1YR1A

Structure of the major extracytoplasmic domain of the trans isomer of the bacterial cell division protein divib from geobacillus stearothermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
GSEWRRIAYVYDRQTFFPLLENGRLLKQEGTKTAPSDAPVLVGWKDGDAIAEMTGQLAELPAAVLGAMSEIHYKPTREYEDRVIVYMNDGYEVSATIRQFADKLSHYPAIAAALDRNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cell-division initiation protein
publication title Domain architecture and structure of the bacterial cell division protein DivIB.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Cell cycle
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr1A00
1YR1A 2ALJA
chains in the Genus database with same CATH superfamily
1NSFA 4KQKA 3C8HA 2FPIB 3KEOA 3JZDA 3VDXA 2WAOA 2ZR8A 1VJTA 4FZVA 3W8NA 2IW1A 3LW8A 2OGWA 2REQB 3Q0IA 2IHJA 4GWKA 5FFMA 1O0BA 4YEDA 2YVLA 5IF9A 1YFZA 2RGYA 3JQBC 4KX3A 3S2IA 4KPGA 4CU2A 3QWFA 2A67A 1BVYF 1Z4LA 2YVQA 4LMPA 2XVAA 3I6ZA 3L06A 2P9BA 2NV0A 1N33B 2R5WA 2W2MA 1ORIA 1Z6GA 4ZT3A 3USES 3QVVA 4WK6A 3JD3A 3QZUA 3OJ0A 1OWLA 5AVOA 1BVUA 1UK6A 2JLZA 4OI0A 2CLEB 2H1RA 5HWSA 1ZSVA 3Q3EA 5A3RA 4CEJA 1AGXA 2PR2A 1FP4A 1EUZA 3QHAA 4DDUA 3D5EA 1NSTA 4J9VA 2ZAOA 2Z2JA 3DDUA 3BKWA 3DR3A 4K9DA 4F4CA 1Z6YA 4BB0A 4M1YA 1E89A 2UXDB 4KTVE 3AKDA 3UG6A 2WSSA 5KKCA 4TL9A 1W5AA 5T41A 1VCOA 5E7QA 1G7TA 1WPGA 1Z7YA 1ENPA 1EXWA 1LSUA 1SXJE 1TQHA 1XXHB 1XCPA 3CEAA 4O59O 2HHHB 4YCLA 5CVEA 1UT5A 2C4WA 1PW7A 2I1WA 3PNBA 4G41A 5AWFC 3HLKA 4JY7A 4AUNA 1NLMA 2O06A 3WWZA 3URMA 2RMKA 3B70A 4LIPD 4Y2JA 3MJ4A 1HEUA 2GD2A 1P18A 3PFNA 4R3WA 3HS3A 1ZYUA 2L42A 3CN7A 1VHTA 3DZDA 3FNGA 3KTAB 3L40A 4KWIA 4OXQA 1E1DA 5FTWA 1SXHA 1U2DC 2B36A 4UPVA 2JHFA 2J3HA 3SQDA 4M1EA 4DDHA 4E12A 4EY7A 3OIGA 3V3TA 1L8QA 2H8GA 4NJOA 4OKSA 1GPKA 1EHIA 4PHHA 4RULA 1P1RA 4U00A 3F5FA 5GAJA 5JR3A 3O2NA 4XTRA 1KGDA 2WR8A 1C9DB 1OLOA 1Y4AE 1YXMA 2QSJA 3QJYA 3QG5A 4ZVNA 1TIKA 1W4ZA 4D3FA 1SXPA 1YNOA 3H5NA 2R5NA 3BSSA 3CE9A 4AF7A 2ZXUA 2E4VA 3EZXA 4HVAA 3RKRA 3ROFA 3W9UA 3RV3A 2G5CA 5DCLA 1EFDN 4ALNA 4Y18A 2WQ7A 2H16A 1T8UA 3OQ6A 3E5NA 1MB3A 3TEJA 3UO8B 4O4IB 2P91A 1L4BA 1SVWA 4O08A 5DTMA 3SS8A 3LKDA 4HAWA 1U0BB 1SUIA 1PEYA 4TS4A 3X1WA 2CKDA 3TI7A 5BUQA 3IUEA 1I5EA 1M3SA 4KZPA 1NATA 4YCCA 1P3DA 4WSOA 3NAZA 5AKZA 1R10A 4X61A 3UM9A 3GGJA 9MHTA 2RSLA 3UYKA 4UQPA 4DLPA 4WH0A 1R6XA 1QC5A 1CC1S 2IE8A 5BNTA 1F5SA 3KZKA 4LE0A 4LW8A 1GILA 2V96A 4YQEA 3COVA 4LBYA 3G2QA 4RWEA 2ZDHA 3LQ2A 4MWDA 1VGRA 2CXNA 2GPWA 5ALWA 1TUBB 1FLNA 5IZCA 5B2ZA 1KQPA 2P4UA 2VP5A 4RZIA 1IM5A 1WABA 3HCPA 3SM3A 1LXCA 4X1KB 2ZIXA 3LQKA 3SPXA 2I9PA 1HY3A 1JILA 3RFCA 3TR6A 1EVZA 1DG1G 3BH0A 2BGGA 1TU4A 4JT9A 2A3RA 3RADC 2RHOA 4KWTA 4G37A 4CM1A 5EE9A 1JG3A 2HO5A 2CE2X 3BF8A 2WT9A 2AKEA 5BSEA 2O20A 1J8FA 2C8KA 3ZDFA 2ZTLA 4P3OA 4K6CA 4XUDA 2IP4A 4JEUA 4K86A 1U0OC 2P6NA 3ISTA 1G7RA 3B82A 3ORFA 5BQOA 3REGA 4JL8A 4HYTA 1GGFA 1FDOA 2P9FA 4L08A 4D4IA 4V0KA 3OLVA 3C41J 3CUWA 3FW1A 5GZ1A 2F3UA 3AEXA 2W6QA 1ZVVA 5C8YA 1GUFA 1Q92A 2XCOA 1HBJA 3P0RA 1V95A 4S0XA 3H0EA 3PF8A 3BGSA 3QPVA 4OSEA 4EFDA 1E8MA 3ZVKA 2X1HA 1IULA 2IDJA 3TRJA 5AXDA 4DR7B 4RNCA 3VU3A 2OB1A 3PQ2A 1OI4A 3FDIA 2IH2A 3IEVA 5FLEX 4AJHA 5MN5A 1QKIA 1V5EA 2GN4A 5AHXA 4ACBA 1JBQA 1HH4A 1JIKA 1Z5PA 2GHRA 1IPHA 2PMFA 3ABQB 3GOHA 1AKWA 1NUSA 3NORA 3PFBA 4KIFA 4KO2S 4J1NA 1LK7A 3NO4A 3RTAA 1T9GR 4DV0B 5CJPA 5AM0A 2FFRA 1V26A 4MRSA 5DNDA 1FZTA 1WKVA 4TLMB 4Q37A 3COZA 2C2HA 1K7XB 2QM3A 3QUAA 4RZ2A 5A3JA 3WK5A 5LQJA 1TGVA 2OSBA 5J9FA 1DDIA 1Z5WA 1UAYA 3K16A 4PPFA 4PZ9A 2QTHA 3SR4A 1OZGA 1P44A 3VUFA 3EC7A 3KR2A 3ZGZA 3VJMA 2MIIA 3O9ZA 2I4MA 2UYOA 3EZFA 4HY3A 1WW8A 4FGJA 3WXBA 4CE6A 4CVNA 1NM5A 4MUAA 2IXEA 3WADA 4ER0A 4RZSA 1YI0A 1GAJA 5JD3A 5EUBA 4DMHA 2G9UA 3GLGB 1TCBA 2XE4A 3DULA 3QSGA 4WOJA 2AX4A 1UKCA 5IJ0A 1IPEA 1YDGA 3CLUC 2NU9A 2Z5VA 2PX3A 5AKYA 3F1LA 1E8NA 2JGKA 2YHIB 4M7RA 1MT0A 1Y4DE 4M1KA 2FCRA 2RI6A 1Z0KA 4CUZA 4DR6B 1I80A 4LYJA 5DHSA 1IN8A 1I7NA 1C1HA 1JBKA 4P83A 2WC1A 1DUVG 3V6MA 4G9GA 1IHUA 3F47A 4P36A 1MTZA 3RSGA 2F1JA 3HY6A 3OJEA 3OIYA 4R51A 2A9RA 2IH5A 3D4OA 1QFMA 3RVDA 4GMGA 1XZCA 2SECE 4JODA 3FCAA 2HUPA 3QW4B 4LJSA 1SCDA 4OK6A 1ZU5A 2H51A 2PLAA 4FHZA 4BJHB 4D82A 5CG2A 1SWVA 4ZZIA 3NBQA 1E94E 2IUYA 5DASA 4A6XA 5DCYA 1C7QA 2MR5A 2NO6A 5AJTA 2QD2A 6REQA 3EY9A 3FJYA 4RTQA 2DCUA 3ZH2A 4RD1A 4JJ6A 2CC2A 3I6IA 2BR4A 1PSWA 3EQ8A 1ISFA 1O87A 2P77A 2QROA 4O6VA 4JYCA 4ENUA 3U4QA 1PQWA 1EG7A 4PQEA 4KWEA 4KQ6A 1WWKA 3W1VA 1W36D 3WGJA 1YVDA 2C2WA 4XCVA 4Y6QA 4UFPA 2B7BA 4CKEA 1W8DA 2DHQA 2Z2YA 3D6NB 2COEA 1YJBA 3HR7A 3I5AA 4R1MA 3EAGA 1E0KA 4YDHB 5G0VA 3SF0A 2X86A 1Q95A 2FN3A 1F0KA 1V5GA 4OBWA 1JIXA 4B45A 1GXSA 2CZQA 3FE2A 3QW2A 5U1PA 2WFAA 4ZWNA 1VCIA 5JDCA 1XT6A 4CMHA 2ZIGA 5H3HA 2CLDX 4DLWA 5IEBA 4GXQA 5HKKD 4HGZA 5LIPA 4YT8A 4UBMA 1RHJA 1J9ZA 1KWKA 2BKUA 2FLWA 1RYZA 1AK2A 2AEMA 2VYVA 2FPWA 3JQDA 5YASA 3WXMA 2HF9A 1VP3A 4UUQA 3D1JA 2ZT8A 1OXSC 1CUFA 3KG2A 2I99A 2FMIA 2ZKLA 4JQZA 3UMGA 5JNSA 4JYAB 1XJCA 2W4IA 1BA2A 2AOUA 5F5NA 2PWBA 2JLWA 1JYFA 5DBOA 2FEOA 5FPSA 1JDBC 3VUEA 4W8GA 4XRRA 2WY2D 3KALA 2H1VA 3W5JA 1A5AB 3CJQA 