4D8WA

Salmonella typhimurium d-cysteine desulfhydrase soaked with d-cys shows pyruvate bound 4 a away from active site
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-Cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 120
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8wA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8wA02
2BHSA 4OFXA 5JJCA 5KINB 3BM5A 4ZU6X 4D9NA 4D9BA 3VBEA 2GN1A 1KFJB 1C8VB 5CGQB 5D87A 5DW3A 4D8UA 2TYSB 2RH9B 4LMAA 1J0BA 1C29B 2J9XB 1KFEB 2EGUA 2CLKB 2J9ZB 1A5AB 3DKIA 3HMKA 5DBHX 3RR2A 1K7EB 1CW2B 1VB3A 5I7RA 5I7WA 1J0EA 4D8TA 1Z7WA 1VE1A 1X1QA 3IQHX 1WBJB 4L0DA 4WX2B 1TTQB 1WDWB 5IWCA 2ISQA 5E0KB 2O2EA 4D97A 3FCAA 3PC2A 1P5JA 2BHTA 1TTPB 2DH5A 2ZSJA 1K7XB 2GN2A 4PCUA 2CLMB 4D96A 4ZU1X 5EY5B 4KKXB 1WTCA 4L28A 2ECOA 1KFBB 4HN4B 3VSAA 5J5VA 5J43A 2ZR8A 5CVCA 2V03A 4QYSA 1UIMA 5JISA 2CLIB 2CLHB 2ECQA 3PC4A 1TZJA 1J0CA 3DWGA 4D9KA 3VSCA 3VSDA 4D8WA 3TBHA 5I7OA 2PQMA 1TDJA 1WKVA 2WSYB 5B1IA 5T6MA 5B1HA 1RQXA 5B3AA 1V8ZA 1J0AA 5IW8A 1JBQA 1J0DA 1BEUB 5B53A 1TJPB 4LMBA 3ZEIA 2Q3CA 2ZPUA 1E5XA 3FGPA 3R0XA 1D6SA 4H27A 3SS9X 1V71A 3SS7X 1K8ZB 4AECA 3AEXA 5HBGA 2Q3BA 4COOA 1OASA 3L6CA 4D9MA 2C2BA 4OREX 2D1FA 4D9GA 1F2DA 5I7HA 2Q3DA 1M54A 1O58A 5DBEX 1Y7LA 2JC3A 3IAUA 1QOQB 2DH6A 1A5BB 4L27A 4D9FA 1UBSB 2J9YB 1A50B 1TZKA 3R0ZA 3PC3A 5C3UA 3SPXA 4D92A 1FUYB 1CX9B 1TZ2A 1K8YB 1FCJA 3X44A 3T4PA 5B55A 1PWHA 3PR2B 5D86A 3X43A 3CEPB 5BW6B 1K3UB 2CLOB 2C2GA 5DW0A 1KL7A 4AIRA 2O2JA 4LI3X 4D9IA 4D9EA 4F4FA 1BKSB 2CLEB 4ZQCB 4I1YA 4NEGA 2GN0A 3IQGX 4HO1X 3L6RA 3L6BA 1A5SB 1UINA 3DWIA 4L3VA 2RKBA 4XUGB 1K7FB 3IQIX 2TSYB 4JBLA 3AEYA 1VE5A 4IL5A 5B36A 4HPXB 2CLFB 1PWEA 4Y6GB 2EFYA 2RHGB 5I7AA 1Z7YA 5I6DA 1KFCB 1TYZA 4HT3B 1KFKB 5DVZA 3V7NA 4D99A 5IXJA 5KZMB 2TRSB 5D84A 5D85A 2CLLB 4NU8X 1TZMA 4JBNA 1K8XB 4D9CA 4HPJB 1QOPB 3VC3A 1V7CA 1C9DB
chains in the Genus database with same CATH superfamily
1ESEA 2WIDA 4QKQA 1H3FA 4FZVA 3I9JA 2C7GA 1VQ1A 3S3TA 1KTIA 1KFJB 1JG1A 2JGLA 1HURA 4LDRA 1DC4A 3UCEA 5LJLA 1O6BA 4QBFA 3LOPA 1ZVJA 1MNAA 4MH0R 1J6UA 3EVCA 1ZK2A 4O4IA 3ZBQA 3WYBA 3GA5A 1L7MA 2GBIA 4LX0A 2QVCA 2AK3A 4R2LA 1LXCA 2JFBA 2EW2A 1ZN9A 2E4VA 3P9QA 4MYHA 3D6FA 5B1SA 4PO8A 3UTCA 3UXEA 3W05A 4B85A 2PE5A 1I2CA 3LWDA 3VPSA 2NAPA 4ZQEA 1FOEB 3HSKA 1ND5A 3KZXA 2ZJ5A 3NS7A 3VPHA 3X0DA 4DCTA 5C5EA 3P9SA 1JQEA 2OV6A 5HCUA 4A36A 2BKVA 2F9FA 2OOKA 3A7DA 3HYCA 1T24A 1VLJA 3OP4A 3G6WA 2XOKA 3KKOA 2P5TB 2IPNA 2LE0A 1DAFA 3HKEA 4RWEA 4TT3A 3W1VA 1WNTA 2Q1SA 5JSQA 5JZOA 2HMUA 4PTZA 3A6FA 3J81k 1ZIXA 3PJEA 4PSVA 4LRXA 3VSCA 5DNWA 3RVNA 1IC6A 3CEAA 2QR2A 4ZAFA 4UCFA 3IRVA 5FPTA 2I9KA 5B1IA 4KIGA 2CXUA 2OSBA 5EPEA 2OCXA 3K6KA 4YRRA 2W6JA 2F1HA 3GAZA 3PXBA 4ZEOA 3C43A 1NLMA 3C5VA 1JR3D 3GROA 2WIBA 4GXRA 3JQAA 2QQFA 3DAFA 4R2HA 2JLUA 1SCKA 2JAXA 2Q4BA 3L6CA 1DIBA 3QVVA 4BXOA 4XLZA 1L4FA 1WF6A 2HDOA 1PT8A 2GD1O 3B6EA 2FVYA 1CEEA 1CIVA 2G88A 1ZG3A 2HF9A 5BW5A 3QHAA 4YMIA 2MYPA 3OFSA 3DE6X 3L0BA 4WECA 4TKVB 2WWFA 3NM5A 2D2VA 4E2XA 2B8NA 3GGJA 4KK3A 4C0BA 5KVCA 4XWOA 2DT5A 3CH7A 4Y8VA 4HWOA 3UV7A 5BPFA 3WIOA 5KYKA 4Y6PA 3IL2A 4JSRA 1N7HA 1P8JA 4MGYR 9MHTA 3G8BA 3H3JA 1RXYA 1ZCAA 4OAPA 1N6KA 2AYYA 2NSHA 4BX2A 3K9NA 2H9YA 3CNLA 3WP0A 2BFOA 3BXHA 1GU1A 4FMCB 4WADA 3QZUA 1GNQA 4PQGA 3C8DA 1C9NA 4R8MA 2QX8A 2ZRIA 3DV0A 2WZCA 1Y3AA 3BYZA 4KQJA 2HX1A 4CG1A 1E2NA 1U28A 1YIDA 3HWWA 2VPXA 2VH1A 3KQPA 4B0OA 1T9GS 2EEPA 2GK3A 2ZITA 3S6JA 2E5LB 4TTAA 3PX3A 1TCVA 2LBPA 3OIFA 3VNBA 1LSSA 4GE0A 4Q9DA 2EF1A 2YXPX 5DB4A 1QV9A 3TMYA 4Q3OA 5CVTA 2I78A 1YJCA 4UHEA 1L4GA 3N3BC 3PHGA 3U4IA 4L5YA 4PGFA 4ZOAA 3OPYA 5GONA 1FNNA 4JL5A 5B7PA 5DVZA 2RBGA 1USUA 4NF2A 1ARZA 1HLFA 4XTRA 3DC7A 2C7PA 3DTVA 2NQTA 2R00C 3IVGA 2VSYA 5CA1A 4BO6A 1RZVA 2BWJA 5AHXA 5BYKA 4AUKA 4NU8X 4OG2A 4X84A 1QNLA 3EDYA 3UK7A 1BHJA 2J07A 3EXIA 3VC3A 3PI6A 3FZEA 3MJRA 5CX1B 4MHTA 3L8EA 4KPYA 2PSFA 3K4QA 1ZUD1 3GJQA 1VGQA 2FMUA 4JUBA 2HPAA 4II2A 1FVOA 2VP0A 1U7UA 2V7QD 4K2AA 3RAPR 3SVLA 4DLBA 5L45A 1JQAA 3D4NA 1FFGA 3KEMA 1ZISA 2WB4A 1RM0A 2R97A 5EHQA 1FX0B 3RYIA 1GGEA 5AVZA 4OK3A 4HNAB 5CUQA 4BEBA 1U7HA 1AE1A 1MD9A 2AGVA 3GCXA 5AQ1A 2AOUA 3IEMA 1KKLA 4O1IA 1Y1PA 1YCFA 1K6EA 2W93A 3PHLA 3ZQ4A 4AY4A 5EYPB 5LZ9A 4C30A 3EQ9A 2VO1A 1FMJA 4PO1A 4BAGA 3AEZA 4ZOLB 4UTNA 3DTYA 3BCHA 3PQFA 2C07A 3HU1A 5G1PA 1HDCA 5JEDA 4GAEA 4MQ6A 2WM9B 3OOYA 3NOQA 3I2YX 4ZI7A 4WNCA 5DSZA 1QRUA 3N0XA 1PZEA 4JI5B 3VO8A 1W47A 2JLRA 3IJ5A 1QONA 1DMSA 1MENA 1U98A 2ROQA 2WLSA 2ZU0C 1NFQA 3O0TA 4K05A 2CVHA 3SF8B 1YA4A 3A2KA 2J87A 2NYAA 5HK9A 2PJZA 3D2LA 4GH5A 1CZLA 5TC4A 3VTKA 4J43A 1EXDA 2CVOA 4YBZA 2ZAGA 1MX3A 3RC3A 1HQDA 3GI1A 5FTWA 4DSAA 4WZBE 4LC9A 4WZAE 2VT7A 2F62A 3OLZA 2VPYA 3BJEA 3LHKA 4NESA 1U2TA 4BX3A 4R9VA 1ZC3A 4EPWA 2KLHA 1BHO1 3JQFC 2R6DA 4CLOB 3PDIA 3HTXA 1BO6A 3COWA 3IKJA 2NYRA 4XJVA 5AKHA 1X38A 3AUFA 5BT8A 1DAOA 4JEUA 2AE2A 4B6EA 2ATVA 1T0IA 3DZHA 1JEQA 2IUFA 2XDYA 3MPOA 2FW6A 1P1RA 3HCBA 5BW4A 3TZLA 2GN6A 1VIYA 2YJZA 2JLWA 4G84A 1GNTA 3L8CA 4EGSA 2CNLA 3G2HA 2XPCA 3M6AA 4XE5A 