2M1ZA

Solution structure of uncharacterized protein lmo0427
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATGIENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAALALIDEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lmo0427 protein
publication title Solution structure of hypothetical protein lmo0427
rcsb
source organism Listeria monocytogenes egd-e
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2m1zA00
3CU5A 4W5NA 7ABPA 3ROFA 2WY2D 4G0YA 4Q6WA 2CHFA 2WJWA 1ABEA 4MLCA 1E6LA 2LBPA 3GWGA 3QX8A 3RVOA 3GA5A 3LUHA 5BRAA 4L85A 1Z12A 3SQNA 2FQWA 3C6QA 1FFWA 3JPYA 5EWJA 1C0EA 5TQ2A 5PNTA 1EFAA 1OXBB 4JOQA 1JDNA 2AYZA 2AYXA 3A0UA 4Z4FA 5KI6A 3K4HA 1LBHA 2J48A 4WUTA 2E4YA 1NXTA 5FWYB 4Q6BA 4N0PA 4NCBA 3HDVA 3HSYA 1DCKA 1JYFA 4MS1A 5D2CA 4RV5A 3A3KA 1XHEA 2HQOA 4MGEA 1P6QA 5F64A 1PUXA 1URPA 1DCMA 3O2SB 2MSKA 4N41A 3H1FA 5E3JA 5FWXB 5JS2A 3H5TA 5CNIA 3NHMA 3OO0A 3CZ5A 3KYIB 4XAQA 4YGXB 3HUUA 1D2AA 3TB6A 2JVIA 4L4UA 4RK7A 4XASA 2FTKE 3SG0A 2R48A 5HKOA 5ED4A 2M1ZA 1M2FA 4JB0A 1XHFA 2KYRA 3BRSA 1L5ZA 6ABPA 4TMYA 4FE7A 4EYKA 3QX9A 4CBVA 1D1PA 3N8IA 3GT7A 2WRZA 1DBWA 1LBIA 2LPMA 3H6HA 1JF8A 3IP6A 3HV2A 4LE1A 3GBPA 2OQRA 4F12A 2FLKA 1TLFA 4MR7B 2YHAA 2PUBA 2E4ZA 1M2EA 2E4VA 4RY9A 3ILYA 2R4QA 5JNRA 1PEAA 4ZMRA 4UHKA 2CWDA 1BVHA 1DRKA 4Z99A 3JPWA 2PJUA 4IILA 4RK0A 3JTEA 3O1IC 2VK2A 4Z4GA 3IPAA 5CNJA 3JVDA 4QPJC 1LJUA 3EQZA 3JS5A 4Q7EA 1ISSA 4DQDA 5BRJA 1QPZA 3Q7TA 3OLYA 3KS9A 4MPTA 3RVQA 4B09A 4MS3B 1AB6A 3HZHA 4G86A 1J56A 5T3YA 3DLHA 1NATA 1YK0A 3LUAA 3QEMB 1Z15A 5JS1A 4OLBA 3C3MA 4RSMA 4KREA 4G0MA 3B2NA 5IC5A 3LUKA 3O1JC 3C3WA 3KKEA 1AB5A 2M98A 3I42A 1GCAA 3NNNA 2NZVG 5EWMB 4OTZA 1DC8A 2FEPA 3DGFC 4JAVC 2PAFA 3JY6A 4KFCA 2RJOA 1JL3A 4OG2A 3H1EA 1U04A 2ZAYA 5B3JA 3HCWA 2PUGA 3OQMA 4JASB 4KK3A 4WXMA 4YS6A 5KQLA 3EODA 4MS4A 1EWVA 4H3KB 4W5RA 1GUBA 2B1JA 1K66A 5C5EA 4GPAA 4IMIB 3O74A 4ZPJA 3GL9A 5TQ0B 1FSPA 2IKSA 5I4CA 1JWLA 4KRFA 5C5CA 1QP0A 3CFYA 2A9PA 2JK1A 3FGZA 2LUOA 3IDOA 3GYBA 1BDJA 3G1WA 3L49A 4ETMA 2FQYA 2PUFA 3R0JA 5IBQA 4YR7A 4YP9A 1YMUA 2FEWB 4W5QA 4MR9A 3OM0A 5DCLA 3VNAA 1LJLA 3RVPA 1VPWA 1ZAYA 4MQEA 4ZMSA 3TD9A 2BGGA 3MIZA 1SXGA 4DN6A 4F06A 1FFGA 3DGEC 5EWLB 2JVKA 5FBHA 5KQPA 1VLZA 1ZHHA 3HVRA 2JBAA 3OLWA 3CG0A 3MM4A 4Z0NA 1ZH2A 2H3HA 2QW1A 3OO1A 3NNDA 4LRQA 4QYWA 3F73A 4IRXA 3SAJA 1USGA 2FN8A 4MQFA 1MIHA 2VYCA 1R8JA 2FVYA 3Q15C 5DTEA 1ISRA 3HS3A 3KCNA 2E4XA 3A10A 5TPZA 1FQWA 1YS7A 2P4UA 3N53A 2NT4A 4H60A 4EUKA 3QLVA 4KQCA 3SNKA 1YS6A 2GWRA 5BR1A 2PUEA 4G0QA 5GQSA 1PEYA 5CHYA 5JNTA 2IPMA 3KTOA 1IIBA 4D6XA 4RZSA 4EVRA 2FMFA 3CS3A 2PLNA 3RVKA 3EJWA 4JP1A 1PNTA 3HM9A 1M5TA 3HJFA 3F6PA 3EULA 4ETNA 2VUHB 3FFTA 3O75A 1JYEA 1RZRD 1SRRA 1JFTA 2IDMA 2F8TA 3EAFA 1MVOA 1VRVA 3RVJA 5DLEA 3BRQA 4Z4IA 2A9QA 1USIA 2FMIA 4RU1A 2HJ9A 9ABPA 1D1QA 2FQXA 5FWYA 1I3CA 2F8SA 3FFXA 2O20A 4P98A 4D74A 4JA2A 3K9CA 1GLGA 3CNBA 5ABPA 3BREA 3QELB 3E61A 4YO7A 4HNSA 3LKBA 1U8TA 3IP5A 1DJMA 4RDCA 4G0ZA 1ZESA 5TQJA 1JHZA 3C97A 3I45A 3RVLA 3BILA 4WZZA 5FWXA 1ABFA 1TMYA 2LP4Y 4QICA 3H6GA 3H5OA 4KK4A 1DP4A 1EWKA 2HPHA 3W9SA 1QP4A 1JDPA 1YTUA 3JVIA 1DG9A 4N0QA 1JX6A 3T95A 1RZRA 5KC8A 2VUIB 5T7BA 2JB9A 1DZ3A 1A04A 5IEJA 4KMRA 1WETA 1P2FA 4EYGA 4RK6A 4NQRA 3FDFA 1NXPA 3RVSA 4FB4A 1W25A 3CZCA 1ZN2A 4H3HB 4WWHA 2L17A 3URMA 2PUCA 3DBIA 4YV7A 3DLBA 4NV3A 1QMPA 4IMJB 3KLOA 2HSGA 4PEVA 3NNSA 4MR7A 3SM9A 2CD7A 4S04A 3KJXA 1EHCA 1DBPA 1GCGA 1Z2DA 2Q5CA 3MA0A 4XFKA 4OLAA 5IUKC 3KG2A 5IUJC 2N9UA 4UHJA 3HDGA 4RS3A 5DGCA 3G85A 2ID7A 4Z9BA 1F4VA 1NXVA 1APBA 2PL9A 1PHRA 5B3JC 4EYOA 5JNUA 4W5TA 3QLUA 5JNSA 1QQBA 4F8JA 1BDHA 3MYYA 4LDAA 3T6KA 1JH9A 3N6VA 4MLDA 4Z4HA 1A2OA 2HQRA 2PL1A 2WB4A 1CEYA 1LK0A 1RNLA 4MS3A 4PYRA 4LE0A 4MS4B 2FMHA 1Z13A 5KWSA 3QEMA 4NCAA 1ZVVA 3O2JA 3D02A 1GUDA 3OQOA 2JVJA 2PUAA 1YIOA 2ID9A 4RK5A 4MRMB 4N03A 4KQ9A 2CHEA 2PKXA 2QZJA 1A0OA 3P9YA 1Z2EA 3HO1A 1NXSA 4PZ0A 2WMYA 5EWMA 5TPWB 1XWWA 4D6YA 1NTRA 3Q9SA 4YCSA 2NZUG 3MQ4A 3HUTA 3QLTA 3IP7A 3FFWA 8ABPA 2LIVA 1BAPA 4EVSA 2QVGA 2MSLA 4G0XA 4KZKA 4MR8B 3TX6A 1KRWA 4HNRA 2MYUA 4OBBA 1ZGGA 4EY3A 1TJYA 4F3TA 2HQBA 3RVNA 4RY8A 1D4ZA 1D5WA 3HK2A 5JNVA 5TQ0A 3CHYA 4N76A 2PUDA 2FN9A 2L19A 1K68A 2ZWMA 1YK1A 4ETIA 3H5IA 5BQ3A 3ROTA 3HXMA 5FBKA 1EAYA 5EWJB 3H1GA 3H5LA 3O1HB 4M88A 4RKRA 5TQ2B 2L18A 3QLVC 2FMKA 2NUBA 1M5UA 3UUGA 4EGSA 5CNMA 3LFTA 3EGCA 1Z25A 4IGAA 2IPAB 5KC9A 1KRXA 2NT3A 2MYNA 3C3KA 3N75A 1DCFA 2IPLA 4YRZA 4ZJPA 4MS1B 4E7OA 1DRJA 5EWLA 4KNYA 4O1HA 1USKA 2E4WA 2TMYA 4HYEA 4YLEA 3LUGA 1NY5A 3LUCA 3T8YA 2I6FA 2QV0A 3O2QB 3OQNA 3KLNA 2A9OA 3LUDA 1ZITA 3OMXA 4QYMA 2RJNA 1JLKA 1Z17A 4GNRA 2V0NA 2H0AA 1JFVA 2B4AA 3M6MD 3QEKA 4JB2A 3LUJA 3O21A 1ZH4A 2A9RA 4G97A 2GKGA 2FSPA 2DRIA 1C4WA 2E4UA 3IPCA 3KYJB 1TM2A 3N0RA 5IEBA 5IX8A 1EWTA 4P1ZA 3SY8A 3DZDA 1DBQA 5CNKA 2FW0A 1QNLA 4F11A 1VKRA 3F7NA 3OLVA 1Z16A 3OLXA 1QQAA 5KQMA 1YVUA 5TE9A 4LZLA 2QSJA 1UDRA 1Y1LA 2X7XA 3OLZA 2FXIA 5HM6A 2RDMA 1E6KA 1CYEA 1RXIA 2XDYA 1QKKA 1E2BA 1SD5A 4O5AA 4LX8A 1NXOA 3I5AA 4XARA 4ZYLA 5KQGA 1ZGZA 1B00A 4Y9TA 1KMIY 