1Y80A 3MYYA 3TCNA 2EFDB 2BMDA 4G4GA 3V1TC 3ZS9A 2D7JA 2VNSA 5CVDA 1P1BA 3ZVLA 3QHQA 3KUDA 4WT7A 3GUHA 2ZE6A 1XN1A 2GCOB 5DM0A 3GDOA 5ITWA 3VX3A 1Z0AA 3WDLA 4HUJA 1TRHA 1NVFA 4FHEA 4DM7A 2G9RA 1Y9AA 1K6IA 1M6NA 1M1YA 4P4LA 1YKSA 1T3ZA 4B8YA 4LS3A 2BHNA 5EUQB 3JCZA 1UFRA 4Q3AA 3TQHA 4EI8A 1N2IA 3IEIA 2J87A 1AS2A 1AQIA 4MZXA 3IALA 4C6SA 1TVCA 3LXMA 2WTAA 5E1DA 1SD5A 4L2IB 2OGSA 2ORVA 4B34A 3PD7A 4K6OA 5C1DA 2IZ6A 2QOEA 1JIQA 3L3BA 4WTOA 3SP1A 5BR8B 1NC1A 1JAZA 1CNMA 2XD9A 3S5JA 3LTEA 3ZE8A 3PXUA 4IIJA 4L16A 4UU0A 1C1DA 1KFJB 1TEHA 3MJSA 2HSZA 1Q3TA 1JIUA 2PD3A 2P8JA 2WICA 3IYLW 3KJXA 1LBQA 3NTQA 2D1SA 3TLXA 1WS6A 4JMLA 3G85A 3I2GA 2QMQA 4WJLA 3KYCA 1TT7A 4POAA 1UZUA 4BQPA 1YJCA 4XPIA 1MR3F 2XQJA 4F4HA 4BMNA 5DWQA 1E60A 1Z82A 1X7XB 1MXFA 3ER6A 2H1CA 1NJFA 1A9XA 4OU5A 3VSDA 4PC3A 1YU9A 3LUPA 3B9QA 1HC7A 5C31A 4BBZA 1YQEA 5ELLA 3KU4A 4PQYA 2OORC 3AB7A 4YGXB 3WLRA 3DZIA 5BSHA 1VBFA 4ICIA 2ISSD 2ZI6A 1F0NA 1K86A 4ZYZA 2QRPA 3NANA 3LOQA 5HBGA 1KIMA 2Q1UA 3HJAA 3TE7A 4BWFB 1IUOA 4E94A 5K01A 3JASA 2CEAA 1TU3A 2YV5A 3C16C 1PL0A 1YVUA 2I0FA 1LEHA 3OZCA 2VP2A 4WXPA 3FCEA 2XODA 4JUIA 4M9CA 3OHMA 5LL6P 2GF9A 5CDYA 1W5FA 1Q17A 4YV0A 1JSXA 1HYEA 4UMDA 2PH3A 4WV3A 4XE5A 3MS4A 3WC4A 1HLFA 2Q2WA 2BR5A 3BA6A 1E79A 3HU5A 4ZZ1A 3EOZA 2AOVA 1QE3A 1N36B 4LOAA 1XFAA 4RHFA 1AA6A 4WVLA 2P5UA 1SCQA 1ZSNA 2WK1A 5IKXA 1YUMA 4B2YA 3MK31 2V9CA 3C6ZA 1R4NB 2PANA 1VL1A 4B2PA 1CDOA 3RYFA 4Y1RB 5F78A 4MARA 1E2FA 4AZVA 4EKIA 3PCXA 1AT1A 4P9NA 3IP6A 3ZZTA 1C3VA 2VG8A 4H31A 4EHNA 5LN1A 3W8FA 2YZ7A 3GNQA 4RIHA 5THKA 4M9XA 1PO7A 3AZQA 5IYZA 2A0KA 3T9CA 4E31A 5C9ZA 2O2GA 1LPAB 2FF7A 3KOZA 4DOMA 4UHKA 2G80A 5J4YA 1YMVA 3AEUA 3AX6A 2WD8A 2ZTUA 4F93B 1H93A 4AJKA 1YA8A 2JI4A 3HA3A 4LBZA 5JCOA 3SZOA 3TN7A 5CPFA 4UE3S 1KH2A 1G4HA 1HDXA 2PYDA 1WZIA 1QG6A 3L9WA 1SXQA 4FBGA 3E3OA 3IAXA 3H9UA 1WB5A 4OXNA 3IVAA 1ZINA 3EWAA 3AEQA 2AEEA 1KNXA 2ZYWX 4WHMA 1XQXA 4XB6B 3TPFA 4DYDA 4X1YB 1E2HA 3SICE 1Q84A 1BWQA 3ESRA 3K6KA 5AIBA 2ZIZA 4MW2A 4EY8A 2VT3A 3QMPA 2ZSKA 3FPBA 4F86A 2DULA 4NDZA 1A0OA 3SC6A 4PLGA 4BPBA 3P8ZA 1F60A 3GIDA 4GWGA 5C5CA 5KNCD 1U8XX 3FOBA 4C4XA 2A9VA 4QASA 1SKAA 3AFMA 4BAZA 5DT9A 1K1EA 4V39A 2N3ZA 1L3CA 1Q11A 4FDTA 4NBLA 2PKWA 5IMBA 3B3JA 3THXA 4A0GA 2I3ZA 5JSQA 1HTBA 4R16A 2R84A 2ZYIA 3CY6A 1ADBA 3LBNA 4KWCA 5BSTA 4WZAA 3UWSA 1I14A 2PV7A 5KX5B 1CVRA 2W6ZA 4YMHA 4M60A 2XZTA 3LD9A 3REQA 3PQEA 2XUQA 1V7QA 1PR0A 3T5CA 1S2MA 4TTIA 3EZ7A 4UTZA 2DWUA 4GDFA 3GAFA 3OZSA 4KV9A 5CDFE 2JJ2D 4C01A 1FMFA 1DJNA 1TD9A 2RGNA 3OTWA 1SH7A 2GJ9A 1CF2O 4RFSA 4Z0PA 3WI7A 3EIWA 4UBOA 3WJAA 4X94A 3CCBA 4UUNA 4DNOA 2YC2C 1EGMB 3PI6A 1UBNA 3HCRA 4O2BA 4CIXA 4F7WA 1Z9BA 1MW9X 2AG0A 3BWYA 1CQZA 2ZCVA 3NUQA 1Y6FA 4Q1FA 1QOPB 4MVJI 4TV8B 3ABSB 4TM8A 1J1ZA 4OP2A 1UIRA 5J5CA 1AUOA 4QKQA 2HM7A 5BVGB 4CR7A 1EZ4A 4KIJA 1L7PA 2OHHA 4UDNA 3G7UA 5KNDD 4DDVA 1BQ3A 1KSFX 3PFCA 3VZCA 4F9EA 2VSQA 2XTAA 1YTLA 2O4UX 2GQ0A 1AZLA 1NW3A 4MEBA 4ACAA 3KS9A 3JR7A 1XRQA 3GJ5A 1I4LD 5EIXA 5ALOA 4ARBA 3FPLA 3AUAA 1DHTA 1T6ZA 2VYND 4C22A 2C2XA 1FSGA 3KQMA 1NRIA 1DKRA 1U8YA 4DR2B 5AXCA 3HMKA 3FPAA 3F71A 3DE5X 4XYBA 3WGHA 3WRYC 2B0JA 4QYMA 1YE3A 4AJEA 2LRHA 1I7DA 3NJRA 2BEUB 2J41A 2H1WA 1NUQA 3BCHA 3LZ6A 3RF6A 3TSZA 4ENWA 2ES4A 1G3RA 2C5BA 2GCGA 4QT0A 2FB9A 1JEEA 1F9AA 4JU8A 4CI0B 3A3OA 1PFUA 1SKYE 3R5KA 3BUSA 1IZ7A 4B7CA 2ZB2A 2X4DA 4H77A 3ITEA 4I9HA 1P7ZA 1V7CA 1Z2EA 2GJKA 4V38A 2INGX 3D7LA 5AICA 5TQ2B 3F90A 1A95A 5TSDA 1YAJA 1MP0A 4BFYA 4I7EA 5KYGA 5DNEA 1JPJA 2H00A 5L3ZA 3SJZA 1LZKA 3DF9A 1IUNA 1W1IA 1NNEA 1QG0A 2AMVA 1SVSA 4HWOA 5JJCA 2LWIA 1G8AA 1WMEA 2BR3A 3IOCA 3D0OA 1Z2AA 4H6WA 1PR4A 1RKBA 1LDMA 5EP2A 1ONPA 2A1UA 2QTAA 5IW8A 3U48A 4NJEA 3O7MA 2R11A 3GJ0A 3CWZA 2AJTA 4F0JA 2EBHX 3G59A 3HO6A 1HNZB 4Y9DA 3TW8A 4CL8A 5LMCA 4G84A 3BXXA 5DYWA 5IN4A 4B31A 4JJKA 2DR2A 2FK7A 3DL4A 3GFTA 1NRJB 4U7HA 5EJ6A 1E3EA 1L7QA 1PYGA 1ZGHA 2Y1GA 3T9EA 4ZCIA 4UXIA 4YCSA 4NMHA 3HB0A 1VOTA 1R9NA 2XBUA 1TAHA 2W90A 1NV8A 2ZAIA 1QHIA 1N6IA 1KSGA 1NVVR 2VCHA 5H70A 1D9ZA 3OTOB 3GLFA 1NUHA 1SUPA 4AZWA 1AJEA 1ZL2A 2UZ3A 1E0AA 5FLKA 5KVCA 2VZEA 4DDTA 4FGUA 3K92A 2YCBA 5AKLA 4D5EA 5KWSA 1QQ6A 2VUIB 3GFRA 1GTVA 1EBUA 1RBMA 2HB6A 2AW5A 2NO5A 4LVCA 4CV0A 1P1KA 3ER8A 2P0AA 1PDVA 2FZKA 3OKAA 5CK4A 2ZB3A 1ENYA 3NHJA 1YZYA 3SDSA 1ES9A 1G5RA 2D5IA 2FOXA 2VPTA 1NQVA 2X0KA 3D3JA 3SBEA 2FXIA 2VS1A 4TMYA 2H9AA 2FPMA 2ZRKA 2NT3A 4AZ3A 1RFLA 4CLRB 3GEBA 4GOOD 1YL5A 2XUZA 3KOYA 3NH9A 4RVUA 1FQOA 4LJLA 2VBFA 4OI4A 2IOFK 3P45A 4BWVA 1HORA 2GFHA 3SM9A 4ADSG 3B6EA 2ZAGA 1WPRA 3S28A 1GDDA 2JJ1D 2GCEA 3BMOA 5CTAA 3QVMA 3KQSA 5CUQA 3Q3IA 4GR9A 1VG0B 1M9NA 3A9SA 4UUBA 1OHHA 1SR8A 3E22A 3FGPA 4J4TA 5ALEA 1FLDA 1MB0A 5AW1A 3TFOA 3BULA 5ENDA 1ZU4A 3K6JA 1HR0B 4C88A 2E4AA 4E5KA 1GSIA 4KAFA 2WJGA 1UKZA 3EGXB 1UPBA 4DR3B 1T4BA 2HGSA 3JQ8B 1KOJA 1XTTA 4N9WA 4BE4A 2R5FA 3W90A 2NXCA 1U1CA 3NNSA 1DKNA 2ZRLA 3CZ4A 1BKYA 5KTKA 4Y0NA 1NMQA 1WULS 4BQSA 4AJPA 2A9QA 1Z17A 1G8KA 1M0TA 1KP3A 2I6GA 4XIJA 2YMQA 1Z37A 1JLRA 3GEMA 5HTKA 4O4HA 4DBLC 4OFWA 2K5UA 2ARKA 4BOYA 1NQAO 1QAMA 2QW1A 1IZYA 1J22A 2QRMA 1L5HA 