A 1B8OA 1DS6A 1GFWA 1LV8A 5AM5A 1IOVA 3OC0A 4GBGA 2W90A 4J0FA 2J46A 2X4GA 3GR6A 1HORA 1NFRA 2WUFA 1KY4A 1X2EA 2CDRA 3OG9A 4KTVE 4W7SA 3DKPA 3L7IA 3MJTA 4KIUA 2WU8A 2YMLA 1AKQA 4QULA 3TTSA 2EBWA 2UVDA 3KFXA 1HFKA 4DNOA 4DS3A 4IO0A 2X2EA 1KR5A 2NZJA 1NR1A 3R5TA 3TLYA 3CZ4A 3HU2A 4B81A 2QQGA 4BQEA 1ATIA 1PQPA 3KCNA 3TQHA 4RD4A 3RBXA 3OKPA 5GONF 2Y1FA 5HK9A 3FHJA 1PJCA 1QJCA 2X77A 2WZBA 3F73A 2WE8A 4KAJA 1R0BA 1KFBB 1Z29A 3R77A 3M9LA 5IP5A 1S3IA 4N5LA 4GMHA 1FFWA 4CEHB 3N0VA 2F8TA 1FUYB 5LYJA 1XQYA 1B8VA 1R0LA 3UQYS 3GGJA 3KEOA 2HU8A 2WSSD 4LQDA 1Q57A 3QUCA 4FFBA 3S2GA 1ADFA 1NVDA 2B7CA 3WRYA 5F7OA 2BRUA 1U7PA 5IM4A 1RYZA 3KFVA 4HLDA 3EXAA 3GOHA 1G59A 4MQEB 1T2UA 2OCYC 2DSNA 1BEEA 3D6FA 3EULA 3NWOA 4HBZA 3H9BA 4L3VA 4EYSA 1D6SA 3PXEA 4P8RA 4KQIA 3QTLA 5J4YA 4KRFA 2NVOA 4H4DA 5T41A 2R7KA 2ZCVA 3AR8A 1DKPA 3C6ZA 4QIHA 2Y0CA 3LWBA 3PIDA 4CM4B 4YC7A 4AZ3B 1P19A 1RLJA 1FJHA 2D1QA 2FWBA 1EJ6A 1PNVA 3N8DA 4GXTA 4LZZA 4FXPA 4AICA 5EFOA 1JJBA 4D8UA 4YMVA 5BPFA 1N5RA 4XSGA 2WRZA 3RAJA 5IT4A 2ACKA 4AAYA 3FGNA 1RDFA 4WEQA 3H84A 5EHQA 2ZUSA 5B5SA 3VISA 1RPTA 1GL7A 1Z6QA 2CDNA 3B5EA 3REOA 2R87A 4F5ZA 3H75A 4RIEA 4Y30A 2DECA 1ZCAA 2OCGA 5CXSA 3PFNA 4Y2HA 1UFRA 1LTHR 3VNAA 2REQA 3B89A 3BFVA 4LJ7A 2Q41A 2E5WA 3MTAA 1V6CA 3VKVA 4E22A 2BSQA 4P5EA 4ZHSA 1QZTA 4UHJA 1RHRA 1PGOA 1WDWB 3QELB 3MWEA 1ZVKA 2PMWB 1IN5A 1K89A 1W94A 2C42A 3QIAA 4ZVRA 3U4CA 4EF6A 2YZKA 2DFVA 2JRLA 2O7NA 5EWJA 4ZMRA 1E69A 5JJLA 3VH4A 4RVCA 2RGBA 1PJ8A 4A6DA 2OG1A 2W9XA 3OT1A 3VKGA 4UHDA 4OLAA 1UDCA 2NG1A 1XSEA 1T9ZA 2FPXA 1UFKA 1WB5A 4BUZA 4B7XA 1XXHA 1Q7RA 2H2AA 1OWPA 4LV5B 4EECA 4LFCB 1RRMA 3EGCA 3BFKA 4GE0A 2B98A 2P1DA 3CF6R 2IIPA 2I6TA 5AKHA 1BYUA 5EIBD 1TJPB 1L1EA 1UODA 2E1PA 2PLNA 3DC7A 3IJPA 4GC9A 1ZJ4A 2J9YB 3B2NA 5LOVA 2PAFA 3FAZA 4LF5B 3OZXA 3G8YA 5LYYA 3LPCA 4RTMA 1D2MA 3K5WA 3OCCA 1JXAA 3QUQA 4GMGA 4X6YA 5CPBA 3PD7A 1PT7A 3I9NA 3TK1A 1V2GA 4O4LF 3FCYA 2JVIA 4H27A 2QD5A 4URFA 1YK1A 2Y0BA 3BGWA 5C7IO 4UUNA 1N9KA 3QJ5A 4XWGA 4AY2A 1KMNA 5A1JA 1M3SA 1KSGA 4DIKA 1QAOA 1E4EA 2GDJA 2OZPA 3UBMA 3NOVA 3Q15C 4E13A 1BA3A 1XMVA 2A3RA 4CIDA 2KB0A 2P78A 2PLRA 1Z33A 1BQ4A 1K5PA 1P9RA 3EF3A 4N54A 4KP7A 3AY0A 4KWTA 1KVRA 4X60A 4Y9DA 3X1YA 1YB7A 3PGVA 4JYZA 2X42A 5KNLA 4QXOA 4IIXA 4JAVC 3SR3A 4M2LA 2ZXFA 4H7KA 5DX0A 4XM0A 5LA6F 4DA6A 1QHNA 2VHJA 5I4BA 3K32A 2RG1A 5HKKD 1FW6A 2GEUA 2G8NA 3PQ6A 4QAQA 4CETA 3J80A 4X91A 2ADFA 3EDYA 4JLJA 1KYZA 1XRRA 3L4BC 2IE8A 1QG2A 1PLLA 3LYHA 4KW7A 4P4NA 4Q5IA 5TEVA 4ENTA 1D03A 3LUGA 4XGKA 5E2IA 1JKXA 5A6SB 5DNYB 2PT9A 5JY1A 4YMWA 3LHFA 4E07A 3R4CA 1DFGA 2TMYA 4RPJA 2QAGC 1L5FA 2JFUA 2WICA 3HGMA 3PD1A 5KEIA 1HR0B 1VHJA 4MQMA 2R8OA 1TM7E 3FDJA 4MKIA 4YCNA 1LPSA 2PV7A 2KLHA 3IB3A 4J3FA 1ZI8A 4DIFA 3OFJA 4K6CA 4OF4A 2FMHA 3SEZA 2HLPA 1YRWA 1BXZA 2J0EA 3P27A 1VMEA 2FDXA 4AQ7A 4JJZA 1AXGA 5L7YA 5B64A 5KTRA 5ULLA 4Q1VA 4WZBA 1HE5A 3UG6A 2AFIB 4FB5A 3DTVD 5JZVA 1M75A 1X1BA 3G79A 5ALTA 3RBVA 2AG5A 4LAFA 2JLWA 2VQ6A 2UUPA 4PLWA 1Y8RA 2AOVA 1UINA 3G17A 1UBSB 3I4CA 3NIDB 2V9PA 1H3EA 1QGAA 1PS0A 2XB4A 1ODLA 1U3CA 1NJ1A 2H1FA 2O48X 3IKLA 1DIGA 1DJPA 1O4VA 1RWBA 2FUEA 4I4TB 1P29A 5JJIA 1VI2A 3UXHA 1KEZA 4JBNA 4B17A 1JBQA 3ICPA 3WYAA 4C6TA 4N12A 4BQIA 2WV7A 4CN9A 1PIWA 4P3PA 4IKOA 2WIAA 2VXBA 3K15A 3P2OA 2P2GA 4FMDF 3NRBA 1NVWQ 3WSWA 2W2LA 3KJEA 4BQOA 5BWNA 3T94A 3HU5A 3LCJA 1WPGA 2YKGA 3L8GA 4WADA 4DNFA 3PJRA 1GIAA 5TRTA 1ETHA 5JZ9A 4ZO8A 1BX0A 3AOEA 2RK6A 1DBPA 3NATA 3A9WA 2OFFA 1GCUA 4Z5XA 1KJNA 3ZX4A 2NYRA 1IBRA 4O2BA 4FFRA 4TWIA 4ZQBA 1UKYA 3NOQA 4BUJA 2XTAA 1NGSA 