1KAQA 3IQDB 2DKOA 2MR6A 4K88A 5TY0A 2JIPA 3A1SA 1ABFA 2NVOA 1Q3TA 2OLEA 3QY0A 5ERGB 1OX5A 1H8HD 2O2GA 4A03A 4CM9D 5AM5A 2DKNA 1I2MA 2MDTA 1ONOA 1NT4A 1R5BA 1JV2B 1ZINA 3V4RA 1YIOA 2H48A 1QIIA 4HUTA 4ARAA 2B30A 4G4SP 2HK8A 4CZ2A 1W48A 4NG5A 5JZBA 1ZI9A 3L8DA 5C46F 3MRTA 4O2RA 2ZYVX 1UBNA 3EZNA 2CF6A 3PDHA 1GQSA 3IP5A 1ZD4A 4JENA 2CMFA 2IUYA 3FFBA 1OI3A 1S8OA 4DIFA 3R76A 4J29A 5DNAA 3WX0A 1UBJS 4TWZA 4M4SA 1TRHA 4CCYA 1NSTA 1X74A 3CNHA 5KX5A 1Z7GA 5IYZA 5JV5A 2NP6A 3R5JA 4GXQA 1E59A 2OAEA 2PU5A 1V11B 3FOAA 4GECA 5AOCA 1TM1E 5BOVA 3RC2A 3RBVA 4A2WA 4OMFG 4E12A 1LK5A 3N9IA 1HETA 3NHKA 4DCGA 3MJFA 4H7KA 1L7PA 4ZOBA 2UUAB 5CYOA 4UTPA 1C29B 1PWYE 3WB2A 4P54A 2PYDA 3TGWA 4UEWA 2B7CA 4R2KA 4PYRA 2OV8A 3TKYA 2FWBA 3A9VA 1VBFA 4IO0A 1FF9A 4Y2HA 5C8YF 1XEXB 4QICA 2GF9A 2XW6A 3HBFA 2D1RA 3ONEA 4I6EA 4MPRA 2OK8A 4GMHA 4BWGA 2IS4A 3PCXA 3QKUA 2BHTA 4GPD1 4JCOA 2G9UA 1IPHA 2J32A 3QFHA 4BLSA 2BUCA 2VSNA 4W8OA 3OJCA 1PDWA 1RHQA 2YCLA 1W0KD 1X94A 5EY5B 3ZCPA 3ZGLA 1E1MA 3MERA 2YINC 4NZOA 4FNOA 2J0VA 5COAA 2H7CA 1NV9A 1RXEA 3FUVA 5C0OE 1WCYA 3RYCB 4ZAVA 2CYBA 1VRCA 4TYQA 2JFHA 2R8EA 4X8HA 5LYJA 4XRGA 1E3LA 2EX0A 4II7A 3SNKA 4K9QA 3WKEA 1SGWA 1WMFA 2P9GA 3MM4A 3OQNA 3ICQB 3HY6A 3LHSA 3U62A 4G5QA 2CF5A 2V7VA 4PVCA 2OEPA 4PX2A 5EJAA 5IARA 4CKCB 2C5LA 1Q0QA 2Q5CA 1NXVA 3AGQA 3QXSA 1V35A 2QPLA 3G0GA 3GEGA 4ZDWA 1OB5A 3PR1A 4CU5A 4PGGA 2TMKA 1V4VA 2W6CX 4MINA 3JAKA 1PW5A 5DHFA 2IHNA 1ZW6A 2AQIA 1ILWA 1D0VA 2CMGA 3MBOA 1TKAA 4Q02A 1VSQA 2JGIA 4FHEA 2OHOA 2WJVA 1A98A 4NSNA 4HX5A 2DYKA 4IDGA 4NZYA 5FB3A 4QJ3A 2NWQA 3NNDA 3IAUA 1D2EA 4RIHA 1JR3E 2R6AA 1LFDB 1HR0B 5IJ9A 2O5VA 4EY6A 4O0LA 3AOGA 5FLXA 2A5GA 2PY6A 2ZSEA 3DV9A 3WHLA 1M8GA 3I8OA 3CLVA 4LRUA 2YJNA 4WBNA 1BW9A 1HQCA 3K92A 4GRAA 3I76A 4GWLA 4BMCA 4EO7A 4FGUA 2WWHA 5DASA 2DKFA 5ALMA 5AW5A 2WLTA 4QPPA 1GXSB 2YTZA 4M9XA 1AHNA 4YXWA 3OT1A 5FLEX 3GJ4A 3T5MA 4HX9A 3VKUA 2NO9A 3SSNA 1X7WA 3AEQA 5DTMA 5FJJA 3IPXA 2Y77A 3DSRA 4X7RA 1AOXA 2H1RA 3LFTA 3O73A 3V7YA 3IKVA 1TD9A 2YUTA 4LZWA 3ZCQA 4CF4A 1NYLA 2QAGB 5CCEA 3AIIA 3T0GA 4Y3UA 2CNKA 3S81A 5FWYB 3A1UA 4JL6A 1SA0A 3NAGA 5H82A 2YHUA 3EH1A 2PQ2A 5TF0A 3QE0A 4QYMA 2QR5A 2BKLA 1FP4B 2NXEA 3KCNA 1Q19A 4ZVUA 4DLLA 5K8CA 1XD9A 2XUZA 3OX1A 1PQPA 4HZUA 3VQTA 1BQEA 5AKYA 1SU4A 4YQEA 2ZBRA 3AUYA 4DHEA 4N3CA 5HQJA 3SJUA 2REQA 2IQ5A 3U7EB 3IP1A 4FONA 5A9SB 2Y1LA 1HK7A 3V7WA 2RH9B 1J5EB 2Y99A 4OJKA 3K2BA 5J63A 1C4KA 1QGDA 4R1OA 4BBAA 3MXTA 5CLQA 1W4LA 1Z62A 1BOOA 2VJMB 2C8VA 5HJ7A 1OV6A 2Q2QA 3H9EO 5E9JA 3SVZA 1JN0A 4BGUA 3IBTA 2ZCUA 2HPHA 721PA 2UUBB 3HDHA 3IUBA 2OHGA 2JJ2A 2BMFA 2ZTSA 2XRFA 4Q4AB 4XD7D 4WINA 1D4AA 4BUJA 3COPA 2O8FB 1U2EA 1U0BB 2BFNA 1JFFA 3NPMA 5FO1A 2HWWA 1C1HA 3CLRD 4UFOA 3NLLA 2RGEA 3RJTA 1BTOA 4CT4B 4RJIA 1IBMB 4V0SA 2NADA 3LKBA 1Y1RA 4GXTA 3H1FA 2BFWA 2V6JA 1X3SA 2QZPA 3BIJA 4L8WB 1L5GB 1KS2A 5BNTA 1RQRA 5BSEA 3MT8A 2PEYA 3OEHD 4G41A 3TI9A 3AFNA 4Z1MA 1ZAKA 1SOAA 1SCAA 2JAQA 4MS3A 4URFA 4C6RA 5JBNA 4H6XA 1VGVA 3ENVA 4WN3A 4NEQA 4EHHA 3QMVA 4QBTA 3CONA 3SBXA 3U13A 4QYSA 3N28A 3HM9A 4EHKA 3AR5A 3K9FC 3WRYC 3E5NA 5HDQA 2Q7DA 3TB6A 1W4RA 4HRXA 4U7JA 3UKDA 1E7MA 4OD0A 4AFNA 5JJKA 2JBHA 1XKQA 3GW8A 4G0MA 3GCWA 3WMRA 4BLQA 1NQTA 1PL8A 1JH9A 2VT6A 4GZ3A 1NDUA 4NAVA 4ZO8A 1UWVA 2YJ4A 3NAQA 1TCUA 4M7WA 1NJFA 3RIMA 4NJEA 3ZWQA 4EHAA 2V7XA 3C7CB 2CVPA 2XTAA 3RRFA 4RGQA 4FP9A 4PLPA 4OAQA 2JNWA 3PNLA 2FFRA 5LQKA 4AF7A 1KYVA 3SDSA 1RWNA 2GVZC 1QG0A 2XUFA 4ESOA 5M3BA 5IJ9B 3OSZA 1R4MA 4NY1A 1WW3A 1G2OA 3DOEA 1EFRA 1YK0A 5FADA 1MJGA 3HCPA 2ZYHA 4IXWA 4J90A 1L1QA 4LW8A 4B34A 1KJ9A 1PBNA 3HFSA 3VYRB 1IZ0A 4EFNA 2PG3A 1TZKA 4Q9HA 2AJ8A 1FFHA 4FFSA 1KRHA 1PGQA 1KI7A 2BMDA 4K6MA 4U02A 3ONNA 3J81A 5K0NA 3EEOA 5L3VA 2BFBA 3HB1A 1GN8A 5EHGA 3SZMA 3DFKA 4WEQA 1WAMA 2D2EA 3A6LA 4X9XA 2GBLA 2V9CA 4KI7A 1FJGB 5I7UA 1RHRA 1XR3A 3DZIA 3MWKA 4K3VA 4Q05A 1Z22A 5DYIA 4US1R 1YR1A 1EXVA 1JZQA 3UHFA 3IEVA 4PLFA 3G17A 4KXWA 4D3YA 1USWA 4AJPA 2ZI4A 2YCBA 1EG7A 2B82A 4GNKA 1RYHA 1X13A 4OIMA 4ZIRB 1R9NA 3FI9A 4WXYB 3LWNA 1ZW1A 3FDZA 5EJFA 1B6TA 3OBBA 1EUCA 2VNHA 3MG9A 2Y9PB 4COKA 1ZX1A 4IDCA 1UXHA 1XV5A 2VLBA 1BH6A 3DP9A 1XXHA 2I6UA 4Y6QA 5JQWA 3R9WA 2VBFA 1JTVA 2C84A 4B6FA 1DSSG 3H8SA 4L0CA 4P36A 4QGGA 4D99A 5AH0A 3EFEA 3W8FA 1CSEE 2Q4EA 5DULA 4LOLA 5TS2A 2B1IA 1GYQA 4QDJA 2ZG6A 1VCOA 1PK7A 1S9HA 1OZAA 5T57A 1TEVA 1VI2A 1FP7A 2RHBA 3PFNA 2OB1A 3DLHA 2C59A 2TYSB 2CHUA 4D3DA 5FX2A 2IZZA 2DQYA 2ZWPA 5F33A 3Q7QA 3O9VA 2VHJA 3B6ZA 5DCWA 3DXYA 3NATA 2O7VA 2CUTA 3DJYA 3ID6C 3QMWA 1SUDA 5E7QA 1B0ZA 3BRSA 4WH0A 4ZCSA 5IJWA 3A10A 1FFXA 4UM5A 1B6SA 1JJFA 3F98A 3FNGA 1QB8A 1SKBA 1UP7A 2ID7A 2PMFA 3E84A 3KYBA 5DO9A 1QU3A 1ODIA 1O77A 1RLJA 1VKJA 2EARA 3K8YA 4M21A 4R1MA 5G0TA 3RYFA 2ZCJA 4AQDA 3NP7A 5A4IS 2RK6A 5IHPA 4F11A 5A05A 3RNOA 1AZTA 1CK4A 2YWJA 4YA6A 1U4NA 2P2DA 4RPJA 1CIPA 4JOBA 3TAUA 5EUCA 2FZEA 5DNEA 5J5VA 1KGSA 1HDRA 1GGVA 4DWWA 4DEVA 3BUSA 3KVOA 3C3WA 4INOA 1RWWA 4H0NA 3MOGA 4UVGA 5EJ5A 1VIMA 3VJMA 2ZATA 5I7OA 1Y4UA 4QUAA 2PX4A 2GO7A 5IKXA 3HCAA 2JPDA 4OLHA 