4MI1A 1OBFO 3Q9NA 4FIZA 2PJDA 5IWAB 1VLQA 2ATXA 2P68A 5FBRB 1RDFA 5AVWA 3HDGA 1BWPA 3ZX5A 5DSTA 3ZVRA 1EQAA 3LCRA 4PVCA 3HJFA 4EPYA 4I6GA 1D5WA 5T8KC 2IYOA 8ABPA 2Z0MA 4RVSA 3ADCA 4IDPA 1MB2A 4NR0A 2EOAA 4GBGA 4PZDA 1JI3A 5IVIA 3TNLA 2Q50A 1MNQA 4AJOA 1WCXA 2YUTA 3MWYW 2OESA 2WF8A 4GYJA 4UEOA 3WTBA 4GEKA 1YJXA 1KEVA 1WW3A 3FB4A 4IF6A 4DCMA 3GU3A 2BFEB 4KRXA 1OVGA 4LX8A 3WRVA 1KHHA 3D0RA 2PFSA 4TROA 4Y7DA 3RIMA 4FP9A 2O8EA 4KMOA 1E3TA 2EG9A 3RSFA 1NG9A 1KDYA 1BE0A 1ZD4A 2PZBA 3CURA 5CYFA 4DQUA 1ORHA 4FMPA 4D9IA 1E2QA 2RGBA 4X6XA 2PO5A 5FLYA 2CVFA 2ZS7A 3A2NA 5AHRA 1M1UA 4B7XA 5TGDA 1AX9A 1LQ2A 2JFQA 3I30X 1GRNA 4GPD1 4A6DA 1T0BA 2GM9A 1LW6E 2QNBA 3QLUA 4JBIA 5F2NA 4X65B 1YU6A 1EJ6A 3O0DA 4MB2A 4BLRA 3AVXA 1I33A 1MAHA 1Q50A 5EMKA 3UG7A 3MWDA 3MJCA 4XX0A 2I4IA 4TRMA 1KAOA 2KSQA 3WLFA 2CDNA 1AQNA 1JHYA 2YY6A 3MHPA 3HVRA 2ZBQA 2NTYC 4CFZA 1E32A 4N82A 4YCMA 4L5CA 4JGGA 1EGQA 3UMBA 1C3OB 1EQUA 1BWRA 2AKYA 4H9GA 5IYZF 5TEVA 4C76A 5JU6A 1P7CA 3ND5A 4NZZA 3SSMA 1EUDA 3IIKA 2GLTA 1NQTA 1JFVA 1WXIA 2HJ9A 1NT4A 1LC0A 5ELXA 4RDIA 2J0UA 3F5QA 3RC8A 1SG9A 3GZ4A 3O75A 5BSUA 3UCXA 1ZEJA 2FMHA 2QRUA 1IL0A 4M1SA 2XUPA 5ICCA 5IP5A 4W1RA 4KP7A 4CG2A 3WYDA 2XTJA 3N2IA 4L07A 3FVTA 1NM5C 2VQSA 1E2MA 4ER3A 1LTKA 3GVPA 4ZYVA 2JLYA 5LZ4A 4F4FA 1R6UA 2J9FA 4FT2A 5DHFA 4IIDA 2ZRMA 5C34B 1P60A 3DEYX 5I7FA 3OA2A 4Q9LA 1Q16A 1PJ4A 1EX7A 1XG5A 1XVIA 3GP5A 4N3GA 5IAGA 3FPGA 5AJZA 3A3NA 3RUCA 1CEYA 1Z22A 2ALJA 2X4IA 2P7IA 2QJTA 2WW8A 4D96A 3O8BA 2XXJA 4FYJA 2HRQA 3RC1A 2ODQA 2RKOA 3OUZA 2X23A 4JJGA 4LXHA 4MB0A 3VU0A 4BRUA 4ZT5A 5AD1A 2G04A 1WUYA 3EGIA 1NBAA 3DLCA 1OTHA 1O57A 3GH3A 3PQ7A 1NUUA 2VDKB 2OXRA 4M1TA 1E92A 1FFYA 4D1YA 1FYDA 1H0SA 4PC6A 3I76A 1FFXB 3N1UA 1D7AA 1A4RA 4FCCA 1DIAA 2B5WA 2C5LA 5DO9A 4AG5A 4MVXA 1HE3A 4IMPA 5L6LB 4RVFA 2UAGA 1TLLA 1GYRA 2HL6A 1F3LA 3UOGA 2Y92A 1R4AA 2WTBA 4EJSC 2Y9PB 3CGGA 3KB1A 1CJBA 3WWDA 2AHRA 1SBHA 2XCUA 4O2BF 4I9UA 4ID3A 4RVOA 3G2JA 2YQ5A 4PEVA 1I51A 2Y1FA 2AMLA 4J1QA 3EH1A 1N6HA 4A8JB 1O6GA 3JYHA 4IIXA 4FFOA 5FWAA 5KYYB 2OC4A 2AF4C 4RVHA 1ISPA 2CXTA 2PZAA 4R1LA 2FWIA 4M8NE 1DPGA 2NZ8A 2RGCA 2H1HA 1NW7A 2WG1A 3EAFA 3QA9A 3YASA 1DC4A 3G5TA 1VSVA 2VIIA 4DFDA 2DY1A 1DFIA 3HCAA 3WHKA 4XVQA 4OJQA 5KQSA 5I7WA 3KT3A 1C0EA 1RLJA 4KGZA 1NY5A 2X9VA 2OV6A 3GVHA 1RYEA 4GSYA 4WXHA 2VWHA 3DOFA 5EJMA 1QAQA 4V0ME 2QT1A 1MD9A 1QPGA 3HN7A 2W0SA 3MYRA 1EXDA 1VCNA 4MTLA 3AFIA 3OMXA 3IBFA 5KYXB 4OQFA 2PS0A 3HKEA 4II2A 3DEKA 1KQNA 3GA7A 3LVBA 2ID7A 2WIGA 3O73A 1QWOA 4ZVRA 2B9VA 5AKHA 1VPVA 3FMOB 1W29A 3SHTA 1MLDA 1N0IA 5A5FA 5LQMA 1GU1A 4X24A 2VEOA 3QRWA 3I72A 1NW4A 3PQ8A 4YLGA 2OM6A 3QV1A 4OHFA 3NQ41 2BFNA 2L69A 3HB1A 3NPMA 3L4JA 4CG0A 5C3MA 4EO7A 4CJXA 1XTKA 2Y3IA 4O3FA 4AECA 1SD2A 1DL5A 3C3AA 1I3OA 4MW7A 4WDRA 1M2OA 2IODA 5DSXA 5FP0A 3DLHA 2AUNA 3P0JA 7YASA 3UBTA 1O77A 2GVZC 1X1AA 3PYXA 3K20A 2R6JA 2GGSA 1NI4A 3AIOA 4IIYA 2GXUA 2AEJA 3OC6A 4I9GA 2QUKA 3VKFA 1H66A 3T06B 1ZESA 2YV2A 1YJ8A 3BB1A 3D6VA 5BSVA 4BJ3A 4HWRA 3IBCA 4J16A 4OL0A 3WNCA 4FT4A 5FD8A 1QCYA 3JQGA 3ZE9A 2Z30A 2QD3A 4LPSA 2NTJA 4U39A 3EIQA 2NUTB 3UAVA 1L7NA 4LK3A 2YYSA 3DDNA 3T7CA 4L5JA 3V4VB 3ISJA 2AK2A 1GAQA 1ATIA 4ZRDA 1EA5A 1ZRHA 2PMKA 3IKTA 2W2QA 4WUVA 1P39A 3DBRB 1P0QA 2CVPA 1SCUB 2JVKA 1Z8HA 4L4XA 2ZIAA 2JHCA 3UC5A 4U7JA 2DE0X 1XF9A 4DSAA 4DPLA 4F9TA 2JIDA 2Y66A 2C5GA 4OUDA 3WQHA 1FFGA 1YCDA 2A9FA 2Y1KA 4JC4A 4AWAA 4QPDA 1I2DA 1J0DA 1W4AA 1H2EA 1UMDA 2O3TA 3UXEA 2ZJ7A 5K99A 4CV1A 4RZUA 4ZEMA 2ACKA 1JXQA 3KJZA 4GQBA 2OD9A 4IO1A 3ZBPA 1EVYA 1TEVA 3S1SA 4JR0A 1VLMA 3CLUD 1XVUA 3VDRA 4TKVA 1V8ZA 2GF0A 3VR4D 3OZUA 4P2GA 5IX8A 5JYEA 1M1XB 2IEYA 4NS1A 2Y1WA 1KPIA 1N5RA 3OJXA 1FDTA 3FFBA 5SYAA 2A5LA 3RS7A 3A28A 3F67A 3AC0A 1WKCA 2XNDA 4IGAA 4HNAB 5AOCA 2M6RA 3M4YA 2VYCA 5FJJA 3WYFA 2J7PD 3PI7A 4KGXA 4XGQA 1UBRS 3SE7A 3ZHZA 3OX3A 4ZQBA 1I7PA 2ZEJA 3GLKA 3BGVA 4R0MA 3E7XA 4HO1X 1ORWA 2O2YA 4AUKA 1HZZC 1J24A 2RCNA 5KQPA 2MCFA 1KJNA 5JH7F 2EWMA 2I03A 3EVNA 5HF9A 4O4HF 5F76A 5T6BA 2YFYA 4RQUA 1T35A 2A9JA 4OM8A 4PPYA 3ADBA 1YQWA 5LDGA 1OF1A 3PGJA 5K3AA 1A8QA 1YRBA 2O9JA 2REQA 1LDNA 3C8UA 3HCEA 5HS4A 1DIHA 4KRYA 1AN9A 3SXUB 4BMOB 2GA8A 4KQGA 4N18A 2PKQP 2CXHA 1CUVA 4MVJG 3LUFA 4ME6A 2VF8A 2VDJA 3N59A 1FJHA 3IAM1 2IUUA 3J7TA 3V8QA 3A37A 4DWVA 1YBVA 3MINA 4EEXA 5CA1A 5JYDA 1WDTA 3IRVA 4MIKA 4MIYA 4Y2HA 1L5LA 3EC1A 1E9DA 2VF2A 5I8WA 2G1PA 3RAJA 5B1EA 1TIPA 1NONA 4TLDA 3ZDBA 1JJVA 3WRXC 3DF7A 4KQHA 3WQSB 3G02A 1DS6A 3LUGA 1GZDA 1PCXA 1SOVA 4URFA 5JMOA 4LRYA 5KU7A 5IULC 4L4SA 4KDCA 4EIWA 3G1UA 5BWCA 5JAUA 4XVRA 1NE2A 3M6WA 1FUIA 3PGMA 2GZDA 2CJWB 3A1WA 4AC9A 4GOND 4P33A 3V4RA 5FWDA 3H4IA 2VP9A 2HNAA 5IK2D 1CEQA 4ZPXA 5BXYA 1DQSA 3AMVA 3KDAA 1JDSA 4YMUA 1FSSA 2B37A 4L22A 1XXHA 2JIPA 3DTVA 3K5IA 1UMBB 4I4LA 4OQ4A 2H18A 5J63A 3C43A 1AGYA 4P5PA 1SCJA 5M7EA 2B5OA 1T4CA 1JDZA 3F4KA 1YBFA 1J8DA 2V5VA 3GFFA 3I9FA 4Q18A 4WWHA 2VRNA 3V48A 1AF7A 1PR6A 1EXNA 2HMSA 4NSNA 3U16A 3KTAA 1U3WA 4MVJE 2NVUB 1H2FA 1LNQA 3T52A 3ER9A 2O7SA 4ZQFA 2FUG1 2OLEA 5TS2A 2J48A 4V0LA 1IYZA 4DEYA 4Z1OA 4RTOA 2WSYB 5KU1A 5A62A 1C4WA 3L6RA 1S96A 