4BZZA

Complete crystal structure of carboxylesterase cest-2923 from lactobacillus plantarum wcfs1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
275
structure length
275
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE/ESTERASE
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 88
structure length 275
sequence length 275
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bzzA00
3MVEA 2VATA 2ZJ7A 3G9UA 1ETHA 3VJKA 2XMSA 5DYWA 2E3JA 4GECA 2OQVA 5LIPA 4C01A 1MNAA 3HABA 4H7KA 3AJAA 1NU6A 1E8NA 2OCGA 1LZKA 4C4XA 1ACJA 3MUNA 3STUA 1W6RA 1GKLA 2I3ZA 1E5TA 1X2BA 3LCRA 5LZ7A 4PSDA 4Q3OA 4Z49A 1IZ8A 3NOXA 1QZ3A 3WWCA 3C6XA 2RHWA 1E66A 1R3DA 1CLEA 4BVLA 5BV7A 1QO9A 3IUMA 2B61A 1YA4A 5ALYA 3ZLUA 3OC0A 4XX1A 1JU4A 3W9BA 1TQHA 4IH4A 1UXOA 4UBJA 4N8EA 4J0IA 4BAUA 4WDQA 2VF2A 2VTVA 2CMFA 1XLWA 1CUYA 4FDMA 1QLWA 1TCAA 1XZBA 2DCMA 1GT6A 3FWHA 5KREA 3JW8A 3VJLA 3CN9A 4BAGA 1BROA 5CH8A 2WIGA 3IUQA 2AJCA 5AI9A 4M0EA 5AM2A 3G0IA 1CUSA 4CIAA 4BP8A 4ZWNA 4LIPD 4HVTA 3L1HA 4LYDA 1MO2A 1EVEA 2DQZA 3FVTA 1BCSA 2VT7A 2WKWA 1UOPA 3H2JA 1XRMA 4X93A 2BGNA 2DQYA 4X97A 1F0PA 1IUPA 1LGYA 4UHEA 2W6CX 3SWWA 1JKMA 1J1IA 3N2ZB 4HRYA 2C5GA 1R4ZA 1CUBA 4BTLA 1Q0ZA 1DINA 5ALJA 4BRZA 4LXHA 3A2NA 2GBCA 4Y2TA 1QIMA 1THTA 5IVIA 1GZ7A 3WIOA 1DQYA 3EF3A 2XT0A 2I3DA 5ALKA 4AMZA 5FKJA 1GGVA 1UOOA 5FPPA 3D2AA 4DNFA 4D9JA 2DHDA 3HACA 4U2CA 3IIIA 3PFCA 1J07A 1JI3A 4MQLA 2HA0A 1JJIA 4F21A 2BKLA 2QJRA 7YASA 3GROA 3HEAA 3VISA 1IMJA 2OG1A 4QNNA 4B84A 2PVSA 5HQ3A 1BCRA 2JEZA 1MN6A 4H7IA 2QJWA 5BOVA 1BRTA 2H7CA 3BIWA 4QDOA 5K3BA 3G9TA 1UZAA 2V96A 3PFBA 5AP9A 5EHNA 5IVHA 1HDEA 3U0VA 3T52A 3I2KA 1SFRA 1AC5A 2ONCA 5AHXA 3HYSA 2ECFA 2GYWA 1M33A 4OCZA 1MJ5A 3VVLA 4MWTA 3I6YA 2IX9A 5AK3A 3N0TA 3BXPA 2WG0A 2CJPA 4W9RA 5LLSA 4BATA 3A2MA 5HQ3B 1WPRA 3LS2A 3M83A 2WJ6A 3C6ZA 1JJBA 1GPKA 2PUHA 3I2IA 4ARBA 3WWEA 3HRHA 1JMYA 5JIBA 5CURA 4HZGA 2UZ0A 1CEXA 5AICA 1R50A 2V98A 5AKEA 2JGKA 4TVKA 1DQZA 4BDTA 2BCEA 3B5EA 3WA7A 1G4HA 3ZLTA 4PSUA 1EHYA 4KAFA 2XQGA 4BE4A 4OUKX 1GPNA 4B82A 3IUJA 4F0JA 3ANSA 2WU4A 4JEIA 5CTAA 3X3HA 5JAPA 2Y2VA 3WJ1A 3H18A 1XRQA 2DFPA 2JGMA 5AM5A 5YASA 4UFPA 1LPAB 5HF5A 1VKHA 1W75A 4FFWA 1VA4A 4G4JA 4X3CA 1EK2A 1XRNA 2QUBA 2VAVA 2ZSIA 1DTEA 4X90A 4FBLA 1N1MA 2B4KA 2PL5A 3WK8A 1MAHA 2B9VA 1TCCA 4Y2XA 3KDAA 3BF7A 4OU5A 2J3DA 3ED1A 1HBJA 2Y2UA 2JGLA 3PUIA 1T2NA 4BZZA 1QFMA 1FFBA 3M82A 3R3ZA 4KYVA 2XLBA 3QITA 4HRXA 3HZOA 4I4CA 2BJHA 1Q83A 5ALLA 5KBYA 3WWOA 1QIHA 4Q3KA 1XRPA 1TIBA 5E4YA 2WUEA 2YASA 4OB8A 4CIBA 1H22A 5C8ZA 2H7YA 2EDAA 2WILA 1YAHA 2BUAA 3H2GA 2BFNA 2PSFA 2C0PA 4BCDA 5SYMA 3LP5A 4IQ4A 2PU5A 3C70A 3WA6A 5DTIA 3KSRA 1AMNA 2HU8A 2PPLA 5I7UA 1BEEA 1ZI9A 2WFZA 5HCUA 2J3QA 1ODCA 1IUOA 2R8BA 3WKDA 1Y37A 5AKIA 1ZI6A 1K6EA 4P9NA 3IB3A 4QA9A 1A7UA 1SOMA 3O4JA 3AZOA 1CUAA 5AKZA 1LPMA 4NMWA 4NZZA 1DU4A 1QIDA 1XQWA 4X92A 2JIDA 2VSQA 2AXEA 4WJLA 1IVYA 3YASA 2VQ6A 5LZ4A 5CBKA 4GEGA 2DHEA 3ANTA 1AGYA 4Q82A 2GZRA 5AK6A 4X94A 2ZYIA 4W1SA 5H3HA 2G63A 3WIBA 5DYTA 4G8CA 2JBWA 1XZMA 1WB4A 4UHFA 5HZGA 4ZREA 2HL6A 4FNMA 5CT8A 2I78A 3A6ZA 4XWGA 4EBBA 4Q3LA 1NU8A 4MJ3A 5CT9A 3G0DA 2WM2A 1ODSA 4DSZA 2ROQA 5AKHA 2FX5A 4X91A 3PUHA 1U65A 2OAEA 2GBFA 4JH0A 3HI4A 2FJ0A 3QBJA 3F8SA 5HKAA 4UHDA 3D4LA 4QZVA 5CW2A 4WFKA 4Y2JA 1AKNA 4BDSA 5AKJA 1BU8A 1EVQA 4KE6A 1Z68A 2V97A 2NW6A 1UKCA 4HS9A 5AK4A 1DWQA 2Z5GA 4I3FA 5ALXA 5DYYA 5JD6A 1H2YA 3D5EA 3C43A 4OSEA 4G8DA 5JZSA 5HF8A 4ARAA 4GHWA 1EB9A 1LPPA 5HKBA 5ALQA 1TK3A 4XJVA 1CQZA 5ALIA 4PQEA 1L7RA 4DSAA 4EY5A 4O08A 2Z3ZA 2X76A 4QDUA 4NS4A 4QDTA 3V48A 2RGUA 3QMWA 4FFVA 5ALNA 5AI4A 1UK9A 1H2ZA 2XUQA 3ZV7A 4DIUA 4N5HX 4B80A 4DM7A 1CUVA 4H18A 4FHZA 5D7BA 4J0CA 4X6UA 1UKAA 3W06A 1XQVA 3WK7A 3R40A 3R3YA 5AI8A 1XLUA 3C45A 1UK7A 1LBTA 3KWFA 5HF9A 5I9IA 1EINA 4J0KA 2HDWA 3W05A 3PDCA 3STTA 4DGQA 3ZPXA 4BYMA 1RP1A 4GXNA 1GQSA 4GI1A 5LZ8A 3DYIA 4GLBA 3G8YA 2XUOA 2VT6A 5LYYA 1QTIA 4FOLA 4EY6A 2V9ZA 1GXSA 3E0XA 3QPDA 3STWA 3MUOA 3IVMA 5K3EA 1L7QA 3WKCA 3QPCA 2XQJA 4PNZA 4UFNA 3EQ8A 3H04A 1EDBA 2Y1KA 2H9YA 3DQZA 5BWBA 1CUJA 2ORYA 5ALWA 4ETWA 3VJMA 5FRDA 4DNQA 3WL6A 3QYJA 1K63A 4EHBA 5AIBA 5AKYA 3OG9A 2ZJ6A 1JT2A 5JYCA 4G4IA 1WPXA 4UBNA 4BE9A 4GDMA 4E46A 4IO0A 4G9EA 3F98A 4AO6A 3R3XA 4J03A 4BCBA 4EZIA 1FFCA 1SCIA 4PV7A 1XLVA 5ALFA 3I2FA 5FDFA 3P2MA 4AZ3A 1CUFA 4UHHA 1THGA 1UWCA 3D2BA 1A8UA 1FFDA 3OOSA 2O7VA 3I1IA 5A71A 4OYYA 4UBMA 3C5WP 4KAAA 3D0KA 1R88A 4DMKA 1MX1A 4LYEA 4BC1A 1XZLA 1EA5A 3Q0TA 1GQRA 5HF6A 5KWJA 1Y7HA 1QIKA 2BGRA 2G5TA 3WK9A 5AI6A 4AO8A 5T4EA 3WYDA 4BAZA 4CG1A 4H7HA 2B20A 1NX9A 5A6VA 1KU6A 3WQHA 4J0DA 3SX4A 3C8DA 5ALDA 1O6FA 3HLKA 2DSNA 4CG3A 4EY7A 1XZJA 2PX6A 5IVDA 2C7BA 5CXXA 4BTVA 4QE3A 1X2EA 3KD2A 5JAUA 5A7FA 4FLFA 5EI5A 3BDIA 2OGTA 1XZEA 2OCKA 3H1BA 3LLCA 4ZRDA 4EA6A 5AH0A 2AJBA 3IURA 3BDVA 5CH3A 4KJXA 3O4IA 2EEPA 4FLEA 5AKKA 1EDDA 2GBGA 4JYPA 4N5IX 5F4ZA 1K4YA 4IHAA 3K2IA 1BEZA 1QJ4A 2ZJFA 5T4FA 1SCQA 4B0OA 3AIMA 2PSHA 1B6GA 1PFQA 3B3QA 1MU0A 4CG2A 2ZSHA 2JF0A 4J3JA 2CBGA 2JGEA 5ALGA 4Y2VA 3UUFA 1VLQA 1N5RA 1HLGA 