1UXKA 3WBBA 4EG3A 3VNSA 5ADUS 4ZMSA 3PB3A 1C4OA 1Y1TA 3BWMA 4N7JA 4MOWA 1NWHA 4TT3D 5KVAA 1QQ5A 5E6RA 4AY3A 3B82A 2D62A 1N4DA 2DLDA 3H2JA 1GTMA 1TYCA 1UXHA 2VSYA 3PNQA 4FKZA 3QEMB 1GG8A 2F43B 1T5DX 1Z5WA 2NVBA 4OHBA 2OFPA 4Q4HB 1L1QA 2W11A 3GLQA 1SD1A 1N2CB 4F5YA 1PSZA 1FL9A 4GZ6A 1PU2A 3GNQA 3UBTA 2R1TA 1EHYA 1RD4A 2VTBB 4NPCA 5F64A 1DJNA 1UDWA 2CVOA 4RD3A 5GGYA 3AYZB 3G0BA 4XPZA 1PAUA 3CMMA 3VA7A 1NMSA 3BYZA 1ZA1A 2I4MA 3PENA 5C8ZA 1M5RA 4XH9B 1JYEA 3INTA 4H4CA 4DR1B 4EUHA 1AF4A 2X8BA 4CCAA 1UMKA 1UBNA 4ZAGA 1RXEA 4BVHA 3QUBA 2J32A 1MBZA 2ODWA 4ZVTA 4QC2A 2JAOA 3OMWA 2QTZA 2BGKA 2MTBA 1Z3CA 3HBFA 3DAOA 3QVJA 5EIWA 1GEEA 5F1KA 4F2DA 1LRKA 4BP3A 5AM3A 3VUEA 4YRMA 3DHEA 3PFWO 3OX3A 2OKGA 4IIBA 1WXDA 4KDFA 2Q62A 3ILHA 4YQFA 2WIBA 1FOEB 2HQSA 3NP9A 4HPWA 1G1MA 1JUDA 1JQKA 1KZ7B 3NBZC 3L0SA 1J0AA 3GLIE 1YDFA 4HGQA 1SPBS 4I1VA 3K9BA 3B5IA 1SZJG 3S2EA 1JG1A 3S7TA 4N5IX 1VPEA 5EERA 5SZHB 2ZBEA 1J20A 2WIFA 3BC1A 2CLHB 1A82A 3BD8A 1TM1E 1I9CA 2WAYA 3C1UA 3IIKA 3SY8A 3T7JA 4Q37A 1XFDA 4H18A 4OLBA 3IQFA 3M6LA 2D0DA 4IRXA 3PFIA 4YRBA 2BTOA 3CR7A 2JB9A 5FNVA 1X87A 1IWOA 3U0BA 4NU5A 1KK2A 4OGKA 2REOA 3A2LA 1Y82A 1TZMA 1Z6ZA 1BG6A 1ZI6A 4RZIA 2NPFA 4MV3A 1R37A 4Y6QA 5AOAA 4Q7EA 4RK4A 1JNYA 3N0RA 5SICE 4V0OA 4DA7A 1EFPA 2IZZA 1PR5A 3CG0A 4MVJH 4Q02A 5B3LA 1ECGA 1U2DA 1XCJA 3GJ7A 2YYAA 5K7SA 2P3SA 4D02A 1VLJA 4AP6A 1D1PA 1QGUB 1TU0A 4I8DA 4MVJF 2BEWA 1DAPA 1UC4B 3TSZA 4RHCA 4QHTA 3CCCA 5AOBA 1KO5A 5C0OE 2GCIA 3ZE2B 2RHWA 3GF4A 4FZVA 3ITKA 4RH3A 4KXWA 1Z6TA 4YYEA 3H2SA 1WF6A 5GIOE 3OPMA 3R6DA 2WIDA 3V48A 1C1XA 4WH0A 2AXNA 5UKDA 1A97A 4RY8A 3K6RA 1JV2B 1ZK4A 2WF9A 5DNEA 3FOBA 3CGGA 5IF3A 1C8VB 2NO7A 4U7WA 3GMDA 4CM6A 2C2GA 3L7AA 2RKOA 4MJXA 2ZZKA 4WLOA 3ZXIA 4UBMA 1K27A 2I0FA 1KQ3A 2C07A 4N18A 3BWBA 3IEXA 4TLEA 4WXMA 4XJSA 4YRLA 5AHRA 2C7OA 1H2RS 3MT9A 3ANMA 4EK9A 3AVWA 3PTAA 1F8FA 1M8KA 2ZI7A 2OP1A 4OSPA 1ZFNA 3X1KA 5F78A 1ZU5A 4Q7JB 4NVRA 5DBOA 2JK0A 2PMDA 3QNMA 2XVXA 4BNGA 1SUEA 2B6NA 2HDWA 4AQYB 4DSAA 1MIOB 1DO2A 4FCVA 1OMOA 2NPIA 3FYUC 1UR5A 2YWHA 3AY7A 4I4IA 2C9CA 1YACA 1E79A 1LNZA 2G9VA 5BSVA 1QRUA 1M1YE 2I2XB 1CWUA 1BHJA 1BCSB 2DYKA 2Z6VA 5FOUA 1WTAA 3K4HA 3R5KA 3TFQA 6LDHA 2VHVA 2XUKA 2WZCA 3AESB 1V1RA 5JAUA 1NBOA 1ZH0A 3T9AA 1ECFA 1CRQA 1JR3E 2JBAB 2AFHB 3BJMA 2WUVA 4LCBA 2H85A 3DE0X 1GQRA 3L4EA 2PD6A 3N0WA 2FR1A 2RGXA 4LUCA 1HL3A 4GPBA 1WE2A 1MJHA 4HO1X 3H0EA 4ZEWA 1WKBA 3UMBA 2Q4OA 2HPVA 2VG8A 2QX9A 4MP3A 2QUBA 2QI9C 3O2SB 5EA2A 2WABA 3W3AH 5FADA 4BDSA 1EM8B 1ESZA 1MOQA 1Z39A 2CFIA 2F43A 3ZVMA 3H6KA 3KSZO 1QUFA 2LV8A 3MGCA 4DR7B 3BVPA 3FN4A 5FUQA 4LFBB 1XA0A 1S02A 3GAFA 4N0DA 4DMFA 1W44A 1N6OA 1QFSA 1SCJA 3KOXA 5I4KA 1G18A 1RWWA 3ZU2A 1E60A 2NQTA 2QP3A 3A9SA 3LT4A 1LDMA 4OHVA 2FZVA 3JD1A 4RHUA 4TMKA 2X0NA 5DISB 2YRXA 4BO0A 4DMUB 1L7AA 1RQGA 1ZQ9A 3KKMA 4KITB 2BBOA 1ODCA 5THXA 1T4CB 2J0UA 1C14A 3O3OB 4U2GA 1IK4A 4U2CA 1QQ6A 1KK0A 1M73E 2EJBA 3NMUF 1EFVB 4X66B 2BTQB 5HQJA 1E8DA 3AUJB 1BXGA 5KAPA 4MVXA 2C59A 4W1PA 3AQIA 4HDSA 3FOWA 3E05A 2FR8C 1EZ1A 1UMBB 3HWX1 3HADA 3WO1A 1V8PA 3DW1X 1YMQA 3KWLA 4LHXA 4DQLA 3AERA 3K7EA 3WGIA 2YIJA 4B8WA 1RP1A 1CSEE 5BVGB 1P9WA 1SA0A 2EARA 2N1MA 3OQ1A 2WMNB 1ID1A 4TX1A 4KDRA 1PV1A 3FI0A 2AE2A 2OHFA 4X0EA 5AI0A 4F3YA 1E2LA 1TC2A 3G2OA 4HVAA 1IUKA 1UWVA 4LY3A 3UCFA 2WVAA 3WRYC 1PHRA 4JBXA 1G66A 3ZK7A 4B6RA 1I4TD 4B9EA 3KPUA 4Z53A 1EB9A 4OJMX 1QCZA 4OG2A 3DPIA 4ES6A 1XVLA 3EGXA 1N5JA 3MLEA 4LYFA 4OHZA 3WLNA 1RRCA 3LUHA 1H9AA 1XRMA 3TD9A 2DHCA 2O19A 1OA1A 5IJXA 3K5IA 1XTBA 1ZIXA 4PLFA 4LGYA 2OGTA 1PV2A 2R60A 