1WSBA 5BRNA 4C4TA 1MNQA 3CYFA 3DQPA 5B53A 5A1TA 4W7IA 3SEQA 2ZI3A 1RYZA 1GGHA 2VPIA 1O7JA 4ZO4A 3JQ7A 4F92B 1KKMA 4OGGA 4BMSA 3FKSD 3SS7X 4RV4A 3LW7A 1OX4A 4BTVA 4EYEA 1MDBA 1IE3A 1N92A 1NFRA 2XMZA 2L69A 1KJJA 1OFUX 4GKKB 1YZHA 2BSAA 3QNUA 3W3AH 4B87A 3EXEA 5FAXA 4DFDA 3F6EX 4UU1A 1JAHA 3N2YA 4WZAB 2SNIE 4QHTA 2XKBA 1J7JA 4PSAA 1HNNA 4UUQA 1OD6A 1KJWA 2IP1A 4JMLA 4FN5A 1YJAA 3HXQA 1V16B 1LVHA 1QO9A 2YIMA 4B5KA 2PKEA 1ZI8A 4MARA 5JO9A 3ECAA 2AC4A 3R1IA 1TZ2A 2FPKA 1XU4A 2GPJA 3LFUA 1K0UA 3QGMA 4QO8A 4C07A 3HPRA 5D86A 4DMFA 1E1NA 1MV5A 2ZWVA 1UL1X 4F3KA 2HHHB 5E8RA 5JDCC 1A9OA 4FFWA 4Q3AA 3MWYW 3OE7A 5ITWA 3SQOA 4LQLA 2CNWA 3C8HA 3CN7A 1GNSA 3TOCA 4BN4A 2LZ0A 2PSHA 2PJDA 4UUMA 4QUDA 1D5WA 1IOLA 4TUYB 4DV7B 1YS7A 1P3DA 4H4CA 2VRCD 3EOZA 2BMVA 1PX2A 4AL4A 3KSAC 3ESBA 3NQ41 3TJMA 4UHBA 5LLSA 4HVTA 4PICA 2C58A 1UT5A 3GPCA 1F60A 1HYQA 2R7LA 4ZMSA 1SCIA 3RVSA 1A77A 1SHTX 1Q77A 1T1GA 2E4YA 3JSXA 1AUQA 2DWOA 4DSUA 3PDCA 4KYTA 4FJ0A 8LDHA 1MG5A 5EMJA 3KT6A 1WDKA 3HNOA 3AFIA 5AM4A 3A4LA 3A9UA 5D6NA 1T8RA 2BM1A 4ARZB 4P84A 3FHOA 3S8EA 1GM5A 1N3IA 4C3OB 4P38A 2XUDA 1SIBE 1FNCA 4RHTA 5GZ6A 4O02B 4PN7A 1Z63A 4HVCA 1QSGA 3JX9A 4PGHA 1NBAA 3P2JA 4JLBA 1W19A 1Y1SA 3H5OA 2JAUA 3AR7A 4WJKB 5HRUA 1FTNA 1XP8A 2QU7A 1IB6A 3K0BA 5IASA 4DRYA 3E7DA 3ZVMA 3MHPA 3QMMA 6Q21A 3KHSA 3CW9A 3MJ4A 4TV9F 1YI0A 3CNNA 1AGXA 3ESRA 3ESZA 3JSAA 2ZWAA 4RZUA 4DSOA 7YASA 1OXUA 3IESA 2XD9A 3KKMA 4DM7A 2XJ9A 1NW7A 2UYQA 4GI5A 4MK4A 2IRWA 2W8BA 2CLMB 3BFKA 1Q7GA 1K75A 3COZA 3RWBA 4V0OA 1E4YA 1N5RA 5JROA 4OMUA 1GKYA 3HUUA 5AK3A 4WBXC 4DXDA 2ZJZA 2ZWIA 1W49A 3PUJA 3UHPA 2ILTA 4L5JA 1F8YA 2PHZA 3BIXA 4YJ3A 4RLSA 2IX3A 2C78A 4FMPA 4U2GA 2OCYC 3SX4A 1O6FA 1SVWA 4LYHA 4IJKA 3C8MA 3NBAA 3AEUA 3SDBA 3TBHA 1D2NA 2P3OA 2X58A 3UH1A 3UWSA 5FI5A 3UMBA 2GERA 4UNQA 1Z4QA 2AQ8A 3AIKA 3T41A 1RQXA 4HJRA 1RVV1 2BLNA 4DAEA 2B4RO 4QDKA 1QLHA 1PJSA 1G9XA 1HO3A 1VKOA 4KH1A 1JKJB 4I4LA 2I65A 4ALNA 5FOQA 4HEHA 3E8XA 1YVPA 3DKVA 1E64A 3GEBA 4DS3A 3PPYA 1S9DA 3QRWA 4HVLA 5C7IO 1XPRA 3EZ7A 4QJIA 2CT8A 3SD7A 5ALXA 4TXJA 2DP4E 3RK4A 2QTRA 1S8AA 3CLSD 1OROA 1Q1AA 4G67A 4Y6RA 5CITA 1G8FA 3MRVA 4OCZA 2X4GA 4ENRA 5CFRA 1VBNA 2IDMA 4QBIA 3UWPA 3UTDA 4BV9A 4D98A 2B7LA 5JZ9A 1AO0A 3KD3A 2Q3LA 4RCVA 1E3JA 1KEKA 2JGEA 1NP7A 4HNRA 2RHJA 1XEFA 3CX8A 4Q9KA 4DZTA 2ZUCA 1D1TA 2LTAA 1SU6A 4E6PA 3FF4A 3R0ZA 1L5SA 4I6JA 3OZAA 1LTHR 5JD4A 2H31A 2VDWA 1DWUA 2VF4X 4CFZA 4I4TF 5KYYB 1TMOA 3WO0A 2QLTA 4MRVA 3WGQA 2QYHA 3WIVA 5FWXA 3WK4A 2Z2YA 3MHTA 3I2JA 4G56A 2OQVA 2P67A 2VP3A 2GZAA 2P9BA 4B3XA 4HLUC 3WZMA 1DHTA 4FXOA 1DTSA 4JQCA 1SG0A 4FK8A 1HLDA 1JQ3A 1JVBA 1UP6A 1FRFS 1RCTE 4FDVA 1KZGB 1EYZA 3WLJA 1FNDA 4JC5A 1YA8A 1J20A 3I0ZA 2PLWA 2ZJ1A 3E0QA 3TM5A 1R6XA 2EU8A 5DDIP 3D8RA 3H1AA 5COQA 1T6BY 1D4ZA 1JLSA 2GOYA 1UZAA 2ENUA 3H1PA 1NN1A 3IQZA 3MJDA 4A0FA 1UDBA 4RWZA 3HN2A 3MQFA 2VNSA 1I7LA 4LQDA 2P4QA 5JAQA 5LB2A 1XJWA 2KB0A 2GH1A 3P0EA 2FZLA 3S2YA 3AFOA 3LY5A 4RTJA 1Z3CA 5IAAA 3K0FB 1E79A 1Z8NA 3GVXA 4KN6A 3UNXA 3LIIA 3MF4A 3TVTA 3THYB 1I6WA 5DBFA 3AZPA 3FKJA 3NHLA 3L8YA 3OEWA 1VG0B 1KEEB 4B32A 4NYIR 1RMTA 5LZ7A 3OEED 3STYA 5B4TA 1ZRSA 4UEKA 4RLHA 1W52X 3R7NA 3I61A 2QRJA 4PYMA 1G5IA 3D3JA 3KCQA 2YFKA 4YFYA 5JS2A 4DSZA 1TCAA 1G3QA 3FWKA 2ASEA 2AG1A 4O4JF 3DOHA 2ZUUA 1NUSA 4KXVA 5DBHX 1GAWA 2WG2A 2VTEA 3WIBA 5G53C 3EVGA 4RYDA 4M3NA 1LFAA 4AG3A 1QB7A 1XI2A 2ZWOA 4JUAA 4GC9A 1R3UA 2HQRA 1QPGA 5JFTA 4HLNA 5GJBA 5HDBB 5LP6C 2QD1A 1SHLA 2DULA 4Q48A 4FFBB 1PTJC 2IS6A 5DT2A 3DAYA 1GZ5A 2NO1A 5IDXA 3BWCA 1H2XA 4GX0A 2XYVA 1WD7A 3ANTA 1N5IA 1UBFA 2ZSFA 1DBQA 2ECKA 1A69A 1LDNA 3KLBA 3BVPA 4WZZA 3LZ6A 4R2XA 4IJMA 5CDGA 1A8PA 3UO8B 4U7TB 1JDTA 1BHQ1 2PKXA 3QJYA 8OHMA 5HQTA 3M1AA 2JI8A 4KYVA 3V32A 5UKDA 3I83A 5B1YA 1TZJA 1FU8A 1NVXQ 5A2QA 2AYZA 2DMRA 3MMXA 2ZI5A 3DA8A 4IG4A 5ILGA 4RV5A 3VSDA 3ET4A 1DJNA 3A3KA 1XNHA 4S3MA 1EVKA 1YQXA 1X7GA 1M74A 2RHMA 4R8RA 3L8FA 3T1QA 3IDFA 4H7JA 2Y1GA 2B25A 4QQKA 3TLEA 4MDFA 1RTTA 2CUZA 3R6LA 4LXUA 1KIFA 4TL7A 1X9IA 1IMOA 3EVTA 1XMSA 4J1TC 4ZCLA 1AG9A 2WJYA 4I8IA 2ZXUA 1QRSA 2O19A 4FFNA 3IIKA 4QYIA 1YFLA 4DIDA 2Q5LA 3I5XA 3HCFA 5SV2A 2CHFA 1CVIA 3BQ9A 4EL0A 2X4LA 2KPOA 2EJTA 2OXRA 3BXGA 4LJ5A 5HGXA 1NVUQ 1ZXBA 2Q1TA 3ZZ1A 3TFQA 3W5BA 1L3BA 2CJYA 1QWSA 5E95A 1U7OA 4JS0A 4UTVA 4Z0TA 4QXAA 3EZ9A 3ZD7A 5C3UA 4LJSA 2PZGA 2P1RA 3DWEX 1MW9X 5G2OA 2G04A 5DTRA 3BMOA 1R16A 4YRSA 3CHYA 3WFZA 4JBGA 1H2WA 3OLCX 4A5OA 4PN3A 2F17A 2O05A 1QX3A 3DO6A 5IWAB 3CVVA 1RJ9A 4G07A 3ZI0A 1YQEA 2PMBA 3V2HA 2BN4A 3A6KA 4L9AA 2HJWA 1WZCA 1UINA 3HM2A 5C8DA 5LR6A 3Q85A 2DPXA 4L3OA 3I6MA 4Y9RA 3PGXA 1BVHA 3QX8A 1GNPA 3FPEA 1LBEA 1KQOA 1PK8A 3CPJB 3FXAA 2OAGA 2H18A 1WHSA 3TVYA 2CNNA 3GAFA 3QTBA 2F3PA 1JNYA 1OGJA 1MEEA 3HEBA 3V8VA 3R0IA 4WAUA 2YHAA 5CNKA 3UENA 1AKWA 3K5HA 3KKNA 4F2DA 3AUXA 3SJCA 3QIVA 5EWMA 1TCBA 1TRKA 4ZQBA 4GYKA 1E2BA 3FDJA 5A7FA 3GELA 2CC2A 1TEXA 4AKGA 2YNMA 5HW0A 5E6UB 1QOZA 5DBIA 2JD1A 3N53A 4G8BA 3T95A 1CB7A 1Z0ZA 3WAJA 2H1IA 4BFVA 1B14A 2VRBA 3FNHA 1ZUNA 4XFDA 2E1PA 3PKJA 4M0EA 2V3CC 