4BZZA

Complete crystal structure of carboxylesterase cest-2923 from lactobacillus plantarum wcfs1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
275
structure length
275
Chain Sequence
b'MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE/ESTERASE
molecule tags Hydrolase
source organism Lactobacillus plantarum
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
total genus 88
structure length 275
sequence length 275
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bzzA00
4QDUA 4LIPD 3NWOA 1T4MA 2PL5A 2AXEA 2QM0A 1N8SA 5EHQA 1X70A 4CCYA 4BRSA 4UFNA 2HA7A 3QYJA 5EIHA 4BVKA 2PUHA 1TKRA 2XMGA 3DD5A 3E1GA 5CXXA 3DL4A 2CJPA 2GZSA 3PDCA 4Q3LA 3LIIA 1NX9A 3WJ1A 3LCRA 1O6FA 3IA2A 2DQZA 2HU7A 3FLAA 2PSDA 3I6ZA 5AO9A 2Z8XA 3QZUA 5EFZA 1QTRA 2JGFA 1XZLA 1P0IA 2EEPA 1QZ3A 5JZBA 1UOQA 5HZGA 5LKAA 3A6ZA 1BCSA 4GBGA 2WTMA 3SX4A 1Z68A 4KE6A 1ZGBA 4XJVA 5JD5A 1Y7HA 3QVMA 4A23A 1WHTA 1ORWA 3AILA 3AFIA 3I1YA 1ZIYA 5KWJA 2BGNA 4JEIA 3WQHA 4TGLA 2ZVDA 4AMYA 1RP1A 3R3YA 2GYUA 2C58A 5CT8A 4QNNA 3OM8A 1CQWA 5F4ZA 1LLFA 5ALQA 3R3WA 3PUHA 2WM2A 1QIGA 1MNAA 5SYMA 1YCDA 2RHTA 3WZMA 4U2FA 3W04A 1CUYA 4B84A 1XQWA 1JJIA 4ZV9A 2YYSA 2XQJA 2O7VA 4W1QA 2WUEA 4KE8A 3WKDA 3WZLA 5FLKA 4AMZA 4M0MA 3ZV7A 1NU8A 1JJFA 2EDAA 3F9CA 4HXGA 1J1IA 4H7FA 4P93A 4DMHA 5ALWA 4IH1A 2O7RA 3STWA 4BTLA 3C43A 5FV4A 5T4BA 1PV1A 5JZ9A 7YASA 3WK9A 3HI4A 1CVLA 2OGZA 5EI5A 1JMYA 4B85A 1ZD3A 4CFSA 3TGLA 3AZOA 4W1SA 3WJ2A 4N8DA 2QVBA 4YASA 2W22A 2QKYA 2WIJA 1DX4A 4C4YA 5CURA 2HFKA 5K3DA 5ALIA 1UOPA 4EUSA 2H9YA 3IBTA 2HIHA 1WPRA 5DTJA 3V1NA 3ICWA 3DOIA 1A8QA 1CRLA 4GHWA 2O2GA 3IUQA 4ARBA 2AJLI 3S8YA 5HQ3A 1IVYA 2PU5A 2XLCA 1WB4A 2I3DA 3FVRA 5JD6A 2WIDA 4MQLA 5ALHA 1FFDA 3KDAA 3BIXA 4OSEA 2HDWA 4X90A 2WFMA 3W05A 5DYTA 3WK5A 1KEZA 3V1KA 4H77A 3B5EA 3IUJA 1W6RA 4KAJA 2OGSA 4IO0A 3F8SA 1CR6A 4YX9A 4ITVA 1VE6A 3AUKA 5CRIA 5JZSA 4U2EA 4AN0A 4BZZA 5AICA 4B9AA 5T4HA 1QJ4A 1ZD2P 5IVDA 3IIIA 3DNMA 3BJRA 2QUAA 3F96A 2X76A 4BCCA 3HLKA 5JAOA 1XLUA 3W06A 3BWXA 5CXUA 1XZFA 1W4LA 1MX9A 2PKYX 4BC1A 1GGVA 3HRHA 4L72A 2H7YA 5BV7A 1UK7A 5EHNA 5EIAA 4KAFA 3D5EA 2DFPA 1Q83A 1CUXA 3H19A 5K5EA 2OAEA 2XLBA 5AP9A 1EH5A 1ZJ4A 4EBBA 1LPBB 3DQZA 1YASA 2HU5A 1EK2A 3L1HA 5C8VA 1YS2X 4GECA 2WUDA 5C81A 1XZIA 1G5FA 5ALTA 3HYSA 1XRMA 1H22A 4TPKA 1XLWA 1BN6A 2PPLA 2X8BA 3VVMA 4EZIA 3C87A 2ZJ6A 2ZJFA 1SCQA 1XZMA 4UUQA 4EHBA 2I03A 4FHZA 3QITA 2QR5A 1N5MA 4EY7A 4F5ZA 3KSRA 1WCYA 4LYEA 1JU4A 2JEZA 2OLEA 2GBGA 2IIVA 3EQ7A 3WIBA 3I2KA 1DINA 4UHFA 5DNUA 4F21A 4MYSA 5I7UA 3A2LA 5IVIA 4JH0A 5FUMA 4Y2RA 4GDMA 3ESAA 1YS1X 5AKYA 3B3QA 4Y2YA 4KAAA 1QIDA 3PE6A 2PBLA 1LZKA 2VQ6A 3EQ9A 5CT6A 2Q0XA 1CUVA 4OB6A 4G4IA 4EY5A 1JJBA 1BEEA 3G9ZA 1ACJA 5CW2A 1LNSA 4U2BA 1U8EA 4UHHA 4KRYA 4CG3A 4QDOA 2Y2VA 2OCIA 4IQ4A 3QM1A 4U2DA 4PSCA 1G4HA 5HF8A 1USWA 2X5XA 2BKLA 3OURA 4X94A 3H2IA 5IKXA 3QMMA 4MEBA 5CBKA 3H0CA 1VA5A 3WK6A 2B9VA 3FYUC 5ALSA 4Q05A 3FNBA 2HFJA 3QMWA 3V9AA 4A5SA 3DKKA 1GQSA 1QIIA 1R88A 4MJ3A 1MN6A 2Y6VA 4DNOA 3IDAA 4HZGA 3L1IA 3MUOA 4X00A 2V96A 2XMZA 2YXPX 4DTCA 3WL6A 1CQZA 4ARAA 4QDXA 5AK4A 3GBSA 4C89A 5ALNA 5HF5A 2JGJA 3FLBA 3V1MA 1ZOIA 3T4UA 4DNPA 4CCYB 3G0CA 5AH0A 4BB0A 1XROA 4YPVA 3LS2A 6YASA 5AI9A 3EQ8A 3CN9A 1ODCA 4Z49A 3JW8A 3GROA 5DWDA 4PF1A 3TJMA 5ALKA 4FLEA 2VJCA 3DYVA 4X6YA 4ZGBA 2WG1A 2QRUA 4AZ3A 4O08A 1CUDA 3EF3A 4BZWA 1CUAA 3HABA 2V98A 2HM7A 4RE6A 5HQ3B 5EGNA 3LP5A 3FSGA 1XQYA 2JEYA 5DYYA 4GW3A 1LZLA 1FFCA 2I78A 4KACA 3VKFA 2ORYA 1YAHA 1WM1A 1EB8A 4H7DA 5ESRA 5K3BA 3WWOA 4WY8A 4C88A 3ZPXA 4MXDA 4L3WA 4Y7DA 2CUTA 3ESBA 4B82A 2UZ0A 1UK8A 1K4YA 1C4XA 2GZRA 3GA7A 4UFOA 3PF8A 5BWBA 4WFJA 5AKKA 5JAPA 3WK7A 3LLCA 1W52X 3STXA 2HA4A 1WB6A 1LPPA 1A8SA 2RI6A 4NMWA 1N5RA 3ED1A 1AZWA 4UBOA 2QJRA 5BWCA 3H18A 3PICA 3ANSA 2HRQA 5DNVA 2H7CA 2ZYHA 3EIOA 3BXPA 4BE4A 3FYUB 3NUZA 3PUIA 4WY5A 1ODTC 5K3AA 2BAGA 1BU8A 3Q0TA 1JT2A 1QFSA 3AZPA 3H2JA 4UBLA 2VTVA 4OB8A 4PNZA 1LBSA 1LGYA 3F97A 2ZYIA 2OAGA 4KEAA 4QA9A 1TIBA 5CH3A 4K2AA 1EXWA 1K63A 1EX9A 2Z3WA 1YB7A 1GQRA 4UPDA 1IZ8A 5AKJA 4QEKA 2XB6A 1E8DA 1MTZA 4CIAA 1LBTA 1T2NA 1YAJA 1CLEA 3WA6A 1QGED 3GZJA 3WK4A 4IH4A 5DTIA 2WFLA 3CN7A 1H2XA 4YK7A 3GELA 5ALPA 4PSDA 5ALXA 1SCIA 1YR2A 4B83A 1TCCA 3L1JA 4F0JA 1MAHA 2OCKA 1CUJA 2DQYA 2EDCA 4C6HA 1W1IA 4E46A 1SC9A 1J06A 2CB9A 2WUGA 1FSSA 2OGTA 1XZHA 1QONA 1HQDA 3PI6A 1VZ2A 5ALYA 4N5HX 4H7IA 5HK9A 3FSGD 4WDQA 3G7NA 3DLTA 3WYNA 1E8MA 2XMRA 2CKMA 2PSHA 2HA0A 3DS8A 5JASA 5AKIA 1G66A 1XRLA 2E3JA 1SFRA 1RYYA 1AKNA 4N8EA 1TRHA 5JATA 1JU3A 2HA5A 4B81A 4UHEA 2AJCA 4H7KA 4OYYA 5LZ8A 4G8DA 4BRZA 4J3JA 2XMCA 3AZQA 4J0GA 5AM4A 4NS4A 4G5XA 4FDMA 1XZJA 1KU0A 4D9JA 4GLBA 4Q3KA 5AOBA 2XUJA 2CMFA 1L7QA 4B9EA 5SYNA 3I2HA 4C01A 4N5IX 5AIBA 4RGYA 1XZEA 1K5PA 1LPAB 3WL8A 5C8ZA 1BEZA 3WKCA 3I2FA 1A7UA 4Y2XA 1ZICA 3OPMA 4UBKA 3IURA 4FFVA 5A71A 1DX6A 4F60A 1EK1A 1W75A 2QXUA 4H7EA 3U0VA 1ETHA 2O2HA 4I19A 3W9UA 3SWWA 1CUUA 1GKLA 2WG0A 3O9VA 1O6GA 3C70A 1Y37A 3JWEA 3O4IA 1TQHA 4PO3X 4ZRDA 4ZV7A 2BUAA 5AI5A 1AUOA 5AI4A 1WHSA 3A2NA 1A88A 3QPAA 2WHQA 4GWLA 2JBWA 