3Q9LA

The structure of the dimeric e.coli mind-atp complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septum site-determining protein minD
publication title Determination of the structure of the MinD-ATP complex reveals the orientation of MinD on the membrane and the relative location of the binding sites for MinE and MinC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle, hydrolase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q9lA00
4TLDA 1R8SA 4WIAA 3REFA 4DLXA 2EFDB 3VKWA 1DG3A 2REXB 2F1RA 4HAWA 3SBEA 4IFEA 2BCJQ 3FB4A 1T6NA 2JLSA 2P0EA 4JJZA 1Q12A 4G5QA 5AJVB 5DLQC 2YWGA 3G5UA 3GLHB 1E9AA 2IYRA 3CF0A 3NKVA 2FSHA 2D7DA 1OKKA 2OILA 4HLUC 4BQSA 2WOJA 5DIFA 2ZRLA 2CMKA 1P9RA 4KODA 2VPPA 1TU4A 3MMPA 4DLUA 5CIWA 2ERYA 2WJHA 4JL6A 4DC9A 3ZVNA 1E2FA 3QENA 4D26A 3OE7A 2B7CA 4IRUB 2R62A 3RSLA 3WMEA 5B30A 3P20A 4KI0A 4D4JA 2ODNA 221PA 4RKEA 4M9QA 1W4AA 5HKKD 2ZYVX 5J4VA 2XTNA 2B8WA 1CIPA 2D2EA 1E0SA 5EE3A 3PFIA 4ZDJA 1MRSA 1X8JA 2OG2A 3JVVA 3RANA 2Z43A 2WKQA 2DFKB 4WA7A 2JDIA 1NG9A 3IEUA 1JEEA 2ZTSA 1ZM4A 4TL9A 3AP2A 1IY2A 4P4SB 2VP2A 3ZQJA 4Q18A 4CRWB 4KO8A 4ZCLA 5TARA 3T35A 2CEAA 1T5LA 1KO4A 4ZKDA 4Q7JB 2J3EA 4XVQA 4KFSA 2PEZA 1N0UA 1XMIA 1XTRA 3GP8A 2Q6TA 1BOFA 1ZW6A 2FFQA 1VTKA 1N6HA 4AK9A 4BZXA 4ZPXA 3B9QA 3B6EA 1D9ZA 1TQ4A 2ZI9A 3GJ0A 2OBLA 3BGWA 3EPKA 4JVLA 2IS1A 3K70B 4MDFA 4AYTA 3QBTA 1EFTA 3KX2A 2C03A 3NC1C 3LWNA 1GDDA 4TYNA 2IF0A 2EFGA 2NOAA 3PR1A 3IIJA 4QBGB 3O8RA 2WWFA 4NCIA 4RFSB 1XCMA 1N5KA 1N6LA 2VHUA 3OIVA 3LNCA 1R5OA 4A8JB 3K1JA 3P4XA 4QJ3A 5CDFE 1W4RA 1P9WA 4O2RA 3U61B 3ZGXA 1P5ZB 4C0KA 1R0XA 1AZSC 5TVKA 2J1LA 4LV8B 4F4CA 3CM0A 5FBLB 4JVSB 4RY2A 1R2QA 1R7RA 3DL0A 2GCPA 2MMGA 3FHCB 3IDQA 1T0JB 3MWJA 3GLHA 1KY2A 3HWSA 1TUIA 3W6OA 2AL7A 4RZXA 4GBMA 1XPOA 2QE7A 4IEEA 4QM6A 2NPIA 3ASZA 1TU3A 2IA5A 2GRJA 4F38A 3SOPA 3EIEA 1Z0KA 4B47A 2ZRIA 1BMFD 2F3RA 1KNQA 4GP7A 4RD2A 3TSWA 4KYUA 3H2YA 4PZYA 2OE2A 4YXWD 2VSOA 4YMWA 1TUEA 4WZ6A 1TQDA 4HAUA 4V0OA 1P3JA 2ZJOA 1GRNA 3QVUA 2HLDA 2GEDA 4ILEA 1XMSA 1ZCBA 2QU8A 3JVUA 4Q9JA 2XNDD 4XSHA 5AUQA 3SJCA 1Z08A 4EAQA 3UIEA 4CT4B 2K5UA 1P60A 2W00A 2ZITA 4JLDA 4PAOA 1XD9A 2C78A 3TVTA 5AJZA 1N6RA 4CT5A 1KO5A 4Q4LA 3AKCA 4B76A 5JZVA 1JAIA 3W5IA 1Z63A 4GSYA 2XB2A 4ESHA 4L16A 3OEEA 1S1CA 1IJEA 3P32A 4JIMA 5C18A 4P4SA 3U3MA 1T8UA 4D80A 621PA 5HZKA 2OM2A 3GJ7A 4W5WA 3TUJC 2CHGA 4NBSA 3RWOA 3W8NA 1U0LA 3B5JA 1QHNA 1E3MA 3BOSA 5AUOB 2P6RA 3PQCA 5BXQC 2QAGB 4O25A 2XXAB 3DOFA 2A9KA 5E4FA 5FPYA 5L3QB 1UM8A 2JJ2D 1XTIA 3HYTA 4LRWA 2BMEA 3O8CA 4R2HA 4PPGA 4DXAA 4MRRA 1LW7A 2IEYA 2VQSA 4RFSA 1NBMD 2VF7A 5TY0A 4E22A 4A8JA 1LVGA 1U8AA 3ZZ0A 3W90A 2JLRA 4NKRA 2IWRA 1TQ2A 4MGZR 1J90A 4TWZA 2C9CA 3HU3A 4RZ3A 1DBSA 3CO5A 4UNNA 1GL9B 5GJCA 1KNXA 4BZPA 2CNWA 2BJWA 4DCUA 1H8EA 5EE5B 3PENA 3I3SR 1SQ5A 3UATA 1KGDA 1LFDB 2WOOA 1JR3D 1EK0A 4WZBE 2WJVA 3QQ5A 1KK2A 3GD7A 3K0FB 421PA 2N46A 5DN6A 1T0HB 3VU9B 5KUTA 1W49A 2FDCA 4URVR 2JASA 1Q1QA 5BYKA 2Q21A 2YWEA 3CONA 4KV9A 3WRYC 1GZSA 1XJ0A 2O0KA 1L7VC 4JLVA 4GNKA 3IPYA 4HZUA 3WP1B 4KSCA 2C77A 4FMDF 3T61A 1Z28A 3OIYA 4QHYA 4JSTA 4C0JA 4G5OA 3VNVA 3OIWA 4FI3C 4V0NA 2GZHA 4DLTA 1UADA 4LDJA 5L3VA 3GFOA 2GBLC 5C4GB 3MGCA 1EX6A 2PEYA 3I73A 4AY2A 1E4VA 1SXJB 4HLUA 1P2SA 3U3OA 3I61A 4LSGA 4HZIA 2XTMA 2WJIA 1Q44A 1TNDA 1PUJA 5CJPA 1QHXA 5TXGA 4D0GA 2O5VA 4C2TA 1CULC 2G77B 3H1TA 5FFMA 2J0VA 3KJIA 2FEMA 1N25A 5FL7A 4HAZA 1N6IA 5FR2A 4Q9HA 4IOJA 3LLUA 4AYXA 1TTTA 1SKYB 4AKEA 5JMTA 4Z8XA 2FPMA 3D6TB 5DSZA 2IYVA 4EIWA 3A1SA 3K9GA 2QAGA 3AKYA 2XXAA 1KO1A 3VTKA 4JYCA 3L0OA 1Q22A 1COWD 4OI0A 1W0JD 2FZLA 3LW7A 5L3QA 2Q9BA 3QKSB 1XNJA 1E2GA 5EE1A 3EZ7A 3G82C 1JB1A 4XJXA 3T1TA 3NBYC 5FI1B 1G8GA 4HB0A 3OHMA 1XU4A 2ZI3A 4UQOA 1Z5ZA 3EZ6A 2X77A 3MLEA 1RYFA 3ZIAA 3ADDA 1W36C 1I2DA 3MCAA 4NYJQ 1JI0A 1H65A 3AEZA 1KHTA 2RGXA 2VL7A 4LUCA 3BH6A 5EXPA 1ZC4A 4IOKA 1EX7A 5KDLA 2AX4A 4M1OA 1FPMA 3T34A 3N2EA 4HAVA 4NCJA 3K9LA 2BOVA 5AR1A 4CEIB 1HE1C 3ZLJA 1BO6A 2IYXA 2CL7X 1E79A 1YZQA 2JIZA 2REBA 4GT1A 1FMJA 3VFDA 1DO0A 4UNPA 4A36A 4LJ8A 4DCVA 2KJQA 1TF5A 5J4KA 3B60A 3C15C 4V0KA 2GA8A 4JLBA 4KHZA 3K0FA 2GZDA 2TMKA 2HCBA 4BFTA 4E03A 2JLUA 2VEDA 3VU9A 1YKSA 2WSSD 1G18A 1PLLA 2Z0MA 3WMGA 4JSYA 1W5SA 4OYHA 4P3YA 1D2EA 1DTSA 2QN6A 1P2VA 3MJRA 3GLGE 1F6BA 2YWHA 5AUPB 1QVAA 4DB2A 3EPHA 4M1MA 2AD1A 3UXMA 1OLOA 4LC1A 3THXB 1OXUA 2YOHA 1VG0B 2OCPA 3DZ8A 4MYUA 3W6NA 1FTSA 4OQFA 3F5FA 3KUCA 2ZRNA 721PA 2OV2A 1NLFA 1NG1A 1UAAA 1IAQA 5FTNA 2ZRAA 4IVRA 2CHQA 4OKSA 3SR0A 4P31A 1G20E 1GP2A 2C96A 2H57A 1MKYA 3NBFA 3R20A 4V0MA 2ZXUA 1SVIA 3SJZA 4R9UC 4F4IA 1VG1A 4BEBA 4DIEA 1GM5A 1AQYA 2ORVA 4WOPA 4NCHA 1PVOA 2QG6A 5F2EA 4DEYA 4AWXA 1L4UA 2WIBA 4I1OA 2JEOA 3B78A 3DKPA 3AVOA 1AS0A 4OQMA 5DGXA 1Z0IA 1F2UB 2P3SA 4LZZA 5DHAA 3X1XA 4S35A 1OJLA 1SVLA 1IJFA 1ZD8A 1GKYA 4K46A 4LYJA 4LHVA 4MDEA 3QKSA 1ZRHA 2QRNA 4B34A 4QHSA 4MKHA 1GOTA 2W6ID 4CW7A 4CEHA 4EQ6B 1KI1A 3Q5DA 3KQKA 3PXGA 2R9VA 5KU1A 2VHQA 2BDTA 4M1KA 4TLEA 5CYOA 1CRPA 1FNMA 1ZAKA 1OF1A 2EFHB 5L3SB 2Z4RA 2RH5A 1P62B 1OXXK 3H0KA 2NO1A 1VPLA 