2ZT7A 5FOUA 1QRDA 5ED0A 1JHDA 2Z8YM 3FOBA 3M2TA 2O7RA 2UYCA 3UMCA 1KFEB 3OICA 1SVOA 4FGLA 2G76A 4K5QA 4TWAA 4XYBA 4IJWA 1DEKA 1H8EA 2DQSA 1E6LA 2PUVA 4HLQB 2H8GA 2RGNC 4QDUA 3KXPA 1X87A 3ROPA 4RHFA 3P94A 2RDMA 1B1CA 3F96A 4KGVA 4XR4A 2MINA 4BO1A 5KQGA 1LF5A 3CZQA 1SVKA 5CJ2A 2A9FA 1XE3A 4BVKA 3ND6A 3UV3A 4F84A 3BORA 3HGMA 1K7YA 4NU0A 4DV3B 2GN9A 4RTMA 1CUJA 1GZ6A 4ZU1X 3IUQA 1VHQA 4N5IX 4UMVA 2AFVA 1NPTO 1P5HA 4I3GA 2A14A 3FSRA 5K3CA 3TLKA 3T5TA 2FDCA 1WUTA 3WO1A 5AW6A 3G0HA 1NUQA 1SOUA 1T2UA 1XKXA 3GO4A 3MLEA 3N6RA 4QATA 3HLTA 2MSKA 5H7XA 4UULA 4WLNA 4B45A 5LZ4A 4M1WA 1ZCFA 2NSDA 5EL0A 5TGDA 1OLOA 3ZH2A 1J0CA 1T2DA 2I7CA 3AL2A 1NQXA 2GFQA 1R18A 4JWTA 3ZBUA 3WYDA 1N8NA 2ZRMA 5TF4A 5ULLA 3PUKA 1FQOA 1GGFA 1GPYA 1E1QA 1KMHA 2FPIA 3A11A 2HV8A 3K0CA 4M1OA 3FPFA 3FSEA 3R09A 3WLSA 3JAMA 1PNQA 4V2IA 3WLLA 5EMHA 1XU7A 3DMDA 3LDHA 4P5DA 1E1RA 2GEVA 1LW6E 1HPLA 1WP9A 4OLJA 1LPBB 1B8OA 4P35A 1W94A 1QBKC 1NJ1A 2W0MA 1TMKA 1YBFA 2BJWA 3BIOA 3V1UA 4Q3BA 1SUPA 1XX6A 1NQVA 3KSBC 3MB8A 1WMAA 1M0SA 2DPLA 4IIJA 5FD8A 2BFCB 2ADFA 4MYSA 4QFBA 1TF5A 4KPGA 2G8LA 3GX1A 1C0EA 3USES 3SQXA 2GCOB 3BXXA 4PU0A 2NU6B 4YQZA 1G18A 3LUKA 4C9BA 1WXQA 5JQGF 2QE7A 4KACA 4D92A 4I14A 1WB9A 2NP7A 2IZ6A 4D45A 5CDUA 4P5EA 4Q1FA 1L0BA 7AT1A 4NABA 4DJTA 3TECE 2Z58A 5CFQA 3NTUA 2C99A 2IBMA 5EQJB 2G9NA 1Z45A 4XGRA 4Z7OB 1KI8A 1WCXA 5EMNA 2Q8NA 3EJ6A 5C80A 1H85A 4YRPA 2LKDA 4HD8A 5CT8A 4L16A 3CVXA 4F6LA 2QLFA 1BN6A 3SOPA 4RHYA 1CR0A 1KAGA 5IX8A 3AC0A 1VSUA 2JAWA 4MV4A 4OHCA 3OIDA 5K6AA 1P39A 5JCPA 4K9OA 1VBKA 4CFSA 6REQB 3C6YA 2WKQA 4JQOA 4TLLB 2O3TA 3TAHA 3VU8A 2VJAA 4Q4HB 2IU0A 1G2PA 4FHCA 3C85A 4PX5A 5A6SB 1LBQA 3QWHA 2G9ZA 4JJ4A 1QS0A 1SKQA 3O5AA 4BUZA 2XNJA 4RO0A 1JI3A 2G1JA 1G2QA 2DBRA 4EL5A 1AQNA 3LLUA 2XOKD 4AJHA 2Q4DA 4AJJA 4TT3D 1YCGA 3HB0A 1XROA 3PNQA 4MCJA 4DNPA 5BN4A 6PFKA 3FOWA 1OBVA 2C97A 2PQ6A 2QUAA 5AM2A 1YF3A 1JLHA 3K7EA 4JX8A 1E1CA 2QPAA 1FDTA 3H4MA 1RAHA 1F2TB 2IYFA 3LGSA 4NXMB 4P2BA 3ELYA 3FHCB 2AOTA 1XHFA 1USVA 1KH3A 4Q4LA 3ZW8A 4BO4A 2XZOA 2ZT6A 3ETDA 4BLPA 3SXPA 3KQQA 2XNHA 4MYUA 4YREA 4MVYA 1JFSA 2DCMA 1JQ5A 1VJCA 3Q11A 1QHGA 4MB2A 3COYA 4UHHA 1Q83A 1MV8A 4HH3C 1GFIA 4W9MC 3W8DA 5AK4A 4DCPA 4H60A 5LKRA 3T4XA 1RMYA 1CHNA 2PUWA 4HQNA 1JIXA 1ORDA 1C7RA 2YICA 3B5JA 3EGEA 3HLYA 421PA 2G08A 3K6RA 1UMKA 4I5EA 4WRRA 5IP5A 3TUJC 1O96A 2B7BA 2IXEA 5LJIA 1H2AS 3IIEA 4MWDA 4BNUA 3I23A 3CF6R 4QFCA 3K31A 1ZWKA 4AYTA 2SHKA 4JVNA 2FSVC 4BNGA 3HA2A 1OILA 2A3NA 2X41A 1K5GA 4DREA 4EB6A 2ZRFA 2A9OA 5LUBA 2M6RA 4HJXA 3SKVA 3R5HA 4Q37A 4UE6A 1ADFA 3T7KA 4IIBA 3SVTA 4UPVA 5AWFC 2PL5A 3ENKA 3ORHA 5ALGA 1B6RA 1RM5A 3D8TA 4TVKA 4NBWA 1M2KA 3ROMA 3DE0X 5HQ3A 3DNMA 1TVMA 1EVIA 3OQJA 4GMGA 5HNKA 3SS9X 2CXPA 1SUBA 4P5PA 5L7WA 5T8KA 4COOA 1XD2B 3BK1A 2G25A 5JY6A 1O0CA 2DX7A 2AFIE 1JDBB 4KXUA 4HYTA 3U31A 1QZTA 3N5CA 3D0OA 1QFXA 1DAGA 3GZNA 2VA9A 2AXPA 1O0BA 5IFLA 1N5DA 2QTFA 1D3AA 1K4KA 1FYWA 3EFHA 3OHMA 2X19A 4Q47A 4M60A 1CR6A 1QIDA 1FMLA 1FUKA 1GQOA 2L17A 4XSGA 3PXGA 1KWKA 3IURA 2HMVA 4PZUA 2XQVA 3TSWA 5EESA 4P4NA 2EKBA 3T3EA 1GDTA 3E1GA 1C30B 4GEKA 2QRPA 3RKSA 2FW0A 2WNHA 3CZ5A 1J1IA 2CWDA 2I8CA 4N7JA 1JAIA 4BEJA 3GLGE 1F0NA 2H54A 3AB3A 3CGWA 3TNJA 4X3CA 1JWLA 4FJ1A 1JSRA 1X7ZA 3E1SA 3P2KA 3JYNA 3DE3X 4XUCA 1JMVA 2WZBA 3QVWA 1PJZA 2DQ4A 3O1JC 4Y2RA 1Y1TA 2HBYA 4OIFA 5MGNA 2NVWA 1X1TA 3HCCA 3T9AA 3IOCA 3AF4A 3PSHA 5AQEA 5IK2A 4E94A 1MOPA 3LKDA 5B7NA 3WGGA 1AUVA 2H3EA 4X6XA 1JA0A 5AKXA 3V4VB 5SICE 4NQZA 1M67A 4MO9A 4TMYA 4KE6A 4YIKA 1HH4A 3CIFA 4H1UA 5ARBA 1QM5A 1T1IA 3W7VA 4XX0B 1LTQA 1XJ0A 5IM4A 3UGQA 4Z49A 5JNRA 4FFRA 1H3NA 2P68A 2FQXA 1BU8A 1GPNA 1TAGA 4KXFB 5E1BA 3LSTA 3KWMA 4V03A 1E3QA 5GGYA 3TSOA 4RELA 1I5EA 3A1NA 4EKDA 3V2UA 4Z3KA 4UU7A 4H3SA 1WNFA 5KZMB 2ERYA 2NZ8A 2NZ2A 1MZPA 2X0IA 4S1VA 4BNZA 3MCAA 1NBMD 4QWMA 4RVDA 4D9CA 1JA9A 5K09A 1V7CA 4M53A 4NENA 1EJ2A 5KINB 3GGDA 4KUGA 4F4CA 1X39A 2A1TR 5ENVA 5MFPA 1UKEA 1R8JA 2GPAA 3GFVA 3IHLA 1SB9A 1H2HA 1PNTA 2BD0A 2C9YA 3PWSA 1SK9A 4RF3A 5JD6A 1S4QA 3OQBA 4A8JA 4L5AA 4CQLA 4ABTA 4CQNA 1V4NA 5BN5B 2ZYTX 1I30A 2QTNA 3DC2A 2HRZA 5B6IA 3MRXA 2GI4A 1VJRA 1Z16A 4L2IA 2P9QA 2WVJA 3Q3CA 4MGEA 3WB0A 1CYDA 1H1LA 5LNK1 3GIDA 5J47A 3KU4A 4Q9LA 5H68A 3M8KA 4B3FX 4P3NA 1UBRS 3MJTA 5DZSA 3EGCA 4BIIA 1NOKA 3OE4A 1GU0A 4PCUA 4J8PA 3EZXA 1QXSA 4HAZA 3JPYA 3FMVA 1E9RA 1B26A 4RY8A 3M7IA 5GAJA 3DTNA 2BGNA 5CVEA 1NI4A 4HB3A 3LCVB 3DL7A 1X8XA 4IO1A 3W6UA 2VDMB 4P81A 3UC5A 3ESCA 3CFYA 3Q3EA 1P0FA 3W04A 5CB6A 1L5KA 1BG6A 4CKWA 3E2MA 1ZGAA 1XYGA 1BEEA 3ED5A 3F7NA 5C7OO 3ANMA 1NURA 4IMRA 3W34A 5DT9A 4BO0A 4O4HF 3QF4A 1NXPA 4W9NC 5JPIA 2ZYIA 3NZEA 2GVDC 4JYCA 4WCFA 3VJRA 2ZIVB 1A2QA 1PG5A 4QE3A 1X3LA 1W29A 2W2OA 4ZRDA 4KVGA 3K71B 3ROXA 5EIOA 4BQEA 3M3DA 1MRSA 4K9KA 1JEJA 1UPCA 1EIZA 2P8JA 1QIJA 5JASA 5M04A 3EIOA 2G0TA 1UBMS 1F17A 1ORHA 1ZITA 2GS9A 4KQCA 2ONZA 4KAJA 4WXMA 3TTTA 5CG1A 3NEJA 4KLCA 4KQGA 3U09A 1EJ6A 3U60B 1ZFNA 2ZR7A 3PXCX 5C8YA 4DTCA 3K35A 5U9CA 5J5AA 4TRNA 3RABA 3IB3A 3VPGA 1CQJB 2WVAA 1NOJA 1G38A 4IG9A 1PT5A 