4UHDA 3T52A 3I1IA 2C7BA 1CIJA 5FPPA 2G4LA 1MPXA 4BATA 1FJ2A 3H2GA 3G02A 2J4CA 3FOBA 1P0MA 3BF7A 4EY4A 1VOTA 3WI7A 1VJ5A 5CH5A 1ZI6A 3A2MA 4AXBA 1ODSA 3IUNA 4LYDA 4FOLA 2VSQA 3DYIA 2WJ4A 2HL6A 2XUKA 5T4EA 2G63A 1P0PA 4MEAA 4GXNA 5ALFA 4AZ0A 2QTBA 2ZSHA 1ZJ5A 1L7AA 3JYHA 4B0OA 5DNWA 4IHAA 1SCKA 2JF0A 4J0IA 4AX4A 2YH2A 4HXFB 4S0XA 1MT3A 5E4YA 4L0CA 2QJWA 1MJ5A 4X7BA 1GXSA 5IVHA 4DLNA 4G9EA 3DCNA 4PSUA 4PQEA 1R4ZA 1M33A 2GYWA 4UFPA 3AIKA 5AK5A 1YA4A 2B61A 2DR0A 3H2HA 1UXOA 4QZVA 1PJAA 2VJAA 1QIEA 3UUEA 3A70A 4W1PA 5K3CA 1UKCA 2VAVA 1MNQA 3O4HA 3STVA 2WHRA 2OG1A 3G0GA 1KU6A 4AO6A 4FFWA 3WWDA 1CEXA 1X2EA 3VJLA 1H2YA 4E15A 1IUNA 2XUGA 4OUKX 2WTNA 4BP9A 4QLOA 2OXEA 1CUEA 2WU3A 4DIUA 2DHDA 4LXHA 4DNQA 1DTEA 3BDIA 4NZZA 5JALA 1THGA 2IX9A 2WILA 4X3CA 5JADA 2XQIA 4EB0A 3STYA 5FOQA 4GEGA 4ZI5A 4FTWA 5KBYA 1DWOA 3R3UA 1NU6A 4WDRA 2OCGA 4AO7A 1UK9A 4MWSA 2RGUA 1ZD4A 3C45A 4KR0A 1XRQA 1QLWA 4EY6A 3IUMA 3QH4A 4BAZA 1QIMA 2XMBA 5K3EA 4CG2A 5JAUA 5FP0A 3WKBA 1AX9A 3C5VA 3O4GA 5A2GA 3R41A 1EDDA 1MX1A 3FAKA 3RM3A 3RK4A 4OD0A 3O0DA 2IITA 3G0BA 1XRPA 2GBCA 5CTAA 3Q8WA 1Q84A 3FYUA 3WKEA 5JAHA 5ALVA 5IH7A 3I28A 2NW6A 4B80A 4BVLA 3DL7A 5A7HA 1XLVA 1XZDA 3G0IA 2BGRA 2ZYSA 4LXGA 3V1LA 1UKAA 1XKTA 4HXEB 1ISPA 3FLEA 1EINA 1J07A 3ZLUA 4DYHA 5ALDA 5D3ZA 3IVMA 1HPLA 4BCDA 4MWTA 3WIOA 4J7AA 1F0PA 3P2MA 4J0DA 2QT9A 3YASA 3QPDA 1VE7A 1ZD5A 4Y2PA 3OC0A 4ZWNA 2WIKA 3W9BA 2AJDA 2HA2A 5EHZA 1GPKA 5ALMA 4RE5A 5HF9A 1EHYA 5HKBA 4KJXA 2XUIA 2RIPA 1XZAA 3MUNA 3FYTA 2Z8ZA 2ES4A 3H17A 2B4KA 1QIJA 1L7RA 2XUHA 2VEOA 5LYYA 5ALEA 1DQYA 5FXMA 4DNFA 5AI0A 4G4GA 1H2ZA 3D7RA 1GT6A 4EA6A 1XKLA 4FWBA 2FJ0A 3WYDA 3D4LA 2RAUA 1UZAA 2V9ZA 2XUDA 5AKLA 2WG2A 3N0TA 4RNCA 4QLAA 5LKRA 5AHXA 4DSZA 4P08A 1EVEA 2WFZA 3OOSA 4W63A 4AB1A 2ACEA 3D2BA 1XZBA 2DCMA 4OCZA 5LZ2A 1SOMA 1WB5A 1ZI9A 3D2AA 2R11A 1EVQA 4BCBA 4H7HA 3H2KA 1I6WA 2ECFA 2PVSA 4M0FA 4WCVA 1U4NA 2C4HA 4IH9A 2QUBA 4B0PA 3X3HA 2XUAA 1VA4A 1D07A 2DSNA 3C6YA 1XZCA 4J0CA 4WFKA 4U2GA 3C8DA 2FX5A 4DSAA 2P8SA 1B6GA 3D0KA 4K5QA 4W1RA 2J3DA 3OTQA 3C6BA 3KXPA 1TAHA 1H2WA 3H04A 1ZIXA 3BJMA 5FRDA 4BP8A 1IUOA 4KYVA 3VISA 5HFAA 4H35A 2XQKA 4RPCA 1FFEA 1CUHA 3UUFA 1UT6A 4N8SA 3FCYA 2BFNA 4B7ZA 4JUIA 2HA3A 2K2QB 2XMQA 4JYPA 4QWMA 1R9MA 4J0JA 1GPLA 1GKKA 2PX6A 1EDEA 5DYWA 4X95A 1CUFA 4BAUA 4AQDA 3CXUA 2PUJA 3KOOA 5LZ9A 1DU4A 4FBLA 2QXTA 1UWCA 2XQFA 1OCEA 4X6XA 1E3QA 4FKBA 3STTA 2GYVA 3M83A 3F67A 4G4JA 3K2IA 2C0PA 3HC7A 2JGIA 1CUBA 1EDBA 3DDUA 5AM2A 1BN7A 3R0VA 4UHBA 1AGYA 2HU8A 1DQZA 3DJYA 2WLSA 4X71A 2Z3ZA 2XQGA 5JANA 4PW0A 3R40A 2HA6A 3G9XA 4BE9A 4X6UA 1XZKA 3HACA 5CT9A 5JYCA 4OPMA 3M82A 2XE4A 5CMLA 4FLMA 1CUGA 3N2ZB 3K9BA 4G8CA 3GFFA 4GI1A 2FUKA 4I3FA 2XUOA 2WSLA 4Y2QA 1WOMA 5CH8A 3BE8A 4B6GA 3ESCA 1VKHA 2HADA 5LZ7A 3OG9A 4OU4A 5FPQA 4CCWA 2XT0A 4HRXA 1P0QA 1DT3A 1VZ3A 2ACKA 1CUCA 4X91A 4KE9A 2XUFA 5AIAA 5J3JA 4QWWA 2Y6UA 1IUPA 4OB7A 2OPHA 3WL7A 5AKXA 4EY8A 5T4FA 1XRRA 3PF9A 2QMQA 4Y2TA 4QDTA 4BDSA 4BTVA 4MYDA 3KWJA 3O9MA 4BVJA 1CV2A 1E5TA 2PSJA 1QO7A 2G5PA 3LIPA 2RONA 5JARA 2Z5GA 4JYMA 4P9NA 1Q0RA 1BE0A 3B12A 3DEAA 4OYLA 4H7JA 5JD4A 4ETWA 2WHPA 5ALJA 2J4FA 4Q3OA 2BJHA 4XIIA 4KRXA 2H1IA 4DGQA 1A8UA 1H23A 1R3DA 5FDFA 3NOXA 4CG1A 2XMSA 4V2IA 2WUFA 5AKGA 2VF2A 2VJDA 5EHXA 2DHCA 1HDEA 4Y2VA 5LP1A 5A62A 4CIBA 1UOOA 5YASA 4Q1VA 1R50A 5HKAA 4BAGA 1LPOA 1TK3A 2FJPA 4E14A 3WWPA 4I4CA 2WFLB 4LXIA 4XX1A 3C8HA 1TCAA 1U65A 3BL8A 3G0DA 5AM3A 4AO8A 2CEKA 1PFQA 3RKSA 3I6YA 3DOHA 1CUWA 2ZYRA 4HVTA 1F0NA 4INZA 3WMRA 4ROTA 4J0KA 4OU5A 1C7IA 4UBJA 2Y1KA 5AM0A 1JI3A 5AM5A 1CUIA 5AK6A 5I8PA 4TVKA 3AIOA 3NGMA 4WJLA 1F8UA 1HBJA 3FCXA 3ICVA 3WLAA 2O2IA 3AJAA 2VT7A 1EA5A 2R8BA 4G1FA 1K6EA 4W9RA 3WK8A 3ZLTA 1QIKA 1FFAA 5ALRA 3R3XA 3WWCA 4BBZA 4XWGA 4A16A 3M3DA 1AQLA 5D3KA 4FBMA 3K6KA 4H0CA 3C5WP 2BUBA 2JGLA 3R3ZA 1J2EA 2D5LA 2I3ZA 5ISMA 1HKHA 4H18A 3I2GA 1LPMA 5K3FB 3FBWA 5AOCA 4BC0A 3R3VA 1S8OA 3I6MA 3F98A 1QIHA 3CCCA 5IVKA 4UBMA 3TEJA 4X92A 3H1AA 2WJ3A 4AN1A 5ALZA 4Q34A 1RWQA 3EBLA 3H1BA 3WL5A 1DT5A 3ESDA 2H7XA 2WQZA 4MQMA 3E3AA 3WWEA 5C8XA 3VVLA 2VA9A 2HRRA 3BF8A 1HL7A 1BCRA 3O4JA 1Y7IA 2PSEA 1YB6A 1W76A 2AJBA 2JGEA 2QZPA 5AJHA 1WPXA 4DMKA 5AM1A 2CBGA 1MAAA 4ZREA 1QIFA 3BDVA 3SC2A 3KWFA 2GBIA 1OILA 2BUCA 1IZ7A 2BCEA 1AC5A 1VLQA 3MGAA 1IMJA 4HTAA 3GUUA 1ZGCA 2WIFA 3E0XA 5E2IA 4DMCA 4Q82A 4G9GA 1QE3A 3DKRA 3SK0A 1BS9A 5EIEA 3HEAA 3QPCA 2WIGA 1QTIA 3C6XA 3E4DA 1B41A 2WKWA 2XUPA 5A6VA 3W2TA 3V48A 3D59A 4J03A 1BRTA 1JFRA 4UBNA 3WKAA 1MX5A 3AIMA 4Y2JA 1THTA 4X93A 3G8YA 4ZXFA 2HHAA 5FKJA 4UHCA 2QOEA 3VDXA 1U2EA 4K6KA 4BYMA 1CUZA 5E4TA 3CCBA 1DWPA 1AMNA 3I2IA 1CFJA 1GZ7A 2OQIA 1XZGA 1UFOA 5KREA 2CZQA 2ROQA 4FNGA 1E8NA 1JMKC 3FWHA 1ZI8A 2VJBA 4LHEA 4G8BA 2VATA 1MO2A 1N1MA 2C5GA 3C6ZA 1GPNA 5AKEA 1Q0ZA 2VAXA 5HK8A 5K3FA 2WHPB 2GBFA 3VJMA 4C87A 5C7YA 4FNMA 2JIDA 1E66A 4X97A 1ORVA 3VXKA 4BDTA 2XI4A 1YSCA 4U2CA 2OCLA 2YASA 4J0HA 4K6GA 2OQVA 1XQXA 2LIPA 2DHEA 5ALGA 1K8QA 1QFMA 1UKBA 2QS9A 5HCUA 2ONCA 5LZ5A 5D6OA 3HZOA 3RARA 5AOAA 5AI6A 5CT5A 3HSSA 2C0QA 5BOVA 2V97A 3ILSA 1HLGA 