4GOKA 5J4LA 1Z6YA 2Q3HA 5DE3A 4V0ME 1EWRA 1Q57A 3SC3A 4CEIA 4TYWA 2G1JA 1AK2A 2KBFA 2QNRA 3AF1A 3GJ4A 3BE4A 4Q21A 2ZAMA 4UXIA 5G53C 1RRGA 3TGPA 3SYKA 1WE2A 2A3RA 5CITA 4QM7A 2CCGA 1XD2B 1QHHB 3TVDA 4ZKEA 3EW9A 3IHWA 4IOMA 5JRZA 5HKKA 3U6KA 3Q7QA 4AURA 3UPUA 2O0JA 3KL4A 1UEIA 1LS1A 1F60A 3LXXA 2YINC 2EU8A 1J8YF 2NG1A 4Z54A 3G0HA 2A78A 2CDNA 1E2DA 1ZBDA 3FMPB 3R8FA 2CLDX 1J7KA 1D6JA 3U4QB 2R6AA 5CLQA 3PUVA 4C7OB 1JECA 4TMXA 4HSEA 5KPDA 1E98A 3GFPA 2CCJA 2DY1A 2QPTA 2EFCB 3OEED 3KJEA 2R65A 3THXA 4KBFA 1SVMA 2ZJAA 4PAMA 1RE0A 3KJHA 4U7DA 3P1JA 1Z6AA 3WHLA 2P2LA 2FE4A 2AKYA 3VHLB 3GCGA 3LVQE 1SKQA 3RRNA 3GJ3A 4LPSA 1ZMXA 4PQRA 2CLSA 2AFHE 2LCFA 1CRQA 4HUTA 3E70C 2QORA 3RS3A 2QL6A 4PFSA 2QM8A 1OXSC 3QKRB 4H1VA 4TSFD 5LB4A 2GETA 2ERXA 4A4DA 5EXXA 2QQEA 3Q9LA 3B1YA 4IXNA 3U60B 3KFXA 3CNLA 3GLIB 3LDAA 3K53A 4M21A 1N6KA 1UKVY 2IL1A 3PV0A 1F2UA 4MITA 4N0EA 2CK3D 5FBRB 2ZRHA 3FFAA 2J7PD 3R7WB 2HT6A 3AVWA 3TUIC 2GBLA 2IS6A 5FL3A 4MUBA 4F4JA 5FBVB 4FMDB 2OXRA 3N5CA 2ZRKA 5FOXA 2JJ1D 5FTLA 3T15A 1LY1A 5F9FA 1UKZA 4EQ6A 2W2TA 4LY6A 3UKDA 3W6PA 2O8CB 1FOEB 2F6RA 2RGNC 3AVTA 4RZ2A 1YR6A 2DYKA 1UJ2A 3HDTA 1GSIA 4JMPA 1BIFA 4RJLA 1ZIOA 1KK0A 3A4LA 5L3SA 5IHPA 3VX3A 1BMFA 4W5JA 1R6BX 1XCPA 4URUR 4YONB 4NE2A 1U98A 2GWHA 4R98A 4XTRA 4YXWA 4I99A 4EPWA 4LWZA 4Y0VA 4OHXA 5JJLA 3RS0A 2OHFA 4G01B 4F93B 3NDBB 1FNNA 4F91B 1XD2A 1QHHA 2GHIA 1PV4A 2XNDA 2C99A 4U00A 2AFIE 3QXJA 1Z83A 4BUJA 3T5DA 2IT1A 2R6FA 1U9IC 3K9HA 3PCRB 4YC7A 1O3YA 3Q85A 1T9HA 3FGNA 1WQ1R 3U4QA 3TUZC 5LD2C 4MKIA 4C7OA 1ETUA 2CLCX 2IYUA 4XWAA 1C1YA 5DISB 4B48A 1CJVC 4KYIB 3U3JA 4B3DA 1TAGA 4POAA 4A2PA 1HT2E 3U7GA 3ND9A 1M74A 4BLSA 4R71A 2XZLA 3DHWC 1KI9A 2RGDA 3IBGA 3PIRA 5KSPA 3TAUA 5K8TA 3AV0B 1G4UR 1NL3A 1M6NA 5FUWA 2IYZA 2JJ2A 5CJ2A 4HI0E 2J0QA 2A5FA 4Q7MB 4GOJA 1P73A 3QKRA 1OH7A 2XEXA 5L3RA 3GJ8A 4IEIA 3R8CA 1UBCA 3A4NA 1KTVA 1NBMA 1K6MA 2QSZA 3BBPA 3K0AB 4FN5A 3GLIA 5C1BA 1QZXA 1SULA 2F7SA 1G64A 3KB1A 5EP4A 5KNCA 4M9XA 3KZ1E 4HLQB 3R7WA 3UMRA 1AIPA 2EW1A 1XWIA 2NQ2C 3LY5A 3HR8A 2CJWB 3LQRA 1MR3F 1NVUQ 3CX6A 3WNBA 4URZR 2A5YB 2P65A 1NMZA 2W58A 3NH6A 2O8CA 4HEJA 3RC3A 1UBFA 5JBQA 1JR3A 2XOKD 2DBYA 2B21A 4PTLA 2R44A 3MFYA 4HUQB 1GILA 4LOAA 4OI2A 2VYFA 5IK2D 3IBYA 3LFUA 4ASUD 121PA 1CJTC 1VCIA 1A4RA 5ELXA 3CLVA 4JVNA 4LCBA 3WMFA 4I81A 3L2OB 1EG7A 4YQFA 4PPNA 1A82A 2ZPTX 3OEHD 2ZU0C 2Q3MA 4DRZA 1GRQA 2B7BA 4Q00A 5KHOC 1NN0A 3B7GA 2MMCA 4Z1MD 1G6HA 1NBME 1P7CA 1QHIA 1RZ3A 2F9MA 1NJFA 1ZNWA 1XJQA 4DLZA 3A1WA 3U7HB 1E9DA 1GG2A 2V55B 4EJSB 1NKSA 5GJVC 2ZQ5A 4DSTA 2AD5A 2HJGA 3HU2A 5FUYA 3SQXA 1GVNB 2F43B 2FA9A 3QKUA 3ASYA 2ZRCA 1YRAA 4E5UA 3BWDD 1DG1G 4TZ0A 1FUKA 1NVWQ 3TKLA 3IQXA 4Q01A 1Z0DA 4JLNA 4D4KA 1DPFA 3V9PA 5KSYA 5HE9A 3MAAC 2AK2A 2ODBA 1M34E 1P6XA 4JS0A 4MUAA 1CJKC 4XSGA 3CX8A 4UKDA 1HQCA 3C41J 5DNYB 5JWOA 5KDDA 4PC3A 1G6OA 4YDSA 1COWA 1W0JA 1CKEA 2VTKA 4II7A 4BLTA 4WZAE 1I4LD 4URYR 3T1QA 1VCOA 1HTWA 4RD6A 1IXZA 2WSMA 2X2EA 3CZQA 4NONA 4TT3D 1ZD9A 5JECA 4PC7A 4DJTA 4P0TA 1OFHA 2C95A 4G0NA 1CR4A 4FD2A 3SHWA 2DFLA 2WWWA 2ZR7A 4UNSA 1BS1A 2PX0A 2ZE7A 4HDCA 1Z6XA 1KO7A 4PANA 3FKQA 2OFWA 3K0AA 2FSIA 1IQPA 1NMXA 4RZUA 2ZJZA 2NMVA 2RGEA 2YOFA 1I2MA 3BB4A 5D3QA 3X1DA 1FTNA 1IXRC 1YU9A 1Z8FA 4MA4A 3T06B 4ZI2A 4L9SA 5GADl 2WKPA 2RHDA 2CJWA 4QFMA 5AJXA 1YZUA 3O47A 2NTYC 1HH4A 1T5IA 4TN1A 2YNMA 1OIVA 3U3RA 3E1SA 1DEKA 3ZJYA 4HUQA 1LTQA 2E9SA 1K5DA 4M8NE 1XX6A 2FG5A 5G40A 1YR7A 3AH8A 4D82A 4PO1A 3VX4A 4RVCA 3AP3A 2V6JA 3IKJA 2WSSA 2ZREA 3H86A 3HP1A 2NO0A 2VBCA 2X19A 1DAMA 1G7CA 2H17A 5CDFA 3M4YA 3R9WA 5FBWB 5LPNA 1T3HA 4EPYA 1YZLA 3AUYA 1LF0A 2YKGA 4IVQA 4GL2A 1GKIA 3DM5A 3L8ZA 3B85A 4LC0A 2H5EA 3LW8A 2DCUA 2E1RA 1U90A 4EUNA 3CRW1 4B71A 4EJSA 2D4HA 4LK2A 4PSVA 2QAJA 2PMDA 1CJMA 4BFSA 2F43A 2ODWA 3K9NA 4K8OA 2RGCA 3LO5A 1ANKA 3BORA 2C5LA 1OFUX 2DWOA 4EPXA 3FMFA 2NGRA 1IXSB 2I1QA 1DAFA 1C9KA 5GJWC 5C4MA 1NNEA 1NY5A 4YMSA 5LDDC 2JGNA 1II9A 4DCNA 2H92A 2JAQA 1CS4C 2BBTA 2P67A 4UJ5A 2A5GA 3AUXA 2XAUA 3SU8A 3BH0A 1ZNZA 1ZJ6A 4U5XA 1G5TA 5KNDA 1OB5A 1HEIA 2CE7A 5AJYA 4Q03A 1W48A 2FX3A 2YJTD 3ZYCA 4LGMA 1QBKC 2D74A 3K0CC 2W6IA 4DHEA 1RVDA 5AJWA 4B6EA 4D4MA 1RRCA 2VSXA 3VR2A 1JR6A 4RCYA 1LB1B 4TL6A 1GNPA 1JQLB 2C9YA 1UFQA 4DVGA 1QVRA 4JL5A 4NDZA 4WAUA 2ZSEA 1FX0B 1G4AE 1ELOA 1MO3A 2G9NA 1NMYA 1U81A 2CE2X 5J4HA 2IHBA 3CNOA 3EPJA 2A2ZA 3NEJA 2UKDA 4HZUB 1DS6A 1TF7A 1Y63A 3CRVA 2HEIA 1ESNA 4NZYA 4QG7A 2AHOA 1G3MA 1E2IA 1AS3A 2QT1A 1OE0A 4D2IA 4D6PA 1KI8A 1KO8A 3JZAA 5FH9A 4Q02A 1YVDA 5JJKA 5B2ZA 2O52A 4JBYA 1UDWA 2R6CA 1Z3IX 3ADCA 5EQTA 2VA8A 4HAXA 5FOUA 1W36D 5JS8A 1AGRA 2OFXA 4Q9KA 4NMMA 1NN5A 1UBEA 3LV8A 3ZS9A 2QUZA 2WWXA 1LS6A 2FPKA 3VR1A 5BW8A 4M9ZA 1JALA 4RD4A 3LQQA 1G8YA 2NO9A 4Y0AA 2BJVA 3GPLA 1VG9B 4BE7B 5KNBA 3X1WA 4BFVA 1XMVA 3OIUA 4QGAA 2X1VA 3CRMA 3DO6A 3EARA 3PITA 2BV3A 4H1UA 3OF5A 5K8IA 1SZPA 3PUWA 4JLPA 1U8YA 2HT1A 3NG1A 1J99A 4QNRA 1S3GA 4KVGA 3AVXA 2QA5A 1JPJA 2HYDA 2Q0HA 2DB3A 1D2NA 4TSFA 3LX8A 2AXPA 1WXQA 4XIGS 2XZOA 2R2AA 2YC4C 1OHHD 4I1SA 1S8FA 4QBIA 3GLGB 1E32A 3AP1A 1HA3A 