4D8WA

Salmonella typhimurium d-cysteine desulfhydrase soaked with d-cys shows pyruvate bound 4 a away from active site
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
328
structure length
327
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords D-Cysteine desulfhydrase
total genus 120
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8wA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8wA02
4HT3B 5I7OA 1A50B 2C2BA 1K7EB 3IAUA 5CGQB 3AEYA 3SS9X 4I1YA 1K7FB 2ECQA 2CLLB 1TZMA 5I7HA 1KFJB 1QOQB 5BW6B 2Q3BA 1O58A 5D86A 5DW0A 5I7WA 2ZR8A 1WBJB 2CLHB 1UINA 2DH5A 5DVZA 4D9IA 4D9FA 1A5SB 1E5XA 2PQMA 2GN0A 1UIMA 4OREX 5D85A 3RR2A 3X44A 1KL7A 2TSYB 5DBEX 3VC3A 3PC3A 4L0DA 3TBHA 3PR2B 5IW8A 3SPXA 2BHSA 5B53A 3V7NA 5B36A 1BKSB 1D6SA 4D8WA 4Y6GB 1KFEB 1PWHA 4H27A 5B3AA 4D8TA 3DWIA 3VBEA 3PC2A 2JC3A 5D87A 3VSAA 2GN2A 4OFXA 4HN4B 2CLOB 4AIRA 1V8ZA 2J9YB 5IWCA 1X1QA 5JISA 1A5AB 2BHTA 2WSYB 4L3VA 1WDWB 4LMBA 1Z7YA 4D99A 5EY5B 3L6RA 4D9BA 5B55A 1JBQA 5DBHX 2Q3DA 3R0ZA 1Z7WA 1V71A 1WKVA 3L6CA 4HO1X 2TRSB 1K8YB 5I6DA 5IXJA 4WX2B 3PC4A 1TTQB 1TDJA 2GN1A 3IQIX 1P5JA 3FGPA 4D96A 5KINB 2O2JA 2ZPUA 2EGUA 3DKIA 3HMKA 4NU8X 4D9CA 1UBSB 1VE1A 1K3UB 2RHGB 3VSDA 3VSCA 2CLMB 4JBNA 1TZ2A 2ECOA 5B1HA 4COOA 1TJPB 1QOPB 1C8VB 4ZU6X 1KFBB 3X43A 4D9MA 5D84A 5I7AA 1A5BB 5DW3A 2Q3CA 1F2DA 4QYSA 4D9EA 4D92A 2C2GA 3L6BA 1J0CA 1VB3A 4D9NA 4KKXB 1RQXA 1J0DA 3CEPB 5J43A 3AEXA 1FUYB 5T6MA 4AECA 3BM5A 1Y7LA 5CVCA 2RH9B 2CLFB 1VE5A 3DWGA 1C29B 2TYSB 1K8XB 1CW2B 3FCAA 4ZU1X 4HPJB 4L28A 5JJCA 2D1FA 1TZKA 2CLIB 2CLKB 4IL5A 4D8UA 1TYZA 1TZJA 1WTCA 5J5VA 3ZEIA 4LI3X 5I7RA 1K8ZB 1TTPB 2ISQA 3IQGX 4XUGB 4NEGA 2J9XB 2EFYA 5E0KB 1BEUB 1KFCB 2V03A 2O2EA 3T4PA 5KZMB 4PCUA 4ZQCB 4F4FA 2RKBA 1FCJA 4LMAA 1J0BA 1C9DB 4HPXB 1J0EA 3IQHX 4L27A 2J9ZB 1CX9B 5C3UA 1M54A 5HBGA 3R0XA 1K7XB 4JBLA 2CLEB 1OASA 3SS7X 2ZSJA 4D9GA 1KFKB 4D97A 1V7CA 5B1IA 4D9KA 1PWEA 2DH6A 1J0AA
chains in the Genus database with same CATH superfamily
1GZDA 3PB3A 1BC5A 1F06A 3MAJA 3KQHA 4BPRA 4O08A 2BI4A 5GM1A 3TLCA 4EQ6B 2FDCA 1VYVA 3LC7O 1AUQA 3S8MA 2AA3A 3CPEA 3DUWA 3E81A 4HDRB 1JWAB 3RVSA 4MB6A 2CV1A 1X6VA 4EHLA 1VMAA 3JX9A 2ZR8A 5AVQA 4B3TB 2OFFA 8AT1A 4CPDA 4K6HA 3N39C 2XE4A 2J33A 2OHIA 2C3OA 3BERA 4M1TA 4WA8A 4KBYA 4DRYA 3HYSA 4M0KA 1DOHA 1Z4OA 3V2GA 3W0LB 4RHXA 4IEFB 4BN0A 5A62A 5JZBA 3UH0A 5CJJA 4BNTA 3W6OA 5AKGA 1T8TA 3CWZA 3ORHA 3PJFA 4P84A 5P8WA 4G0MA 3I83A 3OH8A 3TNDA 3DH0A 1SBQA 3HXTA 3DWFA 4QYWA 2D1SA 3EE6A 3N9IA 3QEMA 4TYMA 2ZSIA 1O89A 1Q0QA 4IYJA 4D57A 1MDBA 5BW5A 1Y9ZA 3PA8A 4V39A 5C18A 3OQIB 1M34A 3O3OB 3DDZX 3HK2A 3LXMA 2XUGA 2EL7A 4QQ8A 2BHTA 2WZDA 4TLLB 1N2JA 1Q3KA 3KVVA 1XZLA 1PK9A 5DFAA 3RTEA 2GFIA 5IUKC 2C2YA 2C7RA 1QCYA 3MMSA 2X5OA 3O4FA 1XNGA 3OLCX 5KTYA 1PRYA 1Z73A 4RK5A 1REQB 4O4IB 4IX9A 1CVRA 4BQNA 3ILXA 1O95A 2C0CA 4N5DA 4AO7A 4DQLA 4Q9AA 5I6DA 1DLIA 1OTXA 5A5DA 1BHO1 1DHTA 1Z29A 3QXXA 5SZHB 4K1LA 5M29A 1ZINA 2NZVG 4DRZA 1OGJA 2GN1A 5JANA 2DPLA 2A6PA 1VJ1A 4RL6A 3KDPA 3OZWA 4K9LA 1NP3A 2A9KA 2D2IA 2H4WA 2AMLA 4UHCA 5F78A 3TWOA 2C2OA 2ZITA 4X93A 4NDZA 4O3FA 5IXSA 4UJ5A 3GYBA 4PHGA 4IXNA 4ZYUA 3HB9A 1XNHA 3F98A 1USIA 3I4LA 3PKZA 1W19A 1GPWB 2GGSA 4WNAA 2P75A 1ZW1A 4FW8A 3WOHA 1WB6A 3RK1A 3FSRA 3PXCX 3BBPA 7REQB 3MCAA 5K6AA 2DBZA 5E95A 2YW9A 2R79A 2HO5A 3NJ8A 2ENUA 3SN6A 4C5CA 3UKDA 1C1HA 3LIIA 2ZYHA 3PNYA 3UAZA 2Q8NA 5IM5A 5T41A 1E3EA 1YQXA 1UBNA 2ATCA 1SA0B 2D13A 2AOUA 1CJTC 3EQ8A 1RI1A 3EXEA 3Q0EA 4HFRA 5WRFA 4ZGBA 1Q0TA 2CV0A 3C7DB 4C21A 3FCEA 2IYQA 5K8CA 4R2HA 1Z4KA 1Y5IA 5CB6A 1GNRA 1OBHA 4PC2A 5IRCD 4N47A 1E89A 4GOXA 3PNVA 1X1BA 1GD1O 1V6SA 1CD5A 1SCNE 2YDYA 5DU2A 1E9FA 3OJXA 4P6VF 3ZE6A 5J2UA 4NH4A 2DC1A 3JQ7B 3K5HA 3AFOA 4KR0A 2VHUA 4COKA 1IHXA 1L5QA 1IZYA 2ACEA 1ZHOA 1R6DA 3PE3A 1Z6PA 2QX9A 5DP2A 2NSJA 1SVMA 1NWHA 4JUAA 2Z43A 5FLKA 5LNK1 3CSSA 3HCWA 3DVQX 4YR7A 3MAAC 5KSOA 3AG6A 2J48A 1HNWB 2OBNA 4KV9A 4YAEA 5GONA 4AMYA 5LQSA 4RAQA 1CRQA 3B13B 1JR4A 1RBQA 5EJ6A 2PFSA 3CTPA 4UFOA 4DGQA 4DILA 4U39A 2JLBA 3JQ7A 3IR7A 4GPBA 4V2UA 5A3VA 3T7JA 3FFBA 1O03A 4B6GA 4D3SA 4LWOA 2C9YA 3DMFA 9GPBA 4DR7B 5C8VA 3HXPA 1NOJA 5JZ9A 4BKMA 4Y0AA 4B5KA 2G9VA 5KYUB 1Z12A 4MVJI 4KLZA 4UBMA 2Q8QA 3ZE2B 3G02A 1KEPA 2JANA 1AZSC 2NZYA 4AZ0A 4ARIA 4ZOLF 1D6NA 3QJYA 2ICAA 2ZU0C 1FDRA 2EQAA 3NOQA 1DBPA 4N7RA 1E2PA 2XOKA 5B6PA 2QUAA 2XMGA 3I8OA 4DLXA 4D5GA 1DWPA 4YP1A 1MX3A 2MINB 4P4UA 5DCYA 1DKQA 1XB2A 5CCBA 3WWEA 1VPTA 1QFYA 4TSFA 3R7AA 4G0XA 1EVLA 1WZUA 5AK0A 3D8BA 4TUYF 1AMUA 2P79A 5IN5A 3LF2A 1FRQA 4DMMA 4XJXA 2V7QA 3N2YA 2QU8A 4XIIA 3L1IA 1TAQA 1F9EA 1YJ5A 1ZU4A 3CONA 3SXUB 4GX5A 3RVDA 4EG4A 1LVUA 1RM4A 3K0KA 2HX1A 3PR1A 1VM6A 1YSCA 1XEWY 1KYXA 2ID9A 2PYZA 3AI2A 3HY4A 1PDVA 3LVBA 3P0FA 4KVGA 5C37A 4WA7A 3BREA 1N6PA 1MG0A 1XAIA 4KWHA 1Z18A 1X42A 3FD8A 3WYGA 4M0MA 1NG1A 1RKUA 1B2RA 1I4WA 1PJQA 2DTXA 3SC6A 1ECPA 1CS0A 1VBMA 3GN1A 1G20B 3LMKA 5CYOA 2M1ZA 1GQSA 3ZGXA 1OFVA 2WD8A 4PGAA 3W9UA 2VPYA 4TVSA 2BZ0A 3GCDA 1QJ4A 1X9IA 3HN2A 1XV5A 2YINC 3N2IA 5H0IA 1R0SA 1NMXA 3L0YA 