3GVIA 4IOKA 1XTPA 5CGQB 2KHZA 2H9IA 1Z28A 2B61A 5LUBA 3RVSA 1M7BA 1Z6YA 3T5MA 1K75A 1E1MA 1FMCA 2EZ4A 3DL2A 4NP6A 4WY8A 2H57A 3QE3A 4JLVA 1IFXA 3UK1A 3VDQA 1ZC4A 3V8EA 3WGJA 4URVR 4N0MA 5JASA 5JYBA 3HM9A 3KD2A 4TKVB 3SIWA 1O5IA 3TXXA 1GPBA 3W5SA 5CLJA 5JZBA 1WSWA 3RLFA 4GRAA 2WWRA 2R2GA 2ZWOA 3DZBA 4QLOA 2B21A 4QYIB 2C83A 4WE3A 4AP9A 3LLUA 4E12A 2HEGA 4X94A 3KTFA 4FWTA 3K09C 2ZI5A 4BFTA 1PL0A 1VKRA 3KJQA 3P9RA 2FLWA 4EKDA 3F3YA 3DKIA 1U0FA 2G08A 3JRNA 2VLIA 3ZZUA 1YDWA 4D56A 4FYWA 2FSSA 4Q48A 1YFJA 3SP1A 3GHYA 1ZNWA 4CT5A 4C0WA 1D8AA 2X41A 4BNFA 1Q7CA 1I7NA 1FUUA 2SCUA 3FZNA 3WYDA 1RXCA 1FRFS 4B35A 1XQ6A 4TLCA 4RESA 1LB1B 5AK3A 3IE1A 5K51A 1U31A 2J4CA 4IICA 2HIGA 4OSOA 4JP5A 2F9MA 2WIKA 1M10A 4QPCA 4EHKA 2P6UA 1XZFA 3A2KA 5AIAA 1Z07A 3GLGB 3FUXA 3O9MA 4E11A 1AOXA 2E4WA 3LBAA 4RELA 5IAGA 4OI1A 4BUCA 1XRSB 3EX7C 3JQGA 3OA0A 5GJVC 4Z54A 4RACA 4XYGA 3HXMA 3TQIA 2A9JA 3WC4A 4FX2A 4RK7A 4RKRA 4D74A 2AUMA 3PQ5A 5TIIA 5JT1A 4RGBA 3KOZA 5AW4A 3AL0C 3N3BC 4CR8A 2H1OA 2G06A 1YA8A 4TPKA 4JI6B 1JDUA 2Z5VA 1QH8B 2XA1A 3LLVA 3S2SA 1UPFA 1V6AA 1WPXA 2P68A 1IOLA 4UZSA 4YLYA 3EXHB 1V5IA 3IAS6 2PUGA 2CNWA 4ZVUA 1XVVA 5T67A 1LNQA 1VGVA 4MR9A 4WBSA 2UV8A 1U7ZA 1N5KA 1RBZA 5EJ7A 4QLAA 4AW9A 4CMHA 1QBGA 4K46A 2B1RA 3DHYA 3EAQA 4YJ3B 2QTHA 1ONOA 1OT5A 4TWZA 4ARAA 4D80A 3FSGA 1K68A 2BFAA 4K88A 2PX3A 1KRHA 3RS5A 1GZUA 3Q98A 1VPWA 3G88A 3GEMA 3HZHA 3I39X 5FL7A 2W83A 1CUZA 1F8XA 3MWKA 3BGIA 4DBLC 4DLLA 4X41A 1DELA 3I3OA 5CW1A 1GU0A 3B3QA 2Q9CA 1MFZA 2J67A 2R2AA 1G38A 2G0AA 1EI9A 4QQKA 2F3SA 2JLUA 3VGJA 5BUQA 3AM5A 5AXCA 3DBRA 4YCSA 3ROPA 3ZY2A 1G8YA 1KYQA 5LQUA 2FSVA 4XRRA 3OLQA 3QE0A 4JJFA 5FXMA 2EWVA 2E49A 2MSNA 1KSHA 3DMGA 3GN1A 1PFUA 4LE0A 4OHXA 5IBPA 4DYHA 4EFMA 2CUKA 1CF9A 3S1AB 2GBPA 1IEVA 3EIEA 3EVZA 1QDUA 3G2KA 4KO3S 5A7GA 4QZVA 4CM9D 4PAQA 2B7BA 3QEJA 1OZHA 2ATCA 2FMXA 4ZC8A 4F7WA 4ENQA 2PJRA 3OLYA 3GRAA 3IS3A 1NPDA 3JQFA 1I5RA 3NETA 1OFHA 1D2CA 1Q20A 3B85A 1CEEA 3S40A 3P0FA 3FOFC 1HXHA 2PGJA 4QREA 4UCXA 4F56A 5JUWA 2PQ0A 3FVWA 4QO8A 3IXMA 1J2YA 2J1LA 2PZMA 1XNRB 1J97A 1HT2E 4PFQA 3R8CA 3W78A 4DDUA 1PEYA 2Q6LA 5FEMA 1RTKA 2OZVA 1GQQA 4YIKA 1X39A 1QZUA 1TXGA 2HMAA 4FDAA 3TX6A 5AJWA 5A4MS 5KOHA 1M2NA 4KBYA 3HO1A 5FPSA 4Q9NA 4U2KA 3QX3A 1P3DA 4RZ2A 3U2QA 2CW5A 5BYKA 3FXAA 3QELA 4TMWA 4PAMA 4W5JA 1IB6A 1ZITA 4PV7A 5TV2A 3LCUA 3N2ZB 1NVKA 4DT1B 1F2DA 1H8EA 2VTKA 1P73A 3OO1A 4DJFC 5C4IA 3PNMA 2IQIA 4YCLA 2D1TA 3EH2A 4CNBA 3KZVA 5L9AA 3Q88A 3V4FA 2P5UA 3LYUA 2O54A 1X38A 4M0FA 2JCGA 2O8VA 2E7ZA 1EUCB 4HWRA 4YCBA 2VJMA 1KJ9A 5CYOA 3KQYA 3JQAB 4D92A 1S2GA 3TSOA 4TYYA 2FEAA 2W6NA 2JH8A 1FB5A 4ZQFA 2RGWA 4I5IA 1DSSG 1XDDA 4Y1EA 3M2PA 2EG9A 3SLRA 3STUA 3ZNQA 4XSVA 5LNK6 2XVZA 1O3YA 4KMMA 3RVLA 4E7PA 1VCOA 3E23A 4NYJR 4UTZA 3SS8A 3C70A 4MIOA 3PHCA 3QLTA 1M9NA 2YZGA 4CEJA 1FQWA 2QQ5A 3B9QA 1E2HA 1G8KA 2BOVA 4UCFA 4J0JA 2X0DA 1QU2A 1RXWA 2XD4A 2R48A 3G59A 3SPXA 4AMBA 4A2CA 2XZTA 1ODSA 2WSSA 3WICA 3RIYA 2R4UA 1EGAA 4E5MA 2JH3A 4TGLA 4M0CA 4LY9A 4AF6A 1CY4A 1E7SA 1RWKA 4WGGA 1F17A 1I2CA 1DPGA 5K0LA 4NZOA 4B3JA 3C43A 3R3WA 3GVXA 4HDQB 5H81A 2R751 5IMBA 1I6LA 3V55A 4LJ8A 2IS6A 1JQDA 4EY7A 3JQ8B 3ZCRA 5BNTA 1E3IA 1ZH8A 4LN1A 1NVUQ 2NAFA 4RO0A 3CHYA 1IPFA 4P86A 5BN4B 4KGZA 3F3MA 4RW0A 4OUKX 1OXXK 1T3LA 3HM2A 1VIMA 2DR3A 3Q12A 4IZOA 5I8WA 1H94A 3S2YA 2ZLBA 3VPAA 1E9SA 4E2XA 2EF0A 3WBJA 2UZ1B 3A0RB 2BEWB 5DCLA 5E8JA 1EVJA 1NY5A 2R7AA 1KVTA 1A4IA 2IXFA 2XQKA 4II3A 2W6ZA 1E7RA 2W6JD 3OFNA 4PIMA 1FA9A 3AIIA 3QENA 2DHEA 4E70A 1C3OB 3K8YA 4D42A 2YY7A 4C2UA 5BQ5A 1N33B 2HPHA 2HFJA 