3FA2A 1E2KA 2H5IA 3LE8A 2W22A 2BGNA 4MI6A 1JPVA 3HO8A 1M6VA 2NPFA 3T7IA 3U3XA 5JI3E 2C97A 4BFUA 1EX6A 1YK0A 4XDHA 5TPZD 3M5WA 2ZUUA 5KDDA 1K7SN 1HE4A 4R1SA 5FH9A 5D1HA 1RPNA 3HKDB 3FLBA 4I2VA 5EE0A 4DY6A 4X3PA 5ER9A 2C8JA 3KBBA 5EEHA 4OQZA 2DHRA 3DDWA 4HB3A 4HNQA 5J2UB 1OCEA 2QUJA 3ND8A 2ZJ5A 3Q7RA 2AG5A 1SG0A 1TK3A 3B1ZA 3M89A 3AJDA 3K35A 1R9GA 4UULA 3GT7A 3MPUA 4O4IA 2V7WA 4OJTA 3I62A 3GHHA 1B3RA 3ICCA 3P9QA 3SQNA 3QQ5A 4YAEA 1HV8A 4WD3A 1DAEA 5AKEA 1DARA 4PANA 2P3QA 1EFPB 1HNNA 4O2AA 2IOFA 1CZHA 4JB2A 1HSZA 1ZBQA 3K8ZA 4X8MA 3WIVA 4D0NA 4EG1A 2IKQA 2FGJA 3DO8A 2EYQA 2JGJA 1WXHA 2ERCA 2JZNA 3R9WA 1RPTA 5T4HA 1TUBA 3RRJA 4PBRA 2V54A 4JBGA 3RKUA 2PGDA 3ZD9A 5LOVB 3UANA 1SEVA 2XCQA 4GMXA 3VR4A 5GTDA 4RF2A 4EJFA 3QUQA 3FYCA 3QI7A 4X1KA 3F8TA 4R0VA 1KZ7B 3SNHA 1B8VA 1MO2A 3GIWA 4JLJA 2IPMA 5B1SA 5FEUA 3FKSA 3TGPA 1B73A 2WSIA 4JKOA 2QTRA 1XWIA 1UDAA 3INNA 5EMJA 4ROTA 5GIPE 1D4AA 4KYVA 1ZZEA 1QZTA 4PXSA 2IV7A 5G1OA 1AOXA 4OA5A 1NVUQ 2EW8A 3F6SA 1NXXA 1VGQA 1J2TA 3GPLA 2XMQA 1N2HA 2NO4A 3V7WA 5ICMA 1T9BA 3QK7A 2LTAA 3RJZA 4KAAA 5EMNA 5GONB 3WIEA 3O8CA 3NP9A 2X0FA 3LFUA 4W5RA 4US1R 3MJDA 2ISCA 1W5BA 4PBSA 4IHJB 1LBHA 3N28A 4FMDF 3WMWA 4I4CA 3B7GA 4JSYA 5CP8A 4ZQHA 3IO3A 3EPJA 4L3OA 2O0LA 3BMQB 3EEFA 4F56A 2PJRA 1G2OA 3OE4A 4WOKA 1RS0A 1VE5A 4N7RA 3ZV3A 3FCXA 4BX0A 1RWVA 3KUKA 3COSA 1KTIA 3QNUA 3RYCB 2FVXA 4YT5A 1T2FA 5COQA 2Q4OA 3V32A 4QYSA 1LBTA 1ZI6A 4FYXA 4TMFA 4UHBA 2A86A 4NZOA 4ZVUA 2P2GA 3C6MA 4IX9A 2GFIA 1X77A 3L92A 3JQ9C 4J4BA 3QE9Y 5E1MA 3L9XA 2PUAA 2UZ4A 1S2GA 2IUSA 4LZOA 5GOZA 5KUTA 2GS9A 1YUBA 2QT0A 1VLHA 4JI3B 2H4HA 4X93A 4K7JA 5D6NA 4BJ6A 5KTYA 4A82A 1PL6A 1MEJA 3RC9A 3MF4A 1ZXXA 1Z25A 3Q11A 4M54A 1US8B 4YO8A 2YIVX 3H5OA 3A9WA 3G2NA 3IHWA 2J4DA 3HBFA 4LSGA 4YP0A 3RYHB 3ENWA 3NHMA 3FB1A 1YE8A 2JW5A 5GGXA 1KYQA 2QHXA 1VG1A 1IOWA 3ONVA 4QUHA 1U4SA 4QUDA 1ZKDA 4Q12A 4AO6A 3GLGA 3N0TA 2EL7A 2AFRA 4DY4A 2O7NA 3IJEB 4XQGA 3S3TA 3OZEA 4LE1A 3E81A 3ECSA 2CL5A 1KARA 3AHJA 3Q4GA 2IYSA 3WK7A 5JWRA 2R6HA 1GTRA 2J08A 2PUEA 1K6MA 4HEA1 3HLYA 1V9SA 1Z38A 1M34A 4DN6A 1BE6A 1E9RA 5HGXA 3AM4A 1HURA 2YJ3A 3L0SA 1DC5A 3PLRA 5EWJB 4G5HA 1Y8AA 2E1PA 4ER7A 1MBZA 4LWPA 1G8HA 4G5OA 3R8XA 2P3OA 1U0NA 3NWJA 1YZFA 2V1XA 1THGA 1XEXB 3QFRA 3QX9A 1BQEA 4HBGA 2PXAA 3W8DA 4ENVA 3L18A 1T0JB 1A8PA 1LD3A 3K2IA 2ZI7A 3UV3A 4BGDA 1SO8A 1XCOA 3A32A 4Q9JA 2DVMA 2WIAA 1IWPB 5EZYB 3TAHA 4RK5A 1Z73A 3OIUA 4II3A 3L41A 4Z86A 2WEKA 4WKPA 2O2DA 5ALPA 5CB0A 2P5YA 1T1IA 3HQ4O 1RAIA 1QFSA 4KNWA 1RCFA 3U9LA 3X1JA 4Z4GA 1AV7A 4YFVA 1EWTA 1OLSA 1PJZA 5EJ4A 2HDNB 1A97A 5C7YA 1RR6A 3A11A 4Q4CA 3H84A 5A1JA 2HA5A 3OTGA 5SZJA 4CCSA 3TMAA 4Z2YA 1DZ3A 3OEEA 3RU2A 5G1NA 3P2MA 3G9TA 5A7HA 2ZUTA 3T12A 2R7NA 4K9KA 3SQXA 3JAWA 5I8PA 2ZZKA 2BKEA 3SHOA 3GMIA 2RAPA 1YRWA 1Z7BA 3DKPA 4OM7A 4UVGA 5LP1A 3T5GA 4DSZA 3P0HA 1MMFB 4L9WA 3STWA 3LUHA 3PPXA 1A9PA 1KSJA 2AS0A 3TTXA 1RI5A 5DW3A 2XA9A 3OU7A 4TXMA 3TVDA 3ZW9A 4F4UA 1O5IA 1Y3IA 4J29A 3VR6H 1P7VA 2NTVA 1S2NA 1K5PA 3IH5A 5EP3A 1VMAA 4FUQA 1QFYA 1SKYB 1XTSA 5IN5A 3D8RA 5CX1B 3QVJA 1KI6B 1SBTA 3OT5A 1R18A 2I3GA 4QLAA 1P2GA 2P1RA 4U8GA 4BC1A 5D85A 4UHEA 3T1YB 3IEMA 1YOBA 2HJVA 3QYFA 1FVOA 1ISRA 1CNEA 3JARB 4WCFA 5ES3A 3TTWA 1LV7A 4G2TA 3KKZA 1CVIA 3D81A 4JJ7A 4F1KA 5HXAA 2VATA 3DZHA 2PS9A 3IERA 3K2QA 4BQIA 1HT0A 3DPIA 1XPUA 1DT5A 4DUZB 3N8HA 3OKFA 3ACCA 3P9IA 1XEFA 4KIGA 4N0DA 3OPMA 3WYBA 4O5AA 5KTTA 1NP3A 3OE1A 1M2VB 4COOA 3ECCA 2JFZA 3OF2A 4ASUA 5K3SA 4H4CA 2QN9A 5J5AA 3PTLA 4D0GA 8MHTA 3OZFA 2ET6A 1ESNA 3ST7A 4U2GA 5K7SA 1Z0IA 2GBLA 3PHGA 1PU2A 1R0SA 1GNQA 1I13A 5GJWC 5LUAA 4I1OA 1CE8A 5JCZA 1MC8A 3D2BA 1P75A 3FOFC 4IZHA 3VVCA 1G5HA 4H6PA 5IAOA 4YJGB 3A26A 3WMFA 4TYQA 2NWQA 1DQYA 2APJA 2O3UA 3SZUA 4JT2A 3TLYA 1P8AA 2Q8NA 4L2IA 2CVQA 1ECGA 5DNCA 4HG2A 5HNKA 3GA5A 1O6ZA 1R3UA 2A9KA 2O0HA 3ET4A 4PPGA 5LFAA 3P2IA 1DT3A 5CD9A 1KL7A 2B83A 5KTPA 4M2LA 3CZQA 4ZEXA 4ER6A 4JROA 5EZSA 1PFYA 1IWBB 3A4MA 4M7PA 5DXJA 5TDHA 3S68A 4HATA 4J3JA 3RG2A 5A5DA 2GYUA 2DPMA 2OHIA 1Y4UA 3CLTC 3P0IA 4LSMA 4QNMA 2ZIUB 3PA6A 1RE0A 1HE1C 2PX6A 3HABA 3OHPA 5HM8A 4XYMA 4GSKA 4AFNA 4NXMB 1X7XA 2OCKA 3JQFC 1B1AA 2B94A 1N1DA 4FX5A 4LJAA 2FHSA 5K3BA 3UV6A 1FFBA 1M2EA 3HRHA 3SZ3A 4LHSA 4WNAB 1DAMA 4TWBA 2A33A 3OLWA 4PONA 3OQBA 3T4PA 4EVSA 3MRVA 1LI5A 4Q3CA 5I01A 1GR0A 2A92A 1RLIA 2A8YA 1YIDA 2O4CA 4NOKA 3NNDA 2XUDA 3T94A 1COZA 3VC1A 4CLXA 4DGSA 1TPYA 4RLSA 5I48A 2JIZD 3PDJA 3L4EA 1IN7A 2Q3MA 1DAIA 4AP9A 4INAA 4JOBA 3ZDAA 4XGKA 3TZHA 4YJDA 5KOHA 4L5YA 3PEEA 2XYHA 1F7UA 1Z0UA 4TXNA 5FYDA 1FFDA 3KVYA 4PLTA 5DYNA 4UNPA 2X1VA 3TLBA 1N8SA 3CLRC 4O4IF 5FNVB 1KMIY 1WB9A 1RHQA 3RF7A 3KLMX 4BFTA 2OOSA 3DVAA 3TLEA 4DCVA 3SMQA 1HE2A 3P71T 4JCOA 1SB9A 2FRDC 4WXYB 5D3QA 3VO2A 2HBYA 3COJA 2WWTA 4PYRA 2CF5A 1R7RA 1YCGA 2DPYA 5HR5A 2AFHA 5FNZA 3S2EA 1CJTC 4MCIA 4WACA 5CYOA 5DV9A 2VUHB 5IAEA 4E03A 1R4NA 1HNWB 4Y1RA 2EZ9A 4QDXA 4BLUA 4DLSA 4OXXA 4XFDA 2VNKA 3JQAB 4G09A 1MB9A 3ESYA 1MC5A 2XTMA 4AJ9A 4KN5A 1FTNA 1O94D 2AE2A 2B4RO 4JLBA 4MWBA 5IH7A 4M9ZA 1GPH1 5BYKA 4X00A 2PM8A 5TC4A 1CX9B 3IQFA 4LHEA 5DXFA 4Y2QA 3ZV6A 3AR8A 