1F6WA 4LKOA 5AI8A 4HS9A 3TRDA 2XMDA 3HJUA 3ZI7A 2JGKA 2VT6A 4FLFA 2ZJ7A 4JNCA 4X85A 5CT4A 1QOZA 5KWIA 4XVCA 4C4ZA 1BROA 5E4JA 4L9AA 4FMPA 2C5FA 1OXMA 4WFIA 5AK3A 1R9NA 3STUA 3ZLVA 2XUQA 3QBJA 3G9UA 2XDWA 3D3NA 4HAIA 4DMFA 1FFBA 1R1DA 4PV7A 4KE7A 3PFBA 3QMVA 5LZ4A 3S2ZA 3FVTA 3AINA 2W6CX 2Y2UA 5D7BA 1CUSA 5AKZA 5A7GA 3MVEA 4DM7A 1UK6A 1VXOA 3U1TA 1EB9A 2JGMA 1MU0A 4P92A 3I2JA 3VJKA 4HRYA 3ZWQA 1XRNA 1CPYA 3HXKA 5AKHA 4QDZA 3WA7A 2AJ8A 2PU7A 1YA8A 5ALUA 3IULA 5A7FA 4UBIA 1C7JA 3ANTA 4QE3A 1LPNA 1VXRA 2ZSIA 2PSFA 3KD2A 5LIPA 3M81A 1XFDA 2RHWA 5ALOA 4Y2SA 5DJ5A 5I9IA 4Y9SA 1LPSA 1XQVA 2J3QA 5HF6A 1TCBA 3O95A 1AURA 5LLSA 1X2BA 1E89A 5ALLA 1JKMA 1ACLA 4CI9A 3UMJA 2B20A 4E11A 1EI9A 2WJ6A 5JIBA 4K6HA 2PM8A 3IB3A 4C4XA 1G42A 3PFCA 2G5TA 3G9TA 1QO9A 5HFNA 3BIWA 4M0EA 5DLPA 2WU4A 5H3HA 4Y2UA 4NVRA 2D0DA 3RLIA 1DWQA 3D2CA
chains in the Genus database with same CATH superfamily
1H69A 1U99A 2NACA 5D1NA 1XJWA 2H92A 1K7EB 1NURA 4KNYA 1SK8A 2VKQA 1T4MA 3GOHA 1AKUA 2AXEA 1KI3A 4UVEA 3D31A 2QM0A 3O8LA 1SB8A 4YAKA 5BNTA 4CIWA 3ZV6A 5ERGB 1VJRA 4CCYA 1A5BB 3UW3A 1Q7GA 3TBKA 3MXOA 5EIHA 4PYJA 2C4VA 4AIRA 4BVKA 3TAHA 3EVGA 1XXHA 5CVDA 4GZLA 3W78A 4ZOLA 1GA1A 1X7ZA 1X1TA 1HFKA 4KQ1A 4MHOA 1U2DA 3UJ3X 6PFKA 2EIXA 1Z7EA 2XMGA 3GAAA 4MW9A 4NOMA 1VG8A 2OGWA 1GCOA 5B6IA 3PDCA 4BBJA 2OD7A 5DRYA 1GTG1 4Q1EA 2ARKA 2DBZA 5LOVB 1GLNA 2R5NA 4GKAA 1ULUA 4R9SA 3UGTA 5E2BA 1DE0A 3RR2A 3FKQA 2C5LA 2LCFA 5B3LA 5B3AA 2I2XB 3NONA 2QRGA 4HMOA 4ER6A 2E89A 1WF3A 1O6FA 1FE8A 3IA2A 1M7HA 4N0QA 4HP8A 2QLBA 4KGDA 5J23A 1U63A 1DIBA 1E3TA 4PCLA 4WZ6A 3THOA 3S2SA 5CEFA 5JJCA 4PQGA 3J81k 4TYNA 1X7XA 2CXNA 3G6KA 2J32A 4F96A 5JLJA 3CM0A 3NHMA 2AT1A 1MA3A 1PL8A 3L02A 4NDZA 4E51A 2YWDA 3FBTA 1RKBA 2Z8XA 2ZT7A 3MA0A 2F8SA 4M1ZA 1BE6A 1SXIA 1V7PC 4ZOEA 3LX8A 4DLSA 3W5AA 3A1EA 1P3Y1 2JGFA 2OBYA 3MBKA 3TIXB 5F1OA 5DBOA 4ZMRA 5JDIC 1XZLA 1EM6A 4FONA 4D3DA 4PLPA 5EWMB 5B1EA 2QPLA 3GUVA 1T13A 1UOQA 4B87A 5HZGA 1TNDA 2R84A 4OI1A 2XCIA 3QXCA 3I6IA 2WTMA 4KLCA 2IV3A 3RVMA 2ZS9A 2GKGA 4A0SA 2YJNA 2WV9A 1Z68A 2ZTMA 2PH5A 4KE6A 3KTOA 3ZWKA 3EEOA 3GZNA 1V8BA 3C4QA 3KL2A 3R0IA 4OJMX 3QVMA 1FXUA 4A23A 3C6MA 3FIUA 2P27A 3AF3A 4D0LB 3A3PA 3WDSA 2B8NA 4LDAA 5KHLB 5KWJA 5FTKA 1ESEA 1L7PA 2UXCB 3QVVA 3QYAA 4O2BF 4TGLA 4AMYA 2YWHA 5COBA 5ILQA 4MRAA 2XCRB 2G0TA 1R74A 3SHVA 3JQCA 2GYUA 4FR0A 3ZWYA 3UQYS 3Q9SA 5EPEA 4DR7B 4JI8B 4LYGA 3DVLA 4MJXA 5TMEA 1Z0JA 4LY6A 1SQFA 1RPTA 4FUQA 3IPYA 3FM9A 2ZB3A 1PQ4A 1T8TA 1QUFA 2Y9MB 2ZETA 3OM8A 1Q7RA 3N5KA 4PY2A 5B6JA 1Z2DA 3W4IA 3EVNA 1H2EA 2MT9A 4BNWA 1E69A 4HGZA 3HWSA 5LBUA 1ORRA 1XZQA 2GN0A 3HCRA 6Q21A 5JJBA 5MHTA 2ZKLA 3V7UA 5SYMA 1YCDA 2VOJA 3HSYA 1Z7WA 3FFAA 3HE3A 1SC1A 2QTVA 2EVWX 1J0DA 3WZMA 3CUEF 4OH7A 1AKTA 2XT6A 4U2FA 5LXTB 2ONZA 3EHEA 4BO8A 2XVYA 1YBVA 3PUYA 3M1AA 1TT7A 5KYWA 3ZJYA 2R7MA 1QFZA 1L5WA 3GP5A 4X1OA 3U3ZA 2DECA 4HFRA 3H65A 2BEWA 4GPIB 4MWGA 1NFFA 4R6WA 1IY1A 4EX6A 4PGGA 2Q41A 2VJMA 3LVQE 1VHTA 1HDGO 1JKJA 1DXOA 1X80A 4KE8A 5E9WA 3WZLA 1SAYA 2OZLB 4NBUA 2PBRA 3EPHA 1B42A 2N47A 1UP6A 2BF4A 3JPYA 4GPTA 4BN4A 1MA0A 5CB8A 5I01A 4LMRA 2EDAA 4FZJA 5IPFA 3MQFA 2YUTA 2VPXA 2XXBA 1FTSA 2A5LA 1NXVA 1LTKA 1VJCA 1XC7A 2QW8A 4HXGA 4QPZA 4H1UA 4U3JA 3BWDD 3TQCA 4ND3A 4YJHA 4H7FA 3TNDA 3IGFA 1FIUA 1ZZEA 3NTOA 1GZ3A 1FK8A 2R6HA 2X3FA 5ALWA 3TG2A 1BHQ1 4F3TA 1W2HA 1ZESA 3U4HA 1WMDA 1TYAE 2CBZA 1QCCA 1W5AA 1ICIA 2AG6A 2NZUG 4OL0A 1OYWA 1R64A 1T9DA 2PR7A 4NRDA 1JDJA 4QBFA 1V5EA 1I1QB 1H6BA 1ZFNA 2GZDA 2HEGA 3MJ4A 3T1YB 3C43A 1SY7A 2XGMA 3BK7A 3LX5A 5B64A 3L1UA 3CPEA 4HFNA 1ZH6A 4YYEA 1V6SA 5JZ9A 3WK9A 2ZRKA 4JQOA 1AZLA 3DXFA 3HI4A 2NXEA 3B9QA 3MS7A 4JP8A 4D79A 4HNVA 3SY8A 1CVLA 1S5PA 4OEHA 4Q4AB 5EI5A 4DA8A 2OZEA 3PXCX 1JR3D 4GYYA 3DZJA 1Q19A 1CNFA 4FU0A 4OG2A 3WHLA 5F1YA 3PVSA 4L73A 2OO5A 1FPQA 4O6VA 4OF4A 3PHGA 4FDLA 3J81A 3HCAA 3RUEA 1HORA 1XDZA 1IZZA 3MQ2A 1SULA 1I2CA 4GRIA 4W1SA 3WDKA 3CKYA 4JVSB 2FVYA 3H5WA 4MKGA 3FUTA 4YASA 1J0AA 4FR5A 1QG0A 1W1WA 2P6OA 4E1VA 2QKYA 3EXG1 4IHJF 2PWYA 2HFKA 5IZ4A 2CDAA 1ITZA 1X42A 1OWNA 4G1CA 4TV9B 1EUDB 1OOEA 3QF4B 5DULA 4B46A 4EUSA 3ASZA 4JZKA 5H83A 5BSFA 2P1ZA 2H9YA 4YPFA 3FG9A 5IVPA 3HBMA 2VNJA 4RK4A 3HYNA 5E4FA 1WPRA 1KQNA 3H7IA 4M8NE 2WPDD 2X0RA 4CQMB 4E08A 1L5RA 5CXQA 3CKMA 3MGCA 1Q7TA 1RQPA 3O3OB 4P3PA 2MJLA 1C3XA 3V1NA 1ORIA 2D1TA 2LDXA 1XVAA 1C1DA 3KR1A 2CCGA 5F9FA 1V2GA 3IUQA 4OM7A 3EYWA 2EIHA 2GCIA 2ZWAA 2GM5A 4UTVA 5HQ3A 2FG6C 3OM0A 3VR3A 2QE7D 2QMHA 1E4EB 3NASA 2WAOA 2XLCA 1JLSA 3PU6A 4UNQA 4WWHA 3E8SA 4DVGA 2GXQA 4P33A 4E3WA 5JD6A 3HKEA 5G4LA 2O8DA 5ALHA 1FFDA 1N92A 4ITUA 1PVVA 3OFSA 3RWBA 3S1AA 1KR5A 1Z2NX 2WP8J 1GTMA 3BIXA 3PQ5A 4LKRA 4NOKA 3W8RA 1U9JA 2WFMA 1PWEA 2FR1A 3F8TA 1M6YA 4GQAA 5A5FA 3DBHA 1DEAA 3F1LA 4ZC1A 5EPUA 1OBVA 1ZRNA 5GMOA 3TZEA 1XWWA 3E15A 4H31A 1WDKA 1ZN8A 5AVZA 1U5CA 2WZBA 4P5EA 2PR2A 3KS9A 3WIEA 3VHLB 4KQCA 3KDPA 1BAPA 4R2WA 3ILYA 3DXXA 1RYFA 2CK3D 1O6CA 4NC9A 1GRCA 1E2PA 5KQGA 4KAJA 3GNTA 4UPVA 2EFGA 4DCOA 1GCAA 1UMKA 3MNFA 5EJGA 1PT6A 3V6LA 3WGQA 4MROA 1CR6A 1AQNA 2PDAA 1VE6A 