3E9QA 4RTNA 2OOSA 1FS4A 1SHKA 4FYJA 4G5QA 1UKCA 3GRPA 3AUXA 3ZW9A 2VHUA 4L4ZA 3STVA 1Q0SA 1ZIOA 3OPNA 1R4AA 4K9MA 3NVKI 3VM6A 3JVEA 2R25B 3DR5A 4EZBA 1NXPA 4P1ZA 1F1BA 1U8TA 4F92B 2J5KA 3KHUA 5IM4F 1EUYA 2VP6A 4NU8X 1ZVVA 4K28A 2OCIA 3MM4A 5TQJA 3D8RA 5A5GA 4BGDA 4PAOA 1PZGA 1UMDA 1NU8A 1D2NA 3Q72A 4O4HB 4Z9YA 4YREA 2IPMA 3TX2A 4A03A 3QW2A 3G7SA 2R4QA 3UWPA 2PYIA 3SYKA 2OMKA 3PI6A 3VNQA 3FR7A 2PO5A 3UKOA 2F64A 4PM4A 3QBDA 3B51X 5AI8A 5G2OA 2WVHA 2B5OA 4GBMA 4QXQA 2C3PA 3IUJA 5D3MB 3O4VA 1OKKA 2EKPA 3K05A 4D4GA 3JPWA 3TNFA 3P0IA 1W36B 3P45A 4E30A 1P0IA 2IS2A 3CINA 4NNPA 4HDCA 3T35A 1U0HC 4PZDA 3EY4A 1GUDA 4KV9A 4O2AF 3VMFA 2AJTA 3CT4A 5H1YA 4CMIB 1ZKDA 1K4YA 3ZZ1A 5B58C 1QFYA 3SEAA 2GCGA 4EUSA 3EZ9A 1CR2A 1Y9JA 1RBMA 3F5FA 5H3CA 2Z3ZA 5J1TB 4U7FA 5KC8A 3I83A 5E7JA 1ZH4A 3KVYA 2SECE 3SFZA 1V16A 5IASA 4N7BA 1RC8A 2QNRA 3E2MA 3RNLA 5LR6A 1W2GA 1UBHS 2CNBA 1MLDA 1CDOA 3CSSA 2OYRA 1UJ2A 4KXXA 1R74A 3FYDA 2ZXUA 1DWUA 1XAJA 3DJFA 3JWGA 4NFSA 1EM8A 2B4AA 2DMRA 1QH0A 1FFCA 1WLYA 2HPZA 2W2QA 2XSZD 3DDSA 3OY2A 4G5FA 1Z4JA 4ZRNA 3V1LA 3G8AA 4KQHA 1SC3A 1ZMOA 2QZJA 3II6X 4G1VA 4HAVA 1A9PA 3SE0A 1DAFA 4BIIA 2HJRA 2ENUA 5AKJA 2O57A 1II8B 1RKBA 1X80A 4BQRA 4FLEA 1P1FA 3U9TA 5LWHA 4HNVA 5LXTF 3UK6A 4P35A 4RCZA 1E6KA 1BOFA 5DBEX 4ZOCA 4B2PA 3IUEA 3HVJA 2W6CX 1LS6A 4ERNA 4LMBA 2W6PA 1MAUA 3GIDA 2KQUA 2JFWA 3EXG1 1G5RA 3MK31 1Z2EA 2FX5A 3GUCA 4GLFA 4IV5A 5K0NA 2CXXA 4M89A 4LOLA 3Q6NA 2FI1A 5IH3A 2ECQA 2ZIEA 4Q4AA 1AS3A 1LZLA 3MBIA 4K9LA 3Q7TA 2C2WA 3VX4A 3WTBA 1W0KA 1L4YA 2O7SA 3EPJA 3D6VA 3WL7A 4MS1B 4TMFA 4RZXA 5KUTA 3VSCA 2FK7A 1PDWA 1NTOA 3E22B 2XA9A 1ZRSA 3OIVA 4O4JF 4XWTA 1ZCBA 3T1HB 1E3LA 5DYGA 2P6PA 5AVWA 3WNBA 2EYQA 4QYSA 4E2YA 3BIFA 3PC6A 4NWIA 3QU4A 4CQMB 1E3QA 5EKXA 1VI6A 3HA2A 5F9MA 4H4EA 3ORRA 1ZMRA 2B8EA 2FSGA 3NBUA 2CSUA 2JIRA 2RFLA 3W3AD 4BU1A 4CJXA 4I8IA 1ZOSA 4TTIA 1E58A 1W5AA 2CMHA 3ECAA 5D6NA 1WQ4A 2DOKA 1P39A 5DZSA 2A0UA 4BNNA 3MHTA 4D9NA 3K1AA 5BMVF 5JXIA 1ZK1A 3RS8A 3AESA 3OX4A 4M6WB 1UWLA 1VYTA 3D4NA 1ZGAA 3D6NB 4BB0A 1JI0A 3SZ3A 2CFRA 2P9GA 1J24A 3P7MA 3U3ZA 4EX7A 2YX1A 4IMJB 5H80A 1E2BA 3CU5A 1KYYA 2JARA 3WGZA 3INNA 3VR6D 1LK0A 5H7XA 1A7UA 3LVQE 3RFTA 5DNWA 3PPWA 5AKLA 4M1YA 1JU4A 5CDSA 4IDDA 5EN4A 2HK9A 2VDLB 1GDHA 1WXWA 2KLBA 2JFGA 1C2TA 3B1ZA 3R6WA 4RK1A 1SVIA 2PR7A 3HQ4O 1T1GA 3V7YA 4KO1S 4LXIA 2GILA 3HVUA 1PK9A 1CIJA 1GA4A 3IBTA 1IMOA 4NYIR 4A2WA 3M6FA 1KH2A 1LRJA 1AQNA 5HJ5A 3Q3HA 1Y89A 4ZAZA 3VGPA 4EJ0A 5JH7B 3ER8A 4EZIA 1DRKA 1I1NA 3P20A 4EHJA 5MDHA 3RFXA 1RLIA 4KNYA 1RIFA 2QRZA 2R7LA 4CKCA 2QD2A 2AR9A 2ZJ0A 3KYJB 1PR9A 4L9AA 5F2NA 1A9ZA 2RCYA 3HACA 5M3BA 3IVRA 3W79A 1XQXA 1LQ2A 3JQ6A 3O8DA 4WPGA 4EL5A 3RSSA 1N77A 3E7PA 1C1HA 1U1DA 2QGFA 3U4HA 1T8PA 3VYSB 3FLAA 2AZXA 3DTNA 2GZ2A 2D2XA 2FEWB 2EFCB 1YRYE 2FW6A 2ZYIA 4BNKA 4ZXPA 4ZOEA 3BSWA 3DO8A 1SIUA 4ARBA 2CLSA 4HEJA 2NACA 4I2NA 3MS7A 4DG9A 2DT8A 2OPBA 3HJTA 1ORHA 4MQ6A 4NDNE 4BPBA 4PVCA 2OT3B 4WFQA 1CUWA 3HKCB 1H6AA 2PRIA 3L1JA 2J6BA 1CJUC 2C98A 2VJAA 3M1IA 3O83A 1WUJS 4GS5A 4RYDA 4DCVA 3ZOKA 5A3JA 2ZRIA 1EFAA 3EDQA 3FX2A 1LVHA 2GPAA 3QEAZ 3Q2IA 5FBZA 2BM0A 2JAXA 1AT1A 1KFCB 4MTLA 4KPUA 3LVRE 3S81A 3A6LA 3HVHA 4UQPA 5DNVA 3TRIA 3ZTWA 4IXMA 3IRUA 4HRVA 4LYJA 1YOVB 2IHNA 3R3HA 2IIBA 1FUEA 4DHEA 4IQ8A 3MILA 4ZKEA 1YQGA 1K7FB 2CWDA 3RPEA 4F2PA 1Q2UA 3BE6A 1XZAA 2R1UA 3HUDA 3QEMA 1EVZA 4NI5A 3ZNNA 4UBOA 3DO5A 2Q7XA 3L8ZA 3Q7EA 4GM1A 2Y8EA 5I5EA 1K92A 1IZ7A 4G3XA 3VNRA 2AI3A 2FF5A 2WJZB 1CR0A 4YAEA 2J3MA 4BMZA 1V5FA 1VL5A 2QVCA 1H9CA 4M38A 1T3SA 4HKTA 3DXZA 5IKEA 5D84A 