4D8WA

Salmonella typhimurium d-cysteine desulfhydrase soaked with d-cys shows pyruvate bound 4 a away from active site
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
328
structure length
327
Chain Sequence
b'MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-Cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 120
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8wA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8wA02
2EFYA 1TYZA 4D9GA 4OREX 4ZQCB 4KKXB 3T4PA 1K7XB 2O2JA 4HN4B 3DWIA 4D96A 5IWCA 5JISA 3AEXA 4D9IA 1RQXA 4XUGB 2C2GA 4D9MA 2ECQA 2DH5A 2CLFB 3X43A 5I7OA 2JC3A 3TBHA 1K8XB 2GN1A 5E0KB 1A5BB 2J9XB 4HO1X 4D9EA 3ZEIA 4L0DA 4D9CA 4D8WA 3VC3A 2ISQA 1TDJA 4H27A 4OFXA 3PR2B 3IQHX 2CLHB 3VBEA 1KFCB 4QYSA 3SPXA 1Z7WA 3RR2A 1J0DA 4AECA 2PQMA 4LI3X 4NEGA 3VSCA 1TJPB 3IQIX 5DW0A 1WDWB 1JBQA 5IXJA 1KFEB 5JJCA 2GN0A 2BHSA 2GN2A 4PCUA 1QOPB 2EGUA 5D84A 1QOQB 2BHTA 2J9YB 1C29B 1CW2B 4L3VA 2D1FA 5BW6B 1Y7LA 1V7CA 4HPJB 4Y6GB 1TZJA 1TTPB 4D9NA 4D9FA 1KFJB 2CLLB 1K7EB 4ZU6X 1F2DA 4D97A 5B36A 2CLOB 1X1QA 1FCJA 1OASA 2RH9B 3L6RA 4I1YA 4D9BA 1J0EA 5DW3A 3R0ZA 1J0AA 5B55A 4LMBA 1TZ2A 3DKIA 4L27A 1Z7YA 2ECOA 2C2BA 1VE1A 5DBHX 5IW8A 3V7NA 3VSAA 2J9ZB 3PC4A 1VB3A 2Q3CA 3AEYA 3PC3A 2Q3DA 1UBSB 5HBGA 5I7RA 5D85A 3L6CA 2RHGB 1K7FB 4NU8X 5DVZA 4D8UA 4HPXB 5B3AA 1A5AB 1J0BA 1K3UB 2CLKB 5I6DA 4HT3B 5D87A 3FCAA 3PC2A 5I7AA 1M54A 2TRSB 2CLIB 4L28A 1KFKB 5C3UA 1CX9B 2CLEB 1A5SB 4F4FA 4COOA 1V8ZA 1A50B 1WBJB 3IAUA 4JBNA 5EY5B 3IQGX 1P5JA 5J5VA 5CVCA 2CLMB 4D9KA 2TYSB 1K8ZB 1KFBB 4IL5A 1J0CA 2V03A 5DBEX 1E5XA 1VE5A 2TSYB 5KINB 1BKSB 1KL7A 3FGPA 1TZKA 5CGQB 5D86A 4D8TA 1UIMA 1UINA 1O58A 3VSDA 1WTCA 1TZMA 4D99A 1PWHA 1D6SA 1K8YB 1FUYB 3R0XA 3SS9X 5B1IA 2DH6A 5I7WA 4D92A 3SS7X 1V71A 5B53A 2O2EA 1TTQB 2Q3BA 1PWEA 3BM5A 5T6MA 3HMKA 2ZPUA 4AIRA 4WX2B 1WKVA 4ZU1X 4JBLA 5I7HA 5KZMB 1C9DB 3DWGA 1BEUB 4LMAA 3L6BA 2RKBA 2WSYB 5B1HA 3X44A 2ZR8A 2ZSJA 5J43A 1C8VB 3CEPB
chains in the Genus database with same CATH superfamily
1P5RA 1J33A 4GBED 4RCVA 4A6PA 2A58A 2D2XA 2FR1A 2OILA 2VXOA 3CCFA 3D8SA 3DT6A 4GNRA 3TOSA 4B80A 4FSHA 2QRGA 3PX2A 5G40A 4YCLA 5LXTA 2ERXA 3O4FA 3FTQA 1A8PA 1Q20A 2VIIA 3HXMA 1AHHA 3SX2A 4J2TA 4RLQA 3Q2KA 4C4XA 3NUGA 1C80A 4NYMR 5EQDA 3GJZA 1PNVA 3PJDA 1PL7A 4NV3A 1LA2A 4WNCA 5HIIA 1PSWA 3UKDA 1ZM7A 4DUPA 5KQLA 3T5PA 2E4YA 3C45A 3BFXA 4EYQA 5JC8A 4EJ2A 9MHTA 4U7JA 4U8GA 1V1JA 1T4MA 2WQ7A 1XCBA 4CCSA 1ODJA 1VMEA 4JS0A 3UMCA 1C2TA 2X0DA 5AKGA 1OIXA 5CFLA 2WPDA 1DAMA 3G0CA 3AB8A 4FZJA 3GVIA 4L85A 5G3ZA 3V4SA 2O9JA 4Q7QA 1L8LA 2Q28A 4L9AA 1JYEA 1H2XA 2JARA 2WOJA 3HLYA 4IDEA 3ZHOA 4XR4A 1XCMA 5JUWA 3LUCA 4KZKA 1M9NA 3V6LA 5CAEB 1OXVA 2WAXA 2F8MA 4WJLA 1PP4A 1AQLA 1KYQA 2BH9A 2ECPA 3LCRA 4Z7NB 2R00A 2H4FA 2FW8A 1UK6A 3DEFA 4BB6A 1IWBB 5B36A 2O5CA 1J8DA 2NZUG 3BHNA 5AVWA 1BEZA 4JN6B 4DDKA 5CDGA 1HFKA 1TUBB 4AUEA 2YZMA 3JQBC 1SCQA 1TECE 5CVJA 4IUBS 5JAHA 3KQUA 3I01M 4ZV4A 2UUCB 2P41A 2ZR7A 2BKLA 3NIGB 1A4UA 4LJ6A 3VMFA 2AJCA 3BA6A 1J2JA 2KBEA 1T9KA 1U3GA 3QYAA 2QX7A 4PZUA 3GUZA 3TOXA 3AJ9A 5F51A 2O07A 3QYJA 3LGAA 4I50B 5EWJA 4QLAA 3SQDA 2IX3A 2R79A 3ORQA 4Y6LA 4M53A 1CR4A 4KFSA 1LXCA 5JPCA 4LRTB 4NMWA 5EC8A 1V95A 3RAFC 3HKEB 3I39X 4JWTA 5IYZF 5JQGA 1FNDA 1RAEA 1V6CA 2XXBA 4RSGA 3WWPA 2O1XA 1M2JA 4R4JA 2J5BA 2GEVA 4L3OA 4LY0A 2CL5A 4PNHA 3QOWA 4ROSA 2Q5EA 3I8SA 3OECA 2EFDB 4ZZ3A 5JAMA 1PNTA 2GS9A 3R41A 2RK6A 5JPIA 3RUPA 3WADA 1NU6A 4JEUA 2DSTA 3DMTC 3E7FA 3KWMA 3RE1A 4JJ7A 3CCCA 2GEDA 3U61B 1LSJA 1N75A 1X14A 1NW8A 1QCYA 1USUA 1ZN7A 1U02A 2Y0EA 1ZVQA 3I2JA 3BPSA 3OPYB 2Z2KA 1MJFA 4M76B 3KVNA 3DAPA 4RMJA 3TTUA 4MA5A 1RXCA 2CXRA 3A05A 3PG5A 5EJ9A 3DT9A 4WKCA 4I9GA 1JN0A 1RRFA 2GDJA 2Q8QA 4MO9A 3TI9A 3VSDA 3VYVA 1PWHA 3GHHA 3LTEA 3CR7A 1IVYA 3KJZA 4RQUA 1B8OA 3O84A 1Q0HA 3OI7A 2BM1A 3Q0EA 4BYMA 3F67A 1L5VA 1U0FA 2PO5A 1ZONA 3QU5A 1F06A 2F8LA 4BNVA 1IRIA 2XRMA 3MCVA 1W75A 4M60A 1Q16A 1SQ0A 3H9BA 4C1BA 1JJBA 3D2AA 1H93A 3BK7A 1KHHA 1YMQA 2WV7A 3G9ZA 3ZTTA 5JO9A 5I9NA 3TLBA 2IW1A 2IU6A 4CQJA 3H5AA 3TGPA 3L7KA 2ZZMA 4RJKA 4MRPA 1NVVR 4UCWA 3UK0A 3VYSB 4LW8A 3GPBA 3ZQKA 3K8QA 4NE7A 4ZI5A 4QTUB 5J58A 4WUVA 3KQPA 5EERA 6YASA 2NUPB 4OV6B 3U44A 4OQZA 1Y1KE 2QORA 3RROA 3A04A 3QVLA 1K3FA 1LU9A 4UM8B 4AO8A 1ILEA 3JQ8A 1UANA 2JI7A 2V7BA 3INNA 2JDID 4IDHA 3UMBA 4YRIA 1IXRC 3T1TA 1O0BA 2K2WA 4QG3A 3Q2OA 5KDDA 3DJYA 1K92A 2G04A 4H27A 3I0MA 1QO0D 2PNFA 3QVWA 4HLCA 3U4GA 5HUHA 1SXHA 4BN0A 1BROA 4DMMA 4MITA 5MN4A 2H5EA 3AUFA 1OLUB 4IIJB 1VMKA 4K6CA 4OJNA 3MJDA 2OHFA 4B3SB 1E3WA 3MMSA 3CJQA 1GKIA 4ZEVA 5I9IA 1G20B 1IEQA 1Q0PA 1S9DA 2PRIA 3Q88A 4FGLA 4NEQA 1DEAA 4ZREA 1FS5A 4LVCA 3COJA 1EUCB 2K7ZA 2YZKA 3C24A 3EZLA 4PICA 3NVAA 3KE9A 3NWOA 4IZHA 3R7LA 3ANLA 3FKSA 4NCKA 1TM4E 3RLIA 7ADHA 4X20B 1W4RA 4G4IA 4AN4A 1WIWA 1N8SA 3K0CC 3ONVA 1ID1A 3QP9A 3WRXA 1JLLA 4A91A 2QXUA 3IKMB 2RHBA 4M88A 1HFWA 2ZATA 3MJSA 3C8ZA 1Y5RA 4UHKA 2P67A 1I0ZA 3DS8A 3IUMA 1FY2A 1T2DA 5F4BA 4DM3A 5DM0A 4XVRA 4IV5A 1O6BA 1D7AA 3EHDA 1KKMA 4JELA 5JAPA 2H48A 2FQWA 2P7IA 5CYFA 