3RVRA 3QK7A 2GX6A 4RXTA 3EDCA 1BDIA 3I09A 3LKVA 3OM1A 3M9XA 2FLWA 3RQIA 4RK4A 4N47A 4TN5A 1NXWA 3CLKA 4MAAA 2GBPA 2JCGA 4PICA 3LOPA 2W42A 2GI4A 1U0SY 3FMVA 2PMCA 5IULC 3QELA 4FE4A 4RXUA 4WXEA 4WT7A 4G0OA 3D8UA 2MYPA 3BBLA 4NICA 3Q41A 4G0PA 4XLTA 2IYNA 3A0RB 3MF4A 4E7PA 5HQJA 2QU7A 4LE2A 4LDZA 1Z18A 2WJAA 1SXIA 1W9HA 3QLUC 4RK1A 4TLLB 3Q7SA 3EQ2A 3L6UA 3LMKA 3UK0A 4TLMB 3CTPA 3CKMA 2YHBA 1HEYA 4RY0A 3LUFA 4ML3A 4PE5B 1F51E 1E6MA 3E3MA 1PNRA 2R47A 3VNBA 4Z9AA 3TO5A 4EVQA 5IUNC 2IPNA 3NBMA 3KSMA 4RXMA 1JBEA 3H5VA 1L5YA 2MYTA 3GBVA 3UKJA 2L2QA 2R25B 4OATA 2FKAA 1P6UA 3H75A 3Q7RA 2FEKA 1QO0D 2QR3A 2MSWA 3GRCA 4RKQA 3IP9A 5GOTA 2WWVD 1RXEA 3F6CA 3OMWA 4O1IA 1Z26A 2P9HA 1P8AA 3MMNA 4RWEA 4EYQA 3NHZA 3GV0A 3TMYA 3CRNA 2RGYA 1U2PA 1T34A 4KVFA 4MR9B 4Z4EA 3RVMA 4HNQA 1QP7A 1NXXA 4MQEB 3KHTA 1MB0A 1ZY2A 1S8NA 1FFSA 3M9WA 6CHYA 1MAVA 3H5WA 3T38A 4IF4A 4XXHA 1JFSA 3ILHA 1BA2A 2JBAB 2QXYA 3CG4A 1ZDMA 4Z4CA 4MRMA 5JNWA 4MYRA 1MB3A 4S05A 1QO0A 1YMVA 3N0XA 5HSGA 1RPJA 5TPZD 4MQFB 2PE5A 4KV7A 1TVMA 2IOYA 2OENG 4KPYA 3N0WA 4W5OA 5TPWA 4DADA 1DC7A 1CHNA 3RH0A 3HEBA 3LTEA 1U2QA 1SXHA 2JRLA 4MR8A 4YWHA 2QVCA 3S99A 5DKFA 1OXKB 1H9CA 1KGSA
chains in the Genus database with same CATH superfamily
4L3WA 3QVKA 3U6KA 3PR1A 1TQ2A 3ZGOA 1UZLA 3Q7EA 4RGQA 2ZUBA 2QUZA 3DF7A 4B82A 5BMOA 2AEEA 2PS1A 3AP2A 5F78A 8MHTA 1JFLA 4W9MC 3R5KA 3LUHA 2ZBQA 1E1KA 3GFVA 3OKFA 1EDEA 4JR2A 4KN5A 4F1JA 4XD7D 5L3VA 2UUAB 1U8CB 1DAHA 4OLHA 4Y2JA 4AC9A 2EATA 2ZI6A 5HZKA 1A3CA 3LC7O 4EFDA 5JOQA 3K0FA 2OGTA 4H0CA 1M6VA 2AWNA 1NW4A 2ZRHA 1K7EB 4PLHA 4CDNA 1RPAA 5AOCA 3QUBA 1NQTA 2BI8A 1UODA 1Y9EA 4YAKA 3ZY5A 5JPDA 4XIFA 1PJQA 3TTXA 4KSYA 3JASB 1XEWX 2AD1A 3NXSA 5ALYA 2R5FA 4BNWA 2X9QA 1E1RA 3QP9A 2QGFA 4BMSA 5JR3A 2REXB 4MH0R 4IFEA 2A5GA 2YDYA 2PYZA 3BRWD 3NV9A 5ARDA 3QFHA 5EJ8A 3G2KA 2P90A 3H0EA 5DNUA 1H23A 1IHYA 3RRXA 4YREA 4JUDX 3HPRA 3L84A 3WWZA 5I47A 1WU7A 3IBYA 2F1HA 3FSGD 5K0SA 3KUUA 3OEEA 4J91A 1VBFA 2FA9A 4KGZA 2PUVA 4LF4B 3NHUA 1M10A 3WZMA 1WJGA 4EG1A 2XKKA 2UXCB 1GL9B 2A67A 1DEHA 3BRSA 3FWPA 3GELA 1FMLA 4TMYA 4KN9S 4BP9A 5LLDA 2OCXA 3QX9A 4PQFA 1KVQA 5J4VA 1NVFA 3GT7A 2GBIA 3DD1A 4KH1A 4YHBA 1JA9A 1RFLA 3G2PA 1ISHA 4P83A 3ZCUA 1A8UA 1E69A 3ETNA 2FRXA 1RQLA 2NOAA 4X1YA 3SLKA 2DR2A 3K9FC 4UTZA 1UZNA 1GNLA 2O1SA 4RY9A 3ILYA 4Y30A 1N33B 1VP3A 3GW8A 2EKDA 4OL9A 1Y42X 5FPHA 5DGHA 3D8SA 5EZ6B 2BFDB 3HRKA 2YQZA 4MRRA 3VR6H 2IYTA 3WTBA 3KJFA 4ZI7B 3MJEA 1CIVA 1ZUNA 2AH5A 1H2HA 2F1KA 1MORA 2VK2A 2YY6A 1TZJA 1DRVA 1FLNA 3L1VA 4J0KA 2GAAA 4QPJC 2XVAA 4F6CA 3RFVA 1MFZA 1TO1E 4KX3A 1T43A 1C8KA 3BIFA 3R7FA 1R0SA 3T12A 4S0ZA 5IVIA 4O2LA 3RU3A 4G86A 4CQMA 1CUWA 2XMGA 4B6SA 5JS1A 5CJJA 1Z62A 2OUIA 1G60A 3UJ9A 3RKRA 4EJSC 1IUOA 4TZKA 3AHGA 4QQ8A 1J5EB 4E88A 2P5SA 2DWCA 4JMLA 1H6AA 3RDPA 3WV4A 4EOGA 1L9KA 4ZYZA 2Z2YA 3NHYA 4G6ZA 5KKCA 1UMCA 3IIJA 4OSOA 3C3WA 3D81A 1W0CA 4YPVA 2FHPA 1YRQA 3ZE2B 3S8MA 3NNNA 2O3TA 3M9LA 2I2DA 2W8ZA 2FP3A 1R6VA 2XB8A 1CY1A 3WLRA 1N2IA 2BSAA 3ZWAA 3TQQA 4F4CA 4HEA1 1R0WA 1FTWA 2VI5A 1AXRA 2UZ1B 3NIGB 3EZXA 1GN9A 3BD6A 3HCWA 5EYPA 3JWEA 5ESRA 4EI8A 5K6TA 3FG9A 4MDYA 1C1YA 3PCTA 2OYSA 4RFLA 1EHYA 2VZEA 5BOSB 1PF7E 4UBIA 1S89A 3WLFA 3UY4A 1O77A 1QYWA 2XF8A 3C7KA 3O74A 1FU4A 4FB5A 5I7FA 4Y8VA 2WAYA 1C4OA 4ZAVA 1HC7A 3BAFA 3F7MA 4B4UA 5I01A 2A9PA 5HG0A 4LBWA 5FJIA 4QRDA 1MB9A 4OUKX 4DLRA 1CQJB 5JWOA 2JARA 2YV2A 1TVEA 5LCXA 5A0VA 1QQ5A 2NNLD 1RAFA 2YQ4A 3CUWA 4UREA 2ZROA 3Q85A 1RAAA 3A6JA 5JSZB 3A9RA 4WACA 5LZ8A 3GBSA 3VNAA 1SKAA 3EMKA 1UMDB 1F0YA 2R7LA 3C1UA 2PGXA 5HA5A 1IMOA 1I2AA 1ECGA 3OC6A 5M29A 2ZJYA 1M8PA 4DSAA 1GUFA 5KBYA 3SFZA 2WJIA 3GT0A 1P2TA 5BSRA 1CP2A 2HB6A 4L3OA 2BEKA 1KETA 3NNDA 1RC8A 2YWCA 1TUIA 3EIEA 2YHUA 4WD3A 2DECA 4RM3A 5HCUA 1PR3A 4D42A 1PLKA 1X1SA 5JSFA 4KFSA 4MVJG 5FI3A 4G9BA 5AVZA 2DFTA 5AJTA 2AKAB 1F8XA 4YDRA 4PZUA 4YJHB 4F84A 1JMYA 3WJAA 1MOPA 1Z0DA 2HCJB 4QUAA 4EUKA 3EG9A 3ESQA 3R76A 3G5LA 4LA4A 4AP9A 1PI3A 2MDTA 3VU0A 3GAMA 2IUTA 3AR5A 2IXAA 4CIXA 3KPJA 1UT8A 4GZLA 1RXYA 1XT6A 3NP9A 3OOWA 4L5JA 2OXFA 1MT0A 3V4FA 4MUNA 1SCAA 1SUDA 2QRGA 1U6KA 3E23A 3IP8A 3QJGA 1WHTA 3IBFA 5J5AA 3T0FA 2IE8A 4BGDA 3HXQA 2VSNA 7GPBA 3DT8A 3UTDA 3R5FA 1SRRA 3FBGA 4GOMD 5KTSA 3O9VA 1NHWA 1Z0JA 1TECE 1JHRA 1N25A 5TX7A 1SXJA 4CTOA 4JLAA 2XUGA 2Y8EA 1GV0A 1PFYA 2GS9A 4ZI2A 3EPHA 5L3QA 4LSGA 4CMCA 3DL0A 4QLAA 3HY6A 3IUEA 4LXYA 2Q6VA 4PFSA 2C3PA 2XNCA 2F1IA 1HQDA 4M7PA 1C0KA 1N5MA 3D4LA 3FCUB 3OBBA 4NHEA 4DLAA 2ZUUA 5LJIA 1TAGA 4HB2A 5HCIA 4AMUA 2O8FB 1STOA 2OFXA 1KF0A 1GU7A 3PL1A 3U7EB 1O0BA 5FL3A 2G82A 2ERXA 1MT3A 3NC0C 3OFSA 4R1LA 4NEGA 1T36B 2C97A 1ABFA 4MPRA 4CM8B 1ZMTA 3K0SA 2B2CA 1YTUA 1YHYA 4PYOA 4G36A 4B3TB 2EIHA 2VBFA 2IT1A 5KC8A 3VVMA 3RWMB 4UM9B 1U8AA 3M4YA 4FMDB 1KI4A 1A04A 4HUQA 4OA8A 3TRKA 1KZ9A 3H1BA 3EASA 3KZMA 3FOZA 2EWWA 3X1JA 1JLMA 1O94C 3QYAA 3RVSA 4QFCA 5D84A 4D0NA 5GOZA 5HS4A 5J2TF 3GJYA 1QF6A 1JI0A 2WHYA 2XODA 3DSRA 2C3UA 3ONFA 3DLBA 5AJVB 5IMBA 1U31A 1P5RA 2I1LA 4QA9A 3I5XA 3FPJA 3MOGA 1JU4A 1U5BA 1Z2DA 3MA0A 2OVFA 4F5DA 2ZT6A 1U2SA 