4D8WA

Salmonella typhimurium d-cysteine desulfhydrase soaked with d-cys shows pyruvate bound 4 a away from active site
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-Cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 120
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8wA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8wA02
2ZPUA 4COOA 4HT3B 3HMKA 2EFYA 2CLIB 2CLKB 3L6CA 4D92A 4AIRA 2O2EA 1FUYB 1J0CA 3IAUA 5T6MA 1KFEB 2TRSB 1UBSB 3VC3A 1P5JA 1RQXA 2PQMA 1V71A 3BM5A 2C2GA 4ZQCB 5B1HA 2CLHB 1TTPB 4D9CA 3X44A 4D9IA 3PC3A 1VE1A 1J0BA 3VSCA 4PCUA 1K7XB 1O58A 2RKBA 3VSDA 1TZKA 4LMBA 4D99A 5I7WA 4JBLA 3CEPB 5B55A 5JISA 2DH5A 2GN1A 3ZEIA 1UIMA 3AEYA 4WX2B 5KINB 3SS9X 4D96A 1A5BB 4ZU1X 2Q3DA 5JJCA 3VBEA 1WBJB 3DKIA 3PR2B 1A50B 1QOQB 5IW8A 3T4PA 5DW3A 5J5VA 1CX9B 5B3AA 1J0DA 4D9NA 3SS7X 1PWHA 2DH6A 4HPXB 5HBGA 4D9GA 1E5XA 2ZSJA 2CLMB 5I7AA 4D97A 2JC3A 1V8ZA 1FCJA 5B53A 4HN4B 4I1YA 3DWGA 1D6SA 3PC4A 5B1IA 1VE5A 1C9DB 1KFCB 4H27A 2ECQA 1Y7LA 1A5SB 1K7FB 1JBQA 3TBHA 3VSAA 3R0ZA 5KZMB 1BKSB 2CLOB 4LMAA 4D8TA 5CVCA 4QYSA 4D9EA 1V7CA 2C2BA 3IQHX 4JBNA 1CW2B 1PWEA 2EGUA 1TDJA 2V03A 1A5AB 3FGPA 5DVZA 3FCAA 2J9ZB 1KFBB 2RH9B 3X43A 4L27A 1X1QA 1K8YB 2ISQA 4IL5A 4L28A 4D8WA 3SPXA 4OREX 4D9MA 5I7HA 1KFKB 4HPJB 5B36A 1J0EA 5D87A 2CLLB 4F4FA 1KFJB 2Q3BA 2J9XB 3RR2A 1TTQB 5I7RA 1Z7YA 5DW0A 2TYSB 1K8XB 1M54A 4D9KA 2O2JA 3PC2A 5I7OA 1TZMA 2RHGB 4L3VA 1TJPB 2CLFB 4ZU6X 4AECA 1TYZA 4HO1X 4NU8X 5E0KB 1K7EB 2WSYB 5D84A 1C29B 3R0XA 5C3UA 1UINA 2Q3CA 2D1FA 1VB3A 1WDWB 5DBEX 3IQIX 5DBHX 3L6BA 2GN0A 4Y6GB 2BHTA 3IQGX 5CGQB 4D9FA 1WKVA 5IWCA 2TSYB 2ZR8A 4NEGA 1TZ2A 5BW6B 1BEUB 4LI3X 2J9YB 5IXJA 4XUGB 5D86A 1C8VB 1KL7A 1Z7WA 2CLEB 3DWIA 3L6RA 1WTCA 4D9BA 1OASA 1J0AA 1K3UB 1F2DA 2BHSA 2ECOA 3AEXA 4KKXB 4OFXA 5EY5B 3V7NA 5I6DA 5J43A 1K8ZB 5D85A 1QOPB 1TZJA 2GN2A 4D8UA 4L0DA
chains in the Genus database with same CATH superfamily
2OD2A 1PJTA 1P5ZB 2ZXFA 1J8YF 2ZI9A 1ANKA 4A10A 3T99A 1MA3A 4EJ6A 1W73A 5E4FA 1D1TA 3DTYA 4RZ2A 5DTEA 5K6AA 3BSSA 3I6MA 1K6IA 3U2QA 3T8YA 3WO0A 2BEJA 1LNZA 2C2GA 4HEA1 2JW5A 1YQXA 5KNDD 4DLUA 1YAHA 1JB9A 2VUIB 5DPMA 2AN5A 3RYFA 1S8NA 4OSEA 5DWQA 3QMVA 3F7TA 3G6WA 4NESA 3RF7A 3V55A 4BCBA 4C78A 2ZIGA 4BQEA 1RQGA 4N5DA 2RHDA 5LMCA 1N0IA 4CVNA 1MB4A 3QBDA 4U6SA 1Z4PX 1E5LA 1U8FO 3DKVA 4A8JC 3UKDA 3NUZA 3Q9LA 5I47A 3UAZA 3LQKA 4KMMA 2XUAA 3AJRA 4FFRA 4HMOA 4MPPA 2RK6A 4I8XA 3WRWA 4B4KA 3WGUA 3G1UA 4JP2A 2QUZA 2CL6X 5HBGA 1NGSA 2VYND 2KMLA 2CLMB 3UK7A 3FNBA 4YRQA 4IY1A 3ZTTA 4WDQA 4FYWA 2X58A 2F8SA 5G4KA 4EP1A 1PL7A 1ZJJA 1JA0A 1REQA 4J16A 1ZD2P 3VDMA 2VP9A 3OO0A 1JDJA 5CR9A 1SUBA 4N40A 3ANMA 1OE0A 4N0PA 3WGMA 2VLBA 2QRQA 1FW6A 1JDTA 5A4JA 4BPRA 3I9NA 1IZ8A 5BR1A 3QE0A 5IUNC 1UKZA 2AN4A 2Q0SA 1RKBA 3V1YA 4LMPA 3OQNA 3UT5A 3NT2A 3U3KA 1FOEB 3JQ7A 3M6IA 3ZHQA 3O8QB 4OXNA 2F1IA 2PIAA 3AUTA 1PGNA 1W1UA 4O2BA 4YJGB 3SM9A 2O8FA 2QYHA 5E1MA 4KXVA 1DTEA 3LDAA 4RL6A 4GZLA 5F23A 3W8NA 1L4UA 2AYXA 1OBVA 3K3PA 4YQFA 1U7UA 1NJFA 1TECE 2FCAA 3AETB 3LUPA 3O84A 3RCBA 3COSA 3IIIA 5FWXA 3IQXA 3SJCA 3Q3IA 3G0CA 1V9CA 1OV4A 2YMLA 3NP7A 1NLMA 5FFNA 5CA0A 4DA9A 2JLQA 4GRDA 3B1KA 4JT8A 2QTFA 4C06A 1QOZA 2JPDA 3DNPA 1YWGO 1C7ZA 1EUQA 5T8KC 2EYQA 3HACA 3OY7A 3OPYB 4HQLA 1GYPA 4B5LA 3D2BA 4FINA 1FDVA 1U8YA 1CQZA 3UEOA 3OOJA 1TA4A 3MILA 3FHLA 1RLMA 2BR4A 3PRKE 3ZHVA 5K3CA 2IYZA 3UK0A 3LBYA 1G5HA 2HREA 4FOOA 2XIJA 4I1UA 5HCUA 3AKCA 4CMIA 1L5WA 1RHKA 1XLWA 3AJ9A 1R8JA 2OHVA 3QKUA 5KBYA 1T9GR 1DDGA 4PHTA 5EI5A 3EWNA 4YO7A 3QFCA 1FFXB 3RQIA 5KEIA 2I54A 3H2ZA 5EMKA 3T5PA 1ODIA 4GM0A 3BULA 2DTDA 1XYYA 4R31A 3BIXA 2AKYA 1B6SA 3N6XA 4LY9A 3DJFA 3OBIA 1Z45A 4IOKA 5CB4A 4IHJF 4XDZA 4CV1A 3LT2A 3CVVA 3PX7A 1YRWA 4Q66C 1QIMA 3W4JA 2AJ8A 4OVKA 4JXKA 2NZJA 3H5WA 4Y0AA 4AI6A 2PTHA 5LB2A 3E9MA 4BE9A 5FI3A 4RKFA 2BHSA 2R79A 1X9IA 4YJHA 2GN2A 3RS8A 4IFEA 4A9AA 3I83A 3QY9A 4KV9A 4AROA 3THRA 3T1QA 3M3HA 4HXGA 5J2TA 4FFSA 5KMGB 4QDTA 3VMMA 2AFIE 4D92A 1OU0A 4KQWA 1TKRA 3IP8A 3UATA 5CT5A 4IX9A 2BDEA 1NVFA 1MJFA 5DCLA 3BC1A 1MN6A 4JI4B 1C3VA 3TCXB 2VQSA 3SSOA 1ZM2A 3PJGA 4QFMA 1EHYA 3AGPA 3QBVA 4RZQA 4WFJA 4KQ1A 1QR2A 4F4CA 4N76A 4Y6SA 4ZC8A 1NTRA 2VAMA 1T15A 1VFNA 1ONSA 1G5IA 1FVHA 1GPUA 1JPNA 1PL6A 3HXLA 4JN6B 1QQ7A 2QSZA 4M22A 4WVLA 4KMOA 2R4QA 5GZ6A 1HLPA 4NOKA 4WNAA 2GO1A 1FSPA 5TPZD 2ZAYA 4U63A 3GP3A 4W63A 3PQCA 4P1ZA 4RLHA 5CEEA 2B5WA 3IVRA 2WMYA 4MRNA 4WJLA 1FXSA 2QRJA 3BXHA 3OPYI 4E15A 4HAWA 2JFVA 3T5AA 2X42A 1JLRA 3ESAA 3ZHUA 2RH4A 1QVRA 5AUNB 4NXNB 3WLMA 1X2EA 1NE7A 2J48A 2XNDA 1K27A 3PE6A 3SU8A 1KIMA 3ZWDA 3CZPA 5F3RA 1EB8A 2V8BA 4JYZA 2DQSA 1K98A 3IPLA 3ZUPA 3HU3A 4ZYYA 2M1ZA 4JROA 1R66A 4BFZA 5FJIA 3DEHA 1GUYA 4CF6A 2FE4A 3FVQA 3HCOA 3NDJA 3OEHA 1S0UA 1FDSA 1S1MA 1XGKA 4QRHA 5FO0A 3ZS9A 2ZYUX 4GW3A 4AO7A 3T38A 1CZNA 1Y7TA 4P4LA 5DXFA 4B3TB 1XJCA 4HDSA 4BC0A 2ZUFA 1PT5A 1BAPA 1UK9A 2CDCA 2V96A 1IXRC 2X1HA 2VWQA 4ZHQA 1QO0D 3PVSA 2W2QA 3D9QX 4FZVA 5AESA 1QFJA 2I2DA 3H9QA 4HJXA 4X8LA 3OZDA 4KUGA 2XUZA 1RHRA 3HA7A 1TADA 4DRXA 4RZ3A 3TW4A 