4MUMA 3T5AA 2MYTA 1QH1B 5BR4A 1GRNA 3L0OA 1IRXA 1YFLA 2QMQA 4DUGD 2DUMA 1HDYA 1TCAA 4CNQA 2ZUUA 1RABA 1L7MA 1XF9A 1JMYA 2PZBA 4CKXA 1OFTA 3MAGA 1SXJC 3V1UA 4J0QA 1U7PA 2NSYA 4JWTA 1AGYA 4DZZA 3A05A 4PZUA 4LQCA 1NF2A 3Q9UA 1BN7A 3UMGA 2GNOA 1T6BY 1G7CA 5L4SA 1TZJA 3PLNA 3VR4H 3ZTWA 4EEZA 4F04A 4HI0E 3O03A 2VUUA 4B73A 2HIAA 3NHUA 3OFSA 2WUVA 1RWKA 5CCDA 1UQTA 3OHSX 3SMQA 3KB8A 1FFYA 1EYZA 1T5OA 3C6MA 4NPCA 2C83A 2CL6X 4RU1A 3O4RA 3DVAB 2UUCB 1RVV1 3CRNA 4FHFA 4N0PA 4YJKA 1IJFA 4JJGA 1BJTA 1XZCA 3DR5A 2IHKA 3KR1A 5EIAA 5TVGA 1ESCA 4NJEB 1MJFA 2C5GA 3HUDA 3O8OB 4AAYA 4DMRA 5HPYB 3WLMA 4DYDA 4D79A 1DIBA 1RWXA 1UFOA 3VR4D 1QHFA 2FEPA 4DAOA 1ZR2A 2ZTMA 1SVUA 2ZVQX 3AETA 5HKLA 4NCKA 5HNKA 2IZ1A 4NVRA 1F2TB 1N0UA 1IZ7A 1IY8A 4RD6A 2Q4RA 3ZNQA 1UKZA 3KLMX 3L0BA 2GEJA 4QQRA 1WX1A 2XYVA 1XEFA 2WTXA 1Q50A 1RE0A 2Q28A 4XX1A 2G06A 4JN6B 4K9KA 4DIMA 3I9NA 4QATA 2PQMA 3PIIA 4ILEA 4DXHA 4FNGA 2QZ9A 4X71A 3PEYA 4G0ZA 3VGJA 3B52X 3QEMB 5DNUA 1WXEA 1XJ5A 2DUUA 4RJ2A 5IF9A 3R7NA 1OWLA 1QNFA 2H9YA 1GZ3A 3GUUA 3QWFA 4HN2A 3T3IA 1CUUA 3NTVA 3NYRA 3I45A 4YRSA 3EWIA 1OAOC 4R81A 3KWMA 3ROFA 3HYCA 4QNNA 2QTRA 5E4JA 1ADYA 1O0SA 5HEKA 5A7GA 2W2TA 1DIHA 4HDCA 4F8JA 5MN5A 3OBIA 3F71A 3P2OA 4U0JA 1WXXA 1U2PA 4I2NA 1RWPA 1R74A 5BSKA 4BFXA 4LF8B 2DU8A 1T35A 3WFJA 1Q14A 1V8DA 5C1PA 3S8EA 1AKWA 4M22A 4RGQA 4DM3A 4X8OA 5A4MS 3VFDA 3GJ0A 3UEOA 4WOPA 4KQCA 2J5RA 3HBJA 3K0FB 1HE2A 5EPEA 1GSAA 2Q6TA 4Y0VA 2OCDA 2DECA 3ZGVA 3GLGE 1QH1A 2IX3A 3DFZA 5HM8A 2P9CA 1M74A 5ALEA 2MR5A 5CHEA 1OHHD 1U3UA 4QWMA 4TZ0A 1HA3A 3O75A 2BLLA 3I1JA 3PHCA 5LC1A 3T41A 1ZJWA 3GPIA 1CQXA 5AJYA 1ADCA 2ODAA 1TUIA 4YCCA 4LDJA 4BKRA 3ECAA 4P58A 3L4BA 2IW3A 2QY9A 5KX5B 3I3SR 4YLEA 2IS6A 2AQKA 1WP9A 3SFZA 3ESYA 3KSMA 4WNCA 4IHJA 4QNRA 3W6PA 1E5TA 1KYWA 1IJBA 2GCOA 2R6ZA 3TW8A 4PVCA 3T5GA 3HZRA 1EIZA 5CDHA 4UBIA 3WLLA 1UZMA 3L5OA 1E1CA 5ALYA 1RQ2A 1Z36A 4YO8A 1ZGZA 2ONJA 1PSWA 1K0UA 1J2UA 2RHCA 2XUOA 3UMYA 1XDUA 2NXNA 5G0WA 1A77A 1V43A 3EZNA 4UMEA 3PRKE 2VN8A 3IVAA 4H0FA 5B2FA 2X2PA 1T0BA 3I1YA 3CBQA 1XGKA 4FIDA 3ZWYA 1O9GA 2D3TA 2R65A 1YFKA 1TF7A 1A2KC 5NLLA 2V58A 4PSKA 1I4LD 4PONA 4WY2A 1C7EA 4R8SA 1LZLA 1A88A 3BJMA 2F8SA 4CG0A 4HLUA 2O2IA 3L7LA 1XPOA 3JYLA 3CO0S 3IRVA 1FVFA 2H2DA 3DTVA 4KPYA 3GD5A 5JSHA 1QC5A 1PR3A 1UKVY 5A3JA 5KDOA 2OP0A 3GFQA 1LF0A 1IH8A 2QX4A 3FHTA 1FTNA 3TLGA 3V34A 3JZAA 2P9FA 5DI3A 5ITWA 2ZSBA 2WIDA 5LP1A 1Y4ZA 1AIPA 3FBGA 3LPLA 5CU7A 3R40A 2I2BA 3WSWA 1AKYA 1GPBA 3U3OA 5BV2P 1WW2A 3ZGYA 3TE7A 3C4JA 2NVUB 2Q07A 3BGIA 3KAJA 2QR5A 3M5CA 3KOOA 2PS9A 1DG9A 3R7SA 4AF7A 5FEUA 3L1VA 3QVJA 4FLMA 4PHCA 3SP1A 1BXRB 4G0PA 4OHPA 3WGQA 2NO5A 1YA4A 3BK1A 5I7WA 2ZUBA 1XPJA 1UJ6A 1YZUA 1ZJZA 2HF7A 3M3DA 2NTNA 2ZS7A 1BDBA 1MH9A 4HN9A 3V4PB 1GGKA 2FUG6 4WMLA 1FDWA 1H8HA 1ZW6A 3M6XA 5EIEA 2J9FB 2XODA 4WRRA 2VTKA 4E6EA 3PNOA 1GRCA 3QP9A 4DLPA 2PIAA 2WV7A 3LS2A 2QUKA 3SS8A 4FBLA 1P33A 3VC1A 5CVJA 1PUJA 2XUQA 1NVMB 2V74B 1YZTA 2IYYA 1RRMA 3P9NA 3SQNA 4WK6A 3ESDA 1Z45A 4GL2A 3TH5A 2OUKA 4NXMB 1T4DA 1KOGA 2ZBUA 3RROA 1C3EA 2DT5A 4AJJA 3GLIE 2P8JA 2BMEA 3IVCA 4YAGA 3MJHA 1Z3IX 3OAAD 4GDFA 2CVZA 3VHQA 4CM8A 2CZGA 5JTUA 4RETA 3R75A 1H6BA 2PUVA 4FS8A 2JHGA 3B60A 4M8SA 3WYEA 1E3QA 1XLTC 2X58A 4II2A 2ODWA 4L3OA 1UWLA 2XNKA 5EHGA 4NYMR 5THXA 4DA6A 2FLKA 3FTNA 1QMGA 2X19A 4GI5A 3W5HA 2C2ZA 2O2YA 3CR7A 3EC1A 3LPAA 2VHTA 2IUFA 4ZO9A 4CWAA 4U0KA 1NBIA 2VHYA 2XVMA 4B7ZA 1RLUA 1T2FA 5FWXA 2OV4A 4BMYA 3KQMA 1IC6A 2EZUA 2Q4OA 2D2FA 2Q4DA 2WYWA 3AP1A 1RJGA 3DBVO 3ODGA 3B20A 4MWTA 4TOIA 4F72A 3UMMA 3VTKA 2D7DA 3PKIA 4UEQA 5DW3A 1ZPDA 3BWVA 2YUTA 3IODA 1TC2A 1KYTA 1E8DA 5CYGA 3QVLA 4BEBA 3KQNA 5I9SA 1TQ2A 1HZJA 1ZONA 1K97A 4GWLA 8GPBA 2JLXA 1XPUA 2FN9A 3R24A 3MJRA 4N18A 2R6JA 1WDKA 3QUQA 3UW1A 3PA6A 4C6TA 3D4LA 7ABPA 4BXOB 3NBFA 1OV4A 2FZLA 1G2OA 3K96A 1T34A 2HZBA 4JCOA 2WF7A 3ABQB 1YZYA 1ZK0A 4OYYA 2G36A 5ERGB 3RFCA 1W35A 4JU9A 4DCUA 4F11A 4WL0A 1OC4A 2GZMA 2J3KA 3LFHA 5IJAA 5LQAA 3NDBB 5HOEA 1S0UA 3BYZA 3A32A 3AKZA 4TKVB 2JFVA 3VDRA 2W4MA 1KSFX 1GGEA 2B4AA 3CISA 3Q10A 1WMDA 4TMFA 4XWYA 1EJBA 1JLRA 3IOYA 4AWAA 2GN6A 3AIKA 2FAXA 4QFMA 3NBMA 3UO8B 3WDSA 3BDVA 1I80A 4JKYA 3RSFA 1A95A 3JZMA 3IKJA 2I4LA 3G17A 1V39A 2I2WA 4WKPA 1VOTA 3KUCA 4M86A 2RD2A 3SKVA 2QY6A 5GONB 1OZAA 4HDNA 4L27A 4BNVA 3VR2D 1J9ZA 4HDMA 2PE5A 2IHZA 4F2WA 3O0DA 4HB2A 3A3NA 4KWEA 1D09A 4MKGA 3SJZA 1Q57A 1Y1PA 2EQBA 1HEIA 1Z75A 3CLRC 3OTGA 4MQEB 3T3DA 5KSWB 4MLDA 4ZVUA 1OT3A 3TW6A 2JFXA 3U7IA 4OFZA 4PVDA 2FW0A 2C0QA 2NACA 4CG1A 4MQ5A 4MUAA 3T9FA 4PRLA 3KKKA 5J2UB 4PN7A 5A2QA 1SG6A 2R8XA 1UBJS 1P9RA 4KIGA 3EPHA 2D5CA 3OX4A 5CR9A 5C8YA 4FI3C 5IM4A 4ZHQA 3GVHA 4N5MA 2YCBA 1W73A 4G1VA 3E9QA 4QJ5A 4U7FA 1N4AA 1KL7A 1BWPA 2IIPA 2GKOA 3EY9A 4UMFA 2BZGA 1VYHA 3GDWA 4M8NE 2AUMA 5KYYB 2V0GA 1MJ5A 2P8SA 1BGWA 3JQ8A 1XTTA 4Q4DA 5D3MA 4RKEA 4ZA2A 4LXUA 2IJGX 3CX8A 2JHPA 1Q5PA 1CQIB 1F1BA 1P72A 4NG4A 5T4BA 2P6UA 3DUFB 2OV6A 3KBOA 3S1AB 3R3WA 2FDXA 3S81A 4UFNA 2NZJA 3B9RA 4P4SA 5ALMA 3L8DA 2IPLA 1UMKA 3FLBA 4X62B 3LQ2A 3G7NA 2GK4A 4KBGA 4OQEA 2FUCA 