4BZZA

Complete crystal structure of carboxylesterase cest-2923 from lactobacillus plantarum wcfs1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
275
structure length
275
Chain Sequence
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Biochemical Characterization and Analysis of the Pleomorphism of Carboxylesterase Cest-2923 from Lactobacillus Plantarum Wcfs1
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords LIPASE/ESTERASE
total genus 88
structure length 275
sequence length 275
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bzzA00
3G8YA 3G9XA 2LIPA 4FTWA 3C8DA 1W4LA 3QMWA 2OCIA 1X2BA 3BWXA 2PPLA 3MUOA 3TGLA 4BZZA 2PUJA 2CKMA 4X91A 4ARAA 1CUVA 1E5TA 1CV2A 1SCQA 3FAKA 2WFLA 4FBMA 4DNPA 3CCCA 4G8DA 1ZI6A 4J0CA 4L3WA 5BOVA 5FDFA 4EY8A 3WL7A 3I2FA 4M0EA 5DYTA 2DQZA 2IX9A 3QMVA 1NU6A 5CH3A 3QPDA 5JANA 3F97A 1OXMA 5LIPA 2WIKA 2Z3WA 1YA4A 4Y2YA 1LGYA 1MTZA 2J4CA 1QIEA 2O2HA 1DWQA 4BCCA 2HA7A 4BCBA 4OPMA 4ZRDA 3WL8A 5ALGA 1VXOA 2HADA 5C81A 1P0PA 2BCEA 4OD0A 1GPKA 3D4LA 1U2EA 3DKRA 1UOPA 3AIMA 5JAHA 3WL5A 1R9NA 5EIHA 4KR0A 3DDUA 3BF8A 2XUAA 4C01A 1HKHA 3M3DA 3UMJA 3IA2A 4BTLA 5EHQA 1EVQA 4G5XA 5HK8A 4ZV7A 4X7BA 1L7RA 1XZBA 3GA7A 1HPLA 5FOQA 4ZI5A 2WG0A 3K6KA 1C7IA 1U65A 4XWGA 1JJBA 3ED1A 4L0CA 5IH7A 1Q0ZA 2WIFA 4GI1A 4ZREA 4FDMA 3FVRA 3U0VA 4C88A 1UZAA 1F0PA 3PF8A 4FLFA 2JGMA 4B0PA 1CRLA 1OCEA 2PM8A 3C8HA 4PSDA 1EK2A 4ZGBA 3BE8A 4DMHA 5EIAA 5ALJA 2I3DA 4I4CA 2BAGA 2CMFA 5IVHA 3G0GA 4X93A 3WA6A 4JYPA 1UK8A 3GELA 3VXKA 5C8XA 5E2IA 1S8OA 1JU4A 3V1MA 1VKHA 2Y2UA 5JZSA 1QIDA 1P0IA 3IDAA 5AJHA 5LZ2A 3IURA 4LXGA 4BB0A 1DX6A 1XZGA 2YH2A 3V1KA 4H7HA 2WHRA 2XQKA 3AIOA 2PUHA 2WJ4A 2YASA 2ECFA 5AI0A 3WWPA 2IITA 5DTJA 2BGNA 5E4JA 3I6YA 5AK3A 2FUKA 5JAPA 3WKEA 5ALSA 1IUOA 4L72A 1AC5A 3STUA 5ALEA 4BRZA 5JATA 1QJ4A 3D3NA 5ALXA 3F98A 3IB3A 1ODTC 3WWDA 4K6GA 3O95A 2XMGA 3RLIA 4GW3A 4PSUA 1TK3A 4U2BA 3BXPA 3WZLA 2XE4A 2ACEA 2BJHA 4RPCA 4H77A 4UHFA 2XQJA 2H7XA 2XUFA 3D2BA 4N5IX 2XUIA 4UBJA 3VJLA 2O2IA 3EQ8A 4N8DA 4EB0A 1P0QA 1FJ2A 5LZ4A 3AZOA 4X97A 5HQ3B 5AKKA 1JU3A 3EQ7A 4J0DA 2OAGA 5ALZA 3WLAA 3GZJA 1CUFA 1ZICA 2B20A 4HS9A 4BE9A 4Z49A 3C87A 1XZHA 3STXA 3E1GA 3G7NA 2RHTA 4J7AA 4JNCA 3O9VA 5FRDA 3QPCA 3IUNA 4FLMA 3L1HA 4Y2XA 4H7IA 4CFSA 3KWJA 1WB6A 4UBKA 3LP5A 2Z8XA 1H2XA 5AHXA 4UHHA 5AM1A 2HA2A 4KJXA 2HRRA 1Q83A 2C5GA 4J0IA 5JADA 2Y6VA 5DTIA 5I8PA 1TQHA 5AI4A 3Q8WA 4OUKX 4PW0A 4M0FA 1MX1A 1CUXA 4I3FA 1BU8A 4O08A 5AKZA 5JALA 2Y1KA 2RGUA 1BE0A 5IVDA 1YSCA 3CXUA 4WFKA 1SFRA 1YB6A 2ZJ6A 5CT4A 4OU5A 2V97A 3AILA 3C6YA 2ZVDA 5H3HA 3WI7A 4DLNA 5ALNA 2VT7A 2R8BA 1CUUA 2OGTA 4W9RA 1D07A 1OILA 5CTAA 4QDXA 5JZ9A 3LIIA 2Z8ZA 5JZBA 5ALOA 2WUEA 5E4YA 2HHAA 2JEZA 5AM2A 1T2NA 3FNBA 1USWA 2PSDA 1AKNA 3D59A 4AO8A 1UK9A 2OQVA 4K2AA 4V2IA 5D3KA 4HAIA 3H2KA 4QDTA 2XMSA 3C70A 4Q82A 4WY8A 1FFAA 3QMMA 4CG1A 1DTEA 3W9BA 1QOZA 3I2GA 4EY4A 3BJMA 5E4TA 4AZ3A 3H2GA 1E66A 3WIOA 4LHEA 4E15A 2FJPA 4WCVA 3WYNA 1ACLA 5SYMA 4C6HA 4J0JA 4WFJA 3IUJA 4LYDA 5DLPA 3KDAA 1B6GA 2ZYIA 1LPNA 2C5FA 4DSZA 3UUEA 1XFDA 3DYIA 1CEXA 5K3BA 1XRLA 4GWLA 1TAHA 3M83A 1R9MA 4YASA 5A7HA 3D5EA 5T4HA 3PUIA 2GBFA 4RGYA 1GPNA 1QO7A 1VXRA 5EHNA 2PSHA 1LPAB 4U2EA 5ESRA 1N5MA 4C89A 2ZYRA 3S8YA 4OCZA 1VJ5A 4LYEA 2WIDA 4F5ZA 2B61A 3CN9A 3H2JA 3S2ZA 4DNFA 1LBSA 3F67A 5JYCA 3VDXA 5AK5A 1AGYA 4QLOA 4NS4A 1YAHA 2JGKA 1EHYA 4UBIA 1LLFA 4EY5A 2CB9A 3CCBA 4W63A 5JASA 4BVKA 4N5HX 3I6MA 3BF7A 3DD5A 3WWOA 3FLBA 1ORWA 2HFJA 4B9AA 3OTQA 1EDEA 1QZ3A 4BC1A 4B80A 1BEEA 1QONA 1N8SA 4MQLA 5CW2A 3H04A 1ODCA 2WUFA 4QNNA 2WUGA 5ALTA 1UFOA 3LLCA 1XRPA 4OB6A 2XUDA 3I2JA 1ACJA 1JMYA 4BC0A 2E3JA 5DYYA 3ICVA 5IVKA 2HFKA 2PVSA 4G8CA 2JF0A 3NWOA 4AZ0A 3JWEA 3STWA 3SX4A 1H23A 2JGFA 3OG9A 4JEIA 4H7DA 5AKEA 1ZD3A 1R88A 1XZAA 5CRIA 1U4NA 1BROA 1ZOIA 3DYVA 2G63A 2WTMA 1ZJ4A 1BEZA 3FLEA 2OLEA 3E4DA 4GBGA 4IQ4A 1CUYA 5FLKA 4UFPA 2I03A 5IVIA 1QIHA 1R3DA 4ITVA 4XVCA 4H7FA 1XQYA 2WUDA 2O7VA 3LS2A 3STTA 2GZRA 4TVKA 3T52A 2QM0A 4BE4A 1CVLA 1EK1A 1R4ZA 2HU8A 1N1MA 2NW6A 2XQFA 2XMCA 1MAHA 5D6OA 4Q05A 4BTVA 5K3CA 1TCCA 5ALVA 5AKGA 3R3YA 3IBTA 4LXHA 3VKFA 4MEAA 5HF6A 1ZD5A 4H7JA 2QMQA 5K3EA 3O4IA 3DS8A 4P93A 3TRDA 2ZYHA 3KWFA 3QBJA 3MUNA 4Y2SA 3ZPXA 1DQZA 4H18A 1F6WA 5LLSA 4B82A 4UBLA 3ICWA 5SYNA 1K4YA 5AIBA 5CT6A 4G4IA 1MAAA 3I1IA 4OU4A 2VF2A 2W22A 2OG1A 2WILA 1HQDA 4MEBA 2OGSA 4EBBA 2QUBA 3DKKA 1VZ2A 2QT9A 3HLKA 4D9JA 1CFJA 2DR0A 2P8SA 1QTRA 1J06A 4UBNA 5JARA 3QPAA 4MWTA 1FFEA 4K5QA 5JD5A 1VA4A 2OQIA 5EFZA 3KSRA 3G0CA 3KXPA 1J2EA 3W9UA 4QWWA 2QR5A 5A2GA 5DYWA 2WG1A 2HA0A 2H1IA 4XX1A 3FVTA 4AXBA 5LZ5A 1A8UA 4ZWNA 2XI4A 2Q0XA 3FCYA 4H35A 1LPBB 1QTIA 5D7BA 1SCKA 2BUBA 1BN6A 4BVLA 3C6BA 4KE8A 5I9IA 2OCKA 3R3VA 2ZJFA 3NOXA 5AI9A 2VTVA 5K3DA 4PO3X 1CUWA 1BN7A 4X71A 1CUSA 3ZLTA 1YS2X 2VSQA 2WFLB 1VZ3A 5AOBA 1XQWA 2XLBA 1CUEA 4EZIA 3JYHA 1IZ7A 2HA6A 1PJAA 3A70A 1XRMA 3IUMA 4IHAA 1WOMA 4H7KA 4BZWA 1JJIA 4NMWA 1ZD4A 5AIAA 2GYUA 1R1DA 4FNMA 3R0VA 4NZZA 1ZGCA 1W1IA 1GGVA 1GT6A 5ALKA 1DU4A 4F0JA 4WDQA 1EX9A 2WHQA 1H22A 4QA9A 1KEZA 4X6UA 1XZLA 3V1LA 3V48A 