1G8FA 1PUIA 2OLKA 2G1KA 3DKVA 1G1MA 3EZFA 3LD9A 3ZVLA 3GEEA 3SQWA 5FPKA 1OW3B 2CK3A 1B0UA 1Z0JA 2J7PA 2J59A 4FMCF 2ZEJA 3KKMA 3K09A 1FUUA 2CXXA 3THWB 2FFBA 2JJ1A 5JHGB 5H1YA 4M1TA 1S1MA 4ZDIA 4DWJA 4F92B 2ZYWX 5JHHB 3NHBA 2XGJA 3T1OA 5LB2A 1OT3A 1ZIPA 2OLJA 1OFTA 2QMEA 3OFND 3LXRA 3MSXA 1FX0A 2WWIA 1NN1A 4HLDA 4A6PA 5TDHA 1TF2A 3TW4A 4BLOA 4DSNA 2J87A 4TLCA 4MH0R 2J0SA 5P21A 4D0NA 5CK4A 3RC8A 2J0UB 1L8QA 3U44B 2GXAA 1QG4A 2JLXA 1ONBA 5FOWA 1S9HA 5FPHA 1KDOA 2BWJA 3IUYA 4Q9IA 2GK7A 4ZDKA 3C7KA 4JT4A 4Q1BA 5DHFA 2WVJA 4D81A 2FNAA 3MWKA 3NBXX 3FE2A 3MWYW 4I1VA 1XPRA 1W5TA 1W0KD 2J45A 1KI4A 1SVOA 3L8YA 1K5GA 3CX7A 3IHLA 1XTQA 3U7FB 4MKFA 1ZM2A 1KKMA 1XTSA 5HPYB 2ZM5A 3W3ZB 4NYIR 4A0HA 1RYHA 2FMXA 3C16C 1MO6A 2LKCA 2IYSA 4V03A 2BMFA 3BFXA 2BC9A 5B57C 3VKHA 1OB2A 1NSTA 4M53A 5B64A 2EYUA 2I4IA 1AZTA 4URXR 4RKFA 4PQYA 3EZ9A 3CPJB 2H7VA 1GAJA 2A30A 3B8HA 2WHXA 4TTPA 4KBGA 4Q1DA 1K8RA 1VHTA 2GK6A 1YZGA 1WMSA 3N2IA 1HT1E 1G3QA 5BN4A 4B73A 2EFEB 3EXAA 2YC2C 1E94E 1NI3A 2BBSA 3B1XA 3GLGA 1ZYUA 2O8EB 3AQ4A 4CEHB 4LPKA 3B9PA 1R5NA 4GOXA 1RIFA 5EJEA 2YZ2A 4BASA 1GL6A 3D31A 4AD8A 3PUZA 4LHZA 3SE0A 2GDJA 3SYLA 1EESA 4TMTA 3SNHA 1G3IA 2J5XA 1F3OA 5BYJA 2G3YA 2IWHA 3THWA 3RRZA 1GWNA 4Q5IA 4P4TA 1E0AA 4US1R 2BIFA 5TMPA 4QGHA 4UNRA 1P2UA 3BB1A 2R6DA 2HXYA 1G19A 4YMTA 3QSYA 2QP3A 2XOKA 3KFVA 5IK2A 3WBKA 1T8TA 1GITA 4KXFB 2OAP1 3SI7A 1G8HA 4ASUA 2D06A 2WJJA 3WY9A 4J0QA 1X6VA 2GEUA 2J0UA 3MD0A 3U44A 2WIAA 4ERNA 1T4GA 1TPZA 4M22A 4C3ZA 2ZE5A 3OEHA 3V00A 1R8QA 5BWMA 3OESA 4N0DA 4PZLA 4Z1MA 1E2KA 4Q19A 3CNNA 4TQUS 3K0CA 3BFKA 1G7SA 1NP6A 2HF9A 2IXGA 2CVHA 3CZPA 3IGFA 2GAOA 3KXIA 4US0R 4C0QC 4B43A 1T91A 2IXFA 1ZU5A 3CKLA 4B32A 2VIIA 2J9RA 3TIFA 1I4TD 1JXOA 1YHNA 1SGWA 3B82A 4QKQA 3UG6A 2WAXA 2ORIA 1RFLA 4QGFA 4BLRA 4TZ6A 3K8YA 3CH5A 1W2HA 4QHTA 4DLSA 2FGKA 4AKGA 2HDNB 1ZM9A 4MGKR 4BPBA 4LJ6A 2FEOA 4TTRA 2D3WA 2IXEA 4PXAA 4N1AA 5CK5A 2CCKA 3KJGA 4IDNA 4IOLA 3RLFA 4A0RA 2D7CA 1E4YA 2N42A 3KTAB 3AVVA 1CR0A 1FFHA 3A6PC 3WXMA 5JS7A 2QGZA 1HQYE 2BEJA 2VH5R 5FUXA 4TT3A 5IT5A 2ZJBA 1G16A 2Q9AA 4WVFA 1RPZA 4L15A 4CZ2A 2IYTA 5CM8B 3TR5A 1XCGB 2WWGA 2O8EA 1CXZA 1QHSA 2IHYA 3IPXA 2KSQA 3FMOB 1CP2A 4KAXA 1A7JA 1KK3A 4M0LA 1HUQA 1ZUNB 4TQAA 3RWMB 3UMSA 4C0LA 1GNQA 2XJ4A 4MKGA 1E2JA 4PHFA 3I5XA 4CVNA 5FOVA 2QTHA 5JLJA 2AWNA 4L8GA 4H9GA 4JBWA 2PH1A 1KZ7B 3QG1A 2IBMA 4EFLA 3LLMA 1X8KA 4FMBB 3RYTC 2C8VA 2MSEB 1G7RA 1KSGA 2ONKA 1OXTA 2ZU6A 3FTQA 4QJ5A 2PBRA 4E07A 1G3RA 3EIHA 5B58C 2IYYA 2ECKA 5FPTA 4PHHA 1J8MF 3X2SA 4DSOA 1U0HC 1NKTA 2D2FA 2HF8A 3HR7A 1MRNA 2Z83A 1W36B 1Y3AA 1F5NA 2AK3A 4PX9A 3BAFA 4FW9A 1W4CA 1AS2A 4RFVA 3T12A 4Q4HB 3ADKA 2WPDD 4B3BA 4QGGA 4LJ5A 4KJZA 5KSOA 4TMVA 1TMKA 2V3CC 1E2NA 1VYVA 4FMCB 3QE0A 4KU4A 4OQNA 4RD3A 2V7QD 1DAIA 1E69A 1IN4A 2ZSDA 4ZV4A 2FZ4A 1Q1EA 2FFHA 4M9SA 3QPUA 3X1YA 5G3YA 2HXSA 4CDGA 4LJ9A 3QXHA 2FF7A 2KWIA 1G7TA 4Q66C 3T5GA 4Q7LA 5KYKA 2QTVB 2I1VB 5A4JA 4US2R 2PT7A 3RDPA 1FP6A 1M7BA 4A2QA 2Z4SA 3KTAA 4YMUA 4JLKA 1XZQA 4HATA 3UWKA 2PT5A 1A2BA 1IN5A 3CH4B 1OIWA 1Q3HA 3L0IB 4DUGD 2IUTA 3QOFA 2ZVPX 2BHRA 1GL7A 3A1TA 1R0WA 4HDOB 3DPUA 8OHMA 2QROA 2R6GA 3FHOA 3AKEA 2WV9A 3BIFA 3LBIA 2ZI4A 1IOZA 3B1ZA 5K8LA 1IHUA 1KZGB 2VF8A 1M1YE 4TYYA 1L4YA 3L0SA 3NWJA 5KPJA 1NRJB 4MRVA 2KE5A 5SZHB 4NL4H 3QXSA 3PUXA 4MRPA 3RRYA 4C0HA 1JNYA 2W83A 1CTQA 1W4BA 4QBHA 4OJQA 2RAPA 3BK7A 4X8LA 2ZRPA 5FI0B 2DFTA 3KKPA 3EWSA 2OFOA 2QMHA 1IONA 3B13B 1E2LA 3NHAA 4B3XA 2CVFA 2JLZA 2IYQA 3ADBA 2H16A 3ND8A 2GVDC 2OSBA 3EC2A 1Q3TA 2GF0A 3BD9A 4PQFA 2ZAOA 1D5CA 1P72A 2ZJ5A 1VYUA 3R9IA 2PCJA 2ANCA 2B8TA 3TE6A 2BBWA 2E87A 1ZM3A 4TMWA 4R2IA 3RNLA 1NSFA 4AG5A 1OH6A 1XP8A 5JI3E 1NLYA 2OBMA 4Q4HA 1R4AA 2NO7A 4TL8A 1E9BA 4A2WA 1Q0UA 5JSZB 1KI2A 1NN3A 1FP7A 4NHOA 2DHRA 2GF9A 2Y8EA 2FPLA 2A5JA 4HYYA 4A9AA 2BKEA 2W6JD 1N5IA 1SHZA 3LBNA 4W9MC 2A5DA 2OXCA 3CF6R 4B2LA 1FL9A 1II0A 2IEZA 2O8FB 4XOIA 5HR5A 3PEWA 2NZ8A 4KLNA 2JLWA 1M2OB 1OHHA 3GLFE 3FHTA 1IY0A 2KBEA 2VLIA 2ZI7A 3MJHA 1E2QA 4A15A 4XH9B 2GESA 2WTUA 1II8B 3TSZA 1US8A 2C98A 2IK8A 3IO3A 4DB4A 1G5RA 4PAQA 4IXMA 3I4LA 1N0WA 3I32A 4OK5A 4LJ4A 2QSYA 3S1AA 1V43A 1N6OA 4M4SA 2ZR9A 4LYFA 3AB3A 4BFYA 1P75A 3HJNA 4GMXA 4KCGA 3UWOA 1XFAA 2GJ8A 2UVQA 4FWIB 3OFNA 2C9OA 2WJYA 1RC8A 4AC9A 4ZCMA 3A58B 3TMKA 1M7HA 1S9DA 4EFNA 3KQHA 3QUSA 1T3LA 1U99A 2AXNA 3AGQA 3BERA 3NH9A 2ZSBA 4DLRA 2PZEA 3RRMA 1VECA 4Q1AA 1S3SA 2FWRA 4Z51A 4Q9LA 3VKGA 3DM9B 1Z0AA 3SN6A 1X1SA 3MG9A 1E1RD 3I72A 2ORWA 2ZJ8A 4HB2A 1MO5A 3AVQA 3CBQA 2CHVA 1WP9A 1PZNA 1W0KA 4JYBA 3FKSD 4P33A 1I4DD 1VDZA 5KTYA 2IYWA 1U94A 4JVMA 1E9RA 5E3HA 3IQWA 1KOFA 5FOTA 4NTZA 4UJ3A 3BB3A 3VAAA 2VSFA 2ZRFA 1MO4A 4GRAA 2PJZA 4IJMA 1KKLA 1HURA 1OPXA 4C30A 4W7SA 2HCJB 3VNUA 3NTUA 2ZIAA 4OK6A 3K70C 2G0NA 2XSZD 2GCNA 5EUMA 4LHYA 2YHSA 2ZI6A 4EPTA 1KI7A 2B92A 4WXPA 5E7MA 5JSZA 2WJGA 4LYAA 4MYHA 4NYIQ 4QOSA 5TV2A 1P9NA 3ZVRA 5EZ6B 2YV5A 4MRSA 4A8JC 2EQBA 3DOEA 2J41A 4DEXA 2IX3A 3ZQ6A 4EKDA 2HV8A 1OH8A 4TYQA 1A5TA 1XXHE 5KOYA 2JLQA 4KFTA 2O8FA 1XRJA 2I3BA 1Z2CA 4E09A 3I5YA 1WB9A 2LWIA 1BYUA 