3QKRA 1KVRA 4W1QA 3HR8A 3IILA 1T1EA 2O2SA 4NRDA 4EHHA 3VFDA 1BYUA 1PHRA 1N6OA 4FIZA 3SFVA 5AW0A 4KQXA 4NE7A 3B1KA 4WKNA 1QYXA 1WA5A 2OWDA 4UOQA 5INTA 5B5SA 1P60A 4TS3A 4WGFA 3SF0A 4C6TB 4Z4HA 3L0YA 1BHQ1 3WSVA 2OZLA 4J43A 1JIKA 1SXJE 2YZ2A 3IURA 5FOSA 3VDMA 1JBQA 1TU4A 2UYQA 3AONB 5KWSA 1CJSA 4PZAA 1NY6A 2CDNA 4N8DA 3W05A 1P7CA 1N2HA 4EZEA 4OHOA 1CFZA 2BFEB 2JH8A 3KQYA 1GADO 1NJ6A 2C4WA 2X9GA 5BVHB 1IY9A 1AKRA 2H16A 2W90A 4RIGA 2XR1A 1Z06A 3KJQA 3O9ZA 2DY1A 1O9BA 4FGKA 3R9XB 4Z1MD 3QZUA 5C8VA 4HEA6 4GOND 1DC5A 4R68A 1T15A 4V03A 1RU3A 1SKQA 3EXHC 1G5FA 1JXMA 4EVSA 4PAWA 1W49A 1WB5A 4RELA 5HE9A 4UMDA 2HLNA 3VBEA 1I2ZA 5IWAB 1XTJA 2QJRA 1LBEA 4S3MA 1RWWA 4IZHA 2C8KA 5LIRA 5C0OE 4B3CA 2QBYB 4U63A 4KQMA 4GLJA 1TEXA 1RWMA 4FFSA 3S27A 2O7SA 6GPBA 4MWZA 4MK4A 1E1MA 4W8GA 1TADA 1Z2PX 3A1WA 4R1TA 1P1IA 2FN9A 4PC1A 4BP1A 4TYNA 4TKUB 1N3LA 2WTAA 3I6ZA 4MYHA 2QRVA 1QONA 4PG7A 4DC1A 4EARA 5KO2A 4BVAA 1SUSA 4BWYA 1QZXA 3BH6A 4KU4A 3Q6IA 4O63O 2QNRA 4LJSA 3UT6A 4ERXA 4TVSA 4ZVOA 2PMEA 1GKIA 4A5SA 1BKSB 3IRVA 2OLEA 3GDOA 5BUQA 2O7RA 1L8QA 3ZHVA 2IV3A 1NHGA 1SBHA 3RJ5A 4BZWA 4XVRA 2FGJA 1QIEA 2XB9A 3DHWC 3L8YA 4PG8A 4MLZA 2FH5B 5KNLA 3NM6B 5D3MA 3D43A 3IHWA 2H1IA 4QOSA 3SE0A 3E5MA 1HT0A 4DR2B 1JSXA 3U1BA 2B37A 4JC5A 2W7TA 3LUDA 3FPKA 3GEGA 3L01A 4BVLA 3C3EA 3OETA 4OQXA 5K3AA 2CV2A 5M3BA 1GWNA 3NRCA 3JWIA 1UM8A 1XP5A 1SCJA 2B7LA 2GAJA 3H87A 3P0IA 5DYYA 3WRWA 4EEXA 1VHDA 1UKBA 1U8UA 1A76A 1T26A 1VYTA 2IHBA 2JAXA 2X8JB 1TM2A 3OIDA 3O8LA 1UOEA 3GARA 4J7AA 4NAVA 3HA7A 2DXIA 3SS9X 4YC7A 4RMNA 3HDQA 1QHIA 4PM4A 2II6A 3PZRA 5CFZA 1AOXA 1SFRA 1T8RA 4MA4A 1N9GB 1TM3E 4N7JA 4TTRA 3OJ0A 4UFOA 4BVJA 4DQUA 4NH0A 2XDYA 1KZ4A 2I4MA 2WG1A 3TE7A 1REQA 4A73A 1DFHA 2O59A 2H59A 4GAEA 4XQ9A 4WOJA 5L7TA 1ZNXA 1AKTA 1K89A 4YV2A 3R7AA 1SC3A 1SUAA 2H9AA 2PLWA 3ENQA 2IKQA 2XVMA 5DBGA 1EVJA 3WXMA 1ADFA 4ZYLA 3KJGA 4P33A 1IHPA 4EHJA 1W46A 4Y9TA 3TUIC 3S2UA 1K92A 3ZZ1A 2GJSA 2V0GA 3WL6A 4XZ3A 3BCUA 3FOFC 4U4AA 1ULHA 3UGKA 4C7BA 3Q8LA 1POWA 2BP7A 2BH2A 1DS6A 4N47A 1FPMA 2X9LA 1W59A 4IQ0A 2PSFA 3TBFA 3P7MA 1GFZA 3HPQA 1V7QA 2AXPA 2VNIA 4UU0A 3RU7A 4FE4A 4URFA 1DTWB 4AZ0B 4EHAA 4R8KA 5A3JA 5B6JA 3NV7A 5B1HA 3I1FA 1M72A 3Q41A 4WDQA 4QSMA 1QHNA 1ACJA 2XWPA 3JAKB 1A9ZA 2PBFA 1BC5A 2PPLA 3VXKA 2A6PA 3IELA 2R6ZA 4XUCA 3LMKA 5M34A 4GQBA 1JHYA 2H31A 1H93A 3CN7A 1FYDA 2QV7A 5KJ6A 4C30A 3EVZA 2G88A 1EGHA 4RAQA 2OO5C 4HNGA 3QXXA 3M2TA 1SKBA 1V1RA 2OXRA 2WKPA 3BQ9A 3DPSA 3KWFA 3UJ7A 5GGYA 5J63A 2PZGA 1G3RA 2GNOA 1LW6E 4RXMA 3DWEX 1LRLA 2B0JA 1X1DA 3H5VA 3S68A 4OXQA 4ZVQA 3T3MB 2I99A 4XH9B 1Y7HA 3W34A 3S1AB 2ACWA 2FKAA 1ES9A 1E1CB 1P1CA 2OCYC 3HWX1 4MKZA 5KX5B 3HXPA 3LPLA 3RHSA 1Z38A 1YQEA 3IJEB 1PT5A 2H1WA 3BZUA 3NO4A 3MRXA 1Z5WA 5EMJA 3RIEA 2NVUB 3TCXB 4B33A 1XBTA 1GUYA 3KYDB 2P9HA 1P8AA 1XMSA 4E5PA 1E7QA 2Y1CA 5L45A 2IIQA 1NZFA 2XD4A 5C37A 1M6EX 4BV9A 2E4AA 3ZQ4A 3GJQA 5LOVB 1RAEA 1VE3A 1ZJ6A 4L8LA 4QOFA 1Z07A 1MX1A 5T8KA 1U9JA 4BTLA 2BZGA 1BXRA 5K0EA 4IX1A 1Q19A 2PRJA 1OGIA 1GTRA 3EC2A 3O8OA 4X8HA 4BMYA 3NIDB 2IS4A 1UK9A 3D9QX 4W8HA 3AR4A 1AKQA 1HYGA 4KWEA 4FD2A 3A1SA 1Q1ZA 2H9IA 3AG5A 3EGXA 1L5OA 3A1EA 5T41A 1LKZA 2Z4RA 4JQOA 5JWRA 3ZY4A 3GJ3A 1IEWA 4WLFA 2CYBA 3WYBA 4GSKA 2D0PB 4RIEA 2GCIA 4WECA 3OCYA 4MI6A 3V1NA 3VKFA 4IJMA 1WP9A 2CVOA 4W5OA 3NJ8A 5IABA 2E85A 4UHBA 2WWYA 1NOIA 3U4CA 5BORA 1U2QA 3O4GA 2DZDA 4HRYA 1GPJA 2A1IA 2JRLA 4M60A 4XTRA 1GPNA 3G59A 3VSEA 4JHLA 1X15A 5LXTB 3VTAA 5H8WA 4DVJA 2PQ2A 4CLEA 3R4VA 3ETDA 1O96B 4MKGA 3A1TA 2W48A 3OZBA 4GOLD 3WNQA 2B83A 4O4LB 1BRMA 3D2BA 3NEJA 3O0DA 5EQDA 4B3MB 1AG9A 1EVLA 5CT5A 5CURA 4RD3A 1SQSA 4MTCA 1OAKA 1NZJA 1LX7A 5TC4A 5ILQA 1T3GA 4BNKA 3RFFA 1NVBA 4QWMA 1FFCA 5DCYA 4JOQA 4X91A 1R0CA 3RC1A 4NCXA 1RYZA 3TRIA 5CB6A 3DZHA 4XX1A 3IEXA 4C06A 3OY2A 3AR7A 5G3ZA 3E8XA 2B9EA 1DC3A 4WXPA 2QVBA 2RB5A 1M6NA 4ZAWA 5KYWB 1E1NA 3G7SA 5FWYB 1NOKA 2UZ3A 5FFMA 5FTKA 5A4AA 3FZNA 1RWKA 2ZWOA 4DM7A 1XMOB 1XCLA 1QH8B 1T3ZA 1GSOA 3CONA 2RARA 2PX3A 2V6MA 2BC9A 4QBFA 2Z1NA 3NIBA 4AZSA 2P67A 4MGEA 2HBZA 3BL6A 4K40A 3OOYA 4Y6QA 3UK7A 4F9FA 5DW3A 1BCSA 2VHVA 4ZAFA 5F64A 1DCMA 1U3DA 4H6WA 5ESDA 4N39A 2HHHB 1ETHA 1CSEE 1FUIA 3MBIA 3R6DA 3R3WA 5FV7A 5FYDA 3SZMA 5KOYA 4PY2A 1WXHA 2BRUC 2J7PA 1CULC 1WCIB 4N6OA 2GHRA 5J43A 5JCPA 1D1TA 2CHVA 1VPDA 2R48A 2Y66A 2WC1A 3G17A 5LBTA 3PX3A 1OASA 4J16A 1Y1RA 1XFAA 3OKPA 1EZ1A 3RYHA 1N1DA 3TSWA 2OP1A 4HVLA 1RC0A 1XJ0A 2SBTA 1UDCA 2XAUA 3R3JA 4ITRC 1JT2A 4OKIA 3UA4A 1ULZA 2XDWA 2YWGA 4ZU1X 2VSQA 3LHDA 1JEYA 4QVKA 1GSHA 1JF8A 1WVMA 3RK4A 3L4JA 4UNQA 4BX8A 4TRJA 2OSBA 1B1AA 3OU2A 4GEGA 2PSSA 3H3FA 3L4BC 3S70A 2VHZA 4FZ3A 5BUZA 1NSTA 2E4VA 2Z43A 1NUAA 3KC2A 2GK6A 1ZMXA 1CNFA 5CLIA 5FI1B 6NULA 2HJHA 3VC7A 4Y1EA 1N8NA 4JHXA 1XMIA 1OFTA 1PJ8A 1ZMBA 4XYLA 4UVHA 4R5MA 4AMGA 4WOPA 2DHDA 3STXA 3FLMA 1DMRA 3JTEA 3TZEA 4LDRA 4CF3A 2HR1A 1M2VB 2Q0XA 2X7JA 1CB0A 1XVAA 3CCBA 4WNCA 1ISSA 1CR0A 2GJ4A 1V1MA 1Q1BA 4WKOA 2WUWE 2Q5EA 2QW8A 4Q82A 5D7BA 5HCNA 3B38A 2XYPA 1E9AA 1W4AA 1OX6A 2WTNA 3OQ1A 4GI3A 4DMLA 2J85A 1TFUA 2OK7A 4K6CA 