5ALFA 1U99A 1QQ7A 1P4RA 2PXHA 3G85A 3LAWA 4YIKA 5CIWA 1HE3A 3DZBA 4H1VA 2DU8A 3WXBA 4KAFA 2F59A 3PCXA 3AU9A 3QWFA 5AW8A 5I9LA 1C0LA 2BCEA 3R3JA 5KNLA 5FPHA 3CUWA 1QXSA 3L0SA 3TFWA 1Q0UA 5D85A 1K4KA 2H29A 5K3SA 5EVJA 2I6QA 2XUHA 3EODA 4JMPA 1NDHA 1YZFA 3AL3A 4GOLD 3INRA 2GBPA 5KSYA 4N03A 2J09A 4LE1A 5DLDA 1Q91A 1K86A 1PBTA 1ZCJA 5ILGA 3V9AA 8ADHA 5K3EA 5FBZA 5D6OA 2QG4A 4V1CA 3ES9A 3ETEA 1FDVA 3GRYA 2A8YA 1Y4ZA 4N5DA 3VDQA 3GWZA 5IJ0A 1CUXA 4G0WA 1B2RA 5DTMA 1YDFA 2DKOA 2WP0A 3KFLA 2C8JA 2PVPA 5F52A 4DSNA 4JEIA 4PVCA 4F6RB 4BX9A 2GNPA 3VH1A 4CQMA 1J6UA 2UZ0A 3BXXA 5AHKA 5EJMA 1U2DA 3ANYB 4MI6A 3TTTA 3JQ7B 4NZZA 2HYIC 1BA2A 2WF6A 3HB1A 1ZSYA 2DFNA 2JGLA 3BIXA 2IPOA 3JQAA 4HH3C 4W9RA 1KDZA 4AXBA 3RAEC 2HWWA 2BP7B 4C4PA 4MS4A 2K87A 3AOEC 4MX8A 4PQRA 2BEWB 2XMRA 4L4YA 3TXAA 3BT7A 3WBKA 3DMPA 2WU8A 3DV2A 2HR1A 3OTGA 1QP4A 3MHPA 5DI3A 1AO0A 4D45A 3WFZA 4CUZA 3NNDA 4C2UA 4K9MA 2V6JA 3I1YA 4FZ3A 2XT6A 3JQCA 3M0EA 1M5TA 4HGRA 5BYBA 3WB9A 1A9XB 1RXYA 2PL5A 2NZJA 3JQ6A 2QROA 3R6WA 1B76A 1ONBA 3F5SA 3PYMA 4BLRA 3D4IA 1RU3A 3AO0B 5EE0A 4M46A 1YB4A 4KN6A 1LRJA 1IFXA 3U48A 1UL1X 2XA1A 4TKVB 4EMUA 2QQEA 2A0FA 3EWSA 1UFOA 1YD7A 1XEXB 3OMWA 4UCXA 4Y7CA 5BUQA 5IC4A 3PJEA 2I03A 1Z4OA 1M5RA 4AKGA 2PUAA 3ISJA 1DKLA 1LI4A 3Q2IA 3QTBA 4GP7A 1ONNA 2XUDA 3LCCA 3GCDA 1RC0A 1Z5OA 2VNSA 3DR3A 4PLCA 5IKMA 1JHOA 5K8JB 4ZEWA 2A9JA 1EEXB 3A6GA 1RJWA 2XHZA 1DG9A 3CFYA 4I9FA 2CCGA 3TQHA 5GQSA 1HE1C 1XTIA 5HP4A 1ZNZA 1AK9A 1R4MB 4DLRA 3K72B 4K9PA 5KX5B 4IIUA 1ZK2A 4LQCA 4AECA 1YZYA 2X22A 1TEZA 3V4ZA 2JGDB 3I3SR 2CL0X 3D7LA 1BH6A 4Q66C 1G5TA 4Y2UA 5CA1F 3TRKA 1DOAA 3HCRA 1UXKA 2DPHA 5C7LO 1U7DA 2QRVB 8OHMA 5EMJA 2UYOA 4MEJA 2G28A 4MWGA 2MSWA 2PUHA 3A4VA 1GAXA 3B7WA 3H2BA 4KR9A 1WXGA 5T4BA 3AY0A 3JZFA 3M7IA 1EXNA 5EKSA 3WRVA 4K0KB 3O6VA 3KVOA 4UBNA 2V7TA 2VTEA 3JQFA 1YOVB 4D8VA 4XYLA 3T3HA 1NMXA 3A6EA 3DE1X 4OI2A 5LQJA 2HLNA 3QVXA 1MAVA 2QT1A 5DP1A 1TKRA 1XLWA 1ORHA 2NXWA 2WM9B 3ZXYA 5A3SA 1V41E 4OOEA 4HEJA 3LVQE 2AF3C 5B55A 1G2IA 5A6SA 3LFUA 4UHCA 3VPBA 2JEYA 1H6BA 1ACLA 1HKHA 4AZVA 2FZWA 3GT3A 4KP7A 1IU9A 1JEEA 2IEBA 5CH8A 3VV3A 2OUIA 2A4KA 1TVKB 1JKFA 1XTBA 1K98A 4EG1A 4HUTA 4B74A 1OPXA 3UG7A 4D3FA 3CH6A 3ZOKA 1PQWA 3KAQA 3O4GA 2GFHA 3T12A 3WL7A 5C35A 1FIUA 5TV2A 3HLKA 2XAAA 1PS0A 2KLHA 4DDTA 1DIOB 1Y8ZA 4CDRA 4FVTA 4RULA 3FROA 4PLVA 5F7JA 1F20A 4D1YA 3E35A 4KK3A 1AS3A 5BUZA 3OHMA 2WJYA 4DPMA 3ZV5A 3N0VA 4IJUA 2XMDA 4D42A 4E1VA 4KH1A 1SUAA 4KWEA 1IY0A 2ZM6B 4F56A 1MW9X 1ISRA 4ZALA 4HVCA 1XCLA 3G1TA 1DIHA 1EJ0A 1C9KA 4XX0A 1Z74A 5JDCA 3OIWA 5DDIP 1A95A 3TLGA 3EFOB 4DR5B 3RVNA 2IY9A 2OSVA 4YY3B 5CVEA 1MX1A 2NQTA 1GYRA 1QHGA 3DH0A 3PUIA 5ALXA 4MQ4A 4TWIA 5CRIA 3TCKA 3LUFA 1CY0A 2CUZA 1YKSA 1DWOA 4RNCA 1VIMA 2SKEA 4GM1A 4MQFA 3Q41A 3ZD8A 5H70A 4AY5A 4K88A 2Z83A 2BF4A 1K3TA 2G82A 2XCTB 4HFNA 4M6WA 1SC1A 2X5NA 3O90A 3KQOA 3NGMA 4I55F 1Q77A 3RODA 4TZ0A 1P4HA 1V1MA 1Y37A 1WXIA 2G1AA 3ESRA 3GZJA 4Q4LA 5REQB 1EIWA 2I55A 3IT1A 2J3QA 3OZEA 1NUAA 4HHEA 4WUTA 3WBJA 4ZT5A 1U1FA 3FVQA 3ESQA 1IZ9A 3S1LA 1KYTA 1RLOA 1KO7A 1U11A 3NUZA 3ICWA 4JD5A 4P3KA 1QFYA 3CJTA 3VVCA 4M7OA 2CK3D 1E9SA 1BNCA 5BOVA 5I3CA 4QUJA 5AKJA 5IM4F 1F38A 1U65A 5JYEA 2ORWA 1Z4LA 6NULA 5F5LA 5I4BA 4GQIA 3M1IA 4OQMA 5HTOA 2I9PA 3HU2A 3SPXA 4EFKA 4L7QA 3AHEA 2MWMA 4EHAA 2OQIA 4DNFA 4QJIA 3IJRA 1XRNA 3SI7A 3SJBA 5KYKA 1SKMA 1L4EA 2CNOA 2AG6A 1DDOA 2EARA 4IQFA 2W2LA 4WEOA 3VU8A 1DPGA 5F7XA 5H83A 1E3EA 3MTBA 1QHFA 2HCBA 2VSFA 4OUDB 2CNDA 3KPWA 5JANA 1GAEO 2QVGA 3QI7A 1H2AS 4AD8A 1SUIA 2W22A 4UAUA 5BORA 5DTRA 1V1RA 3D5TA 4RTPA 5CB4A 3AXSA 4OLFA 1UMBB 1ZK0A 4KXVA 3THSA 1LC3A 3TW0A 2B5WA 2VNHA 4LHSA 5A4IS 3K70D 2GZ1A 2CLLB 1VBNA 3AYZB 3P9QA 4KR6A 1QQTA 5DNUA 4F5EA 4CMEA 3HU5A 1M3SA 4WLFA 1XPUA 1HDEA 4C0WA 1ODKA 1C7QA 4UUQA 2Z04A 5K2MA 3C85A 3UW3A 3KB1A 2O1SA 2JIQA 2EJWA 3DE3X 5HRAA 3GP8A 3C2QA 4G01B 1D0SA 2JBAB 5IKXA 4HYQA 3X2SA 1IHXA 1JFSA 1I6MA 4H1TA 1GZ4A 3KCNA 4RNDB 1BX0A 2XRZA 2G8NA 5H68A 2HTFA 2Q9AA 5E1BA 1XTVA 4NH4A 3O8OB 1C7IA 2AE1A 4HN9A 2QU8A 3F4LA 1NVXQ 3NC0C 3SHWA 1V6AA 1VI5A 3R3XA 1C3EA 3FTNA 4P3OA 2D4HA 4S1PA 1LRKA 3R8CA 5K0BA 3RABA 3AP3A 2IODA 1PTJA 1SRRA 2JGJA 1W30A 1I9GA 1E7WA 3FX2A 3TIGA 3MGGA 4BVEA 1G5PA 4LXGA 1PDOA 2V5VA 3DZDA 4FGUA 3UZUA 1DDGA 1FDUA 2OOKA 2VDQB 3O31A 3PEUA 2HWXA 4L2IB 2QGZA 4F2GA 2NSYA 4LIPD 1NXQA 4XM2A 2HPAA 4NAHA 1TLLA 2Z4RA 1I33A 1G60A 4KFTA 5FJJA 3GQBA 3RRBA 4IIBA 3UM9A 3WNVA 4OMCA 5FO0A 2W0MA 3ZNPA 1V5GA 4FQ7A 1ZR4A 1QPZA 4EFMA 4ISBA 5TXGA 5DGHA 3TL6A 4I5GA 1N5OX 3HB4X 1XZFA 2VP9A 2FCRA 4ZVTA 3ILYA 3DWFA 3ZU4A 1A9XA 2O8DA 1XL0A 5C7IO 1L3BA 4D8XA 1NE7A 3W5JA 4ZYVA 4YCCA 3AKDA 3U26A 3JWGA 5HF8A 1DO8A 5DNAA 1LDEA 1AKMA 4OFWA 5AOVA 2DR2A 5DK4A 2VJNA 1C81A 3MWLA 4HRAA 2P9BA 1X1DA 2PGDA 4PZ9A 5BSMA 4C22A 5JEDA 5CBPA 1C0PA 3EMDA 2XMBA 2JW5A 5TLSA 2J32A 4OREX 1WZEA 4RSMA 5IN4A 1FXUA 3ZE6A 4EECA 4U5QA 4BBZA 1SUDA 4X1YA 3WS7A 3ZWVA 1J21A 2OAQ1 2P69A 3WNCA 4DR1B 1AKUA 1NN1A 1Y81A 2BOVA 2IYOA 3FOZA 2TMYA 1LJUA 3D81A 1J8YF 1T4CB 1EFTA 2ZT8A 2JFYA 4OXXA 1U7WA 3CRNA 3RIYA 