3PQFA 3FFTA 3TD2A 2Z0MA 1Y81A 5CRIA 4BNDB 1J23A 3LDGA 1W5FA 1UFKA 3B1FA 4FZ3A 4K9KA 3VM6A 1NSTA 1RXCA 3OFVA 1KP9A 1VCMA 4RSRA 1R0SA 4ZT7A 4OBXA 1QQ7A 5DN9A 4FVTA 3ADPA 4B9AA 4CJXA 3CW9A 3SSOA 4D4GA 3PEWA 2RAVA 4YR7A 3N5CA 2SCUB 4XAQA 3H7AA 4HVAA 4IM7A 1N2IA 1AB5A 1JEQB 3IO5A 5B5SA 4WH0A 3DP7A 1WUHS 2AOXA 3AXSA 4LOAA 3HJFA 4H1TA 2B1RA 4AFNA 4ESHA 5BSWA 2ANBA 2VCEA 2ZRAA 2XCLA 3LUCA 3THXB 2J9RA 3S7ZA 5IARA 2JAUA 4MW1A 3TS1A 2X76A 4EKGA 1GUFA 4BCCA 4YO8A 2G7MC 2R6R1 1YBMA 2M6SA 4N0MA 4UDYX 5DGHA 3VR6H 4E1AA 5KJ1A 3HDYA 4NPHA 4I1IA 1TF5A 3G82C 1K8RA 4MP6A 1L5HA 5JUWA 5C32A 3UUGA 3MTAA 1IQPA 4HX5A 5FBHA 1MD9A 3J80A 1OIVA 3V97A 4QYSA 4YRCA 5EE1A 2J0SA 4BKQA 4CL3A 2JNWA 4E2YA 4MCHA 1QZTA 4MEJA 1RKVA 2YNMA 2CUKA 5TIIA 3EN0A 1UPAA 1ODIA 5K5EA 5FFFA 1O54A 5EJ8A 1EH5A 2F3RA 1NPDA 4EJMA 4GP9A 2P2NA 1RAHA 3AYZB 3GCXA 4NE7A 4OM8A 4GUDA 2C7VA 3RNOA 1II9A 3NWJA 3N3BC 4LE1A 2BWJA 3QK7A 3ZU2A 4A03A 3S5UA 1OV6A 3WLNA 5DLQC 3DHWC 2VTDA 3OE4A 3AJ9A 2WUDA 3AVQA 5TJ9A 5BRNA 4Z4CA 5C81A 4XUGB 4FDVA 4Q7KA 4UQPA 3NORA 3WFIA 5DLEA 4BVGA 1U0JA 3LECA 5FEUA 1LDEA 2EKLA 2WUWE 3DPIA 4M1KA 3AESA 2X0DA 1XLWA 2J48A 3HNOA 3IBCA 4KGZA 1ISHA 4LVNA 1YHNA 4RLQA 1BN6A 5TJHA 4EZIA 3DD1A 1XJ0A 3C87A 4XDYA 1R6VA 2LCIA 3L2OB 1XSEA 2CK3A 1T3LA 2OBMA 3CLVA 1EE9A 3LV8A 3OE7A 4MGKR 5BQPA 3A9CA 3S2FA 4FHZA 3KV1A 2QR5A 3QLVA 4N3NA 2RI0A 4D0GA 2NP6A 1N5MA 1G8HA 1YS4A 4MR8B 1GDDA 4KAXA 2G1JA 3HXPA 1ECCA 2IXFA 2QTTA 3IL2A 2HWUA 2JFVA 4G2TA 1WCYA 3NCHA 4Q4JA 1NAIA 4TM8A 3IOCA 3PLAE 2GBGA 3EQ7A 4CLEA 3A6LA 3I2KA 4N7RA 2R44A 2VHXA 3R9XA 4QGFA 1Z06A 3ROGA 2YDXA 4UHFA 4BNXA 2ID8A 1WJGA 3REOA 1O1YA 1XD2A 2FSIA 3EAFA 2R1VB 3EG9B 4BASA 3HLYA 2OFOA 1HL3A 5KTYA 1A5AB 5BSGA 4ZMBA 1GU0A 1Z4KA 3ESAA 4O4JB 3KUDA 1KY5A 3JR7A 1CS0B 3VU9B 1QIDA 2I4NA 5E7QA 1E1CA 1PVDA 2OR3A 1LZKA 1NVKA 2QTRA 2XB4A 3NAZA 3PEEA 4HQRA 5DBEX 4E22A 3ADBA 1KJ8A 2W2LD 4Q7EA 1GGKA 2WB2A 4DDKA 2E9SA 2Q0XA 3I9V6 3QUQA 4OB6A 5I7RA 3GLIA 2FUG1 3X1JA 3ZCRA 4G4IA 3V8QA 1XO1A 2Y1OA 1Q3KA 3T5CA 3AEUB 3RJ9A 4QBHA 3EG9A 4E6EA 1ACJA 1H65A 1L8AA 5CW2A 4K0KB 1O7JA 2XNSA 1FFYA 1U8EA 4YV2A 3CX7A 5B6PA 4JT2A 4Q24A 2BFFB 4S1NA 5FD8A 5F21A 3K0CC 1WMSA 2BFOA 4DBZA 2IJGX 2XCQA 1OGYA 1DZ3A 3OFJA 3NP9A 2Q45A 4QVGA 4U6QA 4YRIA 1I9CA 1VECA 1G4HA 4LV6A 3HI6A 2HLPA 4PAOA 4PZYA 4KPYA 3KKPA 5DISB 1J8FA 2V9PA 3AVYA 5CBKA 3DFFA 3IPCA 3H2YA 1ZH8A 4WQMA 4O3MA 1ZOPA 3NOOA 3L4BC 3RSHA 3L49A 3QFHA 5EUMA 3FUCA 3FOAA 3HBNA 4PSKA 1OLXB 2J5RA 1CRQA 3RUFA 2J0UB 1T8PA 3JPWA 4B6SA 2PFKA 3HVKA 3KVVA 4PHTA 2C8JA 1NGSA 1TUIA 5LB4A 4DA9A 1IEVA 1ZNXA 2I7VA 1JQBA 3D0OA 4X00A 2GETA 4P3XA 1I0ZA 1R8SA 1C0PA 4R1OA 2NSYA 1KO7A 5CJ2A 2XMZA 5LP6C 2GB4A 4P4NA 3HDQA 2YXPX 1JLKA 3SQLA 4BNFA 1KZ9A 1RBYA 3JQ9C 2JBHA 2ZSBA 3HLTA 2ATCA 3OAAD 3WL6A 1K0FA 1CQZA 2E18A 4UM5A 1Q21A 4ARAA 4OHCA 3B1XA 3L8EA 3GBSA 4U6SA 4CKZA 3EDMA 2JIPA 2LXNA 3E1SA 4FCWA 3V4PB 3WSWA 4TKVA 1S8NA 2E4XA 1BKDR 3AV0B 5ALNA 1DIGA 3TQSA 3WVNA 3A6PC 2GM9A 3JD2A 3WHPA 1JN0A 5DHQA 2AD1A 3AGPA 5AYVA 2LCQA 3V55A 4BO9A 2D1RA 1L4HA 1XDBA 4C6TA 4PO1A 3GT7A 1R0RE 2ISSD 2J59A 2OL4A 2SBTA 4IDQA 4U5XA 4R84A 1ETUA 4WLOA 3RVOA 3JALA 4UTNA 3VTFA 5JG7A 3CXRA 5AH0A 3F2VA 4JSYA 2FR0A 5A4IS 4MCIA 1K6MA 1Z07A 3LS2A 1M1NB 3PC7A 4NAUA 6YASA 1XDUA 1SBCA 4MAFA 3H1PA 2G08A 5GP1A 2DFKB 2ZE5A 4AKEA 1I3OA 1H2HA 2WT4A 2FWBA 2IYZA 4D57A 5LSAA 3GFSA 1TF7A 2PIDA 2PO7A 1Z4MA 4HYEA 4EUNA 3RDPA 2HMYB 3CNQS 2RB4A 2VXYA 3G3EA 2O0HA 5ADHA 3QX3A 3DPSA 1JJAA 3GDFA 1E2QA 2BZGA 5G3YA 4WGGA 2V7XA 3D8HA 3QWBA 3RYTC 5H3LA 2GK4A 1JLRA 1ZUNB 4FLEA 2I7XA 3ZZ1A 2ZQ5A 5JMTA 2G71A 1VPTA 1WTAA 4ND8B 3AM5A 4PONA 2ZRLA 3G6WA 3HPRA 4G26A 4OK3A 3VV2A 5LD2C 4E70A 2WD9A 3VX4A 4I55B 5H4HA 4F2PA 2UZ4A 1F6DA 2OBNA 1FVHA 5JU6A 1TI7A 4QU9A 1KYVA 3I05A 1OAKA 1PYOA 1XGKA 2KBFA 4MRVA 5DYGA 3RT1A 2C00A 4XRGA 3TVTA 1EZZA 5L8VA 4RDCA 1GTRA 1QS0B 1NJ2A 4LDPA 4B40A 4II2A 3FYSA 2FF5A 2JJ8A 4I5GA 2IYUA 3EGVA 4QPDA 5D3MB 3BKXA 2V7TA 3ETHA 3LP5A 1G19A 2Q4TA 1OYYA 2JEYA 4KVGA 1EGAA 2V45A 2GCGA 1UFVA 2JAOA 3M6MD 3U3XA 1EX1A 5G4KA 2J9FB 4S1TA 5KO2A 1XTQA 3ZGLA 3EXEB 1GHTA 1YS9A 4H7DA 3KZ1E 5ESRA 4TYYA 1CB0A 4JYCA 2I62A 2I66A 2JLSA 3V8VA 3EVTA 4C88A 3ESYA 3PRJA 4IKOA 3ZPXA 4MXDA 4Y7DA 1G8YA 2CB0A 3OX1A 4TLAA 2XY4A 3RJ5A 4HV4A 1SHZA 1RRMA 5ARCA 3COJA 1PKEA 3BCHA 1V41E 1QORA 2HNKA 4HSEA 1JR6A 1K4YA 2TMKA 5K8CA 1YZHA 1C4XA 3O26A 1HC7A 3H9GA 4KQHA 1P5FA 3NPAA 3KEGA 3OMXA 3P27A 2DKOA 4HUQA 4EAAA 3GJ7A 3SIXA 3ZTWA 3BSSA 3H99A 3P9ZA 4B6PA 4RF5A 4YALA 2XITA 5AKKA 5K8IA 3KYDB 5CCBA 4AZVA 3AUTA 1QHGA 3DTYA 2ZBVA 3F49S 1XX6A 3LLCA 1C3JA 1TAGA 3UKOA 4YLGA 4YV1A 1LPPA 3T9BA 5MGBA 4M60A 3M1IA 5BXYA 2IEIA 3F7OA 3U9SA 1A8SA 1U3UA 4L22A 3WG9A 1W59A 1A2BA 2A0KA 1DQRA 3MELA 1BJRE 4CZ2A 4AQYB 4PLHA 3BWCA 4LOLA 2P9GA 3AUUA 3DE1X 3L01A 1IHUA 4NMWA 5DLDA 3VH2A 2MSCB 4XW2A 5IJ0B 2X5JO 1P0CA 4CMBA 5GWXA 1ISFA 2DCUA 3RV3A 2HRBA 3ZIAA 1S2GA 3KTAB 2IVZA 1N33B 1LI7A 2V7VA 4DCGA 5FLXA 2J41A 1NASA 1E3WA 3QLUC 2R96A 1I7SB 2GEUA 4P31A 3KP1A 3WMEA 3EFEA 3K8OE 4CL8A 3EFHA 5AHOA 5TVGA 2CLKB 2VG8A 1TADA 3H2ZA 1SA0A 3ACBA 