1YR1A

Structure of the major extracytoplasmic domain of the trans isomer of the bacterial cell division protein divib from geobacillus stearothermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
GSEWRRIAYVYDRQTFFPLLENGRLLKQEGTKTAPSDAPVLVGWKDGDAIAEMTGQLAELPAAVLGAMSEIHYKPTREYEDRVIVYMNDGYEVSATIRQFADKLSHYPAIAAALDRNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords cell-division initiation protein
publication title Domain architecture and structure of the bacterial cell division protein DivIB.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr1A00
1YR1A 2ALJA
chains in the Genus database with same CATH superfamily
4YR9A 1VZ3A 1UODA 3OM8A 5BRNA 4C6TA 2O59A 4Q5IA 3F2IA 4CBVA 2UZ1A 4HC4A 5EWJB 3Q40A 2VH5R 5JJCA 4Z0PA 4C08A 4ZVTA 4NMLA 1OC4A 4HTAA 2I5PO 4H18A 4HDNB 1JVNA 1ZUHA 4MJLA 3KR2A 4HWGA 5JV5A 3ORYA 2XEDA 1U7PA 3A4VA 4KFCA 3MPOA 4ZJPA 1HUQA 1TVKA 3AR6A 5GONF 1DINA 2H07A 1NBIA 2QD3A 3RRZA 1KWKA 1V9SA 3EVAA 5JRDS 4M83A 4B4WA 3F9RA 1NE2A 2Y4OA 1OLSA 2LTAA 1FLVA 3HU3A 3IAHA 1T2NA 2WWFA 3IBFA 4GEKA 4ZOAA 3WO0A 4BEJA 4ETNA 1ZW1A 3GMTA 1EFTA 5IM5A 3V1NA 1FP4A 3VC7A 3EW9A 3HXKA 4WFKA 5DIFA 1L7MA 3I1FA 5BP7A 2B4RO 2QRNA 3C7KA 4TQAA 5BV1A 1K7EB 3KB8A 3HUUA 1YL5A 3IB6A 4OAOA 3RYCA 2H1VA 3C3EA 3FBTA 2C96A 3ANMA 3JQ9C 4D9KA 3VDMA 3QXHA 2ODWA 1T0PA 4LW8A 3O38A 2BFCA 4E7PA 2HGZA 3BJZA 4LFCB 5BW8A 1EJ0A 1D5CA 1X80B 1I80A 2VKTA 3LZCA 2ACWA 4BNUA 1VHLA 4JLAA 1SNYA 3I6IA 1ISGA 2O2XA 3LTEA 4Z0NA 5BWCA 4G9BA 1BVUA 1CUDA 2JI6A 2JHPA 3QU7A 3K0BA 1W1WA 4HAYA 1I3NA 4HH3C 5E8RA 3AUSA 3MAAC 3GAZA 1S8AA 3W7AA 1B23P 4H7JA 1HURA 3ACBA 2H2FA 5K8CA 2H1WA 2C78A 3AQIA 4BNDB 1NTRA 2CJWB 4AIRA 2R6GA 4DUGA 3VJRA 3QEMB 2NP6A 3I2GA 4RVGA 2QPTA 4GM1A 3KLNA 3RRBA 1L7EA 1BS2A 1PLKA 1SWWA 3T38A 2HDHA 4AUMA 4DM4A 1FZTA 3SC6A 2RAFA 2H7XA 3AR7A 4EENA 2IYYA 1O54A 4Q3NA 1YZKA 2PZJA 2REBA 4W4TA 1PZHA 4ZI7F 1V1JA 2B8JA 4M49A 5FH9A 1G1AA 3C1UA 3FRJA 3HKDB 4Z9BA 1U9JA 2P9FA 2Z6UA 4WOBA 4PM4A 4ENVA 4BNFA 3D1VA 1NPDA 4C7KA 1T8UA 1X1BA 3SJBA 3D9QX 4P0QB 2X7JA 4HDMB 3WRYC 4U2BA 3VZBA 4P83A 1QXSA 2DWUA 2EJWA 1A9YA 3KVNA 4P7KA 5BQ5A 3SAJA 4E46A 2GZRA 4K9NA 4JXXA 1N5MA 5EE1A 4GG1A 1TADA 4IIYA 2AN5A 2ERYA 3N07A 5KO2A 2JLVA 3HBMA 3AONB 1BFKA 2VHYA 4F2PA 3NEAA 1GTVA 1YHYA 1N3IA 2BKAA 2OBBA 2XODA 3EZ2A 3JS5A 2OCDA 4II2A 1N0HA 3FD8A 3BMCA 4MIKA 1NA5A 5K6AA 5K8UA 4FKZA 2XNKA 3T54A 1MAHA 3C98A 5B3AA 5IHXA 1JIXA 3SXUA 3MTAA 5DTMA 3RSHA 3LUJA 3ZJUA 4YRNA 2G36A 4TWJA 1I8TA 4JKIA 4RL4A 4FKBA 4OQ4A 1ADJA 1WMEA 1L1RA 1DEOA 3OE4A 4U5QA 1J70A 4G8CA 5FI0B 4CG2A 4FHEA 4GGPA 1MMFB 4NJMB 5KNDD 4Q9KA 4BFCA 3EEFA 5IVDA 3RT7A 2JKVA 1QF9A 3GHHA 4KSBA 3A32A 4MIYA 1HZZC 4TMWA 4ZO7A 4NU0A 3ZHBA 4IPTA 1XRRA 4D9NA 5MF6A 1BIFA 4XUGB 1UK8A 5GVRA 3MA0A 1GYRA 2OG1A 2QTCA 3PGVA 3A3KA 3MSXA 1JR3A 2DCUA 2C5EA 4RULA 1LJ8A 1CUUA 3M2TA 3EJ6A 1NMEA 2BCEA 4UTVA 5AVRA 3S7TA 1IUKA 3VDXA 5JLJA 1G5TA 4OBEA 2GD1O 5IU6A 4A16A 4UM7A 4O4IA 3SR4A 3GZTB 3WQQA 4TROA 1Q0TA 5NLLA 2JS7A 2B37A 2CKDA 1EM6A 1NULA 2G5GX 2B9EA 1PGNA 3E8XA 1NP6A 3NW9A 4DMRA 1PJRA 1NW3A 2VNAA 2ZYUX 4OLFA 4WIAA 5BYKA 2VG8A 2RARA 3ZE7A 4DMLA 4G26A 1GXSA 2I1VB 2ZIUB 2ZRQA 4X44A 3Q8WA 4E3ZA 1HKUA 3P20A 1ACLA 1X1AA 4IQ0A 3WLQA 3PFCA 4YRLA 2QLBA 1S2IA 1XMOB 5KOIA 1Z07A 3PYMA 1FRQA 1ZD4A 1PTJC 1T6BY 4PVCA 3CLTC 4BBJA 3QEAZ 1W0CA 5TPZA 4R31A 4EHLA 1C3OA 1EINA 1VB5A 2QAGA 1UK7A 4N40A 1PK7A 4IS3A 4QPDA 3ZJ5A 3KPWA 1N36B 4BXOB 2OCKA 3N76A 3KOUA 1L8OA 2J8ZA 5B3JA 3D3EA 2VZEA 5JMTA 4I55B 2MSWA 2NNWB 5D5QA 2HQBA 4OAPA 4Q9AA 5AVSA 5BRJA 2FDXA 1FVHA 1FDVA 5H70A 3CTPA 2MTBA 3EVTA 2FSPA 4HAOA 4OJNA 2C4UA 1C29B 1DPGA 2FSIA 1UXIA 4JI1B 3OPYI 3ANTA 3EIOA 1CJMA 2CDBA 2D0OB 4TKZA 2NAFA 4M0PA 5DHPA 1XRQA 2JLAA 2JIOA 4F72A 3OSZA 1DBIA 3D2BA 1JLLA 3SYLA 1NIPA 2FRDC 5CNMA 1EX9A 3K0SA 2P2GA 3DGFC 4JDPA 3WGGA 2ZKIA 4XYLA 1I7DA 1KP3A 4Q4LA 1VTKA 3O2JA 2J3KA 2P2NA 4MVJF 3AUFA 3TK1A 4BNHA 4I5FA 1C9EA 5CXXA 4ERNA 4E6PA 2ONJA 3GDFA 1Z56C 2NZ2A 3GELA 4GBGA 3HVIA 4M6WA 1Q14A 4YP7A 1VL1A 3V2GA 1GQYA 2QRPA 1XEWY 1X1SA 2HJGA 2WIKA 1E2LA 2N1MA 4JASB 4LJAA 5EKDA 4ZODA 1CY6A 1Z28A 1K7XB 4GSYA 1SZJG 4YLGA 5HJ2A 4WGGA 2NT3A 1KHHA 3L46A 2M32A 4FNAA 1TKRA 2HMTA 3I1YA 2MSEB 2ZVDA 3SQDA 1DXHA 3V7YA 4ARZB 4UDXX 4DZRA 1JHVA 1R16A 4O8CA 3IC5A 1SD2A 2EJTA 4MKFA 4Z4FA 3GNTA 4RHEA 3P0HA 2AR7A 5EMLA 2ZR0A 2F64A 1E4OA 4PONA 4R8MA 4E1AA 4KUHA 4IDOA 3C74A 4QYXA 3OBBA 1F1BA 2B94A 1UJCA 5DYIA 3UT5B 2V6FA 1L8LA 1IPHA 3Q9LA 2GXSA 2PX6A 3P1JA 4FD2A 1ZH4A 1M75A 2YWFA 3KVVA 4JLOA 2BFFA 3MXOA 5B5SA 3CVOA 4PGGA 3UO8B 4AYXA 2X6RA 3MWFA 4YFYA 2G1PA 3RASA 4D43A 4HQKA 4IUCS 1PHPA 5JFGA 1FP6A 1MIOA 1AKQA 1ZM4A 2RI1A 2BBTA 1I4LD 3FHOA 4B7CA 4DR7B 2R1UA 5CVDA 1VSUA 2OV1A 2QVCA 2OZLB 1Z5ZA 1ZM3A 4KN9S 2Q5IA 2YDYA 1PK9A 4CMEA 1EIZA 3E2MA 5L7WA 2FLKA 2IXFA 3WDSA 5T67A 1GPLA 2AI1A 3KJGA 3UJPA 2QNRA 2ZB7A 3BCUA 1MF7A 4IVRA 3W34A 1M6EX 3B1YA 3JRWA 1V8FA 3NP7A 1KO7A 4HH0A 3IA2A 4HEA6 4H0FA 3V4PB 1GEGA 2GMWA 3EE6A 4M0LA 2QTVA 4CKBB 3MC1A 2WHEA 5TX7A 3R8CA 1T0JB 1IZ9A 3CUVA 3H2GA 2VYVD 1LSSA 2KBFA 1N9KA 3GLGE 4ND2A 5TB5A 5CLLA 4MXDA 3B36A 2M1ZA 3ADOA 