4IH9A 3G02A 1PJAA 4A23A 1ZD3A 4X95A 2VJAA 4C89A 2ZYSA 3AUKA 4MWSA 2GBIA 3IULA 5JARA 2ACKA 4ROTA 5K3FA 4P93A 2J4CA 1O6GA 2VAXA 5ISMA 3I6MA 4MYSA 1QGED 3VVMA 2CB9A 4K6HA 4AX4A 1CFJA 2HHAA 3BL8A 4B83A 2HRQA 2JGFA 2PSJA 3AFIA 1CUXA 2XMQA 2X8BA 3FCXA 1XQYA 4RE5A 3QVMA 4FBMA 4LHEA 1ZGCA 5DWDA 1P0MA 1XZHA 4GW3A 5FOQA 5CT5A 3AZQA 2RAUA 5D3ZA 5K3FB 3WL7A 3D59A 3H0CA 1FJ2A 2VA9A 1I6WA 4U2DA 1YB7A 2DHCA 4PW0A 3R3VA 5FUMA 1QIEA 5IKXA 1F6WA 2VJCA 1VJ5A 5ALMA 2C4HA 3EQ9A 4I19A 1KU0A 2XUFA 3DL4A 3TRDA 1ZICA 2QXTA 3ESCA 1YA8A 4J0GA 4Y2PA 2OCIA 3QH4A 5AOCA 5AKLA 3R3WA 4YASA 4H7FA 2QOEA 4Q1VA 4AO7A 4H35A 1U2EA 4LKOA 2XMRA 4MEBA 2XUDA 2P8SA 3G7NA 5C81A 1YASA 1TCBA 2PUJA 4WFIA 1FFEA 4F5ZA 1R9NA 3T4UA 3DKRA 2WUFA 4FNGA 4X7BA 3BJRA 1XZKA 3F96A 2WJ4A 5JD5A 5LP1A 2C5FA 1K5PA 1R1DA 1C7IA 3DNMA 4BP9A 2VJDA 4B9EA 4AQDA 1CUDA 1E8MA 1USWA 3DOHA 1QIFA 5IVKA 3G9ZA 3QZUA 2HFJA 4HAIA 1CRLA 1YAJA 4OB6A 1ZIXA 2HU5A 4U2GA 3L1JA 3EQ7A 4H7JA 2VJBA 1YS1X 1HQDA 3LIIA 5HK8A 2K2QB 3M3DA 4C88A 5FP0A 1W1IA 3H2KA 1WM1A 1GKKA 1BS9A 3OTQA 3O0DA 5DLPA 3FYTA 4YPVA 5C7YA 2WUGA 3R41A 4J0JA 4P08A 3W04A 4WDRA 1QTRA 5KWIA 5D6OA 4UPDA 2HRRA 4QDXA 1OCEA 4N8DA 4KAJA 4QDZA 4KEAA 3PF9A 4BVJA 3AZPA 2HA7A 3O95A 4MEAA 1CUHA 3OM8A 4DNPA 4OB7A 2WG1A 3F67A 3TGLA 2WIDA 1ORWA 5ALOA 5JAOA 1ZOIA 1YR2A 4WFJA 3WLAA 2QS9A 1Q0RA 3C6YA 3GFFA 1YSCA 4Q34A 5EHXA 1A88A 2ES4A 3UMJA 1TKRA 1ZJ4A 4W1PA 1XFDA 5K3DA 5SYNA 3WK4A 2XMDA 1QE3A 3DCNA 4X85A 1DX6A 4ZI5A 1P0IA 3VKFA 3QPAA 1VZ2A 1LLFA 1EXWA 3V9AA 4Y2RA 4GBGA 4XIIA 4UUQA 1FFAA 3FYUB 3V1LA 3FVRA 4Y2YA 1CVLA 4WCVA 5EHZA 4IH1A 2WUDA 3WWPA 3WZLA 5JZ9A 3LIPA 5I8PA 2HU7A 3WKEA 4KE8A 2WTMA 3AIOA 3V1KA 2H1IA 5FLKA 3SK0A 3W2TA 4AMYA 5JADA 3SC2A 4RPCA 3DEAA 4E15A 1UOQA 3I28A 2ZVDA 2RI6A 3DYVA 4FKBA 5T4HA 1JMKC 2ZYRA 3QM1A 5A7HA 1H23A 3BE8A 2EDCA 5ALRA 1HPLA 4CFSA 3AILA 5IH7A 1ORVA 5K3CA 2XMGA 5DNVA 4JNCA 5K3AA 4L0CA 3WK5A 1VOTA 4DMFA 4A5SA 3WI7A 4BB0A 1RWQA 3ESDA 1F0NA 3TEJA 1P0PA 3Q8WA 1ZD4A 4H77A 4Y2UA 1TAHA 1XRLA 4KR0A 5ALPA 2O2IA 3I2GA 3R3UA 1QIGA 1LPBB 5D3KA 3I2HA 1C7JA 4CCYA 1LBSA 1AQLA 2G4LA 5LZ5A 3WL8A 4BVKA 4B0PA 3DKKA 1XKLA 5ALTA 1B41A 2AJ8A 1XKTA 1MNQA 1MTZA 3S2ZA 1ISPA 5EIHA 4LXIA 5EIEA 1UK8A 2AJLI 4W63A 3WMRA 5E4JA 4INZA 4ZGBA 4OU4A 4QWMA 3AINA 4QLAA 5ALZA 1LPOA 4E14A 2WTNA 4ZV7A 2ACEA 4L3WA 4DYHA 3O9MA 4UBKA 1SCKA 4OPMA 5A7GA 4J7AA 1SC9A 4CCYB 1CR6A 1VZ3A 3HXKA 2XUHA 2XUPA 5DNWA 3DLTA 2QM0A 3JYHA 5EFZA 1TRHA 1N5MA 3E4DA 4BCCA 3M81A 2QMQA 2CKMA 1AURA 3ESBA 1XZGA 4C4ZA 2WIFA 3KOOA 2RHTA 2RONA 5ALEA 3G0BA 2WFLA 4AN1A 1BN6A 3V1MA 4BZWA 1W4LA 4G4GA 3I6ZA 4L72A 5E4TA 4W1RA 1CUUA 2W22A 3CXUA 3H19A 3WZMA 1HL7A 4AB1A 5A62A 4C6HA 4WY5A 5T4BA 4YK7A 3FNBA 1MT3A 1WHSA 3BWXA 5EHQA 2XMZA 1W52X 3HSSA 2WFLB 3O9VA 4CCWA 4UHCA 4K6KA 3PICA 1LNSA 4X6XA 5CRIA 1XZAA 3UUEA 4HXGA 1CQWA 1ZD2P 2OAGA 4Y2SA 1EI9A 5AM3A 3QMVA 4MQMA 3RARA 2HA5A 3WYNA 1DT5A 2C0QA 1H2XA 1P0QA 3R0VA 2PSEA 3HJUA 1CUGA 2CZQA 1EK1A 1HKHA 3PE6A 1LPNA 5J3JA 3ICVA 4Y7DA 5CXUA 1IZ7A 1EH5A 3RLIA 3DDUA 4KRXA 3FAKA 1U4NA 1QO7A 4PSCA 4TPKA 3GUUA 4PF1A 3NUZA 1ZIYA 3BIXA 1PV1A 4C4YA 5JAHA 3OURA 5JANA 3G9XA 5ALHA 2WJ3A 3RKSA 2O7RA 4W1QA 3ZI7A 3EBLA 4AN0A 5A2GA 3O4GA 1CIJA 2X5XA 4K5QA 3EIOA 3NWOA 2WQZA 3F97A 5DNUA 2Y6UA 4FMPA 5JZBA 1DWOA 4LXGA 3STVA 2WFMA 2OGZA 3VXKA 5JASA 4NVRA 4A16A 2WSLA 3E3AA 4HTAA 2XQIA 4U2BA 1UFOA 1YS2X 2WIJA 3KWJA 3GELA 5AKGA 3A70A 2WIKA 3WWDA 1YCDA 4EB0A 5JD4A 5AI0A 2GYVA 2QTBA 2XQFA 4GWLA 3CCBA 4OD0A 3D2CA 1QONA 2PBLA 3GBSA 3IBTA 1CUIA 5FV4A 2HIHA 1MX5A 5FPQA 1IUNA 2D0DA 3RK4A 1CUCA 5AKXA 2WHPA 4K6GA 2O2HA 1AZWA 2XLCA 2JGIA 2IIVA 4XVCA 4CI9A 2YXPX 2WU3A 4JYMA 1H2WA 3DJYA 4DLNA 2HA2A 1XZIA 1EX9A 2QKYA 3F9CA 2QZPA 1CUZA 1G5FA 4QWWA 4BBZA 1UT6A 4FLMA 3STYA 2PKYX 3WKBA 3GA7A 4B6GA 5AO9A 2C58A 2XUKA 3C87A 4RGYA 1OILA 4UBLA 2RIPA 3IUNA 2QUAA 2WHPB 4UBIA 3H2IA 1WCYA 4EY8A 1R9MA 1QIJA 4AXBA 2FUKA 1EB8A 1ODTC 1XROA 4KACA 1ZI8A 2BUCA 2OPHA 3BF8A 1DWPA 2XMCA 1WHTA 3BJMA 1XRRA 3WK6A 3FLBA 3FSGD 3W9UA 1EDEA 4U2FA 1QOZA 3DOIA 1MPXA 3L1IA 4KE9A 1J06A 2XI4A 2BAGA 3DL7A 1N8SA 1L7AA 4KE7A 3PI6A 1G66A 1A8SA 2O2GA 1WOMA 3I1YA 1VE7A 2XUIA 2VEOA 4KRYA 1QIIA 4HXFB 1T4MA 5BWCA 2AJDA 4G9GA 2QR5A 1J2EA 4U2EA 4UBOA 3ILSA 4OYLA 4L9AA 1E3QA 4B7ZA 1CUEA 1U8EA 2GYUA 2J4FA 3C5VA 4TGLA 4RE6A 4X6YA 2YH2A 3DD5A 1JU3A 4FWBA 2QVBA 2YYSA 2LIPA 5ALUA 1S8OA 3I2JA 3CCCA 3ZWQA 5DTJA 4H7DA 5HK9A 2HA4A 4BRSA 3D3NA 4QEKA 1DX4A 2HA6A 2I03A 2PSDA 3ICWA 4AZ0A 1BE0A 1VE6A 2HFKA 2OGSA 3H17A 1FSSA 3FYUC 3FYUA 2HADA 1ZGBA 4G5XA 4B9AA 2DR0A 4JUIA 4M0MA 2R11A 3S8YA 2XUAA 2OXEA 3DS8A 1VXRA 4EUSA 3E1GA 3PF8A 2WLSA 5ALVA 3AIKA 4EY4A 3VDXA 4UFOA 2XUJA 5AJHA 1E89A 5LKAA 3FOBA 1G42A 2H7XA 3H1AA 4H7EA 2BUBA 4S0XA 3G0GA 4G8BA 1CV2A 5CT4A 5HFAA 4K2AA 4B85A 3B12A 1RYYA 1LPSA 1ACLA 1WB6A 5DJ5A 2Z8XA 4ZV9A 1XZCA 2Z8ZA 2ZYHA 1DT3A 1KEZA 1WB5A 1JJFA 1MAAA 2IITA 3WKAA 2PU7A 1XZFA 4Y2QA 3QMMA 1VXOA 3TJMA 5LZ2A 2OCLA 2CUTA 1XZDA 2PM8A 4PO3X 4DMHA 5JALA 4B81A 1E8DA 1K8QA 4BC0A 3IDAA 4H0CA 4M0FA 1Q84A 1QFSA 6YASA 4MXDA 2XUGA 5C8VA 1AX9A 1OXMA 