4MWSA 1I6WA 5ALUA 5AOCA 3R40A 5AKYA 5ALWA 3UUFA 4A16A 1IUPA 3WK4A 1LNSA 1YS1X 4UBOA 4H7EA 3SC2A 1UT6A 2CJPA 3ZWQA 1CUDA 1VLQA 3ESAA 1XKTA 4M0MA 1E8MA 2BKLA 1IUNA 2AXEA 1THTA 2QTBA 4Y9SA 1J1IA 1A8SA 3SK0A 2QRUA 4EHBA 1IZ8A 5AI5A 4DMKA 3AZQA 2OPHA 3AINA 2VAXA 5KREA 4WY5A 3H17A 2WKWA 5LYYA 5ALYA 1UXOA 2ZSHA 4U2FA 4DSAA 1XLUA 5DWDA 1DX4A 4BAGA 1BCRA 1SC9A 3EBLA 3EIOA 3OOSA 4Q3OA 1WHTA 3HSSA 4AN1A 2CEKA 3EF3A 3NGMA 1UKAA 4LKOA 2ZYSA 1Y7IA 1W52X 2XMZA 3O4HA 1NU8A 2WIGA 3WKDA 3H2IA 1L7AA 5A7GA 4PV7A 2R11A 4B83A 1YA8A 4P92A 2QJWA 3PUHA 1X70A 3D7RA 2C4HA 5CH5A 1UKCA 1UOQA 1CUJA 4J0GA 4ZV9A 1MJ5A 1RYYA 2CZQA 3R3UA 3F9CA 2JGIA 1R50A 3H0CA 1XZDA 1HLGA 2VA9A 3AJAA 2YYSA 3W05A 2XDWA 2C0PA 2G5TA 2DQYA 5A71A 4AMYA 2G4LA 1UWCA 4GHWA 1IVYA 3CN7A 1O6GA 5HF5A 5CT5A 4IH1A 6YASA 3W2TA 2QZPA 1YR2A 4CG2A 1QIIA 1TIBA 5JD4A 1XLWA 1ZI8A 5T4FA 4Y2PA 1C7JA 4H0CA 2I3ZA 1FFBA 2OXEA 4J3JA 1EA5A 1CQZA 2IIVA 4DMCA 5ALIA 5C8VA 4BBZA 5FXMA 2DHCA 4UUQA 3Q0TA 4YX9A 4HTAA 1MN6A 1C4XA 2HL6A 3HI4A 4ARBA 1QIGA 5HCUA 4C4ZA 1CUHA 1PFQA 2C0QA 1Y37A 4HRXA 1CUBA 2PSFA 5K3AA 4IO0A 1XLVA 1EB9A 3O9MA 4A23A 2K2QB 5ALFA 3G9TA 3WYDA 2VJDA 3FCXA 3N0TA 3HJUA 3R3WA 2DFPA 3AZPA 5EHXA 2WQZA 3WJ2A 4X3CA 2HA4A 2RHWA 1FFCA 4EY6A 5AM4A 1CUAA 3B5EA 2OGZA 3BIXA 3K9BA 5I7UA 1WB5A 5K3FB 2AJ8A 1GPLA 1CQWA 3C6XA 2WSLA 5T4EA 3K2IA 4FMPA 4QDUA 4UHCA 1TRHA 3WKAA 2QXUA 5ALPA 3E0XA 1AZWA 4YK7A 3B3QA 2AJBA 2V96A 3E3AA 5AKLA 5CBKA 2Z5GA 5AK4A 4B9EA 4MJ3A 4OB7A 5LKAA 4C87A 2RONA 4AB1A 3WK8A 2CBGA 3WK7A 1VA5A 1ZD2P 2GYWA 1H2WA 1MX5A 2JGLA 2WM2A 2X8BA 4KAAA 1KU0A 1B41A 3GFFA 4WFIA 4EA6A 1GQRA 4U2CA 2XQIA 3HXKA 3D0KA 4HXGA 4Q1VA 4KE7A 3H18A 4BDSA 2X5XA 3QZUA 3G02A 4BP8A 1M33A 3WQHA 4DIUA 3HZOA 3GROA 5AICA 2H7YA 2O2GA 3T4UA 1ZJ5A 3G9ZA 4HXFB 4DYHA 1YCDA 2XUJA 4F21A 2I78A 2H9YA 3RM3A 1TKRA 2GBGA 4KRYA 3PI6A 5BWCA 1SCIA 1TCBA 3DOHA 5AOAA 1GXSA 3L1JA 1BRTA 3ZLUA 1YASA 2XUQA 3DLTA 1DT5A 3U1TA 3BL8A 4FWBA 1ODSA 2HA5A 2QVBA 1WPRA 3C6ZA 1EVEA 4Y2UA 5J3JA 4HZGA 3QVMA 3PF9A 4W1PA 5CURA 2DCMA 4B85A 4E14A 2OCLA 3NUZA 3D2CA 3W04A 2ES4A 2HDWA 3FYTA 1QGED 2PSEA 4HRYA 1HDEA 1QLWA 3M82A 4QEKA 1QIKA 3HC7A 5HF8A 1BS9A 1XKLA 3ZV7A 4CIAA 3HEAA 3MGAA 1DT3A 1ORVA 1LPMA 4U2GA 4KAFA 3DOIA 1F8UA 4FBLA 2VJBA 3DQZA 2QS9A 4DGQA 3IULA 2OCGA 1EDDA 1UK7A 5DNVA 4G4JA 3ZLVA 4X6XA 2XMQA 1EXWA 1BCSA 3WL6A 4A5SA 1PV1A 4CI9A 2ZJ7A 2VAVA 4KRXA 2PKYX 1JKMA 1G66A 1XZFA 3PFCA 3KOOA 5AH0A 3D2AA 1UKBA 5KWJA 5EHZA 3HRHA 2XMRA 1LPOA 1XZMA 4L9AA 4GXNA 4JYMA 4JH0A 1JT2A 2PL5A 1RP1A 2HIHA 4XIIA 1EI9A 1QO9A 3X3HA 1AURA 5ALMA 3YASA 4CCYB 2XUKA 5LKRA 2GBIA 5EIEA 2AJDA 2DHDA 5KBYA 2EDAA 3V1NA 4HVTA 2WU4A 2CUTA 4UFNA 3WWCA 1T4MA 3ILSA 1G4HA 1MT3A 4X00A 7YASA 3OM8A 5CT9A 3EQ9A 3FWHA 4QWMA 2JIDA 5AM5A 2WJ3A 3IVMA 1VE6A 1WB4A 2QXTA 3VJMA 3QM1A 1LPPA 5CMLA 4ROTA 2Z3ZA 3WK9A 5ALLA 2Y2VA 4QZVA 1O6FA 5F4ZA 1K8QA 3GBSA 1MNQA 2WU3A 4CG3A 4ZXFA 4INZA 4JUIA 5FP0A 4GEGA 3FYUA 3C5VA 4AQDA 3R41A 1QIFA 4X6YA 5BWBA 1RWQA 2C58A 3L1IA 1DQYA 3C43A 3F8SA 1W76A 3WWEA 5C8ZA 5ALRA 5CT8A 4QDZA 1ZGBA 3I2HA 3IUQA 1K6EA 3PDCA 1QFSA 2HU5A 3ZI7A 5FUMA 3RARA 5JIBA 1YB7A 2D5LA 1DINA 2XT0A 1GKLA 4X95A 2WFZA 3P2MA 1EB8A 3WIBA 1ZIYA 1AX9A 4UPDA 3LCRA 3H1AA 3PICA 3WZMA 3DEAA 1E3QA 2DSNA 3WA7A 4G4GA 4J0KA 5FPPA 1P0MA 2OAEA 1H2ZA 3IIIA 3KD2A 4W1QA 2GYVA 3WMRA 3DJYA 5HKBA 2VJCA 3DNMA 1XRNA 2H7CA 5LZ9A 3ANSA 1Z68A 3WK5A 3VVLA 2JEYA 5FV4A 2PBLA 3A2LA 5EGNA 3QH4A 5C7YA 4B0OA 1U8EA 3G0DA 4I19A 5BV7A 3FLAA 3I2KA 3PE6A 3H1BA 1CR6A 2YXPX 1CUIA 4N8SA 2QJRA 2VQ6A 4TPKA 4KEAA 5JD6A 4AX4A 2AJLI 4W1SA 1Q84A 2JGJA 1WPXA 4B84A 5AKJA 2WLSA 1HL7A 2DHEA 1XQXA 4BATA 4G1FA 4IH9A 2PU7A 5AKIA 2QOEA 3BDVA 3ESBA 4BYMA 4MYSA 1CUZA 4GDMA 1ISPA 4FNGA 3FYUC 2V98A 4BAZA 3A2MA 4DM7A 4Q34A 1A8QA 4J03A 1XQVA 2XUOA 2WIJA 1ZIXA 4UFOA 3TEJA 1WM1A 4F60A 3WK6A 1K63A 4Y2QA 4MXDA 4FHZA 4U2DA 5AI8A 2J4FA 5DNWA 4QDOA 3HYSA 2UZ0A 1W6RA 4EUSA 4BRSA 3WJ1A 3I6ZA 1QIMA 3R3ZA 5AI6A 4IH4A 4LXIA 4P9NA 5LP1A 3QYJA 4BP9A 3MVEA 3C45A 2VEOA 1JFRA 2XQGA 1HBJA 3WKCA 2VT6A 4CIBA 4FOLA 2WTNA 4OYLA 4UHBA 4GLBA 1DWOA 1NX9A 4CCYA 4MQMA 2D0DA 4Q3KA 4Y2RA 4G8BA 4FFVA 5ALQA 3JW8A 3G0IA 4N8EA 5ALHA 3BJRA 1QE3A 2W6CX 4NVRA 1CUGA 1UOOA 2ACKA 4G9GA 4OSEA 4DNQA 4AN0A 1X2EA 1KU6A 3OURA 2XUGA 1E8DA 4X90A 2EDCA 2BUAA 1CIJA 3G9UA 3FSGD 2XMBA 3HABA 3DCNA 4WJLA 1CLEA 2HRQA 4KYVA 4J0HA 2ROQA 3VJKA 4HXEB 5A62A 3DL4A 1XROA 4X92A 2ONCA 2FJ0A 5AKXA 1AQLA 1JI3A 5AK6A 3DL7A 2BGRA 4AMZA 3VISA 5EI5A 1MU0A 3ESCA 3FOBA 2V9ZA 4C4XA 4E46A 4K6HA 2HM7A 3TJMA 3AUKA 1AMNA 1YAJA 2VATA 1W75A 4WDRA 5LZ8A 5DJ5A 3FBWA 4PQEA 2WFMA 4UHEA 4KE6A 4S0XA 4YPVA 4DMFA 4Q3LA 1XRQA 2X76A 1MO2A 4DTCA 5CH8A 1J07A 5IKXA 5AM3A 4B7ZA 1CPYA 2WJ6A 2JGEA 2XUPA 1AUOA 1FFDA 4B6GA 3O4GA 4X94A 3ESDA 3BDIA 1EDBA 4KAJA 4E11A 2ORYA 3N2ZB 3OPMA 2BFNA 1XZCA 5D3ZA 3H19A 4RE5A 4BAUA 1QFMA 3M81A 5HF9A 2WHPA 4UBMA 2Y6UA 5AP9A 4B81A 2ZSIA 5AKHA 2PX6A 4BCDA 4TGLA 1K5PA 1N5RA 3STVA 4Y2JA 1GKKA 1VOTA 1LZKA 5AO9A 4GECA 5CXUA 3ANTA 1CUCA 2B4KA 4MYDA 5DNUA 3A2NA 3G0BA 5HQ3A 1QIJA 1EINA 1LBTA 1TCAA 2JBWA 2GZSA 2O7RA 2AJCA 5AM0A 