2PK3A 2QR3A 4QEKA 2G17A 3PRJA 3B38A 4BRUA 4GKAA 5LXTA 3DSRA 3I01M 4LXIA 2WKSA 5L3VA 1TC2A 5DLPA 3DLCA 5ILOA 1XPOA 4GWLA 4ENTA 2ZUVA 3AVQA 1N33B 2XUGA 1BRMA 1QLWA 1W73A 1AIPA 1UKBA 3CF2A 3EF1A 1G20A 1KL7A 4F4IA 2QJOA 1QPZA 1VP3A 3DLIA 4KWCA 1TD9A 2NXWA 3PJGA 2YIMA 3C4VA 1DKQA 1HQDA 3FTNA 1JR3E 2IXEA 4MMXB 3SI7A 3CSSA 4X8LA 4YV0A 5K0FA 1GAEO 1HT0A 2EATA 4YV1A 5JQGB 3BGWA 5KQRA 4P82A 1CRQA 4M9SA 3GARA 3R0JA 2W4IA 5D3QA 2CDAA 3V8MA 5E38A 1CUJA 3SD7A 2OSVA 1NONA 1C41A 3W6NA 3WLPA 3FYUC 2FPGA 2JATA 3U9SA 4RV5A 4PYQA 2YNMA 3UAVA 3Q8MA 2VQSA 4PINA 5BMVB 2C3YA 1CUAA 1O5IA 1GZDA 1VBKA 3LPLA 4MQ6A 4GZ3A 3WHPA 2XZDA 5CDFA 4XZ3A 1F8YA 1TUBA 2Q6LA 3Q3VA 4WK2B 1DKRA 1FUUA 5IKEA 1PJLA 2HIGA 3KJIA 1SMKA 4QGGA 2BBOA 1GNLA 3LDFA 4X45A 4BUZA 1NQAO 1RFLA 2GESA 2H5LA 2WIDA 2WTBA 3D8TA 3T7KA 4ECAA 2WJ3A 5K0GA 3GQVA 4J9UE 4P36A 4FFPA 1NWCA 3INRA 2P6OA 4TSKA 3EVDA 5EQJB 2Z3ZA 2RHDA 2PAFA 3ENVA 5KINB 2J85A 2PX4A 1JZTA 3P9NA 3TECE 3W2HA 4HADA 1D8AA 2OQ2A 2OFXA 4YB8A 5JE8A 3D64A 3BRWA 3A25A 5BQFA 2EKQA 4O4HF 4XD7D 1WAMA 4YJ3B 4B3DA 2VDRB 1U8UA 1UXJA 2SICE 1N5IA 3JY6A 5ES3A 1F14A 1RWQA 4XM2A 3ST7A 1L8QA 5TT0A 3UAOA 4ON9A 3SEFA 3UHJA 4EJ0A 2JCVA 4IIHA 2GTPA 2HSGA 3D43A 1FNMA 3IGFA 1G16A 1MB9A 1SA0A 1L4EA 5KSPA 5TMBA 2KHZA 4BQEA 1NAHA 4EA8A 1E7SA 2WNHA 2JAWA 4IAOA 4A2QA 1L3BA 2CVOA 2XI4A 3M81A 4OL9A 5JISA 3KOWA 2F9MA 1LA2A 3IAUA 1GOTA 3GEIA 4IOMA 3DTVB 2ZRMA 4JNKA 3D3QA 5JMWA 2QA5A 2QM8A 3HO1A 1IK6A 3O0DA 5ALHA 2DPGA 3SS9X 1ENOA 1T26A 2I6XA 5H82A 1PNVA 4YYZA 4ZYVA 1RRPA 3OD1A 4J4TA 5BWLA 4YP0A 5F1PA 4HH1A 4N5MA 1K2WA 2OORA 1SBQA 1SOVA 1SRRA 1YK1A 1XVAA 1C2YA 1VE9A 2O1EA 1ZH0A 3R77A 3TLZA 4BAUA 3L4BA 1I10A 1UFOA 2CLLB 5DX0A 3SHWA 3LF2A 4CNBA 3M6IA 4TRRA 4XGQA 5HF5A 1N1EA 2QK4A 3K6KA 1R6TA 3CZCA 2H16A 1THGA 2NO5A 2NTVA 1LKZA 3PNKA 2JVIA 4L0QA 1V41E 4Y1RB 2NU9B 3HN6A 4HNAB 3K16A 3UANA 5DGXA 4MQBA 1O96A 1I1QB 1AK9A 4BN0A 2PMCA 1VJRA 1PJZA 1QM5A 3OC6A 3KB2A 4IJVA 4LJLA 2C84A 4S24A 5AW1A 1RZRD 1WP4A 2WJHA 1USIA 1Z82A 2IE0A 3U3RA 1G5QA 2C9BA 2WSSA 1THZA 1C3JA 2Q1TA 2IHVA 3LKZA 2HLNA 4OX9B 2H5IA 4FLEA 2IP4A 2V9PA 2DQ4A 1CUBA 3JQ6A 4IIUA 1QP4A 3CLRD 1QZUA 1V35A 1X3SA 4JBLA 2ZUEA 1N6OA 2YVUA 4OVKA 4ACAA 1V1MA 1EFKA 4II3A 4BC1A 5EMKA 3T12A 4V02A 4DG9A 1VLJA 2GFIA 2PCLA 3F6EX 1U9ZA 4OQMA 3D8UA 3O4GA 4WKOA 1SCQA 2XKJE 2ZB4A 1XEXA 4Z1OA 2J6IA 1QIDA 4DHWA 3KTAA 2WE7A 4CLEA 4EDFA 2HV8A 2GA9A 4WESB 5H0IA 3BKXA 2XNDA 3D5QA 3K72B 5CA0B 1OTXA 4AXBA 1AHHA 4B74A 2HF9A 4X66B 5TVKA 3HPRA 4C7MA 4LHYA 3OA0A 3ANSA 4J16C 4JLWA 2GJKA 3KYIB 5E6SA 4CL3A 4X62B 5A4DA 3QVLA 1QTNA 4J2HA 3BTVA 3EXHA 1Y7HA 2HMWA 1N6KA 1QVRA 1QH1A 3GQBA 2DFTA 3JQBC 4XASA 3ZKAA 1OKKA 5DNDA 1COWD 5B58T 5K3FB 1JW9B 4DRYA 3F3KA 4FGWA 4L3VA 1E4EA 2BR5A 1QSGA 3QVSA 1ABBA 4QHTA 2W6JA 4GRIA 3FFBA 5DPMA 4ZKEA 4JXZA 2IGTA 2JFHA 5EMHA 1AXRA 1PJ2A 2IK8A 1P81A 3ZI7A 2I2FA 4PAQA 3WMEA 3GVHA 3NV9A 3RS8A 2J3EA 1J25A 3KTFA 5EVJA 1JTVA 2O1SA 3IERA 5FPSA 4ZWNA 5H3HA 4YR7A 3I6QA 3NT5A 4B80A 4DIFA 4P3PA 3TVTA 2JAOA 4C3OB 5E4FA 1NYQA 4NOJA 1YQQA 4AKHA 4LISA 3ILHA 2O8CA 3M34A 2O7VA 3CYFA 3KELA 4ZGBA 5C2JB 3X1WA 4JI0B 2ZBRA 5ALZA 1IZZA 3IPXA 4ARIA 1YB4A 4EPXA 1ID8A 3PWSA 2X9NA 1JDNA 3F7NA 3G8AA 2CV2A 2V3VA 5KKAA 2H0QA 1DXQA 3LVBA 4QGAA 3PIIA 3W6UA 4LE0A 4A8TA 2HC9A 2QYSA 4AJOA 1Z2CA 2JARA 1TTPB 2D1QA 1RHQA 3OTGA 7YASA 3GLHA 2AOTA 3EA4A 1DIAA 3LZ6A 4MQFA 5LBTA 3PXGA 3V4VB 4BNYA 4N3CA 4E31A 2WF8A 1XZQA 2OAP1 1IG0A 4IIDA 4KQWA 4KPFC 3H2SA 5F2KA 5JLAA 4Y2SA 1YOVB 2DX7A 4E33A 1YGPA 2ID8A 3DBLB 2K4MA 1T2UA 1N3BA 3PQ2A 4UTRA 1K7SN 1TPYA 4QPCA 4NICA 3WI7A 3V34A 5JY6A 3OIUA 1LVUA 2YOHA 2CFRA 4IFIA 1I32A 4ZO4A 2YC2C 3DE0X 3HKCB 3U37A 1EK6A 1NY5A 1QK3A 2G28A 2PX0A 2VA9A 2ZUCA 1CS0A 3MOGA 1E5VA 4FXOA 1YR9A 1Z5WA 5G4LA 4DIBA 3A1EA 5C7LO 1G4UR 1P0IA 4EY5A 3T7JA 1XK7A 5JYCA 1AX9A 4Y6LA 1YUMA 4TV9B 1E79A 2Q45A 1NBEA 1J2EA 4LZNA 2X5OA 1FP2A 1YULA 1Y6FA 4Q3LA 2A2ZA 3LPCA 4H35A 2C92A 3H11B 2ZTLA 4AZ3B 1GL3A 3MWLA 1HLFA 5B7NA 3GNQA 1UANA 3QG1A 2PT5A 1U0RA 1T8YA 2L2QA 3U7RA 3UG7A 1LPPA 2R1TA 4U6SA 2JVKA 2ZYSA 3T5MA 2GZMA 4G5SA 3W8NA 3ELWA 2JGJA 3ME5A 3RYFA 5G40A 1WR8A 2CXPA 5JR3A 1USGA 1DKUA 4A0RA 2HYIC 5BRAA 5ITVA 1NVVQ 2CE2X 4J0IA 1HTBA 2F4NA 2VK8A 4HNTA 4NCBA 2QZ9A 3H2KA 3JD3A 4C78A 2IV2X 3QX8A 3PEWA 4GPAA 4TZ6A 1E9DA 3NV7A 1GTZA 4C7OA 5P8WA 2YUTA 3DT9A 3NWOA 3W04A 4MWGA 1UC8A 3F46A 1RVDA 5DRYA 3KHUA 4GPTA 4TX1A 4UUAA 1NUTA 2I7VA 3LOPA 4I50B 1IVSA 4MZXA 3AUYA 4PFSA 1MAVA 3KQWA 1O4VA 5AW9A 3S2GA 4B6OA 4B9EA 1IJBA 1EDOA 3AHJA 3AHEA 4QTYA 1NJ1A 5BPFA 3RU9A 5GVSA 1FMFA 1P8AA 1ZRSA 1JR4A 2AB0A 4OYHA 4QDXA 4BE7B 4DABA 5CB4B 1L5VA 2C9DA 1TCUA 1Q7BA 1UDBA 3G2PA 3AFHA 2J7KA 3PKJA 1M1YE 4TSFA 4D4LA 4CKCB 1XTBA 5LYJB 3AVWA 1CEEA 1Y37A 3KJFA 1EXWA 3EGIA 1T4GA 1IBSA 4LNUB 1JKJA 2HMVA 4ZPXA 3S81A 1JIJA 4MWBA 3NMUF 2CHFA 3O8LA 2SKDA 3FVRA 1ULZA 4PLCA 3T41A 4BLPA 1BVRA 1MGPA 2CSUA 1IY2A 1N8SA 2XYPA 3EOAI 3FHLA 4KH1A 4KN6A 5ALWA 1I9GA 1YFZA 4GXTA 5EKSA 3WLLA 3HXPA 1L5KA 1R6BX 1QAOA 1Y3AA 1KDVA 4YUZA 1CR4A 1ODTC 3L0YA 5DF1A 4C7JA 5SYMA 2EC5A 2JJ2A 2QVZX 4L5YA 3W3AD 3QY0A 5L4SA 4WCFC 1A7JA 