4N8SA 3D7RA 4E11A 3C8HA 1AUOA 4HXEB 3WL5A 4MYDA 3FLAA 2XE4A 2Q0XA 3ZLVA 2JGJA 2CEKA 4QLOA 3WJ2A 5FXMA 1JFRA 2Y6VA 2XQKA 3KXPA 1Y7IA 3FSGA 1W76A 5EGNA 1F8UA 5AOBA 4RNCA 3RM3A 1UK6A 3K9BA 1BN7A 1LZLA 5CMLA 1MX9A 1VA5A 4J0HA 4G1FA 3O4HA 2QXUA 4DNOA 1A8QA 4F60A 4P92A 3OPMA 5AI5A 5AM4A 1CPYA 3NGMA 1ZJ5A 4ZXFA 2OQIA 5EIAA 1UKBA 5JATA 3IA2A 3HC7A 3JWEA 5AIAA 2JEYA 3FBWA 4UHBA 4X71A 1GPLA 3GZJA 3STXA 1CUWA 5CT6A 3FCYA 2WHQA 1C4XA 3CN7A 2HA3A 5ESRA 4Y9SA 2OLEA 1X70A 5HFNA 2QRUA 2FJPA 5AM0A 4DMCA 4FTWA 2GZSA 3K6KA 3U1TA 2HM7A 2WG2A 3ESAA 4V2IA 3H2HA 4YX9A 5K5EA 4ITVA 4Q05A 5AM1A 4WY8A 1XQXA 2D5LA 5LZ9A 2XMBA 2XB6A 5ALSA 1D07A 1ZD5A 3C6BA 5E2IA 4X00A 4DTCA 2QT9A 3G0CA 2Z3WA 2G5PA 5AK5A 3MGAA 5LKRA 2WHRA 3V1NA 3A2LA 3FLEA 4C87A 2XDWA 1YB6A 5C8XA 5AOAA 5CH5A
chains in the Genus database with same CATH superfamily
2G6TA 1IPHA 4N12A 3VC2A 3L2OB 1W4CA 2VYVD 5E6UB 1GCAA 1JSLA 2IVZA 1ZWKA 2CVPA 3RYCB 3FPAA 3H2YA 2AR0A 1TW3A 3RT9A 2EFEB 2UYHA 4V0ME 2FPOA 4KQKA 3ZQJA 2XB2A 4W9NA 2E3JA 1EEXB 4DCJA 4FE3A 2B34A 4MLCA 3GPDG 4H7KA 4URUR 1DAEA 5TQ0A 2CMGA 1RTKA 1E8NA 2JD0A 1V95A 3GAZA 4GFDA 4KU4A 1ISJA 3PEUA 4NL4H 1LZKA 1VIVA 2O23A 1ACJA 2ZJYA 3A9CA 3MUNA 1II8A 3SLKA 1LBIA 1B43A 1P44A 3IAS6 3ILYA 2H48A 4Q6WA 2D00A 3E8MA 4Z6KA 4ZEWA 3AT1A 1KSHA 3QUAA 3OJCA 5EMKA 3V4RA 2X4LA 3CF6R 4YRBA 2UVQA 1QZ3A 3MTDA 3WWCA 1A9PA 3B5JA 1R3DA 3SQWA 3L7YA 4NG4A 4MW5A 3P0FA 3TZ6A 2ZPTX 3FBTA 3SSMA 3ZWBA 4FMCB 4HDAA 4PZYA 4WZBA 5CYOA 3ZGXA 1QO9A 4V0KA 4DWOA 1SWWA 3R5KA 1M6YA 2PA0A 4PLTA 4NOLA 5A4IS 2Z08A 1SKYE 2C7VA 4RTMA 3B9BA 4EO4A 1DJOA 4TKVB 2V1XA 2KPOA 3R6DA 4N54A 4QSHA 3WDKA 4YR7A 1JHUA 3HFJA 3GLFA 1RBZA 4LN1A 2A2ZA 3DZDA 3HUEA 3RKRA 2NAPA 1KIAA 1KJQA 4FDLA 1L4UA 2IYVA 4RL6A 1H42A 5GGYA 2CHEA 4CXMA 1XELA 2PFSA 3KT0A 3NVAA 4HQLA 4YJFB 2HUNA 3V9PA 3LCCA 4JI0B 2KW5A 4QM6A 1U99A 4BLOA 3WX0A 4N5LA 3FGPA 2RHLA 1OHHA 1Z7BA 3LY5A 4PNEA 2ZU6A 4UVEA 3V2UA 3L0DA 4I6JA 4C30A 4BMSA 4XUCA 3TTWA 3C3MA 5A3VA 4N8EA 4EW3A 3N3AC 3REQB 1DKLA 2JCYA 4FZ5A 2VF2A 3VDNB 3WR5A 1EK0A 1XK6A 3RU2A 4GL2A 2AOUA 2ATXA 4PAWA 2QMYA 3GLTA 3IKMB 2NP6A 2VZLA 3G2NA 4FDMA 2VSXA 2VQ3A 3KZXA 3EVDA 1KO8A 2ADMA 2NWQA 4I8DA 1QLWA 1TCAA 1Z07A 5JQGF 5ED4A 2JFQA 2AEJA 4MUMA 4BP3A 1JJVA 1T10A 2A1IA 5C4MA 4IAOA 4EG4A 4GUAA 4QYXA 3C41J 3FPSA 1EJ6A 3LZ6A 5EY5B 5JTTA 1KWKA 4BQIA 3VHLB 1IN4A 2VUIB 4MQ5A 3LL4A 2A9OA 5BURA 4QU8A 4UUMA 3KB8A 3NTXA 3CG0A 1VPVA 2OUIA 1I4EB 1P6UA 3K5WA 3GGDA 2CDRA 4XAQA 4XEHA 2AFHA 2DPMA 4O63O 5MDHA 3G2JA 3UMCA 4MI3A 4DJTA 2ZJBA 2VBGA 1ACMA 1JHMA 4J6FA 3B6ZA 5AWFC 1P75A 3V8RA 2FWJA 3FYSA 3I04A 3LW8A 5L4SA 2AKAB 5IASA 1O8CA 2GR9A 3A6LA 3WHPA 3WNZA 2W6ID 1PFGA 2C3MA 1EVEA 3MQ4A 1Z82A 3L0SA 4AK9A 5BWOA 1YMVA 3FVTA 3ONFA 2Q5FA 3MHPA 1C8KA 1E1YA 1JHDA 3JAMA 1XB2A 2VT7A 4J0EA 4LNHA 1RI4A 2WNSA 1Y89A 4B32A 5EEGA 3FUTA 3PENA 1FUUA 4YDQA 3GNLA 1F0PA 1X77A 2R1VB 5KNCD 1IUPA 1MXFA 3SFZA 2F4NA 4Q7JB 2J9FA 3BBPA 1LGYA 3WV5A 1Z56C 4H6WA 4DOMA 3HXOA 1R6VA 1W6UA 4ZQFA 2C7RA 2EFDB 4KLZA 3GLFE 4UHEA 2YIDA 2FPSA 3TLZA 1II0A 1K8YB 1N9ZA 4JR1A 5SYAA 1I2BA 3BXOA 3SWWA 1RSZA 1GNPA 1PFVA 1Y5IA 4RY0A 5EVCA 3UT0A 2C5GA 1R4ZA 3HHEA 5UKDA 1MRNA 2QVGA 3W5VA 3WNCA 4DABA 3OE1A 4HF7A 1NJ1A 16PKA 5EN4A 3B6EA 4H27A 2R6AA 1DBRA 3QSGA 2FFBA 2NO7A 1E2QA 3A2NA 4MCAA 3BRWA 3DC2A 4GX5A 3DBLA 4WXHA 721PA 2BEWB 2UDPA 3EN0A 2YUTA 1FP6A 4QOGA 2HMWA 3MJTA 5EWJB 2ZJ1A 4XGNA 3U5TA 3RT1A 1K5GA 3HJAA 4R51A 4YRNA 3U3ZA 1N4AA 1PSWA 1FMJA 2ZOSA 5BPHA 1UOOA 1YRAA 1SBYA 2QM7A 4D9JA 2C92A 4XPIB 5K0CA 3OQOA 2WKRA 4U2CA 2C3OA 4R9VA 3V55A 3QX9A 4IFIA 2WF5A 4MV1A 1AKMA 1ESDA 1M2GA 2DTEA 5A9SA 2BGJA 1J8MF 3TB4A 2O3RA 1IM8A 2BKLA 2JFVA 2Z0MA 3SS8A 4IXWA 2F1JA 4M1WA 4GYKA 2RKOA 3ZHBA 4B3XA 4IZHA 3ZWVA 1NUTA 2HD4A 5F1YA 1XTIA 3M1IA 3C15C 1FUKA 5HKOA 2AFHE 2V5UA 3G2LA 4MWOA 3ZW7A 2LNDA 5FBVB 4NENA 4M1MA 3IOBA 4QNNA 2GN9A 2PVSA 5HQ3A 2GEUA 2VYFA 3FVQA 2QSUA 3CX8A 2P2ZA 4A0QA 3D64A 1ZW1A 2YWBA 5IMSA 2F8LA 5IKPA 5BOVA 5WRFA 3REGA 4GKVA 3WY9A 1SIUA 1HMYA 1W59A 2VL7A 1BWPA 3MSCA 3Q7RA 1PT7A 1KYYA 1OV4A 5EJ5A 1I14A 2AN4A 1R8YA 2IUFA 1SIWA 2WJZB 3KVVA 1EK5A 5ILGA 5K3BA 3G9TA 3U37A 3GRAA 3ZJUA 3H1GA 2HH9A 4MTLA 1SXQA 2V96A 4M21A 4NIMA 3KZVA 5AP9A 1JZQA 1EUCB 2ZR8A 1BEUB 3Q10A 1HDEA 1KDTA 3TRKA 4AJEA 4CKEB 4RKEA 3UXHA 4WKGA 4ZOEA 1XA0A 3WLJA 1QLHA 4WEOA 3MOGA 1TAUA 2Q5CA 1AC5A 5BXQC 4EL0A 3KWMA 3HYSA 4OQDA 4ZDIA 3N2GB 4PWYA 4GF5A 1I7DA 2J9GA 1ILWA 1WXWA 1AUXA 4JJ4A 3B3GA 2O3JA 4N7BA 2EG5A 1R7RA 2G7MC 1IEVA 5AK3A 3N0TA 3A27A 3BXPA 1LSOA 4PZ0A 3GMTA 3PRJA 4TTJA 3R4VA 1RKBA 3PFFA 4CDRA 4RTKA 3R0JA 3MYRA 4W9RA 1N7JA 2YFQA 3CMCO 5BN4B 2UKDA 4V03A 4D9NA 2VPIA 1OB2A 3I83A 1WMFA 2RKWA 5AVTA 3C6ZA 4GYWA 1TK2A 2FZWA 1GILA 2GEDA 1ZHOA 1UBFA 3IILA 3OAAA 2WAAA 1ST2A 4YQYA 1GPKA 1O58A 1FRFS 1SXJA 1RLIA 4YMHA 3EGOA 1ZJYA 2RG7A 5LL6P 1P4HA 4GRAA 3PDUA 1KYQA 2ZCUA 4GPBA 3R74A 4HZGA 1E2NA 4FZVA 5IH3A 4QVKA 5MN5A 3N5CA 4GKJB 5EE5B 2Q9AA 1XCMA 3E9ZA 3IPCA 1NVBA 2WQ6A 3QXCA 3TBHA 2JGKA 3RW9A 1HG0A 4Q18A 3I3OA 5C4IA 1NY6A 4CM8B 4BDTA 1K92A 4TV9F 1PLKA 2OKGA 5CYFA 2OBNA 