3I1YA 4BDTA 1ZI9A 4CCWA 4Y2VA 2J3DA 2RAUA 4QLAA 1XZEA 1VE7A 1SOMA 5K3FA 2XUHA 3VVMA 4P08A 3LIPA 4G9EA 5A6VA 3C5WP 1XZKA 1FSSA 2RI6A 3BIWA 4X85A 5T4BA 1A88A 2RIPA 3HACA 2XB6A 2C7BA 2B9VA 1XZJA 4W1RA 5HFNA 3AIKA 4FKBA 3AFIA 4QE3A 2QKYA 4KE9A 3GUUA 1LPSA 4KACA 5LZ7A 3FYUB 1A7UA 1L7QA 5ALDA 3QITA 1E8NA 2PSJA 4RNCA 3SWWA 5KWIA 1MPXA 4LIPD 3O0DA 4FFWA 4Y7DA 1MNAA 2XMDA 3W06A 2VJAA 2HU7A 3H2HA 1F0NA 3F96A 2QUAA 4DNOA 1DWPA 5FKJA 4K6KA 4C4YA 1WCYA 3STYA 1UK6A 2WHPB 3RKSA 5HFAA 5HKAA 4BVJA 1E89A 3WKBA 3A6ZA 4ETWA 1G42A 5HK9A 1MX9A 5JAUA 2PU5A 1Y7HA 1GZ7A 5CXXA 4RE6A 4Y2TA 1WHSA 4PF1A 2BUCA 1GQSA 4UHDA 1THGA 3FSGA 3I28A 2XLCA 2EEPA 3I2IA 3O4JA 2GBCA 2G5PA 4XJVA 5HZGA 1IMJA 2FX5A 4EY7A 3R3XA 1EH5A 1LZLA 2WG2A 1XZIA 1H2YA 2HA3A 1ETHA 2J3QA 5FPQA 5A7FA 5ISMA 5YASA 3OC0A 4PNZA 1Q0RA 4OB8A 1XRRA 5K5EA 4PSCA 1JMKC 3B12A 4AO6A 1JJFA 4AO7A 4OYYA 3RK4A 3V9AA 5JAOA 1G5FA 3PFBA 4FLEA
chains in the Genus database with same CATH superfamily
2UVQA 1PR1A 3G8YA 1EP9A 4YVFA 2OWEA 4BPBA 1KP2A 3C8DA 4LYAA 4P38A 3SY8A 1LRLA 3HCEA 2NYVA 1T24A 2C97A 2QF7A 2OCIA 1EVIA 4JP3A 2AEFA 4ZOCA 1II8B 4GI5A 4LY6A 5E2BA 4H3HB 1KHHA 4IDPA 5GWXA 3U9TA 3WAKA 2AV6A 2M6SA 4BX9A 4D02A 2I1QA 2CXXA 1Q57A 2J9RA 2OFPA 2PUJA 2B8NA 4RPJA 1YVUA 4XARA 4ZOLF 4YV7A 5B5SA 3ACDA 5L3QB 1XCGB 4ARAA 4Q16A 1H65A 3A1TA 1N75A 2J6BA 4AWBA 2WFLA 4TTVA 4UMFA 2FU5C 3V7FA 4D81A 2WC1A 4DNPA 4Z51A 1LSSA 10MHA 3R9XA 3SNKA 1ULHA 3ACCA 4G8DA 4MWOA 4HGYA 3W7VA 2BE7A 3EZLA 1L1RA 3HXQA 5DMHA 3MMXA 5EAIA 5CDFA 5DCWA 1NBMD 5BOVA 3VNSA 1CNEA 5ARDA 3V6LA 5HIAA 4O5AA 1NVVQ 2PSSA 3IIKA 1SEVA 1Z75A 1H5QA 3PUZA 2X0EA 2R6HA 4EY8A 3I2FA 5BT8A 1FEZA 4OBWA 1FS4A 1GG5A 1QH1A 3CX7A 4GICA 2IX9A 1E9BA 3FTQA 1H9CA 2IUTA 3QMVA 1UXJA 3I1JA 3VR6A 2NXNA 3T3MB 2Q5IA 5T6MA 3QV1A 1XMSA 2E4VA 3IRUA 3O3NB 3QU2A 3CMCO 4UZEA 4MJ7A 4ZCSA 2IWRA 5E1BA 2O05A 1OXMA 1XDZA 1IN7A 4HFRA 4UZSA 2O3TA 3KAJA 4L16A 2Z3WA 1VL8A 1T6XA 1OC4A 4HLCA 3A4TA 3QLVA 4I1RA 4RV5A 2PMBA 3U3RA 3JWJA 5JE8A 1Y8RA 3G68A 3B53X 3JALB 4KIUA 1IULA 3TZKA 4RVDA 1HT1E 1P73A 1JQEA 1Y1PA 2AX3A 1KEEB 2WV7A 1OZFA 1Q6YA 3QG5A 2O2HA 1FSFA 2JGDB 4TZ0A 3EA4A 2C9CA 1DC3A 1Y4AE 1O94C 2WOOA 3A26A 2YJNA 4CM8B 5C81A 3F6RA 5F1PA 3LHDA 1YB4A 3EPJA 1A7AA 3Q12A 1DAGA 3ICPA 4HEA1 1J8QA 1T91A 2OZVA 1GFZA 2ZG6A 2DB3A 4AKIA 2HMUA 2NIPA 1V8OA 1E3JA 1XD2A 2BHRA 3IEIA 4LXQA 2FE1A 3D4LA 1U2EA 5ERXA 2LCQA 4URHA 3EEOA 3A6EA 1V5WA 4JT2A 3SYLA 5AW5A 5FJIA 3VPHA 3F0TA 3KVNA 3KOXA 4D8YA 2VQFB 5J5VA 1HKUA 3KT3A 3OE7D 2REQB 2GERA 3GFTA 2ATXA 2R00A 1ULTA 4DQUA 2B30A 5BW8A 1TQ4A 3UAOA 4YTEA 3CNNA 4L95C 1R2QA 4Z86A 5EGSA 2YCLA 2QTRA 1N1GA 4B3TB 2C9ZA 1E32A 1HKHA 1LBIA 3IA2A 5CDHA 4IJQA 3G17A 5EHQA 5AVJA 5JVDF 5KYXB 1EVQA 2B2XA 1JKFA 3G3EA 4MA0A 3I45A 3T61A 2VK2A 3WBJA 3G7SA 2Q4TA 3AP1A 2CNWA 3QUSA 4KLZA 3A1VA 1X39A 3MHPA 3P0JA 1H2BA 4B87A 4UOEA 5DV9A 2Q0HA 2NYAA 2YTZA 3N76A 2PUEA 2OXFA 3JZFA 4L74A 5FOQA 2IUSA 1QRDA 3NDPA 2YXDA 2VBGA 1T0JB 3PXEA 3UK2A 3KAKA 4FXPA 4JN6B 1MX3A 3LXMA 4N5DA 1F1JA 1KFEB 2IYOA 2WZQA 3CLSD 1DV2A 4JJGA 5EJAA 4EO7A 4LRUA 1Z12A 2AF4C 3MT0A 4PR3A 2B4QA 1Q0ZA 5TPWA 5IH7A 2VZEA 3IOEA 4RK0A 5C53B 4C4TA 4GZLA 4ZZ0A 3NIDB 4XGIA 3TIVA 5JFOA 4LJKA 3U0VA 4C88A 2GNPA 1UBGA 4R2LA 1UZAA 4KVZA 4M55A 5FO1A 3NW9A 5DLDA 4Z0PA 4QFCA 1MB0A 2C29D 1JLLA 5BRJA 3T7KA 4HGOA 2JGMA 1E1NA 4K28A 2PWZA 4NYMQ 1OCEA 5JS7A 3JQQA 2PM8A 3UTDA 4E5SA 1SD1A 1NV8A 3C8HA 4J6FA 2ZT7A 4XLTA 4DMHA 1JDBC 3NHFA 5ALJA 3R3JA 1ESDA 3RVQA 1DKOA 2GTPA 2Y1LA 1Z6PA 4W82A 3B6JA 3T34A 5L51A 2CMFA 5T64A 3ZWDA 2G1UA 5IVHA 3C1TA 3F4BA 4X93A 4JYPA 5K0FA 4CEIA 1UK8A 3IO5A 4KDFA 1SHUX 4WK0B 3EIEA 3PEEA 2HJSA 3TLXA 4BNLA 5E2IA 4ENSA 1NSFA 2Y2UA 3RUEA 4DSNA 1LDNA 2GNOA 5EZSA 1KJZA 1A27A 5ELMA 4W6ZA 1L1QA 5AJHA 5LZ2A 1FSPA 4XZ3A 1Y5IA 2CFIA 3FJOA 3D43A 3VR4H 2WFAA 5I9NA 1KZ1A 3M33A 4BB0A 4WNCA 1DX6A 3N74A 3ROTA 1ZK2A 1PEAA 4JGBA 3VX3A 4H7HA 1U2GC 1X7DA 3FFWA 1BX1A 3AY3A 5ICFA 3RASA 3FDFA 2WHRA 4GX2A 4X8LA 4DEVA 4EWLA 4RTKA 1Z82A 2EVWX 3K1YA 4FGSA 4QFBA 1BS1A 3KUDA 1Q0HA 2ECFA 4G4SO 1U3DA 4M0UA 4Y0VA 2IITA 5DX8A 1ESEA 1O03A 5JZOA 5KWSA 1UBCA 4HQRA 3SZUA 1W4ZA 2I6SA 2WY2D 3P2KA 5E4JA 2DFVA 2NUTA 4BN5A 4HNVA 2A1UB 2C8VA 1GGHA 3U3ZA 2HSDA 4DDTA 2E89A 1SUBA 3LQFA 4A2QA 4BB6A 2R60A 5ALSA 2GN0A 2JLUA 4L72A 2P27A 3RTGA 4DUGD 2A5FA 2HXYA 4WA8A 5ALEA 3PGMA 1KQNA 4BRZA 4B2LA 1QJ4A 3D3NA 2J7PD 2Q7XA 1JB1A 1ZLXA 3IUEA 1NJSA 3SD7A 3WWDA 9ABPA 1JDNA 5IT0A 4D9GA 4QKQA 1D4AA 2XMGA 1KEVA 1XQ1A 4TZTA 4GW3A 1TK3A 3EQ6A 4C7OB 1V71A 2M9MA 3I53A 2G71A 2PV7A 2R47A 2XE4A 3DP9A 4X1OA 4Z9BA 3FKSD 1EUCA 1EK0A 2BRUA 5H59A 1CZOA 3BAZA 2BJHA 1DV1A 3D8NA 4RPCA 3WICA 2BHNA 1QK3A 3V7UA 1N6OA 2VF4X 1PL6A 3NORA 3EJ6A 5FOTA 2VHQA 2WAMA 3D2BA 3ORRA 4JNKA 2D1SA 2ZE6A 4N5IX 4TTSA 1WZ2A 1XEXB 3ZQKA 4DJFC 1X9HA 1R8JA 3ZHOA 1Z2OX 3FNRA 3G88A 2GSWA 2V59A 4LJLA 4KUGA 4WY2A 2YWJA 2C20A 1KJ8A 4EB0A 1P0QA 5JBQA 5HSGA 1I14A 3D2LA 2IU6A 4JJ7A 3WMWA 2YXBA 3LT4A 2R1TA 1E6WA 4X97A 4AJNA 1X8XA 2OBXA 2VDPB 5AKKA 5HQ3B 5KJEA 1FLVA 1QBKC 2E55A 3P9PA 4YONB 4E22A 4GIBA 2ODEA 4J0DA 3ZS9A 1O97D 1G8FA 2C2KA 