4S24A 2J5BA 4W5RA 1EVIA 1WEHA 3GFPA 3QNUA 3OU2A 5IUJC 4I6GA 3W7BA 1VIMA 2OXFA 5LNK1 1Q3HA 1VA4A 3QKIA 1OLOA 4K9LA 3BK1A 2FPGA 2CE7A 1B26A 3QVGB 4G86A 1MC1A 3HJGA 4JITA 1ODCA 3UQYS 3ZI4A 3MT7A 1K2VN 3KT0A 1L5QA 2E89A 4D0GA 1C50A 3CH7A 4Q02A 4YIKA 4ARBA 4D0SA 2QV7A 3L18A 1U3WA 4TVBA 2NU8A 4JLWA 3ZDQA 1U80A 4ZDIA 2PPVA 4EJMA 4ZMSA 5B37A 3H3XA 3NHZA 4MW1A 1C1DA 1EUDA 1R88A 5AK4A 3UK6A 1A95A 1JDZA 4PRKA 4AUMA 3TQIA 4LI3X 4QG3A 3DFKA 1ECBA 1N2SA 1UUFA 2WIJA 1JFVA 3VYRB 3UWMA 1BCRA 3KETA 3KB1A 5T3YA 1JHUA 4JI1B 4M9RA 5UKDA 1UXOA 1SHLA 2EGGA 2JGNA 2YRXA 3KJFA 5SV2A 4PBRA 4BKPA 4YRIA 4HH0A 3TCKA 2BEKA 1P7WA 3GP8A 1Z0KA 5DLPA 4F8YA 3GJXC 3DLIA 2WHQA 3NIWA 4D4IA 3IT0A 4L51A 4Y1GA 1WCIA 2H4XA 2CLIB 1YTLA 4ZT5A 2PL1A 4AIRA 2ZJ0A 4UDNA 1DC4A 3D8NA 3OIWA 4D7AA 2P9CA 3EVFA 2Y0DA 2TRSB 3MBOA 2AOTA 3RE1A 3FTPA 1GGNA 2AOVA 4KK3A 4MGIR 4DMHA 5F7ZA 3UENA 3NP9A 1TTPB 3NHJA 4OUDA 4FEYA 5IZCC 5JJKA 3BN3A 4IWYA 2WKPA 2A8YA 1D5CA 2OO7A 2QJRA 3FG9A 4DLKA 4HDKA 3ETNA 2G9UA 2QT1A 4GMHA 5A7FA 3K5PA 1H4SA 1D4OA 1LF0A 2H4JA 4GLJA 5C8VA 1UOOA 1FJXA 4HNHA 5ALIA 3RU7A 8AT1A 1EZZA 1P4SA 1GAQA 4EX6A 3K70C 3ZVNA 4RMIA 2YUIA 2Q99A 4J0DA 4OKNA 4AN4A 1LQ2A 1UWKA 2Q5QA 2DCMA 3C7AA 4CG1A 5LVAA 1MEEA 3AVTA 1WBDA 1T3GA 1FW8A 4UDXX 1E1RA 4G56A 3ZK7A 3ZU5A 3HYNA 5IKOA 3DEAA 1EFVA 1ZVMA 3E5NA 3FYCA 1H5QA 1XXHE 1RAHA 2JC3A 2XDYA 4O0MA 4XD7D 1URPA 4FB5A 8ABPA 3OQ6A 3IB3A 4OJTA 3RVRA 2QUAA 3BX1A 3FDIA 2IU4A 2C61A 4AN0A 1IOVA 3I73A 4G81A 4RE5A 3T7TA 5IT0A 5KVSA 2XQVA 1V5IA 4Y6QA 4MQMA 1LWNA 2KJQA 2P8SA 3ESDA 5JC8A 2D62A 3BH6A 4GYYA 5EUQB 2VJLA 3D7LA 4RLFA 4ARZA 2VPWA 3OZSA 3DBRA 3F74A 5DULA 2WJIA 2HUPA 3JASA 4CLDA 1DCMA 4QYIA 2QMYA 3LVFO 4H7KA 1KFBB 3HMQA 3KELA 5K2MA 2O07A 3FUVA 1QJCA 2B36A 1OX5A 2QQFA 4BWFB 4R2HA 5KKAA 4HMPA 4A82A 3UJ9A 1YL6A 4QYXA 3IMEA 1N78A 3HKBA 4HAIA 4RVHA 1GRNA 4B46A 3HWX1 1OPRA 2ZBPA 1JE0A 2JKVA 4B44A 3IUEA 2OY0A 3WE7A 1XNJA 2XB8A 2WA1A 4QTYA 1HDRA 2O8CB 4AECA 2PBZA 1HT0A 1S8OA 5TNXA 3SSNA 3SYRA 2PKQP 5LP6F 3GDGA 1C9KA 1RYEA 2JI6A 1XTZA 2XT9A 1PV4A 3B2QA 2JNWA 1JG2A 3LNCA 5BQXA 5EHNA 5M2QA 2E3JA 3D81A 4AJKA 2PV0A 5JR3A 3K9GA 3PPVA 1WDWB 4E7OA 4AZ0B 1CRQA 1OXSC 1QG6A 1N0VC 3VPAA 3TPZA 1WHSB 1U1FA 2B0JA 2KSQA 4L4UA 3NGXA 3ND6A 3A4NA 4L72A 4WOJA 1G3MA 1ADGA 1FLVA 4JK3A 2OBYA 5FNVB 2ZEJA 3V4OA 5BYKA 5JH7F 4YTEA 4G85A 4I8DA 2QDKA 5IU6A 3A1VA 1DJLA 1YUBA 3RVOA 2XCTB 3O2SB 5CYPA 3O03A 2C1XA 1E2KA 2W9XA 1LBQA 4BFVA 2YZ7A 4NE7A 4BV3A 5JCOC 2Q1YA 3PF8A 5LKRA 2YY5A 1H0SA 4OQLA 1O0CA 4D74A 1I7PA 1YQQA 2G36A 3SFTA 5JADA 3U7HB 1EQAA 4GI2A 1QTRA 1ENZA 2NO0A 3EOAI 5KOJA 1P62B 2BI8A 1ACMA 1IHDA 4OXXA 3KV1A 2HF9A 3V3TA 2VRCA 2YWCA 2CWWA 1ST3A 2H00A 4KO2S 4N6NA 4YJ3A 2JHAA 3GVIA 4WECA 4DNQA 9GPBA 3R6GA 4KO4S 3K0CC 4UTPA 2G04A 3AY0A 2IEZA 1J70A 4L16A 1O87A 1Q57A 2AC4A 1DT5A 1XZ8A 2A2ZA 2R7MA 4G0OA 2R4UA 3GH3A 1AGNA 3L06A 3SF0A 2P77A 3QF4A 4IXTA 1P2VA 3IP3A 3QWFA 2COUA 3FJYA 3R76A 2W2KA 3FH0A 1HRDA 4RMJA 1B1AA 4R5HA 3W5UA 1I10A 2X1VA 3FIUA 1TFUA 2GXQA 3KTAB 1NRJB 3RYIB 4U9UA 4J0FA 5C7LO 3AEUB 4GI1A 4U2CA 3SJUA 2IX9A 2VRWA 4YXWA 5T8KA 1HTWA 3C5VA 1JXAA 1H2EA 3FWHA 2QU8A 3MCZA 1C9YA 1I9GA 4MLDA 1L5HA 4MQ5A 4BN4A 4QC2A 3K6JA 3R7BA 3CHYA 1F0NA 1CVRA 4LGYA 2W0SA 3RKSA 4LDQA 2E6KA 2ODEA 5K3FB 4YIHA 4JC5A 1BVYF 1FRQA 4H4DA 2E21A 3ROFA 5IEJA 4ZJYA 1DRJA 1KMMA 3HJUA 3PC6A 3VDQA 3WGYA 1D6SA 3BEOA 3FVVA 1PFVA 3KAQA 1E8DA 4CNQA 3DW1X 1FLAA 1V16B 1XDUA 1MR3F 4BWGA 3G5MA 2B7LA 2TS1A 1FFCA 4LXIA 3UJ3X 4HX9A 4JLOA 3TNFA 2I55A 2IY8A 1TNDA 2DX7A 2XMCA 2HJRA 1MAAA 4GX0A 4EIWA 4UFPA 3OESA 1HR0B 2E7ZA 2PZ8A 1BX0A 1NBWB 1QG0A 5HJ5A 3SLRA 1RJ9B 3PFWO 1I51A 4HFMA 4P0TA 5KYTA 2PUDA 2O5VA 4ZWNA 4GR4A 4WGFA 3B3AA 3N8NA 4QPCA 5KS2A 2V1UA 1BA2A 5KTSA 1NKTA 5FLEX 1CE8A 3AOEC 3K2QA 3AESB 2D5LA 3ONNA 3S2GA 1AHPA 4OLJA 2M1XA 2ZE5A 1JE1A 4PXSA 2Q3LA 4F4FA 5ITZA 3Q0EA 3TE7A 5EQJB 2YJ3A 5FIUA 3F8SA 1S2MA 2FFRA 1DIOB 2FRVA 1COWA 3R75A 1SHKA 3HADA 1PVVA 4Y9DA 4BXOA 5IHXA 1ETUA 1XQVA 4KWTA 3WFJA 1KYQA 4M0DA 2RGAA 3OQ1A 4RF5A 1HPLA 2LD4A 1NBIA 3H2GA 4MR7A 4H7DA 4TGLA 4XCXA 4YJFA 2WJWA 3EXAA 1MO5A 2P0EA 3MLAA 3ICOA 4CKYA 4DQXA 3DF9A 2WNSA 1LRJA 3D8HA 3ZE7A 4BNZA 4QU5A 2GILA 1Z68A 4B6GA 1CNEA 2M6SA 1G9XA 1P29A 1NLYA 3GDFA 3PHBE 4KU4A 2Y1GA 3L6BA 4WZZA 1GAXA 2RG7A 2VDWA 1BYIA 3SQNA 1YIOA 4N7MA 4XEUA 1MOZA 4FMCF 4PHFA 3WXBA 3T0IA 1BXGA 2ZAOA 4H1VA 1IQPA 4RL4A 3HFJA 4ZAYA 4F3NA 3PEVA 5BQ5A 1SXPA 1Z5PA 3WDKA 1T25A 3KQYA 3PFGA 4LJRA 4BGIA 1K9SA 4MQBA 4Z99A 5DNDA 1BS9A 4KWEA 2JB9A 2I6TA 2OLKA 4XASA 4Y9UA 5IFKA 1AK1A 1QH8B 3B6EA 4R1OA 5BNWA 3H1AA 1PVDA 2AZ4A 4OHZA 4WW0A 3I9V1 2V3VA 3PD1A 4YXFA 3I05A 3MXOA 3UIEA 1SC1A 1YZ3A 1PTJC 3LDFA 1J0CA 1O6BA 2QAJA 3AK4A 1E58A 3ICVA 1QZ3A 1V71A 2BWJA 2DT5A 4Q7MB 3AUUA 1TU4A 4J3NA 4DLWA 4UARA 1DVRA 2XMRA 2ZBQA 1VSUA 2LNDA 4C20A 3DDOA 4S05A 2PGLA 2RMKA 4LBWA 4WL0A 4X7BA 3HVRA 3DB2A 2V1XA 4H0CA 4ESEA 5KQGA 1SKMA 1XV5A 4EY5A 4LMBA 3JALB 5EXPA 4E2ZA 3T52A 1FJ2A 3COPA 1IULA 3CWCA 3O21A 4B3CA 2WSLA 4P54A 3GR6A 4BVFA 1WVGA 4HQ0A 4NCHA 4CR8A 3AKYA 4D56A 3DAGA 5LQSA 