1SXIA 4X54A 3G2PA 1DXYA 2J8ZA 2BGMA 4IUDS 4B3GA 3EZLA 4XYGA 3ENZA 4B4WA 2JFWA 2QV7A 1L8XA 1ZD9A 3I2KA 3TVTA 2D4HA 5ALDA 3VYSB 1Z4IA 2QVXX 5IG2A 2P3LA 4G0WA 1H9CA 4DRXB 3H8JA 1ZQ9A 1J33A 2ERYA 1DJLA 1DEOA 3V4SA 3ZNQA 3QPDA 4ARZB 4X1YA 4BE7B 4CV3A 4JUBA 1I2AA 4RLQA 4UHDA 3EG5A 2FI1A 3NEYA 3RO7A 2B1GA 3MAAC 3QM1A 4HFJA 1QFZA 3I01A 1JS1X 1BC5A 3N86A 2X8AA 1VPLA 3CSSA 4DV7B 4AQYB 2PSFA 1XC7A 4IY1A 2GAJA 1GSAA 3LPNA 4M36A 4MROA 3EUFA 3H16A 2N42A 3EZGA 1S02A 2XXAB 1X0XA 3N8GA 4WINA 3VNVA 4EARA 1ZH0A 1CY4A 1KC3A 3Q87B 2Q5OA 3CISA 4HDCA 1U80A 3H97A 3TX6A 1ACJA 2WG2A 3L5KA 4BZXA 4KFRA 3E3LA 2OO5C 1FC0A 1U1FA 1JALA 1Z15A 2M1ZA 3DL0A 3IMFA 1Y1LA 3W77A 3ZWAA 5KHLB 5KX5A 2HO4A 4IQ0A 1V41E 1EE2A 3BAFA 2E5WA 1HUQA 1XCLA 1HOTA 3H42B 4X90A 1P74A 2G28A 1JVNA 3H9GA 5JC1A 4M0DA 4EMTA 4CQLB 5A4IS 1R88A 5TQVA 2BP7B 3S2ZA 2DF8A 1HLPA 4Z5XA 1XZMA 4YMVA 4Q6WA 1ZJ4A 3PFGA 4FBLA 4LQ4A 1N6NA 4G8BA 4IHQA 4MR7A 5TLSA 2RGRA 2VWGA 1U0SY 4YIHA 2DBRA 1W25A 4YJHB 3TNDA 3MS2A 3B1YA 1RD4A 4YI3A 2F3TA 3DEJA 4EEZA 1REQB 3HL4A 4H3SA 3UHJA 5B7NA 4KO3S 4OD0A 1NI5A 2GUWA 5K8LA 2HH9A 1J8QA 3L07A 1BX1A 1K9SA 4OQLA 3TYXA 5JY1A 5B1YA 5EL0A 4URXR 3II6X 4IW3B 4JDUA 1AUVA 4ZOEA 4ZCSA 3L1VA 1XJQA 1H22A 2PVPA 3OZTA 4K8RB 4AK9A 3ILSA 1P2FA 3WVNA 5KTNA 2OR3A 3I23A 1R3DA 4ILKA 2D0IA 3IQXA 5E1OA 2C9ZA 5HF5A 4RE5A 1YTUA 1E6KA 4KFTA 3WYNA 2FP4B 4B6JA 5LJIA 2RGAA 5DTRA 5ALHA 2C0CA 3MWKA 1BXZA 4JYMA 1SGWA 2HCFA 1TYCA 1OI3A 1QIDA 1XB2A 4MGIR 4TMZA 2J3EA 2YVAA 2I2BA 1Y8QA 2VTKA 3M81A 1TKBA 4G07A 3S27A 4DB4A 3HCNA 1JE1A 4E5YA 1N77A 3HU2A 2C7QA 1A5TA 4Q3LA 1QONA 1B93A 1RYDA 1VSTA 4A1FA 2BFFB 1RZRD 3UPDA 1TW3A 2C4MA 2M98A 3KJIA 5TQ2A 2ZJAA 3NNNA 3E2PA 1NJ8A 3NIBA 1VDMA 1XMXA 2AI2A 2GF2A 4IXNA 1BCSB 3UMSA 4ZCPA 5I7OA 5DYYA 3PQ6A 3IBSA 3DTYA 4KN8A 4AKTA 5JMPA 3O8LA 4QXMA 3SSNA 3QU9A 3H5AA 4ITVA 4TS9A 3BFVA 5JSUA 1F5NA 2YBEA 4TKLA 3WO0A 1I2ZA 4DA9A 1LTHR 1V4NA 2BLLA 1QXSA 1WP9A 3AL3A 3D2CA 3HGQA 2YHBA 4RK6A 2O2IA 5AK0A 1YFLA 3UNXA 5CHYA 1N9GA 2LIVA 3QKRB 3BB4A 5BMVB 2AK3A 1TB4A 1M0SA 4MDYA 5F1PA 2FSUA 1FX1A 2AB0A 4U9HS 5C4GB 3D2AA 5AXAA 4L6IA 1DXOA 4QO8A 2R85A 1XZIA 2YXLA 2Z3WA 3BRWD 3D6TB 1H9AA 3K32A 4J75A 5TJ9A 3TBHA 5B6JA 1I6KA 2QJWA 4M8IA 5CBKA 3K5HA 3I83A 5B53A 4J3NA 3CR7A 5JSHA 3LY8A 1F8UA 3T5MA 4FLEA 3JYQA 3SEZA 2JAHA 1VJ1A 1AKNA 2E48A 2XCIA 4DT1B 3KZMA 4M49A 3NTOA 1ZK2A 4QRDA 4I5FA 1C30B 2G1AA 3RQSA 3A58B 3GPCA 2DEUA 1LI4A 4JN6B 1C7RA 4IG4A 2PL3A 4FWTA 3DKKA 3RJTA 2QX8A 1YS7A 4AJ1A 4QPJC 1PJ2A 4TXHA 4AXBA 2CL7X 4EG3A 2IE0A 4LHZA 4ZOLB 2QENA 1LRKA 3FZGA 4JLWA 1IDOA 2R9VA 4KLCA 3WB1A 1NJ6A 1N92A 1QJCA 1L5KA 1VI2A 2OCLA 1YF3A 2UXCB 4I50A 2QT9A 3UIEA 1A9QA 1TTQB 1T5SA 1QRSA 3AHIA 4PZLA 5B7QA 4LKRA 1ICEA 4PAGA 3UOAB 5JNRA 4CLRA 4RJJA 1I0LA 1KQOA 2AFIA 3IAHA 5HIJA 3BT7A 1I24A 3OH8A 2OKCA 2DT8A 5H5JA 5JV5A 3BORA 5A9SB 1G9SA 4PAMA 3O8QA 1XHLA 4KK3A 1VZ2A 4DQDA 3W5SA 1NXVA 3HU3A 1PT7A 2OFWA 3DC2A 4KG7A 4BUZA 1E1YA 1T2EA 4R2KA 5F64A 4R1TA 5EIHA 1EVJA 3TBFA 4HFNA 3PNQA 3PQ4A 3E1KA 4FSDA 4LA4A 1P8JA 5FBHA 3RUIA 4JC0A 3WQBA 3B7WA 4LMAA 1THTA 2RI1A 3TPZA 1Z18A 1WY7A 2AI1A 1IN5A 3BE8A 3PC7A 3PNKA 1Q3HA 2VBGA 4LDZA 4R69A 5K4GA 4KAJA 3AJRA 1PTJA 1J0AA 4HD8A 2VPXA 1U8UA 1KDTA 1X7ZB 1GYQA 3WHIA 1GEGA 3C1OA 3VJKA 3ZE1B 3C3XA 1ZSYA 1QGOA 5K6AC 1S3GA 1B0ZA 3RSQA 1NYTA 4NESA 3VPSA 2QMEA 1Y8RB 2LKDA 3A1VA 3QU2A 4XJVA 2D1RA 4ND6A 2AIRA 2VDVE 1QGYA 4A8TA 4RTNA 1L5RA 3DLTA 5JY6A 3L4BA 5F4ZA 3W04A 1Y7IA 1YQGA 2A9OA 2ORED 3NONA 1BJKA 3R41A 1PZFA 4ZHSA 1SBYA 1E7YA 1ODLA 1AKEA 1I9GA 1PWEA 1EVLA 3HG7A 3VHRA 1PNRA 2VPPA 1KK0A 2EKQA 3A8TA 3JZMA 2RB4A 2VHVA 3ZQJA 1EP1B 3O84A 3E3AA 1R66A 1KMHB 4D4MA 5JNTA 3KSUA 2O6LA 4MDEA 1DDOA 2OYCA 2BFEA 2M2IA 2H92A 4HP8A 2GJ4A 1MIHA 4B3IA 1FQJA 1PSZA 1QH9A 1J0CA 1NVGA 3F8WA 5D86A 4JOQA 3TVYA 1QIMA 3ESCA 1DWUA 4DVGA 1V5FA 4WZBE 3HA2A 2A94A 3MT0A 6ADHA 4LK2A 2CMKA 4EFMA 5KTMA 2XUFA 1W88B 1FUUA 4DTIA 3RT9A 4HQ6A 2IQ5A 5IXYA 1MRNA 2RJ3A 5IARA 1M5TA 3G0BA 3CCFA 1OZHA 3DXXA 1XKTA 4X3OA 2Q5EA 1HGXA 2GN8A 3C3WA 3ZHTA 4OKNA 4REQB 4YRBA 1N0UA 2P9QA 3FM9A 1TVEA 3PB3A 2GXAA 1ZNQO 4G89A 1X1RA 2C9DA 3CF6R 1IOVA 3ICOA 4YCAA 5C1IA 4PAQA 3U3DA 3L0YA 1VC2A 1WUKS 3ONWA 1DWPA 3KOOA 3MRTA 4L8WB 2K2WA 1Z0FA 2PGOA 5BURA 1POWA 3V1KA 4HYEA 4KXVA 3MTBA 2VZ9A 5DU2A 4Z7JA 5KC9A 3KXDA 1JDJA 1SMKA 4ED9A 2FWNA 4G1CA 3BRWA 4EHIA 3F0TA 3QYPA 4MITA 3TEMA 1CT9A 4R3UC 5FEMA 2XVYA 3O2QB 4MS4B 3UJ3X 1CFZA 5FV7A 1H2ZA 3DOIA 1OPXA 2FOIA 1HYHA 3HV0A 3L7YA 2Y05A 1IJEA 3D4BA 3OO0A 4O33A 4QNRA 5AW0A 2YV3A 4HNVA 3W3AA 1NAIA 3JWEA 1BVHA 4MQ4A 2QMUA 2I55A 2ZJ1A 4J49A 1CRQA 1PR5A 1QRDA 2PUWA 1K4KA 2REOA 4RJLA 2OVFA 2PSHA 1E2DA 1SXJA 2QR3A 1TJ4A 5FPQA 5LLDA 2ZB8A 2PT7A 2ZUSA 3I2FA 2V3CC 2DHEA 1FRVA 1KK3A 3GEHA 2FN9A 1ID1A 1SQ6A 4OGWA 3HN6A 5KJCA 4ZYXA 5AI0A 1JFLA 4YWHA 4QPPA 1QVVA 2CYAA 5EIEA 3WLTA 4E30A 3AKYA 4NMWA 2FZWA 2NUPB 2GD6A 1SZPA 3T1NA 3FMIA 4B5KA 4E4RA 1GNTA 4UCFA 3BIFA 5FBKA 1OD6A 1T0HB 3L7KA 4HDSA 3LDFA 4Y2PA 3Q9LA 3R7LA 4YT2A 5KX5F 1KI3A 2OV3A 2HMVA 1A8IA 1EK6A 1FFXA 2UUOA 1UDXA 3FAKA 1E7RA 5SZHB 5JS6A 2ISQA 3MTIA 1ZR4A 3CO0S 4F8JA 3N75A 4ILEA 