2OAGA 3SJAA 3GZJA 3FYSA 3KJZA 3RVLA 1T1SA 4D44A 1B0AA 4DN6A 2DERA 4IG9A 1IAVA 1IC6A 1TCUA 2ASVA 3JD2A 4OL0A 5IJAA 1U6KA 3DTNA 1Q1QA 1LDEA 2P5TB 3C87A 5GM1A 2CE2X 4CT4B 1EIWA 3RS4A 3HU3A 4J0FA 1XZHA 4O2BB 1BHO1 1CJVC 1JIXA 3E1GA 2HV9A 2WWHA 3M2TA 1NJ1A 3PVZA 2LCIA 1AKQA 2GK6A 3BB4A 1VHJA 5FRDA 3NVAA 2HH9A 3UMGA 3NJ4A 1N4DA 1JA0A 5JD3A 2QMOA 1SULA 4XYMA 3G2PA 4H7IA 1ZK4A 3CT4A 4LV6A 3FG9A 4IV0A 1YS4A 2XPCA 5EWLB 1D5WA 4XX0B 4EI7A 2CLFB 3LP5A 1FYEA 3U40A 1IRIA 2QJFA 1KAEA 4HAXA 1V5FA 1QO0D 3LFUA 1H2XA 1KBZA 4FC7A 1BKSB 5EEHA 4X8HA 1FFGA 5JNSA 5DTIA 5JS2A 3QKTA 3I9JA 2NUPA 1KF0A 1CR4A 3Q8WA 4TV9A 5CM2Z 1ZN7A 1IU9A 1SUCA 4TT8A 2GFQA 3VRHA 2ZRGA 5FR1A 3VTKA 3UBTA 1MX1A 1CUXA 4N0DA 1OF1A 2DT5A 2FCRA 1Y7PA 3DLIA 1RWBA 2Q4EA 4BNGA 2D06A 2Y1KA 3JRNA 2AKEA 4PAQA 3I52A 3H5RA 2QTWB 3IT1A 3PTZA 5IVDA 1W4AA 3DDHA 3FMPB 5DNCA 1T9KA 3E9RA 2Z58A 5DGDA 3D8TA 3AH8A 4WESA 2HF8A 4HNTA 2JFQA 4L4UA 3BMOB 4B17A 5L3SA 5G0WA 2HWWA 2CLLB 1TJ4A 2JRCA 5KHAA 2VNHA 3AERB 3CA8A 2BMDA 3VAZA 4LW8A 1I0ZA 1WNFA 1VPDA 2MSDB 1KQGA 3P45A 4G2TA 1VPVA 2QRZA 3T7SA 2VQEB 1P6QA 5DWQA 3Q9LA 2IYPA 2BBWA 3L9WA 3PPWA 5FULA 1TZMA 2BKVA 4DLNA 5K6RA 1U2TA 2R8BA 1TQ6A 1E92A 1CUUA 1JE1A 2QRHA 2CL5A 4ZV4A 1CY1A 3HB0A 5J1SB 1YTUA 1QP0A 1EBUA 3FZNA 3P5SA 2D1YA 5HQJA 2PZBA 4IDAA 5CTAA 4Q18A 3FIJA 3RBZA 3DFIA 4ZZ3A 1JAZA 1WWKA 4DV0B 1GL6A 1NY6A 1KOFA 2X7HA 5ALOA 4JROA 3DZGA 3ER9A 4ZA2A 1P5RA 4M1ZA 2H00A 1BA2A 2JEZA 1NJGA 1RKBA 3OT1B 2PGAA 4CU2A 4TUYB 1T2NA 3J7AC 3F74A 2O50A 1USWA 3FNBA 4DJAA 3QLEA 1ZA2A 5HE9A 4L7QA 3O8RA 3OO0A 4W6QA 4ZIRB 5GY7A 4GSKA 1RWNA 7AT1A 1XU4A 2A4KA 4RHFA 3T4EA 1C3VA 1L5NA 1I7DA 4ZYZA 4ZI2A 3H2KA 4ZC8A 4AIIA 4MVJF 3KEOA 2GF2A 2WB2A 3MWJA 3I1FA 1BGWA 4A9AA 1UXIA 5TMDA 1S89A 1C9MA 1Q21A 2PZ8A 2WM3A 4BX0A 4DANA 4F2HA 3T3DA 4TWZA 2Q3HA 3WO0A 4RSRA 1VLHA 2J59A 2O3SA 2XMSA 4FQ7A 2WVGA 3CZAA 3QNUA 1W8IA 1AD2A 4M0LA 4Q7LA 3LUHA 3S70A 1FFAA 1RCUA 4CG1A 4V1CB 4DDMA 1QFYA 1W5BA 2HWYA 1KOLA 1MO4A 1Y6RA 1QOZA 2A92A 4OKNA 1ZN2A 3MTIA 4UPEA 3MJSA 2FPPA 4YJDA 3H2GA 1E66A 2PDAA 1DGQA 5LL6P 4LHEA 4ZT4A 3T7JA 1B8NA 4LQCA 4WCVA 3LYUA 1PGNA 4Q15A 4JKIA 1IBRA 4UEOA 5SYMA 3M5WA 2IZ7A 4J0JA 2H11A 5H16A 1BWSA 3AY6A 4QU5A 1G0NA 3DPIA 3IUJA 3K8YA 3TL3A 2BEKA 1LD3A 2BDEA 4OXXA 3GT3A 3KDAA 5DRYA 2ZSDA 1TA0A 5BSRA 4NPAA 4RS3A 4EM6A 3UK0A 4NX2A 4QFDA 2Y8EA 4J1SA 4B4WA 3RKUA 5IAJA 4YCSA 3IQHX 2C5LA 2W00A 3ICCA 1I6MA 3JYOA 4I1UA 4DDHA 1B43A 5G1NA 4J7CA 4HP8A 3JZDA 3TPCA 3J80A 1FQOA 2I6XA 5K3BA 2ISCA 3OCVA 1DC8A 3BMCB 3FUUA 4MV6A 4BGEA 4FFSA 2MCFA 1I7SB 1TAHA 2WT8A 5H83A 4US1R 1TECE 3M83A 1RI3A 3OJCA 5A7HA 4PXAA 4RM2A 3RB8A 3NAMA 1QBGA 1PVOA 1YZLA 3GVXA 5FPHA 5HUQA 1A2BA 1ISGA 2Y92A 1OBVA 3A3OA 4DEXA 1SQFA 4EB6A 4CODB 1FYDA 2PSHA 3AUSA 3GAZA 1NW6A 5KOYA 2YRWA 4KTTE 3QLVC 1EWRA 4TSRA 4U2EA 5ESRA 4B4UA 4C89A 4JC8A 1D03A 3TSCA 3CGWA 3OOHA 4F1KA 5LR6A 3B5JA 1A8HA 1PT7A 1RYDA 4LYEA 2AOUB 4OHFA 1ZH2A 2IS1A 4HD8A 3ZLBA 1GKYA 1J21A 1WABA 4E08A 4QRIA 4URUR 1KARA 4BFZA 2MTBA 3CN9A 2NOAA 2BCJQ 2QP4A 3PE4A 4KJZA 5JYEA 4LJAA 4RK4A 2GBPA 3HY4A 1XD9A 4BY9E 2CYBA 2I1WA 1XMPA 4ASUD 4MVYA 2DPHA 5JYCA 1CS0B 1ZCAA 2F1KA 3CRRA 4MUFA 4NPCA 5AK5A 2KS6A 4TM7A 3Q41A 1NP6A 4U0JA 4HUQA 1FL9A 3EASA 2BDTA 1F7UA 2ZPTX 4R1PA 3DLBA 1NNLA 5H3LA 2IE8A 3SIPA 4ARCA 4UNRA 2JS7A 5DN9A 1L5LA 4CDRA 3AUYA 2CB9A 3EIQA 4KXNA 2BBTA 3BL5A 1SHJA 4OI4A 4C0WA 4L4XA 4R2JA 2BSAA 2AOUA 3RAGA 1QHGA 1FJGB 3HBLA 4XFDA 2HJGA 4FE3A 3BF7A 4O0LA 4Q19A 2PE5A 4INAA 1ZG3A 4Q9JA 5HJ5A 2HQ1A 1CTQA 1P33A 2PT7A 3PGXA 4LY0A 3TNFA 3ZD8A 3FLBA 1MXFA 3ZE0B 3S5JA 1NW9B 1I36A 1N6LA 4MS4A 5AVQA 5KNBH 4G37A 4J8PA 3MERA 2PJUA 2A3RA 3UWOA 2E4WA 1EDEA 4GDFA 1V7CA 3GEIA 3NBQA 4MQLA 1Z29A 1U3UA 3C6KA 3HCCA 1ODCA 5D3QA 2W6JA 5EJIA 1VJTA 4FB4A 3U4HA 3N2IA 2B7BA 2PMWB 2X40A 1X1CA 2FZ5A 3KK0A 2FPLA 4ZQHA 1HF3A 3B8HA 3OZUA 3R9KA 3LT5A 4F46A 3ZLJA 1K1EA 1QYCA 2PUAA 1ACJA 4P83A 5EP1A 3HHEA 1K6XA 4BC0A 2PS0A 3AEKB 4DA9A 5AVRA 2C59A 2XYQA 2EG9A 1M3SA 1Z6YA 3T41A 3GH1A 5KAMA 3ICVA 4IMPA 3VHXB 4PG8A 4LJ9A 2HFKA 3SBDA 4WNAA 3AFOA 3V4SA 2P9HA 1KSFX 2I34A 4O8ZA 4P81A 5C5EA 2IF0A 4KITB 2NTJA 5B3AA 4MMYB 2IX3A 1HYGA 3SX4A 3EMKA 4H1WA 2PNFA 4YP1A 4I55B 4PFKA 2Y0BA 3TRFA 4IKPA 3W5DA 4GLOA 3RR2A 3TIXB 3IEKA 4H7DA 2OXIA 1R5OA 1KDZA 2ZRDA 3TVYA 4ZZ1A 1IN1A 4Y2HA 2E4ZA 1R88A 2O6LA 5BR4A 3TX2A 2PUVA 1W5SA 2GJ8A 1GCAA 2I29A 4TKVB 4TN1A 3U7QB 5JYDA 1SBCA 3FUWA 4EHHA 4J91A 2FW9A 1GL3A 2O6HA 3RE1A 5K0NA 1OBHA 4KYUA 2QM8A 4FZ5A 1VCHA 4QTYA 2R8YA 1XAIA 5IJZA 5I4KA 2QA5A 1E6EA 1U2GA 3M1IA 3EZYA 4IQ4A 2QMZA 3I4CA 3KB8A 5AHWA 1DCTA 1I5RA 1QRTA 1QZUA 1M0WA 3V46A 2VAMA 1YZQA 4RK6A 1RADA 4YWJA 1PG5A 3NBAA 4F45A 5ECDA 5G0TA 4B4DA 1QHYA 4YA6A 3VU1A 3B9QA 2WUDA 1GDHA 2P67A 2QG4A 3VC7A 4CM1A 2O7VA 2HK6A 3RUPA 1MGOA 3C7TA 4F85A 4C20A 1NBIA 3GLIB 5IP5A 2HLDA 4ZCTA 5DBEX 3CSDA 1ZO8A 2GZRA 4ZANA 5BN5B 3T99A 3IPYA 1SCAA 3I12A 6NULA 4TLBA 2UZAA 1X13A 4Y2GA 1XT6A 3ES9A 1N6PA 3PKZA 4GYJA 2DUMA 5L6LB 2HU8A 5A5FA 1N1MA 4DC0A 2AL7A 1GR1A 3JR7A 1XMJA 5JEEA 2XQFA 5EQFA 3ZWAA 3VR0A 1VBFA 4WINA 3H1GA 1OZHA 2W6MA 4HH0A 1IM5A 2YMMA 