4MRMB 1NR5A 1HEIA 5HW0A 2R0QC 2PJUA 2BLLA 1EFCA 3LF2A 3PNSA 4CMIA 4J16C 4RKYA 2AX4A 1LBIA 4JP8A 3PUYA 4W6QA 3AWDA 3P8ZA 3MWEB 2I2BA 4EHNA 1QNFA 3U7QA 4AG3A 4D81A 1SURA 3MJ4A 4WLNA 1FNCA 1JA9A 4E3ZA 1HDIA 3CF2A 4W1SA 2VDJA 4BNDB 3QWBA 1NP7A 1SO8A 3B1VA 3Q2OA 3PUJA 1HV8A 2GHRA 2M6LA 5DHPA 3U44A 4HFJA 4NHOA 1ES9A 2CNKA 2J3JA 4XD7A 3ZWWA 5SV2A 5KWSA 1AKWA 2BUBA 4DABA 4W5NA 2C7PA 4LEIA 2BHLA 5DM4A 1LPOA 2QTRA 4RF5A 4F06A 5SYMA 2GVDC 1EE1A 1TKRA 3RREA 3TPZA 4ZI3A 1LA2A 1XD2A 1U7OA 3PNPA 4NY1A 4EPXA 3EXIA 2QZZA 5L3ZA 1BKSB 1QHGA 4M8LA 1WD5A 5GM2A 3ZE0B 1SU4A 4ITUA 2WU0A 3ZV7A 2V98A 3IEPA 4IZ6A 3UJPA 4DJEC 1UT6A 4HQRA 3T61A 4CF7A 3ZDFA 4HMPA 1F9EA 1RFLA 2D0OB 4E2ZA 3GJ5A 4FHEA 5EJGA 5FOVA 3IUPA 2QPTA 4RKFA 1EBFA 1KWGA 4IFBA 5K3DA 1I1QB 2PJZA 2HK8A 4OA5A 1RCUA 2AOXA 2EXXA 4UOEA 2A9KA 2AG8A 1AQIA 4RPHA 3O4IA 3DLCA 4CMCA 5C2JB 1I3NA 1MR3F 3N05A 4BE9A 1ZINA 4JUDX 3I5AA 4ARUA 4YX9A 5BRAA 4YJHA 2BFCA 4WLFA 5J5VA 1HNZB 4P4UA 3HE3A 4MKZA 4ALMA 4BNMA 4ZOQI 4GDMA 3ZV6A 4XGIA 2FP3A 4PZAA 2OORC 2GLUA 4HNGA 3RFFA 5L7TA 3PX3A 5DSZA 3WX0A 8ATCA 1OF1A 1HBJA 1QJ4A 5FWDA 3RFUA 1J0DA 1AUOA 4B0OA 2IVFA 3V1TC 1QIGA 2EWMA 2V6IA 2YCLA 9LDBA 1G8JA 4M99A 3ZQ4A 3SQMA 4P58A 1G2IA 2ZW9A 3JQGB 4R98A 5CNJA 3OQIB 5CNIA 4MQ5A 2GAAA 4OYHA 1Z0SA 1JYSA 3IXLA 3UN1A 2O4CA 2B94A 3RK0A 3IVGA 1U0NA 3OAAA 5DN9A 3THXB 3R3ZA 2EJTA 3G02A 4JMLA 1DUIA 3ZNPA 4E5DA 3C7CB 4Z7QB 4EO7A 2HA7A 5TX7A 4QOJA 3WB2A 1FUKA 2XZOA 4V03A 1SG0A 1ZJZA 5C34B 4ZDWA 3VOAA 4J4BA 5HIJA 4CL8A 1H42A 4E6PA 4EY4A 4ZJPA 1V96A 4MLZA 3S2UA 3SC3A 4BVGA 4DKJA 1E1RA 2FUG1 3SDSA 1OH7A 1TVEA 2J9ZB 4L57A 4M0LA 1VI5A 3MXTA 1TECE 4BNTA 3UUWA 1ZONA 1V48A 9ATCA 5ELMA 5B2ZA 4ENWA 3OURA 5K2OA 4EX6A 4QPDA 1JALA 2YJTD 3TS1A 4DR3B 2HGZA 2LP4Y 3HU3A 4O4IF 4RPLA 4LOHA 2WTEA 3P0RA 5AK6A 5IYZA 1LPNA 1HSZA 2ZI3A 4A6XA 1OUMA 1JPJA 1G7TA 3MFQA 3C85A 2XBLA 3AFMA 3EEYA 3HJCA 3I01M 1YTLA 2CK3A 1RWOA 2ZRCA 3FHCB 1A71A 1PJLA 4HYQA 4NS1A 3FLEA 2NSJA 3CH4B 3RYIB 4C3OB 5CX1A 1QRAA 4J0HA 4OP2A 3IEKA 4EUFA 3DDOA 4BNWA 3LK6A 1N3BA 1ZRMA 2AJBA 1TYDE 2UYOA 3DOEA 3K3PA 2YWGA 3EDOA 2DHQA 3KEMA 1DMRA 1IXRC 4KODA 4OI4A 4YV2A 2XMQA 3C3KA 2DQ4A 1G4AE 3WHKA 3G0IA 5AJTA 5BR8B 3IMFA 5A4KA 5F51A 1Z26A 2ON6A 3ZXUB 1E6EA 2ZROA 3KB8A 2VEOA 1E2DA 1E9BA 1YKGA 1RWPA 3CH7A 4MR8B 3BSSA 1YVPA 1GTG1 1DOHA 1SHJA 1JFTA 1M0EA 4OYLA 2B7LA 1REQB 3D6HA 1S2NA 1SUIA 3O3MB 4CKWA 2E2WA 1N2HA 2R6FA 3P9SA 3FKJA 3QHAA 4LVNA 3JVDA 4MR7A 1G5QA 1FVHA 1XTUA 3LVFO 5CCDA 1W2HA 3AOEC 3QIVA 4R2MA 1JFFB 3VYTB 1Q1BA 4GWLA 2R6AA 2BKEA 3U44B 1QFJA 1KS2A 5FUBA 1S2LA 1C3EA 3WOVA 4AK9A 1E1QD 1VLLA 1H1DA 3CNQS 2UXBB 4NC9A 1E8NA 4KZPA 5CTJA 2Z5LA 2A33A 4TLMB 4KMSA 2FQXA 3KZOA 5BMVA 3PXUA 3O3NB 3R74A 2IEAA 2DWPA 1IMJA 1JQAA 3A6FA 3BRQA 2XE6A 1F2UB 1AKUA 2FW8A 1TZCA 1DX6A 2Q1UA 3E1GA 4M7PA 1Z4LA 1FDIA 1K6XA 2OWDA 3N7TA 2OCLA 5KVCA 5EXSA 4P33A 3QKUA 3WDMA 1J8YF 1JAHA 4AP5A 1XFAA 2B0JA 2JFHA 2OKCA 2V6FA 1JDBC 1XMPA 1XMXA 3ETCA 1IXZA 2QNBA 4EEKA 2X1HA 2JJ1A 3MMNA 4ZHQA 4KH1A 4JJKA 3SIXA 4X7MA 4YCJA 3ZKWA 3CH6A 3RK1A 3VPFA 3D2LA 4RY0A 4TTAA 1U2RA 2J3EA 4QQRA 4I1IA 5BW8A 1NQOA 1PR2A 2ZRQA 1L7OA 1EGHA 1PJBA 2ID9A 1N2CE 3SC2B 4Q15A 3TM5A 4J1TA 4CHTA 3KOYA 4P84A 3GARA 5FTJA 5JYEA 1PWEA 3HMQA 2X0RA 2D2FA 4XM2A 4YI3A 5T8KA 3PI7A 3VC1A 2EKQA 2QVBA 4YUZA 4GPZA 2GF9A 4DOMA 4MYHA 1JIQA 5A03A 2HBZA 3SZOA 3U4GA 3VAYA 1MJNA 1I01A 2W6IA 3DMHA 5AVTA 1A1VA 2O1WA 5CVVA 3MJCA 4PFSA 1XHFA 4PGGA 3C39A 3K4PA 1QF9A 1T0JB 2JKZA 5B6PA 1HNWB 2W0MA 3D6TB 4ENPA 3M4JA 3ZK8A 3QM1A 2A8YA 1RKQA 4Q4JA 1KI9A 2H2FA 1ZN2A 2G76A 7YASA 2AC4A 