3LQFA 4R7GA 1HWYA 3K35A 3FH0A 3N2KB 4X24A 3PXXA 2OWDA 4L15A 4L4UA 4X7BA 4ZQGA 2PS0A 2WT8A 5CYFA 3TD2A 5MDHA 3BFVA 2G07A 2ZYTX 2RB5A 1GNPA 1Z56C 2P2GA 3TI7A 3WTCA 2GJ4A 2QM3A 1P1CA 2RBGA 3CO5A 2VF2A 4HO1X 4LHXA 5JCXA 5KYWB 1MHPA 4BATA 2QJRA 2VTBA 4AJPA 1P60A 1R8QA 3IOBA 1Y37A 2LIVA 2LPMA 4NPAA 5KYTA 4MV8A 3DONA 3MERA 3IIKA 3LC2O 1GTRA 3BD6A 3U4MA 4GBJA 4HQFA 4URVR 1CDEA 4XQCA 1ZU5A 2FWJA 1CVLA 3FI0A 1ZH0A 3CUVA 3RVKA 5KO2A 4LWQA 5A3QA 3AEQB 5LFAA 3A6GA 2XUPA 1FYXA 3HVJA 1P7WA 3LBHA 4B3IA 4HB0A 4TMVA 3QKTA 1A9TA 3AP2A 3OLXA 4NQZA 4ND3A 1QFJA 2VATA 1QYRA 2WHPB 5GTDA 1BA3A 2IP2A 2BCEA 2ZS8A 3WLQA 2IU4A 3L6BA 2IS2A 4JYPA 5GVSA 4MIYA 4N1AA 1HYQA 3F47A 3UN1A 1T9CA 4IV0A 2ISSD 5IULC 1ABEA 1PZHA 1V37A 1N2ZA 4OGFA 1UDBA 2NTJA 4BFUA 1X92A 1O0CA 1UMBB 4IL5A 4LK3A 4MP6A 3K70B 3KBBA 1VLJA 1RWWA 3F67A 1RJ9B 4NZMA 3ZWAA 5JDCA 4JJ8A 4N41A 2QBYA 5DOZA 5AKIA 3SXPA 1MB0A 1SQ5A 5B2EA 3N5CA 1OTHA 4W5TA 2ZXFA 3A26A 1ONNA 3HO6A 2UKDA 4LUCA 3KPYA 2I4OA 5HUQA 5KNBD 2FCAA 1ZL0A 1C4XA 4HS4A 2JJYA 3KYJB 4CTOA 3JR7A 1P1JA 4GVPA 4JL6A 1N3YA 1V26A 4KNVA 4XX0A 5CLJA 3MCWA 1L7OA 4K6OA 1C9JA 4RK4A 3ZE0B 4D9GA 5JC1A 1V7CA 4HNAA 1PLJA 1XXLA 4CLHA 1XQVA 3HXMA 2Q5LA 2W2XA 4K9SA 2QN2A 4TZTA 4EA7A 1XU7A 4L85A 1GT6A 1JYEA 2O8BB 2F67A 2CNWA 3AM4A 1KEUA 3K09C 1ZI6A 3L05A 4Z7JA 4CI9A 2VDQB 3C7TA 3CPSA 4BO8A 3V42A 3K1JA 5IHXA 3NYIA 1H94A 1X7YB 5JBNA 4M99A 2WIKA 1EB9A 3STVA 2WSIA 2YOFA 1GAXA 1QK5A 1T1SA 1HT0A 2H1HA 3AUSA 3NASA 3V8BA 4B46A 4BJ1A 1AQNA 2VIIA 5IW8A 2VAMA 4A6PA 4RDCA 2OESA 1C30B 3BC1A 3K30A 3KOYA 4DAEA 4YRIA 2FR8C 5CFZA 3HFJA 4R9VA 3TZBA 4P0PB 3EVGA 4C30A 3S5UA 2EKDA 4OD0A 2FFAA 1ENZA 1F6BA 1W2WB 4D4HA 1UC5B 2RC5A 3RWOA 1OD6A 3DLBA 1RCUA 1P0IA 4PANA 5AUNB 4KC0A 3U09A 1XZQA 4ND6A 2X8JB 3SIWA 1I9GA 1M1XB 4MW0A 1Y1SA 5F2EA 1OQAA 1U04A 3OT1B 3WNQA 4GECA 4AS2A 3EZ9A 5ECDA 3D43A 2DB3A 1IIRA 3ZQ6A 2YHIA 4NESA 3QA3E 4QBFA 3V9AA 2EC5A 3STUA 4NU5A 4A6DA 1VGQA 2XMZA 3HN7A 2KE5A 1LGYA 4YAJA 2Q3FA 1Z2OX 3QU9A 2IHVA 4MUHA 2A5JA 2ZPUA 1C7IA 3E9NA 1XE3A 5TGZA 2OO3A 5BVHA 2QE7D 2GYUA 1K75A 4C87A 1HEYA 4WXYB 4CF6A 2NTYC 3TIXB 3K15A 5GGXA 3WO0A 3GARA 1VCIA 2VP6A 5DYGA 2WZQA 4LBVA 3WDLA 4BQFA 1GNLA 4P7KA 3OMXA 2YBDA 1HE8B 2GRJA 3V7YA 3DF9A 4P3PA 4RHYA 3SX4A 2QSYA 4LEIA 4B3GA 3HV2A 3F5QA 1R4MB 3U3DA 3IHTA 3NM4A 1LPMA 2B0JA 1RWVA 4RZSA 4H7EA 2B83A 4I9FA 2VJNA 3MB8A 3ZS8A 1H3FA 2I2FA 4O0LA 3DDNA 3ABIA 5D01A 1GDDA 1U2DC 3CF2A 1WZIA 2HA5A 2JAPA 2ZRMA 4TTPA 4EWLA 4OHRA 1Y4UA 3NWEA 4TTRA 4WCFA 1CTQA 2WJZB 3B82A 1QX3A 1V5GA 3EXIA 4HDOB 3OQJA 1PNRA 2H4HA 3AERA 4YUZA 4Q3BA 2X5KO 1TQ6A 5ESXA 2E85A 3GFVA 4UHBA 4WZBA 2IOFA 5CDUA 2HQOA 3F7NA 1LFAA 5ICSA 5K8TA 3Q8KA 1JR2A 4REOA 4CJXA 1U0LA 1LDEA 2Q1YA 1N5MA 2CDCA 2FX3A 4FT4A 4C7JA 3FOFC 2WW8A 4JBLA 4CCSA 3QVGA 4FFBB 1R50A 3GLFA 5C52B 2H48A 3QBTA 4Z3KA 5TQ2A 3P4XA 4DY6A 3HYNA 2V7PA 3QKIA 4OK3A 5AK3A 2FUNB 7AT1A 4M7PA 1B6GA 1GKIA 1MFPA 2IEBA 5KPDA 5M5BA 1PKXA 1A4RA 2J8ZA 3CPHA 4Q9DA 4ZAZA 3H2YA 3RS2A 1P7VA 4HNQA 4NZOA 1TT5A 1JHYA 4MS4B 4H6XA 4FNMA 4Z4HA 1FDVA 2OCXA 3C8MA 4BNNA 2I6GA 2P9EA 4UTZA 3AXTA 4IVRA 1E5XA 1ZKDA 3H13A 2G5CA 1PYOA 2PL9A 3NCHA 3MT7A 4RELA 4R0VA 4RD2A 3ZD7A 2JJMA 1TPYA 4OKNA 1VIAA 3CF6R 4UEJA 4A4DA 2ZIXB 3VKUA 1IUKA 2IUUA 1RAEA 4NV3A 2M6LA 4Z49A 4G4IA 1QIHA 4WUTA 2ZWIA 1RRKA 2RHOA 3IS3A 3GR6A 2B2NA 3HYRA 4M1MA 4M83A 3R3YA 4F4DA 2AOUB 2C3UA 2ZDQA 3EXEB 1BH2A 5J4KA 3UQZA 1DDGA 3B48A 1NPDA 2DCUA 5JISA 3MA0A 5IXYA 3RBAA 3N6XA 3FVWA 5L53A 2IVZA 5EUCA 1VLQA 2HJHA 4TKUA 4UAJA 5GAJA 1FB5A 1SUWA 2ZSEA 3FI9A 3BWBA 2N1BA 5A6SB 3E5NA 1U3WA 5FXMA 3DLCA 5KI6A 2DHEA 1ULAA 1F8FA 2DWOA 1L2TA 4G0UA 2R11A 4O4LF 4BZZA 3F7OA 4PM4A 4ZIRA 5HKKA 3ENNA 3GFSA 3UH1A 3P9SA 2K4MA 3I30X 4B6RA 1ARZA 1M6VA 3O3MB 1RHRA 1TZ2A 4S1NA 1LV8A 1NW6A 2P5TB 3AM3A 5I7SA 4YJGA 1QOPB 4MQLA 3R5XA 1S4MA 1CR0A 1HDEA 3THRA 1GAJA 1LW6E 4IDOA 1WCV1 2K5UA 2DBYA 4YQYA 3CW9A 2BGIA 3OA2A 1O7JA 4G4SP 4D9NA 5HVNA 1FJXA 2CD9A 3TMYA 3P9IA 3DC7A 2ZCVA 1OI3A 2CYBA 1J0DA 3OZEA 2PO7A 1MGOA 4PYRA 1QF9A 1G6KA 1TD9A 3GH1A 3OAAA 1G7TA 3GFBA 1C29B 5H7XA 5BSGA 3I5AA 4B7XA 4PS1A 1E92A 1CK4A 1E1RA 4LOIA 4NBLA 1TYZA 2EFJA 2I71A 2VQ3A 3CN7A 1PR6A 3PI7A 5IBQA 1GADO 5B4TA 4H4EA 4PX3A 3R7BA 3VPXA 1CJKC 4Y2RA 3MPOA 1JIJA 3BWCA 4DV4B 2CNBA 1YR1A 4MVJF 5G3YA 5CAEB 3TTSA 3KQTA 2DFPA 2ESRA 4RADA 4YAFA 4R3NA 4OJTA 3OECA 4JVLA 3FPKA 1NYQA 3ZHQA 4BQPA 1H5NA 4BWGA 2X8LA 4DLYA 4QPZA 4LHYA 4HRXA 1NE2A 5HG0A 4EPWA 2FEKA 3R9XA 1W581 1XROA 2ZIEA 4IIYA 5EA2A 2HK6A 3EC7A 2HU7A 5A2GA 1WOMA 3E9DA 3WI7A 4BJ5A 5K6RA 2OOSA 3Q3IA 5ALKA 1Q7EA 3ZK9A 4BGEA 2GZAA 5BRJA 5MGNA 3V8QA 3OTQA 3LJKA 4YJ3B 5IJ9A 2ZATA 5BNWA 4PHTA 1T8RA 3F5MA 3RBZA 4CFYA 3CGWA 4BTLA 2P3LA 5F51A 4FJ1A 3I9FA 4WFJA 3AW9A 2XUJA 4BP8A 5HZMA 4JA2A 2PAAA 2HD4A 2PYDA 4PLPA 4QFDA 5T5QA 3RH0A 4CGZA 4BBAA 5ALTA 4D6PA 1DBSA 1R4AA 3L8HA 3V7NA 5KMGA 4DUZB 1CRZA 1FYWA 4H0NA 1EP1B 4LF9B 3U60B 1CIPA 3KAKA 2ZB4A 2MTBA 5EWLA 4J6FA 3E3LA 3Q8WA 4QZVA 2AJDA 5D87A 3OU2A 4PSUA 5FI0B 1SU6A 3SC3A 3UAGA 1YJCA 3Q7QA 5K8IA 3CM0A 1ZN7A 1E9VA 4H35A 3S2YA 4BNLA 