1FYWA 4X8OA 4C7MA 3PUIA 5T3UA 3C3MA 3MUFA 3W5AA 2LKCA 1Z6PA 4OXRA 1WLSA 4OQDA 5AKYA 2Y3IA 3RW9A 3A6HA 3C8HA 3ZR4B 1VI6A 4TTQA 4ZN6A 5KINB 2BR4A 3K35A 3O1JC 4KBGA 4EDHA 4LGYA 2Q49A 2NTJA 3L1IA 4U1RA 4XQ0A 1AN0A 3ZVLA 5IK2D 4PU0A 3RV3A 3COVA 1U9ZA 2XGGA 4UQOA 5E7IA 1RKUA 3DDOA 2W2MA 5BPFA 2Q5OA 1WP4A 2TMKA 1ISMA 3A4LA 3TLCA 1NULA 4D25A 4FFLA 4Q4AB 5JPIA 1BEZA 2H2WA 2VYNA 3EIHA 2G1JA 5A5FA 1LV8A 2BF7A 4JOSA 3RSFA 1WD7A 4O4JA 4I08A 1O89A 3OEWA 3OE5A 2VTKA 3B7GA 2RBKA 1RRVA 2XQJA 5KNCH 3DVAB 1NJ5A 5GMOA 2C1ZA 5AK5A 3TQIA 1EIWA 2R87A 1B41A 2MHCA 2ZDHA 2YFYA 4G23A 4IDPA 1LF0A 1FDSA 4O4IA 5DEOA 3ZW7A 1C7EA 3V8PA 4M38A 1BWQA 2WVHA 3EEBA 2OECA 1EGAA 1K5HA 3CEPB 4LTNA 1N9KA 4RGYA 2WF6A 3RRZA 4IGEA 1XG5A 1VKOA 2OILA 4FW8A 2NO7A 1VYVA 4P6VF 3LVQE 3K9GA 3LC0A 3OZAA 4KH0A 3W04A 5LYJF 1B0ZA 1JWBB 3LHFA 3EBPA 1JIQA 1JHQA 2QPOA 4H4CA 5KAPA 4MDEA 4TYWA 4RVCA 4ZREA 5BUCA 4CMIB 2PFSA 3E81A 3DAFA 3MQFA 4EEKA 1PQ4A 3G8AA 2NXEA 1QTNA 5EUQB 4CETA 1H69A 2VVTA 1VPWA 1DAPA 1SWWA 1J39A 3VQTA 4Y2UA 4DIOA 1EQ2A 5CLGA 2RHJA 2UYOA 2BH9A 3MNFA 4FXPA 4MDHA 5FH9A 4MULA 3PQ4A 2PTHA 1L4EA 1FDIA 1ORIA 3I1JA 3B9BA 1DX6A 3L7OA 3NBUA 2XCIA 4Q9IA 3SC2A 5JJCA 2GDJA 4PHFA 1Y6QA 3AEXA 1P18A 3NM4A 4D81A 5AFSA 1FX1A 1QWSA 1P31A 4MQFA 1M2NA 1NC3A 3OECA 2CFRA 2ZCUA 1Y8RB 3ZHQA 4FYIA 5DTEA 4BAGA 3X2SA 5JFGA 4XM1A 4DA4A 3FH0A 2DSTA 3P0HA 4KTVE 2WT4A 4EFNA 4UNPA 4Z5XA 2BGKA 2Z6VA 4AN4A 4CN8A 2HWXA 1ZA2A 3HP4A 4G81A 1AA9A 1BMFA 4KDCA 4JUBA 4I9GA 4OQMA 4XDYA 4QHSA 3L7YA 4BYGA 1B6TA 3BEDA 4CTJA 5CHYA 3WXBA 3VZCA 2A35A 4DLLA 3S7ZA 3UMCA 1BIFA 1CY4A 2GTHA 3SIWA 3WHIA 3TR0A 3HGMA 1WPRA 1BOOA 1VJGA 1VG1A 2PO5A 3IEPA 3NONA 4GRIA 4NFSA 1JKJB 1HTBA 1B3RA 3LGAA 3B53X 2DBZA 4ZCTA 2WWRA 1YFZA 4IZOA 4EP1A 3ZQUA 2RG7A 1USIA 4XYEA 1J23A 1V43A 3SYRA 1RWVA 1D1QA 3ABZA 3JQEA 3VV2A 1B7GO 2JAHA 3DE1X 4CI0B 4ETWA 1RRPA 1PR0A 3H5AA 2P2ZA 1EP1B 2PT9A 4OQEA 3LV8A 5AK6A 4A2QA 3SOZA 3T9EA 4ARAA 4CR7A 1DDIA 2NU8A 2XOKA 3FY4A 3TIFA 1W7AA 4URVR 3F71A 1K75A 4B75A 4E2WA 5JHGB 4YO7A 3UBMA 3A37A 2Q29A 1XTSA 1BXGB 1Z5PA 5B4UA 1NW9B 1JHZA 4DV7B 1YJCA 4C21A 3PHBE 2O8EB 3PR3A 1H0KA 2VJOA 4I6EA 2O2ZA 4B3HA 5HWSA 3SBXA 2LP4Y 4N5LA 4M1QA 1PYDA 3D6AA 3DV0A 3HZZA 3OFND 5A5VA 4B2LA 3ASZA 4XCQA 2BM0A 2P9QA 1P2FA 4EPWA 4F97A 1FDTA 4Z2YA 1KBQA 3JAWA 4R2KA 1S3GA 2NUTB 4LHVA 1NM5C 2RGNC 2IXGA 3MAJA 2B78A 1KP2A 1UKEA 2HL6A 4G5SA 4NPHA 5G0WA 4MP3A 3G02A 5A3SA 1B0UA 1S02A 3PCXA 2GYUA 5GP1A 1YOBA 4IMJB 1QGDA 4PEVA 3AM1A 1VE7A 3OH8A 4JYAB 1EHCA 1GCGA 2YV5A 4XFKA 5EE3A 3KVVA 1OYWA 4X64B 4IY1A 2BDTA 4E5KA 3K2BA 2R751 4EG8A 1G20A 2K2WA 3A3NA 5A4MS 2AF4C 2ZREA 4JJZA 3U1VA 1AUQA 4MKHA 6AT1A 3EVNA 2DTEA 4C0WA 1YQDA 4B8ZA 4CM4B 3PX7A 5BYAA 3JQAB 4RCZA 5TEWA 1EX6A 2B1QA 2PKYX 1TMOA 3RSHA 4OQNA 1DELA 2XH8A 4ISBA 1E1LA 2HQRA 4X1IA 3ON5A 2J46A 4HZIA 1OTXA 1CEYA 4WKPA 3Q7IA 4JDPA 5EESA 5KMGB 2NXNA 5FDFA 3O2JA 4OMDA 7REQB 1GUDA 2OM2A 1R0XA 2A5DA 2BFOA 2JVJA 4YJDA 3QI7A 4HEQA 3UYLA 1IBRA 1F60A 2ID9A 2XIJA 4KN8A 1MAUA 1HDCA 4LDJA 4YP6A 4XB2A 4ZI7F 4Y6LA 4H1TA 4YRRA 2R9VA 4XFDA 2PKXA 1FTGA 1QZ3A 3QVSA 2CZQA 4LZAA 1JLLA 2GLXA 4FFPA 4CMKA 3A31A 1V37A 4Q01A 3A9SA 4HDKA 4TRRA 4C1NA 3GH3A 1A4RA 4H17A 3H42B 4S2UA 3S29A 3Q9SA 1OXVA 3EYWA 3QLTA 3CY6A 3H9CA 5ITZB 1ZJZA 2CW5A 5CVCA 4YI3A 3H0CA 5JAZA 1EK0A 3DEYX 3M5WA 5DH9A 5M7EA 5JAUA 4RSGA 4YUAA 4C7OB 4NPCA 4H4EA 4K3UA 4E6PA 1V11A 4HDMA 4XM2A 2QTZA 2YMPA 4JK3A 4FYPA 3BTVA 1GNQA 3STYA 4FINA 4RY8A 4HWKA 2JHFA 2QRNA 1UK6A 1JDBB 4K05A 1Y48E 3BE4A 2J9FB 1XGKA 2C2XA 5DHRA 1XZAA 5MDHA 4Q12A 3PNMA 3QSGA 1HG0A 1MTOA 4OU4A 3WLLA 1ATZA 4GBGA 4J4HA 3LPNA 2Z58A 1AV7A 5CVVA 4RA6A 1IBMB 2DPXA 3F98A 5BQOA 2O8BB 2ZWVA 4G5OA 4GF5A 1LK5A 4LVCA 1NSFA 3IOEA 4MUIA 5EERA 8AT1A 2ZM5A 3Q3EA 5H1YA 2MYNA 1R9MA 1QIMA 1U5AA 1X1QA 1KDYA 3K8QA 3M70A 3R3XA 4C3OB 1G20E 3K0AB 1UEIA 1RAIA 4MS1B 4E7OA 1J07A 1OLUA 4GT1A 1QUEA 1UOOA 4L9AA 5TNXA 1U0EA 3K7EA 3UF0A 2PRIA 1L6IA 3RYIB 3IVCA 3ZVKA 1QC5A 4IOMA 2O50A 3T7DA 4L75A 2WIFA 1Y0BA 2OXTA 4QYXA 3T7TA 1QCYA 1V8BA 5CDFA 1XRRA 4AMYA 3ORYA 3DOJA 1PVDA 5EVCA 1TCAA 2GCOA 2I8AA 4BNTA 1Z17A 4PHHA 2HXSA 2QRJA 4GL4A 4L8WB 1CQIB 5HKKA 1KS9A 3DE3X 3LUJA 2WSSA 3QYJA 3SC3A 3TRHA 3H19A 4JI5B 3OE7D 4BZXA 3U4QA 2IXFA 2GKGA 2PBZA 5CA0B 1CUYA 5IX8A 1C4WA 2P41A 3GY0A 1T5OA 4BLPA 4XIJA 4F46A 1IVYA 3FVQA 3LCMA 3N59A 1TYAE 4DR4B 2J3EA 1VKRA 3G0IA 2OBLA 4WFQA 5HKOA 2A4MA 5EE1A 3TZHA 2OVBA 3NT5A 1UDRA 4O1MA 5ERGB 5BMVB 4OX9B 3WAJA 2BE7A 1Y7TA 2ZANA 3N5CA 4KXNA 4P7FA 1BA3A 2GKSA 1AQYA 2PEZA 4O5AA 4ZRDA 3EFHA 4LX8A 3WL5A 4RA9B 2NLOA 3I5AA 1BEUB 2FPKA 1E0SA 1W5AA 1S7CA 3PPXA 3FVWA 1AS3A 1GSIA 4UU8A 4XVHA 5B37A 3F4BA 3W3AH 5LFAA 3K72B 1OB5A 1Y7IA 1NQAO 4F2HA 2NNWB 1AGYA 1DX4A 3V7YA 1E3JA 1K63A 4RK4A 4LGCA 3NT4A 1BFDA 5ALZA 3T1TA 3N3AC 1O94D 1NXWA 2BUAA 2GBPA 4HSGA 4IFIA 1VFPA 3LOPA 1TLLA 4RWZA 4D0LB 2AG0A 1MJ5A 2YW2A 3E9YA 4G0OA 4CXMA 3P2IA 5IM4F 1NKTA 2BMAA 4IWXA 4P31A 1I3KA 4ZAXA 4B76A 2IITA 3KAQA 4G0PA 3LQQA 4ZQEA 5K3SA 3H2IA 5TGZA 5HIKA 2Q9AA 2O8CB 3ZHXA 5I4BA 1TYEB 5F4ZA 2EX4A 3U9LA 3S55A 4X62B 3QLUC 4YT2A 