3T9EA 1G4HA 2J6IA 2LKCA 1ZCBA 3WA7A 5KDLA 2OM6A 4ZT5A 2JI7A 3UJ7A 1OBVA 1PQYA 4AJHA 4BLVA 3BREA 2BP7B 1W8DA 3MT8A 3K0HA 4OKSA 1Z4MA 1YE5A 4QGAA 1EHYA 1OX4B 5BT9A 2XQGA 4DLAA 1B6RA 1I5RA 3GQVA 1SQ5A 3I37X 3IUJA 3O3CA 1PJQA 4B82A 4RW0A 1SUBA 3VR1A 4AIIA 2VI5A 1DV2A 1QM5A 1P3DA 3ADKA 4HO1X 3ANSA 2X0RA 1RADA 1Z0JA 2A88A 4RADA 2EARA 4BX2A 2ZBUA 2BFBA 4OATA 4X3OA 2AXQA 4G1UC 3WJ1A 1ISMA 3NAZA 1PHRA 1R0CA 3ETJA 5DGXA 2C1EA 1UBOS 2G76A 4J4HA 3EFBA 3JAKA 3LVRE 2BGUA 4QPNA 1XRQA 3EB9A 2F1HA 2QVYX 2PQ6A 2BMVA 3HP1A 4L4ZA 1E2DA 5YASA 1HDYA 1U8FO 5KVCA 2W4MA 3HKBA 1OYOA 3ZC3A 2QTFA 3UO8B 2XVZA 8OHMA 4FFWA 1GUBA 5JZMA 4X3CA 2JHGA 2L17A 1UWLA 4FYPA 3HI6A 3OQIB 1XRNA 9LDTA 1BGVA 3TDMA 2B6HA 3PGXA 2OTCA 4NV3A 4X90A 2O05A 2ZIVB 2ZRBA 2QXYA 1VI2A 3U7FB 2PL5A 4MV4A 3QUBA 1HNWB 4CIWA 4LOIA 1JHPA 3SC3A 2QTVB 3ICPA 1X87A 1LX6A 2XYPA 5LBTA 2WKQA 3KV1A 2GF0A 1AK9A 2J32A 3KDAA 4KDEA 4R3NA 3ZWAA 4F12A 1NXVA 4E2ZA 4OHCA 4NCKA 2Q4OA 2FY8A 2NSDA 2J3DA 4MTCA 4MCIA 3ZU5A 4KPUB 3ED1A 5K8LA 3NGLA 1ZD8A 2Y2UA 3IELA 3PUIA 3DT8A 4BS9A 1SXJE 5F5LA 4BZZA 3J81A 3IJRA 1J20A 5E2AA 2UUOA 2XTAA 3PX3A 3QU7A 4DR6B 3JQFC 1FFBA 3M3HA 3M82A 3R3ZA 4PG7A 2H1CA 4GI7A 5HILA 4EPYA 3DAFA 1VHJA 3HVRA 1KYTA 3HZOA 3PZRA 2JJ1A 4I4CA 1QDUA 1TJ5A 3GRKA 1PJRA 1QIHA 5HOQA 1N5OX 4BKPA 5C1PA 1XRPA 1FBNA 1X7ZB 2YOGA 4REOA 4V0LA 2HZBA 1IQ0A 3QX7A 4CIBA 4JLBA 4EG7A 4KHPB 4MS3A 1H22A 1ZGAA 4RETA 4NC9A 4F4UA 4G9BA 4AJ1A 2WILA 1YAHA 3HY4A 4B6JA 4L4YA 2BFNA 3N8KA 1NMSA 1RCTE 3GGGA 3VO8A 3OLYA 2Q46A 2R8EA 1DE0A 4YP5A 5LMUB 1I36A 4EJ6A 1DJNA 4BCDA 2XVAA 1FQOA 3DEIA 1IUKA 3LP5A 4FJ2A 5B1EA 2PU5A 4WZAA 1L3IA 4AI6A 2ZSFA 5D8DA 1E2IA 3WFIA 2YR0A 3IPYA 1T1JA 1RXWA 3PJEA 1WY7A 2H0AA 3WA6A 4FB5A 1K6MA 1O94A 3GEDA 1CQIB 2H1OA 3RS5A 3KSRA 1UMDA 3LPMA 2OBYA 5IBQA 3V3TA 2LTAA 3WNBA 1ENOA 2RGWA 4K05A 1SK8A 4FIZA 1I6KA 2NPIA 5F3DA 3GQBA 1S9DA 1HX7A 3AH8A 5HCUA 4B5LA 1V8OA 3T15A 5IU6A 3DLBA 1ODCA 4LW8A 4MUGA 4GQAA 4HJXA 4V3CA 1MHPA 1Y37A 2YXEA 3EY9A 4J91A 4TSFA 4F91B 3LPCA 4B3TB 1OXBB 3DEZA 4D3SA 1FXSA 3RPEA 4D42A 5SY9A 1K6EA 4IXDA 2P7HA 2P9ZA 2BGLA 2AQ8A 3K20A 4PZUA 3O4JA 1F8GA 2QRNA 2IEDA 3OPQA 3EDYA 4DC9A 4TRMA 2OCPA 3BGWA 4GP7A 4RD0A 4MDFA 1G4UR 3EZGA 3TLXA 4WI1A 1QIDA 1KJNA 1ZQ1A 2JHCA 4CR7A 1P1HA 3LBHA 2VJMB 2QRHA 5HS6A 1OH6A 2GRUA 2AXEA 3FNGA 1MABA 3KT8A 1C29B 4NXNB 2GAJA 3PQFA 3ABIA 1ZOSA 4BOYA 4WJLA 4YQFA 1T8TA 4H7PA 4MNTA 4QXAA 4NS1A 3K0AB 3TAXA 1T3SA 2OCXA 2QQ5A 3DAPA 1TD1A 2VQ6A 1D4ZA 1NBMD 1OBOA 2ISQA 1BDJA 2JLRA 2FHSA 1AGYA 2XA2A 3BWDD 1QPZA 3GRZA 1FP7A 2WZBA 4JAVC 2F64A 1RYNA 3ZN2A 3WB1A 2GTHA 3NHUA 4U9IS 1A8PA 5LMCA 1VIYA 1C8LA 3W2IA 2XAAA 3DBHB 4Z9XA 1VKRA 2FPKA 9ABPA 4LNAA 4L07A 5BQ3A 4W1SA 2GNPA 4WBNA 4NI5A 2GCPA 3QPBA 4ZODA 1CB7A 3INGA 1WB4A 4DIMA 1WXQA 4J07A 3NLLA 3VYVA 4B34A 2I7CA 1Z6AA 2HAEA 3UJNA 4ZREA 3E7DA 4FIDA 2Z8YA 4HPJB 3M9WA 4I66A 2ZAOA 1ZVJA 5KOHA 4KO8A 5TF4A 5CT8A 1SULA 3PC4A 4TTQA 1V9SA 4WZAE 3A6ZA 4XIJA 3B1WA 1VFPA 1KY3A 2HTFA 1KEPA 3HS3A 4EBBA 2ZJAA 3OTGA 5H4HA 2PSSA 1UXHA 4MJ3A 2A9FA 1F2TA 3H5IA 2BH2A 4Q1AA 2Y71A 4QASA 3LFUA 3N2LA 2G3YA 1RQPA 2AMFA 3GUVA 1PAUA 5M29A 4XJSA 2NPFA 2ZWIA 4UNPA 1XAIA 3CUTA 4KFUA 4RGQA 5NULA 3S0JA 1FLNA 2UYQA 1B8OA 2FJ0A 1UBEA 2XMPA 1Y82A 3BA6A 4PGFA 2IY8A 2G9NA 5JQGB 4M4SA 3F8SA 3DDNA 4M22A 5DGIA 5T8KA 3X2EA 3CZ5A 4YI5A 3D4LA 3MFQA 6LDHA 4IGKA 1J00A 1XDZA 3CIOA 5CW2A 1EP1B 5HG0A 4XWOA 1P8JA 4YDHB 1KO7A 4BDSA 5BP7A 3VUEA 4KXQA 2AF3C 1YI8A 2JI9A 3PQ6A 4EW2A 3CEJA 3K3PA 5BMOA 1Z68A 2V97A 1P4RA 1RVV1 2H1VA 4ZCQA 1WQ1R 4MVYA 3AV0B 4HS9A 2IDJA 4Y18A 1JQJC 2Z5LA 1DWQA 2G8LA 2SCUA 2Z5GA 4GPTA 4I3FA 4IRUB 4QPJC 1PKXA 3IEPA 1MJGM 3K05A 4G86A 1V5WA 5DYYA 4AJOA 5JD6A 1TLLA 5CCXA 2O19A 2RB4A 3D5EA 2YJ5A 3C3EA 5LB2A 1KYVA 2FUG6 3WJ7A 5KQPA 1GEEA 2AXPA 3NNDA 2HDNB 1GZHB 1R0LA 4OHOA 5HF8A 4AJLA 1LBQA 1JDJA 1LPPA 4H4EA 2CXRA 1BDBA 2GSWA 1K7EB 1SXPA 3HCRA 4IIEA 3GO4A 1WOYA 1V7QA 3RD5A 3TW8A 3RBZA 5I7VA 1CQZA 5F9FA 1KJYA 2UYOA 4JLWA 3SQLA 3ZZUA 5BSGA 1L7RA 4DSAA 1P60A 3TG2A 1E9VA 1O4VA 3W3AA 4MQ6A 2Z3ZA 1DBIA 1AZLA 2X76A 3T5DA 1T29A 4KYTA 2Q7DA 4F06A 2HMAA 2Y1DA 1ZSNA 2W4IA 3DP9A 2VXCA 1YJ5A 4MWZA 4NS4A 3UFXB 2HCBA 1MQSA 2CCJA 1L5YA 3KL4A 2YNMA 4ND5A 4CM6A 4UD2A 5DXFA 5KAPA 4NPAA 2LRHA 3ZHUA 4EFNA 4Z3DA 4P4SB 1R12A 1XAJA 3SXUA 1SC6A 1Y1QA 2NZWA 2ZI3A 2EG9A 3B9PA 4P7FA 3U4DA 3UKOA 3VZPA 4J2OA 4LQDA 2FMUA 2PKEA 3AY7A 1E60A 5JO9A 3JCZA 4G8JA 4P8RA 3VKUA 1QC5B 2VSFA 4O5OA 1I10A 1K9VF 1M5TA 2NZ2A 2XUQA 3TQOA 2VHWA 1XNHA 3ZW8A 1NNEA 1SGWA 3ZHSA 4FYXA 3AL0C 3SEFA 2WT8A 3AB7A 5KTPA 4Y2GA 3NFRA 4FGZA 1CS0B 2J08A 4MUBA 3AYXB 3NMUF 2WMYA 3I5AA 2YZGA 3F7TA 4U7HA 4ZYUA 4J0CA 2WWGA 2NVUA 1JLKA 6Q21A 1G6KA 1I2ZA 3SSOA 5IDXA 5L7WA 3R3YA 2X4IA 4DM4A 2P9YA 2X9NA 4V3BA 4UCFA 3TB6A 6PFKA 1G2PA 4LCEA 1YF3A 2IPNA 3PEYA 2AZXA 1QHIA 2FZ4A 3GJ6A 3KQNA 2GFQA 4DY4A 3KC2A 3ZQ6A 5HF9A 4HDNA 2RGNA 5HJ2A 4HS4A 1R15A 5A0FA 1IJFA 1UT5A 4CT5A 3KR2A 3UWPA 3ZBPA 3W05A 1KF0A 3UF0A 5A9TA 2FZKA 3CJRA 2HCRA 3IPXA 4QHYA 1T25A 4CL3A 1EUDA 2IIQA 4O4LF 3I92A 3P9SA 2IPMA 4LDAA 4E1AA 2VH5R 3PUYA 