2WWYA 5LD2B 1OIXA 2F3TA 1II8A 1UEJA 2ATXA 4C0AC 3O8BA 2VHTA 1E2EA 1NY6A 4QXAA 5DYIA 5HCIA 5BQ5A 3QIAA 1EFHA 1ZC3A 3FFBA 3THYB 1EFCA 3SJBA 3FOZA 4IFBA 1A2KC 2W0MA 3CRQA 3K0SA 5JWHA 3SZRA 2YOGA 1ZINA 4IDOA 3ZD7A 1YJ5A 2OBNA 4IVPA 4UNQA 1NVVR 4PHTA 3W34A 3ZZTA 1ZCAA 4BFZA 4ZCIA 4DT1B 4Q1FA 1OV4A 4LJYA 3W9YA 2XZPA 4D0LB 1E9EA 3THOA 1N0VC 4RD1A 4FINA 1KAGA 4G5GA 1IN7A 1HY3A 4BLQA 3WNDA 2V4ZA 3BXZA 1T3SA 2YWFA 4AKIA 3C5HA 2GXQA 1NVXQ 3SDZA 1VHLA 1XEWY 4OJKA 3W8RA 1AN0A 3OZXA 3AKDA 2GNOA 4B3CA 1TL7C 4B74A 4L5BA 2BVNA 1NIJA 2WWHA 3QY0A 1AQUA 2YVUA 5EZ5A 4AYWA 4BGDA 2WBLC 1B23P 2VHCA 2RGNA 5SZIA 2ZUBA 5J5CA 2QAGC 4JL8A 4NPHA 3H4MA 5K8UA 4LJ7A 1P61B 4GPTA 3RS2A 3DDCA 2AWOA 4XD7D 2AKAB 1FMLA 3NIBA 3TAHA 5FTJA 2YYZA 1X1RA 1VYTA 2JATA 5ANRB 3OAAD 4A1FA 4HDQB 4G5SA 4BFXA 1ESMA 2RB4A 4DDUA 2WKRA 4RD0A 4JLJA 4ZDWA 1EFRD 1LNZA 2O8DB 3BFVA 3QG5A 4DCSA 1KK1A 1XMJA 2R8RA 3WYFA 2QTFA 4HB3A 4NYMQ 1ZD1A 5CB6A 1TADA 1U9IA 4JLAA 2BKUA 2JA1A 4FCWA 1E96A 2GJAA 2N1BA 4DKXA 5JEDA 2QPOA 2RCNA 1EGAA 3FWYA 1KYIA 3P26A 5CB8A 3CRRA 4URWR 1UKEA 3SEAA 1Q20A 2QBYB 4Q48A 5G3ZA 1JJ7A 1UDXA 2QENA 3PUYA 4B3FX 3RS4A 3TH5A 2WMNB 1HV8A 1AKYA 1QHYA 4IHQA 3THYA 1AJEA 3GQBA 4PC2A 2QGNA 3TQFA 2OEPA 2J46A 2EWVA 1S0UA 1NIPA 4FIDA 4IDHA 4ACBA 4DSUA 2OT3B 1E6CA 4CIDA 2PX3A 3U7EB 5KO2A 1KJWA 3PEVA 4A92A 3WRXC 4NCKA 4KVAA 1LV7A 3NDPA 1XEFA 1YQTA 1QDEA 2QMOA 4B75A 4CYMA 3VR4A 4DT1A 3AVYA 4JKYA 4PR0A 3A37A 3NBZC 3EX7C 1DOAA 2PL3A 4R7ZA 2QI9C 1ZU4A 4WXRA 3ZD6A 2OUKA 2DR3A 2V9PA 4G3XA 3M1IA 2F1HA 4AIIA 2EVWX 2OAQ1 1SXJC 3F8TA 4PO9A 1J70A 1E99A 3C5CA 4LHWA 1ZNXA 3E5HA 3SJAA 2XTZA 1KSHA 2H1LA 3EASA 1DAGA 1E2PA 2W0SA 3CWZA 4JLOA 3AVPA 4FCTA 3GFTA 2WPDA 1KI6B 1YZNA 1XDBA 2DFNA 3C8UA 4DZZA 3EA0A 4GFDA 4A6XA 4FCVA 2GJSA 3KXKA 4OQLA 2DWQA 1AA9A 2V7QA 2WM9B 1CEEA 4LBWA 3A1UA 5E7JA 1IN8A 3VQTA 5E95A 5FPSA 1OYYA 2ZYUX 5F3WB 3B2EA 1ODFA 4L9WA 4MRNA 3P27A 2QEQA 4P4UA 4BLPA 2VP9A 1XD8A 1DAEA 3GLHE 2ASEA 2GJKA 2OCBA 3TRFA 3W3AA 4GP6A 3Q5EA 2G6BA 4C9BA 1CR2A 4LYHA 1ZM7A 4QC2A 4A0GA 2O8DA 2O8BB 3DVLA 2F1JA 4DUGA 2QP9X 4GZLA 1F2TB 3HYRA 3TSOA 3VR3A 1CR1A 2V8OA 1KJYA 1YRBA 2ATVA 5IF9A 3T1VA 3U6BA 2IS4A 4O2LA 3CR8A 4Q4AB 4B2IA 5EP1A 5BN3A 1UPTA 4OI4A 3I8SA 4OK3A 2H18A 4O3MA 4NCNA 2ZE8A 2GTPA 1D8TA 2QBYA 2EWWA 1TEXA 1Z29A 4XTCS 3EZ2A 1OYWA 2ZETA 3VR5A 1KSJA 1N5LA 2GEVA 3LBHA 2QPAA 3CB4A 2GZAA 5TB5A 3TQCA 1E0JA 3I1FA 3AF2A 2OZEA 3PEYA 1MABB 2IYLD 1JQJC 3SBDA 4JZKA 2DPXA 1S4QA 4DDTA 3ZVMA 3QXCA 1MOZA 4LBZA 3L82B 5D3MB 1GKUB 1XEWX 2P5SA 3QEOA 4I4LA 4V0LA 4BRWA 3A8TA 1RJ9B 3CUEF 2GJ9A 4P32A 1XJCA 1QF9A 4NH0A 2JLYA 5CM9C 5J40A 1BH2A 2VP5A 1E9CA 4LBVA 5JI2E 1WBDA 2XX3A 3TLXA 1G9XA 4B6FA 2ZYTX 4A82A 2ZSAA 4YDHB 4HLCA 4EFMA 1E9SA 1RW4A 2VRWA 3UK6A 3A36A 3ONWA 1KSFX 4KFRA 1E1QD 2ZS7A 4MQBA 3R9XA 4TL7A 5M04A 1KI6A 1O87A 3C14C 3IO5A 3L43A 2HUPA 2PLRA 5SZKB 3ETLA 3ZZUA 3IILA 1G17A 2W6JA 1Z6GA 4M1SA 5IDVA 4DDWA 3L0PA 4X8HA 1UBGA 3TR0A 4IDPA 3KQNA 4TYPA 1XTJA 2DWPA 2BM0A 1R10A 1Z07A 2PMKA 4AKHA 3WBJA 3RAPR 4QL3A 2IUUA 1G8PA 1H8HD 2X8AA 5EP3A 3WYGA 2PZFA 2RMKA 3EC1A 4B44A 3CF2A 1CBUA 4Q4JB 3RSOA 1KMHB 3AGPA 4DBLC 2O8BA 1D2MA 2KI5A 4BWYA 1NJGA 3O8DA 1F2TA 3KKOA 3N70A 1N2CE 2PCLA 2REOA 4Q4AA 5KDOA 4V02A 2RGBA 1KMQA 2NIPA 2FFAA 2Q9CA 5KSZA 2FU5C 5HZHA 5AK0A 3ZS8A 3FPAA 1N5JA 2FSGA 1KDRA 1W1WA 1GTVA 4PSAA 4Q1EA 1W46A 4S2EA 5BN5A 1JXMA 2Z5FA 1CLUA 1KY3A 4OQXA 3LAWA 4HAYA 5SZJA 2G88A 1WRBA 3GEHA 2ZANA 2V1XA 2ZUCA 3C4JA 1N3BA 4FWTA 2FV8A 4B2PA 3I8XA 3A1VA 4Q1CA 1EFUA 1ZNYA 1MABA 2ZRGA 4TMKA 3JZMA 3NEYA 1E1RA 3NXSA 1OKKD 1S2MA 1KIMA 4XWOA 3HU1A 1XBTA 2GCOB 1W44A 5D3MA 5H68A 4CEJB 3P4YA 4A0FA 1M8PA 1E0KA 1UF9A 3FKSA 1P2TA 1RJ9A 2GKSA 5IRCD 4WW0A 2FOLA 1W7AA 3BC1A 3BH7A 1YR9A 2XB4A 3LH5A 4K81B 4F7WA 3OE7D 3CIOA 1VMAA 4TTQA 4Q47A 4PZZA 2C04A 3I92A 3VR6A 3EIQA 3FMIA 2EYQA 1QRAA 2D62A 4DCTA 1XTKA 2XSZA 4LX0A 2AR7A 1MH1A 1VIAA 2J7KA 3MWLA 5HE8A 3AF4A 1IM2A 1WCV1 1TX4B 1CF4A 1E2HA 3AM1A 4JLMA 4ACAA 1E2MA 1DADA 4I1UA 4O0MA 5A5GA 4NYMR 2ANBA 3QVVA 1G21E 4GZMA 1KI3A 3B1VA 2JDID 4QJ4A 5H8WA 4MGIR 4JT2A 3GJXC 5H70A 5DO9A 5FOSA 2VP4A 1BYIA 1OXVA 1IBRA 1SXJA 4IKEA 2IW3A 2ZUDA 5GVSA 4QBFA 3QF4B 4X8MA 5J47A 2ZJ2A 3KDSE 1LF5A 2ZJYA 5DYGA 3WP0A 1A1VA 3QEJA 4Q4JA 3J81k 2UZ3A 3GJ5A 1Z06A 1KMHA 2GILA 1W2GA 4C0BA 1RRFA 1HE8B 1XPUA 3QNUA 2IC5A 2UZIR 2FSFA 1DAKA 521PA 2ZI5A 5LBIA 3TJZA 3DZDA 1DARA 3FDIA 2OO7A 4ITRC 4OL0A 4XVUA 4XWKA 2ZR0A 4B35A 1L2TA 1X3SA 1G41A 2ZRBA 4PPFA 1QG2A 5F9HA 2QRZA 1OSNA 3DMNA 5GJBA 1TEVA 1CJUC 4B33A 3GMTA 2W2VA 3RABA 2BEKA 1PLJA 3Q7PA 3REGA 3WNCA 3GLFB 1E9FA 3Q3JB 1GRRA 4ZIRB 4UXHA 1R0YA 2WMOB 1VKJA 3HPRA 4PSKA 1NLZA 4AG6A 4DLVA 2JJ8A 1XEXB 2B6HA 1C4OA 1SXJE 2QE7D 1NVVQ 2GXUA 1JBKA 3NVAA 4G1UC 3KXLA 5GVRA 1RKBA 2A7QA 2GCOA 4UXJA 4DLYA 4GDFA 1N6NA 4CEJA 2IS2A 1MV5A 4PC1A 4GI7A 2JCSA 5C46F 1AGPA 2MSDB 2LKDA 5UKDA 4U02A 1SKYE 2PZGA 2ODEA 1G3UA 2RGGA 4NU0A 4BEJA 1ZP6A 1GUAA 2HLDD 1EWQA 4Z8YA 4B3GA 4ON9A 3TK1A 3V4FA 4XD7A 5L8VA 1VCNA 4C0SA 1DELA 3ICEA 5DH9A 4KFUA 3LA6A 1WF3A 3OAAA 2QZ4A 2GAAA 1NF3A 3EPLA 2GVZC 1EFRA 