3Q9LA

The structure of the dimeric e.coli mind-atp complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
b'ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septum site-determining protein minD
publication title Determination of the structure of the MinD-ATP complex reveals the orientation of MinD on the membrane and the relative location of the binding sites for MinE and MinC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle, hydrolase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q9lA00
3I62A 4LPKA 4TQ9A 3ZLJA 2G1KA 4P33A 3RRYA 1AGPA 2GXUA 1TF5A 2XTNA 3IIMA 4UNQA 5LBIA 4GZMA 1HY3A 4YONB 2XXAB 2CK3D 4B3FX 1J8MF 4Z51A 1RJ9B 1AS3A 2AWNA 5TDHA 3U4QA 3DO6A 1IJEA 2A5YB 3CWZA 3C5HA 3IHLA 3BH7A 4MQBA 3BK7A 5TV2A 1YZGA 4TLCA 2ZR7A 2ZAMA 1MO3A 1YZQA 3L2OB 3CZPA 4X8OA 1WXQA 3KUCA 4C0AC 4HUTA 1W0JD 1O3YA 2ASEA 5FBRB 1U8YA 2ZUBA 5SZHB 1D9XA 2WPDA 2BMJA 1IN8A 3ZVRA 5C46F 3H1TA 2JJ1D 4FCTA 4DSNA 1ESMA 1Q22A 2OM2A 3HU3A 2Z83A 1VG9B 4O2RA 1H8HD 5L3SB 2OHFA 2O8FB 2ZSFA 2G88A 3QKUA 2ZJ2A 2NG1A 4BFTA 4BLOA 3EZFA 2EU8A 3Q8XB 2ZJAA 2BCGY 3MGCA 1BH2A 3A4NA 2ZI5A 1S4QA 3LBHA 5EQTA 1KMHA 4OKSA 3IPYA 2P2LA 1DAKA 1CR2A 2JA1A 4C0QC 4BLPA 3UG6A 2ZI9A 4I81A 4QBIA 4QBGB 3VTKA 1ZRHA 2BM1A 4Q4AA 3GJ6A 4MGYR 4MKIA 5A0FA 3WNCA 5TARA 1BS1A 4C7OA 5GJCA 2ZRMA 2ZEJA 1C4OA 1DAHA 4OI0A 3UWOA 2P5SA 3W34A 1FX0B 2QQEA 4NYJQ 5EUQB 3BD9A 3LNCA 2JEOA 3SBEA 5BXQC 5CLQA 1EWQA 4G3XA 1E2LA 3PFIA 3VR3A 3FFAA 1KNXA 4G0NA 5KNCA 4UJ5A 3RNLA 2IEYA 3L0IB 1WDTA 2FZLA 1X1SA 2BBWA 1OHHA 5DYIA 3SC3A 1Z0JA 2IXGA 4XH9B 3SJCA 4K46A 3EW9A 1S0UA 1W4AA 2ZVPX 4RD6A 2XZPA 4Y0VA 5FBQB 2F1RA 1YZUA 3LO5A 1E2FA 1N5JA 4M1KA 3RS0A 2B21A 4AY2A 2FFBA 2WZQA 4QBFA 3M4YA 1ZM9A 5KYKA 5FOTA 1KYIA 2ZE6A 3IEUA 4I1VA 4PO8A 1CF4A 1DVRA 1ZD8A 4JVSB 1G3MA 3D31A 2EWVA 1SULA 4F4IA 4PC7A 2F7SA 1WBBA 4S2EA 4JYBA 4N3NA 3K0EA 3LRPA 4HATA 3K70C 2OFOA 3LH5A 1YE8A 2WAYA 1XEWX 4MYTA 5E7JA 2JIZA 1G8GA 1LB1B 3RSOA 2VL7A 4HLQB 1CIPA 