1LY1A 1Z29A 4AWAA 1N0VC 1HT1E 1YASA 1WHTA 2OM2A 2C0CA 3AR8A 1NUUA 2DQKA 4UTXA 5AUQA 4NYJQ 2GCGA 1E9SA 2X3UA 4R40A 1VA5A 1QPZA 3MTDA 3C2QA 3OZIA 1U80A 4REOA 4YJFA 3T9CA 2BF4A 3F6CA 3HYRA 6GPBA 3G2PA 2R5WA 2QP4A 3DDZX 1RADA 4LA4A 5DOZA 1DIAA 2GO1A 5EIXA 3WLTA 3G5TA 4OQFA 4H17A 4AZ0B 1QORA 5FBHA 1YV9A 2BP7B 4B2PA 4KXXA 4K1LA 3VNRA 1IOZA 1FUUA 4HNHA 4QM7A 1JYSA 2OGUA 3HYLA 5IBQA 4B8WA 4MKFA 1Z06A 3UC9A 2ZJ4A 4TMXA 5KYWB 4GX1A 1N3BA 1A7KA 4TMKA 3SIWA 2J0UB 5K4GA 3ED1A 2Q3FA 3M1IA 1BS9A 2R6R1 3O3MB 2RH4A 1S7CA 5CFMA 5DMXA 1BDHA 5CXQA 4Y6SA 5HOQA 3CZCA 4PS0A 4QUJA 1EUQA 2ZAYA 3G9QA 4FGKA 2O23A 1Z6GA 3ZJYA 2RE8A 1P2BA 4DWOA 5EGNA 3X1YA 5GJWC 5AYVA 1C7QA 2HF7A 2XQGA 4G25A 5FF9A 4H7HA 4ASUD 2DR0A 3KQWA 4PE5B 4AMYA 3ESXA 1YNSA 1C1YA 4PG8A 3R8FA 4I7EA 1IJFA 2AUMA 2OAP1 2VPPA 3QY9A 5H9WA 2C0QA 3EQ7A 3HZHA 3JWHA 4G4JA 4UOQA 4BB6A 3O9ZA 4ZCQA 1ZCJA 1VL5A 4KVAA 1CLEA 4L76A 3I8XA 4J2TA 4QDOA 3UWDA 3RADC 5D3ZA 3TRFA 3RRYA 2JW5A 1N0UA 2NSLA 3BMNB 1YS6A 3OZUA 4MR9B 4DMKA 4BO2A 1CF2O 1S5PA 4DUGD 5BUZA 1YWGO 3BSFA 5TPZA 2ORYA 4M0KA 1ULTA 1GUZA 2WFLA 1IXKA 3H05A 4PAWA 3SS8A 4YAIA 2ZSIA 3DQZA 3DV2A 3LLCA 3TLYA 1W0CA 3KSZO 3L18A 1SC6A 1YFZA 3ZGZA 1MJNA 2BIFA 2POQX 1EB8A 1IN1A 3IV9A 3LG2A 1DBRA 4X97A 1HZZA 1EDDA 1KK1A 1O57A 3ZDZB 3PD1A 2R4UA 2FPWA 2PNFA 5CA0A 4KP7A 4ND7A 2VAVA 3PX2A 4EAAA 3KEOA 1MQAA 1U7PA 1DIHA 4YRNA 5KJEA 1AMUA 1WG8A 3V55A 3W5HA 2G0NA 4BS9A 4TRJA 4YXWD 2ZM6B 4WY2A 1V71A 4QDXA 4ZQIA 1XB2A 1KEUA 3BEOA 4AJKA 5LA6B 3I53A 2XTNA 3X1XA 1VFPA 2XEDA 2UVDA 3LCJA 4D46A 1MAHA 4I5DA 2NTEA 2IS1A 2SECE 3WV5A 4K0RA 2GDJA 3DAPA 3EXG2 5FLYA 3REGA 5IEJA 2Q1YA 3BWVA 5J1SB 2W00A 3Q6MA 3U48A 1OI2A 1OXSC 3C3XA 3MJCA 3V8EA 1ZICA 1N5KA 3C4JA 2ZRPA 4MXDA 4Q3NA 4DBVO 4CV3A 2C96A 1N9GA 5IAEA 2IYNA 3RFUA 5HIAA 1R12A 4MVCA 2GUGA 3BJZA 3E3AA 5DLYA 4EJMA 2V4ZA 4S1WA 1W5AA 5CMLA 4OLBA 4OM8A 4IDPA 2ATCA 1C8LA 4ZHQB 1F38A 4CXMA 3OX2A 3OY7A 3BXZA 3UCFA 5C35A 4NLLA 3GXBA 1JE1A 4AN1A 1I4DD 3DOIA 2RBEA 4ACBA 1XMQB 3E35A 2GN0A 3KFXA 5GP1A 2FRDC 2I67A 3AJ9A 5KI6A 2C9CA 5IKOA 3EVNA 3WLNA 4D4JA 2QYSA 3H5LA 3THXA 3H75A 5DM2A 4BVAA 2O3QA 1YACA 3C87A 3RE1A 4UARA 2EYQA 4TKZA 1OY1A 1RE0A 2XXJA 3GVHA 4OP3A 1WXXA 2YJ6A 3UFBA 4HWPA 3NCHA 3CUVA 2GF2A 3AF5A 4I81A 1VJ5A 1H66A 4NP6A 3GRCA 1L5ZA 3V80A 3T06B 1TGVA 2WYUA 2XIJA 3ICWA 3IOBA 4GR9A 3H16A 3S1LA 2AW3A 3UQYS 1LW7A 3C24A 5FPKA 5MDHA 1E69A 2QRLA 1SFRA 3K0HA 2C4TA 4FMDF 4GI7A 4R0NA 4Z1MD 1EM8B 1GZDA 1TM7E 3AR9A 5E8JA 3O8OB 1MB0A 3K05A 3KJNA 4KGXA 3T7DA 1ZKMA 2XCRB 3N0WA 3TRJA 4NNPA 4IR7A 1PS8A 4JB0A 3PEUA 3IELA 2HF8A 1WZUA 4M7OA 1JU9A 4Y2VA 3RUFA 1U9IA 1WMEA 1RRVA 3AWDA 4HQOA 9LDTA 4MQEA 2WJJA 3THRA 2UUCB 5B37A 2D06A 4GL2A 4YY3B 3BXPA 3B9RA 3QWIA 3FDXA 1Z0KA 2Q1WA 4AKSA 4RU1A 2WMOB 3UGKA 2P9JA 4A8PA 5K3OA 3UAVA 3QSYA 3HJFA 1LLFA 2EFHB 2KWIA 3FB4A 3PUXA 1DTEA 1H4TA 2VDPB 3N2ZB 3M4YA 4J1NA 3JYPA 4LOKA 4WHMA 4E5SA 2I66A 1LC0A 2IBSA 3OMLA 5LKAA 3N3AC 1MB3A 3NHSA 3V97A 3HWX1 4OHFA 3RS2A 1NBEA 3OIGA 5JSZA 4OLAA 1EFRD 1HTBA 2PYIA 5CB8A 4XTCS 4NHOA 3B1FA 4HN4B 2VHTA 1PX0A 2H1HA 5C81A 4EFLA 2VDRB 1O6GA 4Z9AA 3WE7A 1LPNA 4YT8A 2CLHB 3QUCA 1R66A 3JQGB 1UOOA 4KAFA 3A26A 1UDAA 2IU6A 4H7DA 1KU0A 2FDXA 5H16A 1YBMA 1KJNA 2P6NA 3ZIAD 1TIPA 2FWRA 3DVQX 3KZMA 4DNQA 4MKHA 2K7FA 1GD1O 1XCMA 5B1HA 3E48A 2Q45A 4RA9A 2CXNA 3AKCA 3KVNA 4KLRA 3WC4A 5KYUB 4JJ6A 5CHEA 1PGNA 1DWOA 2VXBA 3ZOKA 1YZUA 5EXXA 1E92A 1NF2A 1XTBA 2M2IA 3VZPA 4BCCA 3VU1A 5C4MA 1GT91 2BRUA 4RBNA 3C15C 4E33A 4UOZA 2EJCA 1ADBA 2YZ2A 4FYHA 3A32A 3B9QA 1G5QA 4M76B 2H51A 4UHFA 2GKSA 5CAEB 5TDHA 2X0KA 4X66B 4MJ7A 3RLIA 1CJTC 2YC2C 1UJMA 1KY5A 1I4OA 4W7HA 3BWDD 5HMLA 4NBTA 3RUPA 5DCUA 1KY4A 3MT7A 4DT1A 1YAHA 1A96A 2BZ1A 2FWPA 1F3LA 2Z5VA 3DE4X 1BVRA 2A9JA 2QL7A 1CR2A 2WKPA 3IEXA 4KQHA 4P93A 4D82A 4E22A 4D0SA 4DRXA 2GGSA 1L5QA 3RAGA 2D59A 3KL2A 3GLGB 2Q6IA 4NFHA 3WGLA 3NBFA 3ZYCA 3VU3A 2C4HA 1SK8A 5C1DA 1PVDA 3ZDCA 4HAVA 3ORQA 1TT5A 2AL7A 2C4VA 2H17A 3KYDA 3CLKA 5DGDA 3ZJTA 1DUVG 4MRSA 4TKLA 5A4AA 2AKYA 3ZE7A 4DR7B 3VYUB 1JQBA 4XQGA 4JZKA 1KAHA 3LGXA 4RHXA 1V7ZA 4WIAA 5AXCA 3VUEA 2XUOA 4EYQA 1FLVA 1Q3HA 2QZZA 1GTVA 3X1JA 3GQVA 1UEXC 4HWSA 4A0GA 3HJNA 1YB7A 2LDBA 3WDMA 4S04A 3B85A 2OT3B 5AXBA 2J3JA 5AUPB 1QLJA 2NQ8A 5D5QA 4L3WA 3RHZA 2QI9C 5KSOA 3A14A 5AXDA 2IV2X 2QTTA 3KPUA 1E6KA 5HJEA 4B09A 4GOOD 1XWWA 3DE5X 3TO5A 3F2VA 5AW9A 5BWOA 1N36B 1GPWB 4DG8A 4ZQGA 1KDZA 2JDIA 1IATA 1M6EX 5CVCA 4R1SA 5DF1A 1RYNA 3TL2A 4YR7A 1GCGA 5KTKA 3E7WA 3UH0A 1F6BA 4D56A 3HL0A 1ZIYA 4MUGA 3MINA 4P3YA 5B58T 1EHYA 1K1EA 2IY8A 3KV3O 1HFEL 1DDOA 1WM1A 1ITZA 3FFWA 3L4BA 3LC0A 1Y4ZA 4RH3A 3JR3A 3LBNA 3RK1A 2I91A 4L7VA 1MRNA 3PU6A 3N2GB 3HO1A 1KZ6A 3IQHX 3WWCA 3ZXIA 5CG2A 2YZGA 1G98A 2NOAA 1CDZA 5CCDA 3KQVA 4ZYXA 1KSHA 1SIOA 2JEZA 2JIQA 4UUNA 1PD0A 2JGMA 2CDAA 3FD8A 2WM3A 3Q7PA 4KNWA 1CF4A 4BNJA 1FL9A 1TECE 2IYTA 2J8ZA 3G82C 4FZ5A 1OU4A 4M9CA 4C7VA 1DBPA 3DEAA 3I04A 1KXJA 5EHNA 1NKVA 2GK7A 4QSMA 4W9RA 3N58A 1V47A 3IXMA 4JI7B 4MV1A 2XDAA 1FU7A 2PT5A 2ZVJA 2QT9A 5LZ2A 3TOSA 1N7GA 3DLPX 4TTVA 1QCDA 