3NGLA 4S1OA 3O4RA 1V1RB 3PHIA 1N0IA 3D3WB 1K89A 3EQZA 4G0QA 4FE4A 2WMOB 1G2QA 3BULA 5BR4A 2QW1A 4ZEWA 2QT0A 2D5CA 2MINA 1Z13A 4YQYA 4BMVA 1QYCA 5BN3A 4RM2A 2C2MA 2NVWA 2J5BA 2YXEA 4IMRA 1PS0A 3F47A 5AVKA 1ZONA 1NZJA 4CMCA 1FX0A 2ZSKA 3G8DA 3H42B 3MRVA 3MJEA 2LDBA 2WWHA 2ZW9A 2D5BA 3B8HA 4ZO6A 4MVJH 5K3AA 2QF7A 3W1VA 1M7GA 2ZI4A 3MPOA 4TROA 3W6PA 1F2VA 3Q0TA 3AZPA 1RVV1 1TZBA 4NZOA 1P2DA 4XX0B 3WP0A 4B48A 3T4XA 3DNFA 4OB8A 1T36B 4PNZA 2JG3A 3F97A 3BDAA 4M1OA 2ZYIA 4KEAA 3VNBA 4G24A 2XGGA 4QA9A 5JLAA 1IULA 4XB1A 4D5GA 3ZWNA 1ILWA 4LJ7A 2XODA 3WLHA 3USZA 4B3SB 1A69A 1CZKA 1LRLA 1EX9A 2YMPA 1Z0AA 2ZJ2A 4L3VA 4LF9B 1WRBA 1YB7A 1GQRA 2I4RA 2PA0A 8MHTA 1JDTA 3IT0A 1FFXB 3K09C 3OT4A 3PV0A 4GC9A 2VYQA 3HJHA 2GXAA 1ZUIA 2PUTA 1E2NA 3U26A 4CIAA 2JVIA 1CJKC 2W4QA 1T2NA 1X87A 1UWLA 4HNSA 4MKXA 3K8YA 5JVDF 4KPUA 2LKDA 4MA5A 1BMDA 1QFXA 4OGKA 3GN2A 3OEYA 1C4WA 5L7WA 5AW5A 2W43A 3WA6A 1QYRA 1BA2A 3FVWA 3P9NA 3TTTA 3ZHQA 5LBTA 4LUCA 1UPTA 2P65A 3K0AA 4J91A 4M0PA 3BCUA 2V3VA 3KSMA 1H1DA 4O33A 2DJIA 4KIWA 2LIVA 1JPUA 1B4DA 2NU9A 4Y1RA 2WMYA 1GGNA 1EFLA 2ZAIA 3X1DA 2DHQA 4O1MA 1H4SA 3IR6A 4CLHA 4V2UA 3P0RA 5JAIA 4O4IF 3Q2KA 5ALPA 1SKBA 3OQNA 1GRNA 4FQ7A 4G0MA 3DOUA 3UJ8A 2J30A 1KE1A 4B83A 3AC0A 3O75A 4YMUA 1KWKA 1N32B 3OOHA 4OJKA 2P3QA 4QBGB 3WMXA 4X54A 1G64A 2ZT5A 3CTMA 5FPKA 1XNHA 3MWDA 4H1VA 4YWJA 2EDCA 1R4AA 3FI0A 4JP1A 2B7LA 4K05A 4H4DA 4BY9E 1GCUA 1W1IA 2VLIA 4E46A 1FS6A 1GSAA 1VL5A 3CQ9A 4O2RA 2VC2B 1F38A 4PBSA 4Z2YA 4YV7A 3AKZA 1CEQA 2IOFA 1FSSA 1FX1A 4NICA 4CNBA 1I1OA 3ND5A 1Z45A 4KXLA 3AHDA 3JQRA 3M5CA 5ICCA 5FBLB 3P5BA 4PX5A 2VTBA 4R54A 4LI3X 4RGQA 1GPJA 5ALYA 5A03A 1EBFA 2J87A 2YIMA 3A1WA 3MK31 4XYBA 4DEXA 2GD2A 5ITZB 4ZKDA 4QVIA 3TSOA 3O84A 4R3WA 3C8MA 1VI6A 2FRXA 4N5HX 4RYLA 3VO9A 4UOQA 4WDQA 4RGBA 1D4OA 1ZP6A 2EZ9A 3DLTA 3DV0B 4DG9A 4C78A 3WYNA 1G55A 3ZHZA 4F3YA 2GTHA 5AXCA 1DG1G 1JQEA 1BVUA 3EGCA 1EUDA 3HUEA 1VLJA 3QF4A 3Q3VA 4RV9A 4R7GA 1ZAYA 2XMRA 3FZNA 1J70A 4C1BA 1E6MA 1Z28A 1YL7A 2DH5A 2CKMA 3HSKA 4MKFA 3VYUB 2H0AA 2HA0A 5KYVA 3TW6A 3DOFA 3PNKA 4CTOA 4ZCIA 4X45A 1GFWA 3GJ6A 1N3LA 1XRLA 1O4VA 2E3JA 3UUWA 3HBJA 5SZHB 4FFLA 4ZJYA 3TR0A 1G1AA 4NCXA 3KOZA 3HJCA 2G1KA 4Y6SA 4HB2A 1J2YA 4L6IA 4US0R 1GN9A 4KQIA 2UYQA 2XZPA 3QPUA 1M72A 2XYGA 2ZS8A 2GAAA 3IXLA 2WJWA 3GK3A 3OFKA 3PXEA 1CP3A 4PLWA 3TZBA 5AVYA 1Y7PA 2Q1TA 3RG2A 2HW8A 3THYA 2DH6A 3GH1A 2ECQA 1L4UA 5B1DA 3ZE0B 3SFVA 3BD6A 5JD3A 4GXQA 1DCFA 5HTKA 1Y6QA 4UNSA 2IZ1A 3DBIA 3VC1A 1QX3A 2XVXA 5AXBA 1QE5A 4NS4A 3ZV4A 5CB4F 4O2BA 4AAYA 4J1TC 4DCMA 4G41A 3GJ5A 4P4LA 4BVEA 1TJPB 4C0XA 1DEKA 3D4PA 1XG5A 2ZREA 4GLOA 1JYSA 1K66A 2HY7A 2Z4TA 3B6IA 3NTVA 4XM0A 3KLBA 4EDHA 5C37A 2XUJA 1YBHA 1EFRA 5AW4A 1FJGB 5HRUA 4MR7A 4L08A 2XGJA 3HR4A 1L7QA 2OFWA 3KZKA 2CVQA 3BPSA 3OAAA 3L7YA 3LJKA 4GBJA 1D09A 4M99A 1MRSA 4PM4A 5J9FA 3UHAA 4K9NA 1C1XB 3L8MA 5KTNA 4GIBA 4YP0A 3UAOA 3EZNA 3EPLA 3SE0A 1IQRA 2IDZA 4U00A 4H6XA 5FBWB 4LRUA 3UOGA 4ARUA 1MQ9A 2X2OA 3WKCA 3GMIA 1QRSA 3M6AA 3AW8A 1FSZA 5BT8A 3C3BA 3P2YA 4G63A 4J75A 3RBZA 3CEHA 4TWRA 1YJBA 1ZICA 2AGVA 4Y2XA 3ETLA 2A57A 5C35A 3FSEA 5IF9A 1LDGA 1Z2OX 2GJAA 2G9QA 3MCWA 3EIUA 4H27A 2Q7OE 2C2WA 4EB6A 4D9GA 5SY4A 3KTDA 5SZIA 3IURA 3F7MA 1FBTA 1XR3A 2PMKA 2AL7A 4ZI3A 1EUYA 3PCRB 1I6MA 3WO1A 3S27A 4L7QA 1DX6A 1T5BA 3ROEA 5BSHA 2CHGA 1PTJC 1W75A 3EJ6A 3FPLA 3CVXA 3URKA 4QYIA 3UATA 1F2TB 1E1LA 4KXUA 2Q2VA 4Y9RA 4K9MA 1NR5A 2IQIA 3U0VA 1ETHA 1FP4A 2YCLA 1XTIA 1NQTA 2O2HA 1KFJB 3PE3A 3PEVA 4I19A 3TE6A 1FU8A 2NXWA 3COSA 3WXMA 4MHTA 3RU7A 3SWWA 1WE2A 3BE6A 3UQZA 3AW9A 4BO0A 3RUCA 2B2NA 2B4YA 1WUKS 1OY1A 1BS1A 4DV2B 1GKLA 2WG0A 3O9VA 1SUBA 3O4IA 1V7CA 5K4AA 4EA9A 1HYQA 3KOUA 1UDCA 1V96A 3NLLA 1DRWA 2ANCA 4L4SA 5FX2A 2H00A 2BUAA 2C5SA 2P1DA 2QYOA 3IOBA 3S2GA 1TZMA 5HRAA 1XD9A 3A2NA 3L7BA 3ZDXB 4CETA 3SXPA 1B8VA 1Y1TA 2ZT6A 3SNKA 3MTIA 4FCVA 3G5LA 3UHOA 2X8WA 3I62A 3O31A 5EZYF 4OJTA 2EFHB 2C7BA 3I1IA 5FPPA 1KZHA 3SMVA 5B7NA 4Q3CA 1H85A 5IG2A 1DTWB 1SCAA 2BCJQ 4Z1MA 3SN6A 2P7IA 4D45A 4DAEA 3LSYA 2C83A 2QDXA 2QNIA 3TO5A 3H2GA 3MG9A 1XNRB 4RJIA 2ZBUA 2O8DB 4QUAA 4X9XA 3OIWA 3TTVA 1P0MA 1QAOA 3KFLA 4GU5A 3VZQA 1V4VA 4DLLA 3P9PA 2XKJE 2PUFA 5IYZA 1V4NA 3IT2A 4C2UA 1NXSA 2KSQA 3LG2A 1GUYA 3PT5A 4MI1A 4YFYA 3V4ZA 4F4IA 1OFGA 2G80A 3H84A 3TN7A 4PIVA 3WI7A 1Q1GA 2FFAA 3M3PA 4Y2HA 1PTJA 2P9ZA 1VJ5A 3DUWA 2OENG 2FI1A 1ZCFA 3PIIA 1G60A 3QP9A 2OFXA 13PKA 3DW1X 3NW9A 4PAGA 4AXBA 4LYDA 3F5FA 4FOLA 1KYXA 5A05A 1YI8A 1G38A 2WJ4A 2CFSA 2R62A 3HXTA 3U44A 2G63A 5KAMA 4ARZB 4CLOB 2QN9A 4AZ0A 1X7WA 1T6ZA 1XELA 3FCAA 1OZFA 1U04A 3I4CA 3FNRA 4RF2A 3ZTYA 3NVDA 4R4JA 1E79D 3K6SA 5KOJA 3FNGA 3CUYA 1RAGA 2KLBA 3ZW9A 4LF5B 1H05A 3Q1KA 5JFTA 1EFPB 5JSFA 1GARA 5EZ6B 4HNGA 1M6VB 2O3SA 3QXSA 3ZI4A 2DHRA 4N7BA 4ZGGA 5HBRA 1OFUA 2HDOA 4GMXA 1ZD9A 4RLSA 5LIRA 2VK1A 5EHGA 5JO9A 1KI6B 1IJFA 3GFVA 2YY7A 4H1WA 4YBRA 1XTRA 3G5AA 2Y0DA 2CLCX 1Z12A 5HNKA 1IN8A 1VKRA 2O8NA 3SF8A 4BUCA 1NI3A 4IEIA 3ZZUA 4DB2A 1ELOA 4S0XA 3PITA 1NV9A 4YEDA 1U3CA 1UPUA 2FEAA 3AR8A 4RK1A 2JJMA 1RPJA 4L0CA 3WTCA 3MLEA 4IVPA 