4CUJA 2WWGA 2QMOA 1FRNA 1M6YA 4UXJA 3KQSA 1QB7A 4EEKA 4CKCA 3M6LA 2QRUA 1K7CA 3GCZA 1QWSA 2O0JA 2VXYA 2GDZA 4ZQIA 1EK6A 5B55A 4MRRA 5BXQC 1YDWA 3SR4A 1U3DA 2Y0EA 3AESB 1ZJ5A 4II7A 2G6TA 2W0SA 3DV0B 2KWIA 4HSEA 3N2KA 2ODQA 4WGFA 3BK7A 5CAEA 1X1DA 4LCEA 1B23P 2GBGA 2FQYA 1D9XA 5DNDA 4BEJA 3RS7A 4ZODA 2ZUCA 5KNBH 2F62A 1T2CA 2OY0A 4W5OA 1QZXA 2HHCA 3CT6A 3ZWXA 3AFGA 4YC7A 1C3JA 2W6PA 2GD0A 1OC2A 1QR6A 4GVXA 2FU5C 2NZXA 1QHNA 2EBWA 1E60A 3N2ZB 5EGSA 3RUHA 1ZH2A 4IYRA 1OFHA 4S2UA 1THMA 3DFMA 4CKBB 1Y6FA 1YJ8A 2HCBA 4B4KA 2WKQA 4DWVA 2A5DA 1A5TA 1JJIA 4I14A 2QROA 5FWAA 5JXJA 1Q74A 3GJTA 1ORVA 2BH9A 3GVCA 1E3IA 2BZSA 3UYKA 3ZDBA 3KTDA 1FVOA 5CVCA 4CF4A 2SKDA 4D80A 1HDOA 1YL7A 1LLCA 2TYSB 3AMVA 3G2PA 3PXDA 3R9KA 1HT2E 3H1AA 5JOQA 4HQKA 4AFNA 4XLTA 4Q34A 2WA1A 3JWIA 3EVDA 2C1XA 1DC3A 3LCJA 3OZCA 1L7BA 3IQEA 4LFAB 1TTPB 2R97A 3H1TA 3FFAA 3HFRA 5MF6A 2F8TA 5C5DA 1U0NA 3MWFA 3SJAA 2W6OA 1DDOA 5CTAA 4QEKA 1FQOA 3URKA 1RRVA 2E9SA 3VZCA 5KVSA 5I9NA 2R4QA 2VDOB 1RM5A 2XXAA 1EWKA 1FU4A 2CFOA 4JJ6A 2OV2A 4NZZA 4Q3KA 5C3UA 3ITEA 3LDFA 5EZ5A 4X3OA 1LPAB 4OQNA 3ULKA 2FPKA 1E6CA 3AF6A 4KDEA 4X1IB 2BJHA 2OYSA 4GPD1 1L1EA 2VQEB 5DNCA 5JXIA 1U1EA 4Y2PA 2NP6A 2G9QA 2FX5A 1RMYA 2P6PA 2PG3A 5IUJC 4L9AA 1VCHA 2G67A 1J5XA 1YCHA 2YV2A 4OJYA 3RI3A 4BO3A 4DIEA 3T5DA 4F2HA 3BX1A 3FWKA 3IV6A 1U0EA 1WV1A 1NASA 4M98A 4BNJA 3FMPB 4FYKA 4MVJE 1ECLA 1VRVA 4Q1FA 1KSGA 1BA2A 3HKEB 5BUZA 4WCFB 1WHSB 2XQFA 2WUWE 3H2ZA 3ICPA 1JPNA 1GPNA 1HFWA 3DXFA 5CLLA 5K0CA 4ZTZB 2ATEA 3SPXA 2QTHA 4ZDKA 1V1MA 3D31A 3AH8A 1HQYE 3DHWC 2JLQA 5T3UA 2Q5CA 3LKZA 3QKWA 4JB8A 1KF0A 2FEWB 4NK4A 4P83A 4UUNA 2J5KA 3B78A 3QKSA 4GH5A 3KZOA 3I6MA 1ZI9A 1FTYA 3LCMA 2I3BA 2I2CA 3FPSA 1YE3A 5TY0A 1E99A 2QUHA 1SUSA 4EJSC 2VP3A 4K6CA 4YK7A 2GAFA 2E4ZA 2VKQA 2WAAA 3HKEA 1VPVA 3MW8A 3RVLA 1R4NA 3LOUA 2A9JA 3FDZB 4JGIA 2VA9A 4RY2A 3EB9A 2ONZA 5IHPA 1KY4A 1SUBA 1X1QA 2D59A 2DUNA 2J09A 3TRIA 4E2ZA 1QLJA 2Q6LA 3WKAA 5ISMA 2DBQA 3BMOA 1YMQA 2GFQA 5IJZA 4CCYA 5CNIA 3HVIA 4ER3A 1OJ7A 2DX7A 3D0RA 1M10A 2OQ2A 2R7MA 3FPEA 2BEUB 3R0ZA 5KTMA 1VQ1A 3C98A 3E3MA 1R5NA 4RPKA 4G0NA 2IODA 3IBSA 3PC4A 1K3FA 4JS0A 5JNUA 2R6AA 3BULA 4QYTA 1FBNA 5JARA 3ZWCA 3CRRA 5DKFA 2H5EA 4EHJA 1FLAA 5C51B 2H8GA 1RAFA 3WGGA 5CUQA 4MUGA 1G6Q1 5L3ZA 4M8IA 5J9FA 4DS3A 3LUJA 1ZGCA 4C4OA 2CJXA 4WI1A 2W2KA 4EM6A 1W4LA 1WXQA 1Z9BA 5FI1B 4OYRA 4NBWA 1SMKA 3S68A 1MW8X 1F4VA 2VDKB 1UP7A 3VVMA 1H6AA 2WTAA 1UXGA 3K09A 4FSDA 1OLXB 3KXDA 4MH0R 3AIIA 5DTRA 4CKZA 1EDZA 2E87A 2XD9A 2POQX 1BZYA 4UNQA 3L9XA 2QRHA 2PKWA 3ZIUA 3MMZA 3F5DA 3FYHA 3BJZA 3DEIA 4JUIA 3RSOA 3WK4A 1VLLA 2Z2KA 3CX3A 4EG0A 4R5HA 4NP6A 3FWPA 2RGCA 2V5VA 2W2KB 5EXXA 1XAHA 4L16A 1Z83A 1E9DA 5F64A 1TZKA 3IAFA 2I3AA 4G36A 4KFRA 3ZEIA 3AVVA 4BKPA 1CQZA 2EATA 2V65A 3EXHA 2ETVA 1DCMA 4KXUA 4BO6A 1T9ZA 1QORA 2V3VA 3IQGX 2H17A 4U2KA 4GOOD 1NA5A 1TKCA 3PNLA 5AW3A 3IPAA 3K5PA 3N0TA 1OWNA 5KQMA 1Q1GA 3GEIA 9ABPA 2DKFA 1T2NA 3DTVB 3EDCA 2WWVD 1FCJA 1XEWX 4KYTA 4F4JA 3DKRA 3E8SA 1SCUA 3GRRA 3VZQA 5JMOA 3TGLA 1YB2A 1HK7A 1O4WA 2BEKA 3TOZA 2VQSA 3M70A 1DB3A 2G09A 2HEGA 6GPBA 2PRIA 3DBHB 2G1UA 2Q8PA 3KU4A 3L8ZA 4LXIA 5FWDA 1MO3A 4ZI7B 1U3FA 3UT5A 2ZWPA 2RGAA 1NUUA 1N1MA 1PFYA 4JLVA 3SQOA 4ZDWA 4L5YA 4C89A 3ZDFA 1JFSA 1FSPA 4KZPA 3ZX5A 5AVWA 2BGNA 5C1DA 1G8AA 1RZUA 1U2DA 3G5UA 3OY2A 4P3NA 4EHDA 4MVYA 3WWZA 2DR3A 4MLPA 4AMUA 3FOCA 4F6RA 4DNQA 1WZEA 3T5BA 5LQDA 4KIUA 4OH7A 4PYKA 3UICA 1JDPA 2QPOA 2P2NA 3JYNA 3TQSA 4AJIA 1CLEA 3L06A 1PFQA 4GEKA 4L73A 4OK6A 4RF5A 1CUHA 4V0SA 2IYPA 3SZ3A 2QW8A 4ZJZA 1ISPA 3A1CA 1LVGA 1E9AA 1OI4A 4TQUS 1ZNWA 5EXTA 1Y80A 4JBGA 4JB2A 4G5QA 1VHWA 1UOPA 4DMGA 3EAFA 4HZIA 3IILA 3LE8A 4KQ6A 1GU0A 4KXFB 4ZAVA 1EWQA 3GW8A 1TMKA 2WFAA 3BHIA 4JLWA 5JADA 2QU7A 4FGJA 1T6XA 2LUOA 1MOZA 1RLOA 1LF5A 2RB4A 2WJPA 3EUWA 3NBZC 3RGGA 1VA5A 1GN9A 2JIMA 3UANA 1ECFA 2B8NA 3WMGA 1LRLA 3G0BA 2ZIWB 3FAZA 2QL7A 3VI3B 1KH3A 5T3YA 3U26A 2V0CA 2LCQA 3AY7A 4B4WA 4ZCMA 4DWJA 5HK8A 2NUTB 4MMYB 2GEBA 4YPOA 5IXJA 1TIBA 1J33A 3GLGB 5JYEA 1ZA1A 1CY6A 2ZAOA 4HWSA 5G1NA 1EEHA 3HCAA 4G1BA 3BA1A 4KXLA 3UOAB 1CLUA 1JA0A 4HB4A 2H51A 4H31A 3WKDA 1UBUS 2NZ2A 2IYZA 1O5OA 1U7HA 4OXKA 1GGNA 2JA2A 4OUKX 1QYVA 3RVQA 3M6MD 5FUMA 8MHTA 1JFVA 3KUKA 1E1KA 1Z33A 5HUHA 1IM2A 2QVGA 1U1IA 1KFBB 2D74A 4KXMA 5CDSA 4WZAA 2A0WA 3N6RA 4Z4EA 1H8EA 2AVDA 4QD3A 4A6XA 3DS8A 2ZXEA 5AP9A 5FLXA 1VJGA 2JGKA 1XDDA 4Q93A 5TGTA 4UKDA 2Q4BA 5TSDA 3E5RA 3GIDA 3TINA 2FN7A 3ZHYA 4XTCS 2O8FA 1PDOA 2Q29A 2VF5X 1U9CA 1X7GA 1EWYA 1K6IA 3NHKA 4MWOA 4FW9A 3GOHA 1SXJD 3F2IA 1L3CA 4LXQA 1UK8A 2HA3A 1CW2B 4TMZA 3ZY3A 4DJ5X 3EMVA 3WAKA 3M6FA 3II6X 1CETA 1NJ2A 4H6VA 3E35A 2FHSA 3O4GA 4GKKB 1T4MA 2DP4E 2IV7A 5KU7A 5CXUA 2OE2A 4G41A 2PHZA 2PLNA 4IOMA 4NH0A 4GGPA 5DSXA 3V4RA 2DR2A 1NE7A 1SURA 3ZDXB 4LIPD 2J9XB 4W6ZA 1XPRA 3VU3A 1OYYA 1L7DA 5DHRA 5KWVA 3QWBA 5ECWA 3TDKA 1G21B 1FNBA 1XD2B 2IYWA 3M9WA 2G8NA 4U5XA 2PTGA 3C1OA 4ZCQA 1O6FA 1AHIA 1U8YA 2G7ZA 3G89A 4YP7A 3KT0A 3TLJA 2CC2A 4AZ3A 3E23A 3MTEA 4FBMA 2W6JD 3DO6A 4Z0NA 1K7EB 5GMOA 3CMMA 2X5XA 3LLVA 