1J0BA 4GI1A 3FTQA 4CQLB 4CMAA 1LTHR 4MRVA 1G3QA 1YK0A 2VBCA 3LAWA 4GLBA 4W8GA 3ULKA 5DASA 1ZPDA 1P1FA 1T6ZA 1KGDA 1YBMA 2OLJA 3D4IA 1EM8A 3ER6A 4IGAA 4KX5A 3V8NA 2VZ9A 3HR4A 2VT6A 5LYYA 1QQAA 1ISSA 5HRAA 1FFHA 3I9LA 3V4LA 3WBJA 2JH9A 3LCMA 3FOWA 5CJ2A 2XYRA 2ZJ4A 4DCNA 4DLZA 5BMVA 1GXSA 1NBEA 2J87A 1C9EA 3HDJA 1HRKA 4ZU6X 2BMWA 4EATA 4FWTA 1OIVA 1KP9A 1Q1ZA 1N6OA 2C9YA 5KVAA 1NW7A 4PO1A 3KJQA 1UMCB 4H15A 3FFTA 1WTAA 1F5NA 1U2DC 3HE3A 1P2FA 3MUOA 1M6HA 3IVMA 4TZTA 3H2BA 5CDFA 2HF9A 1L7QA 3L6OO 3AF0A 1Z29A 2WTXA 3O2SB 3SY8A 5BW5A 3KD3A 1SXIA 4I08A 4QTUB 2CV0A 2JIPA 2EL7A 3OIFA 1EDBA 2X7JA 2H9YA 4JYCA 3ZNQA 3EJ6A 3HFSA 4L2IB 3DMYA 4Q4AB 5JO0A 1TVKB 3TZLA 2XNHA 3P2JA 4E12A 2OO3A 1YTLA 2AVNA 2FAXA 1LDBA 4O2BF 2GN2A 1RQ7A 3LVBA 4R1UA 5ALWA 1ZIOA 3RYFB 3TS1A 3ZJYA 4JU9A 4XOUA 4W9NC 1GPMA 3KPUA 2WPDA 5FRDA 2ZIEA 3J80A 4IIHA 4MI6A 3MT0A 3W8NA 4WXEA 3ZKWA 4NTZA 2CJXA 4KMRA 3SQMA 4ZI7A 2HZ7A 5KSZA 4GKBA 2G9VA 4EHBA 1PG0A 5AVQA 2YYAA 3H9CA 3OG9A 3U5ZB 2GQ0A 5G2OA 1GZ5A 3IQWA 4QTTB 1I1HA 1Q11A 1Z4QA 1A7JA 1JT2A 1NN5A 5FBRB 3IPAA 1YB2A 3WC4A 1R4MB 2BVNA 2Z4SA 2ALJA 2ZJZA 2J6BA 1YMQA 4WXPA 5ERYA 3B6JA 4M9SA 2VDQB 4QPDA 1C1DA 4E46A 4IO0A 5ELLA 4GSYA 2GWHA 2ZANA 3ELWA 4LQLA 3C7DB 4TV9B 5FEUA 4Z4QA 2AZDA 1EFLA 1ZIPA 3HDVA 4J03A 1U80A 2WWRA 4B17A 2A30A 1NRXA 1WNTA 5C18A 2R8XA 3EWIA 1ZK2A 4WZBB 3WGYA 1LNZA 2REQA 2ZVQX 3AY0A 3PPXA 1P6QA 4U02A 2VN8A 4NZMA 1XLVA 4N3CA 5ALFA 3CLSC 3I2FA 5FDFA 2YL2A 3BWBA 1J7JA 3SZUA 3URMA 4M9RA 1CUFA 1CEEA 2QLTA 1P2VA 5FV7A 1OFUA 2AD1A 2WWHA 2QQ0A 1JPNA 3D3KA 3F47A 1GZ6A 5IKEA 2HRCA 3SGLA 5GY7A 1YULA 2MYNA 3BSFA 3IEIA 1UWCA 3I1JA 3MJVA 4JB3A 3E9MA 4KP7A 2QRKA 2XF8A 3AR8A 4DJJA 5B1DA 3GVHA 1Y1RA 4Y2HA 3EUWA 3IPLA 1JSRA 4HDKA 3SBOA 1Y5NA 1ZUNB 4OXYA 3A7EA 1T8UA 3JD2A 1R0YA 3MYYA 4MINA 4OYYA 5A71A 3RBXA 4HX5A 4KAAA 5H16A 5KYUB 1MX1A 5F73A 5BSKA 1QZZA 4M0CA 4RY9A 2G04A 4CKCA 1K3TA 4DA4A 2PD6A 5CDFE 3BQNB 1T5LA 1PNTA 3NOQA 4G5YA 5IULC 1VDZA 5BQ5A 4DMMA 2PRZA 1N5KA 1A9XA 1D1TA 1SU8A 3Q5DA 2JFWA 4BX3A 1OXVA 3GNSA 3MK31 3RRBA 5T7BA 5K4HA 5EJ4A 3N2YA 2RHDA 2XOKA 2Y1FA 1DO2A 2ASVA 2X2PA 2XWBF 1WW8A 2O2JA 4IS2A 1EIZA 2BGRA 3PFKA 1O96A 4ALNA 4HUTA 3WK9A 2HO4A 4ZFNA 2PJRA 3I62A 3ROTA 1YACA 2ETVA 1UJ2A 3AETA 1OWNA 5TNXA 3LC2O 2R6DA 1UPFA 2HHJA 2J3HA 4JLVA 2FP4A 2ODNA 4Y30A 1N9GB 3EG5A 4R8RA 2ZSJA 1DKQA 2B20A 4AZ3B 4C4SA 2BFDB 4TUYA 2YY5A 1VRCA 4C4RA 2D2VA 1KHHA 3SX4A 2C2BA 1ZA2A 3NVMB 2WW8A 1E6EA 4C03A 1Q22A 1CJUC 3C8DA 3N6RA 2SBTA 1O6FA 1N2XA 4BO5A 3T3PB 2AC2A 1O54A 4IF4A 4EY7A 2A78A 5KJ6A 4DUZB 1XZJA 5BRNA 1LS6A 4MB0A 4ZAXA 8ATCA 1ZJZA 5CXXA 5G1PA 4P5EA 5IC6A 3K8ZA 1E2LA 5IJ0A 2GOYA 1EXVA 5A1TA 2XVXA 3ZD7A 4PG6A 2EFGA 3O93A 4K1LA 2ZTSA 3N59A 5EI5A 3OIGA 1W0KD 3RS8A 3B8HA 1YQUA 1Y3HA 1PCXA 1U94A 4FNAA 3SSAA 4AAYA 3LLCA 3W0LB 1OYWA 1GCIA 1RWBA 1NTOA 2OESA 2XNJA 4DF3A 4I46A 3I5MA 3NHBA 4KJXA 1AN9A 2EEPA 5AKKA 3TSYA 2QN6A 4AKEA 4R7ZA 1JRLA 1KYXA 1L8OA 3HXMA 4JYPA 1S1CA 1C4WA 4Q7EA 1EJ0A 4FJ0A 5K0GA 4HAYA 1JHVA 1L7BA 5AVOA 1JFTA 3RBVA 4LF4B 3DZ8A 1TZCA 1AS0A 5JSQA 1YONA 2BGKA 5CJJA 2X1LA 1E1RD 5ARBA 3AEZA 4D41A 1R8JA 3ANYB 3CRRA 2UUCB 4TVSA 4XJXA 4K9DA 5ELXA 1SKBA 2IGTA 3BGSA 4IFBA 4E1BA 1UEIA 4E5YA 3E2PA 4WCFA 1PW5A 3NW9A 2DXIA 1XG5A 2BFPA 4NONA 3RUAA 2FWIA 1X7GA 2VOJA 3SIPA 4BY9E 2BFMA 1XPRA 3PXEA 1GTMA 2OXIA 4CG2A 2X7XA 1YL7A 2CV1A 3LC1O 2B5WA 2ZSHA 4A2QA 4E5UA 3OX3A 4PSAA 4ZOLF 4EX6A 1D2AA 4JEMA 2XB9A 2E37A 1IEQA 1D2GA 5DNAA 5ALGA 4XLLA 2QTLA 2B78A 4L4SA 4HFJA 2Q0QA 3C7AA 4KOAA 4YRFA 3UUFA 3ZWNA 4YV7A 1A9TA 1JX6A 2X40A 2ZQZA 4B6RA 4RIEA 1HLGA 2QRVA 4HZIA 4BQNA 1PEDA 3TM5A 1YDEA 1GPWB 4N39A 1O89A 5KNCH 3G02A 5BSUA 4LF9B 2DP4E 4X95A 5K0JA 4KZPA 4I50F 3TOSA 2MYUA 2QDXA 4QNRA 4C89A 2Q3MA 3K5IA 1BA3A 3AUKA 3GRUA 4Q16A 4QG3A 5AJZA 4LHVA 1JG7A 2OBMA 1Y9DA 3UZUA 4D6XA 5A06A 1ZXLA 4B4DA 4IDCA 1UM8A 1DAKA 1ZWLA 3VYSB 1A4XA 2B36A 3F6YA 3UK1A 3OPNA 4HUQB 2ZBDA 3CKYA 1KI4A 2JJYA 2ACKA 3G8CA 3SHTA 4DRYA 3D3WA 4NCIA 3TMYA 5DM4A 3NEJA 3H8VA 2B6NA 1P9LA 3F3KA 1B6SA 4D5GA 1O6GA 1DOAA 1NFQA 1SPXA 5FX2A 5JECA 3QLUC 5F4BA 3EGXB 3MJCA 5GONF 3OJFA 3VHRA 2C8LA 3VVMA 5JARA 3ZOKA 1CFJA 2V58A 2QX9A 3PEWA 5EIBC 3FCXA 2IBMA 2F48A 1NAIA 3OC6A 3MAAC 1SELA 3MAJA 5KYWA 1TI7A 1JE0A 1XQYA 2DYKA 2V54A 2VNJA 4CT4B 5IDWA 2EKLA 2DQSA 3UT6A 3WSVA 2OY0A 2RGDA 1ZRHA 1L7VC 1YHZA 4M36A 1ICEA 4PQRA 5EZYF 1IM2A 5EXEA 1QH8A 3L8HA 4MJLA 4JQOA 3SHVA 2A1UA 1VL0A 2V0CA 2X9LA 3EIHA 1T5OA 4HHEA 4LC9A 3CSSA 4ND7A 5D3QA 1UFKA 2GPSA 1KSJA 2IDMA 1GG5A 3GJ8A 4TMXA 4HNVA 1ZGCA 4WLUA 1X3LA 2Q07A 4IX9A 1P0MA 1Y4UA 2IHVA 1G63A 4QQ8A 5DWDA 4GO1A 2FKAA 3AKYA 4D2IA 4OQNA 1NR7A 4N82A 1NNI1 4E32A 1LV7A 1NF3A 5EP4A 1UZNA 2IELA 3AZQA 1VI5A 4ZJYA 5K3FB 3LTEA 3WL7A 2J0QA 1S2MA 1ULTA 3H0CA 1Z4PX 3WLSA 5I51A 5JJ5A 1JLHA 1KYWA 2H2FA 5F9MA 1UL1X 2ZT7A 3JZFA 4U2DA 2POQX 2ZVJA 2DHCA 3M1AA 5E0KB 1COWD 5EZ6B 1M1YA 2VH2A 4K8RB 4F5EA 3FIUA 3M2PA 4RC9A 2VJCA 4C7OB 4GAEA 3M34A 4GMXA 5I8WA 4FR0A 4NJEA 4AY2A 2AKYA 4D92A 1R18A 4NICA 1OA1A 1QLJA 2DBVO 2HDOA 3ND9A 1P2TA 1WD5A 3NJRA 4CF3A 3WLQA 4CV2A 