4A6EA 1Z33A 3GEMA 3MAAC 4HF7A 3QEAZ 2CV0A 1X39A 1UJ5A 5JSQA 1IHDA 2PZAA 3D6FA 3R9WA 1TVMA 5KOHA 1OILA 1SQGA 1ZGAA 1PL0A 1DKUA 3EIUA 4ARBA 2LUOA 3H2KA 1W581 5JSZA 2MR6A 4RVHA 4YA6A 1E6UA 3EXHC 3S8YA 3WICA 1CUAA 1N5DA 2IYXA 3GEDA 1UIRA 2GPWA 4GKVA 2OCLA 4YQEA 1BJTA 4RH0A 4LEIA 4Q3DA 1YQDA 2IOQA 3BG5A 2CHUA 4QUGA 5DB4A 1LX7A 3GRAA 1RPJA 1U8AA 3KZXA 4GKAA 5IC5A 4TN5A 2AMYA 2NXJA 4IEFB 5JSKA 4ARSA 4DZTA 3KZKA 3KAPA 3PHBE 3UKJA 4P36A 4BNUA 3IS3A 2J87A 4JC4A 2J08A 4DXHA 4F84A 2X3FA 3IMGA 1YRLA 1XL1A 1XMQB 1WRBA 4DIDA 4EY3A 4Z99A 3GA0A 1I5RA 2FSUA 1TUGA 1AK2A 3P0RA 1F8XA 5CITA 5FR2A 5KYYA 3IXLA 3OX3A 4YLGA 1QH1A 5D8DA 1GSIA 1E3TA 4FCVA 3CT6A 3QBTA 4QAQA 5ICMA 3GFVA 3GJ8A 3O0TA 1U1GA 2IH4A 2DR3A 2AW3A 3CN7A 3PLRA 4JFAA 4R68A 5DCUA 2QV7A 2VF4X 5HF9A 4NYJR 3ETJA 5IEJA 1J5XA 3LW7A 1TAQA 1Z82A 1K5GA 4IIFA 4JI2B 3OFVA 2IC5A 3VX3A 3ROFA 2GAFA 5TR9A 1ISFA 2V54A 4X85A 2VYVA 2GWHA 2IW3A 4O2AF 1PF7E 5AHXA 4RXMA 4MWTA 5DF1A 2QX8A 2WFZA 1OGJA 3C74A 5DTEA 5LQKA 4GPTA 1AF4A 2NVUB 4JUFA 3VDXA 3GFSA 1RBZA 1L5KA 3IHTA 3DEAA 2HW8A 1AMOA 4QTTB 4IUYA 4HNTA 1JXMA 1E79A 3IIKA 3OCUA 3WRYA 4F3TA 2C03A 3G9QA 4LSMA 2CUKA 4WECA 3VYWA 1GDTA 4AROA 2PBZA 4WSOA 5LJIA 4YAEA 3ZS8A 3RHSA 3U7FB 4KVFA 1J2RA 3GGSA 3GEIA 2XGJA 1ULUA 3GUVA 3HZRA 4B85A 3O8QA 4C5CA 4BQIA 2DBVO 4KODA 2ZR9A 2EP5A 4C4TA 5TPZA 2I3BA 1NN3A 5E4FA 1AU9A 2O7VA 1ZL0A 3DBIA 1NVKA 1EFLA 3H2HA 3IP7A 5A2GA 2HUNA 4EW3A 2YNMC 3GLIA 4GC5A 3W4JA 1LRLA 2R48A 3CUUA 3F7TA 1MVLA 1E9BA 2VUIB 3L1HA 3M1YA 2FNAA 5K01A 1J1UA 1DX9A 3SSOA 1JVSA 1RKVA 3ZK7A 4HH0A 2J4DA 1XMPA 5EKUA 3HO1A 3AW9A 2EKQA 2R96A 2EZTA 4RZIA 3UAVA 2VJQA 1TK3A 2PRKA 1CE8B 4IRMA 5IM5A 2W83A 3HXTA 2IOFK 4OM7A 4Q18A 4S1VA 5HBRA 5CLIA 1EQAA 4MW4A 4D5EA 4EX6A 2OSBA 4FI3F 4LOAA 2TMGA 5A04A 3PNKA 4R8RA 5EYPB 5TJHA 2V4ZA 2NYAA 4QIHA 2GHQA 2JLBA 4M22A 2WJHA 4MGEA 5AK0A 2GN1A 3IMFA 5LJLA 1RC1A 2QIOA 2QNRA 2ZI6A 3TI7A 3AB3A 4C0AC 2FWPA 3PZRA 1CUBA 1A97A 4K81B 4U6NA 4CTKA 3KU1A 1QZ3A 2HSDA 3C5EA 4Y1EA 4NG4A 2OHXA 3FA2A 4ZVQA 1EVZA 2BUCA 4YQYA 3KEMA 5IMBA 3DOUA 5EEGA 3DMRA 2C3OA 1MZVA 2PKQP 1Z39A 5DXJA 4UE2A 1F48A 1QWOA 1O89A 2WWGA 2WIDA 3KXKA 2PV0A 2ZRHA 4ARZB 4NH0A 1GPH1 2FEWB 1PFKA 1M2OA 1N1DA 4P38A 1LQ2A 3UFXA 5F9FA 2EF0A 1IUNA 1ZLXA 2WYHA 2VH2A 2YXLA 2VDVE 4WKPA 2J0VA 3PC8A 3SBOA 1SHKA 4W1RA 5BV2P 5I9BA 3I45A 3SEFA 4B8WA 2OGUA 3Q9UA 1KH2A 3QNMA 4DA9A 1P73A 4PLFA 4F46A 4ZN6A 5B4UA 2QM7A 2ZBDA 5LA6A 4PZAA 1BFDA 2A0YA 1BDMA 4P0QB 4WZBE 3TEMA 4XRRA 5HUJA 1GPLA 3JVVA 3KL2A 2QL9A 4QEDA 1KI7A 3MA0A 2E3JA 1JU4A 3I9KA 4W5JA 5C8YA 2ZJZA 5FHRA 3UENA 3SQMA 1P0FA 4TS4A 3L6EA 1U7OA 4DJJA 4L02A 1YRHA 4UTNA 4DSAA 3E7DA 5I45A 3DPIA 3JWIA 4BMSA 3RB8A 2OOSA 3IQZA 1XIVA 2XUKA 1R6XA 3L7MA 2VDPB 3D3JA 1SD1A 3D3NA 4OIMA 3RQIA 2FZVA 4ABTA 1H3EA 4O0MA 1H0KA 3UA4A 4REQA 1AQIA 1B6GA 1ZHOA 3EEFA 1R4NA 4HB3A 4IYRA 5H8WA 1ISSA 4JWKA 4CZ2A 5C34B 5BW5A 4FDVA 1RLTA 2XYRA 2J4FA 3DTVA 4RTKA 7REQB 3ITDA 4UUBA 2DMRA 2I6SA 4BKRA 2VWQA 1VG0B 2ZRFA 5AESA 1LPSA 4ZOBA 1P6XA 2CNNA 1CRZA 2HV8A 4RPHA 3G2KA 3EB9A 4O2BB 1S8NA 3L8ZA 4CODB 5A4AA 5IC6A 4IFTA 3S2YA 1YFLA 5IRCD 3FYDA 5JH7F 2XD4A 3Q8MA 3CNNA 4FDTA 4NE9A 4C14A 3UV6A 1BCSA 5KNCA 4WASA 4QGFA 2WICA 2I87A 4LK2A 5A05A 5C4IA 1W6UA 3V46A 1TC1A 1EK0A 3PICA 4UZFA 4WZ6A 2J41A 4C2AA 2BTQB 3HM2A 4MLZA 4R8LA 3IMEA 3AVXA 3CA8A 3FYSA 2XWBF 1FPMA 3TKYA 1JWAB 1YMVA 3WYFA 1U2PA 3BB3A 4OK3A 4HV4A 4E4RA 3SC2B 1L1EA 2JLVA 4MVJD 1J7JA 4IEEA 4LWOA 4DMFA 1CIVA 2HMWA 2Q3BA 1YCGA 1A98A 2HJVA 1CVRA 2V3WA 3NHAA 2PSEA 4IXWA 5JSFA 1JIJA 5A71A 4LWQA 1QDLB 2XJ9A 3EZFA 5GM2A 4BNKA 2JLSA 4MI3A 4BGEA 3IO5A 3LT1A 3NC4A 1PCXA 3EMKA 2WUDA 2LR0A 2IWHA 2WQZA 5A1JA 3EN0A 3OZAA 1GUAA 1OX4B 4AX8A 3F98A 1XP5A 1HNZB 1E20A 1ODTC 4I08A 3HXOA 1R4ZA 2EWWA 4MROA 4MPPA 3QE9Y 1FJHA 3UOGA 3FDJA 3PUKA 3VZCA 2WD9A 4IDDA 1DC6A 4LYJA 3WAJA 1SU7A 1S2OA 2ZB8A 5FBRB 1WDLA 3BEOA 1T36B 3L8DA 2KMLA 1MO6A 1II8B 4BBJA 4LY3A 5IHXA 4IUCS 4JBYA 2UV8A 2DFKB 1WKBA 1E2QA 1U2TA 2K6GA 2X0NA 3GUHA 3NBYC 4LMRA 5CHEA 3SF8B 3TLAA 3UTCA 2JLCA 2ETVA 3ZBTA 5FD8A 2BR3A 3AJEA 4BQFA 1FP2A 1XDBA 3U80A 5GGXA 4JQCA 1QP0A 1G3UA 3K0FA 3UF0A 2YWBA 3F1LA 1RAIA 4L8WB 1MDFA 3NVDA 4WXEA 2UUPA 5EXTA 3QVGB 2QTFA 4R6XA 1OWPA 3CKKA 3T7SA 2GPTA 3L0CA 2HV9A 4FINA 121PA 4E13A 2G9ZA 4JSRA 3J7TA 2ROQA 5BSKA 5BPFA 4WN9B 1N2CE 4O4IB 2YRWA 1FFSA 1L5SA 3FJ1A 4HUQA 3KKZA 5FEUA 3HUFA 2NO5A 1U63A 4IF4A 3SS8A 2P35A 3DE2X 1TU4A 2DBYA 1W1UA 4DMCA 2VYNA 2QLFA 1CQIA 1PEKE 4XFJA 1XMVA 4CT5A 1V45E 5KWJA 1MB9A 1ADJA 1VLQA 4EHBA 2JKYA 3H9GA 5IT0A 3FYUA 3ZTYA 4UVHA 1QTNA 1QZXA 2CWWA 1JT2A 2P3LA 3QVMA 4XLLA 2PZ8A 3W2EA 2VZ9A 1YDWA 4B7ZA 2I4MA 3B78A 2IYEA 2WJ4A 5AI6A 1XQYA 1VJ0A 3ULKA 2XYHA 2FEKA 1ZRMA 1Z3CA 2UKDA 3C3BA 3GQVA 3SZ3A 4IR7A 4TL6A 5K51A 2XNHA 2ZYAA 3KBBA 3T3NA 1JIIA 4LDNA 3ZD6A 1Z62A 2Q4TA 2QXYA 2VP3A 1UDCA 1E9AA 4W9MC 4DSTA 3QENA 3RFUA 5BSUA 5BN5A 4E70A 4C7VA 4O5OA 4AB1A 2WFMA 4XUDA 4TTTS 2RIRA 4MWEA 1ZAYA 2H1RA 2JLQA 4TKUA 4RVGA 4JBHA 2ORYA 1JP7A 3IEIA 1C4XA 1RAHA 2WIKA 3OFND 1N6OA 3D9QX 1GNLA 1LLFA 2YFQA 4J1QA 5ELLA 3K9QO 5BQFA 