2X2FA 5TVKA 1IPEA 1I7NA 2WF6A 4IHJA 3KTOA 1YOBA 1EK2A 1K63A 2GPSA 3AI7A 3LW8A 3TZ6A 3AUYA 1CY2A 2DU8A 2FMKA 2HD4A 5DP2A 3OTIA 4NU5A 3C3BA 4A16A 3OFJA 4C29A 4U2KA 3TX2A 5LU9A 2RBEA 2JBAB 3NXKA 2Z30A 3R5SA 4LJ4A 2I91A 1TTHA 4M37A 4PAMA 4RY8A 5KTNA 4JUDX 3FZNA 4BLVA 5KYXA 2YHIA 4I3GA 4C1BA 4CL8A 2GFHA 2L82A 2IYPA 4XCVA 4X8HA 1JHYA 1T1EA 3I09A 5F1YA 1YDFA 2R96A 4A3SA 4YJKA 3B52X 1Z8DA 1KEUA 2EHJA 4MKXA 1JR3D 3L4JA 2QVYX 2HH9A 4C76A 3L7JA 5C1BA 1TUGA 1AURA 4AM8A 1DAMA 2G77B 3I12A 4BAZA 5AVTA 2OQ2A 5THXA 1P3DA 1VKHA 1T5IA 2PZEA 4JP1A 2XQGA 1TF5A 4X6LA 1NQXA 1RZRA 1ZHFA 2YXBA 4NL4H 4H35A 3RFCA 4ZYTA 1ONPA 1XVIA 3DE3X 3JAKA 1KZ1A 4OH1A 3SM3A 4PSAA 4Q1VA 3V8QA 3WR5A 5IZCA 4X64B 3P52A 2G08A 3WK8A 1KEKA 3TVTA 1QQAA 2ZYAA 3GJ7A 5AKYA 2NYRA 4R9SA 1YZLA 1CP2A 4RY2A 3TIGA 5C3MA 1ORVA 4C5CA 2LW7A 3WLSA 1TX4B 1CZLA 3DQQA 3BK7A 3SBXA 2ZROA 2XCQA 3I3SR 4JZKA 2HHAA 3KXIA 3TIVA 1U0RA 2TMGA 3UB2A 1XTRA 2Y3IA 2QGNA 4NV0A 2JAHA 5LLTA 3OJCA 1U02A 5FBHA 5HXAA 3GLGA 4R51A 1CUZA 1HF3A 1N6HA 5GY7A 2AFHA 1G0NA 1WWKA 4YCJA 5KYNA 1FLDA 4NBVA 3N70A 2DGDA 3H9BA 4QLAA 1Q7EA 4NCIA 1O77A 4WSOA 4BQSA 4XUGB 5IVKA 2GBPA 2INGX 5DHAA 5ANRB 3DUFA 4JJEA 4D5EA 4H6XA 3E15A 2PRZA 1CJUC 4HNAA 1PFYA 3PKZA 4V3BA 2ZWVA 5IAGA 1Z7EA 1N2EA 2CB9A 3CXUA 5TS2A 3R7AA 2B9VA 3GBVA 1LBSA 1W1IA 3MMSA 4EHIA 3P4UA 4UD2A 2FWIA 3F90A 5C5DA 4OX9Y 3FSRA 1D2HA 1U4NA 4OATA 3VTAA 3FVWA 1JIVA 4ECAA 1E3TA 5CB0A 3WFIA 2XJ9A 1JPUA 1VKNA 1BOOA 3D8SA 2HJHA 1ZBDA 3DE1X 3G59A 4XFJA 4QJ3A 5KYWA 1A0OA 3AG6A 3LRTA 1PN3A 1CUWA 3FCYA 1BE1A 1WQ3A 4EUHA 1Y8QA 3L0ZA 5FPSA 3KT3A 3ID6C 2NXJA 3WYDA 4Y2GA 1DOAA 2UZIR 5CM2Z 4YP7A 5AVXA 2JG3A 2GJSA 4C05A 3B6JA 5JISA 3AI1A 5JWOA 4G4GA 3RRYA 2HA3A 3R6TA 3K6RA 4A6XA 1PW5A 1KOGA 5JIBA 4EY8A 5H81A 2CFTA 1OI2A 1EGHA 4WV3A 1W93A 2ZRIA 4BKQA 3F3MA 4EELA 1ZJ5A 4MZDA 4PLPA 1E8NA 5EEGA 3JWEA 3PUXA 4QAJA 2IYLD 2W6CX 1NXPA 4HAUA 2XITA 4N7JA 4E3ZA 1YRAA 3H75A 3AM4A 1SOWA 2FGKA 4MYRA 5C18A 1GZ4A 5IC4A 3A1FA 3FOCA 2FJPA 1SBCA 2IGBA 3DQZA 4EG1A 4J75A 3E9NA 2QUJA 2W4QA 3IIKA 2KBFA 3CKMA 3K0AB 1NW8A 1E2NA 3RS7A 2DWUA 2RHMA 4HSEA 2Q9UA 5KQSA 5KJFA 3VJLA 4B7UA 3DMRA 1NVMB 1IQ0A 3G0GA 4JR1A 4LYYA 4DNOA 2CL5A 2QV0A 1NW6A 1E6WA 4FW9A 1YU9A 4HQNA 2LKDA 1SXJA 5JCOA 4AJJA 3E48A 2OR3A 1GG2A 1YKGA 3DGEC 3UG7A 5CFLA 3AVYA 1UMDB 2CXNA 2OEPA 1RQPA 4EQ6B 1G8KA 1UR5A 2QTGA 5K09A 3N8KA 2W70A 4QWWA 1R2QA 2IZ7A 2WWIA 3HNOA 3ESQA 3ZGNA 2J9ZB 4FXPA 3V00A 4DMRA 4OUKX 3IVAA 1QG4A 2J7KA 4QGSA 3F97A 4QDOA 4Q4JA 5DM2A 3K0CA 4WKPA 3TL3A 1DQPA 1ZKDA 2AE1A 2DPMA 3WYGA 1J9EA 621PA 3WNDA 4KUEA 1EDBA 2C00A 3E5RA 4N8SA 4F12A 1TVKB 2Q1WA 4HK4A 2IYTA 2VJMA 1FUEA 2ZAIA 5F1PA 3SJAA 5C4MA 4YT8A 2Y27A 1BMFA 5AVWA 3AFHA 1N3IA 4EI9A 1Z4MA 2CCKA 4G4IA 3LUBA 4IQGA 2ZJ7A 5CVEA 1N0HA 1GAWA 2H4YA 2VNJA 4G25A 5ALTA 3ZDCA 4P3YA 4S35A 5DI3A 2UZ3A 4HMQA 1QHEA 1Y1TA 1ZQ1A 4D4MA 4RPLA 5FHRA 1R4AA 1RI2A 2X41A 3GRPA 3QYAA 3PGLA 4MVJH 3L8CA 4RMGA 4RVOA 1T9GS 3IPRA 3UBTA 3CT4A 4B1FA 3UCFA 3SYLA 3IUJA 3IESA 4RPHA 2QL6A 4EFKA 4NEGA 3KYBA 5FNVF 3B1XA 4ER7A 1N25A 3OQVA 5G4LA 2XD9A 4K05A 3I8OA 3WGHA 3UVEA 4OHBA 1V3QE 2AJCA 3G0DA 2ZRDA 3CLHA 2W48A 3RVKA 4MV8A 4Q4CA 1J24A 4MEBA 4WDRA 1J1IA 5IKEA 4NQZA 3DDHA 3IH5A 5AHOA 3I45A 3UWOA 3AEKA 4DIMA 3TFOA 4Z3OA 2XR1A 4LRYA 3BMQA 2EJUA 4GP9A 5I3CA 5IXSA 3JZIA 2XRMA 1F9EA 1CY6A 1V43A 2ASEA 2Y2UA 5FUWA 4Q1EA 4D02A 4LWPA 1WY5A 2KX7A 2AH5A 4I4CA 1TIBA 4LF5B 2BBOA 2ZE8A 4JODA 4DJ5X 2PX0A 3TW0A 1L0BA 3QRWA 3ZKAA 5LP6A 4YRCA 1JYSA 3AOEA 2QLJA 3RNLA 1FX0B 3CS3A 4NAVA 3NAQA 5BYJA 3F78A 3MBIA 4UKDA 1GRQA 2YZNA 5GIPE 2WIAA 1JDSA 3U4DA 1H3EA 4MVXA 1CY8A 3GU3A 4JOSA 1VJTA 3QMPA 3LWDA 1ADYA 4TN1A 4CGYA 5JH7A 1DAHA 2IHUA 3ZI0A 4ZZ3A 2VDKB 2VDQB 1O4WA 3EFOB 5JASA 1KMHA 3U13A 2WNHA 4R1QA 3JZMA 3L8EA 1TZCA 1A9XA 4CG0A 5KKNB 3M6AA 1AT1A 3TD9A 3J81k 4A36A 3W2EA 4MEAA 4WMLA 3WLOA 4NK4A 4JJKA 4FNAA 2BMEA 4WZAE 5JI3E 2EG5A 5GOTA 4PTLA 2AR9A 4V24A 1VIAA 1JZSA 5AMXA 4M87A 2WRZA 1A76A 3QLJA 1XLVA 3HJRA 4U0JA 1GPH1 2BCGY 2N3ZA 4RVCA 2A9FA 2R00C 4S0ZA 1ZRSA 2HU7A 5ALEA 4Z4IA 2WTUA 1S3GA 4IMJB 5AI9A 3OKAA 1N0WA 1HDZA 5K1ZA 2OHGA 1TDJA 2VYNA 2J6IA 4MSUA 5L3QB 4LI0A 1ODFA 1QRAA 2MR6A 3Q8LA 1V7QA 2YR0A 4JENA 3T3HA 4HB2A 1MNAA 2JAOA 2RHHA 4DILA 1OLXA 1PTJA 1MAVA 2HPHA 2C0QA 3E05A 2WM9B 5A71A 2FFBA 1TVEA 3CSSA 2CLLB 4YT4A 4V2IA 5EG5A 1UKBA 1XX6A 1YHYA 3HY3A 1LK5A 2BN4A 3EC1A 1QHHB 4OI4A 5BRNA 1SAYA 2IQ5A 1TEXA 3BAZA 3KEGA 3W5DA 4ARVA 1AQLA 1L7VC 2RHGB 2O2ZA 2IV7A 4LOJA 1A69A 3PCXA 3ER6A 4L9RA 1G8HA 5FOQA 3L07A 4ACBA 3R3JA 5EYPB 1LVGA 3NZEA 2GM4A 1GLNA 3LQQA 4OB6A 3K1TA 1YR7A 1WX1A 2D1FA 4WFIA 1VG9B 3ELYA 3GLUA 1E2MA 1U8XX 5JG7A 2UDPA 2LRHA 5TEVA 5CYGA 3PUYA 2WWYA 5JRJA 1E4VA 1U0TA 1VECA 1XDZA 8MHTA 4OB8A 1B93A 5HX7A 3KNZA 4ER5A 4TTTS 1DBQA 2R60A 2TSYB 5DM1A 5DM0A 5IMSA 3QVKA 5IBPA 1VKRA 1QAOA 2EWWA 5B57C 2Q4EA 3K4QA 4NJMB 1IHPA 5FKJA 2ONJA 3OQMA 1PZNA 5LD2C 2IS6A 3A58B 2J4FA 1YCFA 3UJPA 4OU5A 3EPKA 4DB2A 4NENB 1IIRA 1J2JA 5EJMA 2ZS8A 1J0AA 2XDWA 2Y4NA 2FHSA 3O8QA 2ZT7A 1JJIA 4YJGA 3LL7A 1GGHA 1RFLA 2VQ6A 1TZJA 