4F2PA 1TUBB 1YXMA 4WKPA 3DL4A 3TRDA 3WO1A 3QEAZ 3BRQA 1KL7A 4HTFA 4IW3B 1G38A 5L3QA 4B8ZA 5A02A 1JWLA 3LH5A 2QE7A 5CFOA 4Q21A 2RAFA 4FU0A 1YMUA 1EDOA 2J5QA 1ENPA 4DDKA 1KBZA 3ABZA 4H7FA 5EXDA 3BORA 1JPVA 1R4NB 2FRVA 2I4NA 3L4EA 3D7KA 3MUEA 2QOEA 1WDLA 2ECPA 2X15A 3N86A 4BVBA 3UQZA 4AO7A 3JASB 3ORQA 2DM6A 4H35A 1U2EA 1T4DA 3AEUA 1E7YA 3VNRA 3PUXA 2XMRA 1AKRA 4JIGA 4LZOA 3GJ4A 4QQRA 2XUDA 3HUDA 3RRXA 4A9AA 5IUNC 2OP1A 2OC9A 3HL0A 4RK7A 3T3IA 3GZNB 5KYKA 1YASA 4DHEA 5KINB 1HTTA 4Q6BA 3ZE1B 5TDHA 2X0EA 4AMUA 1R6TA 1R9NA 4M0PA 3H83A 3O73A 1L5MA 2EF0A 3SI7A 3T4UA 1HM5A 4AY4A 1X1QA 2X5KO 4D98A 3R6WA 3F0TA 3T5TA 4O3FA 4DWVA 2JK1A 3F5DA 5TQJA 3CS3A 2E4XA 4FNGA 3BJRA 1GTZA 1DBQA 3L8FA 2ZUUA 3F96A 4I1UA 4MS1A 2ZIZA 5A0VA 3RTGA 4B3FX 2YCLA 2Y4NA 3SF8B 4HJRA 2C5FA 2E4UA 3L8GA 5FI3A 4LVCA 3ZCVA 2XHEA 1FRVA 4CDGA 1DAPA 3NRCA 4MITA 5FBZA 1M2JA 3IAAA 1KS9A 2OFOA 3N75A 1YKGA 2ZRKA 3GP3A 6CHYA 1NXTA 5FUYA 2GUGA 1O97D 1FTQA 3I9FA 4Z4GA 1USWA 3DOHA 4HH0A 4M1SA 1I4DD 3ZY4A 4BRWA 1GUYA 1V26A 1HNNA 5L3ZA 1SBTA 2AB0A 1EFVA 3ABRB 5EMLA 2JLWA 3GG2A 5HOEA 4HAIA 3MB5A 3Q8XB 1X74A 1R6AA 1ONPA 2V45A 2ZWOA 3BIOA 3ME5A 1NUSA 1EKXA 3VPSA 4DPLA 5MGNA 5J9FA 3OCYA 1M1YE 1LB1B 1M2EA 4KWEA 4MI9A 5JC1A 1C41A 1W5TA 2D62A 2W6MA 2YHIA 4D74A 3PD0A 4H7JA 4J16C 4KQFA 4YV0A 3A10A 4E1VA 3EC2A 2PMKA 4O4LB 3KR9A 1J1UA 5FUXA 2HPAA 2CKDA 2CNWD 3WB0A 3U9TA 4IVPA 1N6LA 4CEIA 1W4AA 4C88A 3JD1A 5H81A 5GWXA 5FWAA 3OEEA 2MCFA 3O83A 5EPEA 1O6ZA 2PPVA 3LC7O 1VHQA 4ZO6A 5EJ6A 3OTQA 3O0DA 3PHGA 4AM8A 4DR1B 4FN4A 3DP7A 4X61A 1YUBA 1SCDA 2ODWA 2Q5HA 1ZUIA 3O8DA 4KBYA 3SX0A 5GGXA 4P0TA 5KWIA 2JEOA 3TKYA 3KTAA 1BQEA 2BJWA 1Z0IA 2DOKA 2PZJA 4Q3NA 4WN9A 1YV9A 1HURA 2JCSA 3VZRA 3D3QA 4EP1A 3HFGA 2QN8A 3A6PC 3OLWA 1RMTA 1JEQA 5F35A 4LF8B 3O0TA 1OCEA 1U90A 3DTVB 2UVPB 3CO5A 2RGAA 1UDWA 4R8LA 4QDZA 2BWJA 3AF5A 3PF9A 1Y7PA 3MWGA 4OXKA 4K9LA 4RMHA 4W5NA 2YXNA 3HP7A 5CX1A 1L4NA 1NQVA 3I4CA 2GAAA 2QVCA 4DUGA 1RCFA 3O95A 2ZIAA 1IN1A 3FCOA 1HLDA 4IMJB 1BYIA 4BJ5A 5BSWA 4DB2A 4BNHA 1C81A 4OB7A 3P9QA 2EX0A 3F67A 4HV4A 2XIQA 4MGEA 1G291 1MC5A 1ZOIA 1GIAA 1KQFA 1KKUA 2WJIA 1YR2A 3O92A 1SVWA 2GH1A 5HUQA 1QF6A 1Q0RA 3PXDA 5C5EA 4IIJB 4P54A 4RKRA 2Y67A 4CE6A 1JA1A 2Z2XA 1M1NB 1JQAA 1XXHE 1OW3B 3DWGA 3SZLA 4IV5A 4Y8VA 4EJSB 2VHUA 3H4VA 1AXEA 1BS1A 1TKRA 3IEXA 2CSXA 2QP9X 1RYHA 3AJ9A 3LCJA 4U00A 4QPZA 3E9EA 1ZD1A 3W1WA 1JJAA 4NE7A 3ZXSA 1YQGA 1IHPA 2R6HA 4JUCA 3UK2A 4WK0B 3WK4A 1NKTA 3AVYA 1W30A 1X1BA 4DB4A 4QD3A 4TWBA 3KJHA 1Q3HA 5JCJA 4A82A 2FWNA 3BPSA 3O31A 2IQ5A 4N6OA 2AG0A 4YXFA 2JLCA 1P0IA 5B7NA 8LDHA 1LTKA 3RS0A 2JKZA 3FMOB 1V3QE 2I7VA 3J81k 4UU1A 2JASA 4TZ0A 4AJ9A 3QVTA 3RS7A 1VECA 2LIVA 1VZ2A 4YC7A 1Y3CE 2RGBA 3V8BA 1GSAA 3MLBA 3X1MA 3UJ9A 2YW2A 3E82A 3F2IA 2IUYA 4CETA 1FMCA 2CFRA 4TM8A 1ILEA 3HGQA 4GBGA 1EVYA 3BTVA 1V8ZA 2IPXA 3HZRA 3MWKA 3NKFA 1CQPA 1XTJA 4KO2S 3V3KA 1D1QA 2J3LA 1J8QA 3JTMA 3PWTA 3V4SA 3ZBQA 3E6AA 3BH0A 2XE7A 5BSRA 4BFWA 2FSHA 4JBNA 5H9WA 4B1FA 1D9XA 2ZCJA 2ZRJA 2QORA 1GCUA 1DC8A 3PZBA 1MGOA 3HZZA 2N1BA 3BMXA 3SN6A 4AWXA 3SR3A 3IVCA 2CF5A 4LRQA 5HFJA 1E4OA 3F4BA 2P5UA 2VP5A 1V1MB 3JYOA 3EODA 3OECA 1KMMA 1Z25A 2QLLA 4UVHA 3ZUPA 1JAHA 1TYEB 1Y8RB 5JLJA 1OWLA 3KDSE 2R6R1 2VFAA 4KLRA 5EZSA 1QAOA 4ZZ2A 5JJLA 5I8PA 4LGCA 4HGNA 2WE7A 3G1UA 3HB7A 4D3XA 1G8JA 2WICA 1ZISA 3H5RA 5JY6A 1EG2A 3OZWA 4A8JC 5ABPA 2ZYDA 4WLNA 1MV5A 4GOMD 3P5SA 3ROKA 2WTMA 4G01B 2A3RA 4KXMA 4BWVA 4G0WA 4FGJA 1R6BX 1Z4JA 2H1IA 1PL0A 1XMJA 3EPJA 3DEAA 4MZDA 5CFZA 1WUTA 1YRLA 2VO1A 4OYRA 3DV2A 3E58A 3L0OA 3B7WA 5L3SB 2V5AA 4RANA 5JXGA 2D59A 4FKBA 1RXIA 2VP6A 1G0NA 5ITZB 4MB2A 4MUKA 2DMRA 4KZKA 5LYJF 4IQFA 5T4HA 3AFOA 5FBHA 1UM9A 2ACWA 3DOCA 3PFIA 1Y4AE 3ECAA 3VZSA 1JNXX 2UZ1B 1GA1A 5JNSA 4LG1A 3EEYA 1RD4A 4BGIA 2O0LA 4UUNA 4URXR 3A1WA 1I3CA 2EDCA 2I6SA 1OXXK 2JLSA 1VBFA 2RHMA 3KJZA 4IDNA 2QY6A 2VNIA 2RGRA 2R47A 2YNMC 3O21A 2B35A 5CHEA 2C97A 2DECA 2FU5C 1AXRA 2QDKA 4JNCA 4OAPA 4S1NA 3KYIB 5K3AA 1M2OB 3DE6X 1TM2A 1OFHA 5AW3A 1NXXA 2YFHA 1SIOA 3HBLA 1RVDA 4OMCA 1TT5B 3RUPA 3D81A 1Q2UA 2J1LA 3K16A 2WC1A 1X7WA 1HLPA 1RLOA 1CJSA 2FSPA 3ELBA 3USES 1RWQA 1IJKA 3A0UA 3UTCA 1N3LA 3OMWA 2P40A 4OIFA 3TEJA 2ON6A 1R8QA 5TPWB 4LOHA 1ZGGA 1YZYA 3ZY2A 2OHJA 2BBTA 3UAYA 3SC2B 3I6IA 2JFHA 3Q8WA 5JDCC 1RI3A 3OCWA 4J1TA 4REQB 2NUAA 2YMMA 4H31A 3GEEA 4TKLA 3ZHTA 3BERA 5IK2A 3EISA 4MGZR 4YCCA 3B6MA 3CLUC 4Y2UA 4IRXA 2FDRA 2PXCA 4POAA 4C22A 1E2UA 2WPNA 3HNRA 1N5IA 3F7OA 4ZZIA 1RC8A 4JXJA 1T5BA 2W71A 4FONA 5DSZA 2OV8A 4E5PA 3CNLA 1N0WA 3DHNA 2ZAMA 4DUPA 2PWPA 3I2GA 3R3UA 1XCOA 4ZOLB 3C2QA 1OI4A 1QQ6A 3IBGA 5LBUA 5TARA 3LHFA 5DX8A 3DZKA 3Q5EA 1IAVA 1LBSA 5FBLB 4D4JA 2VH1A 4S3MA 5DOZA 2NT3A 4YRPA 3A25A 5E4FA 1AHIA 4ZCRA 4PANA 3QELB 1V8DA 3CH7A 1TYZA 2XSZD 2YWDA 3WL8A 2XKJE 4F9GA 4UC0A 1O95A 2IUSA 3K32A 3H0EA 3DKKA 2WAYA 3GA5A 4GS5A 2HRZA 4I50B 4KVZA 1XKLA 2PVPA 4L74A 4OI0A 2NXWA 1HYGA 5FI1B 4CYMA 3H7IA 3GRVA 3JRNA 3PRYA 4ESEA 1E98A 1FXUA 4XD7D 5DYIA 1U1CA 1YRYE 5BYKA 1MV8A 1XGKA 1NC1A 1JG6A 4CGYA 5CB4A 5EWMA 3RBAA 1SWVA 4LXIA 1OTXA 