4IVQA 2EV9A 2IUYA 2WKPA 3ETNA 1DXYA 2H2AA 3KG2A 4I6EA 4NENB 4UULA 3JXEA 5ARDA 5BW6B 1CQPA 1GQYA 4P31A 4MQ4A 2OCGA 2V45A 4XFJA 5GPBA 1GDTA 3SSMA 2DWPA 1SPBS 3NAZA 1SXPA 4ZC1A 4ZYZA 5JDCC 1S96A 2HYDA 2YYZA 5KTKA 1QHSA 4IQFA 2P40A 4GBED 3ETJA 4NDAA 1ONBA 4BFSA 5EESA 1YB4A 1RR6A 2IC5A 4CQMB 2WHPA 3VSDA 1TJYA 1J49A 2P5UA 5K1ZA 1TJ4A 4BVAA 4D4LA 4RPCA 4Y6OA 3UC9A 2EKBA 4E1AA 1BQ3A 2BFCB 3O74A 1OLSA 1RYHA 4JOCA 1EJ6A 1Q2XA 3H8WA 2C4TA 3G7UA 1SCAA 2PX4A 3GLQA 4QQKA 2G0AA 2WJVA 3W4KA 1UPXA 3GFGA 1IN5A 4YUVA 3C87A 3ZHSA 4D2IA 5BUCA 1C0IA 1H85A 4IO1A 3TPZA 2YTZA 1NXQA 3EW7A 4N3AA 4PC3A 1MC1A 2FHPA 3PWTA 4QLOA 3OX1A 2AS0A 3OZVA 2DXIA 3AVWA 4HOYA 3I58A 4HYTA 4NECA 3AHDA 5G1OA 1Z34A 3IX7A 4O6VA 3B5IA 3H1GA 3UFBA 1WZNA 4B75A 4D6YA 2PO5A 5FP0A 1KVSA 1SXHA 4QXMA 1DPFA 2HNKA 1FTGA 4DQVA 2BW0A 4CQLB 1RPJA 4MITA 5JLJA 1WXIA 1I2DA 4ZO7A 2IS4A 4KVZA 4RQBA 3DB2A 1W6UA 1E7QA 2P91A 1RYFA 3VUEA 1AA6A 3OEHD 2EXXA 3A10A 3K9GA 3L43A 4I81A 3I09A 2W8BB 4R2WA 3T9DA 4F9EA 4UZEA 1V6AA 3PI6A 3S2GA 3DWEX 2YHBA 2C00A 1R8YA 3ITNA 1V5EA 3E0QA 3KOXA 4OHVA 4RNDB 4C2TA 1SXJE 1DQPA 1CY1A 2CXSA 2E0IA 2JD1A 2PKXA 1RBMA 1ATIA 1DL5A 1LRKA 2O0KA 2VJDA 1LI7A 3D6JA 2QUBA 1J56A 4YQEA 4EJSA 3ASYA 4C1BA 5CBPB 2C42A 2Z56A 1A7AA 3O38A 1ZBDA 3K32A 2YNMA 4EOGA 3M3HA 1SUPA 4FOSA 2QGNA 5TJ9A 1N92A 3EH2A 4KP7A 5G1PA 1X94A 1PQUA 2VAVA 3M34A 2QTLA 2CL0X 2V6GA 1ZK3A 2QT9A 3K0EA 3L7NA 4OU4A 3U7JA 1SVKA 1TUBA 2YL2A 2CLKB 5FBQB 5IMBA 3CZ5A 5I5EA 2BGLA 5IJ0B 4C4ZA 5KNDD 2MIIA 2FSPA 2V59A 4INAA 5FPYA 3EGXB 1JVNA 3M6AA 4U3JB 3WO1A 5ICEA 2H31A 1TOAA 5ALIA 3K6KA 3WAGA 4JSRA 5HZHA 2JRLA 2Y6VA 1FZQA 4QHYA 1XD8A 3QF7A 5K0GA 4IGIA 4QUDA 3PUXA 1D2CA 4L6IA 2HF2A 2WYVA 5JQGB 3LTNC 1OPXA 3JVDA 2IYFA 3T8YA 1D2EA 2QP3A 1YK1A 2OECA 2PRKA 2GD1O 3NANA 4QQNA 4MAAA 5TNXA 1EWTA 1MAUA 3N1UA 1IQUA 5ALXA 3RJ5A 3K0CA 2V96A 1E2QA 1G5HA 4Z99A 5LBTA 3HJHA 3J81k 5F1KA 1N8TA 2WWIA 5JCJA 3OE7D 1I8TA 4IKOA 3RRNA 1U2GC 2QRNA 4C20A 2WPDA 5LNK6 1CY7A 3H3XA 4K8OA 1JR6A 1JAYA 2HDOA 1DCKA 2Q1UA 1OX5A 5TDHA 3K1AB 1KOJA 4BMSA 1GARA 1ZO8A 3IDQA 4C5AA 3KQPA 2Y1OA 5G0UA 4ANFA 3M5PA 1ISMA 1JIIA 4JITA 3DV0A 1Z22A 4R54A 5DVZA 4TTSA 3A0UA 5FOTA 1V4BA 3GJ8A 5G53C 4BNWA 2VP9A 1L5KA 4UUMA 4B81A 1PFKA 1THGA 1TLLA 2Q3EA 3EXHC 4H17A 4DOMA 3OCXA 3OMWA 1VIVA 3E22A 1P2GA 5DK4A 1T10A 1S7CA 4MVCA 3WA6A 3L4BC 1KKUA 2B3DA 1L4GA 2R6R1 4ACAA 1Q7TA 4BVFA 2EDCA 3NBUA 1V8OA 4ENQA 4Q01A 2HR1A 1HFJA 1I5RA 1QE0A 3H4TA 3BMQA 3TUJC 4MQUA 1SK9A 3HCFA 3RRZA 1W36D 4XYMA 1TNDA 1NVEA 3Q15C 3H9BA 3EZFA 2WSYB 5CJ2A 4WKBA 1JALA 1QHHB 5EWMA 5PGMA 2EJVA 3OIUA 4HEJA 5ICFA 1FYDA 3AVYA 4TTQA 1Z06A 2EHJA 1MEEA 2ZDGA 3BILA 2H57A 3QOWA 1CCWA 1WB4A 1WKVA 3QHPA 4IIEA 2ZBGA 1TM2A 5DGCA 1G64A 2JL1A 4B8ZA 2ONYA 3QFFA 4M55A 3BS4A 2OXIA 3V8RA 4BVHA 3VMFA 2H7CA 4MCIA 3R3ZA 4CL3A 3IDFA 1QFXA 3HUTA 1GPLA 5AK4A 4GMFA 1L5GB 4FKMA 2QS9A 5JD4A 3MTJA 3DL7A 4LDRA 4NS1A 4WN9A 2AXQA 1XXHE 2QD5A 5B3KA 1V95A 3PCTA 3ZXIA 1IM8A 1DKNA 3A9WA 1MX5A 1OHHA 2O8EB 1QHGA 4IRXA 4YX9A 1DZIA 3FHCB 1YZGA 1DAMA 3LP6A 3FPLA 3NHBA 3DVSX 3M5DA 2LTAA 2CDRA 1A2OA 1P1RA 4EA9A 4F97A 2VJBA 4P22A 1NDQA 1NG9A 3KIPA 2BFEB 4KQJA 1VG0B 1SHKA 1VE6A 1SZJG 3D1LA 4JQOA 2G1PA 4Q02A 4RD3A 4ER6A 5AI9A 2IVFA 3OPYI 3PE6A 4ZVVA 2IDJA 3WRWA 2XGSA 4BX8A 3RFFA 1BJKA 1JJBA 4MS3B 2LE0A 1DLJA 1KVUA 1OV6A 3U44A 3LWZA 1OH5A 1RC0A 5BQOA 4KQMA 2ZUFA 1SELA 4QT4A 2OFXA 1GO2A 2CXOA 1SOWA 2CGEA 5C8ZA 1BXZA 4L9RA 2EZ4A 2Q2OA 4OF4A 2LDBA 3VAZA 1DNPA 2HHJA 3DNPA 4TRNA 2ZQYA 3I3OA 3RT7A 4E5NA 3Q9LA 5BW8A 4EW3A 3ZS9A 3GROA 1XCLA 5BT8A 2BKEA 2I6XA 3R7FA 3TL3A 6PFKA 2XCOA 2FETA 5HBRA 5DV9A 3VQTA 2CLEB 2GCGA 4MGHA 2XCRB 3SR3A 3WRXC 3ZW9A 1DC4A 2GNPA 5FI3A 3WLKX 4Y6SA 4NZNA 1KI2A 3BSWA 4KNYA 4RHTA 2HMWA 5AJXA 2O8NA 4ZT3A 4AX8A 3TVYA 1E77A 1Z2CA 2P3SA 4AYXA 4HR7A 1KSHA 1BD3A 5JCOA 2Z8ZA 3MJDA 4TXHA 3GBSA 4KAAA 3K0AB 2Z5GA 1MN6A 1PZXA 1NVDA 4NJOA 3U40A 1KS9A 3KZMA 4OIFA 3RQSA 3ER6A 5EXEA 1VIYA 4JI1B 5BUSA 2ZT5A 2JAOA 4XM1A 3GHHA 1QGYA 1CNEA 1U5CA 2CVOA 3DVLA 1EI9A 4NYJQ 2YVLA 3DUFA 3HSSA 4GL4A 3HCCA 3QHAA 1HUQA 3HWWA 1YGPA 3LX8A 1W9MA 4CM4A 3TM4A 5EUMA 3RUDA 1YD7A 4WWHA 2BGJA 1ENPA 1A98A 4PY2A 3DLIA 5E8RA 1EZ4A 3TCKA 3NXKA 3LDAA 2WJGA 5E2AA 1G5TA 1E1DA 3G8AA 3V6MA 3KFLA 1JYSA 3DDUA 5HF5A 2UZAA 4HAVA 1W36C 3KYDB 1CHDA 2B1JA 4HZUA 2DHRA 5A1JA 4MJ3A 2IHNA 3INGA 1M6WA 2OPBA 2WWHA 1JTFA 3QPVA 1SQSA 1ZD3A 1TVEA 3AEUA 3PE4A 4X7RA 1A5AB 3D7SA 1G4UR 3GG2A 3AHEA 2XLCA 4CLOA 1DEHA 2D6FA 3V1MA 1JKJB 2XUAA 1YMUA 3HCPA 3NC4A 4K28A 4KSYA 4ARZA 5K2OA 4N3NA 4LZAA 4YPFA 2WYIA 3GBPA 3AHIA 4JJ7A 5FPKA 4OQXA 4MW7A 1Z39A 3OEED 4C6SA 4MQEA 5D3QA 5JRDS 2JD0A 4OI0A 5F2OA 2WQ7A 3BH6A 2H65A 4EKYA 1YB1A 2N75A 3QW4B 5BW4A 1NPYA 4ZREA 1WD5A 2FPSA 2R84A 3OE4A 4JXJA 3V80A 3D8TA 3IIIA 2PSHA 2XH8A 2Z30A 3VKWA 4BASA 3UY4A 1OOEA 3IB3A 5IZCC 2DQYA 4WXEA 5DX8A 1BRMA 2Q45A 5THKA 3HP4A 4TN1A 1KU0A 4QBIA 1E79D 5JDIA 1KU6A 1RACA 1TMOA 2MSKA 3OQHA 2K2QB 4TWAA 4UU1A 3KQQA 4J0CA 4MRMA 4WQMA 2PH7A 2F1IA 2ZS9A 3A1FA 3ZW7A 5JCOC 4CM7A 3NKVA 4C7MA 4DBZA 3JD0A 3EWAA 3MWDA 5FTJA 3A3OA 