2PZAA 1Y42X 2G1AA 2ZXEA 1P0CA 4IIFA 2ANBA 3TQIA 4HI0E 3O3MB 4WPGA 3GZTB 1SZDA 4JDUA 1G6OA 2F3UA 1EFKA 3JATB 4MO9A 5I9BA 1EK5A 5T6BA 5FX2A 2OHOA 1ZD1A 4GZ5A 4RCZA 1VGRA 3R6WA 2A5GA 5BVHA 4V1CI 1KMCA 5AKGA 1KWGA 4J9UE 4TMTA 5FNVA 1XK6A 4XDGA 1MHTA 2V0GA 4BO4A 3CNQS 2JAHA 4KQ6A 4AY3A 5IJ9A 4TTAA 5E8JA 1JIUA 2G82A 4LXHA 1JNYA 1NVXQ 1C8LA 1CDEA 3NAQA 4PNHA 1AQIA 3DCIA 3DONA 1KPIA 4RULA 3VH2A 2DZDA 2HTEA 3ASUA 1K7EB 3DS8A 3GJYA 4P93A 2QTFA 3TRDA 3GZ4A 4DSUA 1P2SA 4ER3A 1TK2A 1W46A 1YUBA 2OCBA 2ZZKA 3DAOA 3IAHA 3NALA 2DXIA 3DD1A 3T9DA 4XUCA 1T9GS 5GJWC 4DB4A 2IEDA 2GUGA 3NEJA 3QBJA 4BMNA 4C3ZA 1LH0A 3FF4A 3QBTA 5MN6A 4JT9A 3WLLA 1C8VB 1ZESA 3KYIB 3ZPXA 2WQ6A 4DLSA 4KOAA 1OFVA 4H18A 3MPUA 1BKYA 3G59A 3W8NA 1WCIA 2X0NA 4OAPA 5IMBA 4UBLA 4DJDC 2PD3A 3FZGA 4BGIA 3MD9A 1NQXA 4F3RA 1ZNZA 1E9FA 4XB1A 4EENA 1XZNA 3QU4A 4NBRA 1WMSA 1UKEA 2RKWA 2R2GA 4BLVA 3X1XA 4KQCA 4NENB 3C1OA 3GP5A 4M9QA 2ZJ8A 2BTOA 3DE1X 4BFVA 4E2WA 3LH5A 4GUDA 3ZWNA 3NBMA 1E1KA 2W2XA 1NW5A 2FZ4A 3F3KA 2QUIA 2OG1A 1TYEB 2W71A 3FMVA 3JARA 3PU6A 2DETA 2JK0A 4ZXPA 2VEDA 4R40A 4OREX 4CEJB 2HPVA 1VZ2A 1IBMB 2Y0EA 4MARA 3VAYA 1ZA1A 3OH8A 1MH9A 5EESA 1ZVQA 3IVCA 4MAFA 5IBPA 2EARA 4LDAA 3S5UA 1J09A 2DR0A 2X6TA 1CD5A 3K31A 4F5YA 5C35A 1Y8QB 1ZEJA 2VTEA 2P8SA 4FYPA 5JFTA 3U44B 1E9DA 3B82A 1K68A 4J4HA 4RZUA 3DEIA 1DBQA 4UBNA 5JARA 1O95A 1XWFA 3RJZA 1AT1A 4HADA 4ZVRA 1FYWA 3CVJA 2QGFA 2ADFA 1S1CA 3A06A 1DADA 1PJ4A 1PUJA 4G1BA 1VA4A 4IIJB 5AW9A 3NHMA 3ZIAA 2R65A 3U4QB 2PBFA 3DEFA 1AZTA 4IUCS 1X1DA 4CM4B 3GP8A 4MKGA 1HFKA 1JQKA 1N5DA 1MGPA 2WKSA 2XSZD 4PCLA 4ZQCB 2X15A 3SJZA 1VKZA 5C37A 2O06A 4PVDA 5DGIA 4JX8A 1H2FA 1XWWA 4KL8S 3W34A 2QTGA 5G4LA 3GBVA 2ZRMA 5JC8A 5EMJA 1I5EA 1ZRSA 1GRVA 1H2AS 1J2EA 2FR1A 1F2TA 1M1YB 2WAXA 1Y5LA 3AR3A 3MJRA 4QQ8A 5A4IS 2BSXA 2JIMA 1SK9A 3R5JA 2X0DA 3V8BA 1DNPA 2H51A 2QR5A 5DYWA 4R9NA 5A2GA 2WG1A 4DQLA 2HA0A 3OZBA 4JSTA 4EG1A 5L40A 1QQ7A 2CFRA 3A4YA 2XI4A 3FWZA 4UPVA 5LZ5A 4BL5A 3SG0A 1TVKA 3VUFA 2BH9A 1DLIA 2Q0XA 3FCYA 3KQYA 2EWVA 4QQFA 3ZQ6A 1MFZA 1LPBB 1PT8A 5E7JA 3HJTA 3RC7A 1QTIA 1FW8A 4DY6A 5ES4B 1QPBA 2WTXA 1Y1SA 2FLVA 3C16C 4N3NA 2NUTB 5SY4A 3GGPA 3O8BA 3U3XA 1QGOA 1AKRA 4IDOA 5I9IA 5LXTB 1AQNA 2NNWB 3WGIA 4RVCA 2O0MA 5BPHA 1RIFA 2IHYA 4DCUA 1DARA 2VTVA 4I2VA 2A86A 3BWYA 5E6UB 4YAFA 1WZCA 3RVDA 1WPGA 3ZWYA 1BN7A 4UAGA 1ZVMA 4X71A 3VC1A 3WBKA 3WGUA 5A02A 1GAWA 2B4TO 5B6IA 5I3CA 1E1CB 1PV4A 1L3IA 1S4MA 1G7SA 1K88A 4E2XA 1VZ3A 2FFAA 2YRXA 3CZQA 2NXCA 5F7ZA 3S81A 4MVJI 1OU4A 5MGNA 2BF7A 4MUAA 4N01A 1EIZA 2IY8A 4AMVA 1KZ6A 1TCVA 3UJAA 3QVGB 1PHPA 3RG2A 2VRCD 2QX8A 4TYNA 4ZVNA 1Q1EA 1MO6A 5BR7A 2DHQA 1JPUA 4UAVA 4Z4EA 3U7RA 1K5DA 3DR5A 3Q6MA 1NW3A 3X2SA 2EJTA 1JLRA 7GPBA 5I47A 2ZS8A 5C8YA 4KHZA 4QUKA 1MOQA 1DKLA 1ZKDA 2ZRLA 4V02A 3EPLA 1KHTA 4LGCA 4MKFA 4G56A 4IIJA 2VP4A 3IHTA 4CXMA 3HNPA 2IUFA 1O95D 3JYQA 2X9GA 2X3UA 4IOJA 2GYUA 3ROKA 1JG3A 4B79A 4FHCA 2W98A 3OU2A 3R0VA 2FWAA 4G24A 4NZZA 1ZGCA 4UREA 4DZRA 4ARSA 1BOFA 1BMFD 1USUA 1GG2A 1GGVA 1GT6A 1I4TD 4IIUA 4X3OA 1M6EX 5ALKA 1I3CA 4A2WA 2C07A 4EKGA 1AHNA 4PLZA 4AJPA 1OV6A 2PLRA 3W8DA 2BTEA 1PFKA 3HWX1 1I51A 3QLTA 3GXOA 2C1ZA 2FV8A 3VUEA 3R24A 4QVGA 4UTNA 5HKKD 1DOZA 1KKMA 1P2TA 2Y76A 1ZIPA 3PR3A 4I4NA 2X42A 4KKXB 1AKTA 1EX9A 3HMKA 3OD5A 2WYUA 3IDQA 3ZWKA 4B3GA 3KUXA 1H22A 4QA9A 2IK8A 4ZKDA 1JDZA 2P2YA 3M6FA 1I01A 4JITA 1Q0UA 2QNRA 5KKNB 4PGFA 3V1LA 4A03A 4OATA 4R8RA 5FUYA 2B1IA 1Q1ZA 5M5BA 1E6MA 4M83A 4P0QB 1V11B 3WMGA 1HMPA 2DQKA 5KJ1A 5JISA 2YZNA 1XXHE 1AE1A 3HCWA 1E6LA 2G5CA 3CLTC 4N6OA 4JBWA 4TWRA 2PQ6A 2IYUA 4Y9DA 1QZZA 4GOXA 4DCVA 5DNYB 1FFYA 3BC1A 2IT1A 4R5MA 1SBHA 3SXUA 4Q0MA 3N8IA 3K71B 4Z4HA 1YS1X 4HB0A 1YBAA 5IT9A 2OEPA 3OEWA 4EUKA 4K1LA 1O5TA 1Y9ZA 4AD8A 5HX7A 4P8RA 5A3JA 4EG6A 4D3DA 4H4DA 2FN7A 1GFSA 1NDQA 3KYJB 1FXUA 2B35A 5E95A 3IDOA 4E09A 4DR4B 2ZKIA 4JI2B 3B7PA 1S9DA 3ASYA 3P97A 2B94A 1T1GA 3EUEA 4DLYA 4BNXA 2X2FA 2YIJA 4ZAGA 5LN1A 1ML3A 5IS2A 1Q1NA 1WQ1R 2X8JB 4LBZA 4GOND 4RSHA 4YQZA 1J1IA 2NPFA 4M88A 3SK0A 4E7PA 2O8BA 5AI5A 1DZ3A 3ZQ4A 1NBAA 4HDMB 3AZQA 3KSUA 4DARA 1U4OA 2N3ZA 3GJ7A 2HY7A 1XJ0A 4WOKA 3K2QA 3UOWA 4CMJA 1VBMA 3HN7A 3Q87B 5E6SB 2JNWA 4F97A 2VKQA 4IIGA 5LYYA 5LUAA 2B5OA 3MK31 4IFBA 1NTRA 1SUWA 1Q7GA 4XWKA 1E60A 5BN3B 5EKUA 4XYLA 5DX0A 1TYDE 1AQJA 2JD2A 3O74A 4KFRA 4KQFA 4U2FA 4DSAA 4XSHA 4NDNE 4D74A 4XWWA 2JHAA 4DKJA 2IDJA 1BCRB 1YZHA 3GD7A 2RBGA 1DUIA 4EJ6A 5ELXA 5BRNA 1I2CA 1YHZA 1CU1A 2GMWA 2O3RA 3AR2A 3FKSA 3X2FA 1KXZA 3FVQA 1FNMA 4UQOA 3E3MA 3HSSA 2P41A 4EG8A 4NIMA 3EF3A 3NGMA 4BO1A 1NXTA 1YQQA 1UKAA 2V65A 1ZGHA 4GMFA 3UAWA 2Q45A 2FQYA 3MJVA 3B6MA 3E1KA 3KV3O 1W52X 1XEAA 1YE5A 2GD1O 2XMZA 2Y68A 1M66A 2Q0QA 3M6VA 3RS5A 5CCEA 1P9WA 1UBEA 4ID9A 1OH7A 2H1VA 2WIGA 3I9V1 4OQDA 3WKDA 1ATIA 2ZAMA 4PC7A 2XCRB 3A37A 3IUSA 2YKGA 4IUBS 2ZE7A 4QUHA 3W4KA 3G2OA 4IW3B 1UQRA 2JI4A 3K9FC 1JKJB 3CSSA 5FNVF 4YCMA 2V6FA 2X4IA 4WMLA 1I3KA 1X9IA 2OAQ1 3QFHA 2WYWA 3IOMA 4GGPA 1P7PA 2B92A 1ZUD1 3GRVA 4ND7A 4XQ0A 2A1IA 2RGXA 1M0SA 1H4SA 3U09A 4MVJM 5EZYF 3C7CB 5B2ZA 3TECE 3P4XA 1M2JA 4L27A 