4HZUB 1EESA 2QMUA 1AIPA 1W36C 4GZLA 2OT3B 2IBMA 2YNMA 1QVRA 2J7KA 4AWXA 3ZVNA 2VLIA 1IY1A 3E2IA 1U9IA 3QXSA 2GKSA 1SVKA 3BJIC 2JLYA 3K9HA 2OILA 3RS3A 1G3QA 4Q9JA 2QM7A 3AVVA 3A4LA 3T12A 1DAIA 1ZU4A 3AKYA 1XB2A 2A2ZA 4BUJA 3TW4A 3GEHA 4LJ4A 1J2JA 4RD4A 2XB2A 3NHAA 3CNLA 2BEKA 4QGHA 4TLEA 5EXPA 3TGPA 4Q9LA 2XX3A 1VCOA 2WKPA 5FBWB 3QQ5A 1KDRA 2R6FA 4HEJA 2NMVA 3LW8A 1NLYA 4IVPA 5JI2E 5IRCD 2H92A 5SZKB 4E09A 4LDJA 3W6PA 3ZVMA 3GD7A 3UANA 3KKQA 4LUCA 2PL3A 2WKRA 2XNSA 2ERYA 4A0FA 4CT5A 3KB2A 4QC2A 1KY2A 1KO7A 1XZPA 1RRGA 2EWWA 1WB9A 1RE0A 2N42A 3ASYA 2IT1A 2FNAA 1IBRA 1MV5A 5E3HA 1UAAA 1F48A 1W48A 2CLCX 2ZRHA 2DBYA 3CRVA 3BFXA 3O8DA 2DFNA 1X86B 4GL2A 4BLQA 1E79D 3ZJYA 4BZPA 4IRUB 1TEXA 4ON9A 3PEUA 1II8A 5GJBA 2CL6X 3GLFB 4FWTA 1HYQA 4PC3A 1RIFA 1JXOA 5HR5A 1R7RA 1XCMA 2WVJA 2CVHA 3EA0A 2CVFA 2C99A 1DS6A 4RKEA 3C41J 4CEJA 3GFTA 1TL7C 1N6NA 1NLZA 3LAWA 1FFHA 1ZCBA 2ORWA 1SKQA 1OFTA 1NBMD 2FEMA 2RGNA 1E4VA 3T61A 4P4SA 3R7WA 2PEYA 4DUGA 4B33A 1OYWA 1NL3A 1IN6A 3GEIA 2QRZA 2H5EA 4JMPA 2VA8A 3U2QA 1KNQA 2ECKA 2ZRDA 5JWOA 4IFBA 4JVNA 1S8FA 4UJ3A 3VMFA 4PSKA 3P4XA 5H1YA 1SXJD 1L8QA 4AKIA 2QQ0A 4PHFA 2UKDA 2G0TA 3S1AB 3EPKA 4MGZR 1SKYB 2RAPA 2G3YA 3K0CC 2WSSD 3QKRA 3T06B 3SJBA 1FNNA 3EIQA 3PIRA 5FL3A 2ZRLA 4PC6A 3CR8A 5KO2A 1AA9A 5JRZA 1US8A 2YYZA 3FGNA 4M9QA 3TJZA 1ETUA 2HF9A 4EFLA 2W2VA 2ZSAA 1Q44A 2MSCB 1G8FA 5DI9A 5JCZA 5KDOA 4B2LA 2LKCA 4LBVA 2NO1A 5E7IA 1QHIA 2CCJA 2RGCA 2Q9BA 5B2ZA 1KO5A 3KTAB 3FDIA 3PEVA 4ZCLA 1E94E 3KUDA 4FD2A 2HLDA 4PC2A 4UNRA 2GCPA 3UPUA 1E2EA 4PHHA 2IYWA 2W00A 4PSVA 1AKEA 1LY1A 3WXMA 4OJQA 2FA9A 3U7FB 2ZANA 3THWA 2O8BB 4DLSA 5DI3B 4GSYA 1YZTA 1NMYA 1T8UA 1G17A 1XFAA 2GEVA 2A5JA 4BZXA 3L8ZA 3TNFA 1DAGA 4C0BA 4PZZA 2GZAA 1MRNA 5EP4A 3G0HA 2CBZA 2OV2A 5JCPA 4W9MC 4NCHA 1NG1A 4LJ5A 2GRJA 2WJYA 4WAUA 3I61A 2QAGA 3QSYA 5C4GB 2IEZA 2GHIA 2A3RA 4LWZA 5FBLB 5HTKA 4CDGA 3Q72A 2V6JA 4DWJA 3O8CA 2HYDA 4LYAA 4FMDF 3KXKA 3QKSA 2FMXA 4MUAA 3IIKA 1GNRA 