5KJFA 5DBIA 3ETCA 3RVSA 2I65A 2JFPA 5JXIA 1SEVA 1T9HA 1RT9A 4PYQA 1Z8HA 5HK8A 1P4JA 3FY4A 5BWOA 2BHLA 1H22A 5LZ5A 2NO0A 1BIFA 2NU6A 2KW5A 4QFDA 3DXXA 4YCBA 3SIXA 3HR7A 2O8CA 2XCQA 5AQ1A 1FLNA 1XVLA 2C5AA 1DINA 5EJIA 3BOSA 1EVYA 1TTQB 3BB4A 3MPUA 4JJ8A 4US0R 2GXAA 3QI2A 2UVPA 1NJ1A 1FLVA 3JQGA 4HXFB 2PL9A 3B13B 5E7JA 3LC1O 4HBZA 1VG1A 3KKOA 1RTKA 2RG7A 3H42B 2NN3C 3LKDA 3QMMA 3SEZA 4CJXA 3FPCA 4OL0A 1CY1A 1ECPA 3FBGA 3SP1A 4RCZA 3MD9A 1URPA 1IYZA 1DG1G 2C0CA 2KI5A 1QYCA 2XNJA 3IEUA 4L50A 4WXRA 5JASA 2NYUA 3AVOA 1MB3A 2BZ0A 4HN4B 2Z8YM 1QF7A 3P96A 2PSFA 1A5TA 4HAOA 2GAAA 3IAFA 1YC5A 4H1UA 3TNDA 3T7CA 2I2CA 2Z5GA 5U4QA 1COWA 3ACBA 2REXB 2RI1A 1SZPA 4KHZA 3X1KA 4YQFA 2QK4A 4KQEA 3NRJA 4QYWA 1EK1A 3DFIA 4JB3A 2YWRA 4P58A 4LWZA 1NBOA 1F7UA 5E1DA 3T5CA 1XDWA 2R5FA 4I4LA 4JUIA 5FBHA 1JSCA 1R6AA 4YRCA 3A7EA 2HRQA 3MEQA 3E2IA 2CT8A 3IP6A 2MSCB 1KDVA 3P9CA 1XZBA 1UJMA 4GSYA 4OLJA 1KC1A 4EO4A 3T95A 1AKEA 1JFTA 1HG1A 2M9MA 3SR4A 5CFZA 4YT8A 2NTEA 3NAZA 3DO6A 3ZE7A 1G3IA 3QELB 1CR2A 3M3DA 1TW2A 4E14A 1B6SA 4B35A 4DAOA 2F90A 1W4ZA 3WHIA 4C9BA 3G2QA 5K0LA 3VVBA 5FTKA 3RS2A 4LDJA 1D2EA 4H7EA 5CJ2A 1FEZA 5CXQA 2VBCA 1K4MA 3B6JA 1PEDA 4WKNA 4O3MA 4DXAA 1ZCAA 1J0AA 2EJCA 3DPUA 3PPIA 3W7BA 2H5IA 3VPFA 5ARDA 2Q2NA 4Y2XA 5DOZA 1N32B 4ZQBA 4TUYA 1JR2A 1F6WA 2AI1A 4L5AA 2OBNA 4V0QA 1D2GA 1H9CA 1CSEE 3RFFA 2XUOA 3S2ZA 4EFDA 5BN3A 1LWOA 2M6LA 1W4CA 4B7UA 4I3FA 1XOIA 3I2KA 1HM5A 2IP4A 4GQAA 5D00A 1DX4A 2R4QA 1MJ5A 4QYMA 1OKKD 3NWEA 1THZA 1PU2A 3HRIA 3CX8A 2XQJA 1VSQA 3LPCA 4KX5A 4LDAA 1XFAA 4AWAA 1CQWA 2YHUA 1GM5A 1EX7A 1KY3A 3BEDA 2JBHA 1X0XA 2AE2A 2G25A 1GGJA 1VBMA 2Q3MA 1V16B 2XIJA 2ASEA 3OC0A 4HTFA 5DYNA 3K70C 1EWRA 1F2UA 5B4TA 5JLAA 3MGBA 4H18A 4IDQA 1NL3A 5TVKA 3AUTA 4IGAA 4LBYA 2HA5A 2FAXA 2PZKA 4XDYA 3HEMA 3RVBA 1PWYE 5T4HA 2EZUA 3D5QA 3GT4A 1JDJA 1CY7A 4CLOB 2IPNA 1CBUA 2DC1A 1YE3A 3BXPA 1QHYA 3JQDA 3A0RB 5KVVA 1XTQA 3UG6A 2XUIA 3LUJA 2BKAA 2YQ5A 1BGXT 5K0CA 3PXUA 1YF3A 3JQBA 1Z0FA 4F5YA 3GU3A 1O7JA 4EY6A 2O8EA 3MJTA 4XTRA 4QRIA 1DAHA 1Q7EA 2WTBA 3DVAB 3HJUA 4XYGA 1GTG1 5A5EA 2A9PA 4L78A 4DZZA 1Z6GA 4JI4B 3C3MA 1H42A 1GQYA 2Q1UA 1Z29A 3MUNA 4LDZA 5GTDA 2GX6A 3HA3A 2VQSA 3C5CA 1KI1A 3ZGYA 4PE5B 4IGFA 4B3DA 1RI3A 3E8XA 2O50A 4O2LA 1X1TA 3ZX5A 4YIHA 5BSHA 4NBNA 3LIIA 2C5LA 1QUFA 1U0GA 1Z16A 2W6JA 4OXKA 2IHJA 3G2PA 4CEIA 2LCIA 4KQIA 1C9NA 2JIMA 4HWOA 2WI8A 4LVNA 4J6EA 2F9FA 4UKDA 1UZMA 4FFDA 4G9GA 3WIDA 1ZOLA 4INPA 1N2ZA 1QDEA 1VKOA 3DMTA 1NASA 3HBMA 4OB8A 2EQBA 4UUAA 3DCNA 4GOOD 3DVQX 1BWPA 3BULA 4D3YA 2CFRA 2E5WA 1OF1A 4HKTA 1HQDA 3SG0A 4LF7B 4HJXA 1SUWA 2DPGA 3GYGA 3OZBA 3KYBA 3E23A 4Q93A 1IY1A 2YWJA 2P68A 3CQ9A 1U0NA 4BBPA 3EPJA 1VC2A 3E53A 1JFFB 2FYTA 5SYAA 1NBAA 3RG8A 3BTOA 5A3QA 4EKGA 3LPLA 1SXJB 1B8UA 2W8BA 1WHSB 2AEFA 1CUUA 3RANA 1VPEA 5ESRA 5KNBH 2NPIA 4QBKA 3SQNA 3K9CA 4GW3A 1GRNA 2PPVA 3A1NA 4R0MA 4GMFA 1NVUQ 1W9HA 3K2IA 4OYRA 3MRVA 3VJRA 2H1FA 2CC2A 1NAHA 5ICFA 1OW3B 4B4KA 1V2GA 4QGGA 1FDOA 4IKEA 3VHXA 3MJEA 3NHUA 1SCBA 1JSRA 1UPBA 1BGWA 5LYJA 5KOYA 3IR7A 2J6HA 3U4MA 2QDKA 4KITB 2C2BA 2Y8EA 1BS1A 2O7NA 2I0FA 3DUFB 3M4NA 1A72A 3Q1KA 3V2HA 1Z5VA 1RWWA 2VDMB 4ITRC 4YAGA 1T1RA 2ID4A 3HUTA 4P34A 4L15A 5BN4A 2YY7A 1L4NA 2V8BA 3TTWA 1P7ZA 2NSLA 3A2KA 4Q1DA 1GTZA 3FI0A 2X58A 4KH0A 3FUUA 4K9KA 2A0UA 2QJOA 3NOQA 1ZW1A 2BMDA 4IS2A 1XHEA 7MDHA 1MIOA 4GOKA 3CS3A 1N6HA 4IPTA 3B82A 5EZQA 3S0JA 2ACWA 1WMBA 3L0IB 3UXYA 2XW6A 4J94A 4I8IA 1TU0A 2XCOA 5C80A 2W6MA 3D02A 1MG0A 1SVSA 1OB2A 2OPHA 1BHSA 4CE6A 1P4GA 1JLKA 3I4FA 2PUGA 2HRCA 2ID7A 3O38A 4WLEA 4BTEA 3LBAA 3R3YA 4J0EA 1JJAA 4UHJA 1PR4A 1CRWG 1SVUA 1KZGB 2CEKA 2MYNA 1Q57A 2IYAA 1TQ6A 5T57A 3CVWA 5EWLA 1OE0A 1UXIA 1E2JA 5KPDA 3F8TA 3ODPA 3R75A 1SOAA 1ZY2A 5FUQA 1R5NA 1W1IA 2GF2A 4CI9A 5SY6A 3PA8A 3WO0A 2D5CA 1BMTA 3K0CA 2AWNA 13PKA 4FCTA 4I2NA 5CUQA 1H2HA 4CEIB 2C00A 2A0WA 2WWFA 2B8WA 2PA3A 1SNYA 1CHDA 3IXMA 3RHTA 2V7GA 3P0FA 5TF4A 3LXRA 3SLRA 1E8NA 5FX2A 2EIXA 2PXCA 3AJDA 3ZWDA 3KQMA 2PFGA 2AOUB 3MG9A 5CDHA 4JDPA 1HC7A 5GIPE 4EABA 4I4CA 2L18A 3H6GA 1BQ3A 4P3NA 5DM1A 3CNLA 4OLAA 3JYNA 1YZGA 3BSSA 2QUJA 3LA6A 1B8PA 1JEAA 3PHJA 3A9VA 3C6QA 3OCCA 1R3UA 3Q7EA 4FS3A 4EYKA 2B0CA 2R3SA 3VPGA 1IN6A 2UYHA 1LI7A 1TCCA 5TARA 2Z2YA 4FM9A 2ZPAA 1K8XB 3T3PB 4BP9A 1MAHA 3L92A 4KL8S 3KELA 3STTA 4LTMA 4N82A 3IULA 1XMSA 3AERB 2BGRA 3CH5A 2QTWB 1W8DA 2OZVA 4Z4IA 5FA8A 2OV6A 2HOQA 4GOJA 5KSWB 1NI5A 4GC9A 4RAOA 5DNDA 1K63A 1KO1A 3CYFA 3BMOA 1LK5A 1YZQA 4UBMA 2VO1A 2PWAA 1MFZA 3IOCA 3CLTD 4OBWA 2OCDA 2JRLA 1U8FO 3O1HB 4R1PA 4LUCA 3S7TA 4P7BA 1GTSA 1VG8A 3I9JA 1K9VF 3H86A 4LRSB 3WYAA 4B3MB 3WTCA 4EVSA 4HDSA 1FZQA 1TO1E 1XZHA 2W2MA 4YJ3B 1T5DX 5TRTA 2GZMA 3AI3A 4CM4B 1AHNA 4X65B 4RTMA 4BVGA 2LP4Y 2IOYA 3KHKA 4BO3A 3U3KA 3AOEA 2EC5A 2VHWA 1GNVA 2JCYA 1RVDA 1ML4A 3R0IA 2AC4A 2E1PA 4TMKA 5I7EA 3AP2A 2C78A 2JLAA 3WY9A 3I5AA 2FPXA 4M1TA 1NQOA 1JAXA 1AVTA 1HT0A 1PWXA 3RSCA 1WLSA 4HDRB 4KMRA 4PZZA 5AK3A 1Y42X 5T64A 1ZUD1 1VIAA 1L9XA 1E2BA 2QZPA 4OA8A 3KXIA 4YCDA 1JQ5A 2FPSA 5HQ3A 5K3CA 2VSXA 4M0FA 1SU4A 1DU4A 1M8KA 