2ONZA 5C81A 3AUKA 1XG5A 3KB1A 4PBRA 2QR5A 3R7BA 5B12A 1TW3A 2AKAB 5REQA 4A36A 1I0IA 1TCAA 2NXEA 2NPFA 1SOWA 3ZZ1A 5EIAA 3RSQA 1DLIA 1Z0UA 1WXQA 3EXAA 3MBIA 4E12A 1HFEL 3OKAA 2GCOA 4BRWA 1W19A 3P4UA 2ZT6A 1VLVA 2NU8B 2AJTA 1LQTA 5D51S 1DG9A 3OF5A 3OM1A 5E6UA 3M4JA 4D26A 1W2HA 2AMYA 3U7EB 3KP1A 3OWXA 1E99A 2A78A 1RP7A 1KP2A 4RAQA 4X84A 1KI6B 2Y2VA 3AM4A 5EJ6A 3M6FA 5AJXA 1Z4KA 5AVVA 1W49A 1AZTA 3I2IA 3N5KA 1MEOA 4J0FA 3LE8A 3T9DA 3KWFA 4L4YA 2E4YA 4ZCMA 2V6JA 3WJ2A 1F0PA 3FIUA 3R20A 5CDHA 4QTTB 1T9AA 3ET5A 2OLKA 4NIMA 1MH1A 1P9OA 1TEHA 4H59A 4MV3A 5KB3A 3IXLA 4F45A 1MDBA 2W6NA 2WOJA 3IQGX 5C8YA 5SV2A 2QTTA 3PUXA 1ZX1A 3IEVA 1Q0SA 1O4WA 1Z7GA 4NYJR 3EFOB 2NADA 4XEHA 4ASUA 3JARA 4N76A 4M8LA 2A0UA 1IIRA 2NWQA 1P2VA 3G2HA 5FT9A 4EW3A 4YV7A 4LF9B 4R8LA 2FMTA 2A4KA 2IYZA 3GP3A 2NU7A 3FOAA 3GYGA 4BBAA 2Z57A 3CLVA 3R0IA 2PXHA 3GA5A 1V11A 1B0PA 1KI2A 4EKGA 4B9AA 1R6VA 3TLKA 1JAXA 5FA8A 4YRDA 1ZN9A 4A73A 2GN2A 2HRZA 3ZUGA 4LOAA 4X7BA 1P0MA 3JQAA 3GA0A 5AW0A 5FNZA 2FOLA 5C7YA 4Q4CA 1WBBA 2VWGA 3TFQA 4B79A 3D6UA 4UU8A 2ZEJA 2AQIA 1JDBC 3ZV4A 4Y2RA 1XA0A 4MGKR 1DUVG 3IPAA 1NF2A 1F5SA 1VJ1A 2F3QA 3DC7A 1GNPA 2R11A 5FQNA 4EEXA 5A62A 4JC4A 3IP9A 2RK6A 2H57A 2NU6A 1G7SA 2AUMA 2JGDA 3TQRA 1N6HA 1J8MF 4H4DA 3WQHA 5BVHA 2YJZA 4YYEA 3SVLA 4G36A 2CMKA 3F6PA 4QDTA 1NNLA 2V4MA 3U3JA 4CODB 1IZ8A 5LIPA 1NW9B 3NYWA 2OY0A 4OFZA 3DQQA 4BNWA 2DVMA 4EJSC 8ABPA 1FSSA 4GXQA 4NBKA 1AQNA 2ASEA 1X1TA 3GD5A 5T64A 1AF7A 2PZMA 3OKPA 1ESZA 5C8ZA 2RGEA 3C7DB 2R5NA 2HSDA 3KKLA 2FCAA 4BJ5A 2XWJI 4EHKA 3T3NA 3H7AA 2C2KA 3CKLA 2AXPA 1XKLA 1S2LA 4JT4A 5AK4A 1EVIA 1UC4B 3B78A 1QG6A 3H86A 4JYMA 3QF4B 4EJ6A 3LLSA 4HUQB 4KMMA 4BASA 2YS6A 2OE2A 1Y7PA 3C6XA 1NVKA 1S02A 4KQ1A 2VH2A 2I8CA 2X3UA 5DXAA 1DB3A 1M2JA 1AHNA 3GGSA 3NDJA 4M9UA 5EPUA 2BFOA 5JZBA 1JQKA 1LRLA 5GY7A 4IXMA 4GKVA 5EPOA 2ORYA 3GEMA 1RI2A 4V0KA 2C31A 1N2SA 1CB7A 4MZDA 3FAZA 2XGMA 3GFSA 4W8HA 4E13A 2C7QA 4JGIA 2I4LA 1EVYA 3FJOA 4HLQB 2WP8J 1JEYA 3UT6A 3V8NA 1AA9A 3FA2A 1GVNB 2D1RA 3KRTA 3ZE1B 1R5JA 2WYWA 1T5IA 4I1IA 1RM0A 4YC7A 1FXSA 3P19A 5DMHA 3D6HA 1K98A 3FFWA 3OMWA 1ADBA 4YRCA 1KORA 5ESRA 3RRFA 3VMFA 5EP2A 4W5WA 5HCNA 3TNJA 4I14A 1SU7A 3IDZA 4UXJA 1P72A 3CHYA 5JJLA 2J9YB 1N25A 4Z7JA 3DBHB 1W2GA 1XMXA 4TQGA 5A05A 3ZWNA 3HGMA 1LF0A 1X3LA 1ZLYA 2JGRA 1NQXA 4ZZ3A 3ZQJA 1RZVA 1H0HA 3NGXA 3B60A 2V7QA 2FWNA 2WYUA 1NUQA 3KD2A 2NTJA 2HO4A 3PA6A 4G25A 2HHHB 4OHFA 5AH0A 4JBGA 3IALA 3X1MA 3OQNA 1BJTA 3D0KA 4CIXA 4J1QA 4AZWA 4UVGA 5E6RB 3NJRA 3GYBA 3PU6A 5LM3A 5KVSA 5KYWB 3P96A 1T3GA 2CFTA 1FLAA 2QQEA 4LYAA 4W6ZA 4AROA 5EIXA 4PLPA 5JZ9A 1G59A 5IJZA 5JOQA 4N39A 3U09A 5FXMA 2XIQA 4LMAA 4WOPA 4ZVKA 1PR4A 1ZHHA 1F0YA 1NFFA 2Y1GA 2XBLA 2WY2D 1N77A 1U7OA 1XTRA 2CLFB 2ZSEA 4OMCA 2B1QA 4H7DA 4Z3KA 3AXTA 2QQGA 2Y8EA 3IQXA 3F1LA 3PENA 4JGGA 1LS1A 1AKYA 4LY9A 4X90A 5CBPA 2CVQA 4DLLA 2H4ZA 4HVCA 4DCOA 4WAUA 4FMPA 4MCAA 1FTQA 1IUPA 2NVUB 1N6PA 4KYTA 3KBBA 2J87A 5FYDA 3MGKA 1WZUA 2COKA 1UZNA 1P5JA 2WHXA 4MNTA 3OU2A 4OI2A 3T0IA 2X77A 3C3MA 3GB9A 4NQRA 4X8HA 2VPIA 1QFMA 3RRXA 1Z8NA 3DV0B 3T9BA 3PUWA 4PLZA 1DO2A 3TBFA 3RR2A 4A5SA 3OTOB 1ODSA 3D6JA 1GNRA 1XD9A 3LK6A 4U0JA 5LQMA 1HFJA 3UWDA 3QLEA 2BEJA 3AMVA 2C5GA 2VQ6A 3TTYA 4C0HA 4BNVA 2P2CA 4JI4B 4LNAA 3PFHA 2CCKA 2IQ5A 3L1KA 1C1XA 4XI9A 1YACA 4B84A 2QDXA 5HUHA 2UZ4A 4LPKA 4AF8A 5BSRA 2JGAA 3H9UA 4AMYA 3E7DA 4M99A 2X58A 3L8DA 1S7CA 3P9SA 1XZHA 1TB4A 4GP6A 2VPQA 4J3JA 2F7SA 3A6GA 2BHNA 1C9YA 3F5QA 2VJCA 1YZNA 2FFHA 5ERXA 3FPBA 3SZUA 4IDNA 3L9WA 1KEUA 4AMZA 1E8MA 3N2GA 3GXBA 3NXSA 4KV7A 1SZDA 4DUZB 2OC4A 3ZGOA 4X1KA 5EEHA 3CVWA 2QP9X 3P2KA 3TNLA 1AGNA 3AINA 3ESAA 3AEQB 2P5SA 3ND9A 4F8YA 2QMUA 3Q0IA 4L22A 5ALPA 3RADC 3EVFA 4QUEA 4JDUA 3UK7A 1CETA 1K1EA 3Q4GA 4HZUA 1XVUA 1P2UA 2WYHA 4XRRA 3T9AA 1RPTA 4G01B 1C1DB 2I4TA 3NVAA 4U2KA 4G1CA 2Q4BA 4AKTA 1IDN1 3C3DA 3GJQA 1GP2A 4Q3OA 3NETA 4AKEA 3LFUA 5ALJA 1XN4A 4GT1A 1D03A 4ZARA 1B8PA 3GI1A 1EB8A 3DCIA 4UVDA 4B6EA 1JH8A 4WXMA 1WUJS 3SYTA 5FPTA 3GAFA 2KJQA 1U02A 1SUFA 5L3ZA 3W05A 1PKXA 3L05A 2IXDA 3PNQA 3DKPA 3FCEA 2PRIA 4QLAA 4DJTA 4NMHA 2H1CA 4L8FA 4LHEA 4EO7A 1CRPA 4RF2A 1N6NA 4RENA 4HR7A 3SXPA 5B30A 4YUYA 5BXQC 2QTRA 2Y0BA 2OO3A 1PR0A 2ZU6A 3WK8A 1PT6A 1SC1A 3DZKA 5CW1A 4TV8F 1G8KA 2I3AA 1JJVA 4YJ2F 4CV3A 2ZIFA 2RIRA 1P61B 4TKVB 4Y30A 4MYDA 4B40A 1N5RA 1SCUA 2DQKA 2RC5A 2RJOA 3B1JA 3PCXA 3OPXA 2RG7A 4JYBA 5TPWB 1OYWA 1QDLB 1P0CA 1XA3A 2A0YA 3EGCA 3K30A 2ODAA 4FB5A 3G0DA 3LWBA 2JLZA 3KR1A 2WSYB 1BDJA 3TZBA 3NOXA 1ZK3A 3M3HA 3RI3A 5P21A 1XZ8A 4AO7A 1DOZA 2HYDA 2Q49A 2X22A 3CGWA 3NTRA 3IH5A 4IEFB 4B32A 5I47A 3T5AA 3PLAE 4LOLA 5IJ9A 4RIIA 5TV2A 4U00A 4KVZA 2BF7A 4L08A 1TMKA 4ND1A 3THRA 4JXJA 1GL6A 2GKSA 1IBCA 1PGQA 4ECEA 2RGBA 5EJ5A 2NT4A 2X0KA 3FNIA 4HH4A 4DDWA 5AKZA 1L2TA 2ZR8A 1FW8A 4L6AA 1XC7A 1FVXA 4EAQA 4NEHB 5DIZA 1P4JA 1P80A 1REQB 1W48A 3AETA 3DMFA 3KCNA 5ARDA 1AGYA 3WL3A 1SEVA 4MP8A 3JASA 3FGZA 5B4TA 3S4YA 5MGNA 2XJ9A 4V0OA 4N3BA 5EGSA 1KE2A 4CIWA 4DWJA 3SN6A 3B3FA 1MXFA 3GRRA 3ZJ4A 4OUDB 3NUGA 4JS0A 1E9BA 1R8SA 2PKYX 4R8SA 3WDMA 3B6MA 1CVIA 4LJYA 3CPSA 1QS0B 