2J4CA 5DX0A 4BO2A 3AR8A 1J2UA 1TCBA 2AUMA 2QRGA 5IRCD 5CB6A 2XE4A 5EP1A 5JSQA 4EGFA 4IDBA 3GLSA 4HHEA 1OXXK 2GCPA 1P0FA 2GNAA 2GKOA 1Y1KE 5CYOA 1AM4D 4ZODA 2C99A 2GKGA 2OAEA 4LSZA 2I67A 4L8YA 3PT5A 5G0TA 4E2XA 1LS6A 1Y0BA 3OPYA 1C4KA 3I0NA 4G97A 2KBEA 2WAMA 3AY7A 3PC3A 4Q19A 4UUAA 2AXPA 4EO4A 2AX4A 2CK3D 1RLTA 3M6FA 2PLNA 4HQ6A 4FOPA 4INZA 1QHGA 5AM1A 3SQOA 3TPFA 3WQRA 1C9MA 2A30A 1QANA 2PGIA 4QJ5A 1HE3A 2IBMA 2Y1WA 4I55B 4Y7DA 2BCEA 3S2SA 1EFAA 3GLRA 2IYSA 2VT3A 3PXUA 1XEWY 3O7WA 3AHJA 5JXIA 3AVQA 3ZCTA 1Z6ZA 1GT6A 5CM9C 2VDUE 4JP5A 4PPYA 3VO1A 2W22A 5TLSA 5IAKA 4PN3A 1NVBA 3RHSA 2LWIA 4C0BA 2BDUA 2XZPA 1Q7BA 4Q5IA 2PSSA 2QMEA 2IXGA 3DTTA 1QX4A 2WZQA 4M7OA 4MVJP 3Q5GA 2ZETA 4PLFA 3O3MB 4I1IA 4FUQA 2ERCA 1I5OA 3Q6MA 2FKNA 2FPWA 2LXNA 3D6MA 1KDZA 1KAOA 2WNIA 3TZBA 4UPEA 5JJ5A 2YN2A 4E4RA 4JEMA 3LYHA 4DC1A 3OURA 1ZWKA 4CKZA 2ZI4A 4D81A 1THMA 3X1WA 1SB8A 1YS1X 1EFPA 4FOLA 5TPZA 2GZ2A 5I9TA 4BZZA 1Y9JA 2DVMA 2NACA 3U37A 4G5SA 3ZWVA 2ODWA 4Q39A 4L76A 1U2GC 5JPIA 2QVXX 2KLBA 3GCZA 3FVRA 2G71A 1V2GA 1WPGA 1RE0A 4QEDA 5TJ9A 3LHIA 2HDHA 2AEMA 3C97A 4ND1A 3CWQA 4Q1CA 1AKNA 1DEOA 1SB9A 3CPHA 2G8LA 2J33A 2NTYC 3BQMB 4PSUA 1SXGA 1US8B 1G8GA 2DE0X 1GSIA 5I8WA 2V4MA 3SEQA 2VVTA 4G0VA 4CT5A 1MGPA 4CIVA 2PUJA 1IZ0A 2PXXA 1H69A 3U31A 3GLIE 3UMSA 4QQ8A 5CDHA 2JGEA 3FZEA 1P0CA 2J9RA 2PFSA 4IMRA 1TCUA 3IX7A 2P4SA 3CINA 1SPBS 2YCBA 4GDMA 1UBGA 2E4VA 4MV1A 5G1PA 5EZYF 3V4PB 1RXEA 3HBAA 1FRNA 2D59A 2QS9A 2W6PA 3RD5A 5BSWA 2HBQA 1EK0A 4ARSA 2WJ6A 4R8RA 3AC0A 1U6KA 1NA5A 1XE3A 2XCUA 1QO0A 3EAFA 5BRJA 3T3OA 2BFMA 4Y2YA 4FMPA 4F1KA 4G37A 4RKEA 3VNAA 4FZRA 3AI2A 4Z54A 5ALMA 4YQEA 2HA0A 3KJXA 2V5VA 3L7AA 5FPYA 1GM5A 4OD0A 5HJ2A 1QIDA 2CVHA 2PUVA 2VZ8A 1AQNA 5DRTA 4M0EA 2G3YA 4WRRA 4LOHA 7AT1A 4FHCA 5I51A 2P6RA 3C39A 4Z0HO 3UMBA 3U3MA 3V97A 1SUPA 3U48A 1QHXA 2CXUA 4MRMB 2X5OA 3JQ8B 5J2UB 4DV2B 3KVVA 1PD1A 1THGA 2Z6UA 3LFHA 1XA0A 2PLWA 5AR1A 4P36A 4BO6A 2DF8A 4XPIA 1AS3A 1FF9A 3SDZA 4O25A 3PXAA 3BSWA 4EF6A 1GEEA 4F2PA 4LDNA 1B8UA 4NJEA 1E7SA 1EAYA 3KVRA 4NFHA 3KE8A 1T43A 4UW9A 4TKZA 4X94A 4DADA 3CB4A 3THSA 1YC2A 3Q0IA 4IDNA 1M1ZA 3L93A 4C0HA 4D9IA 3EARA 1NUHA 4R2LA 3PUWA 3JVDA 2R66A 2Z95A 3U39A 4FFMA 3DEYX 1DXHA 3LFTA 1FK8A 2C8VA 2D1YA 3A2KA 1H0KA 1T36B 2VK4A 3EPHA 2HRQA 3R3ZA 5ISMA 3AVXA 3WJ2A 3WGTA 1Z4KA 1ZGJA 3CLSD 4WZBE 4BUJA 5K05A 2ATVA 1TA9A 2GESA 5F9MA 1T3TA 2WFZA 2VTVA 1GUFA 2VXCA 3Q87B 1U7TA 2Q8PA 2DSTA 1OWOA 4JNKA 1XROA 3AERA 4KPUB 4UASA 1XZFA 4Y0VA 2N46A 2DAPA 1NJ8A 2LDBA 3VVCA 1PK8A 3M9XA 5L9AA 5TQVA 1JRLA 4AU1A 3RS9A 3LKZA 3QUBA 2NO9A 3HTXA 2VHTA 4W82A 4ERNA 1F8UA 2XGOA 2G4LA 2NT4A 3K9LA 5B1IA 1VQ1A 3U1TA 2PGJA 2Q5OA 3KJGA 5AI4A 1F7UA 2J67A 4R7ZA 5D7BA 3REOA 3SQDA 1IM8A 5FA6A 1MKYA 2CNWA 2NU9B 4QSHA 4DEYA 1P5RA 3PZRA 5AKXA 3DEFA 1RJFA 3MUOA 4Z8XA 4C88A 3I2YX 3V9PA 4ZCLA 1J2TA 4J4BA 1XJ0A 5KDLA 1KI4A 1Z5UA 4PX2A 2VF2A 3A28A 1G6KA 2GK4A 4LE2A 4X1KB 3BOSA 5K8IA 4R1LA 3PQ3A 4LHWA 5JROA 5AJYA 4TXMA 4MHTA 2VJPA 1ENOA 3QPAA 5JJBA 4TLEA 1NOJA 1Q7CA 4GKVA 2FSUA 1G1MA 3CH6A 1TJNA 5DLEA 4EW1A 2R6AA 4R1NA 4WI1A 3RTGA 1GSHA 3RRXA 4QA9A 2IOHA 3ADPA 4OBXA 4ESVA 1ZD5A 4YRSA 4KDCA 4J76A 1IBLB 2GYUA 1Q2XA 3WOVA 3R8FA 3PSHA 1X42A 2Q1TA 3ZXSA 5EXSA 1PJ4A 3R4VA 1N6RA 1I1QB 4IYRA 4U3JB 3BJZA 5JMTA 1ZGBA 1W5EA 3A0RB 1EVEA 1J22A 2KW5A 3KBOA 2EKLA 2WUEA 4LXYA 2WU4A 1MO2A 1F2VA 4HI0E 3INGA 4MUHA 1NULA 4OH7A 1JQEA 3UJ8A 4PRZA 4AB1A 3AB3A 6REQB 5U4QA 2DEUA 2WWFA 3E8XA 1KC1A 3OPNA 1GT91 3AM3A 5CPBA 1MAWA 2WMNB 3LOUA 1Z8FA 2VCYA 2HL6A 4ALIA 3D59A 3ZE2B 1J2EA 1ZGGA 2LIPA 5AIBA 2AXNA 1A2OA 2OM6A 4UDOA 3G13A 4UNQA 1II8A 3MMNA 3RC8A 4AZTA 3MIIA 1M6EX 2JAQA 3T34A 3CNNA 4UREA 5DHRA 3W79A 3PDIB 1TIKA 2Y9PB 4OJYA 2PBLA 1HDYA 2RI6A 3UJNA 1YB1A 3LOPA 3JWPA 2PT6A 4PX9A 5J43A 5CHEA 4DCPA 1RPAA 4JSYA 2WD7B 2R00A 5EE0A 1E7MA 3EGDB 3HYTA 3QPBA 4C1NA 4HGRA 1PG5A 2P5TB 1EWKA 1LX6A 4ZOLF 2YKGA 3E9RA 3UXHA 1U98A 3EMKA 3BJEA 3NYRA 4FGLA 3L7IA 2Z2XA 4L75A 2X4GA 4BQFA 4G9GA 4GPAA 1MF7A 3I72A 4NZYA 3LPCA 4PCUA 3RU9A 5EFOA 3QQ5A 2YYAA 3H5OA 5AW0A 4LSMA 1FTWA 2G88A 2EHDA 3KKZA 3JZFA 1K7CA 3MJRA 1GXSA 2V3WA 4H08A 3CZAA 4PPFA 5ICGA 1Y9ZA 1A5BB 1BX1A 4MYSA 5EIWA 2Q5CA 4Y1FA 5FNVA 3RUEA 3VZPA 1ZIPA 1CZKA 3BHNA 3EFEA 4J0GA 3KQPA 1CIVA 4QFBA 5EIBD 2Q6VA 5A6SB 2HDWA 4TS3A 5DB4A 4M9ZA 1K8QA 2X2OA 4E1VA 4L5YA 3R3SA 1XJ5A 1CY1A 3P71T 5EVCA 4UUMA 3H9UA 3ON5A 3UAGA 4D97A 1UDXA 2WJYA 1N77A 2G17A 4UC0A 3ZWNA 3WKDA 2OQRA 3I52A 2FW7A 1E2UA 4M0LA 1U2PA 3RUCA 2LPMA 4ZI3A 5M29A 3TSYA 3JRWA 1KFCB 2V5AA 5D1HA 5DHQA 4W8OA 2OQVA 1OX6A 3ZE9A 3HA3A 3K53A 4X6XA 2J0SA 3JQQA 3QELB 1CKEA 2QN7A 2FEPA 4JQCA 2QW1A 4MV7A 1EM8A 1J0XO 5KJ1A 1NL3A 1YL7A 4ENPA 4CLRB 4YUVA 4EPYA 4YAIA 3TW8B 5JQGB 2B20A 4RA9A 2G1PA 1JDVA 3IVGA 3V33A 4XUCA 3FRHA 3K0EA 2ZTUA 3PUHA 3JATB 4UBLA 2YS6A 3UBMA 3GA5A 4EW2A 1LF5A 1KI6B 2IIVA 3IKJA 4H2DA 4HXYA 4N54A 5TB5A 2P9QA 3AHIA 3ZY5A 4E22A 1RKQA 3H2HA 2JHPA 3KHKA 3KTAA 4KBYA 4LYHA 5G41A 3RYIA 3VISA 4A27A 4DA6A 4P82A 4FNGA 3FNIA 3U4QB 5FWYB 4HX5A 1I7QB 7MHTA 2R68A 5BXYA 1GPLA 1GNRA 