4BIIA 2AFRA 1FW8A 3LHIA 3OM8A 3U1VA 4NFLA 1TQHA 1A97A 4MULA 4WVLA 3VZSA 3BRCA 2BGMA 4E3WA 2NZUG 1E58A 1E1YA 4GRDA 4HXFB 5JWRA 2JF0A 3ELUA 4GE0A 4N49A 4GLFA 3VBCA 4C1NA 3V4ZA 4CMGA 1QV6A 4HDSA 3GMTA 3U7HB 1NXXA 4H1TA 4RL4A 4V0ME 4WY8A 4GZ6A 4R83A 1U7ZA 4BFVA 2WA2A 1QRTA 2EFEB 2PLAA 2YWJA 1C81A 3FNBA 1YZNA 1GILA 4GBMA 2QAIA 1S1MA 4W5HA 2H8KA 5LJLA 4TZ6A 2JD2A 3PC8A 5CDYA 1OH7A 4HATA 3ZU5A 4W9MC 5JG7A 2FP4B 4A10A 2DBVO 5AVYA 3W4IA 5DHAA 3HVKA 3Q11A 4R7ZA 5C8XA 1UPAA 1S8OA 3FYCA 4WEQA 4HEA1 5JCJD 3SHFA 4D97A 4W1SA 5BMVB 4MV7A 5LYYA 4KR7A 3RDPA 4D9KA 4DRXA 1JJVA 1HE5A 2VT7A 3ELYA 3H97A 3LU1A 5K99A 1EVYA 1JLSA 2IL1A 4YAIA 2J4CA 2CLLB 3PUKA 4V0RA 5L4LA 2ZB2A 2OK8A 3W4JA 4U6QA 2IDZA 1M2WA 1PTJC 4UM5A 1H2EA 2EL9A 3E9ZA 2YZ2A 2ZPTX 2IKQA 2C96A 4G63A 4XI9A 3OFNA 5M3BA 2ILTA 4QNMA 4GPEA 3MXOA 4YMTA 2W93A 4WZ6A 4YUWA 1MZVA 4N7MA 4PXAA 1CUZA 3SLKA 5DISB 2Q0QA 2PSJA 4XDYA 3VM6A 1E9RA 4J0HA 4PF1A 4D56A 5IKEA 3FYUC 4AJKA 1XHEA 3PSHA 1ZN9A 3UJBA 1GL7A 5B36A 2R3SA 2SHKA 1BCSB 2BEVA 2B82A 2HJ9A 4EQZA 4QX6A 4BKOA 4EY5A 4B4OA 5H3HA 2X1LA 4KL8S 1JTVA 3D8UA 3GT3A 2IH2A 4Q9NA 1XTVA 2HWUA 2QRQA 2Y4NA 3V7UA 4M37A 3PQ3A 4IDEA 4YCDA 2C82A 1Z62A 5LJIA 4ZC8A 4X0EA 4A2QA 1PQPA 5I8WA 5J47A 2E18A 3WLFA 2XVZA 3MG9A 3E03A 5JMWA 4C78A 1D07A 1TM1E 3KRTA 3DBRA 2GHIA 3IDSA 4IPTA 3OHPA 4KQFA 4TMYA 1Z7WA 3L8YA 3BXZA 2FPXA 3UJNA 1TJ3A 4O2BA 2OZKA 2P0AA 3GJRA 5JNRA 1XVVA 4EK9A 4HYQA 4EL0A 2CF5A 2HOQA 3A9VA 4LHSA 5DASA 3UENA 2C2HA 3JQ9A 1K27A 4KQ2A 3FGPA 5ED0A 1RWQA 1O96B 4U7HA 3U1TA 4EFLA 3N87A 4EZBA 1UZAA 3H11A 2IPXA 3LXUX 1E0DA 4DSOA 4X6LA 4YCBA 4MR8A 3R7WA 4CN9A 5I7FA 2UZ0A 2ZRGA 3H65A 3C6KA 3JU3A 3VJKA 4FUQA 3KQUA 1NC3A 2G1JA 2J0UB 4CTKA 3PX3A 4NOLA 5ALJA 1EP9A 1X7XA 5BOSA 2Y1KA 3SZOA 2OORA 1YZKA 4AP9A 2O20A 4ZQEA 5KQGA 4AJ2A 2IZ7A 4NBKA 2OHHA 4PW0A 4QL3A 3WGMA 2PCJA 5AW5A 4LYJA 2QLFA 1JB1A 2XMSA 3QOXA 3WQSB 3UPTA 2B30A 2O14A 1Q20A 1W88B 2B99A 3DMGA 4LYAA 2P2ZA 4BYGA 5K4AA 3T94A 3J80A 5F5XA 3RGWS 1RJEA 1MBZA 1G98A 5FPQA 1I6KA 1WTCA 1DAPA 1V45E 1H05A 5I7RA 4NICA 1M2OB 1BCSA 4KO1S 4WLOA 1ZMOA 4XRGA 4BJ6A 3NOVA 1VPDA 1T5LA 1MVOA 3BCHA 3QLUA 4UXIA 4E32A 2CFCA 1W93A 3DOJA 3OIYA 4AURA 4JSYA 2JCSA 3MVEA 5A4FS 4CQMA 2BYTA 1BE8A 2Z6QA 3HP7A 3SOZA 3MIIA 2WVGA 4Q16A 1G4HA 1RW4A 1YVUA 2NUPB 4UUBA 7GPBA 4HPXB 1D03A 1DTEA 1J0EA 3KXPA 4O4HB 1D2NA 1Q1NA 4Q39A 3NO4A 4FFSA 4LGVA 4BVEA 1PGQA 4DDMA 4XPIB 3QVWA 5EXDA 2ZB7A 3QXGA 1EEXB 4D26A 2IGTA 1RLMA 3MTBA 2VOJA 2AZXA 3ISTA 5HIIA 2AK3A 2PZGA 3JSXA 4AQYB 1P19A 3U4QB 1KQ3A 3OT1A 4L0QA 2UVPB 1F17A 5CRIA 5GJCA 1U2RA 2X42A 3IIEA 5A5VA 4BZPA 5LQCA 4RANA 3R6DA 4DLTA 4HHEA 1KR2A 2BM1A 3CU5A 2P9TA 2RHLA 4MWGA 4UTPA 3WWPA 5COQA 1Z38A 1IXRC 4B09A 3I61A 1SU7A 3O31A 2ID7A 3X2FA 1U5AA 4Y2SA 5IEJA 1KO1A 1VRWA 5DM1A 3WQRA 5JJLA 1UMBA 5DBEX 4DZTA 1YI1A 1SVNA 3FYUB 1XL1A 2A0FA 3ACDA 4ME6A 3UWDA 1NVUQ 1ZGJA 3FPAA 2W98A 1BWQA 1I3MA 3FUTA 3HWRA 4LDZA 4PTYA 5KWIA 2PWBA 1AGNA 2ZZNA 2ZVPX 2IYSA 3RUFA 1SVWA 1IONA 2HSDA 1GUFA 2FWBA 4OQPA 1KPIA 2OCBA 1E2EA 1SIOA 4F6LA 4UFPA 3FTFA 2OQVA 1IM5A 3BIWA 3RTCA 4KIFA 2BI8A 4NYIQ 3VHRA 3P32A 2X0FA 4UCXA 1QYIA 2RE8A 3UAVA 5F9FA 2PBLA 3ZV3A 4DTIA 3OCYA 4X54A 3T3PB 2O8BA 4GSLA 3K1YA 3BTSA 2ZLBA 1L5ZA 4DT1B 3VR6D 3K7EA 3RRMA 4ML3A 5BN4B 3JAWA 2GR9A 1XA3A 3PQFA 4J1QA 4MLCA 2TRSB 5LBIA 3RODA 4I36A 1XQ6A 2MSCB 3K2IA 4HQNA 1H9CA 4PX2A 5FNVF 2BGGA 1QQ5A 2NUAA 1ZDMA 3OF2A 3HM2A 3OQIA 3WQHA 2BEWB 2JEOA 3RIXA 4RV4A 1O8BA 3W2FA 1GPDG 4AUEA 1F1JA 2YWBA 4C0BA 3D5TA 5G0VA 2QQEA 1ZK2A 4PHHA 2Y93A 1GUDA 1GUYA 4IDGA 5CT8A 5GZ3A 3WBKA 1N9ZA 3PPVA 3M4JA 1DUSA 5ITZA 3FZGA 3KSBC 4Y2TA 4C0HA 1YA6A 2P7HA 5DE3A 4E5DA 1Y6RA 3OCCA 1ZOIA 2AMFA 4QBTA 5LUBA 3W04A 1X2EA 5NULA 1KO5A 4Q37A 3RT1A 1TM5E 2XECA 1NBEA 1KI1A 3GFRA 3HJAA 4IG9A 5C4GB 3K9HA 4FDVA 3OE5A 5DJ5A 2NSDA 1N78A 2FFHA 4HDRA 3UG6A 3WL6A 1FU7A 5TARA 3D2CA 2HJGA 4ND4A 3FNIA 1JBKA 1WOYA 1DXHA 1CNMA 4EQ6A 5I01A 4QULA 1MC8A 5JS1A 2Z5FA 3BJIC 5BSVA 4Q3EA 5AJWA 2GYWA 5BV8A 4DJAA 1G38A 3ZLUA 4WDRA 1TKBA 5GZ1A 1HURA 3AKYA 4J0GA 4QOHA 4ESVA 3RIHA 3HXOA 4BCBA 2BTOA 4KR2A 3JAWB 1ZEMA 4HFMA 3C70A 4D81A 3M0EA 1WPGA 1E2JA 4HAXA 2EVWX 2FKNA 5CM2Z 2A5GA 3K3PA 4CLRA 1G1MA 5CNMA 3LCVB 3B9QA 3UAYA 4GI3A 2MT9A 3K0AA 2FN8A 3AINA 3RTBA 1OLUA 3UTDA 3OZRA 1CWUA 3TTUA 3HADA 4ER0A 3WAJA 4CUKA 3JQFA 1I94B 3CJQA 1P9LA 5FNVA 5HK9A 1P1HA 1ZG3A 2TMYA 3DDCA 1A8QA 1EFPA 4LK2A 4C43A 1DO2A 2IHBA 4C7VA 4EJ2A 2GOYA 2RAFA 1IHUA 4BOYA 4EI8A 4V0KA 3COZA 2I62A 1XAGA 4TKMA 1RADA 3SIRA 4K3UA 2P90A 1RJWA 1OX4A 1PFWA 2C04A 1T3GA 2GN0A 2PX2A 2QRLA 2Z5VA 4FXOA 3SNHA 1PJTA 3TS1A 3W2HA 3DULA 3BRWD 3UKJA 3ZE1B 2IZ0A 3IQFA 4K26A 2VHWA 3RC9A 3TEMA 2ZXUA 2O3TA 3IESA 1VPWA 1ULZA 3MTQA 3L7YA 4GI1A 3UB2A 4WE3A 1YUMA 1UADA 3AVTA 4FE3A 3Q3EA 3FVTA 2EHDA 1O08A 4E5KA 2FR1A 1AZTA 2NNLD 3IFSA 5BQFA 4B2LA 1ULTA 5FR2A 3T5MA 1DBQA 1D1QA 4IAOA 4J9UE 4NBRA 3TECE 4R2XA 2E4AA 2IYVA 2QGFA 4BRSA 5KOIA 2LNDA 5MN6A 1HNZB 2OAGA 4UCWA 1MPXA 2F55A 1YIDA 3EW9A 3NJ4A 3MMNA 2L2QA 4YJGB 3FIJA 5L7TA 3QEAZ 3H6KA 4HNGA 4KODA 5K0BA 1XTSA 1PBTA 2VSXA 2DWQA 