4YPFA 3WLIA 4NULA 4XSHA 3R7DA 3WLAA 3ZLUA 1EESA 1J49A 1JSZA 2YWCA 4X6UA 4CMIA 3HXLA 1PYDA 1ADFA 2Y0EA 2MCFA 3TFWA 3G8BA 4FHFA 2VNJA 5ALOA 4EFLA 2RH9B 1R5OA 2QYOA 2DLNA 4CM4A 4QREA 1QVWA 1E3JA 5ITZA 3TDNA 4FBGA 2GM4A 2NUTB 1QAQA 3JQDA 3QELA 4IFEA 1AKNA 4BWFB 5AVTA 2Z8ZA 5U4QA 13PKA 2A1UA 1U81A 3TLBA 4D5GA 1CZOA 1A9RA 3NEYA 2EF1A 3QKTA 4O4JA 1PYGA 1RHMA 3W7VA 3RE1A 1QUEA 1HPLA 3ZVMA 2Z98A 4TS3A 1KEEA 5CK4A 3TW8B 2VBIA 1M1UA 1XCPA 2RI0A 3OLWA 3B5EA 4ZP1A 3VR2D 2KLHA 2ZUWA 4PFQA 5DGIA 4TYPA 5C3MA 1BD4A 1G41A 1ZOOA 4EKNB 5AI0A 4ZVVA 1KAHA 1N4DA 1S4QA 1VDMA 3KPVA 3U4GA 3UV7A 3GFFA 4D3ZA 4NDAA 3F9IA 4OTZA 4YT5A 1U2GA 4XB2A 3L40A 2F1HA 2NIPA 5HF6A 3HV0A 4AP9A 4QARA 1FNSA 2FUCA 5TJ9A 1WU7A 2XMGA 4JJAA 4K81B 3HDTA 5JMPA 1XLTC 3WWYA 3QWHA 5I7RA 3U7FB 4EF4A 1QQAA 1MC4A 3BRQA 1QQ6A 1PJ3A 2F55A 4NEQA 3EPPA 2PZAA 2BRUC 2GHIA 5A2QA 4TPKA 2W6ZA 2H9IA 4MV8A 4RVDA 2CLIB 3WGHA 4D9FA 1IB6A 2JI4A 4N1AA 2QE7D 3PVSA 4ESOA 2OO5A 1ECJA 3DL0A 1SHTX 1Z0SA 4EFDA 3EXEA 4CHGA 3KVRA 1GUFA 5E3HA 4XYMA 1U7WA 4PS1A 4BO2A 1JQ5A 3E8SA 3CUSA 3AM5A 1XU7A 3AOGA 3GMDA 3KFVA 3FTFA 1NP3A 4V0QA 1YDGA 3PQDA 2W93A 1V16A 5AOAA 1VSQA 2ATVA 3DVQX 2C83A 1QFZA 2ATEA 1M2HA 3F0TA 5FR1A 4RXMA 4H3KB 1RC0A 2O3JA 2V3WA 4ZJZA 2ZXUA 4JVSB 2RBKA 5K7SA 4PG7A 4RORA 5T4FA 2EX0A 2JJMA 1OI4A 3TAUA 2BFBB 4CFSA 3BD6A 3KSUA 2CF5A 3HCNA 2DEUA 1J2YA 3GCXA 1MOPA 3NOVA 5JD5A 1UKZA 4KQHA 3AJAA 3OEHD 4UTOA 3T1VA 4ER0A 1ODJA 4I4NA 3J7AC 5D86A 1H94A 2VDVE 5J3JA 2RD2A 4YRGA 4EVIA 2BUBA 4N3GA 3FDZB 1C7FA 4WEQA 3RUHA 3RF6A 5AW3A 5KNCD 2R66A 3STYA 3GFQA 4D9IA 4G0VA 2CUTA 1H8ED 5AOVA 2YHAA 4OATA 5EJ2A 5TQJA 3LWDA 2IYEA 4RSGA 5IJ0B 4RLQA 6YASA 3O4IA 3L92A 5CVTA 5IBCA 1M6WA 2AH5A 4EG7A 4CMJA 2X4GA 4DSUA 4F56A 1W29A 3D7NA 1NY6A 4IS2A 3USES 4KBGA 2H7VA 4JIMA 4PZZA 4RPKA 3GP5A 1SGWA 4TM7A 3T7CA 4ZOBA 4WK6A 5AKIA 3VR5A 2VA8A 2Z30A 4MS4B 3VISA 4BATA 5LC1A 3M6MD 3ISJA 3LI2A 2GEKA 4IINA 3E84A 2B69A 3C14C 3L0ZA 2ZXFA 5ALIA 4I3HA 1ZXXA 3H75A 2HKIA 1VKNA 4XWYA 5E8JA 3VNUA 4P4TA 4UBMA 1BQEA 5ALRA 3C97A 5AM5A 5KDLA 1WVGA 1IB0A 1RYYA 4UUNA 2C4KA 3VQTA 4Q4HA 3ZHSA 1W76A 2QVGA 1ZQ9A 3M4XA 4KGXA 5FCDA 621PA 2D4AA 1DP4A 2HRBA 2R62A 2WU0A 3ETHA 3U1TA 2NV6A 5LR6A 1W581 2GASA 1TJ3A 1BXRB 3MD9A 4NABA 1I4OA 3DYVA 2YYZA 5L7YA 1QWOA 3R6TA 1XYGA 2X76A 5JAMA 4P2BA 1TECE 2WKRA 2WWVD 1LEHA 1IWBB 2O4CA 2AZMA 2DYKA 4N12A 4U0KA 2YXLA 3ZE8A 4REMA 3CVVA 1WUYA 1XZKA 2J0UA 3CRQA 3AEZA 3AH8A 5SZKB 1GPUA 2ECOA 3WE7A 3WWDA 1QE0A 3L7NA 3DXXA 2XDQB 1YZVA 3I72A 3KYJB 1W0JD 5DBEX 3N0RA 4H6XA 2J6HA 2QT1A 4PG4A 1JQBA 3QWBA 1H1DA 1HI9A 1YT5A 2G6TA 3KLOA 4TMTA 3WNVA 1DZ3A 4RY8A 2Z4SA 3NTLA 3E70C 3EPRA 3SF0A 3G49A 3AW9A 1D0SA 2P2YA 1C3EA 1CRLA 3F5DA 4BLOA 1QJCA 1E0SA 1QIHA 4OP2A 3UZUA 1WVIA 2HA4A 4UAGA 4J0DA 4DGSA 2RBEA 1O5OA 2WD8A 4FFLA 3UB3A 1IBMB 1P5HA 2H54A 1ST2A 1T5HX 2BIFA 5CG1A 3X1JA 5FTWA 4BP8A 1WV1A 4HQ6A 4EPTA 3V4FA 2R96A 1GRNA 4DCCA 1I6LA 2Z4TA 2IIQA 4BVGA 2HU8A 2ZPAA 4JBXA 3LF1A 1ZD8A 4MR8A 1LK0A 1QQ7A 2H59A 4R7ZA 1XTTA 3RARA 3H5LA 4EWLA 1QQBA 4OEHA 4IF6A 3CCFA 3OJEA 1EU1A 1L1QA 2NSYA 2FRVA 2ZIEA 5AK5A 3ZDBA 1ZFNA 4I4LA 3MM4A 3LUBA 3OPNA 1ADCA 4HVAA 4CM6A 5FTLA 3C3PA 1YHNA 2RHCA 3QMWA 4JOSA 1GUZA 4O0MA 3U7QA 4KPUB 2W0SA 2ZWIA 5IVHA 1Y42X 3ZWOA 3E9MA 3G9QA 4XWOA 4JA2A 4CKYA 1P6XA 2VF2A 2J9ZB 2JIRA 3SQMA 3K6SB 3KG2A 1WG8A 3RUDA 1TKCA 2BFPA 1U2ZA 1ZAKA 3Q1KA 1RRKA 2GBGA 2WAAA 3FVTA 4ZQCB 4BE9A 1CVRA 2XYGA 3H1FA 3VOBA 4MS1A 3H8VA 2B7CA 3CZQA 2YZ7A 3KV1A 3ZVLA 2XDYA 4IRUB 5BPHA 3O3MB 3HB1A 4NYIR 2WIBA 3IP1A 2JD1A 3NS7A 2GEBA 3L6EA 3BYZA 5E9QA 3S2SA 5E0OA 5FHQA 2EEZA 1H22A 4LK3A 4A15A 3QE3A 1YDFA 5FORA 2J08A 4B5KA 3TBHA 4C01A 1NFRA 4WCDA 4X61A 4RSMA 5ILQA 1BE6A 1Q95A 1E1QD 3B2NA 1BA2A 1U0JA 4JVMA 4UNNA 1TUIA 1KEZA 4OKSA 1J22A 2N42A 2RDMA 2X5NA 2VNKA 1NN3A 3P94A 5DP2A 4Q1CA 1Y80A 4CCWA 5T7BA 2V59A 2CMHA 1Z83A 4R2JA 3G2QA 3N59A 1O95D 1VPDA 2Z4RA 3FDJA 2DHRA 3NI2A 3UENA 4CQLB 3NB0A 1UAAA 4ZRMA 2EG9A 4UCFA 3K96A 4O63O 1RP1A 1U2SA 1HSZA 1QJ4A 2H08A 3D6MA 2A9OA 4L3OA 4NFLA 4QO8A 3VI3B 5CB6A 4M9XA 4ARCA 4QU8A 3TIIA 1FMJA 3PS9A 1NLFA 2PYIA 5L51A 3U1BA 4MQEA 2MIIA 5DDIP 2XR1A 3ZIAA 1FNNA 4E30A 4R1QA 1GY8A 1AGPA 3K35A 3AT1A 4FI3F 3BBLA 5F64A 2NTNA 2CBGA 5JSHA 4Y2HA 2VDWB 2QG4A 3PDWA 5HTKA 4KAFA 4P33A 1M6VB 1P7PA 2PWYA 3QVTA 1LW6E 2AZ4A 3LDHA 5EE0A 3EPJA 4D25A 1FFYA 1VMDA 1Q1GA 4CQJA 5L40A 3D5TA 1PFVA 1E7RA 1N7HA 1N9GB 4QM6A 1M8PA 1EVKA 3PKZA 4ZCLA 1V8DA 4IO0A 1U8EA 3D8NA 3KDSE 4RQTA 5KSYA 1FFCA 1T6YA 1ZD5A 3R3XA 4JUAA 5JCJD 1XVVA 5JANA 3BGDA 1XGKA 4EEKA 4IL5A 4FWIB 3CVXA 1HDGO 3CW8X 3Q3CA 4HJXA 4UXIA 2OCYC 1KEKA 4D56A 2POCA 3QKSB 1FB5A 3DF7A 3GUCA 2QTNA 3JYPA 4MW6A 1Q1BA 2ZDHA 2QBYB 2CHQA 5HK9A 1TZJA 2QX4A 5HUQA 4AVYA 1GPH1 2AFHA 4MWCA 1CY1A 5JASA 4IUBS 1JKXA 1YAHA 1FFEA 4RPHA 2PJZA 3LU1A 2J41A 1BCSA 3G02A 3GG2A 3H2JA 4JBNA 1N0WA 1E89A 1Z2OX 2NLOA 2Q8PA 1OUMA 1X7ZB 1HOTA 2QPLA 2JDIA 2Y1EA 1I2DA 3HABA 1ZC3A 1UIRA 3LKBA 4FZVA 1DFGA 4KQGA 4R9NA 3FYHA 1L4GA 3B6IA 4FYKA 3RYHB 2E18A 3I9V6 4HL6A 2OYRA 1IBLB 2VI5A 3FNGA 1ORIA 2E4AA 2D2XA 2O5RA 5DM0A 3A10A 3UW1A 1E9VA 4D46A 3QX3A 4F6CA 