4F06A 5I4KA 1WP9A 3HCRA 2VDRB 3FLEA 2D0IA 2R8YA 3A4IA 2PKXA 3E22B 2GAJA 3Q12A 4R1TA 3UV7A 1KHHA 2XXAB 1PJ8A 3WGZA 4HVLA 4EGSA 5E0KB 1U8CB 5FTKA 3TOXA 3TZHA 1CC1S 1Y6RA 2QX9A 4UCXA 1OF1A 4PE5B 2PWAA 5AOVA 3R9KA 3S2UA 3DL4A 3QJGA 1F2UB 1KEWA 5LP1A 3L0YA 5GIOE 4TS9A 4L4YA 3QU2A 3KFLA 3OTGA 1AS0A 4PCVA 1V16A 1T4MA 2J0UB 4FIZA 4TQ9A 3UCXA 3DB1A 3OFKA 1OAOC 1XD2B 3WWYA 4H3KB 3AW8A 1FBTA 2ZIEA 2JEYA 5IJ0B 3A6HA 2GRUA 2RGXA 2PT5A 3R3UA 1HOTA 1NT2A 4M36A 2JLRA 3SXPA 1UC4B 1E60A 2IXAA 4LFCB 1C4OA 1P44A 1IEVA 4OGGA 4REOA 1Y3HA 4C4RA 4MP6A 1W36B 3M4JA 3GBPA 3KYDA 4QOIA 4QYWA 3KFXA 4FFDA 4MPRA 1DRWA 1RCUA 1QX3A 1L7XA 2WKWA 3MUNA 4R6XA 4BU0A 3R5HA 4N6OA 3AESA 2YICA 4OMDA 2BMDA 1QPGA 3LUAA 4HATA 1E3WB 3P2JA 3R1IA 4BY9E 5AKKA 4Z5XA 2IJGX 1U2SA 3CMMA 1WMEA 1NVVR 3GN1A 3ORHA 4W5JA 2R8PA 1Q6ZA 1WR8A 4YQYA 5HG0A 4EA9A 4AMGA 1U2GA 4GC5A 1K3TA 4QBHA 1L7QA 4J6EA 3ZY3A 4V02A 3M34A 4B82A 1PNOA 5CNIA 5EEHA 1ZM9A 2HV8A 1KNQA 4ZN6A 1H6AA 3PNBA 3AR4A 3FETA 3MGCA 4ME6A 3CZ4A 2QN8A 4GVXA 2P9TA 3AJDA 4U7JA 1RI4A 7ABPA 2XMZA 3CNHA 1FYDA 2FKAA 4PLTA 4WLOA 1ZVKA 1BROA 1AMUA 4IOMA 3KKEA 3OECA 5DIFA 3UMVA 2DQ4A 4C4TA 2YY7A 4JS0A 1M1YE 2ZTLA 4HN2A 5IC6A 3UHJA 4CCYA 4IXWA 3VPHA 1HX7A 1QAQA 3KBBA 3HU5A 4KIUA 3RK1A 4A2QA 4WBNB 2ACKA 3V42A 4YP0A 3W2IA 1ULSA 5GINE 4B4VA 2DHEA 1FRZA 3EQ2A 1PHRA 1UBUS 3AKEA 2OVFA 2YRFA 3LV8A 4JVOA 1RYHA 3PC4A 2XUIA 4PAOA 4B4DA 5A5DA 1EWVA 1QH8A 1OV6A 4JCOA 2EBUA 4KPGA 5CLJA 1Q1GA 4MUNA 2FUNB 4HBGA 4LXUA 2B21A 2FNAA 1PS9A 4ZOAA 3ADCA 2FMXA 1UP4A 2ZANA 4WIAA 3SHWA 3FKQA 2V74B 2WBLC 2VQDA 3A14A 4GI5A 4AZ3B 3ZS8A 5CJJA 4QARA 3UUFA 3ROGA 5BNIA 3L8DA 1JHRA 3ZJUA 1I2MA 3CRNA 3G9TA 1N7GA 3I4FA 3MSCA 4OTZA 5J4LA 1LFAA 3CA8A 4QUHA 4ADSG 4RD6A 3W5VA 2F3UA 2ZWIA 6LDHA 2PH3A 3JALA 2GK7A 4AYTA 3DF7A 3AMVA 4A2WA 4YJ2A 2AN1A 1A1VA 4NU6A 1DOHA 1S01A 4IJVA 1YGPA 2EW1A 2NN3C 4CUJA 3B5EA 1RWMA 2OSBA 5KTTA 2JCVA 3LTNC 2BM1A 1A9PA 4QO8A 5SZJA 1M7BA 1NYRA 2JD2A 4DXDA 1TMYA 1JPJA 3WK4A 1PBTA 4ZVNA 2BMWA 1OROA 4OPMA 2J09A 2PUHA 4U0KA 2O8DB 2JLUA 3O82A 2ZRGA 4FYMA 4X6UA 5IG2A 1NZDA 1RI5A 3VAYA 2QTVA 2QZZA 3VPCA 2MSWA 2WD8A 1RHQA 4HJRA 1SU4A 1U4OA 1T2FA 2R5NA 3K8ZA 4HLDA 1NATA 2E18A 3OU6A 4MLCA 1RIFA 5E8RA 1B8OA 3C41J 2OG1A 2W98A 3R6LA 2F4VB 1F7VA 1BGVA 1K66A 2OGWA 2QTRA 1ZNZA 4Y9TA 1UXJA 3KSMA 3TRHA 1FFSA 2H51A 2I03A 3WKCA 1USKA 1I30A 1UWLA 2BM0A 2O4UX 4KXQA 2I2CA 3JRNA 3MMZA 4HWGA 4HYEA 4JI8B 2BE9A 3OZWA 2L18A 4EG4A 4KQFA 1CQPA 1HSOA 4YI3A 2RD2A 2LZ0A 1TQDA 2WF8A 1CZOA 4W99A 5J2UF 3C6YA 4EUSA 3P26A 1TZBA 4G1CA 1CEXA 4E5PA 3UANA 4GUAA 1GZ3A 4QPNA 3LCCA 4TRJA 3B1YA 4Q47A 1HYEA 1I2CA 2IYAA 3Q3GE 4QUGA 3EQ7A 4NVRA 4P4NA 1QBGA 1GR1A 3KVYA 1OU4A 5B3LA 1RC0A 3OPVA 4RTJA 4P4UA 4XM0A 3T9AA 2HM7A 5PNTA 2YV4A 3EW9A 3QEKA 3UMGA 2GXAA 3ZHRA 1MU0A 5A3QA 4RZSA 2EU8A 5EZYA 1UPXA 3OIFA 2BBTA 2O20A 2FN8A 2ZPTX 5FI5A 3LVRE 4EB0A 1I0LA 2P78A 3QMMA 1PR3A 4XOIA 3TXYA 1ML3A 2I99A 1TZKA 4FMBB 4KR0A 4Y9RA 2FFJA 3BWDD 5E7QA 1ZJZA 4INAA 3L4EA 1IN8A 1DO2A 1E4OA 2O52A 3VDNB 1P2GA 4CYMA 4CL2A 3KQVA 3OM9A 1U8AA 2G72A 2VT6A 3ONWA 4KFRA 4NTZA 2WE7A 4Y8VA 3SQMA 5EP2A 1LRLA 2VDJA 3V8BA 3QEMA 3HVHA 4L07A 4N1AA 1SC6A 2MSCB 3D0KA 2ODNA 2P9JA 2W37A 3I0MA 4KMRA 1P0PA 3O1LA 4PX5A 1EXDA 2VYCA 4R7TA 2ZBUA 3AM1A 2VF5X 3B48A 5AXCA 3ZIAD 2H5JA 4YPFA 5IJ9B 3UPTA 1T2UA 4R05A 4AKIA 3GOQA 3NAZA 2AZXA 1S2GA 5KQRA 1PT7A 5E2BA 3SZMA 1KYYA 1VTKA 1IZZA 1NT4A 3MA0A 1QLHA 1G6Q1 3B7PA 4H27A 5C53B 3K8OE 1W8DA 3VM6A 5A3RA 2ZS9A 4C2AA 1C8BA 2DR3A 2EX0A 4OBWA 3GEMA 4K28A 1VGQA 4EY4A 4UE3S 3LGAA 3H87A 4OHRA 1JTFA 3IQZA 1EGAA 1ZIOA 1V11B 4MULA 3NYQA 4MZXA 1CW2B 3RUIA 3STYA 2GMWA 2PWYA 5AW7A 4HWOA 3W4KA 1GUDA 3FPGA 4I50B 1E2HA 3KQTA 4Z3KA 2FN7A 3WRVA 4J0EA 2WU3A 2ZBGA 1FTQA 4PR0A 4BLRA 3UOAB 1JIXA 3D1LA 1X1EA 3WRXC 3CBGA 3QX3A 1R0ZA 3FHCB 1Z6PA 1YF3A 1ODLA 4PZAA 3U17A 4K40A 2AZDA 5CIQA 3H97A 1NFFA 3CZ9A 5DIZA 3FZGA 4DCUA 1M2NA 3E2MA 3EBPA 4TX1A 2G9ZA 4YHHB 1PT6A 3K0HA 4EUNA 1UBLS 3DZJA 2Q2VA 4QNRA 1E2GA 3L7LA 3RODA 4XR9A 2FR8C 2HNBA 2EKDA 3AR5A 3UPDA 4BFUA 1OCEA 1UXIA 1CUEA 2Q4RA 3PCTA 4G26A 4DMKA 4GBED 3G9QA 4EG7A 1PNRA 1WMSA 4RJLA 5SYMA 1W29A 1G20E 1P8AA 1QS0A 2BFOA 2F1JA 2XEDA 2QM3A 1XCPA 3AR2A 3L40A 3MFYA 4IG9A 4L08A 2J8ZA 1VSQA 4OQEA 4P33A 2JS7A 1J9GA 3H6GA 1EUCA 4TWIA 3MW8A 1R6UA 2JVIA 1KOFA 3CLSC 4A1FA 3VR2D 2YZ2A 4NPAA 1J7JA 5K4HA 4GPD1 1YDHA 1UMDA 2YCLA 2YQ5A 4BMDA 5EJGA 5J63A 2AOXA 4EQ6A 4OHKA 2WP0A 4IZIA 3AEXA 1U04A 3OZFA 1IEQA 1NOKA 1YQ9A 1EA5A 3D3WB 3RWMB 2UUBB 2WIFA 3H8VA 1C4WA 1WM1A 2GUWA 5C0OE 1YRBA 3RRBA 1MG0A 3C3MA 3JQFC 3U7RA 5FDFA 2X7JA 3W78A 1VBMA 3NIFB 3ICWA 2VUTA 2HXSA 2W2VA 3EZNA 3RSSA 4DR3B 3UHAA 3CUKA 4FFLA 4TQGA 3PGMA 2QGFA 3ASZA 3HM2A 4ZU3A 2GOYA 1YI0A 4Q4LA 1VL2A 3HB1A 4I2VA 2YV5A 4AKTA 4BP8A 1M2VA 1WIWA 2ZB7A 1V9LA 4OA5A 1GDDA 5GVSA 3ZNOA 1TK9A 2I6GA 3YASA 1DU4A 4FYKA 4PIVA 4AWXA 5K0GA 3KQUA 4QQRA 2QM8A 1SHZA 2VP3A 3DDCA 3P7MA 2N9UA 3PCRB 3CPSA 3DVQX 1Y1PA 3LY7A 1MABB 2XKKA 2BGNA 3MJVA 1Y7PA 2JLSA 1GG8A 2YWBA 3DXYA 5SYAA 4ENWA 2HQBA 1EQUA 3D8BA 3NG1A 3W3ZB 4CM5A 4FX5A 