2OWEA 3DM9B 4I50A 4MV0A 5HTKA 2G70A 4K1XA 4KR6A 2OCGA 4EW6A 5U4XA 4EQ6A 5L53A 3O2SB 3NW9A 3OU7A 1YB1A 1XAIA 4K9NA 2C03A 1NBOA 1SU8A 2FAXA 2O1XA 3GJRA 3C3JA 3LY7A 3OSUA 4GF5A 4FPXA 4H0CA 4QPJC 5F3WB 4YI3A 3LYUA 4N03A 3OE7D 1Q0ZA 4MP6A 1DOHA 1E2KA 3ESAA 2P9HA 5TNXA 3B7GA 2R5FA 1PR6A 1Z4JA 3TL3A 2FMHA 3TRHA 5K0SA 3D5TA 4YCLA 5J2UF 1X1AA 1P9LA 1V37A 2HRDA 3EA4A 2BCEA 4ZEWA 4KQ9A 4L72A 2ZUWA 1N2HA 1A97A 3A9TA 4NL4H 1IM8A 5JLAA 1AKMA 3R6DA 3STTA 1G41A 5JRDS 1P45A 2WA1A 5I5EA 2NO5A 2GHQA 2IVFA 3O91A 1AA6A 2GEFA 1CP3A 5J59A 5JWHA 4B31A 5AVSA 2J0EA 2LPMA 1MPXA 4PLWA 4O6VA 4N41A 3KE8A 1OTXA 1UKCA 3WISA 2OD2A 4C4RA 3NEAA 3CB4A 1Q0LA 1AA9A 2HWYA 4FFOA 4G8DA 5EEHA 4V1CI 3W5AA 3STHA 4CM7A 1FCJA 3OJEA 2FG5A 4CI9A 3E22A 3LO5A 4LY6A 5AHRA 1G8GA 1UPTA 4Z9XA 2HRQA 3PRYA 5JDIA 4MA4A 1PV4A 1BX3A 1PT6A 1QYCA 1L5YA 2WD8A 5LBIA 3IILA 3FTFA 4D26A 1F8GA 2VJNA 4F45A 4WWHA 4ZQCB 3RW9A 3LAWA 2BEVA 2YJGA 2SKDA 3ZD9A 3INGA 3OX3A 3L6RA 2C3PA 1MIOA 1A5SB 2OHJA 4Z9FA 5FNZA 3CF0A 1YRQA 1E8DA 1UBTS 4HHEA 3CSSA 1QK3A 3DMTA 2OA0A 2BGJA 5TRTA 5ALEA 3RO7A 4EPRA 1FNBA 4QUBA 5CM8B 3O3CA 1H9AA 2B20A 1ONPA 2PL9A 3HNPA 5K0GA 1PHPA 2WWVD 3OF3A 2FPPA 5ALJA 1S01A 1II8A 4KFCA 3U6BA 4II3A 3AI7A 3K1ZA 3Q5EA 2F2TA 4IHAA 4HT3B 1ZGJA 3NGLA 4O4IB 3U26A 1G9TA 4HVAA 3EVZA 4OUDA 4NOLA 1CC1S 1EUZA 4J7CA 3ZLVA 1YTUA 1DAMA 1ZA1A 2DF8A 3JVDA 1L1RA 2BKUA 2JIMA 4LMPA 1UWCA 2VUTA 2KQUA 1CULC 3FBGA 4OFXA 4RLQA 5DEOA 4B7UA 4DLNA 4JXZA 1NXQA 2D4AA 2HK9A 1T8UA 3JATA 5HIJA 2MCFA 1Y9DA 4G09A 5M34A 4N47A 4LGCA 2RBKA 3U0VA 1XDZA 3CISA 1H1TA 3KAQA 1N2CE 1UPBA 5KVSA 1AK9A 1PJ2A 4I1RA 3AI3A 3D4LA 1E9BA 3HKEB 4MWCA 4TQAA 2I4LA 4GLBA 2D2XA 16PKA 1DJOA 2GM5A 2Q62A 1W96A 1SXGA 3A7EA 4Q16A 2FMTA 4GMXA 1Z5PA 4AXBA 1T1RA 4MHOA 2CHQA 1JDPA 1QTRA 1W4CA 4GE3A 4QOIA 5ALDA 2R7MA 1RRMA 4QOGA 2CZCA 3HL4A 2J5QA 4FGJA 4XGKA 5IF9A 5DHQA 1RXVA 1TTTA 2BLLA 3RAFC 2WTXA 1CS4C 4JNCA 3JD2A 4JLAA 3TLZA 3JQAB 4BXOB 1YMUA 3AVQA 3P97A 4JP5A 3N7TA 3C39A 1WLYA 1DJLA 2A1TS 3KALA 1UXOA 4M7RA 2BMJA 2Y0PA 1DVRA 1RYDA 2EBFX 1YHZA 2OK7A 3QITA 4Q7MB 1VP3A 2BL4A 4MUFA 4PYIA 1DEXA 1XZDA 3M0EA 4RK4A 4LBYA 4D4IA 2Q2WA 3NFYA 1QHHA 4AF8A 1K8RA 3P9IA 4P4SA 4QRDA 5CFNA 3EZYA 2IF0A 3U9SA 4QVIA 3T0IA 2VQSA 2VHYA 3D3EA 3H18A 3I2FA 3WLFA 4EOGA 4JN6B 4N3BA 1RXWA 1DTWA 4LECA 1PSWA 3A3YA 1O8CA 1YC5A 3HJRA 2AWNA 5JI2E 2BGMA 2XMDA 1L4EA 1IN4A 2Z04A 4L75A 4UZSA 4G23A 5E38A 5TVGA 3WBJA 4RULA 4Z1OA 2XWJI 2EC5A 1JB1A 5BYBA 4DF3A 1FDVA 1W5FA 3OQ1A 1EFKA 2B83A 4MUEA 3QUAA 2IXAA 4X61A 3AVOA 5KVQA 3B1JA 3KPWA 1OMOA 1U1IA 1CJVC 5JO0A 3HDTA 1E79D 3DV0B 3O8QA 2GJSA 5F35A 2GBLC 1Z0IA 1ZQ1A 2EFCB 2ODBA 4P80A 4OHBA 3T5BA 2LWIA 3OJWA 3WNBA 1G59A 3NCTA 4XB6B 3AETA 3LQ1A 4MLCA 3QBJA 4PPFA 1TB4A 4JT8A 5LMZA 1XQYA 2GAJA 1QE3A 2QB5A 3C3DA 4RK6A 1IHYA 2WF5A 4I66A 3D1VA 3ZY4A 1VRVA 5GONB 1TFUA 1XXHE 1T6YA 2HQ1A 2WYIA 2YMLA 3OZCA 3OPYB 2ZZNA 2ODPA 3IQXA 3KV1A 3NOOA 3DTVB 2WD7A 5D01A 5CA1B 1GG5A 3TYXA 3HXLA 1N2IA 4CG3A 3CUTA 1K7FB 1V3UA 1XTTA 2IZ0A 2QTHA 4JI4B 4I99A 2NUTA 2CGEA 1ND6A 3EXIB 221PA 5DHPA 4LISA 4IUYA 2JBWA 3R0QA 5H81A 1XTZA 2O9JA 3GUHA 5KB3A 4ZKDA 1GY8A 4H1WA 4RNCA 4FNAA 5B6JA 3COJA 2QD3A 5LBUA 2C9DA 2P2ZA 1VE3A 1W1WA 2KMLA 2XUIA 3KB1A 1X1CA 3QNMA 2IEAA 4N49A 4QRIA 2XB9A 3K5WA 3IE1A 1T91A 2WW8A 2Y1OA 2R4TA 1OX6A 2V0GA 1L5HA 1G5PA 5KTMA 5A02A 5TV2A 3KR0A 1Y8CA 1EQ2A 3EEQA 4AUNA 1TZCA 2WAAA 3RYIB 3SEAA 3KD2A 1PZXA 3DBVO 4IZIA 5LIPA 1MHPA 2ZGVA 2EJVA 1CY7A 1EFCA 1NRWA 1Q0UA 3DEJA 4KQXA 1AN9A 2MHCA 1C8KA 3FLMA 2AOUB 2L18A 2H1SA 3O26A 3IXQA 2HCRA 1L7XA 2F1RA 3DG9A 3GFSA 3QPAA 4WDRA 1JJVA 3FHLA 4WERA 1L7VC 3DZDA 5FI1B 4EUKA 4KZPA 5BWCA 4W1SA 1YS4A 5E6SA 1VE7A 4MW9A 4EY7A 2UXBB 3WGNA 5B30A 1H2EA 3TPZA 1GL7A 2J3MA 2HNAA 2FPGA 3IAS1 3CZRA 1VKZA 4FE4A 4MWTA 1L8LA 3MJHA 5E0KB 5LBTA 3P7MA 3R77A 4ZI7B 2Q6OA 3MILA 1UC5B 3OA0A 3OIYA 3F73A 3V1MA 2WSMA 4XVUA 1UMBA 2XT9A 1CEYA 4HQ6A 4TYPA 1C5KA 4LIPD 1EE1A 1WXGA 1WV1A 4KMSA 4JR1A 4BDSA 4CLDA 3CX7A 4RK0A 4PQYA 4LJ8A 3M1YA 5J43A 3RUDA 2OV4A 4LWOA 3FHTA 2RI6A 1ZLYA 2B1QA 3QLEA 1ONBA 2XHZA 2HA3A 1DBWA 4FGSA 4DSTA 1E0KA 1VZ2A 1G2IA 4L5BA 4UBOA 3SHVA 4PQEA 3HYNA 1DXOA 4ZOLF 4IDNA 2WAMA 5J40A 1U8UA 1J0DA 2Q21A 1ENYA 1NVEA 2EZUA 3PDIB 5CVDA 5H59A 3RAJA 2IHUA 3VO9A 5I45A 2FMIA 2ZIGA 3FFXA 1B00A 1EK1A 1XG5A 2WYVA 1ECPA 1JEQB 1OVGA 3NDIA 5T4FA 4YRGA 2IH4A 2ACEA 1E2HA 3H5IA 2HMTA 3C5CA 4M6WA 1C4OA 1M1UA 5BSWA 5EKUA 3HVUA 3QEBZ 1P6QA 2Q4OA 4C6TA 5LWQA 3FTQA 3EIQA 3K6JA 3H4VA 3IDZA 2OMEA 2ZB3A 3K09A 4ZVVA 2V98A 3S55A 4C76A 2P4EA 3K73O 3OTQA 4MWZA 2XMCA 3A25A 3JQQA 4JKYA 4M8KA 4ML3A 4MV8A 5ERYA 1PT9A 2YNMD 4QPZA 3WGJA 4IZ6A 4ND4A 1EM6A 3FRIA 3RUAA 3D3NA 4WGGA 1A4UA 1L4KA 1SVSA 1FP6A 1QKKA 1AQ6A 3E18A 3GRRA 3UF0A 1CY2A 4MCIA 5KTTA 2OFPA 3NONA 2NU9A 4P32A 3QMPA 3QLJA 2G7MC 4NMHA 4GEGA 4HB0A 4JT9A 4Z4IA 2V5VA 4B79A 5HFJA 1KYXA 3JRXA 1XJQA 3L7MA 4CCYB 5DHRA 3WGVA 1H8ED 1FXWA 2NPIA 3D59A 3LK7A 3LX8A 1OFHA 4JYMA 4TRRA 5HE8A 1P1FA 5BSVA 5IYZB 3BD6A 5KX5B 1MFZA 2I7VA 2O2ZA 1PJAA 5AKKA 4AQ7A 4BN5A 2CLFB 1KOJA 1WV0A 3MUFA 2EVWX 