4KFUA 5HR5A 5KTSA 2FPPB 1W4LA 3UMBA 3X1KA 2PSDA 4M76B 5HE9A 5TDHA 1FP7A 3HVHA 5JS2A 2WTNA 5HMLA 3WV4A 3CRNA 4MPRA 1TQ2A 4RHYA 1N2GA 3JQGB 1E1CB 1TJ4A 4O2BA 1K5DA 3EPKA 1W87A 3CB4A 1LW7A 3HCRA 3P8ZA 1MC5A 1RXIA 2O2JA 2O1XA 4FMBB 2A9KA 4XFDA 5FLEX 3WL4A 1EFPA 4AX4A 1SQ6A 2I78A 1BKSB 2IUFA 4X7MA 4WH0A 5LNK6 1GUAA 1MV8A 3CUUA 4LXTA 1E5XA 2H17A 4YCSA 2Q6IA 2HCJB 3HKEB 2OILA 1EFHA 2PV7A 3ZK9A 4BMSA 1GTSA 1W1UA 3QVOA 3GG9A 2ZRPA 1FX0B 3G0IA 4FQ8A 2R6JA 4YUXA 2YIJA 3ZV6A 4KPYA 1TZMA 3V4SA 1ISHA 2OUIA 3NJ4A 4GI7A 2DH5A 2Q4OA 1RYEA 2JJYA 4HDAA 4LUCA 4R6WA 2C7RA 3DZFA 1ZD3A 3S55A 5AW6A 2Y93A 4RFLA 3DWFA 4BX9A 3LCMA 4CLRB 5AD1A 3VC3A 3V1UA 1Q3HA 5IH3A 1UBOS 2B4KA 3DPIA 3AY7A 3TMKA 3DBVO 4AYTA 1M5RA 1FNCA 2V54A 1A71A 3BTOA 1XFDA 2J3LA 3KUXA 2PUDA 1E9CA 1KDOA 3A6EA 1QCDA 3WNDA 3OTWA 5CX1A 5JIBA 3Q98A 4BVJA 1SELA 3HCPA 3K6RA 5K3DA 1H69A 1QTQA 2DT5A 1I3LA 2WW8A 4W9RA 1Y9DA 3G68A 3BXHA 4KNWA 4WKNA 5LMCA 3H5TA 4DV7B 1BS9A 3FLMA 3GLUA 3UJNA 1J24A 1S89A 2C0CA 2YHIA 4UHCA 3DZHA 2XZOA 2BHSA 4F11A 3X43A 4XX1A 3CV3A 1MO2A 3I23A 3RHTA 3A7DA 3Q2KA 4PG5A 4ZT3A 1U2EA 1ZH6A 1OXVA 2BBWA 4Y2UA 4DV4B 3RM3A 4LRXA 1WO8A 2Z56A 2BZGA 1PI3A 4PIPA 2O6LA 4MWDA 2XKBA 4F04A 3DM5A 3RFTA 1NUHA 4P4SB 3CRMA 4L2IA 3TRHA 3V8BA 4TYMA 1WEKA 2CMGA 2GJ8A 4HDRA 4MUEA 4YBZA 2G09A 4B4VA 1H5UA 3GJRA 3D4OA 3L6UA 1P9WA 5F52A 3L6OO 3FPHA 3MWGA 1AZSC 1OQAA 4EM6A 4YAGA 1D2GA 1GILA 4V2UA 4HAUA 3FKJA 4ISBA 5JAIA 3TMYA 2BSAA 2WF7A 5CTAA 3TLEA 4YGXB 1KDTA 3M1IA 3MOSA 1EUCA 5M3BA 1AXEA 2PGXA 4DR6B 1G2IA 1HYHA 1SG0A 3AYXB 1VSVA 2JCYA 4OHVA 1P7CA 2EKDA 4RCYA 4MV9A 3QEOA 1DWQA 5T6BA 2OP1A 1RPJA 2FZ5A 2R48A 1CWUA 4K8RB 1ETUA 2ZWOA 4NBTA 4PO9A 5TQ0B 3V4OA 1LJUA 3KHSA 3WFJA 3SKVA 1PFYA 1GNQA 4MKXA 3D2LA 7MHTA 4E70A 2CLDX 2HQ1A 2ZRLA 5EP1A 1NV8A 1U8YA 4FMCF 2XWPA 2QJWA 3WYDA 1PE0A 3AL0C 2P6RA 3RSLA 2LBPA 4J7UA 3GBSA 4A03A 3WA6A 2ZYTX 1GLGA 2OTCA 2VHJA 3X2EA 2O0JA 5AW4A 5LJLA 1TJPB 2CL7X 1XEAA 2WTAA 2YIDA 4OPMA 3HYSA 3SVZA 3REQB 4IV8A 3Q88A 3UH0A 3VH2A 4DCSA 4DBZA 4RUKA 3RVNA 4BEWA 4DR3B 4KC0A 221PA 4KYIB 4J6EA 1Z2NX 3OU6A 5H8WA 5DSZA 1SUIA 1UAYA 2GKOA 1RBMA 3CXUA 3IE0A 3MMSA 2WUGA 2CXUA 1U5BB 4FZJA 3O47A 4U7HA 1H5NA 5HGJA 5BSGA 4KR2A 3HXQA 2GTIA 1YCDA 2NQTA 2OCBA 3QG5A 4FCCA 1YU6A 3RJ9A 1JR6A 4JZKA 2HA0A 4RNCA 4H9GA 3B3JA 3KEQA 2M1XA 3UPTA 3NLLA 4M1EA 5KNBH 1VM6A 3DE1X 1I94B 4C3UA 3VDRA 1K75A 3EW7A 3W6OA 3OQIB 4MQMA 5E3IA 2EX1A 3LYHA 3CX4A 2DBRA 4AWAA 2W2TA 3AOEC 3NP9A 3QLVA 2F1RA 4JL8A 4ZVUA 4BGIA 4BP9A 3BG5A 3FNEA 2C7OA 4LSZA 4KI7A 3ELDA 1T1RA 1H0KA 1JKIA 1KC1A 1R7RA 2Y3IA 1IWOA 1FS5A 3I09A 4MDFA 4TKUA 1PD1A 3CX6A 1W34A 2VXBA 4N7JA 3Q87B 2JLCA 1JR3D 2RB4A 4ME6A 3H1AA 1U2DA 1E2PA 1SHLA 3I52A 1LWNA 3KHTA 4WZZA 4XDHA 5IKOA 1JFVA 4Q18A 2EP7A 2IKQA 2RGGA 2GYWA 5B2ZA 3UUFA 5JSFA 3E3NA 4YRPA 5JNLA 3EVZA 1GZUA 3EY9A 1PQUA 3F6SA 4IWNA 4P4UA 3UAXA 3S28A 1TLTA 3MTGA 3EDOA 2QL9A 5DXJA 2CYAA 2Q5FA 2WJAA 2WFLA 3ULKA 4Q3DA 3GHYA 1M2KA 4O4LB 1PJCA 2PKCA 3DTNA 3I1IA 1VG0B 5DBHX 4I36A 3JYHA 1NHWA 1ACMA 1DRVA 1XDBA 1J0XO 2IEBA 4UOQA 2PZLA 3VPDA 3VRHA 4CI9A 5C1BA 3EK2A 4GX2A 5TNXA 1SQ5A 1E2IA 1T8RA 4OGLA 4BFXA 3DZCA 4G97A 1XZAA 4Z9AA 1RCUA 1YHZA 3QFCA 5CX4A 4DLRA 1DTSA 3H84A 4B35A 2PN1A 4Q02A 5H5JA 3JYOA 3H5OA 3DMHA 1XEWX 5DI3A 1F6WA 3EAFA 3GGJA 1VRWA 2CE7A 4ZC8A 1NAIA 5JS1A 4HCJA 1M1NA 2DUNA 4N7MA 3FWHA 1ZKMA 2UUPA 1DELA 1V45E 1O6CA 3SDSA 2BDEA 5DK4A 4F9EA 1O0CA 5C37A 3EBOA 3BJRA 3H8WA 1CX9B 2C0PA 2G82A 5JDIA 1RHJA 3GFVA 3UTCA 2GBFA 3JZFA 1VA5A 2IV7A 1ESDA 4F86A 1ICIA 4PC7A 1XL1A 4WJKB 1U0NA 3C5EA 3WL7A 1J09A 1U8FO 4KR0A 2VH1A 4FOTA 4C0QC 1UJMA 2IXTA 2FEOA 2NMVA 3DDOA 2VC2B 3TD6A 3PC7A 3R0XA 1CJUC 1XAIA 1NDQA 1Y6QA 1DAKA 5C51B 2VQFB 1GWNA 1QGUA 3AKEA 5KIAA 1TO1E 4CCAA 3JQCA 4DDUA 2I2BA 3C8HA 1ZGBA 2J5BA 2JASA 1O58A 4IG9A 1X1RA 4P3XA 2F2TA 4DQVA 1CV2A 3HP1A 2XUZA 3HSKA 3S6JA 1YB7A 4ND8B 4BZQA 3QENA 1I0ZA 5BV7A 3D8BA 1UWKA 3I05A 4KQIA 3GJ5A 1W5SA 3DLPX 1STOA 4ZEOA 5I48A 3U49A 1Y5RA 4AJPA 5TF0A 4HAIA 4TS1A 3TPFA 3A06A 2QUZA 1YRQA 4ZOEA 1VCNA 4W63A 3MMZA 4CG0A 2BY4A 4L5CA 4GLLA 5I4CA 1E1RA 2VUIB 4B3IA 3IUQA 1Y5LA 2R60A 2WLTA 4XR9A 4DYHA 3C7CB 4FHDA 4JB0A 1GCUA 3OZTA 4D9BA 1QGDA 2QPOA 4AG6A 4TXMA 4H3VA 5FUYA 3URKA 4OIMA 1Y81A 1H6BA 1E0AA 1VCMA 1RTKA 2ZIXA 4JR0A 1MDFA 5TQ2A 1GD1O 3GGGA 4J0EA 1JXQA 4ERXA 5C4IA 2IS6A 2CV1A 3OP4A 3CLSC 5T4HA 4DDKA 1NNSA 3ISTA 2V9CA 4Q6WA 2EL9A 4QRIA 2A7QA 5FAXA 4JMLA 3I8XA 5LKAA 4FLFA 4BB6A 2E3JA 3B6ZA 3JYLA 4EY3A 2COUA 3Q85A 4A6EA 4N54A 3ELUA 2V6GA 4ZI2A 1FFXA 4ZDKA 1KIMA 2YFHA 3AP1A 3ESCA 1RAHA 3I0MA 3NBKA 3P2IA 5C8DA 2X0IA 3BREA 4U2DA 5LVAA 4C6TB 1T35A 2H1RA 4NFSA 3R3VA 1E9RA 2XB6A 2UZ1B 1UMCA 3CG4A 1XD8A 1NVAA 2C07A 3IKLA 4WGFA 4MA4A 9LDTA 2ZROA 1FRNA 4J76A 3UMMA 1J2RA 3N58A 2H5JA 5HS6A 3AJ9A 3E9NA 1TVKB 3AFOA 4GSLA 4URXR 3R7FA 4J1TC 3RHSA 4JLKA 2VZ9A 3WMXA 1USKA 3WYNA 4D7AA 2Z9CA 4KBYA 2NO7A 3EZ9A 1QVAA 3GLKA 3K31A 3VZSA 5JD4A 2G06A 3ZGZA 4YXFA 1FP4B 2Q6VA 5A4JA 4KLCA 5DYTA 3TLYA 2D2VA 4WBSA 1ZNQO 1BRTA 4HMQA 1A88A 3QVGA 4GYYA 2VZ8A 3N8HA 4GRDA 5CIWA 2HPZA 2XB2A 4UQPA 2IUUA 3VDNB 3DW1X 4B46A 3AF2A 1AUPA 