4FMBB 4G81A 5DNEA 1UPTA 3AQ4A 4I5DA 1TQHA 2BFFA 2OBBA 5ALWA 2PLFA 4U7TB 2M6RA 3FFTA 3WZ2A 2AFHE 1WXXA 3IIMA 3OEHD 2GRUA 3K96A 4IF6A 1EUDB 1UKCA 1X1EA 1F9AA 3RT9A 1IDOA 5JU6A 2QS9A 4I4NA 3ZY5A 3KWFA 4HI0E 4QPNA 3KZCA 3OFSA 4Y6RA 1VYUA 2YOFA 3O7MA 2FU5C 2L17A 1T0IA 5DBOA 1G9SA 4P2BA 3BRWD 1IJBA 3FLBA 1S5PA 1X1CA 1CETA 5B7QA 2C2XA 4JBNA 5JSYA 4LSGA 2GF9A 1NPDA 3CLSD 3L6UA 2AOWA 2GBCA 1QHHB 4GICA 1NN5A 4DGQA 2H08A 3CRW1 1W49A 2XRYA 4DR3B 2VH5R 2V03A 4KN9S 1DNPA 2GO1A 1F6DA 1O4VA 1UBMS 1XZNA 1ZH8A 4GG1A 4FNOA 2R87A 2WLSA 5D86A 3EBLA 3FMIA 2XCSB 3PTZA 1VPLA 2OO3A 1MO4A 1ZLYA 3ZHZA 2R6DA 4YI3A 3L93A 4GBMA 4NMMA 4EVIA 5LKRA 2O52A 4ESOA 4KOAA 4RKFA 1PTKA 1XQ6A 1I9CA 3N2KB 4NPCA 3RS7A 5KTSA 2I99A 3AC0A 3GUCA 2VDNB 2YXBA 4WEQA 1WPQA 4ZU1X 4K3UA 4OAOA 4KR0A 3HRHA 4Z51A 4R69A 4EB6B 2OPBA 4NRDA 5FORA 5K0SA 5COAA 3IBGA 1DRVA 1P0IA 2P9QA 2XE7A 2O6HA 2EWVA 3FGZA 4WLVA 5FT9A 2ZUCA 3PU6A 4MGKR 4CDNA 3KZMA 1UBUS 2I6FA 5DPMA 5PNTA 2BD0A 1YU9A 4F93B 4M7WA 1RPNA 1Z5ZA 2RFLA 4K8RB 2O0KA 4EX7A 3PDWA 5CFQA 2XKAA 5ELXA 4J75A 5IF9A 3OF3A 3IL2A 1ES9A 3DOFA 1A9OA 3FPKA 1VPVA 3QPWA 4X1KB 4CQLB 4F3CA 1UOOA 4Z4HA 2RGEA 5JALA 3L7AA 4G5YA 2COKA 3HR4A 1JILA 2CUTA 3D0QA 2DUUA 2P91A 1J8MF 1QKKA 5DLYA 1D7OA 4O4LF 3QTTA 5KIAA 1SGWA 3G0OA 5GONF 3VNRA 3CEJA 1QQBA 2X1MA 3RFVA 3BMCA 1DTSA 4G5OA 4QDUA 5TGDA 4NEGA 4BXOB 4QULA 3TM5A 4QJ3A 1WXFA 2YY6A 1G0NA 1O6GA 2JZOA 4FR2A 4UU8A 1ZNQO 1K89A 1NKVA 4H0CA 5TEVA 4URXR 4C7OA 3GCGA 4REMA 1AA9A 3A3OA 3AY7A 3H5RA 3AEZA 3GUYA 2G8LA 5EJFA 3WQQA 4BO4A 2JLYA 2WTUA 1T2CA 3OOSA 4KOEC 1XVTA 2A86A 3Q0IA 1Z47A 5IYZA 2PXAA 4NZPA 3QU2A 1X87A 1P1CA 2P2YA 1JJ7A 1PT9A 1Q84A 3LUAA 1V3UA 3EIWA 4KXYA 1T5TA 2ODWA 1OLXA 4HR7A 5EJ8A 2QRLA 4L74A 2E82A 3COPA 4GSLA 4PGMA 4NFSA 4L8FA 4ZEOA 4M8SA 4C0QC 4JKYA 4C1NA 5JZOA 1M73E 4MVJM 1FLDA 3STVA 5B58T 3IAS1 3UAZA 3I42A 3ENQA 3I8OA 4MUKA 5ILOA 1TIPA 3GJ4A 4PLHA 1KI6B 2POCA 3RS9A 2G07A 2OXEA 1UOPA 3NOVA 4MV4A 4R8KA 1B74A 2I6XA 1IBMB 3OD5A 1Q22A 1PYGA 2GBLC 1JXAA 2J5QA 3BE8A 1U3TA 3NP7A 2IELA 4IV8A 1ZRSA 2PZGA 2ZJ7A 5ITZB 2D7DA 2ZIXA 1VPTA 1JE1A 1M2WA 4NS4A 3KNZA 1Z0JA 4RIFA 5EKXA 5AVTA 4NATA 3OE7D 3REQA 3U16A 1J99A 1V43A 4AZTA 4WVLA 3LU1A 5D7BA 5KOJA 2GESA 4L4RA 1S2MA 7GPBA 5K3OA 3KWLA 3VA7A 4OXYA 3TTXA 3A11A 2EJBA 1D04A 1IDN1 4G0VA 1JG4A 3LK6A 2COUA 1V11A 2YV1A 3LNCA 1AKQA 1Z5PA 4F6CA 3LPNA 4X84A 1ONOA 5FWDA 1I7SB 3AINA 4DRXA 1PRYA 1Z06A 3F7MA 3MMZA 1W25A 3A25A 4X8MA 1NF8A 2NADA 1YB1A 2P5SA 2ZIAA 1M0TA 5DBEX 1NYLA 5K99A 3DYBA 1O5TA 4Z9AA 3CWZA 5FWAA 4NCBA 4EEZA 3LVFO 1ISJA 2WG0A 3WFIA 2GN4A 1YB2A 3GEBA 2I67A 1Y8RB 3VR5D 3ECAA 1GSHA 4M1ZA 3VR4D 1TAUA 1TZMA 1X1SA 1W6RA 3KQQA 5FWNA 1TO2E 1H94A 1VRCA 2RONA 1L1RA 3OP1A 1CJMA 3IJPA 3QV1A 5TPWB 3WWYA 1F12A 2VOEA 2ZJYA 5EGNA 3ZY4A 1AQ6A 5JCOC 5K03A 4RTJA 1YFZA 1KAEA 2Q0HA 3SZRA 4Z4CA 1QZTA 1X7WA 3BXGA 4BFLA 3SXUA 5JPDA 3L1JA 1VB5A 1IJKA 2XMGA 4YRPA 1FB5A 2WTAA 4S24A 1NNSA 5JSUA 1V3VA 4IGEA 3WGKA 2C7VA 1SZDA 3ETDA 3ZWKA 5E95A 2AXQA 1NKTA 2QG9A 5DHAA 1ENOA 3TEFA 3RS0A 5LP6F 4HXYA 4FYMA 1YVRA 4GMKA 4COKA 3OE4A 4OQXA 2D2VA 1ZA2A 6ABPA 3AEQA 3EEQA 5HTKA 1IK6A 1X8LA 4NDAA 4QJ4A 4X5OA 2ARKA 2JC3A 1P8AA 3FWNA 4OHBA 5I8PA 2IH5A 1GRQA 3WX0A 2IKSA 4JYMA 4DUGA 4IDBA 5KTOA 2BGIA 3QHAA 4WFKA 5IAEA 1OYYA 3TLYA 3P9NA 5H02A 3GYBA 2B21A 3ZGVA 5BOSA 4N6GA 4X66B 2B2XA 3D1VA 2XSZD 1NBWB 3DLIA 3ETNA 4GOND 3M49A 4TMTA 5J2TA 4DB2A 4A7PA 4FHZA 4KO3S 1IQRA 2ON6A 3FOWA 4X60A 3C3EA 1FNNA 1PW5A 5IANA 3UGJA 3RVJA 4YPFA 1NW7A 4F21A 4DQDA 2JJ2D 3C87A 3PXEA 2ONCA 2VHXA 3NGXA 1NN0A 3UWDA 1U8UA 4E3ZA 1RHQA 4FHFA 3PE3A 1TB4A 4MLCA 4TLCA 3TEJA 3A3PA 4DWWA 1AGYA 3BJZA 3FNQA 3NBZC 4Q21A 2GN0A 2JD2A 2XODA 2CXNA 3SWWA 2Z1MA 4HNQA 2A5DA 3SE7A 1CF2O 4DV7B 2F1IA 5KOJB 4LRUA 3FTFA 4KO2S 1G63A 4R1LA 5EWJB 5HF5A 2X3YA 1BDJA 2YINC 4J0IA 2FX3A 3V8EA 3JSXA 1BG6A 2CV1A 4O29A 2RH9B 4D0RA 3VH3A 10MHA 2HHAA 3AF3A 4XQEA 4DSZA 5LDDC 1FMLA 1H6DA 2G63A 2ZK7A 3C98A 3QNUA 2AKEA 1QOZA 2VDWA 1KOFA 1VZ3A 1NUSA 1P18A 2WHPA 1RWMA 1W94A 2ZXEA 3CONA 4LOHA 3T61A 5B2EA 1RNLA 3IBSA 3Q3EA 1SA0A 4IGKA 5H82A 4F85A 2WPNA 3W5SA 2JFGA 3IVRA 1CEEA 2QMZA 2HQSA 3RTBA 3DTTA 1NUPA 1UZNA 1H65A 3PC6A 3H1BA 3LJKA 5CPBA 3K31A 5K0NA 3RU3A 2VFAA 2ZBUA 5JDIC 1P74A 4NE2A 4PYRA 4GXTA 2TRSB 3EWNA 1ZGCA 1P2VA 1P81A 1SFRA 1Y9ZA 4G09A 1W19A 1AUXA 3PE4A 2I7VA 4ZVVA 2BYTA 1Q44A 3EXHA 1CUJA 2FZKA 2QSJA 4NZ9A 1NVGA 2VTVA 4PZPA 3WG9A 2C61A 1V9LA 3G2NA 1LDMA 1WS6A 2BGUA 4P86A 1O57A 4M38A 1T2EA 2OV1A 4JQYA 3OICA 3UPDA 1VE9A 3RKRA 1EEHA 2LIPA 1PK8A 2NXCA 1ZHFA 3KAJA 1CDOA 4P7JA 4Q9AA 2Y66A 1RQLA 3BL6A 5DASA 4ZXFA 4M9QA 3TK1A 3B5JA 1BOOA 4RD4A 5PGMA 4B4VA 1W7AA 2OHHA 1LSUA 3O2QB 1T2UA 4XFDA 5COBA 5AKLA 4B40A 3GFRA 2IYNA 3LKZA 1LNZA 4UEQA 3HVIA 5IH3A 2QI9F 3PXDA 1UWKA 1MEOA 5I9TA 1K6EA 1HYQA 2HQOA 3WA7A 2HI0A 2NU8A 1OU4A 2PQ6A 2FZ5A 2XXJA 3DOEA 1FS4A 4OGLA 2OFOA 2ORIA 4Q1BA 3UJAA 3U7GA 3PPYA 4YV2A 1Z17A 5KYGA 3JQ8B 1Q3TA 4BP3A 1LVGA 4R9RA 4MICA 3O3MB 1AQUA 1UCFA 3D7SA 3D8RA 1TCAA 4KKXB 5BNZA 4GO1A 3DUWA 4PAQA 4F7DA 5DOVA 2IGBA 1TRKA 2FOIA 4CFSA 3A7DA 