1G5PA 5EXTA 1US8B 4L4UA 3QPVA 4MYTA 4ARZB 3MRSA 2KB0A 4JBXA 5EP2A 3BRWD 2GXSA 3H84A 5JJIA 2F1IA 4GMDA 1DO2A 5DI3B 2IUSA 2PJRA 3QF4A 3S1AB 1DVRA 1Q21A 1ZUHA 4QNMA 2P6UA 4BFWA 2WICA 1F48A 3SFVA 4CF7A 1YE8A 1JEDA 4ZI3A 3K70D 1AKEA 5HTKA 3ZH9B 3M0EA 3KKQA 4OHYA 3QXXA 4LJAA 3M6AA 3QI2A 4LHXA 3QKTA 3UANA 3UMFA 4M1YA 5JFGA 1U8ZA 2RHMA 1VCMA 2H8KA 2ZROA 3F0TA 4OBEA 2ZS9A 5CIQA 2QT0A 1R0ZA 1FZQA 2G83A 3U3KA 2CL6X 4CGZA 4PO8A 1KDTA 5FR1A 1XXHB 5FTKA 3LRPA 3TBKA 4JJKA 3K0EA 1D9XA 2QQ0A 3EG5A 4JKIA 1ZUIA 2ZRMA 3BS4A 5DI9A 4PHGA 5A0FA 1AM4D 3GLFA 4EJSC 2CNWD 2V1UA 4RCZA 4ZIRA 1H8ED 2PLFA 1IN6A 1M7GA 3EAQA 3GJ6A 3VHXA 3W5JA 2QY9A 1XEXA 5C2JB 1Z22A 821PA 4LV6A 2CBZA 2ZRJA 5AWFC 2ZE6A 5DN6D 1WDTA 3AF0A 3D7MA 3QF7A 2BCGY 2MSCB 3ECCA 2Q3FA 1JPNA 4LV5B 1S96A 4KLZA 4FXPA 1J2JA 5JEEA 1U0JA 4XVRA 1KJZA 3TW8B 2L0XA 3QBVA 3DMDA 3SHFA 2FH5B 3NC0C 1P4SA 4OHVA 1JJVA 3X1ZA 3MUFA 2P5TB 2BBOA 3EA5A 1Z0FA 2VP0A 2W2XA 4TMZA 5FTMA 4OHZA 5JCPA 4PC6A 1V5WA 3HPQA 4ABYA 3IEVA 2P6NA 1PJRA 2RKOA 1OH5A 3PJRA 2BMDA 2ZS8A 1FW6A 1G291 4W5HA 1SVSA 4WBSA 3KUDA 3SFZA 3U5ZB 2QMUA 2HJVA 3D3QA 1Q1BA 3V4RA 2F9LA 2FN4A 1KAOA 3RS7A 2WAYA 2AN9A 3A4MA 4IW3B 1MT0A 4OI1A 4LI0A 5FL7D 4ZO4A 4ARZA 4DLWA 5FBQB 4TLBA 3I62A 4DIDA 4C2UA 1VG8A 3AVUA 5JRJA 2X2FA 3F3YA 4Q7KA 5DI3A 2OCYC 1DE0A 4TLAA 5E7IA 4C4PA 3KQUA 4BRUA 4G5RA 2SHKA 4NYJR 2C2HA 1YZKA 2Z6VA 4M1WA 3Q72A 2ZRDA 2O0HA 2QM7A 4IDQA 1SVWA 3LX5A 2BM1A 2VP6A 1PLKA 4N3NA 4BFUA 1EXMA 1GNRA 2OESA 3IIMA 4PPQA 3GEIA 3B1WA 3ZIAD 1N6PA 5AUNB 1WBBA 2QP4A 2ZVQX 5FUVA 4BECA 2FGJA 4TQ9A 4HB4A 1XXHA 1W47A 5G41A 2VHJA 3ICQB 5JWRA 1FQJA 2RGAA 2XJ9A 5EE9A 3E2IA 3IIKA 5EUQB 1DAHA 1RRPA 1VIYA 2FJUA 2G0TA 2JLVA 1JAHA 4LBYA 3WYAA 2IF2A 1Z47A 1GIAA 2JIZD 1E79D 1WA5A 3SS8A 2XNSA 3QJYA 1Z6TA 1ZVQA 4M2LA 4OHWA 1R5BA 1Z2AA 1E1QA 1XF9A 3SYNA 6Q21A 5CLLA 3EWAA 4RSGA 3BJIC 3CR7A 3CW2A 4KSBA 1TQ6A 3RS5A 3UG7A 5F98A 3KKNA 2XITA 2ONJA 1KDPA 3D8BA 5JCZA 3GLIE 4X8OA 4MGYR 3RHFA 3CWQA 1FQKA 3DEFA 2WZQA 1U2RA 3FVQA 5CYPA 4DDVA 1YZTA 3K09C 4QRHA 3PG5A 2VO1A 1QHGA 1GFIA 2OCAA 1SVKA 3PEUA 1YR8A 3ZDQA 1H8HA 3PVSA 4NP6A 2NZJA 1UKYA 4EPRA 3VMFA 4YMVA 5J4YA 1SXJD 1X8LA 3FYHA 3KB2A 3TNFA 4EPVA 3AF3A 4YLGA 1SHKA 4AI6A 1CU1A 3LVRE 2CL0X 1JR3E 1X86B 1Q1ZA 1XB2A 2BMJA 2V6IA 2ZSFA 3CPHA 5HCNA 2F55A 5EXSA 1IY1A 3U2QA 1HYQA 4D4LA 2HYIC 3QPWA 1XZPA 4D25A 1OFIA 3KQLA 4ESVA 5EE0A 4MYCA 4BZQA 2NO6A 4EDHA 3CPEA 2NPFA 3WHKA 2V54A 3Q8XB 4KITB 3RVBA 1BKDR
chains in the Genus database with same CATH superfamily
5AW8A 4XR9A 4HMPA 4WIAA 4N6NA 1ZIXA 2Z8YM 3SBEA 1IK6A 4HAWA 3QXGA 5E2AA 4ER6A 2BCJQ 3NB0A 2VWHA 4QTTB 2BLLA 2PYIA 2P0EA 1Q12A 1BEUB 3G5UA 1XMQB 1CY6A 2X3UA 3PFKA 2IYRA 5J2UA 4ALIA 4WY8A 3UWSA 3NKVA 4CCAA 3M6IA 4NWIA 3G7NA 2CVOA 1GYRA 3LWBA 1WOYA 3C45A 4H7FA 2QRQA 4A91A 5G0SA 3W7VA 2OILA 1HE3A 1K86A 5SV2A 4HLUC 5IJWA 2CWWA 3MJTA 5JAUA 2ZJ0A 4GO1A 4NE9A 1TC1A 5KQPA 4JR2A 4YJ3B 1TYEB 3A4TA 3SIPA 3A10A 3AFHA 4INAA 2JVIA 1NF9A 5FQNA 2WT9A 3WGOA 4DV7B 3B5EA 3BSFA 3ZVNA 3QU4A 3QENA 1B14A 3OE7A 2JZOA 1Z4PX 5FWYB 2B7CA 2FXIA 4R7GA 3IAM6 1MJ5A 3MT0A 4HVAA 3WMEA 2BF4A 2YBDA 1U0RA 2ZBRA 3BSWA 4ISBA 4RKEA 3U37A 2ZYVX 1NLMA 3HBMA 3VBEA 3I5UA 5E3JA 3BK2A 1CIPA 4BGIA 3RJZA 3E3OA 3PFIA 2GRUA 3I4CA 1T4DA 3FAZA 1HWYA 1A4XA 1BWRA 1MRSA 4W6ZA 3RANA 1KH3A 2DFKB 2DWUA 3IEUA 1IEVA 3QYAA 5CH3A 2ZTSA 1ZM4A 1M2KA 2XHZA 4TL9A 4YQEA 1WXDA 3IP3A 4DR2B 4MWEA 3ZQJA 1L4KA 4Q18A 2IHKA 4CRWB 1K7SN 4KO8A 4WGFA 1H4VB 4G89A 3NEAA 4AJ4A 2CEAA 2Q7OE 1T5LA 4X1IB 4XE5A 4Q7JB 2J3EA 1JHUA 5JFTA 1C1DB 3OKPA 5FBZA 1XTRA 2FFQA 4OHMA 1N6HA 3FWHA 4AK9A 3KTDA 3SVLA 1JKJA 2I2CA 1JN0A 4ZPXA 1IXYA 1H0KA 2DJ5A 1NTOA 3U7IA 2FPPA 1D9ZA 1GRCA 2ZI9A 1ESEA 1DU4A 4OIFA 3D7NA 3T95A 3K70B 2PXAA 4EVQA 4AYTA 3QBTA 3FTEA 1EFTA 3KX2A 2C03A 3W5DA 4ZEMA 1NW7A 4AX4A 1NI5A 1UWLA 5DU2A 3WKEA 4HWKA 1JP7A 3WV4A 2HBZA 1G8SA 2N75A 2WWFA 3H16A 4RFSB 1XCMA 2IV2X 3V6LA 4DMHA 4Z7OB 3TF5A 3WVNA 4L4ZA 1R5OA 3TBHA 4QJ3A 3BZWA 1OLSA 1O6GA 1PR0A 2AOVA 2B2XA 2NXEA 3K5WA 3QHQA 5CDFE 5LQJA 1W4RA 3SM3A 1E1MA 5ULLA 2PRIA 4H77A 4UE2A 1P5ZB 1YK1A 3HI4A 2JGMA 4GPD1 1Z5GA 1AZSC 1FLAA 1SOUA 3QLTA 2GSWA 4OHBA 5AT1A 5TVKA 1O58A 2J1LA 3KQWA 4LV8B 3FYSA 4JVSB 4EHLA 1CR6A 3LZ6A 1R2QA 2GCPA 2PJUA 1I0ZA 2Y1GA 2MMGA 3VVMA 3ESXA 3T0GA 1L5YA 5CLGA 5CT6A 4I9GA 1KY2A 3HWSA 4HNAB 1GXSB 4ALMA 2QVXX 3COYA 3R5JA 4GBMA 4HQ0A 4IEEA 4TRNA 4BVJA 2XWQA 4QSHA 1XPOA 4GNRA 2IA5A 2ZIZA 3O95A 5I9TA 1QQBA 3UK0A 2GRJA 4TV8F 4F38A 1UZMA 3SOPA 1EJ0A 1BE8A 4UCWA 3EWIA 4LKOA 2F3RA 1GAWA 4JR1A 4BMDA 2Y71A 4KVZA 4RD2A 1RXEA 1CV2A 2YUTA 3A3PA 3E7PA 4KYUA 4ZANA 2OE2A 2XZDA 3GVIA 4QEKA 4J6EA 2EEPA 1V5FA 2D5IA 4K6OA 4LNUA 4WZ6A 3H9UA 1BMDA 3IUJA 3LYAA 1GRNA 3QVUA 5FOQA 2GEDA 4WLVA 4BMNA 1XZAA 4F5EA 1RYDA 4EG6A 3OX4A 3RB8A 3H19A 3RAJA 4C7JA 4OAOA 2INGX 4G4SO 4LI3X 3IHKA 1JSCA 4U2CA 1V5EA 2K5UA 1V41E 2W00A 5A7FA 2C78A 1N4AA 4ZO6A 2PKRA 4DIMA 3CCCA 5ALYA 3ZDEA 1NC1A 2FRXA 3GVXA 4NZPA 5JZVA 1JAIA 3PBKA 4FBLA 1L8XA 1ZKDA 3M5DA 4TS9A 1JFLA 2XB2A 4UW9A 4L16A 3N8NA 2C7PA 1OBVA 1IJEA 3P32A 1M76A 3FX2A 4RA9A 1ZVMA 