3CJTA 3TNDA 2FKAA 4DADA 4MWZA 2AT1A 4TSFA 2YXLA 5G4KA 1S8OA 4P32A 1WMAA 2EG5A 3EXFA 4MRAA 2CNWD 2HMUA 2ZTSA 1KXJA 4BMNA 4PYQA 1CS0B 2PQ2A 3EPKA 4J9VA 1DQNA 4L8WB 2CFOA 2JFFA 3E3AA 1G17A 2C2BA 1VPVA 4RJ2A 2OXIA 4LCEA 4D5EA 2AF3C 2J8ZA 1NVGA 1YI1A 3HYLA 4Q6WA 1EQAA 2XCOA 4PZ9A 1X94A 3UK2A 5JD5A 5LYJB 2I3GA 3LDHA 4UE2A 3ZU3A 4GX5A 4J7CA 4CGZA 1SZDA 4NAVA 4TVKA 3V6LA 1C9JA 3ABRB 2OV3A 5L3QA 1Q3KA 2SKEA 1L4GA 1YKSA 4S1NA 2B2NA 2VPTA 1JEYA 1DINA 4RYLA 4DCGA 3OOHA 1C4WA 4I9GA 2O5VA 3F71A 2E48A 2H4HA 5M2QA 2DB3A 2YVUA 1Y3HA 2IOFK 1P0QA 1HT1E 3MTQA 3QZUA 4LDQA 4OXYA 4S35A 3TKLA 4LRTB 2C8LA 3VV3A 1OFVA 4X00A 1MOZA 3SF0A 4LYGA 3G5MA 3V7UA 3CLSD 1MU0A 2BW0A 1B0UA 3OFKA 2G9QA 2Q6VA 2PQMA 1EA7A 4KHPB 4HQKA 3A70A 4BL5A 2JLQA 3LX4A 2X19A 4PCLA 5AKIA 5L7WA 4QVIA 4BKPA 5I9IA 4HVLA 2PA0A 3MT7A 4QFCA 4ADSG 1FE8A 3FGPA 3C1OA 5CYPA 1EQ2A 3GK3A 2BSAA 3CPSA 2E1RA 2NZYA 1EX9A 2YW9A 5JMWA 3AEQA 1JAYA 4TSKA 1JHOA 4FEAA 4BVKA 3R5HA 1Q83A 3F6BX 4M87A 3VR0A 3ETHA 4C4OA 3EEBA 1W2WB 2NSDA 3F5QA 2V9ZA 4I7EA 5IXSA 3H2ZA 1Y48E 1ODJA 2BL4A 5JO9A 3FZGA 4ZJYA 1N2OA 1PE0A 5EXTA 3U1TA 4J1SA 1I2ZA 3T3DA 3BB4A 1URPA 4ROTA 2FGJA 3BULA 2XMDA 3E22A 2BP7A 2HLDD 3U62A 1A1SA 1VDZA 2WWYA 2D59A 2R3SA 3ZGYA 2O20A 2A58A 1WBBA 3FIUA 2O8EB 2IXTA 3RYHB 1QG0A 3GY0A 3OE1A 4N39A 4WI1A 4ZQCB 4CLRB 5CAEB 1L4LA 4UU1A 5ESXA 2GS9A 3L84A 1JEDA 2GEBA 2WNHA 4GRDA 5EPEA 3VZDA 2OM6A 3SC4A 4YHHB 3NAZA 2HBYA 4XDGA 1FS6A 2RAPA 5ITVA 3I58A 1RLOA 3OPQA 5DCWA 2VF5X 3OUUA 2YVLA 1OAOA 2R86A 2RGRA 2JHFA 8OHMA 3MOSA 4Z3KA 2Y1CA 1NHGA 3PVZA 3QU9A 4ACBA 4MVJI 1P1HA 3PHJA 2BONA 3RTAA 4NJEA 5JBNA 1K63A 3HVRA 1O0SA 3SJAA 1W88B 4MLCA 1UQUA 4RIFA 4URYR 1JG2A 1ZK2A 5T57A 4BECA 1YOVA 1G16A 4EMSA 2ZKIA 3BWVA 3PNYA 4BO8A 1R4MB 2D4HA 2MSLA 4BLQA 2X3YA 3T7IA 5ILQA 4XQEA 2X3FA 4GOOD 5KQLA 2Q0HA 3VDNB 1WA5A 2Y3IA 3DUFA 3HRKA 4JP3A 5B2EA 3K9LA 2GO7A 2VIIA 4RC9A 3X1WA 4UNRA 2HCBA 4P98A 5G02A 1NVMB 4X7PA 3MIIA 2YMQA 2JD2A 4PFKA 4PRLA 3R41A 3TTWA 4BNJA 2Q3LA 2R9VA 3F46A 4QARA 1YI0A 2EBHX 3K8OE 1WZCA 5HFJA 1SBTA 2V6JA 2ZULA 4JNCA 4K6GA 2AXEA 4K7JA 2ONKA 4NE7A 5HUJA 3HZZA 4LKOA 4NCHA 4KWEA 1Y81A 2WSLA 3DONA 4COOA 3DZIA 1A27A 4NU6A 1T5HX 5KYVA 2JCVA 2H8KA 3NBAA 2JFOA 4CLHA 5E0OA 3USCS 4KQMA 1Q0UA 1JIKA 4Y6SA 2BEUB 4BFWA 4JC8A 4CTNA 4CMGA 2AX3A 3RYTC 3HV2A 2P2CA 3TD6A 3CF4A 1G291 3AK4A 1MJ5A 3K6KA 5F77A 3VO8A 1RMQA 4BE4A 4E31A 1YB4A 2V65A 3UOGA 1DMSA 4EJ6A 2PKWA 5BN4A 3FYCA 4MJ7A 1MABB 1NLMA 1TZKA 3R3VA 1O57A 1B6TA 2RKWA 2W8ZA 1QF6A 2ZRHA 5FDFA 5F9FA 3VUFA 1FYWA 5I48A 2DHDA 4B6SA 2QRGA 2P2NA 2DC1A 1JA0A 3TXYA 5DE3A 1EYZA 1ZW1A 4K6FA 3PE4A 2FUNB 1CUFA 4TQAA 3UFXB 3NVMB 4ML3A 4DJJA 3ESQA 3MEQA 4RJTA 2I9PA 4IDPA 1R6BX 2J5QA 4EKYA 3RG2A 4ZVLA 1L4HA 2R84A 4JY7A 3DFMA 2WWFA 2VTDA 1Z5UA 3C98A 4M8KA 4EW2A 4IYJA 3D59A 1K5DA 2QMZA 5TARA 2QN7A 4B4DA 3DQPA 2HQ1A 1M7HA 1UDRA 3T9FA 4W5HA 3W7VA 5KNCA 4UMVA 1P0PA 3OLWA 1QYXA 3I9LA 1MIOA 1RXSA 2WG0A 5ITWA 3UAGA 3BXGA 1YJAA 2J6CA 1MG0A 3A2NA 4KC0A 4UXHA 4Q19A 3M82A 5D1HA 4BV3A 4E1VA 3VC7A 1ZGGA 1D3AA 1GSAA 3CNHA 3HP1A 4JGBA 2PX6A 1HLFA 2DQZA 1XMSA 1FX1A 3MA0A 1L4EA 4J3NA 1WM1A 2B37A 4DMHA 4GG1A 1JFSA 5B1YA 3DVAA 2I6UA 1PGNA 2Q21A 2R66A 5KO2A 3ZQ6A 4OBXA 2BGIA 3M6VA 3GLIB 1CP2A 3UK7A 1D9ZA 2P4UA 2LNDA 3AUUA 3PYMA 2XUOA 2VPZA 4FBLA 4W5WA 1VKHA 2F9FA 4UASA 1COWA 4BIMA 3SLKA 1N0IA 2AJLI 2O3UA 3FMVA 5TVGA 3CH5A 4I66A 4CM8B 1QRRA 4EL0A 5IH7A 1LBQA 3C4QA 5B58T 2XXAB 4GWGA 3LBHA 2CYBA 4FR5A 3CNNA 3N6VA 1GAEO 4Z8YA 2Q6IA 3CS3A 5LIPA 1ZCZA 3LP8A 1NLYA 1ZIPA 2ZKLA 2ZSAA 5AWFC 3RUAA 1OV6A 4B33A 3HXLA 4YV0A 