3GPLA 4JODA 2VK4A 2FPUA 5CA1A 5FBLB 1TADA 1MHTA 3ORRA 1A8IA 1E3WB 4AF6A 5IK2D 1PGQA 2VXCA 1EWKA 2C95A 3QWIA 3JS5A 3B5EA 1MEEA 1Z2DA 3DHYA 1SWVA 1MU0A 4Z9XA 2AHOA 2KM1A 4H4DA 4MPTA 4IVQA 1VHJA 3TRDA 3VR2A 1PJ3A 1PLLA 2CV2A 3V9PA 2XOKD 4M9ZA 4Z9BA 5JD6A 3B3JA 2FQQA 2ODNA 5ALHA 2GYWA 1JLLB 2ZYDA 3BXZA 4OB7A 2EKDA 2G17A 2VJMA 3X0DA 5HJ5A 3EE6A 5FL7D 4LJ5A 4GVPA 4XJVA 2AN3A 4QDKA 3AF0A 2I71A 3GNSA 3OY7A 4L57A 1RCTE 1H2ZA 2PX4A 5LMZA 4ARVA 2YNMA 4HNAA 2R6CA 4A1OA 3NTOA 3GRRA 4DV4B 2C4VA 1NSYA 1BX1A 1DC8A 1TF5A 4C2TA 4Q1EA 4A9AA 3D0OA 3SFZA 4MS3B 1QOQB 2GPYA 3CURA 2J9YB 3JYLA 1DXQA 1SXJD 3HFRA 5KC9A 1QFXA 1CKEA 1NFFA 3NQ41 4G4SP 3AFOA 3V8MA 5ECYA 1DRUA 1ECJA 4D9FA 1O54A 2OFXA 3GD7A 3PUHA 4H4CA 4HB0A 4YAUA 3O4VA 4PQYA 1RM0A 5KTNA 2W4IA 1MIHA 3NOXA 1Y80A 2QUHA 4G1EB 4H7PA 4IRUB 2B92A 4Q5IA 2COEA 1RXUA 2X9GA 1ABEA 4UHEA 3LH5A 4KRGA 4XASA 2YWFA 3CW9A 1MAAA 4QTZA 4CMGA 2C1ZA 1UH5A 2Q3DA 1KDTA 3WGUA 1IL0A 1H0HA 2B4AA 3R0QA 2MU1A 3CH4B 3GF4A 4EG3A 5AW0A 5IJ0B 2OXFA 3MAJA 3K73O 4A6DA 1A82A 4HWSA 3ZWCA 1QAOA 4U1RA 4IRXA 3LYLA 1FSPA 1P3JA 3ETLA 2YQ4A 3TL2A 4LV8B 1UXGA 1EG2A 3CX6A 4CQMB 3QVVA 1KI8A 2V0NA 3OPMA 3CE6A 1B0ZA 2QM3A 5KVSA 4B6RA 3PX7A 3NHJA 3A70A 2BMFA 3KWJA 3JQAB 4JYCA 4COOA 1JMKC 2IPLA 2P4QA 5I47A 3JWJA 4MS4B 4B4DA 5HOEA 3KLNA 2GT1A 1ZI8A 2WK1A 3RI3A 4EAAA 4OI1A 4JZKA 1UBJS 3ND8A 2GAIA 3PUWA 3RYFA 5DI3B 3BFJA 3RYHA 1VLJA 3EC2A 2HREA 3J81k 2WJZB 3HYRA 1G66A 2KJQA 3I28A 1P45A 3SZMA 1K75A 1FE8A 3DZFA 2UYQA 5JJKA 3MWJA 4QYXA 4Z1OA 1WM1A 4MVYA 4N5HX 4RPIA 3WQHA 5FEMA 4YUZA 2C88A 3QSGA 3VKGA 3HBNA 4JU9A 1UBFA 1QGOA 2C54A 2GD0A 2KE5A 3GH1A 3PC7A 4OOFA 3CG0A 3R9KA 3NGLA 5IM4A 3ZIDA 2ATEA 1DJLA 2R8YA 2X6RA 4ZOLF 3TLJA 1ENYA 5KTPA 1BFKA 2JDIA 1Z0SA 4JJKA 2IHNA 1OXTA 1IXZA 4HYTA 5IFKA 2A0XA 2BONA 1I4EB 3EIHA 1KH1A 2BPOA 4KGXA 3IMKA 4U2FA 3U2QA 3ST7A 1JAZA 1U0JA 1R66A 3RSOA 3BMNA 4QJ5A 1RYBA 1NBME 3AI2A 4KK4A 3T94A 1XYYA 4P4GA 2H2HA 2PX2A 5I7OA 3EMBA 4QYTA 4NFHA 4AI6A 3T35A 4KNYA 1BN6A 3JD3A 1QIDA 2XMCA 4L22A 4DQXA 4L5BA 4B43A 2K4MA 2BKVA 1C30A 3UWSA 4BKPA 1U7ZA 2VRWA 3C7KA 3L46A 1PGNA 1AKTA 3L0BA 4HZUB 2O19A 1NU8A 1HSZA 1I2CA 4J7UA 3CGWA 3MJCA 2XZTA 2OXIA 4OH7A 2CHEA 1GRVA 2YJ3A 3CSUA 2X2EA 4OF4A 3TAXA 1R15A 1SWWA 4ZO7A 3HB0A 3CO5A 5JVDF 5LP6C 2VDKB 3VTKA 2PTGA 4NCHA 3KUKA 1PGPA 1OWOA 2AL7A 3GLHB 4AJEA 1UKBA 2F1OA 3SVTA 1JLRA 2V0GA 1J2UA 3G0IA 1M2VA 2LGJA 2OLEA 3VO9A 1SB8A 2CB0A 3P2MA 4B6QA 3G0HA 2F1KA 5HFNA 4R0NA 4MB0A 5A6SB 3SCZA 1OD6A 2VYFA 4KPUA 4D4IA 1LI5A 5JZ9A 3HGMA 3K4PA 4E22A 3MCTA 1J8QA 3LUGA 4WZAE 3H7AA 2QMUA 4KQ9A 3SY8A 1X1QA 2QP9X 3VR6D 1ESZA 4YRSA 3S7ZA 3UJ6A 3ZLTA 3I4CA 2LE0A 3L43A 4QXMA 3M5CA 5HZKA 4IIYA 3T3MB 3W1WA 3NEJA 1M83A 4CTOA 4UM9B 2VP0A 1VCOA 3DBVO 1STOA 1M8FA 3A2LA 5AVYA 4GXNA 3EZGA 4K8OA 5B1SA 1YK1A 3NJ8A 3OJOA 1GPMA 4DXDA 4KXWA 2IS2A 1AKWA 3NHWA 4HK4A 3PJGA 4NCNA 1XCPA 2IXGA 2YQZA 2HJWA 4FE4A 3GLFE 5KO2A 2C2MA 4XUEA 2OLJA 1RS0A 1SCUB 2WT4A 4HNRA 4TV9F 4HT3B 2G1PA 1J9GA 1S8OA 4FYKA 2RK3A 4JBIA 4PIMA 4JT2A 4MQBA 1O5IA 1RM4A 1XBTA 2VDRB 5DXFA 5LD2C 3CZRA 4YCAA 4FYVA 3PUZA 2BGKA 3EVEA 3B85A 2C1XA 2QMQA 4XX0B 2H1CA 3TLGB 2IEZA 2ZXFA 4JP3A 1E99A 3FWYA 4JL8A 4P1ZA 4B6PA 4LJSA 5M7EA 4WZBA 5CVCA 3GJ7A 1Z83A 2ZTHA 5KYNA 5FI3A 1KOLA 3DMNA 1YQEA 1G3QA 2LBPA 4PAGA 1TKCA 1CUHA 4FFSA 2QMEA 3H2JA 5CDFE 1WB4A 2VNJA 3K9BA 2XZPA 1WAMA 1S1MA 3DOIA 3LWZA 2GCIA 5SZIA 5JMWA 4GRIA 2AG8A 5AOBA 1HLGA 4H08A 1FP4A 2D5IA 4M6WB 4OKSA 4LZWA 2A33A 3JQEA 4ZV7A 4FGKA 1V1MB 4PAOA 1N2JA 4JHLA 4RJIA 3LECA 4FFWA 6CHYA 4KACA 3BWYA 2J6BA 2DFVA 3ELBA 3EVGA 1RBQA 1WKVA 3N8HA 1N5MA 3AM1A 1P5FA 1S7GA 5AKHA 3V8PA 1LLCA 4PBSA 2G88A 5BN3B 5H9WA 4ZOCA 1PGJA 3G9UA 3KL4A 4DR4B 4UDOA 4YECA 4ND3A 2MOKA 2VDJA 3FSGD 2CFOA 5DM4A 3CXRA 1SUPA 5JBNA 4DRYA 3UHAA 1XJ0A 3AVPA 3TNLA 4GL2A 2ZI9A 5B37A 4BWFB 3TWOA 2JHAA 4ESVA 4NJMA 2VCYA 3KHSA 3EVBA 4EG4A 5EPEA 3QITA 1PFQA 1TK9A 2BFAA 1T34A 5I3ZA 1EFVA 4NC9A 5EHNA 3F6SA 4DJEC 3W5BA 5E4YA 4AS2A 3RADC 2VLIA 16PKA 1X13A 4JZYA 3DW1X 3EQ2A 3R6LA 5LPNA 2Q3HA 1N33B 4RK0A 3GEGA 4WA7A 3HSYA 3LK7A 4ZAXA 3WK6A 4B46A 1JR4A 3E0QA 3FTEA 4Q9JA 1O95D 3LL7A 4O4HA 4DSUA 5IJXA 5CG1A 5AI0A 5D6NA 1NJFA 1LW7A 4BV8A 5CB4B 4CIAA 4R1TA 2VJPA 2ZQYA 2IXFA 4KVGA 4OGKA 2GASA 5AJUA 3RS3A 1PJZA 5J9FA 3VNVA 5F12A 1GZSA 1XR3A 4MKZA 1DAIA 1NW9B 1Z75A 2AVDA 2KBFA 3ON5A 2ZUUA 3KOXA 3KCQA 5HE8A 3SSMA 2WM8A 2VN8A 3IVGA 3LY8A 5A4FS 2NLOA 4ES6A 3HDQA 1EINA 3DB1A 5E2IA 4TZKA 4F4CA 2EJUA 2OVBA 1RI1A 4K7JA 4AZSA 2IT1A 5B1EA 4QQ8A 5FQNA 5A2QA 2H59A 2RKWA 4IVNA 3Q7SA 1JIVA 2OG2A 2O2ZA 3CBGA 3KOZA 3AVVA 2W0SA 1NLYA 2AUMA 2YVUA 3HM9A 2DWQA 1HNWB 5CM2Z 3STHA 4B6JA 3Q6NA 1PFUA 3TFOA 3OMXA 3GH3A 3OKPA 3OJEA 5HGXA 5A0FA 4ZOQI 5BNTA 3S2SA 1JDZA 1PT7A 1TYDE 3DKIA 4DNPA 3KIPA 2Z0MA 4F45A 2CSXA 5AI4A 3A6ZA 5FAKA 4JV5B 5FBQB 4NESA 2M2IA 2MSDB 2P0AA 2FG5A 1HL3A 4YJDA 1E1LA 4BAGA 2H4HA 2JH9A 2ECFA 3GQBB 3HWSA 3V3KA 5DGCA 4YBZA 1QU3A 3FMGA 1XRQA 1N2CA 1EHCA 1EWVA 4G8BA 3D54D 4NABA 4X8OA 3SFVA 4DADA 2XEDA 2ZSKA 4YBRA 5CB8A 3PTAA 4OHYA 3B70A 3PSAA 2OL4A 4CKYA 2QW1A 2O8DB 