3TEFA 3IP6A 3P27A 4B09A 2VQFB 4CM3A 3K4PA 3A6JA 4B2IA 1SCNE 3I6IA 1NM5C 4M49A 3BL6A 4G1VA 1P5HA 4PZ9A 2YC2C 3B7GA 2OK8A 5EESA 4D4LA 4YRPA 4F92B 2HRZA 1V4BA 4Y2SA 4AMBA 3UAXA 2WV7A 3OZXA 4PV7A 1E77A 3AIOA 4RS4A 3AJEA 2CEAA 3O9MA 3Q1KA 4ZOLA 5BN4A 4XPZA 2A14A 3H9CA 5AVQA 1H2ZA 2XF2A 3LDGA 4WK2B 4XA8A 5HZGA 1XRJA 3ANXA 3JWGA 3Q72A 4J03A 4NZPA 4TT3A 5G02A 1N5OX 1CVLA 3IQHX 3U1VA 1K6JA 4CG2A 2Q45A 3JY6A 5JQGF 4UUBA 2HSWA 3VHQA 4TPKA 1FX0A 2FZCA 3Q6IA 1X1QA 4N0DA 3V48A 1C30A 1TGVA 1A2BA 4C08A 4DFDA 2OV1A 3PNVA 3NOOA 1UBJS 4ZCQA 1OI3A 3KJEA 2VRNA 1BDHA 1V7PC 2Q3BA 1B0PA 2D8MA 4JQZA 1I1OA 2V7TA 3K9NA 5MFPA 3NTRA 2NPIA 2ZU0C 3AOGA 3ZVKA 1NYLA 4LY6A 3P1JA 1Y48E 4EK9A 3NQ41 1YI8A 5E6UB 3L82B 3TAHA 5BWMA 1VIYA 1OIWA 4IX1A 2X77A 3DMDA 3OBBA 2WFMA 1PSZA 4ITVA 2LKCA 5GM1A 3RU2A 9ABPA 1FYEA 1GPBA 1M8JA 3KQSA 4PO9A 5AQ1A 1BWQA 1QF6A 3GZNA 3MMXA 3FOEC 1Q19A 1U3DA 3EBOA 1IRIA 1VP3A 5EFZA 2MJLA 1CZHA 5CLLA 4EPRA 3EQ9A 3W5IA 1JUDA 4DQVA 3LI2A 2HR1A 3PYLA 4LF6B 2AQ8A 4NZ9A 2F3SA 3U4HA 1GGJA 2JH9A 2YFHA 3H16A 3OUUA 1JYEA 5K8LA 2E4YA 1YR3A 4IIYA 5FF9A 4EJSB 1P7VA 3SMVA 5EHGA 3LX4A 3S2FA 5I3ZA 2Q07A 4OFXA 4U1RA 5LA6A 1Q95A 5F76A 1JLKA 2IT1A 3AHCA 3Q9NA 3VV3A 1F0PA 3NRCA 1FMCA 3ZYCA 4FS3A 3D4LA 3UAWA 3F5SA 4V0SA 1OH6A 3UH0A 3PNPA 2CKDA 4RYDA 1RQ2A 5ENZA 1NRIA 4D5GA 1ZL2A 4M9UA 3KYCB 1PL0A 1U1CA 3V3KA 5KHLB 1VA5A 4PLCA 4NMHA 1DIRA 2VN8A 1MPXA 4BBPA 4IXDA 1IZYA 2FQWA 1U0EA 4YDQA 3OIYA 1POWA 1TQ2A 5CH3A 1KBOA 3S28A 1IDN1 1PR2A 1OFUX 2CF5A 2CUTA 1SWVA 2NGRA 1L4LA 2QQ0A 3LT0A 3K35A 3UW1A 5EYPA 3ZJYA 3F9RA 5GZ1A 5KQPA 3SYNA 4Q9IA 3CEPB 4ETMA 5F51A 3OUTA 3LFUA 3I6BA 3MTJA 3NFRA 4Q7KA 4E6PA 3MINA 3OZIA 4CZ2A 4F6CA 5BWCA 1TKCA 1UQRA 2PJZA 3KPUA 5CCXA 3K0SA 1RU3A 1W4CA 1RXVA 1Z6QA 1PLLA 4DVJA 2AD5A 1NRWA 5DOZA 4XOUA 2O8EA 1S3SA 2RI1A 3F6EX 5BQOA 3C3DA 1U0HC 1YKFA 4XWWA 4KWHA 4CUZA 3BRSA 1JEOA 3VSBA 3HK2A 2OBBA 1XAHA 4OAQA 2CK3A 2GVDC 4FN5A 5IARA 2VL7A 2A5LA 3GUUA 1QIFA 1G63A 1ZCBA 2Q1SA 5LYYA 1C1XB 2YIDA 2E49A 4WBNF 4UEOA 4YDSA 1JG7A 1RRFA 4IDDA 5IJWA 2R1VB 2H1WA 4LOKA 1EX1A 3VTFA 3WLHA 5CK5A 3CRMA 1Y8RB 1C3OB 5GVRA 4CIBA 1O3YA 3FR7A 5CVCA 3ESCA 4Y6OA 3PTAA 4GL2A 3EK2A 3HDTA 4FVTA 3LQFA 4URFA 1ORWA 1S2LA 2SKCA 4YEDA 1R0LA 3GRAA 4MVCA 3P9RA 2DY0A 5TEWA 5IKMA 3EB9A 3ZGYA 1KEEB 1DPGA 4KL8S 4XWTA 5BVGB 3K92A 1KYTA 2UXBB 4IUDS 3GDWA 2BM9A 3MC1A 4E5VA 1N2JA 4RDIA 1IBRA 4ESHA 1KMQA 1DG3A 4N41A 3D7KA 1Y4UA 4PQRA 1AZTA 1I4OA 5EKSA 3UB3A 2HZBA 1XU4A 1JZTA 4R4JA 3AZQA 4ZV9A 3O94A 1YZYA 5TDHA 5EJ5A 1IJKA 1XZJA 3IVMA 4HZGA 1FP4B 4ON9A 2G5TA 3NBFA 4D3FA 4CTJA 4ZMBA 1Y3AA 2ZZKA 3F5MA 2V9PA 1N92A 3VNRA 1NBMA 3R0VA 1ZOSA 1VCHA 3GEDA 3NVAA 1T6ZA 3TLBA 2MHCA 3RSGA 4L4SA 3TCNA 3IYLW 4J29A 4U7TB 5TPWB 1LPSA 2JGLA 1YD7A 3U5ZB 1UODA 1E69A 1UP7A 1PJZA 4EA8A 2GN9A 1W47A 3PQ8A 4LC0A 4TZ0A 3VPDA 3O4VA 3HLKA 3EZLA 3B6MA 4Y2HA 4JWTA 3GLHB 3C3WA 1Y4AE 4LYGA 1K3UB 4C0AC 3V4RA 1WD5A 4GOXA 2IHNA 5COQA 1SUWA 4RTKA 1OIVA 1QZXA 2CHFA 5GQSA 3U5TA 3WP0A 4HT3B 5I7EA 4ND7A 3JYPA 1RC1A 3R3WA 4TKUB 2VDLB 1US8A 2YJ5A 4PTZA 2HYDA 3W3AH 3WSTA 5C35A 4EW6A 3GL9A 4MWOA 4YV7A 1M7GA 4DRYA 3H8SA 3A05A 5FQNA 4WN9B 2CSXA 1KGDA 4YP5A 2WYUA 3EISA 4ISBA 4X1IB 4NAHA 3KX2A 2I7DA 4MRAA 1Y5MA 2I6SA 3H4IA 3QGMA 3WRXA 1R6DA 1RTKA 1NJSA 4NV1A 5AVOA 1IXKA 4BEBA 3VZDA 1SURA 2VJBA 4KCGA 4NYMR 4Z1OA 4M7WA 4C2UA 3CR3C 2V0NA 5B55A 2C5GA 5BMOA 1GTMA 1H6CA 2X6RA 4JC8A 3STTA 1Z6GA 4FB4A 1PR4A 1XU7A 1NIJA 3MCAA 4K6KA 4EBBA 5HUQA 2CNDA 5JUWA 3JQAB 4R1SA 3U3DA 3ORYA 4GGPA 2EJVA 3U6KA 2PMWB 1YMVA 2WJVA 1BH6A 1ZUHA 3SJBA 4B3MB 2VP4A 1KEZA 4KBGA 1KS2A 1E6EA 5JNTA 1HNZB 5JAQA 2QW8A 1SHUX 1N9GB 4JMPA 2ETVA 4MRMA 5J2UA 1ZJYA 1W44A 3O2NA 2BGLA 2QTZA 4QELA 1L7MA 1SKBA 4O8CA 2C8JA 2OAQ1 5JTTA 1CHNA 2ZI7A 3TBHA 4TV9A 3LA8A 4GQAA 1P1JA 2XCRB 2A5JA 1MDBA 2XTMA 3JQAD 2R6CA 3NPMA 4UZEA 1H2HA 2IZ0A 5AHWA 1IY1A 4M1YA 4ZO8A 5LOVF 1BDJA 1YJXA 2PWZA 4PGAA 1L7AA 5C4GB 4KGDA 5MFZA 4AJPA 4BX3A 4QDKA 2FG6C 2Q6IA 1A9YA 1NSTA 4Z9YA 1GZDA 2J07A 1T9CA 4DIUA 3JQFA 1WXFA 3HNRA 1QV7A 4NAUA 1JHQA 4EHNA 1KTIA 1PZXA 4JLJA 4N0MA 1T36A 4LHYA 3JU3A 3FTFA 1U0SY 1KFJB 2DKOA 2IEYA 3GAMA 1BRTA 2Q0QA 4DR5B 1R3UA 2GPYA 1XHFA 3CM0A 4PGMA 2KPOA 2VPIA 3MF4A 1ZINA 4GMGA 2EYUA 1KA9H 2OFWA 4R69A 5CX1B 2VAPA 3TLMA 3ZOZA 1BO6A 3R09A 2BE7A 4NX2A 1MH1A 4XVQA 1Z5NA 1IUNA 1DUIA 1MQ9A 3ANNA 2ZJYA 3ESRA 2W83A 5BR7A 3PQ5A 3H65A 1E9VA 2DRIA 3HR8A 4JBGA 4L8WB 3OIDA 5AVSA 1NUSA 2P4UA 2X8JA 3G6KA 2VI5A 4CM1A 4E30A 2GVNA 4L4XA 1P1KA 3IQIX 4XB6B 5AUPB 5LCXA 3G2JA 2ONZA 5GJCA 4GU5A 4W5HA 2ZB3A 3EG5A 3TTTA 3UJHA 1NQOA 1W6UA 2WAOA 4HWKA 4LY3A 3NW9A 1JIIA 1NM5A 3F7MA 1G3RA 4FILA 5AWFC 5G3ZA 3Q3VA 3EGXB 4QUAA 3AFGA 4WOKA 2JKZA 2BVNA 4J07A 2PUWA 2QUKA 1Y3IA 1ESEA 3K2IA 4FD3A 3OX2A 5LR6A 3SAJA 1PBNA 3CISA 3ZU6A 3GEEA 5IVIA 3RUFA 3H4TA 4H0FA 1Z2NX 2VLIA 3WOHA 2BYTA 1QO7A 2D7CA 2ZPUA 3DGFC 4UXJA 3VR3A 3LDHA 4B6QA 1R8QA 3PR1A 2ANCA 3ZK9A 3G8YA 4C6SA 4Q3BA 2G5GX 2Z1DA 4IDCA 3IAUA 2G0NA 1A82A 3U7JA 4BP3A 4RVDA 2KQUA 2ZBEA 2XRFA 3IB6A 1YZFA 3UA3A 4OKSA 2JKYA 5LYJB 3CUSA 1FTYA 1RFGE 