5JNVA 1MJ5A 3B9RA 2IU3A 1SOVA 3RGGA 3IJEB 1Q3TA 4ZPJA 1JB9A 3Q1LA 4LECA 1IPFA 1E0SA 3RSQA 2Y0CA 4IFBA 5J1TB 4PZUA 5DXAA 1PUIA 1R4ZA 2D13A 3IXQA 3JZMA 3K72B 4G0WA 1RI4A 2QAJA 1P2FA 3PJDA 1EM8A 3MJVA 2PGNA 2DR0A 2Q3EA 4YAWA 5EIBC 1NVVR 5HG0A 5CA0F 1TF2A 3L7LA 3LT2A 1FUKA 3OP1A 3FB1A 3QI2A 1HQYE 3K6RA 1M66A 3A32A 3WO0A 4LPSA 1PZHA 3VJRA 4R1UA 3UUEA 2O2YA 2FWRA 3KSZO 2JAHA 3A70A 3VHRA 1VSBA 1JAXA 1OHHA 1HG0A 3OZRA 3KLNA 5BYAA 2HMSA 2HK7A 2YZGA 1ZISA 2FDXA 4KUHA 5CNJA 3SKVA 4RPJA 3STVA 1HDXA 1YVUA 4OL9A 4E12A 3U7IA 2OG1A 3EXAA 2AN5A 2CD9A 3FGNA 3G0GA 3GPIA 4RL6A 3OH8A 4AO6A 2DOKA 3WWDA 4BWVA 1CEXA 1OH6A 4MMZB 3FN4A 2IBTA 3VJLA 4LDNA 1DC6A 5HUJA 4J1QA 1PLJA 3N0RA 2DY1A 4IRUB 2BSAA 4EKDA 2XUGA 4QICA 2C4WA 2ZWPA 1GEGA 4QLOA 4LF4B 4NBTA 1Z39A 2V54A 1L4MA 4P83A 2OHJA 1SEVA 1NOIA 1P17A 1W88A 3ZZ0A 1U0NA 5CDYA 1T1GA 4FYPA 1DHRA 3OZFA 2P9FA 4NK5A 4LRWA 3RTGA 2JZCA 3BDIA 1ZXLA 9MHTA 1ID1A 4GL4A 3VPDA 4TYWA 1EX6A 2EJVA 4EFLA 3RRNA 3DWEX 2I80A 4KK3A 4M88A 2JI6A 2ZTLA 4NH4A 1ECGA 4N7MA 4Q18A 1YULA 3STYA 4EB0A 4QG7A 3UIEA 4GEGA 2IZ7A 2X0JA 4FZRA 2O2ZA 4KN9S 2F4NA 1UR5A 3GI1A 4UASA 5AW2A 5ITWA 2HR1A 3IXMA 3PHBE 5FNVB 3AHGA 5T3UA 3SDZA 3WNQA 2G82A 2GD0A 1NU6A 1RDFA 2FR8A 2OYSA 4BBPA 2OCGA 1NQAO 1RABA 1UK9A 2GCOA 2RGUA 3QXXA 3QLTA 5IZCC 5AESA 3BMOB 1QGOA 1LW7A 3PS9A 3RT7A 1E61A 1CR0A 5LQRA 1JXAA 1IDN1 3SJ7A 3H6HA 1Y98A 4QLBA 3BMXA 4X41A 3PSAA 4BFXA 3LWBA 1TKAA 1CQIB 1U98A 1JYEA 4AXXA 3QEJA 2CL0X 3U4CA 3RAJA 2IFTA 4KZKA 1PQUA 3IV7A 2XMBA 2V0GA 1VJGA 1XVUA 1Z15A 1S9HA 2D3TA 4GZ3A 4JCOA 1M76A 1KAQA 4JOBA 1VKOA 4W99A 4CG2A 1HNNA 1XE3A 4LMBA 4WBSA 5B1IA 1PD0A 1N0HA 3TBFA 3O4GA 4LOIA 3W7VA 5NLLA 3R7DA 3BGVA 3EC2A 3W8NA 5A2GA 3R41A 4Q66C 4DJJA 4E32A 4R31A 3IIEA 4BX3A 4BXOA 3FTFA 1FMLA 1TM2A 3DFIA 3I39X 3G0BA 2AKEA 2WPDA 3AR7A 1R5NA 2Q6IA 3NZEA 4Q93A 4C2AA 5K2OA 3PXUA 5CTAA 3ZHVA 3KQYA 3IOYA 4PLYA 4LBYA 4BJ1A 3LRTA 1DAEA 3WKEA 2E5WA 5ALVA 2C54A 2P9YA 1C2YA 3FCUB 1BIFA 2RB5A 4GXTA 2PX5A 1QOQB 4HAYA 4JK3A 4Q16A 1ISIA 4G5SA 4MV5A 1BA3A 4I4LA 5DI9A 4A6DA 2LPMA 4B80A 3DL7A 4JB8A 4JJ6A 5FR1A 2OHFA 1VSTA 3G0IA 1GG5A 3ORYA 1EVKA 2ZM5A 1IHPA 1ZRHA 3QBTA 3V1LA 5BR7A 1S2NA 3FLEA 3OCJA 1TYEB 3OP4A 1J07A 2HZBA 3ZLUA 4FI3F 3F90A 4BO1A 2Z1DA 2YC2C 3OQHA 3ZHUA 4DYHA 1IVNA 5D3ZA 2Y77A 1JDSA 1Q1AA 4AKIA 3LDAA 1Z6TA 2ILVA 3AJRA 3S7TA 5KINB 2Q5IA 3F4BA 3AM1A 3AVWA 5K1ZA 1WDLA 5LYJB 3S1SA 1GTL1 5KYYA 4KWEA 3BGDA 1RYNA 2QT9A 3RK1A 4R0MA 2FFQA 4CL0A 3CLRD 1PWHA 1WUYA 4G65A 3H5TA 4M9ZA 2LKCA 1QLHA 3OCZA 5J43A 4IMJB 2PL9A 4D0NA 1CDEA 1IG3A 2WIKA 2GEKA 3QFRA 4ZWNA 2AW5A 3JQDA 4JJ4A 4EA8A 4EHNA 1VIAA 4NNOA 1N6OA 2W6PA 5L95A 2OECA 1AUPA 2FPOA 3JQ6A 2VJKA 3RC2A 2Z98A 3SBDA 1VGRA 2CYBA 1E9BA 3HV0A 1ZVQA 3L46A 4HRAA 4DIMA 2C1XA 1L5HB 1MJGM 3DMFA 4Y8VA 1L5KA 4XQCA 4DE5A 4OI0A 1H1TA 2IF2A 3MSXA 4L4YA 2XUIA 2IIBA 4KJXA 2JS7A 1DOHA 3D6HA 3AQIA 4C4AA 3K53A 3KDSE 1PW5A 4JFAA 4E5SA 7GPBA 5HOEA 5HR5A 5T64A 3X2FA 2UUOA 4UATA 1L7RA 4HEA6 5A4MS 3PXDA 2K7FA 1H4TA 1MABB 2CJFA 5ECDA 2ORWA 3QUBA 4L4XA 4XYGA 4A0GA 4NYJR 3LQ4A 3FMIA 3JATB 1W8DA 3GV0A 4EJSC 5FUQA 2XCOA 4HF7A 4OGWA 1GT6A 2NYVA 4IEEA 1YIOA 1XKLA 1SGWA 2CJWB 3P52A 4L8GA 2OLJA 4GE0A 3B38A 1ZAKA 4X20A 1NPYA 2X23A 2DQKA 2P3LA 4INOA 3VTZA 2CXUA 3A6JA 4OFZA 1EQUA 3QFFA 1EKXA 4R40A 1LKZA 4TMXA 3WOVA 5EZYA 2EXXA 6GPBA 5J47A 3F2IA 2PCJA 3CUVA 1T1RA 3T12A 1PZEA 2PTGA 4YCDA 3BHMA 5AKLA 1HKUA 4AYTA 5E7JA 5CEEA 3N0TA 2IXDA 2YZNA 4OO3A 2G9VA 3FOWA 4RNCA 2CFIA 5KJEA 3UK0A 3R9WA 1SCBA 4G97A 1ZJJA 4IG9A 4UUBA 4CV3A 2CZCA 2M2IA 3L9XA 4YAGA 1KYTA 1OTXA 1A0OA 2AYYA 3NDRA 3BCSA 3RANA 4DSZA 2H1LA 4KQGA 2W2MA 2WD7A 2WSBA 3G5TA 4EI7A 3N2KB 2YWEA 4WLVA 4NQZA 4TUYF 1FY2A 3P5SA 4QJ3A 4WBNA 4H16A 1F6BA 1ESNA 4E03A 5AUOB 2XB2A 4GVLA 1E1NA 1ONNA 5DM1A 2DCMA 1JR2A 4OCZA 4JL8A 1NT4A 1KYWA 4NCKA 5EJ6A 2BLLA 4PRZA 5EJAA 4Z4EA 1IRXA 3R5JA 1UXIA 4KRGA 3T3EA 1Q16A 3WLIA 2R11A 3MTJA 2QTFA 2XYQA 1Y9ZA 4B3FX 4C9BA 1WXQA 4CM8B 4LA4A 4D80A 2R1VA 2J5QA 4BCBA 3OIDA 1XUOA 3IOEA 4H7HA 2O19A 4EPTA 5DXJA 5I7HA 2ECFA 3F7TA 4M0FA 4PFKA 3GEEA 4QUGA 3ESQA 1I0LA 4CE6A 4CMHA 4LQLA 1GO2A 1VIMA 2NAPA 4GGOA 5ANRB 3T5GA 1U4NA 5I4BA 2H5LA 3H8VA 4PINA 1EX7A 5TXGA 3Q8LA 1WXXA 4QBIA 1GN8A 2FDRA 4JX8A 4CN9A 2A3RA 5HGJA 3CT4A 2BV3A 5LL6P 3WNZA 1WPGA 4KQMA 1PDWA 4IH9A 4RVHA 1FDVA 2BKEA 2QUBA 3C48A 4JLSA 4PTZA 2D1SA 1MCZA 2XUAA 4XOIA 4S1WA 2HTFA 1HT2E 1X77A 2DSNA 3EXHB 3PZBA 1XZPA 3CX8A 1ULBA 2O7SA 2WJZB 3HCNA 4XQEA 3A05A 4LAFA 2XZLA 2A9PA 1M0EA 1VJDA 2UYOA 5FI5A 4CKCB 5CA1A 2C59A 3RE1A 2VAMA 3C8DA 1NT2A 3TVYA 2CCKA 2FX5A 3SSNA 1G6KA 1X38A 5LNK6 2GUGA 3WRYC 2FEKA 5B2ZA 2P8SA 4HVCA 1E0JA 1Q5PA 3BIJA 3O7WA 2J45A 4MQUA 4EFKA 4QO8A 4TWAA 5JYDA 2I4OA 5CFOA 1FSGA 4PYMA 5F7JA 4CKBA 3PDIB 2OORA 3A3KA 1P81A 4QPJC 3GJQA 5I3CA 3RC3A 3C6BA 1LS6A 3IELA 4EJ2A 1NWCA 2JD0A 2ORIA 3DWFA 4EWLA 4X20B 5HWSA 3R6GA 4B3BA 1T6YA 2HT1A 2R6ZA 3FNHA 1TKCA 1D1SA 3P26A 1WHSB 4AWAA 5A02A 4A8HA 3KNZA 2WAXA 3A14A 2X9QA 4I4IA 3UFXB 2ERXA 1IUOA 4KYVA 4BJ6A 4LI0A 3OF3A 5F35A 1WW8A 4BVAA 3HWRA 1Q17A 1L5OA 1W4CA 5DX8A 3H13A 5JNUA 1TECE 