1ML4A 4PGHA 1R5BA 1RPNA 1UKCA 4BO9A 5K0EA 1ZAKA 3LGXA 3SN6A 6GPBA 5HKKA 2G9VA 4PTZA 3ZDEA 3WIEA 4OP1A 2HQRA 1PUIA 1VLLA 1YD7A 3L6EA 1O95C 3PT9A 4B3DA 4C0KA 1SG9A 3RRJA 4CM6A 1AO0A 2OD7A 2P1ZA 4URFA 2CZQA 4JAVC 3F9CA 2O8CB 4JOCA 2H3HA 3OZTA 3H0CA 3LSYA 1HLGA 4CIDA 4LXXA 3MWGA 2YYSA 3RJ5A 2P6UA 3W05A 3PNPA 2ZM5A 1YGYA 3D1JA 2XDWA 3TOXA 1NVFA 5CDUA 2C0PA 2G5TA 4RENA 4KXYA 2VH5R 2I0FA 3AHIA 2SNIE 4OQEA 5B2FA 5K7SA 2P30A 5A71A 1RM4A 2Q07A 3EDOA 2VRWA 1C41A 3NYQA 3MUFA 9LDTA 3NKLA 3W5BA 4QGGA 4OKSA 3OJEA 3RBXA 4BZQA 1ATZA 2ERXA 1G8HA 1ZQ9A 3UWMA 3AHHA 3CUWA 5KWEA 2HMAA 3L6RA 4TLCA 4FMBB 2ZWMA 4JUBA 1JJAA 1IVYA 5IFLA 1DP4A 3VSDA 3OPVA 4LY3A 3WXMA 3ZC3A 3O84A 3L46A 4A8PA 4C30A 4KN8A 5AXAA 3EDRA 3ZYCA 1JJ7A 2BM8A 1CDDA 1KYWA 1JAXA 1RQ2A 5T5QA 3SYNA 2ZYTX 3M9LA 4WAUA 5GMOA 4ZKEA 3ZXXA 1OREA 4BEJA 1ZZGA 3QOXA 5ANRB 3SPXA 2Z6AA 2CY0A 3CLTD 4P2GA 1JEYA 3M9XA 2QL9A 3I8XA 2XJ9A 5JD4A 4CUJA 1HK7A 1PYDA 2CB0A 4UTRA 4URXR 1TFUA 2DY1A 1RAHA 4LOKA 4OMCA 4Y2PA 1BRMA 1U63A 1R12A 2EFYA 2JLXA 1XTRA 3WJAA 1JSZA 4JBLA 1FFBA 3KOYA 2OFOA 4QDJA 5DWVA 2OXEA 1XMIA 2R6R1 3L6BA 4TVOA 4YJ3F 1EA5A 1XEXA 3WFIA 1W47A 1ZK1A 2XXJA 4C9BA 3PHIA 2AW3A 1YKSA 1TMOA 5C8VA 3R44A 3ZWMA 3OIUA 4I8XA 3TLAA 4HOYA 1S96A 1XNHA 3IX7A 3NBXX 1YC2A 2IPXA 3EEIA 1WF3A 2NU7B 3MM4A 4JWTA 3TFOA 1JILA 1U3VA 3R2JA 1V39A 4YX9A 1Z73A 1DIRA 5KYUB 3PUWA 5BOSA 1ADCA 2B4AA 1ZYUA 4QPNA 4F4JA 2GHTA 2I2WA 3L8ZA 2XB2A 5HCUA 1Z4OA 2H9AA 4C4ZA 2RD2A 1IJEA 3FPBA 4ZD6A 2C0QA 4UNPA 1CUBA 5K3AA 2PGJA 2VNKA 1JKJA 1Q74A 4X7RA 5K51A 5FAKA 3B6EA 2WJAA 3H0KA 4HPXB 3DMPA 5LU9A 3QF7A 4OF4A 2XSZA 2K2QB 2IOQA 1F2DA 3K5WA 3PT5A 4KXMA 3DCJA 1NZFA 3L8CA 3QVKA 3R3WA 4H1HA 3UJHA 1R16A 2QNIA 2QAGA 3KKEA 2DFPA 4Z9AA 2Y77A 2QD3A 3QELB 3ZGZA 3TXYA 1OWOA 1JQLB 5P8WA 2B8JA 2VUHB 1N92A 4DNXA 3Q8MA 4WUVA 5LOVA 2PG3A 1KZYC 1LTHR 2DLNA 4EY6A 3UHPA 5JWOA 4QAJA 5HJ7A 1XU7A 2OGZA 3BQ9A 1KMHB 1QAOA 1YBHA 3K9BA 3MA0A 4YMSA 1WB5A 3BYZA 3PQ5A 4LG1A 3WY9A 4J49A 4YRQA 5FFFA 1ZJZA 3TMYA 3ZIDA 3AUAA 1K92A 3CZ9A 3I04M 5T57A 4BV9A 1LUAA 1TXGA 3U3DA 1EM6A 3GLUA 4L4SA 4EZBA 2F3SA 4D43A 2H4HA 2HMYB 1GLNA 5EXTA 1HLPA 5BMVB 3UAXA 4AK9A 1F12A 2FK8A 2NNLD 2O2YA 2REBA 4ME6A 4X8MA 5CFZA 4MDYA 1A98A 3DTYA 4LNHA 2UUBB 4HLQB 2QT0A 3GJSA 1NQWA 4MAMA 4UHCA 5EC8A 1BDHA 2OLJA 2DFKB 1PS9A 4R2MA 1ECGA 3I09A 2P9ZA 4NAVA 2EF0A 5ALPA 1GN9A 2VHEA 3ROGA 1P9OA 5F2KA 3DM5A 2MR5A 3E0XA 3T0GA 1Z4KA 3WGZA 2O8BB 2EBFX 1DBIA 1YVRA 2A30A 5JJBA 4GM4A 1OIXA 4YK7A 1Z0IA 4LC1A 3DOJA 2YC4C 1EFTA 1P2UA 1DXQA 1U9JA 1WF6A 2Q49A 3G5TA 4FI3F 4PZPA 2V7TA 1XC7A 4IJUA 3RUFA 4K9LA 3KR1A 4XIYA 2G76A 2OUIA 4X65B 2BGMA 4L6AA 3FDJA 3QK7A 4Q37A 4QICA 5JBIA 4ENTA 1QYXA 5CTJA 4NOKA 3JAKA 5EWMA 4GPZA 2A9FA 3UCFA 1VKNA 1WZNA 2FI1A 1C50A 1L8LA 1ZU5A 3FTDA 4MRSA 5AYVA 4AB1A 1PN3A 1Z47A 1K08A 4AULA 4EBFA 4F8JA 1DIOB 3IRVA 3N0RA 3ZVKA 4M7RA 1GSAA 3IPRA 5F3RA 4G0PA 2FPMA 4BQPA 5TB5A 2D4AA 3CUSA 1OJLA 1Z8DA 2N75A 2JGLA 3A28A 5LB4A 3R09A 1B3RA 1OQAA 4KAAA 2NQ8A 3KP1A 4HDQB 2GM4A 1DBWA 1Z0KA 3K0CA 1B41A 3GFFA 3N0VA 4DJ5X 4XW2A 4EA6A 1SUAA 5E7IA 1TF5A 1GQRA 3NTQA 3E0QA 2XQIA 2R7AA 2W11A 5GJCA 4MRMA 3PTAA 3D0KA 4NZNA 4HWSA 4HXGA 5ER6A 3KKLA 1O54A 3LZ6A 4KE7A 2X5XA 2FSUA 2QHXA 3TLZA 4CMGA 5E1MA 3C3DA 1SU8A 2P1RA 4UASA 1EVJA 1G8PA 3L6OO 4LGVA 5HGJA 3SC2B 3SF8B 1IEWA 3R6DA 3WQHA 5A9SA 5MFPA 5JH7B 3ZK7A 3C0KA 2QN2A 3FNIA 2AEEA 3LBHA 2W9XA 4DRZA 1M1ZA 4NCHA 2H7YA 2DFDA 1QRAA 2O2GA 2PXHA 2ZKLA 3F3MA 4KGXA 2GLUA 1ZJ5A 1NVMB 2CCJA 2NU9A 2Q3MA 3LK6A 4L51A 4M1TA 1DG9A 3RPEA 3FBTA 4IDFA 3VZDA 5C1BA 3S0JA 3HFSA 3PNQA 3HJFA 4XEUA 1XD2B 2AW5A 1NMYA 2ODTX 3MT9A 3OECA 4IEEA 2JCVA 4KRYA 3LC0A 3QWIA 2ZIVB 1RJ9A 4WCFC 1D7AA 1TCBA 3EFOA 2VTDA 3AETB 3KB6A 4PG4A 1UM8A 3S28A 4G25A 3I23A 1TLLA 1VRWA 4RJTA 1V8FA 2OD9A 4QPZA 1F5SA 1WEHA 1Z7WA 2ZBEA 3R0XA 2ZRPA 4OSEA 1CZUA 2QTLA 1IXZA 1N2CB 1ZUHA 1DT5A 2Y67A 3U1TA 4Q47A 4Z3DA 4OJKA 1E2DA 2XGJA 3EXAA 4MLPA 1GU1A 4FWBA 1ODSA 1Q50A 3EEFA 1L5VA 5CYOA 4RA6B 4UTVA 2JFWA 1W6UA 3TUZC 3EGXA 4LJ5A 1EE2A 1F4VA 1NNI1 2AGVA 3E81A 1PGJA 3TZQA 1WPRA 3INGA 3NPAA 1M7BA 4EX7A 3BH7A 2P0AA 1P6XA 1QYRA 3DWGA 3PC3A 5ARCA 5CURA 1V16A 3EUAA 1EAMA 3NUZA 4EH1A 1GR0A 3QFCA 3S2GA 3IIJA 4F38A 1NIPA 3ZXUB 4FCWA 4TV9F 3P9QA 1KDPA 1C1XB 1IOZA 2QLBA 1T29A 4Q4LA 3V7NA 2FEOA 3ZZNA 2HDWA 1BYIA 4ZOLB 1OXTA 4KFUA 2X5NA 4X84A 2PSEA 3KQNA 1XYVA 1NYRA 2D4HA 1XTUA 3B52X 3FFTA 2NU7A 4JHXA 4C4PA 3T5PA 4ZI7F 2ZSFA 5DE3A 2QMUA 5AD1A 1QLWA 5FWYA 4C7MA 4NNOA 3PEWA 4E4TA 1I1QB 2DYKA 3ND9A 3HC7A 2OORA 1SGWA 3G8BA 1A5TA 3FY4A 2OO7A 3GB9A 3I4FA 4FE7A 4I8DA 3ZV7A 1WY7A 2AXNA 1Y4UA 3KWMA 3W5SA 3HEAA 5D87A 1ZGAA 1ZN8A 1TPYA 4ZHQF 1KEKA 3C41J 1D1QA 2FPOA 2OM2A 2P6MA 1B74A 3QA9A 4DIBA 3G2KA 1E94E 1G6HA 1JX6A 4B7UA 4BQSA 2O8VA 1TVKB 5CG1A 1GTJ1 2GCIA 3MOGA 1U2DA 5BSEA 1EFLA 3G23A 5C5CA 1UBTS 1D6NA 1Q3KA 1MQAA 2Q28A 4JOSA 4AQYB 4CKEB 3A1UA 3L43A 1AUXA 2C54A 1YRQA 3IULA 3QWAA 3RYIA 3GR6A 2ETXA 2OCGA 1N8TA 1EDDA 4GO1A 3L7BA 1W5TA 2F8MA 1UK7A 3KQQA 4JC0A 2VJPA 1AMUA 3JQAA 2FZVA 2HPHA 3IKMB 4UHKA 2WYHA 3KTFA 1AU9A 3P9KA 3UMVA 3SI7A 4G4JA 1KYZA 4ZI3A 