4RMJA 2D6FA 2AZ4A 1RTKA 4IHAA 5EMHA 2XQFA 4AIIA 4B3XA 4AJJA 2VTBA 4N48A 1S9HA 3DMDA 4GPAA 1YS9A 3CXRA 4CF4A 2XUOA 1HFJA 2HBRA 3EGDB 3U17A 1PW5A 1W34A 1E3LA 1JDUA 1KRHA 1SHKA 1R15A 2DKFA 3DP7A 5TE9A 3EY4A 4TSFA 5LMZA 3G3EA 1AK9A 2R0QC 4BKQA 3W5AA 5JXIA 4R1UA 2AN5A 4GX5A 4ALMA 5KYYA 3RUHA 1LLQA 4FKMA 5ITVA 3TXXA 4B3SB 5E95A 4PNHA 3P1JA 1ODIA 2FA9A 1Q1NA 2W6JA 2YRWA 3KKMA 3OKCA 1JGTA 1GKKA 4GXRA 2MINB 4MWGA 3QSYA 3X2FA 2BMAA 3RS0A 4OQMA 1H8ED 2BFWA 4QL3A 2COKA 3DZ8A 3WKCA 2ZI9A 3UGQA 5HPYB 4DCTA 3LM8A 4B3HA 3OE5A 5CAEA 3ZKAA 4EDFA 2C2MA 4YB8A 3GEPA 1WMBA 2IEIA 5E3JA 4EH1A 1F2UA 2H3EA 2VQEB 3PWKA 3OCVA 5KYXA 4NCKA 2KHZA 4GOMD 3ZWYA 2UZIR 2ZANA 2ZRCA 4NARA 3UCFA 5HKAA 5E1BA 2G7MC 3E9CA 2BGLA 1XK7A 1RM4A 1OMOA 1P1HA 3A70A 1OZ0A 3PGKA 4DMFA 3U7HB 4B47A 3KQHA 4J43A 4EAAA 1KZ4A 5IS2A 1KS2A 1AGNA 3Q9SA 4G1VA 4MDHA 4BZPA 4ZJYA 3IUPA 2PGLA 3ITKA 1EWYA 4PE5B 4BCCA 1YRQA 1SUFA 2BIFA 3RIXA 3VMFA 4F4DA 1IFXA 1ZM2A 3GLQA 4Q6BA 3UXYA 4PY2A 3VNBA 1RWQA 2GPJA 4B6RA 4IBOA 4YXWA 4WNCA 4V0SA 3ZD6A 3A1FA 1JFRA 2FY8A 2JH3A 2W2PA 3JD2A 4DAEA 1RKUA 1BD3A 4WY5A 1EJBA 4Z9FA 4IWXA 2X8LA 4C1NA 3KVOA 3RC2A 4DM3A 3EXAA 3HC7A 1AZTA 1P7YA 2NQ8A 2YV1A 1DJPA 4I4IA 4NJMB 4ZI5A 3UUWA 5EQJB 3JWIA 4IFIA 4INPA 1P2VA 1ZD3A 3B1VA 5B12A 1UPCA 5CB4B 1TXGA 5KNBA 4FFSA 4HDMA 1C5KA 1UOEA 3ZLBA 5E4YA 4G86A 1ECBA 1SA0B 2DQ4A 3N74A 1CUBA 4RF5A 4OLHA 1DQZA 5CITA 1IXKA 4GLFA 4C04A 4DC0A 5JQWA 2J6CA 4YFYA 4WOPA 1D1QA 3EDMA 1H85A 4I8IA 5AP9A 2WM9B 1O97D 2PXCA 4X7BA 2P2CA 1RE1A 1FYFA 3W8RA 3AXTA 3IDZA 4QHTA 2CCKA 2CEKA 1KIFA 2Y8EA 1IH8A 4KOAA 4LX0A 1FRQA 2NUTA 3IP7A 5BNZA 1A77A 3PL1A 2WU8A 2ID8A 1TCUA 1Z12A 2WABA 3DBRA 4S1OA 1U98A 4KWHA 1SCUA 2H52A 5SICE 4HC4A 2AZXA 3OCCA 2XECA 4MVJP 5ELMA 1ZCAA 4DLAA 5ARBA 2YICA 3P52A 1YZQA 3DNFA 4MMZB 4CG3A 5GM1A 2QKYA 3FVVA 1GYPA 5F1KA 3AR7A 3IESA 4GOXA 4I50F 3PUJA 4P3NA 3T5DA 2E37A 1HG1A 3HDQA 3LQRA 1CDZA 4TLEA 3UV7A 4DLRA 3CEJA 4WA7A 2PJZA 2GKSA 3TOVA 5C1PA 1V71A 1PK7A 3HBJA 1M5RA 3I8SA 3NUZA 4ZVLA 2RHLA 2HX1A 3NVAA 1NVDA 1RVV1 3VO9A 4DDKA 1ZGCA 5CX4A 5I7RA 2A5GA 2Z2ZA 5EKSA 3IT2A 3K9FC 4JELA 3LWBA 4IJMA 2DSTA 3J81k 2VJMB 1MNAA 2LNDA 4K1XA 5C4IA 1IWOA 4HNAA 1J21A 1EXMA 5K3DA 3CEHA 3KYDA 2ZULA 4KR3A 2NPOA 1EAMA 5DVZA 3WBFA 1OIXA 1RRMA 2CXOA 4CFSA 3RFFA 1CJKC 3O95A 4HDOB 5E4FA 2ZUFA 1FQWA 1PVDA 4JLVA 2JEYA 1H9BA 1M7HA 1AS3A 3AONB 3GFPA 1V35A 3DH0A 1VLLA 4OBEA 3TW4A 3GWZA 1UINA 2HPVA 4AKSA 1NHWA 2IIPA 4K87A 1AV6A 1IM8A 1PWZA 5F5LA 5KWVA 2VA8A 5ALIA 4MHTA 3FYSA 2R7MA 2X9GA 4YUXA 5KS2A 4Z4IA 1KYZA 2ZQ5A 1U31A 5TQ0B 5EMMA 1I1OA 1L6RA 5ECGC 3ZTYA 3LK7A 2AQHA 4M53A 5CT8A 2X15A 3R6DA 3TRFA 4QT4A 1N3IA 6CHYA 2Q6TA 1ZN2A 3GEDA 3SXUA 4CFYA 2DOKA 4FW9A 1ESMA 4Z8XA 3AVUA 3NGLA 3AH8A 1LRJA 1K8ZB 3I3SR 2DAPA 3SU8A 1MX3A 4ZC1A 1JZTA 1H8EA 4I8DA 4YR9A 2YXEA 4E33A 4D4LA 1TKCA 2II6A 2KLHA 4NAUA 3O2SB 4UOZA 3SHFA 5FTMA 2FUCA 3EUEA 2HEGA 3NZEA 2PKQO 1Z16A 1AE1A 1UK9A 5ETJA 4EITA 3H9JA 4BL5A 5ALJA 3JZAA 3OPQA 2XEDA 4IXTA 4O1HA 4QFCA 4XB2A 2J85A 1FMJA 3KSBC 4HVLA 4EX6A 1GTL1 2XYGA 4DDMA 4DPMA 4RJTA 3DE3X 4OX9Y 1DKUA 1YQXA 3UT5B 2Z83A 2WKQA 1N0VC 2O14A 1PJ3A 1YR7A 2WHEA 3DO5A 1FYXA 4IUBS 4B83A 5ALFA 4OQDA 1UMBA 3RBVA 1E7SA 1ESEA 5AM1A 2OCBA 3M3HA 1OH6A 1BH2A 1MC1A 2FMUA 3TNJA 4BWYA 3LBFA 1ANKA 4CM9A 5KPDA 1KAQA 3HB4X 1ZIYA 1B2RA 2JFFA 1GY8A 3IAS1 4RHYA 2NVUA 2R47A 3INGA 5FRDA 4G1EB 1U9IC 1HQKA 2CMDA 4WLVA 4LZPA 1DC8A 4A2WA 1E99A 3E53A 3T4UA 1XDWA 3DMTA 3I2JA 5FIUA 5HM6A 3K0EA 1FP2A 1I3CA 1NDUA 6LDHA 2XB2A 2GM5A 1NLYA 2B20A 3KAQA 1NQ5A 5LXTB 3AW8A 4KYTA 4BEJA 4R98A 2VUUA 1VP9A 5K3CA 7ABPA 3BCSA 2R3SA 1U99A 4KH1A 1BXKA 1DEKA 1ZICA 4HGPA 3HKDA 2QI9F 2F9LA 4WXMA 3RC3A 3ZCRA 1YQTA 2Z3ZA 5J2UA 3PFHA 2EWWA 3JQCA 4F6RB 5A3SA 2SCUB 3JALB 3GT0A 1SIUA 3LCVB 3A6EA 1LUAA 1R64A 1SK9A 4HGNA 4LN1A 3WLOA 3KBOA 2O5RA 2IHUA 3CLTD 2WWRA 3PFFA 4YROA 1G6Q1 2I7XA 2ZQYA 3E82A 1XNQB 1ZK0A 3WFJA 1EFPA 3PHCA 3DA8A 4GUAA 4LRSB 4NI5A 4YMSA 4F04A 2R751 3FZYA 1H2YA 1LFDB 1RJWA 1BEZA 1A76A 2WVAA 4F2WA 3LH5A 4CTOA 5FPTA 5JO0A 2HK9A 3DW3X 3ETDA 5F35A 5LOVA 4UDYX 1VYTA 4IZOA 1C14A 1HZJA 3ZHUA 2TYSB 2F67A 3T6KA 3E5RA 4F38A 2SKDA 2Y0CA 4I19A 2OVBA 4K8OA 4Q21A 1R0CA 2WUVA 2AHOA 5C7OO 1A98A 3EIHA 4UU7A 3IMCA 2VKQA 4G0YA 5HKBA 3O3MB 1PYDA 4U1RA 3LOPA 3UMVA 3MD9A 3WLKX 1CB7A 1JIVA 2WOOA 1BW9B 2MSLA 4L0QA 3D59A 4BJ5A 2YYAA 3CLRD 3IAEA 4NYJQ 3WNVA 4U7FA 1Y6JA 1ZDMA 3PC8C 4EZBA 4BB6A 1RMYA 2DXIA 2YW2A 2JKZA 3RLFA 5FOWA 5LJLA 1KI7A 2A4KA 3EIUA 3O1IC 4JITA 5DRTA 1BKSB 5GONA 4FPXA 2OZEA 1LNSA 3SAJA 3I4LA 2ATCA 2ZRHA 4DC9A 3NB0A 2QYHA 4IHJA 5EJGA 2P6UA 2C5FA 3D4PA 4HK4A 5CFOA 3I32A 2O8BB 2IYWA 1JKIA 3KV1A 4WGFA 1OX4B 1JT2A 3CWCA 4XJXA 1RM5A 4EYKA 1FZQA 1K0FA 2O1XA 2OZLB 4GQAA 1E3DA 5T4BA 5JBNA 5CT4A 3WBBA 1JXOA 3CLSC 4KFSA 1WR8A 2GKGA 3DXFA 1E3JA 4RY2A 3SFZA 3Q98A 1ZGBA 3QQPA 1B6GA 3GEGA 3RFUA 2I6XA 1FW6A 4QQKA 1NR5A 3GCWA 2Q3DA 3LXUX 4UJ3A 4D3YA 1ULBA 1YR8A 3PIRA 1JTFA 2BDTA 5D3KA 1M8KA 1SAYA 5KJFA 2P41A 1RJEA 4I6EA 4UFNA 4EPRA 1CY1A 3DUFB 3Q8KA 3WQQA 4NE2A 4FVTA 4QO7A 4MAAA 2NSLA 2BRUC 2QMOA 3GPDG 4A0QA 4HPXB 4Q1CA 5IXSA 2GT1A 4JZYA 1B8UA 