3ZGYA 4H77A 2G67A 1II0A 4NCKA 1M2WA 4RETA 5EXDA 1OFVA 1KSGA 2IPLA 4OMCA 5K2MA 1G42A 4P92A 2R751 4RDXA 1WZEA 2AKAB 2HXGA 4WE3A 1X8JA 4YO8A 1NULA 1O2DA 3Q12A 1P91A 3O9MA 1TLFA 2LKCA 4OJQA 4PHHA 3PSAA 2GZDA 3BGVA 4PPQA 4JBNA 3S4YA 3WA6A 5JAPA 1NNSA 4MI6A 4KR3A 2OLJA 3W1WA 3DGFC 2HBRA 4ZU6X 4FM9A 4ZV7A 4D8VA 2XMSA 1G5HA 3JRNA 1XCGB 3GU3A 4PY2A 2ZJ8A 4ZGBA 2JLVA 4U9HS 4EATA 2HMYB 3C6XA 2ZM5A 1RC8A 3X2SA 3OE5A 4NAUA 1D9ZA 2JATA 4Z2YA 5K01A 3P8ZA 4TN5A 1KE2A 1PSDA 1JU3A 1S6YA 1SO8A 1YH3A 2RHRA 3C6ZA 4AKTA 5K5EA 1BRTA 1BX1A 1NAHA 1PO7A 1G21A 1R0RE 3N8IA 1E1RD 3OCVA 4DLUA 4QAQA 4J4HA 5LYJB 3E3NA 2G09A 3EOAI 4AY2A 4HNTA 1I9CA 3SIPA 2O5EA 1T3TA 2NPOA 2LNDA 2RK3A 1XCPA 3IAAA 4A91A 4P9NA 3SYLA 3S1SA 3JQ8B 3N70A 1UJBA 2W22A 3RYTC 3IEPA 3TVDA 1KEZA 3C6QA 4BPBA 2B9EA 1OZFA 1KF0A 3ZOZA 3NM4A 1UH5A 4WNYA 4WVFA 4Y2PA 5FIUA 3GLIA 5BSMA 1F51E 4IV0A 4K46A 5A5FA 2PT7A 3LTNC 3JAKB 1YKSA 2PQ0A 1WU8A 4D43A 2XGMA 1S3FA 3IOYA 4GS5A 3QELA 2FE1A 4C20A 1ESMA 4NBKA 3H2YA 1YQUA 2K6GA 3CW8X 2H85A 1U3CA 4NMWA 2WSYB 3UVEA 3RWOA 4EA6A 3NT2A 4HAUA 3JASA 2FUG1 3AYZB 1A9QA 2IYSA 2JFUA 4MYTA 4XCQA 1XJ5A 4P4TA 5BSRA 1EBFA 3U37A 1ZH0A 1KQFA 1RLTA 1GFZA 1LV7A 1F6DA 3IP3A 2YYSA 1OYVA 5C1IA 1JHPA 2X5JO 2XTZA 1BW9B 3PQ4A 1PYGA 3UANA 1P6XA 2MSEB 4I55A 3F5QA 4WBNB 3B3JA 2VTBA 4R2MA 1L5OA 4XARA 8ABPA 2MTBA 4MKRA 1CY4A 1MUUA 2CMDA 1PYOA 1YI1A 3SHWA 3SQMA 3OT1B 4GG1A 3G49A 1X7WB 3AEQB 3Q6IA 4DJ5X 3AHFA 4QTTB 4UC0A 1KMNA 5JE8A 2IYUA 3EZGA 2FOLA 2ZUTA 3SKXA 4AT1A 4FDAA 3ILSA 3EIHA 4F5DA 2HIAA 1CZRA 2ZE6A 3GPIA 5F52A 6NULA 3HP1A 4HOYA 1XRQA 1WIWA 3PR2B 1SA0B 3G2MA 3O4JA 5CNIA 3DW3X 4WESA 3ZWOA 1CWUA 1NW8A 1E7RA 3EIFA 4HZUB 3KZCA 3NH9A 1CR1A 1TYEB 4BWYA 5C8ZA 3TNFA 4N82A 2XA2A 5IXSA 4ARBA 1KZ1A 4AROA 4ZICA 3TFOA 1P9RA 1O54A 2REQB 4B44A 4E70A 5BSTA 2O2CA 2OORA 4RZ2A 5KUTA 2DBVO 2C2OA 1I3CA 1DXYA 1K06A 1ZJ6A 2AG5A 1VLZA 1PYDA 2Q50A 1Q12A 4RQUA 2VSFA 2VQEB 2K5UA 3LYAA 4K0KB 1E2DA 2ZBDA 2YN4A 1OH5A 2JCYA 1V5EA 5E9WA 1JRLA 3BAZA 3WWEA 4IDBA 5BMVA 2EWVA 4PXAA 4A6EA 4YECA 3AKYA 3EOBI 4XM0A 4ZT3A 4B80A 4FYYA 2GPBA 1O8BA 4XLLA 1JFFB 5ALUA 3DOOA 2BYTA 2YIJA 2R87A 5ERXA 2VSOA 4D3FA 1K66A 1UFKA 2QVYX 5TT1A 2QEQA 3H4TA 2DBZA 3KP1A 2A9RA 2ZQYA 3H1BA 2JEYA 2PX2A 3SHFA 5I51A 2FFAA 1XDBA 2WD9A 3HMKA 4AVYA 4YRMA 4AKIA 4PRZA 1UAYA 2JJ1A 4MS3B 3EQ8A 4C7KA 3MQ2A 1XZ8A 3BWYA 4A1OA 3K6SA 3RSZA 4BO7A 4BLTA 2JFQA 3SC6A 1H42A 1XZKA 1YS2X 1XRNA 3G2OA 1MX9A 1WDWB 4CIAA 6ADHA 1Q0RA 4RDIA 5LCXA 4YJ2A 3NHAA 1RAEA 4FZJA 1BNCA 1LRKA 4H6WA 4LJAA 3QIAA 3SYKA 4BTEA 3PNKA 4KX3A 3EH2A 1QH8A 1HEUA 3KXDA 3SJAA 1EBUA 4NJEB 5EP1A 2B5WA 1GV0A 4BYGA 4DDMA 4J16A 5B4UA 4MRPA 3TWOA 2QVLA 4S35A 2VPZA 3FZGA 2RHCA 4I0WB 2HA5A 3RU9A 4CMCA 1ZIDA 1ZONA 1ICEA 1UIMA 4FR5A 2CJFA 4LJLA 4NQRA 1VC2A 5FBKA 3G8YA 3NTQA 4WUTA 4RIGA 4CNQA 4D4MA 4JKOA 5HKKA 1R4MB 1XEWX 1IN6A 1RXCA 2CJPA 3CG4A 4JR2A 2XTMA 1B15A 3E8MA 1JXQA 1V8ZA 3HB4X 1IBRA 4MWBA 4IZOA 2PN1A 1O5TA 1ZL0A 2VNAA 4QXMA 5EXPA 3JVEA 3PC6A 4MVJA 3QFTA 4HGOA 1EVEA 4BUCA 3AVUA 2RMKA 3T3MB 3T9FA 2BFBB 3JYOA 3LHIA 3T1NA 4EZIA 1A9RA 4IIYA 3A6JA 1USGA 3CUWA 4EG8A 1P61B 3W2HA 4HDKA 1I2BA 3L43A 3L1HA 3MTBA 1JS1X 4CF7A 4LK3A 1UOQA 2OO3A 2NYUA 3KIPA 3C5WP 2RGBA 3L3BA 3HKCA 1E8MA 1QOQB 4YQYA 2G71A 1CB0A 3M4NA 4ID9A 3STVA 2NV0A 3G6KA 1YTLA 2D2FA 3WHKA 3WK9A 1RIFA 4BVFA 5EFOA 5AT1A 4P98A 3FDZB 3RFVA 3H2GA 2XWSA 4CHGA 1EUCB 3AU9A 5KNCA 4XR9A 4DHWA 2QTAA 2WHQA 4NBSA 4LGYA 1XXHB 1MX5A 2JANA 2B5OA 2HSEA 1E3WA 4G5XA 5BSFA 2R8BA 4YAGA 5HZGA 2FY8A 3AKDA 3I58A 5DTIA 4HYEA 1LQUA 5ELXA 1Y4AE 3JV7A 4D6PA 1SBIA 3V46A 2YV1A 3VDXA 2GZRA 2X40A 1M83A 4EJ6A 1MMFB 3IR6A 1EK0A 3JVUA 1FMCA 1RFLA 1XCOA 4IILA 4RTLA 3B2QA 4GKBA 2YNMC 2D3TA 1TC1A 3H13A 1PFWA 4C1BA 1U4SA 1FW8A 2ZYAA 3K9WA 5CJJA 3AY7A 2JH9A 4P4UA 3NU1A 3WFIA 5I7AA 1MO2A 2XWPA 1XCLA 4AS3A 5DNVA 2DUWA 4CMBA 2EF0A 1VECA 4XQ9A 2F9LA 2PKQP 4K86A 4NBLA 4NONA 4UVIA 1J06A 1CPYA 1EQUA 1K86A 1SC1A 2V7WA 3NVAA 1HXHA 1V8BA 1FFXB 3ACCA 2XB6A 3SOZA 1GKIA 4Q34A 5EFZA 3BHNA 3M4JA 3ZZMA 4B6QA 4CJXA 3ER8A 4ATNA 4FR2A 3OU2A 5CTAA 3RYFB 3UK1A 3Q4GA 4FYXA 4L0QA 5KNBA 2XXBA 5ABPA 5ED4A 3P0HA 3B2EA 2HMAA 2B4QA 3OCXA 4JEHA 4JVOA 5CNJA 5IMBA 3RGGA 1ZEMA 2FPRA 3ZHVA 3KT3A 5DM1A 3QQ5A 3BTUA 3QYPA 4FHGA 1GCUA 1XBTA 5CR9A 1W85A 2YVUA 3CS3A 1N3YA 3L8ZA 3LXXA 4FI3C 5EMMA 3U4HA 3JTEA 4RZSA 1VXOA 3GARA 2A1UA 3PHJA 3ME5A 1DBSA 1H69A 5DHUA 4E46A 3VOTA 1ZVQA 2Y2UA 3CF4A 4YAJA 4IGKA 4DKXA 5HUJA 5JZVA 3FX2A 2V96A 3AHCA 1DG1G 2JHPA 4BLRA 1VPLA 4KODA 3EBPA 1Q1EA 3JD3A 4UJ5A 3FVTA 5DYGA 4A1FA 3D1JA 4FBLA 1RSZA 4KAAA 3UFXA 2B2XA 3RUIA 4FUTA 2WIGA 4QOJA 3GNTA 4KKXB 3AO0B 3RSLA 2C04A 1QR2A 2SCUA 2I1QA 3D2CA 2QENA 3JQ7B 3O1HB 4PX9A 4UEOA 4BYMA 4IJ5A 5BR4A 1OF1A 121PA 1OX4B 6LDHA 4IGFA 1C50A 3K0CC 3EIUA 4JASB 4OQZA 3GRZA 4RD2A 4Q9NA 2COUA 5DIZA 3EXEB 3G2IA 1RYBA 3NTXA 1D9XA 2FI1A 5DOVA 5KU1A 3EARA 1E20A 2VZEA 1ZBQA 2R1VA 1E9EA 5AKJA 1U63A 3LTEA 2ZVDA 1EU1A 3B1VA 3I37X 4PQFA 3A3PA 3L7NA 5ECGC 4FNGA 3QXXA 1IN8A 1P9WA 2AZDA 3H6HA 3I6YA 1OYOA 4QUEA 4R68A 3KSRA 1OWNA 3BG5A 4W6QA 