1FFAA 2F1RA 1V3TA 1FOEB 2G9QA 3JWEA 1JWLA 1J8FA 2A1UA 4RTRA 2TSYB 3I76A 4IDPA 4PNEA 2XXAA 2BBOA 2QR3A 1QCCA 5J5CA 3TPZA 2HBQA 4ZK6A 1JDBC 3BWVA 1O58A 3JALA 2A92A 1SK8A 1N9GA 3B9QA 4RGQA 3HI6A 2CJXA 2IP2A 2GK6A 3RG2A 1OV4A 3WGGA 2C9ZA 4C7JA 4X1YB 4CLEA 1AZTA 4BRWA 3K9FC 1P0MA 1QF9A 4GM0A 5IXYA 1F8UA 3UJ3X 4MPDA 3FSEA 3F5MA 1IB0A 1C9DB 4S0XA 2G1UA 1DAOA 3Q6IA 3MTIA 5F64A 3T5BA 2WSYB 2XLCA 1X74A 4E7OA 3RBZA 3D7RA 4WJKB 4C7XA 2VTBA 1V9SA 5KOHB 3ZI4A 2FCAA 2H9YA 1SBHA 3ONWA 4CMIA 1JXQA 4HDMA 4R9SA 1PBNA 3FF1A 1ULAA 4FMPA 1KNXA 1HGXA 4OXQA 5JSZB 1KYIA 3DNPA 1VI2A 4XVHA 1VDMA 5J2UB 2QT9A 2MTBA 3Q9NA 3IODA 4MSUA 3SHVA 1EFCA 2GYVA 3ZQ4A 3HCCA 2E4AA 4H7JA 2OBLA 5TGZA 2QJTA 3M5PA 1JRLA 5AR1A 3INYA 3K1JA 5IT9A 3WGHA 2A5JA 1WKCA 4TLDA 4D0NA 2WUEA 4E33A 2FSPA 2FH5B 1XPOA 3K92A 5F5XA 3DR5A 1JDNA 3GN2A 2IUSA 4DV1B 4PYMA 3GRUA 1NV9A 1WE2A 1R10A 1GADO 3TZBA 3I1JA 2WUFA 3QVTA 4KJXA 5LZ7A 4JLVA 4WOPA 3MC1A 4JMLA 1SBTA 1V4VA 1VL2A 5A3VA 4YRBA 3SHFA 5KYYB 4ZQGA 1IZ7A 1WVIA 4KXMA 3LLUA 2C4HA 1QH1B 1XJWA 2Y1OA 4Q39A 5HKKA 2RARA 1WEHA 4UARA 5D7NA 5CA1B 2BGMA 2FUNB 2JH8A 1AZLA 3OKFA 3REFA 1E6KA 1Q12A 2RC6A 1R37A 1GNTA 1WDMA 2WSSD 1RQGA 3IR5A 2IUUA 1NDQA 1V37A 2B82A 4OQPA 1WHTA 1M74A 5CH3A 1H8HD 5CGZA 2DCMA 4F06A 3LQ4A 3O95A 5TNXA 2J3JA 1XXHE 4IIDA 4C4OA 1ZSVA 1RM3A 3CUKA 3OQBA 1IM8A 1IWPB 1CVLA 2CFCA 4HB2A 1A9SA 4QECA 5ALQA 1CEYA 3HUDA 4HQLA 4X3OA 3HZOA 3NPMA 3VISA 1DO0A 1PR0A 4P8RA 4BVLA 1C9MA 3KM0A 4XE5A 1AHIA 3EVAA 4F38A 3EHEA 2OVFA 2VNKA 1HT2E 5JH7A 2H4YA 2QTAA 3HKDA 3G23A 1ESCA 3WFJA 1JPVA 1JE0A 3BHMA 3PC4A 2YFHA 4NNJA 4E5PA 3VZRA 4E5DA 3LUPA 4CWAA 4AP5A 4IH9A 4GKJB 1OTXA 2A0KA 1TX4B 3N7TA 2NTYC 2WVHA 3D8NA 2WJGA 1QR6A 1T1JA 1HPLA 4Y2VA 2ZBPA 1WW2A 3O9ZA 5F9HA 1JQBA 2JHCA 1A8UA 2MINA 2PEYA 5CYGA 1ZYUA 3O8QB 5BQXA 3DFZA 3BE5A 5EFOA 4C6TA 4LF5B 3IOBA 4MV0A 2ZUTA 1B42A 1L4FA 2JJMA 3U4HA 1ENZA 2GZ3A 1RHJA 1DAPA 2WMDA 3H8JA 3PI6A 2ZS9A 3H87A 4LHEA 4OIFA 4PS0A 4Q9NA 3ZS9A 2FW7A 3CB4A 3E7WA 2ZUSA 2HX1A 3MXTA 5CT5A 1VMDA 3PFCA 4HC4A 5CNIA 3SIWA 3GLIB 3KK0A 3L7JA 5TT1A 3I92A 1SCJA 1PVDA 4LKOA 5CT6A 5LZ2A 3G8CA 3C7AA 3V8NA 4B6FA 2B61A 2QV0A 2OFWA 4QBIA 4DIOA 1X7ZA 1OC2A 1R0KA 3KAKA 3H7IA 4PZDA 4GRAA 5FA5A 1FTWA 1T5IA 3H1EA 3HB7A 4OAPA 1NF2A 4D82A 2H0AA 4EJMA 1CU1A 2FJUA 3PUJA 3C97A 3JWPA 3TIXB 1GO2A 4JYAB 5EHGA 4MARA 3GJRA 3Q5EA 2WG1A 1TO6A 3A1CA 1O94C 1SN7A 1WNFA 4XFKA 3UXEA 1P7YA 3ED1A 4EI9A 1J09A 5ETJA 1AN9A 4QVIA 1MXFA 3BCHA 1WMAA 1BS9A 1QK3A 1RYDA 1UOEA 1YBAA 2HIGA 2QW0X 2DETA 4AY3A 2OTCA 2ZE7A 1LW6E 4KE7A 1RE0A 2BGNA 2PRSA 2RE8A 3GLVA 3HDGA 4QE3A 3Q8WA 2E4UA 2D06A 4ALMA 5KCMA 2PJRA 2QMOA 2ZI7A 2INGX 5E6RA 5C31A 2V97A 3SYTA 1AMNA 3JAKA 1QAQA 2C29D 4F2WA 5G1OA 4J3FA 4V0OA 2IQIA 4MHOA 5KHLB 3ZXIA 2QQFA 3ME5A 5K4AA 4S12A 3AI1A 3B1ZA 1ZMBA 1NBHA 3EDYA 4FS8A 2R6AA 4NR0A 1J23A 4R31A 1Z25A 4RMGA 3QBJA 1I4LD 4LI0A 4LXIA 1T8RA 4RABA 3AT1A 4MVJG 3C15C 3LC2O 1P9NA 1YQGA 2X5XA 4J16C 1M2OB 3V5NA 4ER5A 3UFXB 1BXRA 2DWCA 4KQKA 3W3AH 1PFVA 1CLEA 4MDYA 3TZKA 2BTOA 2GLTA 3CY6A 1GU1A 4WD3A 4K87A 4XD7A 1N1EA 4G1CA 3ZNOA 1WJGA 4FFRA 3SZGA 3EY9A 1IG0A 4EG5A 1A8HA 4DHEA 1LB1B 1DLJA 3CRMA 1KYWA 3CPJB 1RIIA 1I94B 5TQVA 1KOJA 4FU0A 4K5QA 5C8YB 2Q8PA 1GUYA 1YJXA 4TLMB 5KJ1A 1BE0A 5AW3A 5F73A 4OQFA 3PRYA 3X1XA 4Q1AA 3V42A 4B0PA 1K66A 3CZPA 3T1NA 1WUKS 3I9NA 3OQIB 3PFGA 3ZH9B 2PH3A 4XVCA 2YJ4A 5BXYA 2P8SA 1OHHD 3S99A 2B4KA 3A6HA 4KYIB 3T3EA 4TXLA 1FDSA 1UOQA 4REQB 1ORVA 2DR0A 3CLRC 2EKZA 1R4NB 1P6QA 5EZ6B 2ZE5A 3R44A 1SCKA 4CKZA 4TMVA 3PS9A 2Q27A 1P1KA 1ZI6A 3DTVB 3H97A 1Q11A 1XJCA 1R88A 1O0CA 3VKHA 1GLVA 2H31A 3PP8A 1N3LA 2FWBA 1F17A 4LJLA 5I4CA 4FCWA 1MO5A 1VL8A 1KPIA 2Z8XA 2ACVA 4KQXA 2ORED 4R8MA 4ZTBA 1E2FA 5L6MB 3V7YA 2PS0A 4MMZB 4N9WA 5A0TA 1UWLA 5DVZA 1QF6A 1T24A 1Z4PX 4RIGA 3WWEA 1DEKA 4J2OA 3BKWA 5GZ1A 2CVHA 1JDVA 1F8YA 3W7VA 3WHLA 5T4FA 1BCSB 1NVTA 4AJKA 3IEXA 3OPYA 1I5EA 4XWKA 2RGRA 3ZD7A 1SZJG 4KFRA 4DA8A 4FR0A 4Q4JA 3TYXA 2Y1KA 4CQMD 4I3GA 4O4JF 3PTLA 4JOBA 1IY9A 3QEBZ 4ZPJA 4ZYXA 4QBHA 4ZOEA 4JJGA 2IHYA 5EHXA 1DDIA 2PH5A 3JQAD 1T3LA 1ESEA 3TL3A 1USKA 2P8JA 2Q9BA 4E46A 3HVRA 4DR2B 4G1VA 4B33A 5KNDH 2ECKA 1FDRA 3BSWA 3NXKA 1KI4A 2GSWA 4E09A 3LDGA 1XDUA 3GVXA 4RM2A 1H8ED 1QHEA 1CY8A 1KJJA 2FF7A 2ONJA 4HQFA 3W0LB 4CF7A 4ENRA 1TIBA 2Z6AA 1WCWA 1NW5A 2B1GA 1QCZA 2MR5A 3E9EA 4D46A 5FP0A 1FYWA 1PWEA 3JPYA 2XTZA 1W52X 2Z9DA 2HJGA 1HZJA 1VL5A 1XWFA 1U8EA 2IKQA 4G8CA 4X6UA 1Z13A 3EC7A 3I61A 2VJOA 4V02A 1W46A 3SC3A 3DTNA 1XZAA 1LD3A 4MIOA 1F0PA 4H3HB 1KC3A 4Q3BA 3AEXA 2GN9A 3BTUA 3BTVA 2OBYA 1P19A 5M5BA 1VE3A 2G83A 2YC4C 4TMZA 1JHAA 3SLKA 4BY9E 4N0EA 1Z9BA 3NNNA 5HF6A 1KQGA 3K0FB 5F2OA 1WXQA 2AUNA 1IHPA 3D4LA 5EKDA 1CFJA 1JHDA 2P79A 1GG8A 3SQOA 1G20A 4PZLA 4UATA 3IPLA 4ZT3A 3HQ4O 3ZDAA 4BB0A 3K4HA 5EJ2A 4BNYA 5T8KC 3CCBA 4UREA 3F96A 1E2GA 5F1KA 2CLHB 3CB2A 3RWMB 2ZT7A 3I5MA 3UB3A 3DJFA 3EEBA 3MTEA 4HUQB 2BGGA 5JXHA 1IJEA 4OHUA 4CN8A 1TM3E 1ZRHA 2A5LA 4DZRA 5CEFA 2BAGA 2IX9A 3PQ5A 2YHAA 4GSKA 4JOQA 4POOA 3AEUB 1CQIB 3KQHA 3ZE0B 1HO3A 3B6KA 4AF7A 2VRCA 4XCVA 1GPJA 