4MVCA 4B80A 4CIAA 3D5QA 3QOXA 4J91A 4RYLA 3C74A 3OMLA 3ICQB 4R4JA 3UJAA 4DPKA 1N2XA 1E6CA 3JD0A 4NFHA 1G3MA 1XRMA 4DBZA 1TAUA 1IN4A 4PTYA 1GR1A 4KSCA 5DIZA 2WRZA 1IVYA 1ICIA 1E96A 4WNYA 2O3SA 2X7XA 4U9UA 1RZVA 4ZO7A 2OXFA 5E2IA 3X3HA 1U81A 5I4CA 1CS0A 2G77B 3LKVA 4FHGA 1MO3A 3OOWA 3THRA 3SYMA 3S8YA 1C8VB 4IKOA 4MW5A 2QGFA 3CF4G 3GJYA 3OFKA 2Y9MB 4TLBA 4UMVA 1H94A 1NTOA 4D98A 3KT8A 5EWJA 4CMGA 2QWXA 3ILVA 3AWIA 1P61B 3LWZA 5IC4A 3N2KB 5DDIP 4ZXFA 4A6PA 4GYYA 3ED5A 4FWBA 1Q91A 5LZ8A 1K2VN 2VJQA 3VNUA 3QVLA 1NGSA 4DR4B 5CDFA 1EP9A 5K4AA 4EECA 2IELA 3JRXA 4QGBA 5A9RA 4ZEWA 1RADA 3B48A 3NKVA 3X1XA 3UWMA 5JECA 3TUZC 3FMFA 4PYNA 4KR0A 4JLPA 1JN0A 2OEPA 4R9RA 5JFOA 1KJ8A 3VOAA 1YS6A 4A10A 1H69A 4J7XA 1NBEA 1Z4PX 3N2YA 1XTQA 4KB5A 2EWVA 4OL9A 3THWB 2PL1A 3G7SA 4MQ6A 3ZU2A 5FUQA 1DJMA 4FHCA 3FPJA 4TKMA 4P3KA 3V8PA 4KFCA 3DEFA 3JQAD 4LEIA 3DV0B 3ZE6A 3Q88A 1WVGA 3FFTA 3M4JA 3ZWKA 1IVNA 3IEKA 1GGKA 3ZU4A 5DZSA 3VPFA 5A4AA 2I9KA 4Z9BA 3IB6A 3IT1A 1JH8A 1Z28A 2VXOA 4X20A 5AKJA 1Q15A 2AOTB 3CN9A 5DULA 2D5CA 5BRJA 2Q6OA 2Q4RA 4IJ6A 1VG8A 4CMIA 1UDRA 5JS1A 4EZIA 4RJ2A 1GCUA 3OZRA 2CYBA 3TL3A 4BNGA 3E18A 4YMLA 2P4HX 2VA9A 1JT9A 1T5TA 1A9ZA 3H5IA 4B32A 3HB7A 4FFMA 4XDYA 5E7JA 1A71A 5K6RA 2ONZA 3H1GA 1OUMA 4KXLA 2EZ8A 4I55B 2DBYA 4C6RA 3R7FA 2BCGY 3E9MA 1KI6A 4AY5A 4RORA 4HT3B 1EJ0A 4X66B 4RWZA 5AKXA 2CNDA 1X1CA 4OGGA 3ROTA 1Q2UA 3S29A 3VI3B 5HZKA 4IOJA 2NVBA 1PEDA 2FPLA 2LP4Y 3JARA 6YASA 4LXIA 3AIIA 4DV3B 5J1SB 1UBSB 1DBIA 1VJGA 2K6GA 3EBOA 2GN2A 2VAVA 3A1CA 3BZUA 1U8EA 4LDJA 1G64A 4D9BA 3RH0A 4BFSA 2VDWB 2BUAA 5WRFA 4E7OA 3HXTA 3VX4A 4NBUA 1PKXA 1HL3A 1PJLA 4NLLA 1RACA 721PA 1Z6QA 1M2VA 4IZ6A 3DJYA 4RPJA 3KDSE 4OI1A 3KB2A 4D4KA 5LP6B 4TUYA 2ANCA 3GBPA 3MWEA 4GO1A 3BFKA 2OXTA 5JDIC 4BFZA 1NVXQ 1UDCA 2OY0A 2QNRA 2XUHA 1N34B 2YHAA 2JARA 1GZVA 1BVRA 1GPYA 4OY3A 1IUKA 3VTAA 4CT4B 5FA6A 3VH2A 4D5GA 4EHDA 5M5BA 1MV8A 2BH9A 3RVOA 2G07A 3R7WB 1UZLA 2PXXA 8OHMA 5AHKA 2HA0A 4AO7A 3PDCA 3L0BA 2FWPA 1WDMA 3NHBA 1ACMA 2LGJA 1MX5A 5E8RA 4KHPB 1AD2A 1OBVA 2UVQA 3JQ7B 1FMLA 1VKNA 5JADA 2PH5A 4QQ8A 1UUFA 2R6FA 3DMGA 1YQDA 3GROA 4NBSA 2W2XA 1XZKA 2IY9A 3TM4A 4ESEA 2C1XA 3RIHA 4LXXA 4JYZA 1MH9A 4HQFA 4HAUA 3FWKA 2MTBA 5EHXA 3PHIA 5K0CA 2CFCA 4OF4A 2JBHA 3L1JA 1N9KA 1X8JA 2DWCA 2QBYB 1KF0A 2J3MA 4CT5A 2G71A 3E3MA 5F5XA 2HDHA 1EIZA 2UYHA 5JZSA 1X2BA 4WNAA 2P9TA 3DV2A 3K4HA 3G5AA 4XXHA 1OPRA 1FX0A 3OLZA 1MIOA 4RCVA 5AW3A 1T9KA 3IJPA 1AVTA 2IHYA 5G2OA 5IJZA 3FHLA 3PL5A 3PT5A 2FW9A 4PRKA 2Q3FA 3R2JA 2PZLA 2A14A 5KWIA 1D07A 3GH1A 1Q77A 2ZLBA 4GLLA 5JS2A 5K0SA 2IF0A 5J2UF 1SBCA 1X7HA 2PX5A 5CLQA 3FTDA 1Y4ZA 2WTEA 5ERXA 1ULAA 1XNGA 2YMPA 2QP3A 3CNEA 3OPYI 5FNVA 3G79A 3U4DA 1Q1AA 4YP1A 1BE1A 1L5GB 2NPIA 3H86A 4O29A 2Q4DA 3PGLA 4MWZA 5HGJA 1YBAA 4RV5A 3E9RA 1ISIA 1UEXC 4LXTA 4XPZA 2HD4A 1THMA 3K05A 2NSHA 1PN3A 2V3VA 3LQ1A 2JKYA 4EYQA 2VHZA 2O2HA 4BVHA 3DOCA 1XTIA 4WX2B 1UQTA 3PDUA 2Q1XA 5LOVF 3AI2A 4NZYA 1ZP6A 5ENZA 3KQTA 3T61A 2R2AA 1UKVY 1ZG3A 3EQ2A 1I1HA 1YZGA 4GX2A 3VR1A 3DMHA 3IAAA 1F12A 2Q2QA 3F7OA 3RYIA 1PZHA 1VBMA 1MGOA 4YRFA 2B2CA 3IXMA 2FZ5A 1NYRA 3HSYA 4JVMA 3HNPA 4LVOA 2Q5IA 3CM0A 5ILQA 5MDHA 2AKAB 2H0QA 2CZGA 2ZYTX 2DT5A 5LUBA 1TZMA 4GU5A 4BBAA 1DEHA 1GRCA 2RHRA 1JR3D 1Z6AA 5D2CA 4ARZA 1TIBA 1MENA 1PS8A 5GONF 1IBRA 1E61A 1T2NA 2FE4A 1Z36A 5TR9A 1ABBA 2Z6QA 2EKLA 5DN6D 1BGXT 2EC5A 3BF7A 2CD7A 1W1UA 2N1BA 4IHJF 4MULA 4YTEA 2FWRA 2EX0A 3A7EA 1UBUS 2VFAA 1D8TA 4Q34A 1X1DA 4I3FA 1T6YA 4WW0A 5FHQA 1CZLA 4EF6A 3BBPA 1WMSA 1SUSA 1VI6A 3H9CA 3LUCA 3N0WA 3ZJVA 3WK8A 3R8CA 4FQ8A 3OU2A 4V24A 4X6UA 1EE1A 1QYDA 4RKQA 4BFLA 4DCJA 4QDOA 1ESDA 4E0BA 2X0JA 3HA7A 2FEPA 1D2RA 1JP7A 1HTTA 1ZD1A 4HRYA 3W2HA 4RV4A 2H8KA 3EZNA 4N03A 4FCTA 4UU8A 5J4HA 1ZL0A 1Z47A 4KLZA 2O0MA 1L5MA 2F6RA 1SU7A 2FSGA 3MJFA 3OLYA 1GGMA 3CTMA 4IM7A 5ALXA 3UZUA 2RAVA 4KUEA 1Q0LA 3JVEA 5EMLA 3T7SA 2BP7A 3TQCA 3M6MD 4EO9A 2YZNA 1U1IA 4WBSA 3EA5A 3QTLA 4DG9A 4HWSA 3GCZA 5C8ZA 4BU1A 4B7ZA 2IOHA 2O7RA 2VP6A 3OFJA 2QN1A 4YJHA 4MO9A 4Q4JB 4K9QA 2PGXA 4FE4A 3VR2D 4CKCB 4YWJA 1REQA 2PS3A 3EBPA 2QVCA 3RU3A 3QH4A 4J2OA 4UHJA 5K05A 5DTEA 1CDDA 2ZTSA 2H65A 3VYWA 4DMUB 4ENRA 5B3KA 1NUTA 5LKRA 3OG9A 1KGSA 5DNYB 2YN2A 3ASZA 2Q49A 3UJPA 1JYEA 3QEBZ 2CLIB 2JZCA 1SVUA 2W6PA 4MMXB 4EKNB 1O0CA 1GLNA 4GPTA 1QJ4A 2QZPA 4UOQA 4Z2AA 4NYIQ 4OAPA 2FP4A 4RYDA 4D2IA 2DX7A 4PZYA 1JVSA 1RBQA 2BZ1A 1GZ7A 4QHSA 2WM2A 2JS7A 1RSZA 4M1QA 1NVMB 1EAYA 2JFVA 2YW9A 2ZJ2A 2A9PA 3IMGA 3Q0EA 3QKIA 4HNGA 1QV7A 4DLZA 3ZY4A 2D00A 3KTFA 3UN1A 4JJEA 1ZAKA 4ZREA 4EGAA 1UP7A 2YFQA 1XPOA 1IK4A 2BFFA 4LF8B 1EJ2A 5F12A 3CZRA 3IQDB 4C5BA 1ZIDA 4Y2SA 2YJZA 3X2SA 2PD6A 3Q1LA 4CIVA 1P45A 1Y48E 2IYZA 2VXYA 3NYWA 3H8VA 3P26A 4N0MA 4PFQA 4UUOA 5EZYF 1QYWA 1BCSA 3GEEA 4WBXC 1CULC 4DRYA 5F7XA 1Y3DE 2WHPB 3SJ7A 4BAUA 3UJNA 1ID8A 5H02A 2VI5A 3O0TA 3VC3A 4TYWA 4H18A 4JJIA 4OHXA 3T3EA 3TW0A 4HXFB 5JD4A 4YALA 4L0CA 3RVRA 3SC2B 2GI4A 4BX2A 4ZCTA 3NUGA 1K4YA 4TTJA 4U4AA 3IVXA 4Y1EA 1K27A 2NTNA 4KKXB 1KEKA 4EG8A 4LYDA 3NYIA 5G0TA 2IWHA 1PX0A 3HCDA 2IXBA 3A2MA 4CLOB 1YZVA 3D7MA 4H27A 2Z8YM 4HMOA 3OWHA 3TIGA 