3MINA 4TKUB 4ALNA 4P4SA 4D80A 1VIMA 1YL7A 1XKLA 3BGVA 1VLQA 1IWPB 4KH0A 3RWOA 3WYEA 1L9XA 1GAEO 2KM1A 3RIHA 1F0NA 3E9NA 3IBCA 3UAGA 5K4HA 4PRKA 1E3MA 1C1HA 1YASA 2BRUC 3BOSA 2HJHA 2P6RA 3PQCA 5T4EA 4EI2A 2FF5A 2QAGB 4O25A 5KX5A 4D8UA 2IHVA 2QVYX 3JAKA 1GEGA 2HPHA 4UHCA 5E4FA 2GTIA 1Q7EA 3OCZA 4C5CA 1U9JA 4UM5A 4J3NA 2EIHA 2HMVA 3D7SA 5I5GA 4ZPJA 2P6PA 1J0EA 4IX9A 4ROTA 3O8CA 3D6NB 4RSHA 1L5GB 3INGA 3U4AA 3FDZB 3OZFA 4MRRA 4DXAA 1U2PA 4QT4A 5CDSA 3PTAA 1JR2A 1FFYA 2H3HA 2VF7A 5TY0A 5CAEA 1DB3A 1ZA2A 5F7XA 1PJ4A 1EFAA 1U8AA 2VCEA 3BXOA 4OQYA 2HU2A 1JYEA 2HRDA 2JLRA 4O4JF 4AZ0A 2JK1A 1CP3A 2I1LA 1QQTA 4MGZR 4NKRA 2C9CA 3U1TA 3HU3A 1X7DA 1HRDA 2SCUB 3FJ1A 2P9GA 4RZ3A 4F97A 3VNQA 2FX5A 4GRIA 3ICVA 2ASVA 1G5HA 1Y9ZA 3AUFA 4BZPA 1CB0A 2BJWA 2H2GA 2ODTX 3K4PA 3PGMA 4AKSA 3I3SR 3R0QA 1Z45A 4MAFA 3FG9A 1LFDB 4BJ3A 4MPPA 3HYNA 3T3IA 3ZUGA 2WJVA 3FHLA 3QQ5A 1KK2A 4I4TA 1UZAA 1VBKA 5EWMB 4GVPA 1W49A 2AN5A 3D02A 3DJFA 2JASA 1VE6A 3MFQA 2IV3A 1FDOA 5BYKA 3CONA 1JDBC 3II6X 4HXGA 4KV9A 1BKYA 3KLNA 1L7VC 4JLVA 4DMMA 3MGGA 4HZUA 2HV9A 2P90A 4HNVA 1YS9A 1ZI9A 3DDZX 3ITEA 4QDUA 1Z28A 3OIYA 4QHYA 4JSTA 2ZSHA 1MTOA 1IUNA 2GYVA 3G8YA 4IYRA 4FI3C 3ZNPA 4V0NA 1U3UA 1UANA 3T3GA 4DLTA 2O4UX 3K2EA 3ET5A 3LQ1A 4L8YA 5JSUA 3FM9A 4KDRA 3GRYA 3HUTA 2QRJA 2YX1A 1E4VA 1U7UA 4G5YA 1SXJB 2JBHA 4G56A 4HLUA 1SM4A 2ZJ4A 4KZPA 1OLUB 4LHEA 5TXGA 3V3TA 1E6WA 3GRPA 4D0GA 5EKUA 2XCSB 1YR1A 1CULC 1PSDA 5FFMA 4IV5A 4RELA 3C3XA 5CA0F 4DUYB 5BRNA 2QG4A 1KFEB 1VMKA 5FL7A 4C20A 4Y7DA 3BE8A 2FSVA 3C3AA 3LLUA 5EAIA 1TTTA 1KE2A 5IW8A 2JZCA 3LDFA 4EIWA 3IAAA 3ENWA 1NZJA 1JHVA 3A1SA 4XYEA 3RVRA 3AKYA 3ZU3A 1U2ZA 3HG7A 2IGTA 1JEYA 1Z82A 3L0OA 2DKOA 3B3GA 4BWGA 5CA1B 4I1RA 1COWD 5KJCA 1WHSA 1U1CA 1GNTA 4ZXFA 5L7YA 1UBTS 1X15A 3VU8A 5I7EA 1F8UA 4H1TA 3EZ7A 2AI2A 2PUJA 2IYFA 3GAMA 3P9KA 4LNAA 3T1TA 4C7VA 3RM3A 4HFJA 1QGUB 3ZV5A 2XUHA 3E1GA 2Z95A 2ZI3A 4UQOA 1Z5ZA 5I5EA 3ESRA 2X77A 3MLEA 1I9GA 1RYFA 1YACA 3AIMA 4GYJA 4NESA 4RANA 1MP0A 2B34A 3CLSD 3ZIAA 2YY5A 2CNDA 4NYJQ 4TVSA 4K87A 1HK7A 1KVSA 4C2AA 2RGXA 1L7PA 2B25A 3MJVA 1Q7RA 2W6NA 1ZC4A 3DH0A 4TWJA 5DWQA 4DYVA 3AL2A 4IOKA 5KDLA 4BO6A 1XZHA 3C3CA 3QLUC 2EBHX 3T34A 2P30A 4GMFA 4HAVA 3ICCA 5EXDA 1E1CB 4UHFA 4LE2A 2VTVA 3SIRA 1OYOA 4OU4A 1BO6A 3VJKA 2Q9UA 2MDTA 5E1OA 4GT1A 3W2EA 5LYJB 4A36A 3P5BA 2E18A 2FKNA 2GO1A 1WJGA 3C15C 4AJHA 2GA8A 3SX4A 1HDRA 5LNK1 4NK5A 1H4SA 4GDMA 1YONA 1U4SA 4MJ7A 4PCUA 4BFTA 5D7NA 4DJJA 4IWNA 4DMLA 2Z0MA 3A4VA 5HK8A 5IVDA 1Z2PX 4BATA 1Q0SA 4NRDA 4ZZIA 3IKVA 4PLZA 2R96A 4B4OA 1JG3A 1D2EA 1DTSA 1WXIA 1CJBA 2PL9A 1P2VA 3IUNA 4LYDA 1F6BA 1QF7A 2GLUA 4Q7QA 3WGTA 4D7AA 5JS1A 4YP5A 2ZYAA 3FXAA 3N2GB 4BO1A 1GN9A 1EI9A 1TGYA 2Y4OA 3ITKA 5KMGB 3BGDA 2V6FA 2PHZA 5K3FB 1OLOA 4LC1A 5GIOE 3S2UA 3THXB 4MIKA 2FSSA 1PL7A 1VG0B 2JHCA 1NM5A 4MYUA 1VLVA 4OGWA 4OQFA 3TXXA 3W6NA 3ZUPA 5JC1A 3R23A 721PA 4EMTA 2V0CA 5AXCA 2AT1A 1NLFA 4YJGB 5F78A 3GG9A 1D7OA 2P6OA 2R8BA 4H60A 2B8JA 3Q12A 4IMJB 4IP0A 4O5OA 4Y6RA 3J81A 7ABPA 5JY6A 1IAQA 4MSUA 2ZRAA 4IVRA 4JKOA 4IQ0A 3RK4A 1KEEB 3QEMB 1BXKA 1ORHA 1GP2A 4FHCA 3EFBA 3FA2A 1PT9A 3G89A 2YYSA 2GBGA 4YEDA 2J6BA 3K05A 3NOXA 3NM5A 1VG1A 1WX1A 2SNIE 2IE8A 3QVXA 1GM5A 4WOPA 2ORVA 3I2KA 2YZKA 3GX1A 4ZMSA 3U7QA 1PVOA 4CG3A 4F0JA 2IVFA 3FJYA 2A58A 2V7UA 2WIBA 3PL1A 4I1OA 1RBQA 1YDFA 4KLAA 1R0LA 4ND5A 5EZQA 5IH3A 3AVOA 1AS0A 5DGXA 3VYWA 3AG6A 3OCVA 4S35A 1DHRA 5FCDA 3SSMA 1P19A 2ZWIA 5FFNA 1NMQA 4G8DA 3MXTA 4MQUA 4B34A 2HBYA 3OLWA 1RWKA 1V45E 3EFEA 4ARUA 2OYCA 1WXXA 5LQUA 5K45A 3EQ9A 5J59A 3QFHA 2R9VA 4PLFA 4C4OA 1KEPA 4ZO8A 3PA6A 4NEGA 2FX2A 5FNVF 5JC8A 4BNMA 1DV2A 2GPJA 3WQRA 2FCRA 2Z4RA 1N9GB 3E03A 3H0KA 1OXXK 5EINA 3EXHB 3HM2A 1DBIA 4TX1A 5J4LA 5LM3A 2B5OA 2HO5A 2YW2A 3D0RA 4D3XA 1VJRA 3CKMA 3A6EA 4V0ME 4KO4S 2DMRA 4DPKA 1Q57A 2GBPA 4CEIA 3U1VA 1QYCA 4QX6A 1I3CA 1GUDA 3AF1A 1CDOA 4BV3A 1VE7A 2HWXA 1Q7GA 1VL6A 5H80A 3NQ41 1D6NA 2HO4A 3OQ1A 1L5RA 4QM7A 1QBGA 2CCGA 1QHHB 3X1MA 4AULA 5IH7A 1W88B 3FCOA 5C5IA 3U6KA 4AURA 1FYEA 2O50A 4X91A 1ZXLA 3F67A 4KVFA 1HDOA 7GPBA 1RAIA 1TCUA 1UEIA 2XE4A 5FADA 3LXXA 4QBTA 2YINC 1XTUA 1TVCA 1J8YF 1TO2E 2EU8A 2IDKA 2AQ8A 2CDNA 1T5OA 2ZT7A 4U7WA 4LXIA 1D5WA 5LQRA 4XCVA 4J16A 3HCBA 1KQPA 1WVIA 4W5OA 3FOFC 2A57A 4FDAA 4A1OA 3KCQA 1V9CA 1TYBE 3EXEB 1JECA 3PC2A 1WV0A 3M6LA 3PUVA 4TMXA 2DHDA 4U9HS 3DMFA 1UWVA 4G1CA 2CCJA 3MHPA 3I2FA 1QTQA 3GFQA 2QX4A 1C9EA 1P4RA 2XWJI 5ED0A 2ZBUA 5BUQA 5THQA 2YVQA 4EM6A 3R9KA 1SVMA 2YBEA 4RDCA 5KNBD 2FW1A 3DW1X 1ISSA 2V4UA 1K8QA 2FETA 3A26A 3CLHA 3P1JA 2P2LA 2ZXFA 2FE4A 5EUQB 3E9MA 2AKYA 2R5WA 3FB1A 1UKCA 5EJ9A 3QY9A 4CWAA 3RSHA 1IMOA 3GJ3A 4IDCA 1MB4A 3CVJA 3RYIA 4LPSA 4UD6A 1U3DA 4G25A 1T24A 4R8RA 5CHEA 2FLKA 1CRQA 2OFFA 2I8LA 4F2HA 4AZWA 4G5XA 2QM8A 4BO8A 3R7FA 3UMYA 4IM7A 2GETA 4HEA6 4XR4A 2ERXA 4A4DA 3QLVC 1R12A 4GP9A 2QQEA 1CUIA 2AZDA 2G17A 2PZJA 3B1YA 4NBWA 4XX1A 5HGJA 3AR8A 1VJDA 3RTDA 5K0FA 3KJFA 4LZLA 2WD8A 4M21A 2NM0A 4BTLA 4F21A 1GAXA 1V39A 3QWBA 1XNHA 1F2UA 4AG3A 1XZKA 3LKBA 2CB0A 4GQAA 4E5YA 1P29A 3AVWA 1A9XB 2DETA 