5ARBA 2XYGA 2VHUA 3O94A 3WYAA 1TB4A 3CTPA 4G5HA 2V3VA 2YHBA 1TRHA 4LMRA 3T5BA 1OJ7A 1ZOIA 3E7FA 2C7PA 2RHRA 4ML3A 5B1IA 3ZGNA 2Q5FA 1IRXA 1OFUA 1B8NA 3C3YA 4U7GA 3LA8A 5C1DA 1UCFA 5CDFE 4YRLA 2ID8A 4DSZA 3U7FB 2A7XA 2BFFA 2C5AA 3SGLA 2PR7A 1WDWB 3E4CA 2YWRA 4GEKA 3J81A 3SZLA 3CX6A 4NOLA 2L2QA 1SBCA 3UWKA 4F3YA 1W2WB 5B1SA 5DIFA 2OBMA 3EUAA 3VGPA 3A4YA 3EA5A 3CBQA 3L7DA 2GTIA 1I94B 5FEUA 2ADOA 2R68A 1BMQA 2Q2WA 3A6KA 3DW3X 3KEOA 4FMDF 3T1QA 3HKCA 1GT6A 4KSCA 4P4UA 4R0NA 4UM7A 3HCFA 4O2BB 3D4BA 3I01A 4RHUA 4O1IA 4RWEA 2V1XA 3AEUA 1IM8A 3VMFA 4MW2A 1E61A 5I7RA 2WTEA 1LB1B 2HKIA 2KHZA 2BHNA 2DAPA 2QTRA 4HWRA 2BD0A 4CODB 3ZQKA 4DLPA 1KO8A 1W5TA 3LDHA 4Q7JB 3F6YA 2IUSA 5EJ2A 4ALJA 2F1RA 2HEGA 3HCCA 5A5GA 3H5WA 1HT3A 1GGVA 1ARZA 3S81A 1GG2A 1WAMA 4ZFNA 6Q21A 4QATA 3CH5A 5FBRB 2AN9A 3BMCA 4BGEA 2A84A 1K98A 3LBFA 2X6QA 3ZWXA 3B7PA 3UA3A 2FU5C 4D9EA 1NN3A 2QM7A 3N0XA 1KTVA 3FPHA 3I6IA 3MS4A 4G5QA 2VQSA 2CHQA 3KKQA 4XM0A 4Y1RA 1KJNA 1WLYA 3ZDBA 1PDOA 2A86A 2OAQ1 1XJ5A 3UJBA 2O3JA 2FEMA 1QU2A 2CLOB 5CFQA 4MR8A 2SKEA 4WK4B 5EY5B 1ID1A 1FVFA 4QE3A 3X1ZA 2HADA 2RGEA 1U8XX 2JHAA 1Z7GA 5DV9A 4M7RA 1WPGA 4CTKA 4GM0A 5JNLA 1UZAA 2G8LA 2HJVA 3HYSA 2H85A 3URKA 4FILA 4OY3A 5E95A 2AXQA 2AQIA 2Z3WA 4J3JA 4OUDA 4JI2B 5FD8A 2AL7A 4EHBA 2QNBA 2JGAA 1N8KA 3IOCA 4MUAA 3ZDEA 3AV3A 1GGFA 3JPYA 4LPSA 4XLZA 4ZCSA 5TQ2A 2QN9A 1MD9A 2ZJ4A 3BKXA 1X8LA 2VDUE 4FU0A 1AO3A 1C2YA 3V7FA 1L0BA 2QF7A 2CN1A 3TINA 4L8VA 1ZN7A 2QP9X 2XMDA 3NHLA 1NUTA 2F43A 3HR7A 4OKNA 2O19A 1LBTA 4PFQA 2D1YA 2CLCX 2HDOA 4QL3A 4QUKA 4RX1A 5CX1B 5IC6A 5TT0A 1E3LA 4HAWA 3EXFB 3ZDXB 1YU9A 1E6UA 3LZ6A 1WKCA 2GBLC 2ORED 1G21B 1PUXA 1HEIA 3DQZA 1I7QB 5EE5B 1WY5A 4G56A 2DFNA 1M76A 2GQ0A 3CUKA 4N41A 4D43A 4RAOA 1YMQA 3OAAD 5DPMA 1XDZA 3NIWA 4J1SA 4O8CA 5IM4A 3ZHUA 5HGXA 5IWCA 3OZ7A 2JGRA 2E7ZA 3K1YA 1KQPA 3HY3A 1IC6A 1ZM7A 2QAIA 4WZBB 2JDIA 2EYQA 4N0EA 3VHRA 3EVCA 2EZ4A 1WEHA 1B3BA 1M0WA 2VAVA 4IXTA 4QYIB 3BDAA 4BGUA 3UMBA 1KSGA 1E4YA 1HL7A 2C82A 5JU6A 4WINA 3VTZA 4D4LA 2Y05A 3OTIA 2PUBA 2O8FA 2YVKA 3R6LA 5ENZA 4TPKA 4QYSA 3BIJA 3CW8X 2VYVA 1W96A 3KL2A 4EG4A 3RAEC 1TJPB 3AIKA 5JI3E 3KZKA 1V7PC 1VCNA 3LX6A 5EXPA 1ETUA 3CRMA 4K6KA 3ITNA 3KT8A 3TECE 3EN0A 2X2FA 3HJNA 1CLUA 3C3XA 1EDOA 3BJMA 1EDBA 2D62A 1NJ8A 2D74A 1DU4A 5I3CA 4Z4GA 3AFGA 3CISA 1E8MA 4TS4A 1SVMA 1JPUA 2RKOA 3CRW1 1UM9B 4I66A 3UT0A 3R0ZA 2EJWA 1T9KA 3PQ6A 4IDCA 4TLDA 4UDXX 3CC8A 1WS6A 4HUTA 1Q6ZA 2FQQA 3ONNA 4Q93A 1NATA 2HHCA 3FDZA 1EFCA 1YR2A 2ORWA 2QTHA 4Q9JA 4GGOA 3LCUA 5MGBA 4RSMA 2PGLA 4GMGA 5LU9A 1FSZA 5L4NA 1B16A 1IB6A 2SECE 1GGMA 2ZRDA 3P0RA 2H4WA 3OZGA 5E7JA 3V42A 4G0UA 4CZ2A 1CQXA 4IDBA 4KQEA 4R7ZA 4JQSA 1CY0A 3PQFA 4NK4A 3I04A 1OBHA 1T2CA 2E87A 3R3UA 4OO3A 4XOUA 4C88A 4ENPA 3V4OA 4GNKA 4ZOAA 2CNKA 2FVXA 4HG2A 4GPBA 3GPLA 5B3JA 1Y63A 4E15A 2NO0A 4UTVA 2JG3A 1D2GA 1XTUA 4O0LA 2I4TA 3DS8A 3ILVA 4KK3A 4OAQA 5CIQA 4RJ2A 3HWSA 1GLVA 2E89A 2D00A 3QRWA 3RAFC 2Z2ZA 4X3PA 4ZCQA 3TSYA 4IMIB 4BP8A 2I4IA 3IHKA 3BGIA 16PKA 1KK3A 2PEYA 2WG0A 1W52X 3WFJA 3KSUA 2Q4TA 1EFUA 2XNDD 4DIMA 5FJJA 3WGIA 1TO6A 4FCTA 2ZUCA 4I1RA 5E7MA 4OI0A 2FQYA 3UWPA 5KVCA 1X39A 2AFHA 1C80A 1RBQA 1TIKA 2CMHA 2J5KA 2R00A 4M99A 1N0WA 4MR9A 3OM0A 2CYCA 1N1EA 3HU3A 1AF7A 2UUOA 3OT5A 3JX9A 4RHCA 5DSXA 5KVVA 1CY6A 1SXGA 3E18A 4NYJQ 4OHRA 4L78A 4WMLA 1FFGA 4L6IA 3KBOA 2JGJA 4RJJA 2YC4C 3GGOA 4TMFA 3ZJ4A 4G26A 3OCVA 1CZUA 3TX2A 5C5DA 1AF4A 1HYQA 4LRQA 5L53A 5FOXA 4H18A 2ZDGA 4JUFA 2BYTA 1K6IA 3WC4A 1CRLA 2W0MA 5LOVF 1S2MA 3NKVA 1W2GA 3S8YA 2FPOA 1T1RA 4TKVB 2XYRA 4JQCA 2JAPA 4TL9A 4AX8A 2XAAA 4FSHA 3DXYA 4WL0A 4LHEA 1A98A 4YRTA 4CV3A 4MMYB 1LSJA 5ALLA 3SICE 4HNTA 3R3ZA 3FCAA 3FZYA 1QIIA 2Z83A 3F1LA 3T5TA 3M6VA 4QXPA 3STHA 2M9MA 2F59A 2QGNA 3VUEA 4PR0A 4LOLA 3L07A 4ZVPA 3PWKA 2CK3A 2ANBA 2R65A 2VNSA 3O3NB 2Q5LA 1E3EA 3ZD6A 1L5VA 5F9FA 2YIVX 1QZZA 1RWQA 2FV8A 1M5TA 4P80A 1V41E 3FN4A 3R3VA 5F4BA 5KYNA 4PZLA 5M04A 4URHA 2H07A 2O1XA 5L4SA 4MVJM 2GERA 1K7XB 5JG7A 4ABYA 2IDMA 2I6SA 3F8WA 4XUGB 5BNIA 5LQCA 3R9WA 1U2DA 2IW3A 4BCCA 2HO5A 1BGWA 1T8UA 5FAKA 5L40A 1NKSA 5DTIA 4CEIB 2OCAA 3TZLA 2X9NA 4Z0PA 4OFWA 3PC2A 3ZBTA 2VTVA 3D0OA 4GVPA 5LSAA 5ABPA 3KEGA 3L43A 3DNFA 2PN1A 1K5PA 2AFHE 2FFQA 2FSSA 2PA0A 3DE5X 4KWCA 4NMXB 4JEUA 3W3ZB 1UJCA 4LRTB 2G07A 5KTKA 1QFMA 1E2FA 1XTTA 4QXAA 5FF9A 1KZGB 3SM3A 3QE9Y 1NJGA 4ZVNA 4DYVA 4CG3A 4M36A 4WZZA 5I7WA 1O7JA 4WLOA 2ZRPA 3PNQA 1EWKA 2RCYA 4KYTA 4OB6A 3BCHA 4CG1A 3H2KA 4B3DA 1N2ZA 1MABA 5IJ9A 1K4MA 1Y6FA 2C3OA 2I29A 2IY7A 2R66A 2YVAA 4J0HA 3UJ6A 2JB9A 5IKXA 4L07A 1XTKA 2H08A 3JYNA 5IAGA 2YNMA 2FDCA 3OU7A 4YFYA 1IUKA 3PLNA 3ET5A 3VKHA 1T0JB 1BWRA 1KAOA 2HSJA 1G7TA 3K0KA 2WIBA 3Q9NA 3ZWDA 2N1BA 2C59A 4BV3A 1YZHA 4YV7A 5CEEA 2WZCA 1QMPA 1SCDA 3F3MA 1R1DA 2JD0A 5EPEA 3VGJA 4QUBA 1OLSB 5BQFA 1N32B 1VECA 4ID3A 4NE9A 3SX0A 4BVHA 3L4KA 2GZHA 5FNZA 4ZGGA 2XT0A 3GNSA 4IG9A 3K4QA 4WOCA 1TVKB 2PGAA 4REQB 2JIRA 2YXEA 4AVYA 5CVTA 4WV3A 2HNKA 4Z9BA 3I9V1 3U7QA 2PL9A 1QHSA 1R10A 1C81A 1IZ7A 3M81A 4YAGA 2ZUEA 3EIWA 4UQPA 3RQSA 1D07A 3AO0B 5J2UF 2HDWA 4G37A 