2YICA 3NW9A 1U0GA 1AGRA 2XNDD 2P9GA 1NJ6A 2XSZA 4FFRA 5KOJB 4Q9IA 3RUAA 2O8CB 1UMCB 1OB5A 4RDHA 2I91A 2BPOA 1M7GA 4P4LA 3ZV6A 3L7IA 4OGLA 1ZY2A 2HXSA 1BQ4A 4ND2A 4S1TA 5FJJA 4D25A 4XFKA 1PT6A 3EF1A 2JGMA 2PMKA 2YQZA 3PUIA 1CZRA 2WMDA 1ZIOA 2X41A 2XI4A 3KV3O 4M0FA 4NOJA 4MV5A 3IAM1 2D1QA 4Q1EA 3MELA 3NBKA 3DTNA 4WK0B 1AV7A 1G5PA 1NVWQ 2HLPA 2VZEA 2P1ZA 2CMKA 4L50A 4Q18A 1KY3A 3DE6X 2X4IA 1FDTA 2IIVA 1I3KA 1QK4A 1UP4A 4WFQA 4P7BA 4OXRA 3C45A 3W3AD 5HXAA 4PX9A 1Z35A 3C8DA 4QPNA 4MVXA 1G7SA 4TRJA 1CUGA 1M2HA 1XYGA 3VO1A 2Q5JA 2XGOA 4V3BA 4F92B 2RK4A 4ZVNA 5CB4F 2DSTA 3AZPA 4ENVA 5AIBA 4Y2QA 3HCBA 4TL8A 1ZEJA 1UODA 1JBEA 4I9HA 4BNXA 4MPRA 4MV4A 1A82A 4RYDA 3C48A 3LT1A 4A15A 2D0IA 1Z0KA 2UYGA 2GEDA 2ZULA 2OCYC 3C7KA 3INRA 4BLSA 5HJEA 3EFOA 3BQNB 4UNNA 3TSCA 2GXUA 2GWRA 4YV1A 5LUAA 4MQMA 3CE6A 3NHYA 2NXCA 4PLFA 4RIGA 5BR7A 1IG3A 4HWOA 1YS7A 5ICCA 1WSAA 3ECCA 1WW8A 3PHIA 1C4WA 1GG5A 2GXSA 3G5LA 4NEGA 1ICIA 5EXSA 1OXMA 4DQUA 3ROPA 4BQOA 4CIVA 2RAVA 1ADJA 3ZCQA 2C0PA 3PXGA 2PR2A 4C3UA 4Z4GA 1TF2A 4WPGA 4LJ9A 1GOTA 4XM0A 1QQ6A 1ZOPA 4KPUA 3U56A 1M54A 4O0MA 2H3EA 3KHUA 2DULA 3IUPA 2Q99A 4E3ZA 3AYXB 1A9SA 2X7XA 5FQNA 2WSSD 3DE1X 2XDQA 2C7PA 3DOHA 5LIRA 2H4FA 1UMCA 3DW3X 3PNBA 2W6ZA 4ZTBA 2A0YA 3TLZA 3UV3A 1WXHA 3LCRA 4G25A 2MINA 1UC8A 1UXKA 2G25A 4ARVA 4BFTA 1H4SA 5H4GA 1P62B 1RYEA 3IEPA 4Q9LA 4E5MA 3L4JA 2H59A 3D4IA 4XD2A 3NTUA 1J2YA 3WLAA 5L45A 1AHPA 4ZPJA 1XRMA 1PNOA 1Z8HA 4M1OA 4E6PA 1A5SB 3EISA 2B20A 4PG4A 4A3SA 3L01A 3TXXA 3GDHA 2WWXA 1AGXA 4DIDA 3EVAA 3HYTA 4ERXA 3QXJA 3F4LA 5DGHA 5JEEA 3TQFA 4HX5A 4A27A 3IP1A 2B8WA 5LZ9A 1NZFA 4EIWA 1E3WB 3R6TA 2VYVD 1NI4A 1F3LA 4J4BA 3COYA 4YAOA 4UTVA 8LDHA 3UAWA 2YW2A 3NZEA 3KYCB 2N3ZA 1IWOA 1ZGHA 4NV1A 3ZWWA 1XCBA 1JVBA 4L08A 1YL5A 2XGGA 2I4MA 3FCUB 5EHNA 1DRUA 3WBJA 3DAFA 5JYDA 4U2BA 1HYGA 1P0PA 2AG0A 3MRTA 2Q4TA 1KGSA 1ECBA 1UBLS 2DGDA 3F8SA 4IUBS 3KP1A 4TQGA 3FFXA 3AFNA 3E70C 1BW9B 1HPLA 1EFPB 2JJ1D 1DAIA 4QOIA 4QUAA 1QVAA 2HRCA 3T38A 2FXIA 3MBIA 5CFLA 3DA8A 2AW3A 4U2GA 4O1HA 4FHEA 1G8MA 1U5BB 2E5FA 3D4OA 4JLMA 3RV4A 2KW5A 4FYVA 2AZTA 2JB9A 2QTVB 3BGVA 4RVNA 4YO7A 3L1KA 1I1HA 3FLAA 4DCVA 5EQTA 2BP7A 1PIWA 5IX8A 2ZE5A 1Y4DE 3LUGA 1J9EA 4E11A 1RCTE 3ND6A 4LX8A 4MUJA 4D3DA 1L4YA 4WJZA 5IK2A 3U48A 1T6YA 4HS9A 1W5SA 3JPYA 3W9YA 4DA8A 2GKSA 3ZWOA 3D54D 2RJOA 1B3BA 2IUEA 2BE9A 4NQRA 2ZUEA 4PFSA 2VCHA 2P2SA 4TTAA 1HI9A 2WTNA 3NU1A 1K5DA 2C2MA 3DZBA 3WRXA 4R9RA 8OHMA 2DFLA 1MVNA 1EK2A 4V1CB 2RCYA 4XGNA 1LQTA 4DVGA 3B6MA 4B82A 1FP6A 2JAHA 1LDGA 5IT0A 4WNAB 5GIOE 5IVKA 2QYSA 3GLUA 3H2KA 3FXAA 2A88A 3KKNA 3ASVA 4CMIA 4ZDJA 3CKKA 1XMXA 3ISVA 1YF3A 2VNSA 3PU6A 1QM5A 4D9JA 1AB6A 4ENWA 4JVMA 4ZEVA 4J2TA 1EFHA 3L5KA 3DE3X 2YS6A 2WWTA 2IXFA 3FKQA 1YDMA 3HCRA 3OKPA 3H9EO 4FWBA 4EB6B 1ZN2A 1K7SN 5M34A 4C7OB 3UWKA 4JBXA 1U1FA 2EFYA 3N7TA 4X63A 1KBZA 4XVUA 1VMKA 1IJEA 1II9A 3ZIDA 1CF2O 1P2VA 1J2EA 4OUDB 4ND1A 2VSNA 3WHLA 5E9AA 1SZCA 3AP3A 3RE1A 2Y99A 1YKSA 1LLFA 2X2EA 1R9MA 3JATB 2GF2A 4HQOA 5B7GA 5KQRA 2HIHA 1XL0A 1IBCA 4I4TB 4KLRA 3W8RA 4I4TA 1BE0A 3HI6A 3SVZA 4QSMA 1HBJA 1PWEA 1VZ3A 4D9CA 4KREA 2DQSA 5A0TA 3PD7A 4AO6A 5EHXA 4RVUA 4KGZA 3MWEB 4DT1A 1K3TA 4C4RA 3RWMB 4LPKA 2ALJA 3MJVA 2X8JA 2PKCA 4X44A 4OVKA 1E4EB 2O5EA 2II6A 1N5OX 3SWWA 1KJIA 4PQYA 1YVEI 2VZ8A 5C5CA 5KJFA 2BSXA 2CJYA 1UUFA 2R48A 2GCEA 1DWUA 3A70A 4N5HX 2XOKD 3F9IA 3MZ0A 5F4BA 5BWMA 2XMQA 2I54A 3FCXA 1EAYA 4P3YA 3HLKA 4TTVA 4M2LA 4C6RA 2VJKA 4NONA 2AG8A 2EKLA 1TCVA 4WECA 1DUIA 3AOEA 5FB3A 4JQYA 4TMXA 1SCKA 1RU3A 2G83A 4AQDA 3P9QA 1O0BA 3H6HA 3PWKA 4IGFA 3MWGA 1C8BA 5HTKA 2IFTA 4NMHA 5DXAA 4KJXA 4XOIA 2OLKA 4IIJB 2V9CA 3LYLA 4LI0A 3HGQA 4O1IA 3IUSA 4AS1A 3OLYA 2FE1A 1RXSA 2IUTA 3QI2A 4OBWA 3RAJA 4F60A 1CDOA 5JPIA 4TRMA 4R8MA 2Q5OA 2XVAA 2B25A 2LDXA 1F7UA 1ISRA 4M9XA 2QLBA 3ZHCA 3BAZA 1F2TA 1NXPA 1NZJA 2ETXA 2EARA 5C35A 3LLSA 2LBPA 1MO5A 4DREA 2R0QC 4AP6A 3SKYA 2YUIA 4GR4A 3DB1A 3ZJTA 4QOJA 1NQTA 5DHTA 1LC0A 1Z26A 5ED4A 1UPFA 1G8FA 3OPYA 4I8DA 4YWJA 1RPZA 4I4TF 4K1XA 5TMEA 1YB5A 4M3NA 4G65A 4FINA 3DAPA 4MV6A 4PLGA 3A1EA 5TRTA 4DQXA 1KA9H 4YJ3F 2PJRA 3QLJA 4U6NA 2IEZA 4ZEOA 4C7OA 3EA4A 3U7QB 2PEYA 2QMUA 3AJ8A 2V7XA 3HKCA 3ZQ4A 5HP4A 1WLSA 5IVDA 4LSZA 4BB0A 1WNFA 1CUCA 2FGKA 2M1XA 2A1TR 3NDPA 5FR1A 1J0CA 4FDAA 4CM6A 2V6JA 2CVQA 3JASA 1YCDA 2EU8A 5K3AA 2F90A 3HR7A 3UMRA 4OCZA 1LI5A 4U7TB 5I51A 3CZ9A 1RC8A 3A3YA 2WOJA 3SC2A 3MHPA 4I8XA 4E13A 3FUUA 3I42A 4IGEA 4IR7A 2OLJA 4OX9Y 5F1YA 1EE1A 3ZWBA 4NCAA 1WW3A 3GP8A 1EHYA 1I01A 3CRVA 4GF5A 2WTEA 2X0IA 3N5KA 1W75A 3REQA 1EBFA 2Q9BA 2R8ZA 4FVTA 5KVAA 4L0CA 5TF0A 4DMCA 2O5VA 3W5DA 4F2GA 2FPGB 4OOFA 1M0EA 3OIWA 4Z6KA 1CRWG 3L0CA 1XWIA 1HFKA 2XKKA 1OFUX 3HBFA 5BSWA 2J3EA 2PT9A 3Q2OA 1RAAA 2CCGA 2RJNA 4UDYX 1GP2A 3TPCA 4M60A 1J0BA 4Z51A 4I4LA 5LYJA 4RSGA 4Q3NA 1QHHA 3Q8XB 1ZVJA 2B5VA 4WXPA 4KSBA 4R4JA 3NGMA 2VJAA 4XGRA 2HM7A 4WOKA 1URPA 1NI3A 2PRYA 3NEPX 4FGWA 5ECYA 2JZCA 2OV1A 1PJAA 1VKRA 1M66A 3A4LA 1YKFA 1NFQA 4JAVC 4KMOA 4M8LA 3VISA 5A1TA 5A5EA 3QE2A 1FA9A 5BV7A 1KMIY 3TQQA 5EJEA 1NBME 