1WHTB 3SHTA 2FPMA 4UQOA 1HDEA 3NJ8A 1U3VA 2XE8A 5YASA 1TF7A 1YZHA 3QA3E 2JNWA 5IK2D 3LC1O 4R8RA 2RBGA 3ZWBA 5HEKA 2FJ0A 4EVRA 2FK8A 1KI1A 5D3QA 2P7IA 4ER3A 2V1XA 1OWMA 3UFXA 2H7CA 1J5XA 1JFFA 4Q9LA 5CG2A 1AUPA 2CZCA 2CZGA 2E82A 2A1TS 3I3SR 1AKTA 2QRLA 3UPUA 5ALDA 2RK4A 2D54A 1SUDA 2Q1YA 1NNEA 1G5HA 4F5DA 3JYPA 4RKEA 1NI5A 2WUEA 4CIYA 3LZCA 4UXIA 4QXAA 3ZU4A 1E6CA 1ZD4A 3H04A 4HUTA 1EPUA 1R0RE 2R8ZA 1ELOA 2JGRA 2ZRMA 4GHWA 3FRJA 1NT4A 3PXCX 4S2UA 4HWKA 1LQUA 4N7RA 2BTEA 2IGTA 4PCAA 3KUCA 1Y1QA 2CL6X 3QXCA 4MRVA 4BE7B 3P9YA 4TRRA 1RP7A 3QKTA 4Q9KA 5CG1A 3U5ZB 4C20A 2PTGA 2WW8A 1U2QA 4DVGA 2UYHA 3I2HA 2XAAA 4DUYB 4IF6A 4KFSA 1JEOA 4WN3A 3JQRA 1BMFD 3K70D 1MVLA 4IZIA 1CB7A 2Z4SA 4O4LB 2NO4A 4DJTA 5JNVA 5JYCA 3QEBZ 2QSZA 5IJWA 3LKZA 4RWEA 1ISJA 3OJFA 3PLRA 3DFUA 4OXNA 4R1OA 4MGYR 2RHHA 3SHVA 1G21A 3OFVA 3IV7A 5LC1A 4AO6A 2PUFA 4L8LA 3G7NA 4RF3A 1GZDA 1V95A 1UWKA 2IF2A 1XTJA 3ZI4A 1SXJA 5EZ5A 3ET4A 5J58A 1YTUA 1AH2A 4JR1A 5ARCA 4G4GA 4JVMA 3ZWCA 4C22A 3OZGA 3NTRA 1QR2A 4O08A 5CIQA 3P0EA 2AMVA 3H7IA 1T25A 2GLXA 5KX5A 4TT8A 1B16A 1ISGA 4FD3A 1E1CA 3IE2A 4J0QA 2C84A 5AW7A 4OGFA 4RANA 3JW8A 3U6BA 1FDSA 3HXQA 2R79A 2WYIA 3BXOA 1TMYA 3GJSA 5KQPA 3KJXA 1A50B 3FZYA 4GYYA 4FHZA 4MYRA 4QYWA 1U0JA 2XXBA 3ZD8A 5K8UA 1RAFA 1G3UA 1LF0A 3CX4A 3HDJA 4ZVKA 1WUTA 4JFRA 5FHRA 2I3BA 3SHQA 3RRZA 1CXZA 3V1MA 4YCCA 4HEA1 4OEHA 3E5NA 5CT8A 2O2YA 1RR6A 4JBWA 4RY2A 1DAGA 4EHDA 3WAKA 2EGGA 1YZQA 3KDPA 3O8OB 2GPNA 4ISCA 4QDTA 5AKYA 4LZLA 3CTPA 5BOSA 3C4JA 1DT5A 3QUSA 5E9JA 2VNIA 5CBPA 3S28A 4HAXA 4TYNA 4OREX 2VUSA 2C9ZA 3BJIC 1GUBA 3C3BA 4N5DA 4A27A 3LC7O 3NPMA 4S3MA 2C2MA 4GOXA 2H2WA 2JGKA 1R6UA 3HCEA 3LTEA 5LXTA 1EXDA 1Z0FA 2WUGA 2FRDC 4D5GA 2HLHA 3GP3A 4H7FA 2QROA 5JTUA 2WT8A 5JPCA 2P75A 3DHNA 1T0HB 2AGVA 1ULSA 2HIHA 3E82A 3I2GA 4P2GA 3SKYA 3VQTA 2VK4A 4BJHB 2VSFA 2AXQA 2CLLB 4CR7A 3LHSA 2ANCA 4OMFG 1LF5A 3E8SA 2OUKA 5G0VA 4B6OA 2GZMA 3DQQA 3K2BA 3PHHA 4DUPA 1DIAA 3SSAA 1KK1A 1Z5PA 1IPHA 3U7IA 3EXEB 1UDBA 3GGSA 5EMLA 2JHGA 4QXMA 2X5XA 2L2QA 3GNLA 3Q3IA 4FYHA 4ZWNA 1JL3A 1KAGA 1QVAA 1QPGA 2C2OA 4I6GA 2VNHA 3EOBI 4TL6A 3R7BA 3EMKA 1K06A 2BMDA 3KJFA 621PA 3DT9A 4LRUA 3I37X 3P2EA 3S70A 3H5RA 4BO1A 5LBUA 3WGUA 3EF0A 1VYUA 1U8UA 5I3CA 3DKKA 5FD8A 4CCYB 1O87A 5EE3A 4C6SA 2RHOA 1VJCA 4FSDA 4ZT6A 1X7XA 1UK8A 2CHFA 3CZCA 5E9QA 3KZXA 5JE8A 1Y5MA 3BZBA 4MYDA 4WXRA 3A1NA 2OCBA 2FH5B 1DAHA 2ZBGA 4XTCS 5LNK1 2LR0A 4DIEA 1RI3A 4J1NA 3VVBA 4ASUA 4NIMA 3UMVA 2IYSA 3DWEX 3RRYA 3E7DA 3RAPR 3TLEA 5U9CA 3UATA 1GAJA 1RZ3A 3KLPX 1M34A 5JJBA 4XXHA 4BV8A 5FWNA 1JDVA 3CXUA 1OYVA 3GGDA 3R0XA 4P3KA 4ZO4A 9MHTA 1JKJA 1ODIA 1LBHA 3VOSA 3U4DA 1K98A 4YS6A 4LSGA 4AWBA 1YE3A 3X2FA 5E1DA 1YS2X 4Z9FA 3C7KA 4QG3A 4KFTA 2Z8XA 1CD5A 2CD9A 1MHPA 5KTPA 3E48A 3TB6A 4ECAA 3V32A 2XGJA 2XBMA 4O1MA 1UPTA 4J0IA 4Y67A 1OSNA 1H1LB 4RVFA 4WA8A 5BSHA 3DMNA 4R8KA 4HGOA 3WZ2A 1VYVA 1FP6A 1RYYA 3ZLVA 4WASA 5DTEA 4BX9A 1GVNB 1MTZA 4EJFA 4L75A 3EWAA 4MIYA 3C1AA 1Z2CA 5E3HA 2CKDA 3FMPB 4N9WA 3C15C 4XOIA 3KTAB 5E7MA 5CT4A 3GLHA 3QE4A 3T5GA 1XZMA 1RZVA 3D7NA 3ED5A 4BLRA 5KOIA 2EC5A 3A9TA 2O9JA 2CE2X 4TV9B 3U3JA 4F8YA 4OHWA 4PSDA 2KW5A 2XKAA 1H93A 1UIRA 2QL5A 2IE0A 3M49A 1R0ZA 1WY7A 4L85A 4YDQA 2BFFB 4ER0A 4HP8A 3ANXA 3T1OA 5KNCH 4FZJA 1UEJA 4C4AA 4EEZA 1DEAA 1Q19A 2EBFX 1PTJC 1QWOA 4S1PA 3W2FA 3DBLA 1EM6A 3DLAA 3CLRD 3HCOA 3N76A 2C1EA 4V39A 1ZSNA 2GHTA 4NOLA 4BNYA 3IA7A 3NBYC 3CX3A 3PITA 4FXOA 3ZBTA 1DARA 4CRWB 1Q7BA 3U26A 2C4MA 2YIVX 2PSHA 1UKVY 4UTVA 5JH7A 1KZ4A 2X8JA 5A5VA 3I34X 1OLXA 2TMDA 4ETWA 4WMLA 4KPFC 1ZN9A 