1KTVA 1V7ZA 2GZ1A 1U04A 2XMQA 3AVWA 2GGSA 3A27A 4FR2A 3QVWA 3GHHA 5CHEA 4BLWA 4F86A 2X5JO 1BCSA 4A5SA 4EHKA 4CQJA 1GQYA 1PWYE 3AHJA 4I6GA 1JXOA 1T2DA 2CHEA 1WMFA 4KRXA 3O83A 2R2AA 1JKMA 1V3QE 4BTEA 1XZFA 2Q3FA 1PCXA 3PFIA 2F8TA 1C9EA 1H2HA 3AF2A 1YCGA 4BE7B 4DCCA 4JL5A 1NLYA 2IW3A 3AEKA 1PLJA 4LVUA 2QYSA 4RJLA 3SHTA 2EW1A 3U4DA 4C0AC 5EWJB 3PD0A 1P1FA 3H3JA 5F7XA 3QU5A 2XMRA 1F3LA 1IE3A 4JEMA 3T1VA 1FTGA 2O8FB 1XEWX 1Z18A 5JPIA 1S3GA 2Z5LA 1G7TA 3N1UA 2VZ9A 2FHPA 4MV8A 2ON6A 4ETMA 1QKJA 2DBQA 4MCAA 2IUUA 5ICEA 3U37A 3VR5D 1VL2A 2PL5A 5JI3E 1EUCB 3BAFA 3QMPA 4ZZ2A 4EW2A 1WLSA 4XIIA 4XTRA 4ZVOA 3JRXA 4MKRA 4JEUA 4CJXA 1JSLA 3X3HA 5HCNA 1AURA 5ALMA 2LDBA 1YS7A 4B3FX 2CDAA 3WVNA 1SA0A 2XWSA 3OQ6A 2JA1A 2DX7A 2GBIA 2AR0A 3E70C 4P36A 4DDKA 4Z5XA 3LY7A 2AJDA 2DHDA 4QOHA 1B6RA 4ZCQA 3WKEA 3ANYB 4KIWA 4PAWA 2EDAA 1VBNA 4AP5A 1WRBA 1UKVY 4O0MA 2EJVA 4H15A 1JHXA 1L7BA 1GGKA 2R1VB 4UFNA 4YWHA 4XLLA 3WWCA 2FZEA 2JLWA 3NBKA 3S7ZA 3U7EB 4EJFA 3B2NA 3GEMA 5FL7D 2P4EA 5DNAA 1QHSA 1COWD 3PXXA 3ANLA 2LP4Y 1I7LA 4D98A 2F7SA 2RB5A 1NZDA 1PQYA 1UJBA 2PX5A 2X8LA 1J2UA 2YWEA 3VR4D 3GQBA 4ATNA 3CWZA 4OHVA 1L5ZA 4C6RA 2P0YA 2P9GA 1PJQA 2PS9A 4OQYA 4DXAA 1N7GA 1AOXA 3F71A 2OP0A 4UATA 3BIOA 4QOFA 1WB4A 2QXTA 1T0IA 2HTFA 4DLTA 2DLDA 2OUKA 4FD3A 1DKMA 2Q6KA 2ZR8A 4MWEA 3BG5A 1EHCA 3L7CA 1FVHA 4ABTA 5FBVB 1HDOA 1NE2A 3RHSA 3HGTA 3SEQA 3N7TA 3TQHA 1SKMA 1PT6A 3LI2A 3VNVA 4IRXA 2Z4RA 1ECLA 5FTKA 1VHLA 1I3OA 4RVGA 2QY9A 1J22A 4OGFA 1PL8A 4C2BA 4QZVA 4UMVA 2LCFA 1AS0A 3WMFA 1IJFA 1RHUA 1JDBB 4ND1A 1OYVA 2QRLA 3C97A 3H2ZA 1SZJG 3BGDA 4RTPA 1J70A 2H07A 2XECA 1QGZA 5JSYA 3JATA 2UXBB 3PQ4A 3TZEA 3X1YA 1I2BA 1WDMA 4OMUA 3R20A 4FMDF 2OSVA 4JUIA 3KL4A 3SZGA 3V3KA 1DTWB 2HRCA 3K7EA 1W73A 4PLPA 3D81A 4JGIA 3LV8A 3JYNA 3FYUA 5KHLB 4QXAA 1RYNA 1YKGA 1EWVA 1G3QA 4AQDA 1X80A 8ADHA 3CH4B 2ZYVX 2OZLB 4PZUA 4RFSA 2DWPA 5CLHA 3W6NA 1NQ5A 5K2MA 3T9FA 3V7WA 3FSRA 1SHZA 3C4QA 3L07A 1LLUA 3Q5GA 1E79A 2HNKA 1YC5A 3SHOA 2IIBA 3JQ9C 2EZUA 4BZPA 1MUUA 4XGNA 5EVJA 2I71A 3OY2A 4X24A 2P4SA 2XJ4A 2OT3B 1GUBA 1IOVA 2KQUA 1N9ZA 4G5FA 4TLEA 3SLRA 3WWEA 4PICA 5C8ZA 3SDZA 4P3NA 1C9JA 3FH0A 1ZW1A 4HLDA 3TOZA 3I2HA 1KAOA 3TL6A 2QM3A 3IUQA 3KV1A 3BWVA 3ZHQA 4BFYA 4D57A 4ZJPA 5KQRA 1K6EA 5FUMA 2FRXA 2HU5A 4OHWA 2XYPA 3PXGA 2QYHA 3FRJA 5JRJA 4X60A 3EVCA 4Q03A 2DG2A 5F77A 3RARA 1HUQA 3VQTA 4IDDA 4JLMA 5C34B 1TB4A 3MAGA 3VDQA 1GILA 2CDNA 1VIYA 4A0SA 4X95A 2VF7A 4V0SA 2MHCA 2VJMA 4U7JA 5DN6A 5TDHA 1MCZA 3GAAA 3MYYA 3R23A 1VLVA 5JCJA 4P4SB 2Q7DA 2VCHA 1U0TA 4G0MA 5JCPA 1EB8A 3IERA 4JUAA 3WIBA 1CY8A 4WBNF 1ZIYA 1AX9A 1ISHA 1DAHA 3OTOB 4CKBA 1NLUA 3HDTA 1KH1A 1JKIA 4Z0TA 2XXBA 4IXNA 3S1AA 1PNVA 3C14C 3L0IB 1OX4B 2BFFB 3WZMA 3LD9A 2E7ZA 3BHIA 4OMDA 5IRCD 1ODJA 1P2FA 3HDGA 4KMMA 1UQUA 4B3HA 4C5BA 2EBHX 1UC8A 4GYWA 4EPWA 5FBQB 3CONA 1A82A 2WHYA 4RVHA 4A91A 3Q2OA 3N2EA 5T8KC 4HFNA 5U9CA 1P0MA 2DFLA 2Q5QA 2AMJA 3AEZA 3OFVA 3PNKA 4K26A 2VZ0A 4MCJA 4W1QA 2C5AA 1SA0B 1CIPA 1YZYA 2C4VA 2ZRBA 2A94A 3L49A 1G20B 2GYVA 5HM8A 3TR6A 3LMKA 2D0PB 2R8EA 3GIDA 2X0IA 4KFSA 5K1ZA 2VJCA 3TPFA 4EI8A 3DNMA 1XRNA 2HSJA 1JHAA 5JLAA 5LZ9A 4KR6A 1QF7A 1NN5A 1M1NB 3VPCA 1HE1C 2L17A 2JIBA 3ANSA 4JFAA 3VPGA 4URWR 4WKNA 5KU1A 3QKSA 3DZHA 3OESA 5FV4A 4FHGA 2AB0A 1TKAA 2QSUA 3A2LA 3HG7A 3TBFA 4FVTA 5EWMB 4HSGA 5C7YA 4XGQA 4YT2A 4WL0A 1DC7A 4CMAA 4KQKA 5LYJF 1XHLA 3ANNA 4ZMBA 3QKIA 1RM3A 4I19A 5EYPA 4EPXA 5JMOA 5BV7A 3CH7A 3FPLA 4I1OA 3HXMA 3W77A 2BIFA 3JYLA 4XUEA 1UQTA 4G26A 3TM4A 2H4YA 5C7LO 1RI1A 2W43A 3AR8A 1EZ4A 3I2KA 3PE6A 1U9IA 4DS3A 5EIWA 1DJMA 5TXGA 3HDQA 1D2GA 1GNTA 2PS3A 2QN3A 8MHTA 1GU0A 5IEJA 3VC2A 1FXWF 1J8MF 1S5PA 3ZNQA 2JFPA 4YJFB 3DE5X 3E3NA 3LAWA 3OCZA 4KEAA 2NXJA 1PQUA 1ST2A 4N4AA 3SF0A 4XSVA 1M2NA 2FLKA 4NRDA 3V8PA 3RTEA 3W1VA 2YV5A 2YNMD 4IJMA 4AX4A 4RXMA 1OFUX 1Z0UA 4JXJA 3UB2A 1WPXA 4ND8B 1SU4A 1NBEA 2XDAA 1PZFA 2R6AA 2C2WA 4QX6A 5AKJA 1Z25A 1ZM9A 6CHYA 1UM9A 2ZB7A 2WLSA 1TX4B 3ZE8A 4PZCA 3OIGA 3LL7A 3GFPA 1IQRA 3SM3A 1I33A 1PQPA 2HDHA 4YCAA 1W29A 3WDKA 1M2VB 1SKYB 5LOVB 1C3JA 1BVYF 4YRMA 1AM4D 3OJOA 2ASEA 5TV2A 4C03A 5IM4A 3QX3A 4A36A 4UOZA 1G98A 3E8XA 4M2LA 4QASA 4J76A 3MS2A 5KB3A 3KSMA 3K5HA 4HWKA 4UCFA 4LJ7A 2AMLA 1XJ5A 1C3EA 4OBXA 3R8CA 5BV0A 1ONSA 1RVDA 1KFKB 1ABFA 3EOBI 2GFHA 4FNGA 4TXMA 1X7YB 2JCGA 2V98A 4BAZA 2F43B 4YMLA 4MITA 5TEVA 3PITA 3SHWA 3H7IA 4KSBA 4ZDWA 3HDHA 2WWRA 2Z57A 4Q1CA 5KMGB 3A2MA 2YBDA 3LQKA 2XKKA 3OF2A 4JLDA 2KYRA 1WNTA 5BYKA 2XCTB 1CYEA 2OLKA 3A25A 1G5IA 4YN3A 4TYWA 2BLLA 1BD3A 3CW9A 3P9SA 1X7ZB 3C3KA 2CVOA 3MGKA 3WRYC 1NVUQ 4NS1A 1K0UA 2WTUA 2EGHA 4HL6A 4OHRA 1WM1A 2OM6A 3AP2A 3QXCA 4J2HA 4R8SA 4MVJH 5BQFA 5IC4A 2F1JA 1HNZB 1JWLA 3QPUA 5BVGA 2AUMA 1MW8X 5H81A 1UWVA 2W6OA 2ZJAA 3CH6A 4JJ6A 1QU2A 4FYWA 1PUXA 2UZ0A 2WU8A 1MO3A 3NKVA 1AB6A 1SXJB 3GEGA 5I6DA 4YHHB 3GCWA 5BUSA 4E4RA 4BRSA 2BMAA 4PYKA 2G6BA 2HSWA 2ZBRA 3VGJA 2JAUA 3UMBA 5BN4A 3AVXA 2PRKA 4MSUA 4OGWA 2ZI6A 3CUTA 1KZ4A 2Z95A 2VDWA 4RGVA 4PG7A 2XCUA 4L7VA 3RAPR 3UC5A 4LE1A 3PKIA 2IWHA 3DXYA 4OUDA 1B8OA 3REFA 2MYTA 4NECA 3WDLA 5DSXA 