5EIEA 2BFWA 3EMVA 2AJLI 1SKUA 4W63A 3WMRA 3R8XA 3WLNA 4AJIA 4AJJA 4JIMA 3AINA 3DYBA 1J0DA 4GVLA 4G4SP 3W6UA 4RKQA 5ALZA 2UUAB 3X2FA 4IG4A 1GHTA 3P52A 3QXJA 1KA9H 2BEVA 1ULBA 4RS4A 4E14A 4ZYVA 5FHQA 2I71A 2WTNA 3LWNA 4BMVA 5CIQA 3OQHA 1NZFA 4IHJA 3MQFA 4L3WA 3THXA 2FEKA 2PXAA 3O9MA 2GF2A 3M70A 3IB6A 3GZTB 1R5NA 2QYHA 4ZA2A 5GONB 1VSQA 1Z22A 4RY8A 4GDFA 1T4CA 2PWYA 2I55A 5FD8A 4TTVA 4CCYB 4F38A 3LCUA 1ANKA 4IVNA 2Q3FA 2BF7A 3IP6A 3AR4A 5F98A 4FS3A 2A9PA 4KO3S 3OHPA 4R7GA 3AK4A 2P9EA 2QM0A 3DLTA 4GR5A 4MQFA 4EENA 1Y8ZA 1PI3A 3QQPA 2YV4A 1W93A 1N5MA 4PTZA 1GKIA 5EZYB 3WIUA 5K0TA 3K0KA 4KTVE 4A4DA 4ZI2A 3HA7A 3W2GA 5IBPA 3FW1A 1K5DA 1KI3A 2XD9A 3FF4A 3ZTWA 4DR7B 1CF9A 2B8NA 4JOCA 4R8VA 5JCOA 2HEIA 3WLRA 2QB5A 3AI2A 4TWRA 3QNWA 2FPMA 1XZGA 4L08A 5FTNA 5GM1A 5KNDD 3D5TA 3UJPA 5BVHB 4WAUA 1DRVA 2I7TA 3FHLA 4H1WA 1IFXA 1N2GA 1VJ0A 1U0JA 2RHTA 1SAYA 3EWNA 4TZKA 2Z9DA 1I7PA 2VYQA 1L4LA 3G0BA 4LUCA 1XWWA 3WVNA 3I9V1 3V1MA 3W5CA 1W4LA 1QH0A 4G4GA 2OC4A 3WAJA 4U6SA 3I6ZA 2IS6A 2O06A 3G3EA 4LZWA 4V1CB 4BXOA 5CCBA 5A05A 3BHMA 2LXNA 2JGDA 3OZVA 2GMWA 2FI1A 4PPNA 3NTOA 2FDCA 3B89A 4YUWA 4ZMSA 2FPLA 3PHIA 1X9GA 4P35A 3H19A 1BOFA 2PLNA 3GJZA 1GAEO 3I32A 4JS0A 4ALIA 4CFYA 2OHIA 2WDPA 3QFHA 4O4JF 3E05A 1FSZA 4Q4HB 1WP4A 1J8DA 1A27A 1CY0A 4KGVA 5JMPA 1NNUA 4CLOB 4NU6A 2ATEA 1UBTS 4JZYA 4ZHQA 3LXUX 3CZAA 4WOCA 1N36B 3OVMA 4L51A 2HQOA 2I1QA 4PLFA 3H4IA 2A14A 2OV1A 3JWJA 3KR1A 4NNOA 1PF7E 2R7AA 3H87A 3LXXA 4MUJA 4AKTA 1HDOA 5LOVA 1VG0B 2DE0X 1Q0UA 5CU7A 3CLKA 2CHQA 3ISTA 3BWXA 3DD1A 2BOVA 4FYIA 5J2UA 4JBXA 5EHQA 4KHZA 3ETEA 3KYCB 3DO6A 2XTMA 2WFLB 3BEDA 2BFAA 3IMFA 1GTJ1 1GRRA 1VPDA 4XM1A 1GWNA 1JB1A 4G1BA 4K6KA 2QRJA 1LNSA 2VDNB 3H6HA 4GZ3A 4YNBA 3U17A 3CEMA 3RYIB 1PJ3A 2G88A 1DFGA 1HDGO 3FX2A 3PC8C 5IX8A 3KSZO 2JD1A 2O07A 3WG9A 1CQWA 1I4OA 4ZVLA 3SYTA 1MG0A 2VF4X 1KMHB 2PK3A 4CPDA 4JQCA 4ICIA 5JS2A 1P4GA 3TX2A 1EI9A 2HO5A 2VDVE 3CX7A 4YP9A 3UWDA 5AVWA 4X8MA 3RARA 4V0OA 4CI0B 1D4AA 2Q2VA 4K1XA 1GTRA 3F6SA 4IYRA 4D8UA 5IM4F 1VPEA 1YQQA 3H3XA 3TCNA 1L8LA 2CDNA 3CH4B 1YIDA 3EQ2A 5AW9A 3GPLA 3HLTA 5DMHA 4DZZA 8AT1A 1PR9A 4LC0A 5AJTA 4UQOA 1O5TA 3L7KA 3AVOA 4KWCA 5M34A 1E2MA 1U0TA 1SC4A 2IKSA 4DSUA 1CUGA 1O0SA 2FN7A 2CZQA 2C99A 2ERXA 4TMWA 5BUSA 2I34A 4HDMB 3AKCA 4RD1A 3F3YA 3VYUB 2GEVA 4UM8B 3Q72A 1LDNA 3PE6A 5EMMA 3DVAA 4P2GA 4P5DA 4TKZA 3FBGA 4BQFA 5JNVA 3Q6NA 4US1R 4Y0NA 1ONNA 1HFJA 4OKNA 5IARA 5HQTA 2ECOA 1Q0TA 3OJXA 3F9IA 4UU7A 2D5BA 1REQB 3Q1LA 3TOVA 3VTZA 4ETIA 2O7SA 1N6KA 1P4JA 1FZQA 2JDID 1OAOA 2HX1A 2ZBGA 3JPYA 5AVKA 1QO7A 1I3NA 2QSZA 2X2OA 4M6WA 2PANA 3OQ1A 3BHJA 5B55A 1T2EA 1Q7RA 3LKDA 2Q1WA 4F72A 1JIJA 1IPFA 1VHTA 1ZIYA 2Z3VA 1MA3A 1VL1A 3IXLA 1LTQA 3ZQUA 1PV1A 4C4YA 2ILVA 4P3KA 1HZZA 3DOEA 2O8VA 2QNIA 3ZNPA 2BLLA 3OURA 3DTVD 2AN9A 5JAHA 1KEEA 2JI6A 4A6EA 5G41A 2WJ3A 3I8XA 2QJFA 2RHHA 1V7CA 5CNKA 3RKSA 4DDHA 2O7RA 3H11A 4OM8A 1FTSA 4DT1A 1RAEA 4Z3KA 3HDTA 2QTTA 4QJ5A 2QZ4A 4HVCA 3EBLA 3EVGA 1D09A 2VEDA 2VCHA 3O4GA 3IMKA 3Q6MA 4NKRA 2XOXA 3HM9A 2JVKA 2C77A 2MINA 2Y4OA 3G1WA 1NBWB 4LI0A 4EM6A 3HH8A 4RZUA 1OZGA 1YGYA 2G36A 3M4JA 2YXLA 6ADHA 1V16A 3OLXA 3RWOA 4YMGA 4Z86A 2PQMA 3T7KA 4TV8F 2DBQA 3CF0A 3W4IA 2XT9A 2A5GA 3U56A 3MINB 3OQ6A 4CEHB 3AHCA 3IFSA 2C1XA 2V7GA 4QTYA 1YQWA 5U9CA 4F8JA 4LXQA 1QYIA 4FMPA 1DKMA 1DVRA 1DWOA 5EP1A 3RFFA 3R8FA 4D44A 5H4GA 2VHVA 1BAPA 3OF5A 4OXRA 4QX6A 1U1GA 2LDXA 2OGZA 2WFMA 4P4NA 5FBKA 1P61B 4KXUA 3KHUA 4G0XA 2ZB8A 3JVEA 1UQTA 3L7AA 4IZ6A 3OFSA 3VV3A 3HU3A 4BFXA 4G5RA 5JASA 2PA3A 3CB4A 3GJYA 3NFYA 2FMTA 1IOZA 3QNUA 5T3YA 2ZYGA 3FUVA 1HFEL 2X5JO 3WOHA 5KTNA 2R85A 1ZNWA 2W8BA 4RK0A 4KQWA 1YS2X 3KALA 3EQZA 2X9QA 5GM2A 2X3UA 2KJQA 3RH0A 5DN6D 4OFXA 4Q1DA 3UKJA 3GGOA 5CFQA 1SVSA 1U3DA 2I3AA 2VYVA 2WIKA 5DLYA 3TTVA 1FE8A 1XVIA 1Z36A 4CKWB 4EGSA 2O8BB 1Z12A 1F9EA 3EJWA 1R2QA 3TJZA 3W8EA 5LNK6 1AKWA 1YCDA 4ZZ1A 4D3DA 1WUJS 1C8VB 1A9RA 2XHZA 1L7MA 2XPCA 2IDZA 3OZBA 4R1MA 5BYJA 5AI0A 1CJBA 1ESMA 3EXEA 4BHTA 2K4MA 1FNCA 2QTBA 1YK1A 2C2WA 2VPQA 1ISIA 8ADHA 1J8FA 1NVTA 1XTTA 3JQ7A 3VSCA 4WNAB 4ND4A 4YLYA 2QENA 5CXSA 3EXG2 4BNUA 2YHUA 3QEKA 4LFCB 4HWKA 1XQ6A 4UVGA 4ZVUA 5IANA 1QUFA 3ESQA 1CUIA 3QHAA 3AUXA 3Q9UA 3VTFA 3V2IA 4IO1A 1PZEA 5L40A 4AP6A 3AWIA 1HH4A 3EF1A 2XXBA 3RVJA 5L51A 4L95C 2HCFA 4P38A 2E21A 4IJWA 4BV8A 2Q9CA 2YHBA 4HEA6 4ZVSA 2I2CA 4WA7A 3JRWA 4D99A 5JNWA 1VSVA 3AI1A 3TXXA 1GRVA 1ENYA 5BUCA 1UODA 2VTBB 1GSIA 2O2HA 3HNOA 3NCTA 4YIKA 3DE5X 2JGIA 1HTWA 3VMFA 5LQDA 1UPXA 1C0IA 1PJBA 1C3XA 1XAGA 2I65A 3U3XA 1OLOA 2YXPX 2FHPA 3I1FA 4XB2A 1H2WA 2W37A 2CL0X 2PL1A 3LNCA 4Z8XA 2IV2X 2GCGA 2CW5A 3FFXA 2DWPA 5KU1A 4BVGA 3CLRD 1TEHA 3T7EA 4DA9A 2QKYA 4O29A 3UCXA 5BXYA 5IT5A 1C8BA 4FOTA 3DWFA 1P81A 1CCWA 1VL2A 4FK8A 4PTLA 2GAFA 4OLBA 4M0KA 3F9CA 5TGTA 2QZPA 1I4WA 2XZTA 5BVGB 1SJ9A 2ZWVA 2OZVA 1QO0D 3LA8A 3MWYW 3Q3CA 3GCWA 1UT6A 3GIDA 1U2ZA 1N0HA 2IZ6A 3JVDA 5E3JA 4MW7A 3CLHA 3NHYA 1L5NA 3BMQA 1TW2A 3GWGA 2R68A 5IN4A 3SQXA 5A3QA 1EGMB 1YOVB 3DMHA 2CFTA 4PX9A 4TLCA 2QTCA 3ZX5A 4PFSA 3T7RA 4ZCMA 4KWHA 1RJEA 3DBRA 