4QXRA 4YLYA 3GT7A 2ZVPX 2OKGA 4C7OB 3RT9A 3LRXA 4U3JA 1RP7A 1X13A 5E95A 3PNMA 3SC3A 3OD1A 4F9FA 2A0UA 3X3HA 2PGOA 2BFCB 2XBUA 5LQNA 2IHYA 3LQ4A 4KBFA 1Y4DE 2WJGA 1ODTC 4QOSA 1GTRA 3PGVA 1NU6A 2OV6A 3G5UA 1LBHA 1N6PA 2A9KA 3ILVA 1LDNA 3KPYA 1U9JA 1GG5A 1UT5A 3PE4A 4GF5A 2VT7A 4D9HA 1ZRHA 2XUJA 2YIVX 2DHCA 3EBLA 3RANA 3WSVA 1I7DA 2R2AA 3FYUB 2BKLA 4FCWA 4US1R 4G1EB 4WJZA 5MGBA 2FUG6 4EO7A 1XYGA 4B75A 1OD6A 2H1CA 2ZIAA 3AXSA 1R0BA 4W9NC 5AIAA 4D79A 3WMEA 3PDIA 4J7XA 1FQKA 5DK6A 3R9WA 1L7PA 3T9BA 4QPPA 4UM5A 1G5FA 1WQ1R 4MA5A 4ZQIA 1QKIA 2A0XA 2DUWA 2YZKA 2UU9B 5FOSA 3AH8A 3UF0A 1HG1A 3DDSA 1JU4A 2WD7A 3LPDA 1GZSA 4TL9A 5K3EA 1QGDA 3AEQA 3VPGA 5AI8A 5BWBA 2IS1A 3EHDA 2YNMC 2W2TA 1T2EA 5E3HA 4DC9A 4DG8A 4RQAA 1KU6A 1LVHA 3Q3JB 5T4HA 1MIOB 5L6MB 2P0AA 3GJ8A 1FQJA 4BO4A 1SCDA 4H1HA 1YV9A 5EXTA 1S4QA 1DIHA 4UUOA 1HEIA 1MP0A 1Z2OX 3B8HA 1C3LA 4BRSA 3UHOA 2VNSA 2H54A 3ZTWA 3LKDA 2B5OA 2Z2JA 3HYLA 3IJ5A 3FUUA 3ME5A 2GR9A 1GU7A 3OIGA 4K8OA 4D0NA 1OLUA 1INLA 5CVTA 1D2AA 1X92A 1EFRD 2BGKA 4BCDA 2VAVA 3I9LA 2HJSA 1T5DX 5A7GA 5DT2A 1P0MA 2E4UA 1T4CB 4EF4A 3EOZA 5MF6A 3ACCA 4H16A 2AFIB 4HGOA 2JFOA 4FDAA 3K0FB 1G7CA 3Q5DA 2FF5A 4BE7B 2B6HA 3QX9A 3D6HA 5A6SA 4KAFA 4PZZA 1HSZA 1ESCA 2L19A 4PC1A 1TC1A 4PQGA 3GNQA 3CRW1 1SKYB 2E37A 2PYDA 2X0IA 2RHTA 2Y1LA 1BXKA 1VIVA 4X45A 3R7SA 2Q3CA 5BV1A 3HUDA 4C5AA 2YJGA 4F9EA 2JH8A 1Z9BA 2RHJA 1U2QA 2DECA 3CX3A 2X14A 2Q4OA 3MRTA 5IHPA 3D0RA 1TLFA 3IQGX 4BMPB 4TLLB 2P1RA 5BYAA 2IKSA 4R9RA 4ZVSA 1DUVG 5B2EA 2O2SA 3DOUA 2ONYA 3DO6A 3ICCA 3L46A 3RYHB 3TN7A 2PUBA 2VSQA 2QY9A 3CX7A 2W71A 4XIFA 4IQFA 1H8ED 3HEAA 4O4IB 3RIMA 1AXRA 4FKZA 2ZXEA 5JQGA 1YOVA 1Z17A 2WU0A 1GOTA 3GARA 3OZCA 2I62A 3KOYA 1DEHA 1HXHA 2JARA 3QVMA 2OGZA 1X15A 1LB1B 1JHAA 4QL3A 1DP4A 3BXEA 1SJ9A 2XXJA 3JATA 4F0JA 4BLPA 3C74A 3QG5A 3RVPA 2B9EA 2HNKA 1ULHA 4KXLA 1MHPA 2FEKA 4TTJA 3WMFA 5BR4A 4CKWA 1EX6A 3DT6A 5JFTA 1H66A 3OVMA 4CKXA 1RJDA 1S2DA 2DWCA 2L69A 3KJNA 3R3YA 3AF1A 1CTQA 3KZ1E 2ASVA 2CJWB 4NBWA 3WLPA 2C04A 2C3PA 2F8MA 2J1LA 3EZ2A 4GXNA 3BTSA 3EZ9A 3V2GA 1I94B 5I9SA 3OHMA 1BEEA 2Q1XA 5BV0A 5C5IA 4OCZA 3JR7A 1J4AA 2VBIA 3VR0A 2XXAA 3GEIA 1QRRA 1NMSA 1OX4A 2GNOA 4DBZA 2BEWB 2NZVG 4A6PA 1L5YA 3AI3A 1R9NA 1JKIA 2YBDA 3BMCA 5LDHA 1Z38A 5JRZA 4KR2A 5DBIA 4XDYA 1GPMA 2PCLA 4NBRA 4Q9HA 3WWDA 3I6QA 4B4WA 2R48A 4ZVKA 3HG7A 2J0UA 1TYAE 4KVGA 2B3TA 2FW0A 3K1ZA 2B6NA 1XD2A 3X1YA 1HRKA 4R2JA 4BAGA 1MJGM 3GRCA 1MAHA 5DKFA 5H5JA 5FB3A 3ZVMA 2GKSA 1N3BA 2XQKA 4JKIA 4M53A 5HTKA 2F90A 3NTLA 3TLYA 5IJ0A 2COKA 4K1XA 1ZIYA 4EUEA 2JI8A 1GG9A 4G23A 2CNKA 3DFUA 3MAGA 3TOVA 1C2YA 3WL7A 1S8FA 4R1PA 1SU7A 3TKAA 1XBTA 1FSFA 3ENQA 2HJVA 4F9TA 3MLEA 3IXLA 2BL4A 4E09A 1AE1A 1C9DB 1P2BA 4HKTA 1JR3E 1I4EB 1R64A 3OT1B 2QTHA 3MWJA 4N3BA 4QJ4A 3A1TA 5GP1A 4B33A 1F0YA 1E3WA 1QP7A 2VWPA 2QT9A 3LPAA 1RMTA 1OBCA 3PD0A 4URHA 1Y9DA 3R7FA 5KJ6A 1TQHA 4ZVLA 2P3SA 1F5SA 1RZ3A 3G0OA 4B84A 4DY4A 2C2BA 5AM5A 2P4EA 1ZD3A 3LBAA 3N8IA 4MV9A 1IATA 1NXSA 1HFKA 1UJ2A 4X1OA 3W90A 3ZLUA 2HSJA 5AJXA 4WJKB 1Z83A 3K20A 2QL7A 2XE6A 4ZT4A 4M54A 3B13B 1D04A 1CUJA 3I5MA 3L7MA 3Q2KA 4IRMA 1MT0A 3KSBC 5I7SA 3WAJA 1XALA 5B58C 1XK6A 4Q9NA 3I9MA 2ZWOA 3TLAA 3P2OA 1BVRA 4EHAA 4ZGBA 1UZLA 1QFZA 5KX5F 4HEJA 1KRXA 4WY2A 4DCOA 1JG4A 4LNUB 4CLHA 2IXEA 1KJWA 2QRUA 3BTUA 1DAKA 3BT7A 2Y0PA 1O4VA 2KWIA 4NCNA 3Q7PA 4AS3A 4I4LA 4OJKA 3DH0A 4KHZA 2X5JO 4WBNA 3GGGA 3MVEA 2HMTA 4LYFA 3MSXA 4QUDA 2XTNA 2M98A 4NYIR 4X61A 4EJSC 5C8DA 3X1JA 2VJCA 4JEIA 4PLZA 5DEOA 3RIGA 1KY2A 2JJYA 4RV9A 1TQ8A 2G82A 2DPLA 3FJ1A 3O4RA 2JCYA 3OJ0A 4WD3A 2XB2A 4LC1A 5IT4A 2FV8A 4IKOA 5EHIA 5JDIC 4XUDA 1TK3A 2V7UA 2H4FA 3ZZNA 3GJYA 2RI0A 2QPOA 3L79A 3NR2A 4IBOA 2NAFA 1LPAB 4R01A 4J0JA 3VXKA 1ZD1A 4RHXA 3JQBC 2XWBF 4PX3A 5EKDA 3A0UA 1WOYA 5KTYA 2FX5A 4YRFA 4G4SO 4JP8A 1VMEA 2BFBB 2P69A 1K88A 3PFKA 2VK2A 1SBNE 3PPXA 4OA8A 3WL4A 1HNNA 1XZEA 1KO8A 4YP6A 1XXHB 1U65A 4ND8A 3OCJA 1SQGA 1BQ4A 1EDZA 2IV3A 3UB4A 5C2JB 1N7IA 2RBGA 3EXEA 3V80A 5HK9A 2IUEA 3CSUA 2D2VA 5KC8A 2OAGA 3VO8A 4D6YA 5JAUA 2NZ8A 4XYBA 2C96A 4ND4A 3VX4A 3BMOA 2J4DA 1DQYA 3LU1A 2XWQA 1IQUA 3GLKA 2G07A 3GRYA 4AURA 4B8YA 2XE8A 2ZQZA 3PQFA 1FXUA 4FDTA 4AZWA 4B0PA 4YV0A 1F8YA 1WCYA 1YQTA 4RY0A 3VOTA 2O8DA 4HGZA 3R5XA 4EZBA 5LQJA 2BTQA 3OJXA 4TYPA 4DGSA 3PUIA 3VA7A 3EXIA 1NJ5A 1T9DA 2PX2A 2Z4TA 3FBWA 1C41A 3GDOA 4INOA 2H65A 5D5HA 2B2XA 3B9RA 4UEQA 3ELWA 4JI6B 2DLNA 1CLUA 1JQKA 4O3MA 1U1GA 2EZ9A 3DVLA 3RFTA 1MXHA 2D0PB 1CB7A 4NBLA 2ORED 3C7DB 2B69A 2KHZA 1VJDA 2BGJA 4BNMA 4EATA 3BEDA 2WG2A 1W5BA 3ITEA 4AAYA 4DIFA 1EFKA 2PLFA 3THXB 5CUQA 4L2IB 1N2ZA 2C97A 3PGJA 3Q3EA 1CF2O 3M4ZA 3WKEA 1PNVA 2W93A 2G1UA 5M34A 2XYVA 4BMCA 1EXNA 2J3JA 1Q16A 1PJRA 1QIHA 3FSEA 4E46A 2QMUA 1NY5A 3A7DA 3VR4D 2H92A 4YRRA 4IXMA 4OKIA 1RCTE 4DS3A 2YFQA 3ZGZA 5AOCA 1RRVA 2J5XA 3RUPA 4B6SA 4ZMRA 5FBRB 4OJNA 5FCDA 3MRSA 4Q1AA 4C0QC 1D2RA 1Z4QA 3AUSA 4IL5A 1VMKA 3GXBA 3SHVA 4RM2A 3C3YA 2B4AA 3QFFA 4JA0A 3K0BA 2XCSB 2IPMA 4K9NA 1V96A 1RAFA 2A0YA 3OCVA 3ZBPA 1H94A 4E12A 3W2TA 1FNBA 1Y5NA 4KODA 3MBKA 