1C9NA 1IFXA 2CNKA 3R6GA 3A70A 2XTMA 2BFCB 2QX8A 3R0QA 4EB3A 2DTXA 1JE1A 3NANA 5LMZA 3LY7A 4W9NA 2D00A 3KJZA 4XCXA 1B1AA 1WF6A 3ABSB 1DIBA 2WVGA 3GJTA 4UNSA 1NU8A 2Q7DA 3A6KA 3B85A 1KKLA 2Y0PA 3FPCA 5B2FA 4B2PA 2HHAA 2X41A 3IT0A 4QOEA 4U9IS 2JPDA 4IVQA 4KXWA 1OIXA 2E4UA 4HQOA 4MWEA 3NGLA 5F7JA 2ZYVX 3EEIA 4RSRA 4G0PA 4OU4A 3R74A 1W5AA 4WNCA 5ALYA 3GF4A 4ZRDA 2ZIVB 1BE8A 2CVHA 2O6HA 2HDOA 2X2OA 5DO9A 2XY4A 3SR3A 1Y4UA 2B0CA 1WW3A 4JLJA 3VPXA 5KTRA 2DFPA 3EUEA 3PCRB 4CLDA 3RVKA 4BLTA 1M1XB 5H3CA 4QGSA 1LNZA 4BQPA 1UC9A 4GVLA 1SM4A 4NQZA 3ZXUB 4OI0A 3CLHA 3Q72A 4ZMRA 1TZBA 1O03A 1RU3A 3DLAA 2P65A 4RL6A 5KOHA 2BYTA 2UUAB 1PLJA 1R4MA 4DYVA 1JPUA 4TMXA 3ZY6A 3GVIA 1CSEE 3NWPA 4GC9A 1SCDA 4MJ3A 3T94A 4KWHA 2NNLD 1GLVA 1TF7A 4RZSA 1AK2A 3LUDA 2H8GA 1OLOA 4QYTA 1F06A 3RWBA 3WGKA 1C0PA 2IHBA 5JAZA 4JX8A 4OLBA 2WP0A 2H4XA 2I62A 5IARA 2JZNA 2Q50A 2C97A 1AUXA 3L6BA 1XZBA 1CZKA 1EJ2A 5H80A 1SQSA 2HRQA 2P77A 1QR2A 2EFEB 3IV6A 3SX0A 2PSSA 2AXQA 1T0UA 2P5UA 3DTYA 1Q7RA 2AXEA 1MPXA 4WZBE 1UPXA 5DLQC 1RM3A 2O3QA 4PSUA 4K26A 2ZDQA 3BMCB 4R2KA 3COWA 4TOIA 1Z8HA 3RS0A 3T3MB 1MJHA 1GTMA 1P73A 1L7XA 1PGPA 1W44A 3JQ9A 3SXUB 2R751 1DUIA 2I2DA 3T9FA 4MYHA 2QSYA 3VPAA 1E66A 2FFAA 2ON6A 4TLBA 4HLUC 4N3AA 4JD5A 3R5JA 4HN2A 1XYYA 4QA9A 2OQIA 1Z8DA 2O7RA 3X3HA 5I5EA 1OXKB 3GA7A 1H42A 2WM3A 5AJHA 3VZDA 4O02B 4XRGA 1L4FA 1R12A 2NO6A 1FK8A 9LDBA 5DWQA 2J7PA 2J46A 4RABA 4EI2A 3F5SA 4GYJA 1P75A 5KNBD 4TN5A 1LTQA 3VO8A 1QYRA 1WNTA 3MTJA 5H83A 4WZAE 4BLRA 3K1TA 4PC2A 3HBFA 4X64B 4KE8A 4ZDIA 2R8EA 4O33A 2DETA 5JHHB 3IAFA 2C2BA 4HNGA 5ITWA 3CNOA 3MNFA 3WL8A 3KKPA 4O4IB 2HBQA 4KAJA 2XMDA 4KXYA 2H2IA 5DYNA 4GMKA 1MOSA 4M8IA 1JYEA 2C9YA 4WFJA 4GR4A 3WP0A 3K09C 3QP9A 3PXBA 2EZUA 3RU7A 4HDNA 4XVCA 4RGBA 2B35A 2CGEA 2HM7A 3CO5A 3JR7A 5I7VA 5GM2A 3CX8A 4AN0A 5JBIA 2E55A 1NBOA 3K9LA 3UQYS 1YS6A 3GWGA 4C4PA 4EW2A 2WYIA 3BK7A 1GXSB 3MHTA 5THXA 1GZ7A 3WRYA 5EAIA 3F5FA 4V1CA 5IC4A 3STVA 2A58A 2YY7A 1JI3A 5CIQA 4P84A 5D7BA 5EXSA 4RE6A 3RRJA 1G5FA 4RK6A 5AVXA 3SLKA 5BSUA 2F8SA 4DAEA 1C3OB 1CUGA 1FS4A 1GPBA 2QAGB 3NTUA 4R51A 2YFYA 1E3EA 5ARBA 1SB8A 3H2ZA 4LOIA 3ZTYA 3UJ9A 2LNDA 3OTHA 5CLFA 3EEBA 2CFOA 1TYDE 1DS6A 3S8EA 1VJDA 4FYVA 3JSXA 4BO9A 1P19A 1ONPA 3FIJA 1ODLA 2G4VA 1I5EA 5L3SA 1Q92A 3WO1A 1QF6A 3FLAA 2SKEA 5IP5A 1ID1A 3DPUA 4XJXA 5JY1A 5LNK1 4DC1A 2H92A 3R4VA 3FYTA 2DKOA 2OPHA 1C0LA 3A36A 3ESZA 1YR3A 2Y2UA 3FH0A 3L9XA 4HLNA 4QWMA 4FOLA 1EBBA 1URPA 4JHLA 3EEOA 1N2ZA 5GOZA 4BB5A 1N2EA 1X80A 3FI9A 1Y7TA 1F4LA 4DA8A 5FD8A 3W2IA 4JN6B 4KXQA 2ASVA 1GGVA 3JTMA 4X1OA 3U31A 1BMQA 1JLLB 2VAPA 4RIHA 4FEYA 1KJ8A 1L7PA 3EZNA 3H5AA 1VPLA 1TQ8A 3UMGA 3KXDA 4R9UC 4C3VA 3ETCA 4P4GA 4Y0NA 4G65A 3TXYA 4HX2A 1EVZA 1OZHA 4RADA 5LZ4A 4QDUA 4F8EA 5CDYA 1YZQA 4UEKA 2BHLA 1PL8A 1R6UA 2YXPX 3UTDA 2PLWA 3K8ZA 4AMGA 3DT8A 3K70C 5CGZA 3ZS9A 1QBGA 2CB9A 4AZSA 1N0VC 1NVDA 2Y27A 4M6WB 2NXJA 3FDIA 2EAUA 1DE0A 1ECPA 1JSLA 5T5QA 4NWIA 3E0XA 4ZOLF 1LLFA 3HI6A 1BVYF 5FR2A 1Y1TA 1KOFA 2Q1WA 3SC4A 1PJQA 2QTHA 2P2LA 2VAVA 2QL6A 4L7QA 3Q2IA 1MNQA 1NDUA 2OGUA 2H4JA 4I1SA 3TB4A 2OC9A 2DHQA 3CWQA 3AR5A 1VRVA 2W71A 2Z04A 3HKDA 5DHAA 3VSEA 3ZXSA 1N92A 2DZDA 2O54A 3KLMX 2IOYA 2C82A 5F35A 4BKMA 2WJWA 5COQA 4WBNB 4ICIA 1QRRA 3R6WA 2PVPA 5FBRB 2HCRA 3RIEA 4YXWD 2B4QA 2X8LA 2IYRA 3LVFO 1QYDA 1WETA 2BJWA 5KNLA 1C8LA 1U3CA 1PTJA 2HZ7A 3OFKA 4RQUA 3WGMA 1ABEA 1T9BA 1EGAA 3D02A 4L7VA 4FM9A 2CYBA 5M5BA 3ANXA 1JFFA 1O94D 2PCJA 4MKIA 3JVDA 2BFFB 1ZVKA 3BA6A 4G6ZA 4YRMA 3KQHA 3FVWA 1BDBA 4XGRA 5CT4A 2E4WA 4W5RA 4YRBA 2OHOA 3E7XA 3ONWA 1MIOB 1CLEA 5FA6A 4Z7OB 2R1ZA 4KITB 5CMLA 3WWOA 1JA1A 2BFDA 3TI7A 3ZV3A 2FG6C 1WW2A 2P8SA 2X4DA 3BSSA 3CC8A 3DL2A 4MWOA 1J39A 4X91A 4X0EA 3T5BA 4BTLA 3E3OA 4C21A 1V5GA 1DQNA 2QSJA 2FZLA 5CA1F 1SEPA 3N53A 1AV6A 3CNHA 3TG2A 2O4UX 3CX7A 3WIOA 4NJMA 3VR2A 3G5LA 2DJ5A 1WCXA 4BL5A 3S1AA 5JW6A 4TL8A 2HREA 1JFSA 4DBLC 1EFUA 3NRJA 5DP1A 4Q12A 5JJIA 4C5AA 3IBGA 4FCVA 2DT8A 4XIGS 3K0FA 4S2UA 2W2LA 2QTVB 3WDKA 3HVRA 2NTYC 1O0BA 1W4AA 3NWEA 2ZB8A 5BQPA 3WVNA 3DPSA 3BHIA 2ZI3A 3O8RA 2OGWA 3VAAA 4LYHA 2BZ0A 1VE1A 1GPMA 3ETGA 4LJ7A 4PSKA 2PT6A 4Z9YA 3ZWWA 4N5HX 4B4UA 3D3JA 4NAVA 2V7TA 4OGFA 2PWZA 3T3OA 2C95A 1YRHA 3AIOA 4JP8A 4FJ2A 2ZRIA 4C88A 5DWDA 4BQSA 3JWEA 1M0TA 4BVAA 3GMSA 3NKVA 3MJFA 4U4AA 3N3AC 1E79D 1G20B 2PRSA 4WE3A 1Z73A 4IJ6A 4XWKA 3PZRA 3PI7A 4MRVA 1IRIA 1Q0QA 3EF3A 2D4HA 4DRXA 2DHEA 3JAWA 4FYXA 4YMGA 4YP5A 1TPZA 2PANA 3M6UA 4TZTA 1K6EA 1G4AE 2D6FA 4IP0A 5BURA 1MJGA 3NHKA 4G0NA 4RANA 1YQ9A 5GINE 3ILVA 2UYCA 5EIEA 1J8YF 5JFTA 1XLVA 1LBHA 2D8AA 2FPGB 1FSZA 4HXFB 4V0LA 2WD9A 4F1JA 2VJQA 1U8TA 3QPCA 3CT6A 4K9DA 2QS9A 1TUBB 2PWAA 5GP1A 2ZJ5A 5TY0A 4W5TA 4EA6A 3TRKA 4ZYZA 2AE1A 3LXUX 2IU4A 4EH1A 1KRXA 1SXIA 4TRNA 5D3MB 5G4KB 5JRZA 4OY3A 5DHQA 2IYVA 4QPZA 3GNSA 3A14A 2H1LA 1OB2A 2OK8A 3ROZA 3DDZX 3NHBA 4JQOA 1H3FA 3MJSA 2PS1A 1QRUA 2ZR7A 2EVWX 1KYIA 2ZRFA 5J5VA 3U13A 2EQ5A 3A9TA 4K9SA 3PB3A 5FO1A 3SFZA 1CUHA 1FVFA 1HYGA 2FFQA 1RKXA 5E9AA 2HRCA 5BSKA 4YI3A 1L4UA 1A4UA 4FU0A 4LF8B 4NY1A 3AHCA 3TX6A 2D7CA 5AKKA 3ORFA 2FHSA 3IT2A 4TSFD 