4NE2A 4QUEA 2UVDA 2XUKA 1N9KA 3JZIA 1OV6A 4HNUA 1ODIA 2IHKA 5EJFA 3SF0A 3ZY3A 4F1KA 2BMEA 4N01A 4WGGA 1NKSA 1I1QB 3OICA 3U3DA 1XL0A 2J3EA 4IL5A 4M7RA 2GJKA 2BSXA 4YHBA 4ED9A 2QUAA 2WHPB 2EWWA 1WULS 2ZREA 3MHTA 5K8VA 4EPXA 1HI9A 4BVFA 5HJEA 2VJPA 1Q77A 1X7YA 3H2IA 4HAOA 2V7QD 4RXTA 3QX8A 4CQMA 3O74A 3F90A 1M6EX 3NANA 5JMWA 3WMGA 1JHYA 4JLNA 1YVPA 1G3MA 4YYEA 2W6IA 3FDZB 1VMKA 3PHLA 1EP3B 3EZNA 4QUJA 4EY8A 3ZZ1A 3K9WA 2WHYA 4Q48A 4L78A 3SR0A 4FKMA 1H4QA 1XEXA 3T95A 4P0PB 1Z08A 2ENWA 3EFEA 2PRSA 3BF8A 1T0BA 1TT7A 4OLFA 2XMCA 1H6AA 3UA3A 3FXAA 4YJHA 2Y99A 1NMZA 4Q4DA 1M2WA 2NV2B 3UJ3X 1CBUA 1XRRA 4L15A 5F2EA 3TSZA 1I7NA 3FOZA 1VJGA 5KNCA 4U2FA 1P1JA 1N6HA 5IEJA 2I3BA 1RRFA 4TWJA 1NRIA 2PLAA 1I5OA 3BILA 3C5HA 1V3VA 3KOUA 2GASA 4M1YA 2R84A 2XE8A 4P3NA 4HATA 3VTAA 2QG4A 4M0LA 1D6JA 1G7RA 2JBHA 4HADA 3AF2A 1MEJA 1HE8B 4JJKA 2BAGA 1F2UB 1N8SA 2NZVG 3PIRA 3CPEA 3A28A 3ND7A 3Q88A 4EQ6B 5B7QA 2YIJA 3ICOA 3ITDA 4Z4IA 2QP3A 4KE7A 1OXUA 3PI6A 1RRVA 1VBNA 2ZGVA 5IF3A 2GM4A 2M6LA 2H4JA 4RM2A 3EMDA 1BMFD 3KXDA 3X1XA 3JAKB 2O2GA 3I1YA 4JT8A 3VR6D 2CL7X 1PR5A 3KQWA 2A5JA 5FB3A 4EPWA 4CDMA 1TVMA 1R5OA 3ZHXA 3K6SB 1PJ8A 2VEOA 4KRYA 4DG8A 1PIWA 4EHFA 3HKBB 4HXFB 3CH5A 3L6DA 5BWCA 2C98A 2AJDA 2P6PA 2PLFA 2QR5A 3EGIA 1TKBA 4G9GA 5DX0A 1YQEA 1E2JA 3FTNA 1XPJA 1XOIA 2JFXA 2JHAA 3B9QA 4IZIA 4PBTA 2ZIUB 4QUAA 3UICA 4B76A 4DV0B 3A6KA 3TLBA 4GC9A 3ZLJA 4J0QA 3TLEA 4MVJM 4WK4B 4YALA 2VF7A 4NULA 1E3QA 1M2HA 3PA8A 3PHHA 1BKYA 1U0GA 2LCFA 2YBDA 4B7ZA 2J4FA 2QG9A 3DUFA 4XYBA 3M6LA 3SM3A 4XWWA 1WBBA 3DDOA 3ML1A 4MUIA 4Y7CA 1KY5A 4OVKA 3DD5A 1SC1A 1KNQA 1IB0A 2BGTA 1U7XA 2V0NA 3UWMA 4RTJA 3R0QA 3QFCA 1GP2A 4AQ7A 1A0OA 1Y0BA 1YBVA 2H2WA 2Y1XA 4FWBA 5JCPA 1DKUA 3QU2A 1UBHS 2KWIA 1M10A 4HNSA 4RVHA 1GZVA 1U6JA 3I2JA 5C46F 2F62A 1P9RA 1N6PA 2BLNA 1QZUA 1CP2A 2C29D 3RYHB 3DMTA 5HK9A 1SD1A 3U44B 1QHSA 1SZDA 4NF2A 4U8GA 4YO7A 4PLYA 3TOXA 4B7CA 3OIUA 3FB4A 4BRSA 1DX4A 4BWYA 4KNYA 3LCVB 1DP4A 3PP8A 2HA6A 5HGXA 1MOSA 2ORIA 2EATA 4AZ0A 1VE6A 1SOUA 2V3WA 1EFTA 4N40A 2NU7A 2R25B 5A5FA 4NR0A 2JHFA 5DM2A 2NN3C 3NBUA 3ZDXB 4ND8A 3FYUC 3NBQA 4HGOA 4B9AA 1H66A 2R79A 3M5CA 4GGOA 4LY6A 2H2DA 3WRWA 3X1KA 4CKBA 2NXJA 1LH0A 4NYIR 4CWAA 5IZCC 2OXEA 4NNJA 2WLTA 1JDUA 1QG0A 1C14A 5LD2C 3AKZA 2C8KA 2EKBA 4QUKA 4EUSA 4YRGA 4MVXA 1SOWA 1X6VA 4XFDA 4BVEA 1QZTA 2WLSA 4EY4A 1BVYF 4O8CA 4UFOA 1NJ5A 1TTQB 3ZDEA 1W581 1IBSA 3LK7A 2XUJA 1TCVA 4MWBA 3NEPX 4WLVA 3EA5A 2X3YA 4KMMA 1PTJC 4DDWA 2AXNA 4TTRA 1RM4A 1NVFA 1U8ZA 2EFYA 2YJNA 3M33A 3PQ8A 3DOFA 5DF1A 1ZG3A 4ARZA 1T8RA 1YRHA 4E94A 2ZE5A 4OJMX 1MFPA 1Y8CA 4MWEA 5CT4A 1YVEI 2HBQA 2P2GA 4GOXA 1W4RA 2FW7A 4K2AA 4AECA 3WRYA 3QPUA 2I80A 3G5MA 1MAWA 4K88A 1PJZA 1XZCA 4O4JB 2IL1A 1RHUA 4N4AA 2ZYHA 4O6VA 4ERXA 4ZYWA 3TPCA 1JR6A 1WETA 3TCKA 1WB5A 1CEQA 4POOA 2PUTA 3TNLA 1JT9A 3KQTA 3O1IC 2ZBPA 4XQEA 3RGGA 3U4GA 3WQQA 4R2JA 3W4JA 1KI9A 3OFKA 4HB2A 2OT3B 3AM3A 4WH0A 4OM7A 4EG3A 2DPHA 2Q1SA 3JYNA 3HGTA 4WK2B 4XX0A 2AFRA 2BONA 1NRJB 2C4TA 3HBJA 4JB8A 1GTSA 1HYQA 1OTYA 1XZFA 1Q14A 1Z45A 5KB3A 1KH2A 3KG2A 3U4AA 1LVGA 1PHPA 4TS1A 4V39A 4GM1A 2D74A 3UAGA 4BWGA 1QYXA 3IO3A 1FX0A 5A6SB 4XEUA 4DMHA 3BXEA 5KHLB 2OBFA 4DYDA 1EHCA 1BWRA 1MBZA 3ENKA 3BE6A 4I1PA 4RA9B 2Q1TA 4LA4A 3N70A 1YDWA 3NBKA 4ESOA 4BC0A 5JOQA 4MYTA 4DBLE 2GTPA 3BWEA 5DU2A 3OESA 5AUQA 1F3LA 5G4LA 3AVVA 4ER6A 4QGSA 4LNUB 3RSCA 2GK4A 3RJMA 3HN2A 3JARA 3JR7A 5FR2A 5JJBA 1C1YA 1D2HA 2XUGA 3P9PA 4PO9A 1GPUA 3ACBA 3NHPA 1SCJA 5JDIA 1CY6A 2ZBFA 4X44A 4WBNB 3RC7A 4MYDA 3VZDA 4LSWA 4C2UA 5KTYA 1EZ1A 3DHYA 3L18A 3FLAA 2XE4A 1LDMA 4BNTA 1CB0A 4HG2A 1KO4A 2JGJA 4NLLA 1TE2A 1UPCA 3NM6B 4CF7A 5FXMA 4OHZA 3GPBA 3LOPA 2IH5A 1I8TA 3JPWA 4GX2A 4RKWA 4XKJA 3QSYA 1PWZA 4ZQCB 1Y7IA 4KQJA 2I2XB 1W76A 3AP1A 2EKDA 1PJ4A 2OCBA 3GJ3A 4FHDA 1F8UA 2EOAA 4RNCA 2A7QA 2Q2WA 1F2TB 1U7OA 4O4IF 2GZDA 1UK6A 4A3SA 3UAOA 3K9BA 5C35A 1E7QA 3OCJA 4FFBB 1W36B 2PMBA 5BNFA 3ZZ0A 3HR7A 4BNWA 1Z5ZA 1JA0A 2GRJA 5IFKA 1B6TA 1ST3A 1X86B 3O4HA 4LDRA 2QXUA 4F3CA 2PJUA 3FDXA 1BQ4A 4ESHA 3GH3A 3QOFA 4YAGA 2HK7A 1NNSA 1P9NA 3C6KA 3GFOA 4JX8A 2ZUBA 4C2AA 3OLCX 2I4OA 1ZJ5A 1EVLA 3E53A 1CNMA 2G4VA 4PC2A 5DM0A 4UREA 2IYXA 1IULA 1QB7A 2X8LA 4C08A 3S7TA 4E22A 3L46A 2BE7A 3JWEA 3KBBA 3C8UA 2F43B 3NHSA 2P6OA 1M6VB 2R5WA 4CF6A 2DHRA 2ZR9A 2J3IA 1RPNA 2WF8A 3N8HA 4YCJA 5AHWA 1DC7A 3EYWA 4BQOA 1Z6TA 3GV0A 4RXMA 2WP8J 1P2GA 2B98A 2V8BA 1KVRA 1GADO 5IXSA 4KLCA 4HVAA 2Q7XA 1PT5A 1UQUA 2SCUB 3K0SA 1GG9A 3I4LA 3PPYA 2GILA 1ZK3A 3X1WA 2Q27A 2QN3A 1ZS9A 4FJ1A 1SXHA 2HGZA 3DNFA 2V6MA 3CN7A 4M49A 4PG5A 4IDGA 4BEJA 4J43A 3D8BA 3UGKA 2H51A 4WXRA 3ZGYA 4GMDA 2GPWA 4TV8B 3UJ6A 7REQB 4WJKB 3PRKE 3MJRA 1MDFA 1O5IA 4BJ1A 1XCBA 1O95C 3L06A 1BRMA 1XAHA 4HB4A 3HCFA 4XVUA 3AERB 4IMIB 1H6BA 4R2KA 1TQ4A 1PR6A 2E4VA 1EGVB 3ITNA 2C5LA 1XC7A 4DMCA 3DV0B 4F2HA 4FQ5A 2PUBA 2B3DA 1QPGA 5E6UA 3RYCA 1Y1PA 4HEQA 3QQ5A 3U1TA 4KQGA 2HM7A 4IOMA 1B2LA 3RU7A 3SNKA 4V2IA 3N8IA 4C4TA 2I9KA 2KI5A 1RPTA 1UBUS 3LQQA 3CZQA 4DQ0A 4N3GA 4LX8A 4WY8A 1XL1A 2I6GA 4BNZA 4DMUB 1I01A 4FYWA 3RK1A