5EVCA 4DUZB 2REQB 4MCAA 1AS0A 1E77A 4U7PB 4HH0A 5E9WA 1Y5RA 3LFTA 5FBVB 4FP9A 2F1JA 3NIGB 3MW8A 1D4OA 2OSVA 2R8EA 4LOKA 4PO1A 4XX0B 3TIFA 4ZYUA 5M5BA 1H4QA 4DMGA 2GBCA 5A3RA 2CLFB 1R9JA 4HOYA 4D4HA 1NUUA 3M5DA 3Q3VA 3ENKA 4F5WA 1GPDG 4GEGA 2PMEA 1K4KA 3Q0EA 8AT1A 5ITSA 4K86A 5JS6A 1WXGA 4DBVO 4ENSA 5CGZA 2EFYA 4G0XA 4DEYA 1IH8A 4EG5A 3FTDA 5FEUA 3W9YA 1U8XX 1MX5A 1EHCA 3M34A 3BH0A 5EZYF 4AJKA 1RHQA 2GH1A 1P6UA 2YZMA 3AHFA 1BEUB 3UB4A 4ACAA 5IRCD 3U4QA 2PSEA 3WGMA 1F8YA 4YMLA 3U56A 4UUBA 2BMVA 3K94A 1NP3A 1XD8A 2HWXA 3L3BA 2JVKA 3LPLA 3HWWA 1SKBA 1RYHA 2A7XA 1Z06A 1BS1A 4GI7A 4X90A 2GGSA 3A3NA 3DVAB 4LF6B 4KQFA 3ILVA 2C00A 2W48A 4Q7LA 1TVKA 1I3OA 4NPHA 4CEHA 4BBPA 4QTYA 4NMMA 3PNOA 4NBRA 5T8KC 5C46F 3EWIA 1QE0A 1C7FA 1Y9AA 2WEKA 3B12A 3QXSA 3QWAA 1H0KA 1M2VA 3O8BA 5ELXA 3WWYA 3X1DA 3FF1A 3OI7A 3DFFA 2PWAA 2VJOA 3KOMA 3FNHA 3OCXA 5HK8A 2IBSA 1SHLA 4R5MA 5KYWA 1R4NA 1B8PA 3PC3A 1VMKA 4QTUB 4M88A 3FE2A 2XMRA 1I24A 1QB8A 2VK1A 4N01A 4HUJA 5HZGA 4OQQA 2ETXA 1JIIA 2VHTA 1KZ9A 3OM1A 4RETA 5KKAA 1O96B 2BT4A 4JHXA 1E4VA 3DE3X 1V8BA 2IY7A 4M9ZA 5FFMA 3UGTA 3E9ZA 4L0CA 3L0YA 4G81A 3GGGA 1GQOA 4ZVMA 1JR2A 4IIUA 2WYVA 1JQEA 4JB0A 3E35A 3OEED 1IG3A 4KB5A 2H3EA 4U2FA 4ZICA 2P65A 1HURA 1II8A 1U9CA 1A4XA 1W6UA 1I6WA 2QLLA 3MCUA 4JJ4A 1CUEA 1RRGA 1HFEL 4RKQA 3WGNA 2RHGB 2VXOA 2P30A 3H11A 4XGNA 2PWZA 4PG5A 4GLLA 1PT5A 4JEIA 4UNNA 4XWKA 2H5LA 2J4FA 5I51A 1X9GA 1JT9A 4UZFA 1X7HA 1GKYA 3BE5A 2XW6A 5A4AA 4XVQA 1GGMA 2KM1A 1YVUA 4AMYA 4XWYA 1MEEA 3QVMA 3FM9A 5J5CA 1H65A 2A14A 2OEPA 3IQZA 5FOWA 2N3ZA 3NPAA 4REOA 4KKXB 4YRTA 3WADA 3PUZA 3RAFC 3DXYA 5JRDS 1B1CA 4PZUA 4RIHA 3RQIA 1CUJA 4CQLA 3FCUB 1KMCA 1RXUA 1TX4B 1KMQA 2W2MA 3DOFA 1XROA 4IL5A 1ZVQA 2WJIA 4YJDA 1TQHA 4J7AA 1SKMA 4NICA 4TZ6A 1V9SA 3GLFA 3LCCA 3RB8A 3M7IA 3CUEF 1TYEB 1IUPA 4X1KA 1BSVA 3PFHA 3EGDB 4G97A 2D7JA 2RKBA 3SVTA 3KZCA 2CDBA 3F9RA 3NNNA 3KJHA 2VKQA 2J33A 3EXIB 1HT0A 5FCDA 3RVJA 4I50B 1G8GA 4LV8B 4D0NA 3RYCB 2JW5A 2VUTA 4CODB 1MRSA 1VB3A 2AV6A 2OM2A 1T10A 3HEAA 3QYFA 4GPAA 5AH0A 3I62A 3WLMA 2YWRA 2QTLA 1KH1A 1KNXA 4EKGA 1GPLA 2X0IA 5DOZA 1H6CA 5JVDB 3GBVA 3OX1A 4BCBA 1PSDA 4LI0A 2AI1A 4PSKA 1WDTA 1T2NA 2H2IA 2OLKA 1W36D 3O8RA 1QYRA 1H0RA 2NO6A 4YFYA 1MGPA 2C99A 2CXOA 4B87A 2IC5A 4ENVA 1P4SA 2QXYA 4MO2A 2YV4A 4A5SA 5DB4A 1YZNA 1T0UA 1JDNA 3UGKA 1QYDA 3WRVA 4C4YA 5FWYA 5FV4A 1EDOA 3TAXA 2IU4A 2PE5A 4X8OA 2DUUA 4XDYA 2C9DA 2M6KA 3FAKA 4TS4A 3OHSX 5D01A 3GD5A 1T6BY 1W4ZA 4E03A 2WD8A 3PDCA 1NRJB 1RE0A 1U3UA 2UZ1A 5F4ZA 3H4VA 1S96A 5KHAA 1IBMB 1Y6FA 3C5HA 1H9BA 1M6VA 2PYZA 5DRYA 1BDIA 2WWWA 3WZMA 3TEFA 2IYTA 4JLBA 2G80A 1YNSA 4M54A 3CX7A 2ATEA 2OYCA 5A9TA 1MX9A 2QVZX 3ECSA 4PC1A 4V1CA 4C6TB 3WMWA 3AETB 2HJGA 2CBGA 1UQRA 3LAWA 4MS3B 3OLVA 3UICA 4UOZA 3S4YA 4M9SA 5L3SA 2ZB8A 4LSMA 2INGX 4D8YA 3AR6A 5BR4A 4S0ZA 1YB2A 2PGXA 3HXPA 3DKVA 1A9YA 3IMGA 3R5JA 4IF4A 4B75A 4MARA 4ZI7A 1PQ4A 4HNHA 1K9VF 1Q1NA 2D6FA 4MUMA 3RFVA 2YWBA 1Q0PA 1BDHA 4NCKA 2ZRJA 3BGVA 3CSDA 3RARA 1O1YA 2C97A 1X7YB 4WDRA 3MRSA 2AHOA 1IHPA 1JT2A 3R3SA 2OBLA 2WQ6A 3A4LA 3ER9A 4ER5A 2CUZA 4HWGA 3O94A 2ZEJA 1ENOA 3QLUC 1X8JA 2EW1A 3WJ7A 2IIQA 1E0DA 2Z57A 1FRQA 2CXTA 4KOEC 1PJ3A 4U7TB 3HEMA 5BSRA 1I14A 4WKCA 4NXNB 3FCOA 5DM60 3NDBB 2OCXA 1M2OA 3NKVA 4HLUA 3SHWA 3VDXA 1KEKA 3L6DA 3LRXA 2DJIA 4F3CA 4WLVA 1AB6A 1FVOA 2WF5A 1KYWA 1AA6A 7ABPA 4B7AA 4EPTA 1RXIA 3MQ4A 4GVPA 121PA 4G0NA 4U5QA 3GCGA 2JATA 5GPBA 4DG8A 4J3JA 2HDOA 4KTTE 1QK5A 3GLRA 4Y2YA 5JPIA 4DSOA 5JDIC 3EE6A 4JLPA 4WJKB 4KVFA 1I4OA 1CUDA 1ZOOA 2HA5A 1QR6A 4Z6KA 1E9FA 3FVQA 3K6SB