1Z6PA 3B70A 4LTNA 1PT5A 1DCTA 3N2LA 2I6GA 3PX2A 5A03A 3HXMA 3THOA 4KWTA 1SA0B 4WLUA 1EVQA 3RS2A 3V42A 2HDWA 3TN7A 4L85A 2Q21A 3ZGVA 1JAYA 4MYTA 4XX0A 5IUKC 3AR3A 1BYIA 1C8KA 1EGMB 1J4AA 3RJTA 4YT2A 1LXCA 4MUKA 3ABOB 1AN9A 3GLRA 2QZPA 2JJ2D 3HY4A 3OIWA 5H3LA 3IHKA 3E05A 2FW6A 4EI8A 1V5IA 1Y1LA 1EIWA 1I0LA 1Z6AA 3RGGA 3D4IA 4IYJA 1N7JA 3RFFA 1A2OA 2P9JA 1XDUA 1W9MA 2JJ8A 3GN1A 5KVVA 4FFOA 1YO6A 3UT5A 4C7XA 1WKBA 2RBGA 2VUTA 1A04A 4V1CI 3PI6A 1HH4A 5JZMA 2LUOA 3E7WA 4CEJA 3ZOZA 3EOBI 2WIFA 1RJGA 2I3DA 2WM9B 3VPFA 2I87A 1DRKA 2R4UA 1A8HA 7MDHA 2JH3A 3S8YA 4MI9A 4FGZA 1YB2A 4QO7A 5AR1A 2WM8A 4LVNA 4R2HA 1D07A 1GM5A 3BAFA 1IN1A 4ZO9A 4H3HB 3FKSA 3QFTA 2QLNA 1G3MA 2C4TA 1E5TA 1SIBE 1U5CA 2J9FB 3EH2A 2AF4C 3T5CA 1OT5A 1FRFS 3SS8A 1E7YA 1O96B 4FMDF 4MUIA 1X8LA 4GR5A 5DBFA 1Q0RA 5GIOE 4NZZA 4LXQA 1ZO8A 4CPDA 3U61B 5AJYA 1JZQA 4F12A 5FP0A 2GXAA 2WUEA 3EQZA 3LV8A 1LPOA 3CS3A 3WGJA 3OP1A 2MWMA 4Q1AA 4BV8A 4PXYA 5IM4A 3ZV5A 1CJSA 5A4FS 1Z88A 4LSGA 3UJDA 4W1RA 3BRSA 3ZZNA 4MHOA 4RJJA 1X7HA 3OO0A 3I4LA 1FFSA 1QO0D 1GQOA 3SOZA 3RREA 1D6MA 1SUSA 1V1MB 1WTAA 2H85A 3IIJA 2G72A 3B2QA 2B34A 4JUFA 1R15A 5KJ1A 1J90A 3BSWA 2WJYA 4HHEA 1G7CA 2PR7A 3SWWA 2GM5A 2B82A 4J90A 4TS4A 3OT5A 1XEXB 3IOYA 3KTAB 4O29A 4YWHA 4KHZA 4KKVA 4OG2A 3RABA 3NONA 4AURA 3K0CC 1XQ6A 1AKEA 4BVEA 5J40A 3A37A 1BN6A 1XZLA 1TM7E 3O91A 5KYYA 1UBCA 3AGQA 3F7OA 1ZVJA 5D3KA 5E6SB 3GFGA 4Y7CA 1RRMA 2AOWA 3TZQA 4DB2A 4YCCA 2FUNB 3WNCA 3GQBB 1PT9A 3ETJA 4D6PA 5TC4A 1QH1B 4FI3C 2XKKA 1PP4A 2CDRA 2NYUA 4NZPA 8ADHA 5I51A 2F90A 1GPKA 2IOQA 4UTPA 1Y7IA 2GN1A 5BV0A 5HRUA 1DEXA 3C0KA 1E4EB 1ZOPA 1ZJ4A 2BKVA 2KQUA 4GMDA 3EVBA 1E6LA 3VI4B 5M34A 4JCCA 5DHUA 2ZYWX 2GGSA 2QENA 4EPWA 1RR6A 2D1YA 4DOMA 4ZDJA 1YA4A 1Z16A 4E5MA 1C5KA 1OXMA 4S35A 4G8DA 3GUZA 2OFWA 1Z62A 3PQ7A 5ERYA 3I9JA 1GIAA 3NALA 4Y1EA 3ONDA 3EFEA 1YOBA 1UJNA 4OK6A 3TLXA 4MOWA 3BX1A 1PFUA 2FXVA 2BOVA 2W11A 1MHTA 3ZCPA 2O8NA 4NS1A 4GFDA 8OHMA 3UJCA 4YJ3A 2LDXA 1GSAA 4RIFA 5AJUA 2GBPA 1FE8A 4I6EA 1N32B 4PNEA 1SG6A 3HBLA 3GPCA 2P2ZA 3LXMA 2DUWA 3VZRA 1L5QA 5HUJA 5K0TA 4JVLA 3ESBA 2H7YA 3NDBB 4RDHA 4V3BA 2I4IA 1XTZA 4OM8A 2AFIE 5IYZF 2GSDA 4AU1A 3O9VA 2AOTB 2GHQA 4BFLA 1T2EA 3V3KA 2ZREA 4MQFB 4KLNA 1DG3A 5KNDA 1AO0A 1YQDA 2WPDD 3OE7A 2I76A 4B3BA 3ZI4A 3DAGA 2J4DA 3C6MA 3F4BA 1S3GA 1LK5A 1U8AA 1FS6A 2GD2A 5A02A 1XZFA 1PV4A 2Q3DA 5A3QA 2CLCX 1AMOA 4GEGA 4C87A 4CTNA 3QGMA 3U17A 3UGQA 4J16A 2XCUA 2ZBGA 2FSFA 4OOEA 1JWAB 2ZRBA 1OILA 4DG8A 1YTLA 1A95A 2A6PA 4LE1A 1JNYA 3TQFA 1NR5A 5HCUA 1PUIA 1G5IA 3NBAA 4BCCA 1A27A 1CS0B 3O75A 1NMXA 1VL6A 2BSXA 1SUCA 2X1HA 4YEDA 3IQHX 3ZY2A 1OFUX 4H7HA 1NXTA 4UU1A 4AFNA 2IWHA 4LVUA 1PNRA 3D6VA 4H15A 4OCZA 2C2YA 2I7TA 2CCGA 2HNBA 2OHVA 2QTMA 2WK1A 4I8DA 4JB2A 5B3KA 2QYHA 1L6RA 4QHSA 3X44A 4N5IX 3HNOA 2NX2A 4I2NA 1EFCA 3BL6A 4J03A 4X1YA 4HDOB 1YQTA 1ZGJA 2JBAA 3ZK7A 1J07A 3NAZA 1CU1A 2R1TB 2YVQA 5EOVA 1JHRA 1ZHOA 2D7DA 2AKYA 1V8BA 4ZAWA 3IXMA 3I6MA 3RYFB 1SVOA 1Z6TA 4FFSA 1C7QA 3CURA 4GMFA 2GA8A 3C6YA 4NH0A 3CR3C 3P97A 2BHRA 2JRLA 1I51A 4HS4A 5IANA 4EG6A 3NPMA 3HNPA 2PRKA 1PQYA 5ALUA 3OZVA 5KWSA 4TTPA 1HT2E 3LC2O 2ZRCA 3LZDA 2WUDA 4XYEA 3S70A 2HAEA 3MMPA 4PAGA 2RH5A 5C4GB 4C7OB 2G67A 4OFWA 5DMXA 4R3NA 3A6PC 2ZJ1A 3DFIA 4GI5A 5H16A 3MLEA 4LRQA 3DEFA 3RTBA 3IMEA 3PQEA 2HU2A 4JC8A 3NRCA 4CCYB 4D9MA 3HRIA 3ZVNA 2I1LA 5JT1A 4NU6A 2V7GA 3PR2B 3VX4A 1UXHA 3QLUC 1NPYA 3VC1A 1KNXA 2ZI7A 3AZQA 5IDYA 4RHCA 3OT4A 1MB3A 4NBUA 2EYQA 4GO1A 1QKIA 1WSDA 2AOUA 4NS4A 3FTDA 5CA0A 5JWOA 3IL2A 3V8QA 1OWPA 4HP8A 4ZJYA 5EWLB 4Q1BA 1PL7A 1D6NA 1NKTA 4AK9A 3T35A 4B71A 3HDHA 4PZUA 4FOOA 4Y6QA 1KO4A 2Q62A 3AUUA 3G13A 3K05A 3B5IA 3BF8A 5F98A 3R3ZA 3LYAA 2CEAA 1JKJB 1WXHA 2X0EA 3FPSA 4B3FX 2H63A 4F5DA 2ET6A 3PEVA 2IYUA 4Z4GA 3PFNA 5AOBA 5KTPA 3EGDA 3L0SA 2H2GA 2EBWA 1EEXB 4QUAA 1OXSC 2XUOA 2C2GA 2XUAA 3TQTA 4C07A 1YJCA 1LU9A 1I7QB 3C45A 1XHFA 3HL4A 3FGOA 1NV9A 3VHXA 4BDSA 1IUOA 4G5GA 4ZT5A 2EKZA 3BWDD 3Q3IA 4IMRA 3IJRA 1ENYA 1WHTB 5REQB 2PJRA 3HA7A 3Q5EA 5DV9A 1JJBA 1Z4LA 3PPXA 1N9ZA 3AF5A 2C4HA 1J7KA 1UPCA 1Z6YA 2DBVO 5JRJA 3AUAA 2GCOB 1ZIOA 4N0MA 5K03A 1MT0A 3QLJA 3WQSB 4TUYA 4JLVA 4K9LA 3BHJA 4TZKA 5J9FA 4D2IA 4O2AA 5EHZA 5GADl 3BFXA 2ES4A 2VEDA 3HWWA 2ZR9A 5GWXA 5AW5A 3ZV7A 5I7AA 3V55A 1DRWA 2RHTA 4MPJA 5GMOA 1P29A 3ESDA 3LVQE 4HYYA 2BPOA 4WK0B 1S2GA 2A7XA 4HK4A 4PWZA 1AA6A 4HAWA 3E3AA 5K8IA 2ZJ4A 1T4MA 3L7JA 2YMLA 4WX2B 3S2UA 1IOVA 4JR2A 4GP7A 2WM2A 1K8QA 1G2QA 1UQUA 3EB9A 4U8GA 2JC3A 4YRJA 2BL4A 5KQGA 4KVFA 4I4TF 4OYRA 1HDRA 4MW9A 4RPLA 4DQXA 3AIKA 3DD5A 1G8JA 2BDUA 3G0CA 3UIEA 5IAAA 2KM1A 3PUIA 4C6SA 2A5FA 2RB5A 1KSJA 2VYVA 3JPWA 1FOEB 2VYFA 1FU8A 2HJRA 1MORA 3JARB 4RD2A 2XYRA 4KO3S 5PNTA 1MO5A 1QIKA 1BWSA 2XYQA 2JEYA 2QMQA 2ZWPA 3EZFA 2YWRA 4L4ZA 2WLSA 3NM6B 3HKCA 4RY0A 3C1OA 4HNQA 3HY6A 1UDRA 2FN3A 3VTAA 1G6KA 4IZIA 1E8NA 1Z26A 3OKCA 4P7JA 2GF9A 1QC5A 1FDOA 2WJIA 3DDWA 3HL0A 2NU7B 3V6LA 2VK4A 1LPAB 1I2CA 1R18A 3QBVA 2IDZA 1R88A 1V11B 1E2QA 3FZNA 3QXSA 5DASA 4QDJA 1Q1NA 1QP0A 2QIPA 4WCFA 3J81A 3UAYA 4JBYA 1RACA 1QR6A 3GDOA 4FLMA 3L4EA 3IAEA 4EP1A 1K92A 