1K7YA 1AMUA 5DGHA 1SEPA 2OAEA 4MUBA 4UDOA 2XCUA 1CUZA 4YH1A 5LYYA 5JYCA 1K6JA 1C7QA 1AQIA 2ZRKA 3P0RA 4NMHA 3BIXA 5FOXA 3MIZA 5CCDA 3ROTA 1QNLA 2OBXA 3BMQA 4C7MA 2ALJA 1DCFA 3KSDO 1UKZA 1KJNA 3M4NA 3OT5A 2YY6A 3OU7A 4FYIA 5EHGA 5K51A 1NBAA 1TYZA 2W2TA 1ZWKA 4LY6A 4RVOA 3WK7A 2O8CB 3R5HA 1NR5A 1D0VA 4IXDA 4PX5A 3HDTA 1S89A 1X38A 5G2OA 4UUQA 1KK0A 5K3OA 4OGGA 5L3SA 5IHPA 1I2BA 3VX3A 1DXQA 1RWNA 1E3WB 3MERA 1XCPA 3LPLA 4YONB 3FWNA 4N18A 4NE2A 1TJPB 4N3CA 4B46A 1SA0A 1A9QA 4U39A 4Y0VA 3F7OA 2VOEA 5GV7A 5GZ3A 4EDFA 4WZAB 1D0IA 3P94A 2WRZA 1AUVA 1H6BA 3HXKA 3VZDA 4G01B 4W5RA 4KPYA 2F8TA 3V2IA 3NDBB 3MC1A 1MTZA 1AO0A 1KFJB 3VC1A 3C6KA 3RUAA 4F11A 3U40A 3N86A 1CY4A 1DCKA 3I9MA 3RT1A 1Z83A 3W8EA 3D8SA 2QXTA 5LBUA 1J49A 1ENZA 1U9IC 3I04A 5IJ9B 3KYDA 2YWXA 2YZ7A 5KYUA 1O3YA 4ZCRA 1VL2A 1SC9A 4QLBA 2NZXA 3GV0A 4G09A 1IPFA 2IIVA 5F12A 3UWPA 3UXYA 5JQGA 2BLNA 2DKNA 3QLUA 3HBFA 1SIOA 2JNWA 2IYUA 3AZOA 1FTGA 1C1YA 1R37A 2O7SA 4JHLA 5DISB 5KAMA 3LECA 4UTZA 5KBYA 4S0XA 1LWOA 2XB9A 1HTTA 5D6OA 2AMFA 1TAGA 2JFZA 3V8MA 4POAA 1B8NA 2HK8A 4UBLA 3MYRA 4TUYF 5IZCA 2IYPA 3EDMA 3TLGA 5BNIA 2AN4A 1N4DA 1KI9A 1ZIDA 2RGDA 3IA2A 4C4RA 3QELB 4BC1A 1PK7A 3UAXA 4DEVA 2DKFA 3C8ZA 3FSEA 3DDHA 1OI4A 1P5JA 4O29A 5FUWA 2IYZA 5F7OA 1VL5A 2PPVA 5HIIA 3BT7A 3L77A 2J0QA 1WSAA 4XWGA 1DUVG 4DCJA 4GOJA 1P73A 3QKRA 4KPUB 5L3RA 4RY0A 1E66A 1F38A 4XPIA 5CVTA 3BZUA 1O5IA 1YI8A 3HVIA 4XYGA 3WB9A 1EK1A 1K6MA 5G4KA 3TQRA 2YL2A 3TMAA 1D4ZA 1IE3A 3GLIA 3F78A 1QZXA 2M32A 4UUNA 2GDZA 3AU9A 2AE2A 1THGA 1XTVA 3UMVA 1K89A 3IS3A 4PYRA 2FMKA 4B2YA 2XWPA 4G0UA 3O9ZA 1IN1A 1CRZA 2XEDA 3QFTA 4YDQA 3KBOA 1UXOA 1YZYA 4AMUA 4H0NA 2CJWB 4Q3EA 4Y7CA 2RCYA 3SLKA 3ZV7A 1R6UA 4NENA 1NVUQ 1D8AA 1MB0A 4G2TA 5BUSA 2PDAA 1ZOLA 2A5YB 2P65A 3DL4A 4JOQA 1LLQA 4HEJA 5IABA 4X1YA 1P8AA 1UBFA 3W2GA 2XOKD 4PTLA 1XO1A 3C7DB 4CDNA 1KOGA 4OI2A 4LOAA 2WJ4A 3AJ8A 1UCFA 4F72A 3BZBA 5AHRA 4EGQA 4ASUD 4HBZA 1K63A 3I9LA 1S7GA 3N7UA 5K3AA 1OTHA 4RJJA 4XUDA 3WMFA 2C29D 1MNQA 4I81A 5IPFA 3FOAA 4PPNA 3Q10A 3WFZA 2P2GA 5CCEA 4UUBA 1U1IA 1P6QA 1Z5NA 2B7BA 4Z4IA 4Q00A 3A6KA 1V6SA 4RK7A 4Z1MD 2WD7A 2VDJA 4RHYA 4WMLA 3LBFA 2FRVA 1QHIA 1NJFA 2Q45A 1ZEJA 5FB3A 1MPXA 3RH0A 4D9FA 2NNWB 3G49A 1FZTA 1BX3A 1I4OA 1RAGA 4CKWB 4AY3A 5IVPA 1M66A 2JCGA 2GHRA 1GG2A 3HDQA 3LHFA 4RMNA 4ZP1A 3E6AA 3TLBA 4DSTA 4AXXA 2F43B 3ROGA 1THTA 3X1KA 3ASYA 4Q82A 5IKEA 2M98A 1YRAA 3ZCXA 4BO2A 2DULA 5HFJA 2O57A 1DG1G 2X6TA 2XXJA 4KP7A 2H0RA 3G0DA 3HI6A 4Q16A 3ORHA 4IDFA 5BQOA 4FEAA 4TZ0A 1U0FA 4FGKA 1RAHA 3TKLA 3IQXA 4ZGWA 1UFRA 4OOFA 4UM9D 1TIKA 4Q01A 1Z0DA 2W2QA 3KVOA 1DPFA 3DGFC 3MNFA 1WR8A 2ODBA 3IE0A 3IJRA 1M34E 4X93A 4O1MA 4FFDA 3NC4A 5FPPA 4OY3A 1UC5B 1Z33A 1XN1A 3C41J 2VJDA 4UARA 5DNYB 3NM6B 5MDHA 3JY6A 4PC3A 4MDHA 1G6OA 3UICA 4EJMA 4YDSA 1COWA 2W2PA 2VTKA 4JB2A 4L50A 2IZ0A 4GLFA 4IF6A 1I4LD 3ROPA 4MW7A 1AKQA 1VCOA 1W2WB 3EODA 5I01A 1RD4A 2WSMA 3CZQA 4TT3D 1ZD9A 4UMFA 2GCGA 1HT3A 4G0NA 1CR4A 4UBIA 1EIWA 4OFBA 5C5EA 4YIHA 2WWWA 9ATCA 2ZR7A 5JU6A 1QM5A 1BS1A 2A88A 5FA8A 3QFCA 1C3VA 4PANA 4PO3X 4LJLA 4Z53A 4TTIA 5BUCA 2QMZA 2FSPA 5CVEA 3U48A 1CIJA 1EG2A 2RGEA 5EHQA 2A9JA 5EPEA 4OH1A 1DC8A 4MA4A 2RHLA 4LQ4A 2FJPA 2D0IA 4X63A 2IIBA 3NJ4A 2G6TA 1P1HA 1VLLA 3HO6A 4HS4A 4TYMA 4QFMA 3S68A 3W04A 1YZUA 3DBHA 3KYCA 2D13A 4TVKA 1WXHA 1XI2A 4U7GA 1BG6A 3E1SA 3WIBA 3WDKA 4KKVA 3T38A 4YMIA 1Y1LA 2O7VA 5G0UA 4RVNA 1RJWA 1I5EA 1GGHA 1VKNA 3MWEA 1YR7A 5SYAA 1T36B 4HQLA 4JU8A 3RIXA 3WIOA 3GEDA 4ZAZA 1C1XB 1EXDA 2BL4A 4TXJA 1Z8DA 4W1QA 4ED9A 2YFQA 2VBCA 3PLRA 4LK3A 4EG4A 1SCBA 1TT5A 2BISA 4E32A 1CYDA 4HFMA 4QOEA 2H17A 2ZG6A 1BCRA 3L49A 4YAOA 2RH8A 4O02B 1CUCA 5CDFA 3FN4A 3X3HA 1PJ8A 1GJRA 1QLJA 4MICA 5A62A 1MPTA 3WSVA 3AUYA 5AI9A 1LF0A 3S5UA 5EMNA 3UWMA 2O3UA 4AXBA 3AOEA 5C80A 2NZWA 3B85A 4LC0A 5AXDA 2DCUA 3H42B 4O08A 4RULA 3BEOA 5FUMA 3CRW1 3A9TA 1F7UA 4EJSA 4O4LA 1WZIA 2D4HA 1WUHS 3OHSX 2V6BA 4LK2A 3OZBA 4PSVA 4BGEA 4LYEA 4FFWA 4BNGA 2BEWB 1VL8A 4Y67A 2FWBA 4BFSA 4K8OA 3ZLUA 3ZHQA 4CBVA 1E1LA 5DTQA 1ANKA 1AHPA 1N34B 1EVKA 2P9EA 3ZE6A 4XYLA 1VSQA 2AMJA 3OLYA 2PAFA 4JJ8A 2WB2A 5K9ZA 1OAAA 1OYVA 1TYCA 2RC5A 3NALA 4LCJA 5C4MA 3WJ1A 1NNEA 1XLTC 1NY5A 3RVBA 3DMTC 1JQDA 2QM3A 3GFVA 4ZJPA 4KQGA 5DJ5A 3TFQA 1V3QE 1L4NA 1OU4A 3JQ9C 4A5SA 3L4BC 3GI1A 3DT9A 1CS4C 3DVAB 2P67A 3ROKA 1OZGA 2FP4A 3O38A 5GQSA 1WPXA 4KUGA 3B3AA 1PG5A 2HKIA 1AB6A 3L7DA 1ZNZA 3NTLA 1CYEA 3EUEA 4WJLA 1HEIA 5IFKA 2YTZA 2KPOA 2GM3A 2YXDA 4AUNA 2WY2D 3C5WP 3CC8A 2FX3A 4XUCA 1QBKC 2D74A 3AYXB 3DMPA 3JYOA 1MXFA 4LMRA 3E15A 3GNLA 5AJWA 4B6EA 4D4MA 1JR6A 4RCYA 4DRXA 3MCZA 2X0KA 1V3TA 3FLBA 4MGEA 2RHCA 3LS2A 3OJXA 3C6ZA 4TL6A 1UFQA 3T7IA 2FWPA 4H7IA 1E4EB 4NDZA 4WAUA 3ER8A 4KAJA 4TTTS 5EFZA 2C4NA 2ZSEA 4ZU6X 1FX0B 1ELOA 4RS4A 2GKGA 3R3HA 2IX9A 5JADA 1R16A 2RE8A 1U2GA 2JFFA 3C6XA 1NQOA 1U81A 3I12A 2RHWA 3UUWA 4QUDA 1I6MA 2JI8A 4CQLB 4BMCA 3HR4A 3EPJA 1T4BA 1X1BA 3K1ZA 1G4HA 4P6VF 4CI9A 2UKDA 3HFGA 1WSDA 3PHCA 1DS6A 4CF4A 3ZHSA 2HEIA 1ESNA 4NZYA 4RU1A 1H93A 1PYDA 3T3HA 2ACEA 3NTOA 4CU2A 3N0WA 1VSBA 3KR1A 