2WYWA 3LO8A 1MJGM 5EE1A 3FYUB 3W5AA 3UMGA 3M9LA 4LA4A 4ZCPA 1QIGA 1HQCA 1XPJA 4M9XA 4ME6A 4QQRA 5CVVA 2J1LA 2WEKA 4Q12A 3EGXA 9ABPA 2WZCA 5L4LA 3CSSA 1T25A 2BM8A 2R8EA 5UKDA 1BA3A 3ZWPA 2XLBA 1L7XA 3TGWA 3HU1A 4BRSA 4CETA 1DB3A 3AZPA 3K94A 4RH1A 2AK2A 3KEFA 3P9IA 4LFBB 4WXMA 2QZJA 3OLVA 4UE3S 2HDWA 1FFCA 1OI4A 1OAOC 2I2XB 5EQTA 4NJOA 5BN5B 2EGHA 4LECA 4NBSA 4P7KA 1MOSA 4FDLA 4UM9D 2FKNA 2GM5A 3TIFA 4BO6A 5I48A 3J80A 3IAXA 3H13A 4TKUB 3U0BA 2XE8A 3QF7A 2PZEA 3ROMA 3AF6A 1Y5NA 4E2FA 2PA0A 1A5AB 1PLKA 2BEVA 2QUIA 3IEPA 1NXSA 2X7HA 1Y98A 1T10A 4LOJA 4UDNA 3ZWOA 3LYUA 4I9HA 4TLBA 4ZZ0A 1KAHA 3JQ7A 4EGFA 4ZJUA 4FQ8A 1T0PA 3IA7A 2MYUA 2NU6B 2XBUA 1MN6A 4NQZA 3WGNA 4HAVA 1BHQ1 2F67A 2HBYA 4KXFB 4MVJA 5E6UB 2O8CB 1JQAA 2O0JA 2TYSB 3LY9A 3ABOB 4KWTA 4QOSA 2AQHA 3WLKX 5KYXB 4IL5A 5T7BA 2GZ2A 2W6QA 2NMVA 4CMKA 2UVPB 4BP1A 3EVDA 1N8TA 1PG5A 1ZBQA 1TPZA 1IBCA 3D3EA 3JQGB 1GGEA 3LY7A 2FUCA 3UATA 3PFKA 3R3VA 1NNEA 2M6KA 3AXTA 4HWPA 3GDHA 1IBSA 3WJ1A 4B5KA 4WV3A 3K05A 3WB0A 1PD0A 4TKZA 1YBVA 3I83A 2ISSD 3QXCA 5T41A 3K9HA 1S8FA 4TVOA 5IXSA 4E94A 5DT2A 4MQEB 1SPXA 2AFHA 3L06A 2RGXA 4I19A 3SS9X 3SXJA 4B7CA 3ZZTA 2RJOA 1S4MA 1BFUA 2D1YA 2QTZA 3TAHA 1GGHA 4BWVA 4ZZIA 1U2ZA 1XEAA 4B6SA 1SELA 1WVGA 1A88A 1YIDA 5FUWA 3HXPA 1XEXA 2NNLD 1P0QA 5JOQA 2WVAA 1OGYA 1L4LA 2IIQA 3G2IA 1J49A 1UMCA 5EI5A 4BCDA 3RC9A 2ZI4A 5EJ6A 3P26A 3I6YA 1AOXA 2GBLA 3EG9A 1RLIA 1L5MA 4D96A 3PFFA 2QX9A 4UEKA 1WV0A 4XEUA 2HT6A 2FMXA 4MWOA 4U9IS 3KPYA 4FYJA 4LXUA 5EN4A 4KYVA 4QARA 2CDRA 3HY3A 3AKEA 4N5LA 4UC0A 3O21A 2ZKIA 3LOUA 4QSMA 3PFBA 4JIMA 2WAAA 5CVDA 1GFWA 2EX0A 3AR7A 5EMLA 1KE2A 4EYEA 1DAFA 3FSRA 1W59A 2C58A 4BFUA 4L5YA 5ECWA 1K5HA 2JFFA 2QQGA 2DERA 1K7SN 4P3PA 5BSWA 3C3AA 2E4VA 4IQ4A 4OSPA 2D7CA 3DM5A 2CNKA 1O9HA 2QUZA 1RDFA 2G4LA 3HJBA 4ZT2A 2W2LD 3OOEA 1AF7A 3C1AA 3TZ6A 5LL6P 3MMPA 1ZI9A 2W6CX 5HK9A 2KSQA 2B4RO 2Y9MB 1BEEA 2I3ZA 4RQTA 4JENA 1GU7A 1W5TA 3LHSA 1UFKA 4CGYA 1YOVA 2PM8A 1PHRA 3IQEA 2NQ2C 1GGNA 1M1ZA 4QASA 2QAJA 1IE3A 3K30A 3ASYA 1HETA 3GCZA 1M2KA 1VA4A 3HUUA 1QWSA 5IZ4A 3U3ZA 4ND1A 4S1TA 4C21A 4W8HA 4F12A 5JCOA 1F2TA 4TS9A 4OP2A 3QG5A 4ZGBA 3PD7A 4EB8A 1Q7GA 1TVKA 2XMZA 2C84A 4URHA 3WYCA 5CB0A 3ZIAA 2ZRAA 4GYJA 4RJJA 1OX5A 1TJ4A 3TSYA 4RPGA 3SVZA 1JDPA 4OUKX 4BDSA 2C2ZA 2PKYX 3UUFA 4DOMA 3QE4A 4G89A 4A15A 4DRZA 1WB6A 1JEDA 4B79A 4TWJA 4FOSA 2C59A 5CNJA 3T8YA 3WL4A 1M2EA 1RWQA 3OFNA 4X97A 4WESA 5SYMA 3H0KA 3G82C 5FCDA 2QR2A 1POXA 1VFPA 3E5HA 4QAJA 2PKEA 2ZREA 4FGWA 1D2NA 1F2UB 1DELA 1HORA 1Y7PA 2O8VA 4LOKA 4Y9SA 4BJ6A 3T3GA 5B58C 4WFIA 4IH4A 1CX9B 3PWTA 3CPSA 2PKQO 4F6LA 2I2AA 3DG9A 4PTLA 3MERA 3KUCA 2V7QA 5DWDA 1T9ZA 3CZCA 4F3NA 3EAQA 1L3IA 4DWJA 2BRUC 2BFOA 1QB8A 4TXJA 1BKDR 2NZWA 1DBPA 1E5XA 4RMIA 1K27A 3EF0A 1I3MA 4HL6A 5K0JA 3KQSA 3UT0A 4QHSA 1IVSA 3N86A 7YASA 5JS1A 1E7SA 1YZTA 3P4YA 4OD0A 2O8EB 1HFJA 4Y9UA 2BR4A 1I3OA 2FY8A 2R86A 3K0KA 4OMFG 4PHGA 3FPFA 3EUFA 1SHJA 4NCIA 2OCYC 4JB8A 1GZHB 2WD8A 3G8YA 4BFYA 5KX5F 1WEKA 3IP3A 2ZBVA 3PIDA 1JR6A 1BXKA 4W8GA 1CZHA 1ZJYA 3OTWA 1QTRA 4K2AA 3GEEA 3M9WA 5REQA 3OETA 4EZIA 2UYCA 2X7JA 1DFIA 1F0NA 1JIKA 4EYGA 1L7EA 3GAZA 4ZDKA 2CXQA 5ELMA 2H07A 3M6AA 4PSAA 1WL8A 5LNK1 4CG2A 2IPMA 2FUG6 2F55A 1T5LA 5HX7A 5LMUB 1O6CA 1X8KA 1LWNA 3C1OA 1NDUA 3HVKA 1K7YA 1L7PA 2I3GA 3K5IA 2R8OA 2VF7A 1WABA 1XJQA 3L41A 4M87A 4TL8A 4ZAYA 4LS3A 5AT1A 3LL4A 2XJ4A 2IPXA 4W4TA 5AIBA 5JDIA 4EG8A 1Z34A 4FOOA 2YXEA 3BIJA 4YRFA 1NY6A 2ODQA 2VNAA 2WWRA 3B2NA 4D80A 3O8RA 5AW5A 4AXXA 4HO1X 1WU7A 4OLHA 5BWMA 3A4IA 1RXVA 5AHRA 1Y3CE 4G56A 4KNVA 3KV1A 3QZUA 2WD7B 1Y8CA 4FUTA 4LKRA 3LD9A 1HY3A 5CD9A 1GARA 2JH3A 1JSXA 1R6BX 2BI7A 4PRZA 4PYLA 5HFJA 2W8BB 5THKA 821PA 3G13A 3PVZA 4U02A 1HYBA 1B6TA 3FCCA 4FXOA 4LCBA 4V0NA 4ZARA 5G1NA 3RUDA 2ZRPA 3RVQA 3ZKAA 4EVRA 1ZK1A 5IU6A 4N49A 4BNTA 421PA 3GCXA 3VSCA 3ETGA 4YCJA 1ZH4A 4IOJA 5F2KA 5IXJA 2Z98A 3EG5A 4TTSA 5EHIA 3CF6R 2AD1A 2PZFA 2P65A 3LUDA 3G6WA 4RL6A 3VHXB 4EHIA 8ATCA 2XR1A 3FHOA 3EPLA 3IQWA 4FDMA 5LYJB 1GEEA 3M4ZA 2RGCA 1D1QA 3CU5A 2RHTA 2BI8A 3RC8A 2JVKA 3LHDA 1T6BY 4KRYA 3ZX4A 2W2PA 4CR8A 5BN4B 2W6ZA 2SCUB 3C5HA 5AXAA 2QUAA 5EEHA 1ZD3A 2XVMA 3LRTA 5I7FA 2XQKA 4TT3A 2VYVD 4FFBA 3OSUA 3B9BA 2D7JA 4R7ZA 3K7EA 4XIYA 3BCUA 1OKKA 3KR2A 2FUEA 3AY6A 4R1MA 4P93A 4MKGA 2W6ID 2JCXA 1MIOB 4N9QA 3DZ8A 4AUMA 1LVHA 2AQ8A 2AQKA 5LBIA 3ZPXA 1JNYA 5KSPA 4BNHA 3MWDA 1MC5A 1PR5A 1RE1A 1VB3A 4U9HS 4UTXA 4RAQA 3A0UA 4L2IA 4L51A 2QE6A 1E79D 3BBPA 4O8ZA 1CIJA 2YYAA 3DDZX 4R9VA 1NXPA 4XI9A 4OJKA 5CEJA 4IDNA 3PITA 1RKQA 2H1WA 3FWPA 5KAPA 1CK4A 4CIBA 2IUYA 3UQZA 1LQTA 4J0JA 4QM7A 5EWLB 3VO2A 1DARA 4NZMA 1WDTA 2CHVA 2NQ8A 4WCDA 3O4RA 4DCVA 4L4XA 3KDSE 1AT1A 1H5NA 3RFTA 2BWJA 3NBKA 5TPZD 3NTVA 3QJ5A 3RJ9A 4AY2A 2XNDD 2QKYA 3RO7A 2UVQA 5JG7A 1H2RS 5A4KA 1P7VA 1QO7A 3LLSA 3R24A 2ZI5A 1M7GA 5WRFA 3IBFA 4NWIA 3S29A 5JXJA 4RSRA 2EVWX 4X93A 1RWOA 2AMJA 1J06A 1CT9A 1I6WA 1WXHA 2VL7A 4KIUA 3PHGA 4N0PA 4BLTA 4RKRA 2H2FA 2NVOA 5IZCC 5LZ9A 1M34E 4NG5A 5TGTA 3KJIA 4KR7A 3O3NB 4H60A 3D4PA 3W4KA 1Y33E 3CVVA 1G18A 1GZUA 1D2MA