1Y3BE 3SHVA 2Q3CA 3ZN2A 4RVUA 1Z5NA 1DPFA 3PFKA 1RMTA 3LS2A 4FSDA 2VN8A 2FWJA 5JI2E 2VLIA 2YWEA 4LKRA 2O0KA 2VDKB 4OHPA 3NX4A 1NW4A 5GJCA 2XWSA 4EF6A 1WDLA 2NV0A 2NU6B 1R8YA 2H8KA 3EVEA 1BH2A 2JGDB 1J9GA 3LGAA 4QBGB 4WN3A 5BVHB 7AT1A 1CIPA 3IEIA 4OU5A 5C18A 4QXMA 4R1TA 3W6ZA 4ZEVA 2QMOA 4M2LA 2VHUA 2YZMA 2EG5A 3IOMA 3W2FA 1XRPA 4KP7A 3SZGA 2X0NA 4HRYA 4J1NA 1BKDR 1LX7A 2IU3A 3AB3A 1NBAA 5JARA 4JUBA 1JF8A 2C5FA 4C3ZA 2XGOA 1N2HA 1NVEA 2DKNA 3C4QA 3GD7A 1PGOA 2BFWA 3PLRA 3ROKA 5LDDC 3U3MA 3R75A 4KIWA 5BWBA 2IHNA 1ZINA 4LECA 4Y2PA 4RHXA 5I7OA 5L95A 4KR6A 2A88A 5CM9C 3M3PA 4QNRA 4O5AA 1JX6A 3OCYA 3SVTA 1CB0A 1O97C 2O48X 4CN9A 5CB4A 2WVJA 4QAQA 4XSGA 1B4DA 1BHQ1 1TL7C 1QHIA 5LYJA 2X5KO 3HM2A 2GXUA 1KE1A 4ATNA 4RVFA 2Q6KA 6REQB 2IDKA 2XMBA 3IDFA 5EJ8A 1L7RA 4IDCA 1L5YA 1Z75A 1TM4E 2BLNA 2W2QA 2C4MA 3Q3GE 3R3UA 4ZXFA 4BHTA 1B41A 4DV1B 1Z4PX 1GYQA 1T15A 3DAPA 3EZLA 3KPJA 1W93A 4Q9NA 4CL2A 5H4GA 3UBMA 3RU3A 4P4LA 3IDQA 1EYZA 2GVDC 2HJWA 1GGKA 2Z9DA 3KHKA 5BQXA 5FDFA 3RLIA 2FK7A 1V7PC 4AY4A 1JEYB 4RESA 3ZWQA 1RCFA 3IYLW 2MSLA 1NXXA 1XWIA 3A1UA 3CZAA 5FBWB 2C8VA 4OQLA 5A5VA 1VLHA 2NG1A 3VHRA 1FXWA 2BEUB 2I3GA 4MAAA 4MV1A 1W5BA 3U3KA 4DQDA 4ESEA 3GW8A 4KXVA 4OXQA 2O8VA 3L8ZA 2BJHA 4BFZA 2V65A 1KMQA 3CH5A 2X2EA 3FPJA 2HNKA 3IRVA 4TGLA 4JSTA 1Q2UA 1Y9JA 1OZ0A 3CCCA 3RFUA 2XMPA 5A4IS 3GRPA 4XVHA 2CLHB 3HFGA 3ESQA 2R7MA 1FW6A 2GRAA 2GB4A 4TS9A 2EFDB 3NWJA 3LA6A 4MUMA 4PSDA 1IEXA 3OTQA 3PJEA 1NF3A 5DB4A 2XTJA 3WG9A 4D41A 1U6KA 3QWAA 4HWSA 4C20A 1K27A 5AKHA 3WOHA 3IP7A 2R6CA 1MQ9A 4ZAYA 4EK9A 1RKUA 5BN3B 4FFRA 2D3TA 2EKBA 2XWBF 2I2CA 3P9PA 3MTQA 5LOVF 4KYUA 3LW7A 3PUKA 3VVMA 1X0VA 2XUQA 3H6HA 1M2FA 1RZRA 4MEJA 3EVCA 4NPAA 4F91B 4GL2A 3I4CA 4WJZA 1P9RA 5BYBA 4OFBA 3V2IA 3WKBA 2EFGA 3HB5X 3WLRA 5CBPB 2CJFA 3CLKA 4F97A 3MPUA 1NM5C 4AKSA 1RTTA 5K3BA 2R7NA 1WMAA 4C0KA 4WN9A 1Q0LA 4E4YA 3H87A 2K7FA 1U1CA 2HZBA 2XB8A 5EHQA 1E9SA 2VCEA 3HWSA 2PVCA 2NZYA 2IEYA 4RK0A 4LJ6A 3QUBA 5I9BA 2BEKA 3KBOA 4CIBA 4AXXA 3E4DA 1QIGA 2KX7A 2B2CA 1T8WA 2QN1A 3MJRA 4HGZA 5J4HA 1G5RA 2GR9A 5C35A 4K1LA 1P33A 2O8DA 3TZKA 5IT9A 4EIWA 1YGYA 4GWKA 1ZIXA 2DY1A 3ILYA 3DO6A 5T8KC 2C2OA 1IN6A 3PHGA 2Q46A 4ZVMA 4EYSA 3RO7A 1OFUA 3VU9A 2FWRA 3LCRA 3GFBA 3OX4A 1WB6A 2AA3A 3QBEA 4Q1VA 1GZ5A 2D13A 2FZGA 4DY4A 1B74A 2O20A 1LK7A 1C1XB 3QVJA 3TRFA 3I30X 4PAOA 4P2GA 2ZRJA 4S2EA 3R8FA 1WCIA 1ILWA 3NR2A 1JHYA 3K0HA 3R3WA 4JHXA 4BV3A 5LXTF 4ZHQF 1PUJA 3N7TA 1P8JA 1L4KA 4NP6A 4OSPA 2A9VA 4EPVA 4P53A 2DB3A 1TX4B 4PCUA 3GDWA 2G40A 1Z0IA 1OGJA 1HE1C 3EF0A 4BO5A 4UNRA 1DGQA 2PU5A 3N2GB 1EWQA 3LC0A 2JVJA 3DBRB 2QE6A 1H4TA 1IN4A 4X1KB 1OVGA 2XUIA 1CDOA 5G02A 3SZMA 4E5NA 4GBMA 4Z5XA 5LLSA 3A04A 1L4YA 2J45A 1WMSA 3V7NA 1IY8A 1O9GA 4PLWA 1KU6A 1YI0A 2F1OA 1DJPA 121PA 2X8WA 3V1KA 1YNOA 3WL6A 2XITA 5CCBA 2X7XA 4RMJA 2XMCA 4UBIA 3ZZMA 2I4MA 5FLYA 3AKYA 2GDJA 4DLVA 1EAMA 2LCFA 4AO6A 3M7IA 4YMTA 5KQSA 1WMDA 2X23A 5MN5A 2APJA 4HZUB 3RC8A 3QJGA 3MAGA 3OU7A 1X1EA 2YHSA 4X6YA 2VRCA 4ZZIA 1SQFA 7ADHA 2PJUA 2ZI6A 1M73E 5TE9A 2CNBA 4TMKA 1JEJA 4HUQA 4GDFA 2P41A 1XZIA 4CV1A 2GO7A 3VKGA 1KPIA 1NI5A 2WUVA 1CZUA 2JI9A 2XXBA 3F6BX 1KERA 3D2CA 4KXXA 5GONA 2B4TO 2P8JA 2QTZA 1XR3A 1NDHA 3QVKA 5LFAA 1AS2A 3D54D 2JGFA 3M3DA 2O2ZA 1ZJJA 3CO0S 1NUAA 2YXNA 5DM4A 4N65A 1VIAA 1W8DA 2QRMA 4C9BA 2N47A 1QPGA 2I6QA 4GUAA 5LDHA 1KHTA 1U9IC 1A9QA 2XCIA 1R0SA 4PYIA 1P44A 2W0MA 3UAZA 4BEBA 1R6XA 3AQ4A 2J0EA 3QVWA 2Q2VA 1YMUA 3GWZA 2XX3A 5EI5A 1YVUA 2EW2A 4D45A 3KX2A 4XB6B 2QL5A 3MSCA 3LDGA 2E6KA 4Q3BA 4L27A 4YMIA 4YUVA 1ZK1A 5JUWA 4QSHA 2JGNA 4RELA 1DDOA 1N6IA 3PQ4A 4WACA 1OFVA 1SCUB 2H2HA 4EHHA 4PYJA 3LUHA 3N2KA 3VOSA 1TOAA 4HTFA 4L51A 4UKDA 2EXXA 1TMGE 2GPTA 3DBHA 3RTDA 1FDWA 2XQKA 2ZT7A 4Q66C 3ZDAA 1JIIA 2JIMA 1MB2A 1V26A 3G7NA 3QITA 4K6HA 4LAFA 2AKEA 5JZVA 1IY0A 1UBMS 1SC9A 2YJTD 4H4CA 4JC0A 5IJ9B 3GXOA 3ZQ6A 4G23A 4JZYA 3S3TA 1TT7A 4IIBA 4NTZA 3BORA 3PHJA 5JATA 3U7GA 1WDWB 2NUAA 2IT1A 4E3WA 3TM4A 2PIDA 3LX5A 5DCUA 3AETB 3HCEA 1DAIA 1XTQA 2Q2WA 4YAEA 5HZGA 1Y9EA 3NAMA 3JASB 4DLPA 5DJ5A 2C9MA 1TLFA 1N0UA 3UXHA 1P4HA 4G5XA 3SF8B 3ZWXA 3FMOB 2W6QA 4XGKA 5ANRB 3HB7A 4KMOA 5IF3A 5HFJA 2II6A 3UMYA 5DNCA 5DVZA 2D1SA 2W8BB 1L5RA 3P27A 4CFYA 1UP4A 2DUJA 3RVOA 4IQFA 2DMRA 2PGJA 9ATCA 1KKUA 1ZY2A 5HJEA 1N5JA 2QUHA 4URWR 1EI9A 4X3OA 1L1FA 1R0XA 4CMIB 4MYCA 3V4ZA 2MYNA 2ZTMA 3H0CA 5HM6A 2ZZKA 4CM4B 1XROA 4NMWA 3FUXA 1THTA 1US8B 3G7UA 4BX8A 3MZ0A 1NI3A 3QELB 1VXRA 1YBFA 2VTEA 1BFDA 1HV8A 2Y99A 2A1UB 3N8NA 2AF3C 1DEHA 2JAUA 3QZUA 3ZU3A 3R09A 5BN4A 2C5AA 3W4JA 3ZWVA 2O50A 4O4JB 1F60A 2PPLA 3IEUA 4LF6B 1TYCA 1L5FA 1CULC 2EKLA 2I66A 3OOJA 4PYLA 4ARAA 1R64A 1SFRA 2VHTA 3NTXA 1UAGA 3OCZA 4N18A 5ELMA 5TXGA 3RHFA 2FUG1 2Q29A 5E1DA 5K3EA 1HMYA 1U31A 1HE2A 1W94A 2OUKA 1YIAA 2IDMA 2R6DA 1ZNWA 3JAKA 3N6XA 4G1UC 4GE3A 4S1TA 4BCDA 2CVPA 4YV2A 4QE3A 3ZYZA 5KAMA 5EIWA 4IZOA 3K92A 3RVSA 3U3OA 1Y6JA 1WVMA 3R40A 1Z17A 3LQKA 3KEFA 4GF5A 3LBYA 2CXOA 2HSEA 1X8KA 1UMKA 4UCWA 3AUXA 3LCVB 1NXQA 4UDNA 1DX9A 5B2EA 1NJSA 2AQHA 1WDKA 3ZDQA 2QLFA 4MR9B 4AYWA 3W3AA 4QJ5A 3OJLA 1YU9A 2WHPA 4R2LA