2QI9C 1XDZA 4C04A 1LDMA 3ONWA 3CF4A 1KYYA 4KO4S 3U4IA 4F45A 1JP7A 1G6HA 1DXQA 3IT1A 3OOJA 1UINA 1KGDA 4U5QA 3FYDA 2E6KA 4JP2A 2P4UA 4YREA 1Y6JA 3QLEA 4NEHB 3NEJA 5EE3A 1AKNA 2G1KA 2VDNB 4GDMA 5HS4A 1JT2A 4EF6A 4L8VA 1JVSA 1P0MA 1N5IA 2GMWA 4A0QA 2X3UA 4UE3S 2Q2VA 2GD2A 4NFHA 3L2OB 1VJCA 5CEJA 1VL8A 1E4VA 1NR7A 5C3MA 5HQTA 3W8EA 4RZIA 5IAJA 5CPFA 2GPAA 2VSFA 3N07A 3QVKA 1T0HB 2GFHA 1JEJA 1H65A 1RJDA 4MR9B 3RIEA 3RU7A 4ZHQB 4MYCA 1JQJC 2I3DA 5AYVA 2QTFA 2J3IA 4B76A 3FMGA 3I2GA 1M8JA 4O4JA 5A5FA 3NBAA 4C07A 2FOXA 4ND8A 5I9LA 2OYRA 3SF8B 1FFBA 5EY5B 1G9SA 1EH5A 3IEUA 2BUBA 3QELA 1LX6A 5AWFC 1CXZA 4F5WA 4RV9A 5CXSA 4K8RB 3K9LA 4MGIR 3GPCA 2G4CA 5BV1A 1ML4A 1E2FA 2CLSA 2ZRBA 3MJEA 4KUEA 3F78A 2HU2A 2QNBA 1T1JA 2WVAA 4Q7JB 2QTAA 4FCTA 1RHJA 1VE1A 4C7BA 5KOJA 4DJTA 2ZJAA 3GJ6A 3V1LA 1E5LA 2YXBA 1NXTA 4X91A 4BNIA 1VRCA 2SCUA 4DADA 5A0FA 4KIWA 3R1IA 4O2BF 4IILA 3BZWA 3K9BA 4QYMA 5IEBA 2PA0A 3MRSA 4QGSA 2HYIC 1H2RS 3PUZA 3CKMA 3IMEA 3OU7A 3E4DA 3T06B 3UHJA 2JZNA 4MUKA 1ZA2A 2Y0BA 3S27A 3WTBA 3KSRA 1T29A 1W4ZA 4KOAA 4QTUB 3WFIA 1Z6TA 1NRIA 2AHOA 4H7FA 2O4UX 1KI9A 4LZWA 4RYLA 1Z6QA 2OC9A 2X5JO 3ETEA 1BQEA 3L6UA 2IXAA 2YDXA 4GXNA 4ILKA 5K3OA 2G4LA 1T2EA 1UK6A 2WOOA 4P2GA 4PLHA 4OHYA 2R7LA 2VEDA 1D0VA 4QKQA 2PV0A 5KC8A 2EW8A 2RI1A 4PZDA 3S28A 1EVIA 2NXJA 3D7NA 2OCKA 4JLUA 3TLBA 3P9KA 5JS8A 3BXFA 4I08A 3G5TA 3T7KA 1KMMA 1H2HA 1D2HA 2Q6OA 3KCNA 4ZD6A 3SX0A 1FNMA 3CRMA 1KFCB 4WCDA 5HR5A 4LTMA 5KZMB 5DM60 4FSHA 2WQZA 4D4JA 1PQWA 2H63A 4ZOEA 5IJ9B 3WJAA 5JO9A 2WYUA 4J03A 2J9RA 4V03A 3D64A 1H8ED 5JT1A 4P80A 4OLHA 3SLRA 1E4EA 4OSEA 4DG9A 1Z4LA 5J4LA 5JTTA 3I6YA 3IBCA 3UAOA 2ZUVA 3RC1A 1E5DA 1C3LA 4KR9A 4IWXA 1JHXA 5DXFA 4HT3B 3LFUA 4U02A 2ZM5A 4IXTA 1PGNA 4M9CA 3RUCA 3G0DA 4GM4A 1SBYA 4XVQA 5EHZA 3GGSA 4O4IF 3LW8A 1E94E 2VDRB 1X1CA 1C50A 1JZSA 3AOGA 3JYOA 3NV9A 4RWEA 4TV8A 4XUDA 4PPGA 4OU5A 3TDMA 3DPIA 1MRSA 1PUIA 4C0SA 1IN7A 2QT0A 2WIBA 1UC4B 2RIPA 4BU1A 5MHTA 4MS3A 3NUGA 3ESQA 4HMQA 5CT5A 1AMOA 2Q7OE 1Z4IA 5JJIA 5EHQA 4MRMB 5KKAA 3UW3A 2REQA 5A6VA 4AY2A 2AXNA 4X20A 3HR4A 3O8NA 4XKJA 1Q84A 2QSUA 1RQGA 1RMQA 2EW2A 3HVHA 4ALJA 4YH1A 5HMMA 2WWRA 2P4QA 3PT9A 4YJ2F 3RT9A 3UAXA 1GRVA 2Z8YM 3EZGA 3G0IA 2IU3A 4M7WA 1EX6A 1N5JA 1UPCA 4GOMD 1GITA 1DBRA 1J99A 3AUUA 3HJBA 4ZYYA 1APBA 2ZEJA 1QYDA 2GESA 1OLOA 1NQOA 3PK0A 4GGMX 2X9VA 5FWYA 3O8QA 1JTEA 4PLZA 5ECGC 5IT4A 4IGKA 3E7FA 4P5DA 1S8FA 4ONEA 4XYEA 3N7AA 4PIMA 4REMA 5F3DA 2GAJA 2JIZA 1DADA 2COEA 2FUEA 3TM5A 4OATA 2PANA 4XASA 2AE1A 4RDIA 1EMDA 2F59A 1G8YA 4Y8VA 5DNAA 5JHHB 4GU5A 2P5YA 2PGDA 3GV0A 3O3CA 4DHWA 1K9VF 4MVJD 3N76A 1EXVA 2HWYA 1XNJA 4AVYA 4D43A 5ELXA 3RO7A 1J8FA 1NRWA 3EQ6A 2R5WA 3KAQA 3P1JA 16PKA 1SKAA 3H5IA 4MI9A 1M0TA 3IT3A 4BAZA 4AU1A 1YQTA 1QV9A 1IU9A 2WKSA 3KU1A 4TSFD 2V4ZA 5D7BA 1I3LA 3R74A 1ZLYA 2X22A 3LOPA 2XT6A 3NKLA 4GR9A 4CKCB 3K5IA 2OB1A 4UREA 1OY1A 3IEMA 1R6BX 3CINA 3MT9A 5ENVA 3H4IA 3IUNA 2QKYA 3UK0A 4QECA 3N2GA 4MW5A 5CA0A 2Q1WA 1XIVA 2GTIA 3ZEAA 4V1CA 2VP2A 4FOPA 4B48A 3MMPA 1UKYA 2AZDA 1TGVA 2FG5A 2L69A 2V6FA 4LS3A 1P75A 3M4ZA 1JLKA 2IYAA 5JE8A 2IS1A 1TUEA 4BKUA 1Y4SA 3TEFA 3JQ9C 5MN4A 2RHBA 3QGMA 3NBXX 5CCXA 4IXDA 1MG5A 3E2PA 1BEUB 1MENA 1XQ9A 2HUNA 3BFXA 3LIPA 3O3NB 4QFCA 3A25A 2PU7A 2FLWA 4BUCA 1X74A 4DJDC 2WQ6A 2R7KA 3I92A 4ID9A 4DYVA 4AN0A 1DC7A 3D9QX 4G37A 4OQLA 4OXQA 2QJOA 3AQIA 3KEMA 10MHA 3BGDA 1NVKA 2HHAA 3PGLA 1P5RA 1YVDA 3ET5A 3SHWA 2P9JA 4IJKA 3WGTA 3V00A 1JAZA 1USWA 3NWPA 3O8QB 5K4GA 2XE6A 4HSGA 3TZEA 5JH7F 4JEHA 1XVLA 1WRBA 1IBLB 1IHDA 4IXMA 3C6BA 1O6ZA 2P2LA 4OKIA 1ZCZA 4DSUA 1QOQB 2C8VA 1OA0A 3EIFA 2IH4A 4Y6RA 2I7TA 3FKSD 3GO4A 3BEDA 1V9CA 1E7MA 4N82A 3G1WA 1U31A 4CKWB 5HKAA 1TB4A 4M9ZA 4D46A 1W49A 2HMYB 2BM9A 2R9VA 3T4XA 1XT6A 4YACA 3VO9A 4LKOA 4B6EA 3RR2A 3W2IA 1AJEA 2HUPA 2NPIA 1NQXA 3ROEA 1AHHA 3A7EA 5LZ5A 2WMYA 3FNRA 1D8AA 4OHXA 2PRSA 2RHWA 2A9VA 4U8HA 2RONA 1Z5NA 1V7PC 2YIMA 3VV3A 3P94A 2OO5C 3JARA 4JLKA 1XN4A 1X2BA 3ADOA 3OCJA 4ZT7A 2Q2WA 1T2VA 1WUTA 3REOA 3PSAA 3AHCA 3VOSA 1UK7A 1QYWA 1E6LA 3DWIA 4BO9A 3U3RA 2G0NA 1Z8DA 2VHXA 2WSMA 2GN2A 3FSGD 3HJCA 3IXMA 1RLJA 3LI2A 4QUGA 4TV9B 3VU9A 1DKLA 2VNHA 2D62A 3EEFA 3LPMA 3GN2A 3LT0A 5E6RB 2YRWA 2BD0A 2QN3A 2ACKA 4RWZA 3BORA 1UR5A 3ZBTA 2X9QA 3U7EB 3VSBA 4AL4A 3O8LA 4KG7A 4EYQA 3OOSA 5K0SA 3NVKI 3BWMA 1HC7A 3MN1A 5JI3E 1QWOA 2V0NA 2NTVA 1U9JA 1TU4A 2FFBA 1OXTA 2WG1A 4YB8A 3MSXA 1KYQA 3GWZA 4CQLA 1UANA 2B9EA 3GEMA 3AERB 1PV1A 4RVOA 4WJLA 2XBLA 1NUPA 2WIAA 1XMSA 4MWCA 2QYTA 2WT9A 4QRIA 3O26A 2F3UA 3ETHA 4P7GA 5MGBA 3UHFA 4U7WA 1B93A 2EDAA 2KQUA 4OAQA 3JZDA 4QC2A 1XRJA 4OP3A 3K4PA 3M5WA 4IKEA 4MCAA 1K98A 5AM4A 5B7PA 3M4NA 1BSVA 4K6GA 3MQ4A 1IEWA 4Q6BA 4UU0A 5H02A 2C4NA 4UZFA 2OZLB 5FRDA 1A5BB 4YRJA 3UJCA 4DF3A 4JT8A 4WY5A 2MCFA 5SICE 1VFPA 1MA0A 2MMGA 2PFKA 1OWPA 4G0QA 3KZ1E 3OT5A 4J49A 4LG1A 1EXDA 4M46A 1RE1A 4JBHA 3K5WA 4X1KB 2DLCX 3JYQA 3ZK8A 1DTWB 3V4VB 4DSTA 4LMRA 2WE7A 3Q7IA 4IWYA 1XEXB 3WADA 4JY7A 5KTPA 4KYUA 3GXOA 4LHZA 4BO4A 5CK4A 1VPLA 5HM6A 2WY2D 3THYB 1GTMA 1QH8B 3U4QA 3ZDAA 1ONOA 4IIDA