1PGQA 2XMPA 3VRHA 3BMNB 4V0MA 1WA5A 3OOJA 4ZRNA 2QQFA 3ZI4A 2I33A 2IEDA 3OU6A 1U7WA 3EUAA 4PX9A 1COWA 1OX5A 1JDPA 1YR6A 3LSYA 1VA5A 2VF4X 5A5EA 1K8YB 3KOMA 2G6BA 3DGEC 1C30A 4II7A 2CKMA 4XCQA 3K8YA 1E59A 3TD6A 4HADA 2VAPA 3R5TA 3KYBA 1PQ4A 3QBEA 2NACA 3AUYA 2R60A 3SEFA 1CJSA 1L8AA 4ZOLA 3T7AA 2VR1A 2YH2A 3MFQA 4RM3A 1V3VA 1JIIA 2IYYA 4X8HA 5I9IA 3V00A 3VKHA 4P0QB 4MAFA 5DE3A 4HQOA 3GGDA 2NOAA 1ZA1A 3VPCA 3EF3A 1UXJA 1UXKA 3D1LA 3MUEA 1O9GA 2YVKA 3MJVA 4MQUA 4DNFA 1JQBA 1EM8B 1JZSA 4IEFB 1N2JA 5E9AA 3LO5A 3RUEA 1L4GA 2WMDA 3PVCA 2HZBA 1SC3A 1JQ3A 2V4ZA 4OHPA 3EVTA 3WJ1A 4BV2A 2XDYA 4RXTA 3FWPA 5HJ7A 1T3SA 3W6ZA 3WKAA 3KYJB 2VN8A 2QLLA 4ZVKA 5L6MB 3E4CA 1FDVA 1MA0A 2I2WA 1QKJA 4X60A 4AKIA 3EXHB 4UVDA 5G4KA 2VSYA 2YWFA 1LJUA 1ZOOA 3L05A 3PU6A 3T0FA 3U31A 4GF5A 4E6PA 1F2DA 1ULHA 1AM4D 5GINE 2XE6A 2HTFA 1UP4A 3M6XA 1BQ4A 4DSNA 1VL6A 1CP3A 1MAUA 3KR0A 4H0CA 1C7FA 5U4QA 4C0SA 1RAEA 5IVKA 3WGIA 3HEMA 4K46A 3T35A 2A5JA 3TWOA 4DWOA 3DLPX 4IIUA 3Q6IA 4P35A 2C03A 4BMZA 5FA5A 3MPOA 4FOTA 2PL9A 4MQFA 2RHJA 4LYAA 4BDSA 3TDKA 4YAKA 3ESDA 3HR4A 2N47A 5LBUA 5EJAA 5JCJD 1Z6XA 3MGGA 5B36A 4KQ1A 4BP8A 3WLIA 1WV1A 4JNKA 1B1CA 2WWYA 2C57A 1MX9A 2ESRA 3PJEA 3QWAA 3GFQA 4NPHA 2VH5R 4J9UE 2VXCA 5IFKA 4PM4A 2Y1LA 1K3UB 3L6EA 1XR3A 1CY2A 1EA7A 2P5TB 3NALA 3VU8A 4EY6A 3G5UA 3DMRA 4KITB 4TN5A 2Q2NA 3DYVA 4HJRA 1DCKA 2VJNA 2PJUA 3GLHE 1FU7A 5GQSA 3WDSA 4RTRA 1KMHA 1LI7A 4A0RA 2XCSB 1U28C 5BPHA 2FMTA 2BCEA 3NIWA 3R0VA 3WL5A 5CG1A 2ONYA 3SHWA 4ZAFA 1UFVA 4XGRA 1TNDA 1D2EA 3PEYA 4RUKA 5TARA 3PENA 3P4UA 5I45A 1S3FA 3FTNA 1WV0A 3CCCA 3RUPA 1KJIA 2BBWA 2PZ8A 4P86A 3UB2A 4Z4HA 1A2KC 1QDEA 4LKOA 3TQOA 3VU9A 1G4AE 1XLWA 2AJ8A 1E6EA 4MA0A 4XASA 2BSQA 1A9YA 2CBGA 5TX7A 2XUKA 3JTMA 5FNVF 1ST2A 1W88A 3ZC3A 3ZYCA 1PZEA 1MEEA 3C4JA 5H1YA 5L7YA 4DUGA 1XVLA 4LQCA 1X1QA 5I8ZA 4ESHA 2BBTA 2JH8A 2VDQB 3ZBUA 3JQPA 5IJ9A 5L9AA 1G6HA 2IX9A 1JHXA 1UKEA 1YQUA 4XWYA 5CB6A 1IXYA 4ZKDA 3HJRA 4C78A 4UEWA 1Z2PX 2W2VA 3WL8A 4F60A 5C8DA 1T3TA 4GIBA 2EQ5A 5EZ6B 2XF8A 4DV2B 1JFSA 1L1QA 4RC9A 1NBMD 1P62B 3D6UA 2I2XB 4I1VA 1OFUA 4D26A 1VMEA 4TMKA 3HH8A 2BL4A 4FOSA 4L9AA 5I7AA 1S2DA 2P69A 1II9A 4UW9A 3AIMA 2EYUA 3WLSA 5K0FA 4DA7A 4E2XA 2H07A 4M1ZA 2WI8A 2J6BA 4Q9HA 4JT4A 1SHZA 1K8RA 1NJSA 1RI2A 3CH6A 1JDTA 3KO8A 1UBEA 4AY3A 4XWOA 2BW0A 2C78A 2FX5A 4YR7A 1KDPA 1P29A 4H7JA 2BGWA 2XZLA 1JRLA 5BVHA 3UMRA 4DV6B 5EFZA 2L18A 2NNWB 4XR9A 2VRWA 3C3PA 2EBWA 4MS4A 1ISGA 4X3CA 5A71A 4HCJA 1QBGA 1L5VA 4PSKA 1G8GA 2HC9A 3DHVA 1L7RA 2B8EA 3LPLA 2ZYSA 3SC3A 3UWPA 2NAFA 4OATA 3SBXA 4YK7A 2YQ4A 521PA 2OO3A 2WF7A 2Q3LA 4S1VA 4I1UA 3VDMA 1M2NA 1NBIA 1U9ZA 4OHVA 5I9BA 4DMRA 2OUIA 3HBLA 1QV6A 5JZVA 4ZTZB 4PLWA 4XM2A 4M0UA 2XMBA 3EN0A 3LC0A 4V0RA 4B87A 1DFHA 4D9JA 1S2OA 2XCTB 2HQBA 1KJWA 3DVSX 3KEGA 4N12A 4PCAA 4V0NA 5ILOA 4RELA 1L5SA 2IGBA 1TJPB 2GJSA 3EMKA 2PYZA 4RIFA 1YR2A 1IBCA 4FYKA 2E4ZA 4F9GA 1J56A 1RMQA 2NUPA 2WE7A 3KR1A 4GDMA 4MVJA 4XJSA 5GZ6A 3L8EA 2RONA 3DXZA 3LQ4A 2YXBA 3M5DA 4IRXA 3PXAA 3RUDA 3LZDA 1GA1A 1KOGA 2AVNA 1X8KA 3BTSA 5GVRA 4B3BA 2W6OA 1KYYA 2QF7A 1WZ2A 3VTZA 3BYZA 3ELBA 3SX4A 2DFVA 2J3QA 1L4HA 3U7GA 3HADA 1YIOA 4HDRB 2V0CA 4MKZA 2G8NA 1I6WA 4XGNA 1VMIA 4J2TA 4GNRA 3LC2O 1XV5A 2BI4A 3BK7A 2HJWA 3EGDA 4CUKA 5JJLA 1G6OA 2W2NA 3BD6A 1TM7E 1CIVA 4M0CA 4YS6A 3UH0A 3F9IA 2HIHA 4ENQA 3CPHA 5THXA 1Z2OX 3WWYA 2WJ4A 4PIMA 4QM6A 1JWAB 1MN6A 5D7BA 1LFAA 1KJQA 3KNZA 5LWQA 2A1TR 3Q3HA 3B53X 3SVTA 3UTDA 3DZJA 3A9UA 3EULA 1E2UA 2PUTA 3HBMA 3DFMA 3K0BA 3KZ1E 5FF9A 3MT8A 1HE5A 3RYTC 4JQCA 5G4KB 1XQYA 4Y0VA 4NHOA 2MINA 3EGOA 4HH0A 8ATCA 1UP6A 5FX2A 1EMDA 1UQRA 1FLVA 1EHYA 3QBVA 1NLUA 1P3Y1 4J7CA 4O0LA 4UEQA 2Z1NA 1D2HA 2G70A 3QOWA 3ROKA 3IUQA 1BIFA 4Z1MA 4Q3EA 1VDZA 2HWWA 4BXOB 2D0PB 2EATA 2IVFA 4FC6A 2B92A 1SVIA 4HEQA 4ZGGA 4G4IA 4ZYUA 4FNMA 5CW1A 3TRHA 4KVAA 4DXAA 3AJ8A 1K6JA 2ECKA 4HEHA 4EUFA 5DI9A 2FKAA 2ZI4A 1DVRA 1PP4A 1URPA 2GARA 3FVWA 1B42A 3N07A 2XLCA 4W7HA 5A7FA 5CA0B 1GQRA 5KIAA 3GLUA 1MU0A 3HCOA 4J8PA 4KQWA 5FL3A 2BWJA 3ETJA 4ATNA 2ZKIA 1P1FA 3WBKA 1Y33E 3OEHA 1ECFA 4E15A 5IDWA 4ZVOA 5HRCA 3NU1A 3A14A 3BXGA 1YRLA 2M9MA 2L17A 2HRCA 1NYQA 4DIUA 3B1FA 4W8HA 1NYLA 2CXXA 4ARVA 3MWLA 2YBDA 3IPRA 4M1WA 2IBSA 4EZEA 3EW7A 2ECFA 3S5UA 1H23A 2LCQA 1HQCA 4I5EA 1EUQA 2FPGA 2VPYA 1GSOA 3VPGA 5BMVF 3HJGA 3E0QA 3CVJA 3OP1A 3CEPB 4NJMA 1W4RA 3SYTA 2F4NA 2TSYB 4DMGA 5AVSA 2QLJA 5CB4A 2JAOA 3DOUA 3ED1A 1F4VA 2WAMA 3SEQA 5JG7A 3CLSD 4FR2A 3A25A 1LW7A 3C1AA 1SA0A 3CX6A 2DGDA 3I09A 1XTJA 4FHDA 1OROA 1NJ1A 1HPLA 3I9V1 3TUIC 4BN4A 3AF5A 4MP3A 2Y0PA 1ZH4A 3C87A 4CF5A 3IVGA 1SJ9A 4LZWA 4WY2A 1GDHA 2PT9A 3GX1A 6Q21A 1GL6A 2R8EA 3GT3A 3TLGB 5JJ5A 4OK5A 2BGIA 1GPLA 1EZZA 2ZPUA 4KGVA 5TEWA 4PLZA 3RFTA 2ZROA 1JSRA 4NCIA 2CCGA 3X1KA 1U5CA 4EKEA 5JAIA 3OZAA 1EUCB 4ZOLF 4ZOAA 2HIAA 3FSEA 2D54A 4PX2A 5AW5A 3LP5A 5LYYA 3ZGXA 5JNLA 2FR8C 3KVVA 4M86A 5HVNA 1M66A 2FW0A 1FYWA 1H6BA 2JB9A 4QJ4A 3V8EA 3D02A 3L46A 2QE7A 1UK7A 1GZ5A 2J9XB 4F84A 4R5MA 1WJGA 2ZYGA 3F1KA 1E69A 3VKGA 4RMNA 3JAMA 4U3JB 2OHJA 4HGOA 3AG6A 3G8YA 4R8KA 1C7EA 1WHSB 2VJMA 4NBRA 1EK5A 3QFFA 1LSSA