3T1NA 1K6JA 4X1IB 1PJLA 3SXPA 5IYZF 1GL9B 2BF4A 2FUNB 4KN5A 4R7TA 4MS1A 3FPFA 1WKVA 4D9BA 2M1ZA 3NAZA 3O1IC 1Z4JA 3LVBA 4NZYA 2W70A 5JTUA 2XXAB 1YZFA 4FGKA 4WERA 3WKCA 2VT6A 3EZNA 2ZM6B 4G0YA 3PEVA 4K9KA 1JXQA 2CC2A 2WTNA 3OTGA 4OYLA 3GYGA 4Y3UA 4ITRC 1I1NA 1TAGA 4Q7EA 3ABRB 4M8SA 4R16A 5D5PA 4C7OA 1GKUB 3NR2A 3SQDA 1NHGA 3T3OA 1BQEA 3HEBA 1UBUS 1RHJA 4MQMA 3UHJA 3DT9A 4Q3KA 3CPSA 2FPIB 3KEGA 3PYMA 4KPUA 2ZULA 1EFVA 1LQ2A 4MQFA 4RWEA 2O0KA 4XVRA 4KXVA 1GVNB 5ED0A 4MRMB 4AJKA 4JI5B 4QOEA 1CQPA 2AWOA 2QZZA 3AYXB 1EP2B 2C9DA 4GXQA 2DBZA 3W5VA 1RHKA 1QVWA 4HDOB 1S9HA 3GU3A 4HDSB 2AEMA 1AS3A 3OOJA 2AA3A 1JDJA 1II9A 1CUGA 3NTXA 3LBFA 3O03A 4X20A 4F2GA 3WRVA 3EA5A 5BVHB 2I9KA 2FZCA 3C4JA 3EOAI 3GO4A 4M7OA 3TXXA 2QJTA 1RKVA 3B1KA 1J0BA 3EVDA 4J16A 4DFDA 4YLYA 2BFPA 3C7DB 1LK7A 1SVSA 2X9NA 3QLUA 4JQYA 2PX8A 3QUBA 1QVRA 2FPWA 1D0VA 3ICOA 4F4IA 3JWPA 1E2KA 5KSYA 4AG3A 2BC9A 4JKYA 1Z16A 1K3UB 2EDCA 5FI3A 3AKDA 3EWIA 1XVUA 3GFQA 4PYLA 4TLMB 4R9UC 5DGHA 2Q3EA 3W3ZB 3ZCQA 3Q3VA 1G5HA 4WCDA 5JSHA 3ZGNA 3NGLA 3GGOA 1O89A 1EVKA 4S1PA 3V9PA 2VXCA 3G9UA 3FSGD 1U8FO 3QVOA 4P58A 5CFRA 5CFLA 3TXAA 2XMBA 1M5RA 4RCYA 3RW9A 2ZS9A 1FMLA 3F6BX 3SHVA 4P5PA 2H5EA 2PYZA 1J99A 1JHUA 2ROQA 4J0HA 5FL7A 3SMVA 2E0IA 1AQYA 2WT4A 2C3MA 3H5IA 4IDNA 3GLFE 2UYOA 2QMHA 2BGUA 2EKBA 2MSWA 2WNHA 4IEFB 1ORHA 4HRVA 4X92A 4LI3X 4W7IA 3AU8A 4NHEA 4HDMA 2ONCA 1SU6A 1B6SA 3VSEA 1QR6A 2K7ZA 4RTOA 4I5IA 4HQKA 5L3SB 3D8UA 5AKXA 1AQLA 4IX9A 1BS2A 1YGPA 1TEVA 2YOGA 3ZJ5A 4X1KB 4IQ0A 3FDIA 3PC7A 3VISA 2XMPA 3ZY6A 2B3DA 5IANA 1MU0A 1LF5A 3OWOA 3I30X 4OYRA 5AVKA 1PZEA 1TU0A 1AY0A 3ESCA 3FOBA 2V9ZA 4WE3A 4MIYA 1DXHA 2XGMA 4ND5A 5GV7A 2Q5CA 3H5NA 4K6HA 3VYRB 4LYFA 4EHJA 1GPBA 4RSGA 1OYYA 2XA2A 1JTVA 5MGBA 2XZTA 1QQAA 2V4ZA 2QTTA 3DHVA 4Q9NA 3V4RA 3DKIA 1H6BA 1E5QA 1M2VA 2PXAA 3E05A 3FI9A 1IHXA 3MSCA 2GA9A 4LQDA 5BNFA 4L5CA 821PA 3MZ0A 3ECAA 4OK6A 4JI1B 3OX1A 1EMDA 1UM9B 1FUYB 1EGAA 4KXFB 4F1JA 1TT5B 5JVDA 4QIHA 4MV5A 2LUOA 2V8BA 1K8RA 2W2LD 4QPDA 4R01A 1FP4B 1HDZA 2ET6A 2YN2A 4M1WA 4R8LA 2YVAA 3TBHA 1G21E 1MO2A 4CZ2A 1XPJA 2R79A 5GZ6A 2GPAA 1J07A 4RTLA 3KXIA 1N8KA 1XI2A 3C3XA 5KI6A 2HNAA 2XUPA 4FJ2A 2WSBA 2CLIB 4A15A 2WUWE 4Q3BA 4IMRA 4OFXA 3T5AA 3DE3X 1K2VN 2VI5A 4B6GA 2C2HA 2YQ5A 4WBNA 2XQVA 3W1WA 2WA2A 1HY3A 3UT6A 1B14A 5K8JB 3FVVA 1G291 3KHSA 4ZK6A 4DOMA 3JQPA 2GXUA 2VVTA 2YWHA 4WTOA 3I6QA 5CPBA 1GZSA 4DR3B 4ER5A 4FEAA 5IK2D 3OPMA 1B7GO 5JXJA 1XZCA 5FJJA 2HEIA 4HATA 3VNRA 1KI7A 1ZL0A 4CQLA 2D13A 3H19A 1YCFA 3D1LA 3WSWA 1QFMA 3ZDBA 2GN6A 3GI1A 3SEAA 3THYA 2RCNA 3H9BA 3I9V6 3M4YA 3PL1A 5H1YA 3L93A 5BN4B 2L42A 1GRQA 3EGEA 5K8LA 5MN5A 1BH2A 4BLSA 1NFRA 4XVHA 1VL6A 2HCJB 2YFYA 3FZQA 4FPXA 4D82A 1U8CB 3IE2A 3IKJA 2PX6A 4BCDA 4C29A 2GB4A 1BHJA 1DC6A 1MOZA 3HFGA 3OZEA 3ITKA 1GKKA 2R96A 5C7OO 3K96A 1AO3A 3QVGA 4PPYA 5JV5A 2E87A 5GP1A 4E5PA 5AO9A 1C8KA 3U7HB 1P1JA 5EKXA 1N6IA 3DO6A 3P2IA 3T3EA 1V6AA 3TEMA 3PXDA 1M2OB 1OVGA 3OCWA 1CRQA 2Z2XA 4RANA 3UJBA 3AWIA 4QD3A 3ZV6A 4DVGA 3NC1C 2RGAA 5IZCC 3CFYA 4W5OA 2C4NA 1T9GR 3KR9A 1U4SA 4B33A 4AY2A 2RK4A 2JBWA 3TSAA 1EXNA 1PRYA 2H2FA 1U0BB 1EGVB 3TRHA 3UKOA 1R0BA 4LSGA 4PQFA 2I4RA 5GINE 1P6UA 4XUGB 1ZI9A 4GOLD 1ECCA 3BWMA 2HHHB 4Y2VA 1ID1A 1QV7A 1Y63A 1RWWA 4C3VA 4R3NA 2ESRA 3E7PA 1NPTO 1UDRA 4GMKA 1CJKC 4ZRNA 4HR7A 4P53A 3TAHA 5CD9A 3NBYC 4P08A 4DR1B 3OI7A 5FQOA 3LIPA 4G9EA 5AHRA 1SBNE 1T5IA 3E9YA 4MQ6A 1FYVA 4BV8A 3C5WP 1FSSA 2RI6A 4FEYA 5H82A 4ZDKA 2Z8YM 3PPVA 3F73A 5JCXA 2NZUG 3KBBA 2FN9A 3N6VA 3ENQA 3HJNA 3I61A 2QUKA 4L78A 3GFGA 4M8KA 3F7MA 4MV1A 4D6PA 1XYGA 4RCVA 1SU7A 2O5EA 4K81B 5A04A 5E4FA 3CUYA 1X1BA 5KTYA 1IBSA 3QEBZ 1J33A 2L69A 3ZWPA 5JJIA 4W1RA 3B6KA 4QEDA 4RD0A 4XEHA 1F1BA 4F2DA 3ZXIA 3OA0A 4BNNA 3QTLA 2OFXA 2QKYA 3JTMA 4TMKA 4QGHA 1Y8AA 3LP8A 4MKZA 1LPSA 2OKCA 3IQDB 4DWOA 2VYFA 1COWA 3FYUB 4JP5A 4ILKA 4ZEWA 2ZYUX 5ILGA 3TSOA 1L7QA 1MF7A 4K05A 4TMZA 4CTOA 2J30A 3AM3A 2GM3A 4I1SA 2JD1A 3V8NA 1GGNA 2QI9F 4RSMA 4UC0A 1P3JA 2XADA 3P2EA 1MB9A 4CT5A 4EX6A 4TS4A 5TX7A 3NTOA 1DEKA 2D2IA 4G23A 4AMUA 4ALKA 3DCYA 1A8PA 4TRRA 1NDUA 3AMVA 1L5QA 2YMLA 2JRLA 3V33A 3BRQA 4EW1A 1COZA 4QYXA 2CDBA 2HU7A 4CKCB 1XLTA 2QSYA 3E7DA 3H2HA 4QHSA 4M8LA 1M8GA 2EKPA 3O9ZA 1E79D 2G06A 5DHQA 3WLRA 3HYNA 621PA 2NYUA 5FA6A 4DNOA 2FFRA 1DWPA 1FSGA 3KSAC 1QZXA 4R9SA 3SQLA 2X14A 1GUZA 1UMBB 3JWHA 2ILVA 1C9NA 2VNSA 3H9EO 5FEMA 3ZW8A 4BKQA 4C1BA 2W2KA 1BHQ1 1D2HA 3STYA 3QBDA 1H1TA 2NLOA 4LK3A 3ROPA 5AXDA 5ICMA 3RYFA 4O4LB 3NIBA 2IBSA 5HKAA 2BZ0A 1GG8A 1WXQA 5LP6C 3QA3E 1FLNA 3UFBA 1R4MB 4IQGA 2AC7A 3NAGA 3I2YX 3CX6A 2AD5A 3CHYA 4ASUA 4CN8A 5M29A 3A6ZA 2WMYA 4GKAA 3Q88A 1B2RA 1MENA 1L0BA 4ETWA 1LDGA 4MAAA 3ZKWB 1JR3E 5A4DA 4XIFA 5JAUA 1B76A 3CYFA 2W2VA 1W36D 1GFWA 2MWMA 3DWEX 3FRHA 1AQUA 3CV3A 3ICEA 1E2UA 5GONB 3VAAA 1DRVA 3EFBA 4LMAA 4B4VA 2Z2JA 4Y9TA 3ZE6A 3BWBA 4JB2A 2O0JA 4O2BF 3MINB 1RQXA 1I2MA 3BD6A 1GTG1 2REQA 5H02A 1VHTA 4ZDIA 3K0AA 3LCVB 3JQRA 4G85A 4OFZA 3ROEA 2FMHA 4DQ0A 4DZTA 4BS9A 3TG8A 2FW1A 4GR4A 3SXUB 4HGPA 2OBBA 3FSGA 2X19A 3CRQA 2OAP1 1BMFA 3ZHXA 5BV2P 5LWHA 2PZJ