4D26A 2Z09A 1CEXA 1QRAA 3BD9A 5CVUA 4XDGA 4YJGB 1JKXA 3C5VA 1HFKA 4LGVA 5FPPA 1VZ3A 3UMJA 2FMHA 2CLMB 4RYLA 3PGXA 2YXLA 3CVYA 4AKGA 1ZVVA 3ES9A 4L50A 4D9NA 2QZ4A 1K5GA 1PX0A 1R88A 5DLPA 4F1WA 1PL7A 1DC6A 4IS3A 2ATEA 1E79A 5K8CA 1QG6A 1Y3AA 2QE6A 2IYYA 1M6WA 1C7ZA 4WY2A 1XRPA 1IXSB 1HG1A 1UPTA 1YS2X 1O08A 1I6WA 2CDBA 4ZVSA 3ZDCA 3NWOA 5K05A 1OZ0A 4W9NA 3C1TA 4ER0A 1YJAA 2BUCA 1DEOA 3HU1A 4H6PA 4MGKR 4U8GA 3DKRA 2W8BB 4PLVA 4IKPA 4DMHA 4DSTA 4YO8A 2BDUA 4D92A 2KX7A 4DTCA 4EKDA 2QRUA 1ZINA 4CF6A 1HT1E 2V0CA 3GCDA 4GKKB 1WCYA 2R0QC 4UUNA 4Y6PA 4EH1A 5JQGB 1R0YA 2E0IA 3EXIB 4KEAA 2XHZA 2VCYA 1NAIA 3L9XA 4FJ2A 2HAEA 2J0VA 4BFSA 2Q7XA 4UCXA 1O8BA 4LECA 2VPQA 2HJRA 5LWQA 4LJ4A 3HXMA 1H9AA 5L7YA 4GOJA 1ZI9A 1SWVA 2RK3A 1CWUA 3N3BC 4RKRA 4RLFA 3AM3A 3HSSA 5BWCA 5JZOA 2UXBB 4KE8A 3BZBA 3PC4A 4OM7A 1M5UA 2BMFA 1HBJA 4W63A 2WOJA 1X7HA 4M1ZA 4TWAA 5H02A 3R24A 3M4JA 1RKVA 1XQXA 4GP9A 5JS6A 5B3LA 1EUDA 5KEIA 2WE8A 2FP4B 1YR8A 1CDZA 1P62B 1Q11A 2CXRA 2W6PA 3RFXA 1YDGA 1FP2A 1N2BA 3CWQA 5J4LA 3NT2A 1DTSA 4KLZA 3W8DA 4B6JA 4IJKA 4RZQA 3LUGA 3B2QA 5SZKB 3UV3A 4YECA 2NGRA 4NV0A 2N42A 3D3JA 1P45A 4XEHA 5KTRA 1ZQ9A 3HEAA 1K8RA 4KO4S 3V7NA 1LI4A 1YJBA 2B4QA 4BXOB 1XZHA 2FSIA 1V9LA 1SD2A 5D7NA 1DARA 3ED5A 4JB2A 3U80A 1ZAKA 4G1BA 5CMLA 3TL2A 4I0WB 1JKFA 1TM4E 1X74A 1Y7PA 2Q8NA 4PAMA 4CF4A 5DK4A 3ZWQA 1L5MA 1ZU5A 1ZJYA 1SBIA 2GEJA 3JVVA 3DZIA 4XI9A 1H6DA 4UEQA 5DVZA 1KYYA 3B36A 1PJZA 2C9ZA 1PKXA 5DCWA 2G76A 1JV2B 4KWTA 1RDFA 3JQBA 3PFHA 3PP8A 2RDMA 4NATA 2YV4A 4EZIA 1M7BA 4N40A 1VJRA 2NU7B 4FGUA 1HQYE 4F71A 1VLQA 4RSHA 1TYBE 2NSJA 3AJ8A 1YKGA 4RD1A 1ZGZA 2ANCA 2ZRAA 4DZRA 1MB4A 3D5QA 2JGDB 5ALXA 4BO3A 2O14A 3ZU4A 3DE2X 2AEFA 3EDCA 3RSCA 1M2OB 1FNMA 4HMQA 5IMSA 2FLWA 4CMJA 3FTDA 3IQEA 1RYEA 3C5HA 3PNBA 4NI5A 3LT1A 3UJ8A 1JMKC 3DULA 4AO8A 3E2MA 4BLRA 3O26A 2G0AA 2K6GA 3H1TA 4RXUA 5E6RB 5H7XA 1GGEA 4N6GA 4CFYA 1V4VA 1WVGA 3RT9A 4ZC8A 1C0IA 4QZVA 1PVVA 5HKBA 3AEKB 2HHLA 3ITDA 5J2UA 4C0SA 1PNVA 3BFPA 5DRYA 2A0XA 2IYUA 5AUQA 3AK4A 4Z9FA 4HD8A 2FRDA 3COJA 2C07A 1EWQA 4HFJA 1VKZA 4XD2A 3L6UA 1S3IA 2C94A 2CXXA 1L7RA 3SZOA 2IU3A 2RHMA 2H5LA 5GZ1A 1XB2A 2DMRA 1X8JA 3DFUA 3HXOA 4JEHA 4BZZA 4C2TA 4CHTA 3TO5A 2Y9PB 3DBVO 4TQAA 4ZOLB 4I4CA 2R1UA 1T3TA 2HU2A 3NC4A 2VJKA 1VA5A 2HBQA 2HU8A 3NYQA 4H2DA 4MI1A 4QQNA 1OH6A 1KAMA 4BO7A 2MYTA 4BNDB 4IYJA 1E9VA 1MX3A 4IF6A 1S4QA 2XMRA 4ZO8A 4IEIA 1NN0A 2FEKA 4HL6A 4MVJI 1ADYA 2IYZA 4MB2A 2P4EA 1JH8A 4IQGA 4AG5A 3SVLA 4KR6A 4K6FA 4PHGA 4V0OA 3TEFA 5KPDA 3UHAA 1UF9A 3UJPA 3I9V6 3EWSA 3OHPA 3F9IA 2Q1SA 1LBQA 3K8YA 2ZE7A 3Q8XB 4XUDA 2YYYA 3FKJA 1T5DX 5DI3A 1CYDA 4MVWA 1SHKA 5T4FA 1I2MA 5JVDB 4YALA 1K3FA 3UAZA 3VR6A 4UPEA 3GD5A 5JMTA 1T34A 5CDUA 4JJGA 4RZHA 2P40A 4BC0A 2LE0A 4MQEB 1ZY2A 4U3JB 3HBAA 2YN4A 1MAVA 4X94A 4YMLA 1ESCA 2BFCA 3F3KA 3FKSD 4XXHA 3OJXA 1COZA 4X71A 4EA8A 2QXYA 5H3HA 1GXSA 5I9LA 1X7XB 1HO3A 4ENWA 5CDHA 2ZKIA 2ZRKA 1R4MB 2XUDA 3MGGA 3P9RA 4IIYA 3E9CA 3ZK9A 4R2HA 4TTVA 3M6AA 1IY0A 4TV9B 2MOKA 3O6VA 2OHIA 2BEWB 3AY0A 4DADA 5DMHA 5REQA 1GKLA 1GCIA 1QJCA 2XQFA 1SELA 1Z29A 3FGPA 4DCJA 4W5JA 4S35A 1PT7A 1UKAA 1I0ZA 1YDEA 4MMXB 1OV6A 1ULAA 5IAJA 4A8PA 3HB5X 3ZV6A 5E6UB 2VTEA 1KYVA 1L4HA 2XYQA 1KRHA 1NJ1A 3FYUB 1MBZA 4HGPA 2IXDA 3ZBQA 4C4ZA 4EB6A 3AR6A 3B8HA 1Y1SA 1E63A 1GL3A 3F5MA 3LPAA 4JI8B 2C54A 4R54A 4OBWA 3DE4X 4Q4JA 5DTQA 1J06A 4A10A 1JKMA 3GA5A 1GT91 1PN3A 2WJ3A 3RVOA 3FWHA 3K16A 4K28A 2XMCA 4CQJA 2MCFA 4J7XA 3I37X 3L3BA 3SQNA 3C6QA 2IZ5A 4YDQA 1YONA 1C0EA 4YCBA 2GJKA 2VA9A 5HQTA 3ZHSA 2AK3A 1O87A 2AYZA 2AYXA 5EIBC 5SYNA 2EX1A 3EEYA 1BCRA 2CDRA 4E30A 5BXYA 3GFQA 3N0TA 2Y1KA 4C0LA 1OPXA 2GGSA 3H4VA 1G8JA 4KIFA 3T7AA 2P3OA 1YBFA 3EYAA 4Q37A 1IUNA 1E5QA 3GFOA 4C7VA 1OXMA 5E38A 3IIIA 1G8GA 1KHHA 4KGDA 3KD2A 5IP5A 5KYUB 2ZZNA 3R3HA 3CLSD 2WU4A 3LRPA 3WIUA 1UFKA 5IKEA 3V4VB 3E82A 4MV0A 3J7TA 1KI9A 4LQLA 2AKYA 4M0KA 4EUNA 5CBKA 3LZDA 1SHJA 4L9RA 5G2OA 2I9PA 1L5KA 2QU8A 2HRBA 4UUOA 4EB0A 5BV2P 3WGGA 3GFPA 4IDQA 1NYTA 1PV1A 4G01B 1G5PA 3RS9A 4DRXB 1XTZA 3FAKA 3H11A 2KE5A 5DHQA 1P0CA 1TLTA 4B6PA 3GCXA 1KFKB 4BMVA 8LDHA 5IZ4A 1Y9AA 4FHEA 4ZEVA 5AM5A 1NUQA 3OOSA 1FMJA 5DBHX 5ED4A 2M1ZA 2HSWA 2R86A 3AINA 1Z47A 3AI2A 4G4SO 1L5ZA 1EM6A 2OBFA 3LVRE 4J0QA 4HJXA 1DJOA 3KQMA 3QITA 4KXWA 5JSKA 3EXEA 4UBNA 2CSXA 4QM6A 1WXGA 2FE4A 1RKBA 5C7LO 2ZZMA 4DDWA 5I9MA 1W1UA 4LDPA 4KIUA 1PQPA 5CPFA 2H2DA 4EPVA 5JAOA 5K4GA 3G2HA 1YFJA 2XWBF 1HQKA 1KI3A 2OQRA 1U1IA 3PD0A 1E8NA 1SVIA 1PNOA 1X2BA 2QYSA 1IBCA 2FF5A 2RC6A 3AGQA 7YASA 2D1TA 1ATIA 3ZNOA 4URYR 4P08A 1XLTA 3Q87B 3GNTA 4X3OA 3DMHA 3UHOA 2ZJAA 5J9FA 4JVOA 3JRNA 1Z4OA 3N05A 2CWDA 3PDCA 5KVQA 5AD1A 2JLZA 1IB0A 1GG9A 1UBJS 4DMGA 1FBTA 5FI0B 1EKXA 1FFAA 1C9YA 5DN9A 4AYWA 1SKMA 4HAUA 3EX7C 3UCEA 1U11A 4ZHQB 1B6SA 3VA7A 2O2EA 3WKDA 5LYYA 3JS5A 3V7WA 4ENSA 3FSRA 4I4TA 2I8LA 3BK2A 1KDVA 4FUQA 1EDDA 4MVJH 4GYYA 1E6EA 2ZSJA 3F3SA 3IRUA 1VMDA 2QD2A 3GB9A 4PGFA 3RVQA 4WN3A 4ZP1A 2RGXA 3NHSA 5CB0A 2IS1A 5AHXA 5JW6A 3NC1C 5CFOA 2JLYA 2YWEA 2X14A 3B85A 1VB5A 2AUNA 3Q5GA 4ADSG 4CL8A 1K6XA 3MWYW 