5EZ5A 1ZJYA 3RB8A 4DIEA 5CEFA 621PA 4TZ0A 1A71A 4L4UA 4C2AA 5J9FA 3EXHA 3FUTA 4C4OA 3QW2A 4R3NA 1OYYA 3UYKA 1MXFA 3FI0A 5K0BA 4TTSA 1FRQA 3JVIA 3ANLA 1XQ1A 3E9RA 4Y2TA 5ALHA 3TK1A 3LUCA 4IIUA 3VR5A 1V8FA 2R2AA 5DX8A 2QJFA 2AVDA 1ULUA 1ZESA 5ESDA 4HXEB 1QIEA 4MVWA 4YK7A 3KOYA 1E3TA 2HZBA 4QT4A 1SZPA 2Q41A 2EIXA 1S4MA 1ODJA 1WVMA 1HGXA 2ALJA 2HT1A 3P9XA 1OFTA 4RS4A 1EGVB 3CMMA 2CDBA 3PQ3A 1FPQA 3CU5A 4JC8A 5TQ2A 5K6AC 2XR1A 3AL0C 1INLA 5SY9A 3EUEA 2RHTA 3T1VA 3IUJA 1M0WA 3MAGA 2QROA 4BQIA 4F4FA 1H4QA 2OYSA 3UHAA 1Q22A 4KKVA 4IGEA 1DKNA 2VYFA 1MVLA 2RKBA 1XA3A 4GLFA 1FFEA 3DBRA 3U7FB 2YZMA 4FDLA 2H7YA 2IPOA 1TGYA 1HT2E 5B2ZA 3H11A 1SUCA 2FX5A 3C3YA 4TUYF 1KOLA 2NW6A 1H2FA 2JKYA 3WR5A 2Q0QA 2XITA 4M99A 2XRZA 1WB6A 4ZALA 2A86A 4IQFA 3UPDA 1DFIA 3P0RA 4PNZA 3QPWA 1T9DA 4KOAA 2H4WA 2UYOA 2GM3A 4CIDA 3IJRA 1QGUA 3FPGA 3SEZA 3TSAA 1HRKA 4JP8A 3WWDA 1WBDA 2B61A 3HU2A 4INPA 1BCRA 2JFNA 5T4BA 3U3RA 4IHQA 3FDIA 5JXIA 2WTBA 4JJ8A 2I71A 4GPZA 4JVLA 4DJEC 3TDMA 3K9GA 3VNSA 2C8JA 2VP5A 4LX8A 3L4KA 1EIWA 3K0AA 3L6UA 3DZKA 2W8BB 2V9PA 5LXTA 2HGZA 2OZVA 1ULZA 5LQSA 5ALRA 4R0MA 4GX5A 2O14A 2PH1A 3KT0A 4J76A 1Y0BA 5AKIA 2HM7A 5L4SA 2ZRHA 3PIIA 3M4XA 4QUGA 3KBBA 4WOKA 4F56A 2GWHA 1UXKA 1J8VA 4M87A 4YJ3B 4AMBA 5JIBA 2X2PA 2WVGA 3RKRA 1F06A 1RRFA 3AW8A 4Q5IA 4W8HA 2I7XA 3H6KA 4LCEA 1O6CA 3AEUB 3LVQE 1M73E 4WQMA 1R74A 1WLSA 1JIJA 2VBCA 3I6BA 4D79A 3AF6A 5JCJA 2XE6A 3EHEA 2EP7A 4GSLA 4LNHA 1XT6A 1XZFA 4YVFA 1A88A 2EG5A 2HFJA 4KV9A 1G9SA 4LMRA 4RTQA 5MFZA 1Z2EA 4JKIA 4QYWA 5LC1A 3AV0B 5JHHB 1COWD 1QQ5A 4UQPA 1ZMRA 5A2GA 3OF2A 4WMLA 4P0TA 1LDEA 4L74A 5D5PA 2ADMA 2HQSA 3DO5A 2D1TA 4N48A 1SG9A 1UK7A 1R6TA 4FJ2A 4AMVA 4F2HA 3PFIA 2RGAA 4JLVA 3PENA 5T8KC 4EI2A 8ATCA 2VWHA 3EMDA 3K8OE 5DWDA 5ICFA 1YZYA 4DCOA 2FQYA 3F6BX 4J0JA 2NVUA 3TLCA 2VQDA 5JXWA 1QP0A 3AQ4A 4TS3A 5FL3A 3EEIA 5LNK6 1QQAA 1OXTA 2RG1A 2AYXA 4FDTA 1Z8FA 5KC9A 1A9XA 4GKVA 3FFTA 4LHYA 4X1KA 4A8HA 2Y67A 2CK3A 3A4MA 2IH2A 2F3UA 2VDWB 4WZBA 3ZY5A 4JROA 1IU9A 1QDEA 1DINA 3VMMA 5FWXB 4DL9A 3ABZA 3GLQA 4ODIA 3ZZNA 3SQLA 1WW8A 3ZDFA 4QTYA 3AUAA 2IYQA 2LRHA 4JCCA 3IEUA 1DEOA 4MJ3A 1B7GO 1XVAA 3ZY6A 4EFDA 3I0NA 1JMKC 4JJIA 2CL0X 2DH6A 4N3GA 3WWYA 4CKYA 1AQJA 5DLQC 4LRWA 3JWJA 2R47A 3TLGA 2P9FA 2XECA 2HLPA 2V1UA 1BKDR 4RF4A 4WACA 3F5DA 4K6KA 5HOEA 4BE9A 1XU9A 4R5MA 4R83A 3T7EA 2ACWA 1P2DA 4KGZA 4JQYA 2QX4A 3EVDA 5I3ZA 2J3EA 5JJIA 4K6FA 1CLUA 3HXKA 5CT5A 1GP2A 1NR5A 3WY9A 4GM4A 1BJKA 4XSVA 3RRBA 4B6RA 4ZEXA 4G9GA 2OC4A 3GPBA 5KSPA 3WNQA 1U3TA 1ZL2A 3DMPA 3I9KA 2C98A 4PANA 4J2OA 4FWTA 3OD5A 4NE9A 4G1FA 4AKEA 3W5JA 4CMIA 2A9QA 2OD7A 1EPUA 3LOQA 2ONKA 3ADBA 2VDKB 1IEWA 3QI7A 3HUDA 3S2IA 1W4AA 3CT6A 1L3IA 5E1DA 1ORVA 1NSYA 2RAFA 3H9CA 1FJXA 4B3TB 2VHZA 2WUEA 3SZ3A 2HO5A 4I5IA 1DT5A 2GEDA 3TZHA 3D2BA 2PEZA 4O59O 4OO3A 3BD9A 4BNDA 4C1NA 4CYMA 2GBPA 3KT8A 2VP9A 5ENZA 4HAOA 4A8JC 3Q98A 2Z1NA 4FDMA 2PUCA 1IQRA 1NGSA 4S2UA 2O5RA 1DCMA 1RQPA 3L77A 3G9ZA 3W9UA 4CKBA 1SKYE 1CUIA 1LSUA 3Q41A 3WVNA 3G2JA 4KQEA 1Q1GA 2QNIA 1RKXA 1OZ0A 4CNBA 4EGAA 2RC5A 2BTQA 5EJMA 3S0JA 4URXR 1ECLA 2IZOA 3OOEA 4AJ4A 2XRMA 2VK8A 3DXFA 4TS9A 4TPKA 4FQ5A 3VOAA 4LWPA 3ZTWA 4JFRA 2GZ2A 4OATA 4OXRA 1BDBA 3HUFA 1HDOA 2I4MA 4OBEA 3DZGA 4LY3A 1FFWA 4V0QA 1CERA 1TUIA 2KS6A 3PQ2A 3U81A 4AKHA 2OV1A 2ZTHA 4JP1A 4Q39A 3RS9A 3ZHCA 3BULA 1QG4A 4JQZA 1C4XA 2R84A 5KHOC 1WU7A 1CQIA 1JJBA 3GLHA 4LS3A 4WCFC 4PYOA 3RF7A 3I9MA 1NHWA 4QYIB 4BP1A 2VHVA 3GLRA 1AF7A 1GTG1 1T29A 5KAMA 2BC9A 1XRJA 3E0XA 2FSSA 3JQBA 5E2IA 2QTGA 1Y3IA 4RTKA 3SNHA 1WA5A 3KO8A 3BMCA 1AT1A 1MBZA 2RJ3A 3Q7RA 3SEFA 3CR8A 4YRZA 5CDFE 1G1AA 1ORIA 1NJGA 1PZHA 3F8SA 4XGIA 4E30A 4ENQA 3LP6A 1Q0TA 1GV1A 1F0KA 2VZ8A 4CTJA 1C3VA 3UMJA 1WEKA 1K0FA 4D6YA 3D6TB 4ENPA 3N59A 3BMOB 1ZLXA 4WKCA 3C5EA 5CVJA 2GLUA 1EGHA 2WJZB 4DW8A 4FFLA 2A4KA 4HB2A 4CGZA 1RJ9B 1T6ZA 4B35A 1VMAA 2PWAA 4EQZA 4KX5A 2J9FA 4CQJA 1Y81A 2QK4A 4C7BA 3HDYA 5F7XA 3QU7A 3ERCA 4Y2QA 1V2HE 3HA5A 1NW6A 1RHJA 2FXIA 4BFCA 1JVNA 1NQ5A 3VZDA 1E2QA 4FYIA 2X9VA 4URZR 4A2QA 5EIBD 1WHSB 2ODTX 1I5RA 2VKTA 3ZWCA 8AT1A 4W8GA 3M6XA 4RH0A 1D6JA 3FTEA 1B74A 4LVOA 3QA3E 2BFEA 2G8NA 2JDID 2QUKA 4CF3A 2O8CA 4QOFA 4LV6A 3OQOA 3PFGA 5TX7A 2W2XA 3B48A 1EK6A 5EWMB 2WKRA 3B3AA 1Z4NA 2OQIA 3GH3A 2W98A 1VLLA 4Y1GA 4MCAA 3ADCA 2BEKA 1PJRA 3FY4A 4EHNA 3SM3A 1FRVA 3ZHUA 5DNCA 1X6VA 1KA9H 1GPH1 3TIXB 3VRHA 1LPSA 4IVPA 3FNQA 1G8YA 4MJXA 1ZUNB 2AA3A 3OUTA 4CM4A 1M2OA 1EUDA 2NM0A 3UB3A 3KQOA 5JS7A 2YKGA 1IQUA 1YRLA 3IJEB 3NXKA 4IX1A 3EE6A 3UQZA 1UFQA 3QUQA 1M7BA 3B12A 2GNPA 3ESQA 4IS3A 3R3ZA 1P3JA 2EP8A 2P35A 3BFXA 4RVSA 1UBUS 5DLPA 1Q11A 2MINB 4TOIA 3LK6A 4JI0B 4WOCA 1ISIA 2AMYA 2V54A 4JHXA 5JJCA 3EUFA 5L3SA 4NARA 1HDYA 2RHWA 4G9BA 5J4KA 5CNMA 1HV8A 5JSYA 1ZSYA 1A1VA 3OCCA 4N8EA 5K51A 5U1PA 5LOVA 5DX1A 1GA6A 3I32A 2VDNB 3LMKA 1NKTA 4LTNA 1CRQA 4YDRA 2GCEA 1QH1A 3SICE 1KAMA 5A6VA 2YXLA 3ENNA 2XDQA 1VHJA 1O5IA 2V7QA 4I1OA 4L50A 4NCNA 4WN9A 2WG1A 2HA7A 1WMDA 4FIDA 1E1KA 1NN3A 1KMHB 1JILA 1HZZC 1QUFA 1UOPA 2FPIB 2H4FA 2R8OA 2WDPA 2PXHA 3M89A 4G