1MIHA 4WBNB 1VCOA 2BFNA 1XTTA 2WWTA 3DZ8A 5JWHA 3G2HA 4IRMA 5HCIA 3ZWOA 4Y6PA 1QV7A 2BC9A 4G36A 3RG8A 2ZBDA 2JH3A 2QVZX 1BZYA 2QN2A 3A1VA 3ABRB 3AP1A 1Y9JA 3MS2A 5FNZA 1TU4A 3UTCA 3GW8A 4RLFA 1FJHA 2R2AA 2J1LA 1OJ7A 4Q9DA 4LYAA 5KUTA 4MDYA 3BTUA 4TLLB 4IVQA 3LFHA 5LDDC 5M34A 1GNVA 2XMQA 3ORSA 2AS0A 4NYJQ 4D4JA 4RKWA 2P79A 1OJLA 4JYPA 4QWMA 2IKSA 2X1VA 3H8SA 4IKEA 4K9SA 3P2OA 3PKZA 4W6ZA 4YAEA 1QQ6A 1OLOA 3LYHA 2DR2A 5IAGA 3S40A 1GKKA 2JHCA 2PX6A 2CUZA 4ZP1A 2BELA 1RM5A 3KKLA 5DYWA 4D44A 3HK2A 2PMBA 4V02A 3A7EA 3HN2A 4BAUA 3FSJX 4UMFA 4A5OA 3SJCA 2EGUA 5E8JA 4R2LA 4FIDA 2P2LA 2R47A 1F2TA 1B43A 3F8WA 4P38A 5CFQA 4JC4A 4KKXB 5AJXA 4HOYA 1OCEA 1AZSC 4UMEA 1E3QA 4FKBA 2BEJA 4D26A 2ZBGA 3L3BA 4G4SO 5DM2A 3WGJA 2HJSA 4DLYA 4EQ6A 4BQEA 4AL4A 1ZUNA 5I4CA 1O87A 2JGIA 1CUBA 4IF4A 3CY6A 3JRNA 5D85A 4EHLA 4B4VA 4EVRA 3DDUA 5AM2A 3H4IA 5IRCD 1GD1O 3VRHA 2PH1A 4UHBA 3SHOA 1E1KA 2CLLB 1JG2A 3GJ3A 5CPFA 3ZKAA 4X71A 3HXLA 2YBEA 3IMFA 1KYYA 3SP1A 3TLGB 2C7PA 3HGQA 1NXQA 4BNNA 2QB5A 3N1UA 2ZU0C 2ERCA 2HGZA 4AY4A 5KCZA 4LNAA 4JWTA 4KDRA 2A5YB 3QTTA 4NLLA 2WQ7A 1CY1A 1OB2A 4DLAA 1KKLA 3I0MA 3L77A 4X6UA 4PXAA 1N8TA 3HACA 2IL1A 4N7JA 4P81A 5CT9A 3RVJA 5IYZB 3Q3EA 3LT5A 1OBOA 2A6PA 2PX8A 2WSMA 4NZYA 2A92A 2R48A 1G0NA 1WUJS 4IWXA 4OSOA 1YIDA 5AWFC 4BX8A 2VQFB 2FG5A 2Q3HA 1PJTA 4KPEC 4D9IA 1KEUA 5B1HA 2PX3A 2CLHB 5A4AA 1NE2A 3RQIA 4DDVA 4D2IA 1VSQA 3L5KA 3F9IA 4D6PA 4ECEA 3FHJA 1J8MF 3JR3A 3FWNA 4DCTA 1UQRA 2XUOA 4Y2QA 4X8LA 1X1RA 5DN6D 4B47A 4LK2A 5CFNA 1J2RA 1ZN9A 1YV9A 2NTVA 2V6GA 1B8NA 3BE8A 3ESCA 1VBFA 1YK1A 2Y1LA 1OPXA 1DJLA 1DPGA 4JQYA 1H94A 3ZHSA 2H11A 3B6ZA 1BGXT 1EDOA 2IYFA 3IP5A 3PHHA 4IVNA 4OU4A 5AVRA 2CD7A 1CR2A 4WEOA 1C3EA 2P9CA 4L50A 5FFMA 2IVFA 3DEFA 3KK0A 1EEHA 4V1CB 1PYDA 1ZA2A 3IPLA 4EFMA 4QKQA 3QKSB 2A30A 4OX9B 3CX3A 5C5IA 4HB4A 4BNGA 3GXBA 4X91A 4X6LA 1MBZA 5JOQA 5GIPE 4OHKA 5JJKA 5LUBA 2ZBFA 3KKMA 4DLXA 1Z29A 4YQFA 2RHMA 4CGZA 3JALB 1P7CA 5J3JA 2DPLA 3H9QA 1ULAA 3H8WA 2ZAMA 1N3BA 2GI4A 4OB7A 4JODA 5TE9A 2RCNA 3PRHA 4N01A 2R4QA 3ZCUA 3AF2A 2IHJA 2H1WA 2F17A 1GJRA 2QMOA 1UEJA 4Y2TA 4QDTA 3ZD8A 4Q3NA 1LX6A 3DL2A 2K7ZA 4LEIA 4E09A 1JPNA 2XUZA 4HYQA 1TJ3A 2BE9A 3R24A 4MH0R 4S3MA 2A8YA 2OMEA 2JVKA 4DY4A 3T1HB 1SZDA 4DJEC 4HZUB 4BNTA 5I4IA 2BBTA 2FOIA 3SYLA 1JL3A 2H48A 2H2DA 1FYEA 2EFYA 3O93A 4PRYA 1DKNA 1E5TA 4RJ2A 4I08A 4ZT2A 3IKTA 4FBGA 2FW6A 2G5PA 2P68A 3LIPA 3DE4X 3DE6X 4CXMA 2QAIA 2Z5GA 5H59A 3UKDA 1D2AA 4KDFA 1ZMBA 4N1AA 1BWPA 1Q0RA 4I4TB 4PYOA 3U44B 5FADA 4RW0A 4H7JA 1U7DA 1QG2A 1K8XB 2QRQA 5JD4A 2CNWD 1C9MA 5IAEA 1QE0A 1T0BA 2FB9A 2C7GA 2R1ZA 1EGVB 2LE0A 3GIWA 3I5MA 3HYLA 4MPPA 5CHYA 4JD5A 4N12A 2J4FA 3O0TA 3LA6A 3QFSA 4BEBA 4QM6A 3BX1A 3ACDA 2XDQB 4NMMA 1OU0A 2VZ9A 2H8GA 2C95A 1L5VA 3HKDB 4GPAA 5J4KA 2P4HX 3AHFA 1RWKA 4FGKA 2ZKIA 4QASA 5BWLA 5GTDA 2QNBA 3F5MA 1FDOA 5F3WB 2ZUUA 2XMSA 4KRFA 1WOYA 2HMUA 2VHUA 3PXBA 2AKYA 1RMQA 1LA2A 2WUFA 3BD9A 4D8VA 4YMLA 2DY0A 5GM1A 5L40A 2VJDA 4KWCA 3HB7A 2DLDA 1PNTA 1R0CA 3ANMA 4H4EA 3PFNA 4EHKA 1RJ9A 3IE0A 1ANKA 4Y2VA 4ZVSA 3THSA 4REQA 1KK3A 3EGDB 3GAZA 4OTZA 1CSEE 1G8SA 4QEDA 5LR6A 2WWVD 1E92A 2CXPA 3L05A 2IA5A 8ABPA 4DM3A 2R8XA 4Q1VA 2VK8A 4TTTS 1FRNA 1VYTA 5HKAA 1A9OA 4LCEA 5DX0A 1HURA 2FJPA 4FT2A 1P2TA 4PGHA 4IICA 3WWPA 3T41A 1GQYA 3G5UA 1JDPA 4XA8A 2G76A 2WFLB 3LLVA 1T5TA 3C8HA 3ASYA 5BSTA 1FNMA 4F3KA 1AGXA 1SKQA 1TW3A 3GJZA 2HJRA 2WF6A 1U65A 2R4UA 5JMPA 4TOIA 1UADA 3O3NB 2YOHA 3G0DA 1QHNA 1IBCA 1UBJS 1M8FA 4BQOA 1Y1KE 3EA4A 3ME5A 5WRFA 4JBGA 1KFKB 2CEKA 1NVMB 2FPPB 2ODAA 4JT9A 1PFQA 2NUPA 3EDQA 2H18A 5KSPA 4PAQA 2UXBB 5LQDA 1M2WA 2FMXA 3E4CA 4GH5A 1IPEA 1TKBA 1LBEA 3KO8A 3JXEA 5AMXA 4W5TA 3TKYA 4TZ0A 4DUYB 3EZYA 5BNFA 5AM0A 3SEAA 3W5HA 1PL6A 5AM5A 5AK6A 3RC9A 5KAPA 1OLUA 2OA0A 1M1XB 4QU0A 2OZKA 3P9YA 3IBYA 1CHNA 6CHYA 4OHYA 1SD5A 1LXCA 2Q7XA 2Q3CA 4PPQA 3L4JA 1JAZA 1G8PA 1BD3A 1OI4A 3ZY4A 4C0BA 1Z88A 2R3SA 1ZW1A 3G7UA 5BYBA 5HZMA 4Y6LA 2BMWA 2AG5A 2PZLA 3W1WA 4W9RA 2J6BA 1EFVB 4HDNB 1NBOA 1K68A 2Z08A 4JJGA 3RTEA 3ZLTA 4IAOA 1QIKA 3CZAA 1OF1A 5B36A 1JPJA 1O97D 3W5BA 5H7XA 3VVCA 1FFAA 1UP4A 5LFAA 5K9ZA 5KNBH 1YNSA 4QAJA 4BBZA 4ZYXA 4ZZ1A 3KQKA 1JEEA 1U8FO 3AEQB 4OY3A 2F8TA 4WLUA 2AI3A 5FNVA 2QRZA 2CN1A 3ZLBA 4YCBA 4KMMA 1PUXA 3IAM6 3UJCA 2UZ1A 3K6KA 1E96A 4H0CA 4RHUA 4WNAB 1NBEA 4OJYA 4EPYA 3PSHA 5BV1A 1EUCA 4ALMA 4C3OB 5M29A 4CM3A 2GNAA 2OWEA 5AK0A 3RI3A 5BN5A 4YQZA 3RVSA 1HKHA 5ISMA 9LDBA 1DARA 4LSZA 1LPMA 1POWA 3IHLA 4RK5A 2DXIA 3FBWA 3EMDA 4Q9LA 2I71A 4TS9A 5AOCA 5M3BA 2G36A 4Q19A 2CWWA 3GLFB 1Q0LA 4QFMA 1TVCA 2VCYA 4C6SA 5IK2A 1MO6A 2ZI7A 1F48A 5EQDA 4LHZA 1UC4B 1Z9BA 2NO0A 3PYLA 5AW1A 4QM7A 2R5FA 1HWYA 4PG6A 2BVNA 2W11A 3F98A 3MAGA 1B1AA 2VI5A 3LHIA 4ODIA 3WB9A 1KKMA 1ZQ9A 1ZA1A 2GNOA 3M6UA 1QP7A 3IR7A 4KDCA 2YHUA 4RC9A 1N34B 1V5GA 1JHQA 3PL5A 4TQUS 2WIAA 4J7XA 5JNTA 4X92A 4AWBA 3Q8XB 4LJLA 3BCRA 3D8SA 3K1TA 3CVYA 4KBGA 2BDUA 1ODJA 5ES3A 1KJ9A 3H1BA 3TGPA 3UCFA 1HNZB 1T8RA 1YE3A 3IDOA 2NG1A 1P2VA 1II8B 1PWYE 3O82A 4MUYA 3I09A 4JEHA 3ESDA 4HDKA 1M75A 1KXZA 3L7IA 3N2LA 4NCNA 1SRQA 