5F5NA 4ER7A 2PZ8A 1PTJA 4J0GA 3VX4A 1T13A 2E1PA 3BUSA 4RVNA 1P80A 2JBHA 1FNSA 1X1BA 4PCVA 5BN3B 2YMLA 3R4CA 2W2KA 1V16B 3J80A 2FEPA 5GJBA 1UFRA 3CX3A 3T3NA 2XKJE 2D0OB 1RZ3A 3BOSA 4YRFA 2EEPA 5DT9A 1TK9A 4IL5A 5KSPA 3SEZA 2Z5GA 3Q7PA 1P81A 3L0ZA 1J7KA 1G2QA 3CF4A 3DF9A 3FPFA 3HKDA 3RV4A 1E4VA 1JEQB 3EODA 3VYTB 4QHYA 5E9WA 1DT3A 2FPXA 2O8VA 2IS6A 4N3GA 5C5EA 1IK6A 5HP4A 3U13A 4DDKA 5CD1A 1QDEA 1DKRA 1RBZA 2IKSA 2XUAA 3OJEA 5I4CA 4XSVA 5C5CA 3CNNA 3CFYA 3CUYA 3A25A 3FPLA 4A0QA 3LVFO 1JEOA 1NURA 5KAMA 3SYLA 3VO9A 3ZD8A 3IDOA 3CRVA 3VOAA 4ZKDA 5KYGA 3EZ9A 5B58T 3RT7A 4ETMA 3FUWA 2Q5JA 1GA1A 5DYNA 1FQOA 2Q4DA 3Q12A 3KPUA 4D3SA 1QHHA 2YZ7A 5I51A 4IDGA 4LCJA 4RPIA 5JAIA 1NVTA 3TD9A 1QORA 4RKYA 3C45A 4TN1A 4DN6A 1UJ6A 1RMTA 1JDBC 1KQGA 3OQPA 4I8DA 5EWLB 4M9ZA 2ZGVA 3GVPA 1XOIA 3BXZA 3IR5A 4L2IA 3NFYA 4R2WA 4TMTA 4HXGA 5IJXA 3SQMA 5KJ1A 2AOVA 1CY2A 1DQRA 3AKDA 2OORA 4RHFA 3SS7X 4XWKA 1X92A 2DQKA 4Z7QB 3SF8B 4G41A 5IVKA 4XPIA 5C1OA 1VM6A 3SAJA 1A4UA 5AVUA 2EBHX 1MIHA 4QDTA 3W5JA 1XPUA 4IZIA 1B14A 1WZNA 3U09A 2ODAA 3DHYA 1UPUA 3IPYA 2HT6A 2GNAA 4M2LA 5KCMA 3PQDA 4LF9B 2NT4A 1QMGA 2R62A 3F5DA 4B9EA 1C7RA 3W90A 2D5AA 3K0AA 4TSFD 2GWRA 3T4EA 5BR1A 3WGKA 1C3LA 2QTWB 1IJBA 3TZCA 3L02A 4BU1A 3LTNC 1NT2A 1L3IA 3EMBA 2C8LA 2ZULA 5CYPA 1RMQA 2YL2A 1YFLA 2CZGA 1HR0B 5DSZA 2REQA 1KI2A 3EULA 4RE5A 2NVBA 2Y4NA 2VWHA 2AW5A 2EGUA 1XMJA 1GKUB 4IMRA 4XB6B 4J9UE 3U4HA 1JEJA 3KDSE 3QEOA 1TC1A 3BRQA 4TM7A 5KNBD 3W5UA 1XYGA 4RU1A 4FYJA 2P91A 3OY7A 4JQYA 4UBMA 1QE0A 4KMSA 3ENKA 4B7AA 4D0RA 5A6SB 3RNOA 3UXYA 4Z1OA 5KYYA 2ZATA 4F4JA 1MJHA 1ZD1A 3D0QA 3KHUA 4FEYA 1P0IA 3L1UA 4MPDA 1P2BA 2A9VA 2FMXA 3QELB 1DBVO 1WW3A 3BL5A 2XUJA 4JROA 1T9BA 3LPMA 5E1OA 3WBKA 1OMOA 1WXIA 5AHRA 5TT1A 1DJMA 2QB5A 3HTXA 3LH5A 5FI5A 3JZAA 1DVRA 3E9NA 4YROA 5FWXA 2HCTA 2FJPA 4QRHA 2NU6B 5AQ1A 4B34A 4ZCRA 3W9SA 2RH9B 4ZQGA 3O38A 1K7CA 3ZD7A 2R8YA 3JQ8A 3KLBA 5A02A 1SA0B 1EIZA 5JC8A 4GZ5A 1QZTA 2C8VA 4EL5A 4KUHA 3H2GA 4CMBA 2ZK7A 1TGVA 3GJ6A 4IJUA 4TT3D 3A7EA 4X1KB 2HK7A 3KFLA 2X3FA 3EPPA 4WLVA 4NZNA 1PW7A 2DUJA 4MKRA 4QUEA 4WWHA 1ZM4A 1Y5RA 4C0AC 1N7HA 1HZJA 1QV9A 4U5QA 1GG8A 4EUFA 4PPQA 5CLLA 3UKDA 2ZT5A 1AJEA 1RIFA 2CD7A 4GLBA 1N5DA 4D1YA 1J20A 1PS9A 1YZKA 3FBTA 4TMWA 4NFYA 3SYTA 4UW9A 4MW6A 4F0JA 5LLTA 1Q1GA 1DSSG 4O2AB 2IHUA 3M82A 3WLAA 3T06B 1OZHA 3WZLA 3U17A 4TYYA 2ZR8A 4KGVA 4JBNA 1QSGA 3HNRA 1RI4A 3VYRB 1IBSA 3AMVA 4ZHSA 1TUBB 2XA1A 4RESA 1T0HB 1W85A 3DEKA 2DFKB 4JBGA 4CIDA 1XCGB 2RAUA 2V7EA 1I1HA 2OE2A 5KOHA 1E5LA 5DZSA 1MIOA 3R3SA 2I6UA 4HXYA 2IOHA 3FF4A 4FNAA 2EBWA 4B6FA 3ELUA 4LBZA 4D57A 4O2RA 4Q7QA 4RBNA 4BS9A 3WLKX 3OZVA 1O2DA 3JQFC 2ERCA 4GYJA 1LTQA 3ECCA 2FMUA 3LXMA 2G08A 4UDOA 4NXNB 1KDTA 3MWJA 1ULBA 2J9ZB 5A6VA 2SKDA 2HIGA 2W9XA 1H2ZA 3EFOA 4GPZA 1X8KA 2WSIA 2QZJA 4ND8B 2WSMA 1EB9A 1WABA 2P7IA 3EXG1 4H0NA 3SEAA 3H3JA 1AA6A 4AKIA 4GUDA 1BN6A 1XRSB 4QBGB 3HBJA 4OYRA 1U3UA 1C1DA 1ZNQO 1HKHA 1NL3A 2IHKA 2OFFA 2W6ZA 3OCCA 1ODFA 4YAIA 5KDLA 1J8QA 5LZ9A 2FSFA 3GH1A 2J3QA 3QPWA 2Q27A 3RGWS 1SQ6A 2C78A 2O0LA 3MWDB 3T3OA 4RTOA 1CZHA 3AJ9A 2IP2A 3MILA 3JR7A 3MT8A 1INLA 1M1ZA 1WUJS 1ZIYA 2HQBA 2W2LD 2Q46A 2QR2A 3BULA 3CLUD 3HCOA 4PG4A 4QRIA 1D7OA 3UENA 3MLBA 4JQZA 9GPBA 3LE8A 1BWSA 2YFKA 4N76A 1XPJA 1Z5UA 1L4NA 3OC0A 2CUTA 3D4OA 3OZIA 4HGYA 3K8OE 3RC7A 4ND3A 2PS0A 4NBLA 3TQHA 2P9BA 3CPHA 1BS1A 4E5DA 1YRAA 3FHOA 4TL7A 4RVDA 4TKMA 2WMDA 3TBKA 1DIAA 1QX3A 3B7WA 1E2LA 1X7DA 1SO8A 3QU4A 4KQKA 4IGAA 2FZ5A 5EP1A 3LWZA 4IAOA 4RPCA 1SUWA 3IQHX 1QH1A 2AX4A 1HMPA 3D6VA 1RBMA 2R4TA 4ZT3A 3TZKA 3I9LA 5CB4B 3T9BA 4ASUA 2H2AA 3AERA 4OYHA 2PUDA 2OQIA 3LUCA 4B17A 2QV0A 3Q40A 1F2UB 1QF7A 3RO7A 2VFAA 4YT4A 2OHFA 2QJOA 3G2QA 1RRMA 2BLLA 4OLJA 1OD6A 5K03A 1G41A 4QJIA 5HX7A 1PFKA 4AICA 1FA9A 4HDNB 3GLKA 2RG1A 1DV2A 3F7TA 3KX2A 2TS1A 3IALA 3U44A 3P71T 4WLNA 3F2VA 1YGPA 4U0JA 3UUWA 3KYJB 4DXAA 3L06A 5CCBA 4U7JA 2GPNA 4HVAA 1VIAA 2QLFA 3C6XA 1QNLA 5DBEX 1DLIA 4RO0A 1V2GA 3GEPA 1UINA 1UZUA 1WTCA 2XZLA 5JV5A 2LDXA 3OEYA 4UNIA 3QKSA 2JA2A 5I3ZA 1YQGA 3QNWA 3QV1A 1ESEA 4XARA 2EZUA 4R51A 2GETA 4XDZA 5E8RA 5LQSA 2HLDD 3I5YA 1ZJJA 3N86A 1LDGA 3ZWPA 3RODA 5GIOE 3PFCA 3AB3A 3GX1A 1KO4A 3AIIA 1VL6A 3RSLA 3BTSA 1OC2A 121PA 1WQ3A 3CNLA 4GOKA 3RVRA 3TIIA 1X0VA 4C01A 4M8IA 3KDPA 3QVGA 1ZVJA 5AXDA 3T1NA 5LKRA 3QOXA 4Q16A 1DJNA 2WT8A 1JIJA 2ACEA 1R4ZA 2VT3A 4FX5A 2JCGA 4HQLA 4QREA 3W8EA 4F6RB 4DDVA 3MVEA 2AI1A 2DT8A 4MGIR 1NW3A 3DLIA 1N3YA 1E2NA 4TV8F 1T4DA 2YN2A 2GD0A 1QRTA 4NZPA 1Q2XA 2PBLA 3DBOB 3H2ZA 1ULTA 1E59A 2NX2A 2P78A 1WBBA 1GEEA 5CX4A 3BKWA 2P5UA 4YN3A 4XWWA 1U3WA 3LW8A 1YB2A 1KEEB 1KO1A 4OYLA 3ETHA 3CKMA 2XRZA 1HEYA 5BNZA 3I58A 1AZTA 2VIIA 5CXUA 4RLQA 1J9GA 1JE1A 3T7CA 2VOJA 5CG1A 2JCBA 3MHPA 2XQGA 3K9NA 3RUAA 1DJPA 1EUCB 2DGDA 2XNHA 2XRMA 3IAHA 3DTYA 5DSTA 2I9KA 3B6EA 4I5GA 3PCRB 3IIMA 5AUNB 2AI3A 2C5GA 3GBVA 3FKQA 5EJIA 5KKAA 3ZY2A 2JFWA 3O8NA 3JSXA 4K87A 2R1VB 2R96A 3E3OA 3UICA 5F2EA 4CEJB 1I36A 3QHAA 4GDMA 3IODA 4OSEA 2ZIZA 3QF7A 4ZZIA 4WNAB 2VJLA 5GV7A 4FMCF 3RSSA 3PE4A 3SVTA 1GNPA 3LCJA 2YWHA 