3OOEA 4ETIA 5JATA 3OQJA 1GEGA 3BE5A 3JX9A 4P35A 2N1MA 2UYOA 4JI5B 4AF8A 1DDOA 2R8EA 2ZSKA 3ECAA 1DADA 3O4FA 4FDLA 1H5NA 4MW2A 5ALDA 1D2EA 4U5QA 3UUWA 3ZV3A 4LJLA 1SVWA 3P97A 4HZUB 2ZSUA 4PNEA 1N3YA 5KTPA 1D0SA 1RBQA 4TVKA 3GRKA 2YMPA 1E59A 2VPQA 4N18A 4B9AA 3C4VA 3H3JA 1MZVA 1P17A 3ROQA 4UU0A 3BWYA 3HH8A 2QMOA 5EMNA 1UBHS 2NUTB 4IF4A 1F1BA 3FGZA 3TR5A 1ZOLA 2HCTA 4RZXA 4EECA 2FMTA 3H7AA 4J94A 5LOVA 4IW3B 5DISB 2GBLC 3G1WA 4AS2A 1IH8A 4JQOA 2LBPA 3H04A 4W9NA 2Y05A 2HQSA 3TRFA 4FC7A 2I4MA 4BV2A 2AG5A 2ATCA 1QNFA 3HBNA 1V11A 5HGJA 4O02B 4D3ZA 1GUZA 3KP1A 4F2HA 4YPVA 5F7OA 4HGPA 5HOQA 4LF7B 1Q0TA 3M5PA 1GFWA 2QDXA 2JASA 2P91A 2WVHA 3KR9A 3GPBA 4IIVA 1MEJA 2W6JA 5FULA 4ZCTA 2IZ1A 4UTVA 1FSZA 3JVUA 2YNMA 1P4RA 2CJXA 3VAAA 3TF5A 2I3GA 1JW9B 2ZKIA 3N6VA 3FR8A 1XEWX 3V2UA 1WB6A 1IEWA 4DR6B 4Z7JA 4G01B 4CF7A 4L9WA 4P93A 2WT4A 4HLCA 3MQ2A 2ZSIA 3VR2A 4B6PA 3E58A 4MS1A 3A3YA 1UWVA 1VP9A 2ST1A 1HQKA 2R8XA 4YMIA 1L5GB 3S2IA 1JDPA 3RV4A 1UMBB 5D3MB 4ZICA 2A9VA 3ZR4B 5LYJF 4QFDA 2Q49A 4MMXB 2F48A 4MPTA 1J25A 5AICA 3WI7A 4B9EA 1GP2A 3HRHA 4DLSA 4AMYA 2KYRA 3H11B 3H2SA 2G4VA 4DR4B 1N6OA 3PJFA 3QZUA 3A36A 1TM2A 3HU2A 1QYIA 4RHFA 2Z6VA 4ZAFA 4IIGA 3IQDB 5L45A 1O9GA 1LDYA 2I6XA 1BWRA 4AF7A 2W42A 1P1HA 5JMPA 4H6VA 1ZU4A 2R3SA 1RVV1 1UFOA 4L7VA 1A7UA 3JTEA 1VC2A 4JSTA 2FE1A 4EKYA 2EQ5A 3CLRD 2J7PD 1PR6A 3ANLA 3GH1A 4JL6A 3T7CA 3U26A 2GLUA 2JLBA 3ZH9B 1NVTA 3CN7A 1E3MA 3ZOKA 2GD1O 5E0OA 4YROA 1V1MB 3D3WA 1A9OA 1OYVA 1LD3A 1PKXA 1WP4A 3VPXA 4OK5A 1E18A 1NN0A 3V1KA 2ICAA 2QL5A 4HRAA 5J3JA 1Q91A 4PCLA 3BFKA 2IX3A 2GRJA 5TMEA 3RRFA 2OHIA 4EA7A 5I9NA 2YXEA 4NG4A 4E0BA 1ZSYA 1ZP6A 3LBFA 3A25A 4AJ4A 2ZJ1A 4E1BA 4QVIA 3VPSA 3ZXXA 3G7SA 1XQ9A 5H59A 2O9JA 4EDHA 4RKWA 3DDZX 2XUFA 1TOAA 3O3OB 2FW8A 4PF1A 5DSTA 4F86A 4HQFA 3GIDA 4PC7A 2X4DA 4BEVA 3SVLA 2EDCA 1XDBA 2IL1A 1JU3A 1U3CA 3ZDFA 2ZUUA 3BSYA 1MABA 2E4XA 1DWQA 1XZIA 3OZTA 3A9WA 2NVBA 2UUOA 2H17A 4RK7A 4ZJZA 3DNMA 3RTDA 4RQTA 1TIPA 2FW9A 3RHFA 1T3HA 1Y82A 5B2FA 3DLPX 1OXKB 2NYUA 3C8ZA 3CUTA 5HZHA 1AOXA 1HFEL 1NWCA 4U2FA 3N2GB 5BT8A 4PWZA 1KRWA 4ZO4A 3QWIA 3AUKA 5LM3A 2YVQA 4ZOBA 4FC6A 5SZIA 3OCCA 4KE7A 1W96A 1ZY2A 1H42A 2XVAA 4JVNA 5EINA 2QYOA 2Z4SA 3SFZA 3WQHA 4AULA 4L7QA 5A4KA 2HMYB 1EFDN 4JXZA 2BI4A 1XKTA 2JBWA 3R3XA 2CFOA 3GGDA 1P4GA 1DI0A 4G5HA 4X8OA 4NIMA 1EVZA 5AJUA 4C0JA 1BJRE 1R0RE 2FFHA 3L1VA 5EE3A 1QGOA 4GSYA 3BZUA 2XRYA 2XB4A 2YTZA 5DCYA 3HN7A 1L5MA 1P74A 3NBUA 4GMFA 3PNKA 3OO1A 2YIJA 4C7MA 3B89A 4O4IF 3BDAA 3E9ZA 2DBVO 2ECOA 1P73A 2QPAA 3Q11A 2ACVA 2NVOA 4MV0A 2OAP1 1CJBA 1YE3A 2JIZA 2C4WA 3E6AA 3GJ6A 3BIJA 3OT4A 4NONA 1OHHA 3TAUA 3VR5H 1OT5A 4CR6A 1A4UA 3I04A 3RC2A 3EDCA 1DG1G 5F5XA 2D5BA 3FAZA 4FLMA 2RAVA 2ADOA 1T35A 3OX1A 4DQUA 1OLSB 3P0JA 1H8HD 5FJJA 5FYDA 1RQXA 4FN4A 4KFTA 2J08A 4QGFA 5T4EA 5ELXA 3ZZ1A 5CTAA 5ALNA 2IOFA 2PSFA 5EQTA 2V7GA 3NKVA 1DKQA 1AMNA 5IYZB 2DQZA 2NYVA 4PYMA 4KN8A 4YMGA 2Y77A 3EZXA 3O73A 4CQLB 3FYUC 1ZICA 4QREA 4UTXA 1TQ4A 2E1RA 1QVZA 3FKJA 3LPMA 5DLQC 2H2DA 5FWNA 2R0QC 3AV0B 3DOCA 1XKXA 5H1YA 1T1JA 4B87A 1GGFA 2Q9BA 3NDBB 2NSJA 1QVVA 5T57A 1PWYE 2XOKD 5JDCC 5KYYA 3JSAA 4D26A 4Q3NA 2OC9A 2ZE7A 1OZGA 1WB4A 1NAIA 1XAJA 2O2HA 2IF0A 3A4YA 3FNFA 4O6VA 3WJ1A 3W6UA 1D1QA 1GZVA 2BD0A 3HY6A 3IOEA 4FBGA 4OQZA 3CF4G 5DN9A 3WZLA 4EJSA 2V3CC 4HC4A 3PKIA 3GJ5A 1HWYA 2EATA 1HC7A 3OF3A 1XA3A 2DPGA 3PU6A 4HWPA 5B53A 1HQDA 4YCDA 1GPNA 2QQGA 2G9RA 1CQIB 4FXOA 5JHHB 5JDIA 3B85A 1YFJA 1Y7LA 3E9DA 3ND8A 3ORRA 1QP0A 1ADJA 2GLXA 1GY8A 5CLGA 2YXLA 1U7PA 2H6EA 3H3FA 2CGEA 2VP5A 2RSLA 3EPPA 4RESA 1AB5A 1WHTB 4FW8A 2QRVB 3GBSA 3WMGA 1PWEA 5IAAA 3WGJA 1KYVA 4FFNA 1NSFA 4HOYA 1EFUA 1WJGA 3F6YA 4KEAA 1MBZA 2CMDA 5JAZA 4X62B 1MQSA 1QKKA 5JPDA 4DIKA 3RIXA 1O6FA 3MZ0A 1RXWA 4MWDA 5P8WA 1WCXA 2BBSA 2CKMA 2X8WA 4GVLA 4A0SA 4Z0NA 5K0CA 2PJRA 2ZG6A 2A86A 4NDNE 4D80A 4EKNB 3IMCA 3CCCA 1HURA 3D0QA 4WK6A 3N2LA 2J3LA 2CUKA 4IR7A 1CK4A 1I7LA 1NMZA 3RBXA 2CLFB 4AY2A 1TYCA 2PS3A 4WXHA 5IT9A 1X1TA 1C14A 3NATA 3O26A 2WQZA 3U6BA 3E7WA 1GLGA 3ANTA 2DKFA 2Y8EA 4IDGA 4KO3S 3GFVA 4Y6LA 5FPPA 3RAEC 1C1XA 1PQUA 1DAFA 1UEJA 2BKAA 3EFHA 4HNGA 5K6RA 3MWYW 2IU0A 3ROMA 1PO7A 1NMXA 2R1VA 3A9UA 4Q9AA 1F51E 1ZZEA 5JBNA 4I6EA 2BDTA 3QVUA 1FS5A 3URMA 2Q29A 4XSVA 2XVMA 2QZ9A 1BHJA 1WG8A 3RSFA 5JCJA 1ZOIA 2NUAB 2JJ1D 1WKCA 3F0TA 3HWSA 4GR5A 2WUGA 3DL7A 2NPFA 4EZIA 1CQXA 2D3WA 3T7KA 1IN6A 3WYEA 1YNOA 4J1QA 3IULA 3NV7A 5CCDA 1OASA 1KVUA 2X0NA 1SPXA 2OCKA 2QNBA 2XNJA 2Q6OA 2WA2A 1KEEA 1IE3A 1VHQA 4KQKA 1W0JD 3DCNA 4A0HA 4YRKA 1XTKA 3P8ZA 4ZYLA 1CUHA 2FPOA 2OHFA 4Q37A 4G1BA 1XCOA 1YH3A 4J43A 3QITA 3L6CA 3N3AC 1TVMA 4JHXA 2Y6UA 1CIJA 1KK2A 1ISPA 2XLBA 1UFRA 1I0IA 3QYFA 1U2TA 4HLNA 5A0FA 4BVKA 2Q0HA 4IJUA 3IVXA 3QVWA 5DYIA 4EKDA 2HTFA 5AVJA 1A9QA 1B42A 4H7JA 1PFWA 421PA 4HQRA 4N48A 1TCAA 5LBUA 3RVJA 2GPTA 3DKPA 4HVAA 4PO3X 1FP4A 4BBJA 3MMPA 3ACBA 1CJVC 5AW4A 2HN9A 2OV2A 3CLUD 1Q92A 1XDGA 3D2LA 1R12A 3C8DA 4KQ2A 1DB3A 1UBOS 2OFFA 3TUJC 3G17A 4JA2A 2GM3A 3MTEA 1XPOA 2V45A 4TOIA 4P2GA 4G63A 4UVHA 1KIFA 1U5CA 2OV4A