4D6PA 2OD9A 1JHPA 3HUUA 3DE6X 1EE9A 1TK9A 1KO8A 1VOTA 3JZAA 3DDSA 3LT4A 1YVDA 4NU5A 4P3XA 5B2ZA 4AAYA 1XNRB 4JBYA 4RW0A 4RTLA 5JISA 4KIJA 3V8NA 5DM70 1DC6A 2I9PA 1JWBB 4MQ6A 4UDNA 4BS9A 3LGXA 5HF6A 4HAXA 4NATA 1IY8A 4C7KA 3ADCA 1U0TA 4LZOA 3BQMB 4HEA1 4GI5A 3FPFA 5D87A 1NN5A 2ZYGA 3AEXA 2OXIA 2VI5A 3RI3A 3BA6A 3WQSB 2QUZA 2WWXA 3VR1A 4LSZA 1X74A 4M9ZA 5CFLA 2ZTMA 2ZDHA 5FLKA 1AQLA 1EZ1A 4B8YA 1F9EA 2W2KB 3MB8A 4TRJA 1T1JA 1VG9B 3HN6A 5CBPA 5KNBA 3GPLA 2OV3A 1RXCA 3X1WA 5F2OA 3OIUA 2ZJ1A 3DC7A 4QGAA 1Q0ZA 3CRMA 3DO6A 1LLDA 4YJHB 5JAPA 1OJ7A 3AR2A 1SZPA 3MA0A 4JLPA 3PQ4A 5A3SA 5CD1A 1YR2A 5AW6A 4ETWA 1S3GA 2BD0A 2GEBA 4KVGA 4RTOA 3AVXA 2Q0HA 5GAJA 3NWBA 3I53A 4KGZA 1C30A 4N54A 5K6AC 1JL3A 3G9UA 2QVZX 2XZOA 3PWKA 5EHXA 5BN4B 4WI1A 5A4MS 4HGQA 2XA1A 1EUQA 4WTOA 3CY6A 3A6GA 3G17A 4TS3A 3RCBA 1G8FA 1PUIA 2OLKA 1L5ZA 1R64A 1G1MA 2G1KA 3EUFA 5F4BA 1Y3BE 3X43A 1WUJS 1RYNA 5FPKA 1KOJA 2V97A 3FVTA 2ID4A 1KU6A 3KKMA 4K6KA 5F5NA 1KARA 4JK3A 5JMPA 3T7KA 2EZ9A 2FFBA 1ST3A 4I50A 4ZZ3A 5KTPA 5H1YA 2Q6OA 2O2SA 3KE8A 4YUWA 3L7AA 5ADVA 3IERA 1XP5A 2ZYWX 3EIFA 2XGJA 3E58A 2UYQA 1WSBA 1CY0A 4ZTBA 4NMLA 1ZN7A 5DFAA 1QVZA 1G20B 3LXRA 3MSXA 4GZ3A 4HLDA 3PXDA 4UTVA 3I6YA 5BT8A 2O59A 1ID8A 3KSMA 4BLOA 2Y93A 4TLCA 5EGNA 4IIHA 5CK4A 2GXAA 3QITA 1PUXA 4V1CA 3E22A 2BUCA 4OA5A 4PLYA 4UUPA 4WL0A 5KKCA 2AKEA 1S9HA 2FZKA 1AUXA 1T5DX 3NVDA 2ZIXA 3IUYA 4BNUA 4BMZA 2GK7A 1BGWA 4RMIA 1TK3A 4HSGA 3G0CA 1ZXXA 2GH1A 1H69A 1UINA 2OQIA 3C7KA 3TL6A 2P2NA 5BSMA 3FCCA 1H2ZA 3F3SA 4BO0A 1NAHA 6NULA 1XPRA 1W5TA 2J45A 2P9HA 2I7VA 3WLEA 1K5GA 4IH1A 4GQBA 3IHLA 5EIFA 1PTKA 1UL1X 4AMGA 1XTQA 1EU1A 3DCNA 5I9MA 5HPYB 1ZM2A 1D1QA 3EFOA 4KXMA 1RRCA 3D5TA 3S7TA 3W3ZB 2AFVA 3ETGA 1RYHA 1GL3A 3OX3A 2FMXA 4S05A 2XDAA 2J4FA 2GPTA 1MO6A 1RHKA 1YDHA 3F97A 4CMEA 2IYSA 4V03A 2DY0A 2ZIWB 4UPDA 3GUYA 4NAVA 1YL6A 2BC9A 4RZSA 4E11A 2WUFA 3FYUB 4MVWA 5B57C 4DV0B 1ULZA 3AMVA 5LZ5A 3QHAA 5B64A 4IRMA 1R0SA 4ZGBA 1SCIA 3HNRA 4WOCA 4Y2XA 3WWPA 4URXR 2A0FA 4PQYA 1Q2XA 1DXOA 3JQGA 3EZ9A 3AB7A 3DEKA 3OBBA 4X54A 4XB2A 1SBZA 4BO5A 3F8SA 4ALJA 4XARA 3WLJA 1R6AA 4EGJA 1GT6A 1Q1AA 4KBGA 4MTCA 1JIVA 1U8TA 3OC6A 4XOUA 4JITA 2Q6IA 3H4VA 2YIDA 1JEAA 1VJ5A 2NZVG 1LLUA 1O0CA 3HLYA 1UZUA 4CIYA 2EFEB 2B35A 1D7AA 4NU6A 5E4YA 1P2BA 3B1XA 1RBYA 4LS3A 5B6PA 1ZYUA 3L7LA 2PKXA 2HDWA 4GOXA 4K7JA 1RIFA 4RFLA 1EEHA 2OP1A 5BQ3A 2YZ2A 1VMEA 3TGLA 5IM4F 2QU7A 3OWHA 3PUZA 4QO8A 3I83A 4BNDB 2D5AA 4OX9B 3ZPXA 3JD4A 4OREX 5CFMA 4NMWA 3RRZA 3HVKA 1D03A 4P4TA 1Z35A 3G8CA 4E5MA 3HO8A 1E0AA 4KIGA 1RQNA 4MUXA 2XKBA 3PFWO 5TMPA 2NQ8A 4HR7A 3VVLA 3O75A 4BNIA 4UNRA 1P2UA 2QUBA 4EBBA 4L0MA 3S70A 5KINB 5KKNB 3MN1A 3ZHTA 2XOKA 3KQSA 3UMJA 1FB5A 4KMOA 2OHIA 1XLTA 3C3KA 3HZHA 4V0SA 1GITA 2AG6A 4FGZA 2OAP1 2OPHA 4BE4A 4ASUA 4YUAA 2P91A 3SBXA 3UTCA 2AJLI 2I2FA 2P41A 2BGNA 4Q3OA 2J0UA 3MD0A 4PHCA 4CF3A 3U44A 2WIAA 3HABA 4HGNA 3EE6A 1TPZA 2GN2A 3G2NA 3ILYA 1JX6A 4KWIA 4PIMA 4C3ZA 1B6RA 2PD4A 3T8YA 5C8VA 1O0BA 3KZNA 3PDHA 1CDZA 4FZ3A 3F9RA 4N0DA 1SN7A 1W19A 4Z1MA 5CYGA 5IJ0B 1YB1A 4R51A 3CNNA 4NZNA 3ZJTA 3TJMA 1G7SA 5IXYA 3OZCA 1M3SA 1XAIA 1JHXA 3PPVA 3IGFA 1SD5A 2BI4A 2P4HX 1EJBA 4RS3A 1P18A 4UCQA 4US0R 5ALXA 1JFVA 2RDMA 1ZU5A 5C37A 3NAZA 1LDEA 5B1IA 3GCZA 4J75A 4RK0A 1IOWA 2OWEA 2VDWA 3KHKA 3W2IA 1I4TD 3WKAA 1JXOA 4YT2A 4EYEA 2C07A 3G2KA 3LGSA 4FYPA 4X7RA 4YRFA 1NHWA 5DN9A 2CB9A 2I8AA 4FYMA 3GJSA 3UG6A 2WUEA 3KOYA 4N3GA 1X2EA 4FEEA 2Z6UA 2ORIA 4ZYYA 2VNKA 3SXUB 1JF8A 2BEUA 1PJLA 1KRHA 1YNOA 4CL8A 3LT1A 1SVUA 2X58A 4QYIB 1VSTA 1DT5A 2IEBA 5IBQA 3RC7A 4AKGA 1ZM9A 1KEUA 2PIAA 4MGKR 1JHZA 1GTMA 3IFSA 4PXAA 5A3QA 3ER9A 3OEYA 1ZRNA 2B30A 4QGSA 5IYZA 1DQSA 1E4YA 2D7CA 3C1UA 3KTAB 4FLFA 1WB5A 3ZHOA 3L4KA 1FLVA 2BEJA 1WMFA 5LQMA 3DUFA 4TT3A 4EHKA 2BMVA 3SDSA 3SF8B 4MZXA 1LK0A 3DTYA 4LJRA 3IHTA 3EY9A 1FNSA 2G04A 4X00A 2IYTA 1ID1A 1XCGB 1X14A 2PYDA 3TR5A 4E33A 1B43A 2O8EA 1CXZA 4DPMA 1QHSA 1CE8A 2WILA 3DFKA 3CCFA 2VH1A 5JCXA 3KPWA 4HPXB 4DUZB 5C0OE 1VZ2A 4YAEA 1FBNA 3GJZA 1HUQA 1U6KA 2B69A 2RH9B 4IUCS 4GUDA 5F3RA 3OZUA 4I0WB 4TQAA 4RPKA 3RWMB 2B6NA 2XJ4A 3ML1A 4MKGA 4OFXA 3KZKA 4X97A 1S5PA 1ZSNA 3WGQA 2XRMA 5FOVA 3JQ7A 1FXSA 3HEAA 2H2FA 1VHJA 5D51S 2OXTA 3T5CA 2JBAB 3G68A 5K99A 4H9GA 4EFLA 1KZ7B 4ONEA 1BVRA 1KY4A 3LLMA 3RYTC 2C8VA 4ZOCA 4ZV7A 3GDHA 1KERA 3FTQA 4NFYA 2ZBEA 5JCOA 4X24A 4RGVA 4YV1A 3UNXA 2ECKA 3IOBA 4P38A 5CXUA 3BHIA 1WNTA 3QMMA 1EDEA 5CU7A 1WG8A 2PU5A 3X2SA 4LZAA 2Z6QA 1NQWA 3HR7A 3USZA 3W2FA 1EK6A 3ZE0B 1W36B 4OCZA 3B52X 3QW2A 3AEUA 4RVSA 5KVAA 5LLDA 4M9CA 4QJIA 1YE5A 3WLMA 2ZFUA 1H2BA 1MC5A 2R0QC 5AVWA 3HCCA 5FYQA 5TT0A 3EQ6A 4Q3NA 4X90A 2GYWA 1GN8A 1T6YA 4GRDA 2Q0SA 4HDRB 4R8KA 3UVEA 3VRHA 3ZW7A 5KQGA 4ZEOA 1E2NA 1UJ6A 1VYVA 4FMCB 4HDKA 4KU4A 5LIPA 3FOCA 2EKDA 4FZ5A 1A5AB 3FIUA 3ZZMA 1QH1A 2EP5A 2ZSDA 3EH1A 4WUVA 2FZ4A 4DTCA 1SURA 2FFHA 3X1YA 2H3EA 1QP8A 2IUFA 1JEQB 4JBHA 1YBAA 1NWCA 1XRQA 1YT5A 2B1RA 3PR2B 4Q66C 5ALMA 3T5GA 3WRYA 3FFWA 5KYKA 5JAOA 2CJFA 3N75A 4US2R 4MQEB 1QK4A 4NZOA 4E12A 5IBCA 4ZVQA 1NJ5A 3RDPA 5IAKA 3BHNA 4DL9A