3W7AA 2QAGB 1RP7A 3MG9A 2DU8A 3F6CA 5K0JA 2J09A 1TT5A 2ZTVA 3VR3D 3KTDA 3DWFA 4CQLA 4Q5IA 1U90A 4WESA 3GV0A 1QG0A 4YQFA 5IJWA 2Y68A 3DOUA 3R0XA 3TI7A 1UBSB 3O4IA 4L22A 2FWPA 2Y1EA 2AMFA 4G9GA 4YJ2A 4Z54A 5IG2A 4Z4EA 2HTFA 4ZOEA 4NJMB 4TTSA 5B1DA 1FFSA 1NP7A 8ADHA 2BOVA 1KEVA 2BTQB 2I66A 3ANMA 3LYUA 1IXKA 2LGJA 2JZCA 1YJ8A 1BTOA 2IBSA 1HFJA 1P77A 2HO4A 1MXFA 2LD4A 3I5MA 5I8PA 4ZQFA 2BBOA 5EZSA 3L7IA 2JL1A 3QQ5A 1QGZA 4LC9A 5EKDA 4B87A 1GZ4A 1U28A 3EG5A 2Q6OA 4LYEA 5JYBA 1SXPA 3OQIA 2PE5A 1KE1A 5G41A 3N0WA 3TOSA 3WE7A 2O9JA 3DDHA 1OLXA 3RUCA 2HF7A 1T5IA 5FR2A 2N0SA 5PGMA 2DCMA 2BFAA 1RS0A 3RH0A 4CCYA 1LZLA 2Y67A 3BF8A 4DVGA 1E1RD 1MC8A 3S1SA 3LDUA 3LKDA 2UYCA 4B6EA 1M83A 1MKYA 3QWIA 2XX3A 4AY6A 1KPGA 2WQ6A 1UBGA 3NI2A 4GMFA 1OU0A 1TI7A 2B92A 3DR5A 3LOUA 1ZK1A 1HYEA 4JOBA 5DN6A 3ZWCA 2BMDA 1O97C 5KNCA 4HTFB 5LB4A 4B7CA 1JLHA 3OEED 2F64A 3QX8A 2C7BA 3VPAA 5BT8A 3DL7A 3F49S 1IXRC 3UXHA 2W37A 5EWJA 1UJMA 3T1VA 1F2DA 2A0KA 1QPBA 3UJDA 4MRNA 1IHOA 1H2AS 2O2HA 3HA3A 1Y9ZA 3T5DA 3Q4GA 2P0YA 2OT3B 3W77A 3ZU6A 4BATA 1NR5A 3RCBA 4C89A 4Q6BA 4Y7CA 2FZGA 3MN1A 4UXHA 1Q91A 2I7XA 3W8FA 1AKWA 5LQRA 4CCAA 1KH1A 3K0CC 5G1NA 3HKBA 1F6DA 2A5LA 1NMSA 3DDZX 3CR7A 4FFMA 4HH0A 2H1CA 4L3VA 5DOVA 4KOEC 3ZYCA 2DHCA 1NVKA 2P8JA 1X42A 3QKTA 4R9NA 3T0IA 1SR8A 1P61B 3C6ZA 1RJGA 3DO8A 3LY5A 2ZBUA 3IXLA 2V7PA 1U4NA 3CZ5A 3T61A 1D2AA 4TV8A 3QPCA 2NXCA 1CVRA 5DFAA 2C77A 2IZ7A 3MTIA 4P34A 5JATA 3LWDA 3I2YX 4EJ0A 1LRKA 2H7CA 1L5WA 1B0AA 3F74A 1XKQA 5HFAA 4LDQA 4CQMD 1VSUA 1S9DA 3UT5A 3E15A 5KHLB 5AW6A 1NF2A 2V7XA 4R0MA 4Y2QA 5CRIA 4HRAA 1U98A 4YXWA 5CAEB 4RQAA 3L7NA 4X45A 2A5YB 2NADA 2FLKA 3FI0A 4KL8S 4MR7B 5C8YA 3WIDA 1R7RA 4Q05A 3RS2A 1E2IA 2BGMA 4KDEA 1PJTA 4BKMA 1F14A 4CLXA 3AU9A 1JB9A 3GZNA 3WWPA 2BR5A 4XR9A 1JYSA 2W4MA 3ANNA 4RDHA 1BVHA 4D8XA 5TDHA 1BE1A 4RK0A 4Q9LA 5J58A 2FOXA 4UU7A 4OLFA 1KMQA 3WNCA 1FFYA 1KH2A 1YB4A 2DULA 3TLJA 3GQVA 2R8XA 1WSAA 1Y3FE 1JG2A 1NRIA 2VDLB 3KKPA 3LW7A 5JDCA 2A1TR 3SNHA 5TB5A 3C4JA 5DP1A 2J3MA 3EXAA 1GNVA 3PFFA 2D4HA 3HZHA 1PUIA 3I9MA 4KX5A 5ALPA 5EVJA 4P2GA 2ZJ1A 1HA3A 2C3YA 4NQZA 1SVNA 3PKIA 2YINC 4CN9A 1DQZA 1CJBA 3ORHA 4G0MA 1XD8A 4IRMA 1EK1A 3KB6A 2VF2A 1W44A 4QOIA 4NP6A 5CDTA 3QE0A 1E3DA 4AZWA 1I3NA 1MVLA 4W5WA 1DBIA 3BMOA 4XPZA 4MQLA 3VYSB 2FWNA 4Y2HA 1P9WA 4CMGA 2BSQA 1D1SA 3HBFA 4W1SA 3SHTA 2HK8A 1LBSA 3HSKA 2CE7A 5FPYA 4F6LA 2VSOA 1R37A 4TMZA 1SJ9A 3I9NA 1WE2A 3MJHA 3OPQA 2Y2VA 1A2KC 2Y99A 3K53A 4J6EA 5KJFA 2PUGA 1EXNA 1GUZA 4L0QA 4WXMA 1VP9A 2GVZC 1OX4A 2I3DA 3DB2A 4EAAA 4F93B 3THXA 2FW6A 1EWVA 4GXTA 3Q0IA 2WPDA 1W4BA 1Z0KA 2J6CA 4LY0A 1K66A 5B2ZA 1SMKA 1Q7CA 1T4BA 5TR9A 3FDIA 3ZXSA 1JR3A 3EB9A 1U63A 5EIOA 3E9EA 1N3BA 4OFXA 4LHYA 1V5IA 4UNNA 3RIXA 5K5EA 2C96A 4JEIA 2P2LA 3TKAA 3V6LA 3W5SA 3W2TA 3SMVA 2GCEA 1ZXXA 3AR2A 3EVDA 5EXXA 2C84A 1C9JA 2DH6A 2ARKA 4FYHA 4I5FA 4TROA 4BEWA 5L3SA 2QX4A 4NBSA 1J1ZA 1ODLA 2GO1A 3PIDA 4M1SA 1FMFA 4IDNA 5D3KA 1ZZGA 3SDBA 4EYEA 5CXSA 4G8DA 4M9SA 2Q1YA 3WGOA 3K32A 3NCTA 1VL1A 4PBRA 1W19A 2VRWA 5EKUA 2PGNA 1J24A 2GPSA 2VSXA 3NCHA 4MZXA 5AT1A 4H08A 3WMEA 5CH5A 3VH1A 4AULA 1CJVC 1PWHA 1V0JA 4OOEA 4KPFC 3I5UA 6REQB 5C32A 3CIFA 1GRQA 1XKXA 2NYVA 2X15A 2AZDA 3CYFA 1BSVA 3OO1A 5JCOC 1XCJA 2DYKA 3UFXB 5LN1A 4DIUA 3AYXB 1P3DA 4XR4A 5KU7A 3AP3A 4RHEA 1SXJD 1CC1S 4R2XA 1Y9DA 2DUMA 2V5AA 2Z6UA 2OO7A 1IVNA 5JCJA 5EIBD 4F2GA 1BJRE 3CMMA 3HG7A 4YFVA 3TVYA 4DABA 3OE4A 3Q0EA 5BRAA 5K8IA 4EBFA 3AX6A 3PDWA 3MTAA 3I6YA 2PUEA 4DLSA 2IF2A 3HCPA 4TV9F 5FRDA 1ITZA 2LRHA 2VAMA 3GVCA 2L69A 3L8CA 3EOBI 2GZ3A 4FX2A 2EFGA 4HZUA 3IUSA 3FR8A 4BB0A 1U2RA 3OPMA 3PDIA 4FI3C 4DPMA 2RGRA 1AHPA 1WUKS 4L76A 2P65A 4XQCA 1YVPA 3IQDB 4ETNA 2E9SA 1EFHA 4O3FA 4CLRA 2CJWA 3VZDA 1D0SA 2CKMA 2HF8A 4PSDA 5ITSA 1QBGA 1E1QA 4A36A 1MVOA 1JR3E 1ANKA 1QIFA 1S5PA 2A9QA 1PR6A 1F0NA 1MRNA 4Y2XA 2FMIA 3LLVA 4DM3A 3LVBA 3QX3A 4EKYA 3IO5A 1KJIA 4BZQA 2JGEA 5J40A 1EESA 3GN1A 4IVRA 1Y8CA 3FFXA 4G8JA 4LCBA 3UMSA 3OZTA 4BX0A 5AKHA 1UQRA 3CNBA 2HCBA 2ZUTA 3QUTA 3L05A 4JNKA 4NFLA 4OKSA 3RE1A 1KEEA 4DIKA 3HNPA 2OCGA 3A28A 3JQ9C 5ICMA 2MSNA 1KEZA 1X77A 3BXOA 4L0DA 1E2GA 1XN1A 2J3DA 2YZMA 5E4FA 2QX7A 821PA 1QF9A 1CNEA 1PTKA 5TQJA 2QORA 3MHTA 4O33A 4O4HB 4S24A 3SU8A 1VOTA 2ZRFA 2W2OA 1CVLA 3NAZA 1TF5A 3N2NA 3QY0A 3BE8A 3ECSA 4BMXA 1AGRA 1MPXA 2FPGB 2DBQA 3JVIA 4KFUA 4M89A 4N0QA 4DNXA 5JXWA 1I7SB 2UVPB 4Q1VA 2IPXA 3R0VA 1LS6A 4NOJA 3B6JA 4DNFA 2WW8A 3V9AA 1WR8A 1JHXA 3CVVA 1RWBA 2P2DA 2VH5R 4WVLA 3DBHA 4MB0A 1VLJA 4EYGA 1WETA 3OD5A 4DUPA 5AVVA 3FDFA 1OXTA 3B9PA 3TUZC 1KFCB 2AEJA 3DDNA 1RAHA 4QBIA 1Y8QA 5M2QA 3HBMA 3WYDA 2LKDA 4B74A 5LDDC 2CF6A 1QYDA 4B44A 2FR0A 1Q44A 5F77A 1VYUA 2H3EA 4XGRA 1VLVA 3QX7A 4BJ3A 2IVZA 2JAWA 3NVAA 1Y4SA 4HMOA 3MS7A 4WERA 3TAXA 4CTMA 4BN4A 1FJGB 3MWGA 1NQ5A 3TKYA 2N9UA 1UEXC 4S1NA 1SNYA 3V8NA 3SQXA 1NQWA 4RS3A 3NTXA 5DGCA 1I30A 2GBCA 2GAFA 2J41A 1U3TA 2DE0X 2OZPA 3BWYA 3JQAD 1NXVA 2GF9A 3A4TA 3C0KA 3D7KA 3UB4A 3UGQA 3C4VA 4D3DA 2POCA 3LCRA 1QQBA 2PRYA 3MYYA 3T6KA 5AVRA 1JIVA 3JQPA 1R4NA 3KQVA 1JQJC 1LPMA 2C9OA 3IXQA 2J5XA