4MQMA 3ONWA 1UODA 2G7ZA 1EESA 3VVLA 2X5NA 4FZVA 3D6NB 1HL7A 1BCRA 3O4JA 4FGWA 3EG5A 2JLUA 1UDRA 3ZDAA 2PSEA 3IE2A 3L92A 1XPOA 3WQRA 5IAOA 5EQJB 2AJBA 4RWEA 5K3SA 4BLRA 4LHYA 2JGRA 4FX5A 1WPXA 5L4NA 1WCIB 4CDNA 2HK6A 2H6EA 1JU9A 4R8LA 1UPCA 3RHFA 3C85A 2WSIA 3S8EA 2YZKA 2Z30A 2YJ5A 3WTBA 4QGHA 1QIFA 4ZU1X 2FPSA 3P4XA 1PJZA 4F2GA 2GBIA 3G2OA 4LZNA 1OILA 2G83A 4HADA 3NM6B 4OXIA 2JAQA 5IASA 2W6ID 2X40A 2WZDA 5IZCA 4U9IS 4MSUA 4IJMA 4EG1A 4DEVA 1YVDA 5A1JA 2IF0A 5LOVA 4INJA 4DSNA 1DAFA 2QD2A 3ENQA 4HTAA 2AWNA 1ZGCA 3E0XA 4Q82A 2GTPA 4M1MA 4DA0A 1DFGA 4G9GA 1GADO 2PEYA 1QE3A 4FDUA 3SS9X 3U13A 3CTPA 4BEJA 1BS9A 3L6UA 3M5PA 3FR7A 3V9PA 1E3EA 4ETNA 1THMA 3OUTA 4YAFA 2R8RA 4H0FA 3R76A 3TLBA 4AKSA 2HRCA 1R8XA 1J33A 1ZGAA 2JCBA 3HUDA 1E4EA 3IIJA 4HEQA 4R16A 4WUTA 2OBXA 5KYXB 1DKOA 4KN8A 1WSAA 2WKWA 1WNFA 2XUPA 5ILOA 4JN6B 2WTXA 5BMVF 3CUUA 3A11A 5JZVA 4OATA 3W2TA 3QJYA 3CZMA 4LRYA 4YMTA 5BMOA 5FCDA 3U7QB 3V48A 1YQGA 4TYQA 3F0TA 1MPTA 1O9GA 1GLGA 1T3TA 2PT6A 3ZEIA 3OLQA 5KPJA 1ZRSA 3A06A 3LZCA 4LJ9A 5FL7D 5FWXA 5LYJA 4CMKA 4TV8F 1GPBA 1CQIA 3K0KA 3ZHYA 4J7CA 2CLEB 4B5KA 2XZOA 1MX5A 1EGHA 2GPTA 4DHWA 1EAYA 5IBCA 5EMHA 3CEMA 4J9VA 4YONB 3UJPA 4YPOA 1CZRA 4HJXA 1N7JA 1NNSA 2GZ1A 1ULTA 2BFDB 3RIYA 4A2PA 2UVPB 4BYMA 2UU9B 2BDEA 1KDOA 2X9LA 3EMBA 3FHOA 4YRGA 4MPRA 3ZD9A 4DREA 4MS4B 5A6SB 4YDSA 4CF3A 4HBZA 2NNWB 1SCUB 3WQSB 4E4YA 1AMNA 4PFSA 1CFJA 4CM9D 1CZHA 3L1VA 2X42A 1KMHA 2R60A 2YVKA 1B7GO 2B30A 2QU7A 4Y1RB 4G07A 1WHTB 2R65A 3CNOA 4XARA 1UEXC 5KREA 5HDQA 4NARA 2FWMX 1NI5A 2ROQA 1DAIA 1MENA 4TMYA 4TXMA 3A9UA 3U2QA 3DGFC 4X1IB 4AJ1A 1ZI8A 4MLCA 2XXAA 7ADHA 2I33A 5M2QA 4G8BA 2OZPA 2XB9A 2XDYA 4U8HA 4RDIA 3PUJA 3CFYA 2FMHA 1HE5A 1J8QA 1X9GA 2X77A 3KJZA 5AKEA 5HK8A 4Z8YA 4WZBB 1HO3A 4Y3UA 3V7NA 3VV3A 4B74A 5BRAA 1KAOA 3LHDA 2WAYA 4FHCA 4KW7A 4MWEA 4OXYA 5K3FA 3B2NA 1Y42X 2JIDA 3OBBA 3IQDB 3UGKA 4X97A 1NW5A 3EF0A 4XLZA 5ADUS 1UMBA 5T57A 1UT5A 2OC9A 5CX4A 2JI7A 3GDWA 3UG6A 5BW8A 2REQB 4EGQA 2QRLA 3GCWA 4PHGA 2OB2A 1PTKA 1QRDA 2TYSB 2XI4A 4IZIA 3ORQA 4XCVA 3UJDA 1ORTA 4BGIA 2Q3LA 5C8YB 1M7BA 2Z83A 1L7BA 1YFZA 4XGRA 5LWQA 2G9ZA 2ECKA 4G81A 4RFSB 2OCLA 4QRIA 5TF0A 1WVIA 4J0HA 3R6DA 2PLFA 4K6GA 4W7SA 5B57C 1UMCA 4GBMA 1XQXA 2XJ9A 2Z09A 4PPGA 3HKCB 2X8JB 3IP6A 1L1FA 4HK4A 1GPAA 3JQEA 4DA6A 2JI4A 5K6RA 3SLRA 3JWGA 3CWQA 5SZKB 5L4LA 1QP0A 3V2GA 4KZPA 2GEJA 4LJ6A 4OQZA 3U40A 2YJTD 3N0VA 4TQ9A 5F7ZA 1UKBA 3OLYA 4FOOA 5I48A 2QLMA 5BNZA 1L8QA 3DW3X 5C1BA 3G1WA 4DAOA 4IV0A 5HCUA 1T6XA 2CLFB 4FKZA 5TB5A 4LF6B 3PFKA 1NVWQ 4M7WA 3HADA 4ID3A 2O2XA 4KO8A 5FA5A 1QH8B 2B37A 4IOLA 1N4AA 3D2LA 4F86A 1QZZA 4KFRA 1MUUA 2KQUA 2GX6A 4FK8A 4MS1B 4RD3A 3QG5A 4I36A 4IIUA 5JJIA 4MUJA 2PBFA 5DT2A 2V97A 3CX4A 4BNYA 4V24A 1VP3A 4MVJF 1HLGA 1F6WA 4INPA 4LKOA 5ICEA 3R6LA 4N54A 4UEQA 2VTBB 2WSSA 1EE1A 2XMDA 1IWBB 1RBQA 3HJUA 4Q3BA 4EBFA 2YHSA 2PNFA 3TE7A 4V0QA 1VLMA 4MR9A 2A14A 2HMWA 4KI7A 4W5JA 1SHJA 4ZOAA 3H5AA 4I8IA 4QUDA 3TDKA 1T3HA 1NHWA 3IKVA 2PWZA 1NVEA 4PLCA 3UB3A 3V1TC 3V7WA 2I6FA 3CT6A 3ZWWA 1W7AA 4C4ZA 3CLRC 3OZEA 2WJVA 1BROA 1IQUA 3Q7IA 2V6IA 3MSCA 4FQ8A 4BJHB 1VFNA 1EWTA 3PI7A 2ZQYA 1TW2A 3GD7A 4PWZA 5A4KA 2OFPA 4C0QC 1G20A 1GPWB 1NW6A 1OXMA 2AZDA 1BEUB 4WFIA 1EU1A 3Q7RA 3IQWA 5J2UA 4YVFA 1GUDA 3GP8A 3OPXA 5IC5A 4TUYA 3ZLJA 4TTAA 1RXSA 3O94A 4WERA 4A26A 4YROA 4JI6B 4DMFA 5KHOC 4L4ZA 1V8ZA 3OA2A 1FFBA 1R1DA 2FA9A 4M8LA 4JBLA 1GZDA 5B1SA 3UXMA 2POQX 1E2BA 1O57A 5FNVF 3S2ZA 1D0IA 3FVTA 4N03A 4EEZA 4MUGA 2DC1A 5BXQC 2QN3A 1T0JB 1E59A 1XP5A 2C04A 3HNRA 4DM7A 4UFPA 4UXHA 4XYLA 4G1EB 4RFVA 1P1CA 1GQOA 5DBFA 3VR6D 4DYVA 3ZYZA 5F7XA 1JHPA 1BWSA 2QQFA 4B2YA 5FYQA 5JTTA 1EB9A 3ZNPA 2FMTA 1LWNA 1SWVA 4PG8A 2DJ5A 1OTYA 2HF7A 1MU0A 1XMIA 2ON6A 2P62A 2PLRA 2AR0A 2Q8NA 2BKVA 4J43A 4JYBA 4MA4A 4RK0A 1FMFA 4QDKA 1VHQA 5T6MA 4GAEA 3WLOA 4LXYA 1U2RA 3ZWQA 1U0RA 1XRNA 1CPYA 1PRYA 5DDIP 3BEOA 4LX8A 4OIMA 1M8GA 1I3LA 4ZCQA 1K92A 1GL7A 3DZCA 2AQHA 3I37X 4MINA 1VYUA 3G49A 1TOAA 4K9OA 4HQLA 4YY3B 4PYNA 2WB4A 4BVFA 3BQ9A 2P41A 2PZEA 4IZOA 1ST3A 2C3UA 3FMPB 2E48A 3QNUA 1RWNA 4K3UA 3KKKA 3FKSD 4JITA 4DS3A 2I1VB 4OLAA 1VB3A 2VWQA 4CFYA 2C9DA 1VXRA 2UYCA 1TEZA 1N6RA 2GPWA 2PZKA 3CPSA 1P5JA 2CLSA 4MAMA 1D4AA 2PSFA 4EGSA 3K71B 2GBLC 1OC4A 2YNMC 3JARB 3M81A 3GVPA 2RC6A 4KV7A 2BGJA 3NGXA 4UZEA 3OESA 4IJVA 2VS1A 5EMMA 4XGNA 2OV3A 3G8CA 2RGCA 3BA6A 2FWJA 1OVMA 2RHRA 1PT8A 1U02A 5I9IA 4Y9SA 5K01A 3THRA 3KE9A 4HFMA 1FDWA 1LPSA 1Z18A 4BQNA 3EXHA 5HF6A 4LNHA 1M2KA 5JCPA 1BYUA 3ENWA 3KZOA 1DQSA 1YB4A 1YDGA 1YVRA 2J9FA 2JD1A 4TLEA 3TUIC 1KVUA 2VUSA 4ISCA 2Z56A 4FFBA 3RWMB 1W29A 4EPXA 5IK2D 2ZU6A 2ZIXA 5EEGA 2C7RA 2G70A 1E89A 3Q3GE 4RADA 3K1AA 1TAQA 1XU7A 4F45A 1ZEMA 4RQBA 2VYVD 1T9AA 3ITKA 2O3UA 1JQJC 3AQ4A 4RD0A 1GQ2A 1RQLA 4TZTA 4DJFC 2DKNA 1NUAA 1KOGA 1UAGA 4Z9FA 4KG7A 4URHA 4EENA 1OBCA 3HDJA 4K6HA 4BLQA 2PM8A 4EEXA 2JKVA 1U7HA 4AK9A 4JX9A 4D8WA 2FJUA 4JASB 3ZCXA 3H6KA 3QMPA 2F4VB 1V1RA 1QO9A 2AW3A 3SZ3A 5HFNA 2NZVG 4IOJA 4I6GA 2WU4A 5DLPA 1KZ4A 5H3HA 2ZWIA 4R8MA 3F6CA 2P3OA 2VQEB 4K9LA 1M1YE 2E4AA 1ZD8A