3CM0A 4NCJA 3SU8A 3B78A 1NP6A 5CK5A 3THXA 2YWGA 3MG9A 3RSLA 4B76A 1OLOA 3BOSA 3QJYA 3VAAA 1Z2CA 1XU4A 2ATXA 1E0KA 1DG3A 1QG2A 3AF0A 1ZYUA 2JLVA 2NPIA 4I1SA 3VFDA 4DT1A 4DB2A 3SDZA 1IN7A 1P2VA 2VRWA 1GKUB 1E0JA 2VHJA 4L9WA 4CEHB 2QE7D 4B73A 1PUIA 1ZNWA 4MYCA 3QENA 5BN3A 3X1DA 4HLUC 1T6NA 1QHSA 3OEED 3SR0A 2J0SA 1D6JA 2OUKA 4KCGA 521PA 1GKYA 1Q1BA 2B92A 2AXNA 3NEJA 2GJ8A 2ZS8A 4IOJA 3WNDA 3X1ZA 3CKLA 3E70C 4M21A 4AK9A 4TL7A 1S1CA 4MKGA 2BWJA 3RAPR 2EYQA 1W4BA 1FMLA 2VO1A 1P9RA 4ARZA 3TUZC 2GZDA 1KK0A 4OHZA 2ZSBA 2ZJ8A 2PMDA 2VHTA 5AJXA 3R8FA 2D06A 3OFND 2GBLC 4EJSB 2VP6A 2CL0X 2RGEA 1OT3A 3LQRA 1BYIA 4TYWA 3WBKA 2AK2A 1T3LA 2XOKA 2IS1A 3TBKA 1E1RA 3B13B 5FFMA 1ZP6A 2ZVQX 3EIHA 2ZI7A 2W2TA 3U3KA 5EUMA 1S9HA 4M2LA 4DBLC 3EPJA 3DKPA 2VP4A 4EKDA 1R0WA 2PZFA 3FKSD 3A36A 2VP9A 4ZV4A 3H4MA 1WA5A 2RGBA 1EX6A 3VU9A 4KBGA 1DE0A 3RRMA 3UMFA 4YLGA 4CW7A 1JNYA 1KKLA 2YC4C 3OF5A 1E0AA 3LX8A 4GP7A 1EK0A 1NVXQ 1MO4A 4M1YA 1G8YA 4EQ6A 3BE4A 1W46A 3EWAA 4WOPA 3WYFA 1MT0A 1OFUX 1COWA 1KMQA 2C5LA 2DY1A 3NH9A 4LBYA 1E2QA 1NKSA 4LYHA 4R2HA 3T35A 1WRBA 2VQSA 4PHTA 1G7TA 3ZS9A 1XEFA 4CIDA 2QBYA 1LVGA 4DLZA 4QKQA 1KDOA 2ZYTX 2HF8A 2YKGA 2D4HA 5KSPA 3QUSA 4TMXA 3H0KA 4Q4JB 1BYUA 3ZVLA 2QI9C 4OK5A 2WWIA 3PXGA 1FNMA 1XMJA 2GZHA 1QHXA 4B34A 2ZSDA 1UEJA 4I1UA 2OG2A 2ZU6A 2VP2A 5EP2A 1CR0A 2QSZA 4NCNA 1U0LA 3FKQA 4TZ0A 1S2MA 1E9FA 5HKKD 1P73A 3BS4A 5FOSA 4EPXA 2EFDB 2R65A 1QZXA 1JECA 2ZM5A 5TB5A 1KZGB 2IUTA 3V00A 4A8JA 5L3QA 2XOKD 4QHTA 1XEXB 2OCAA 1DOAA 2Q3FA 1GAJA 3K0FB 2NQ2C 4G5SA 3U7HB 4JKIA 1RVDA 4W7SA 3CX6A 1E9BA 1GVNB 4QG7A 4LCBA 1E99A 2QENA 4B3GA 1UBCA 5LB4A 2J46A 4KO8A 5C4MA 2HJGA 5FR2A 2V1UA 4EUNA 3PR1A 4PPGA 4DLWA 2W6ID 5FPKA 4V0ME 3FOZA 4IDHA 4PAOA 5KPJA 4XSHA 1CJVC 5JBQA 3B5JA 2IYVA 4BECA 3KJIA 4BRWA 4HAWA 3FE2A 3QF4A 4TSFA 2J0QA 1TUEA 2IS4A 2VTKA 1UADA 3HDTA 1IY2A 3K9LA 2XEXA 3CRRA 3SJAA 5EE5B 4BFVA 3AP2A 1NVWQ 4LGMA 2ZRIA 3SEAA 4FMBB 2QTHA 4F4JA 3Q9LA 1R0XA 4MGIR 2J0VA 4BPBA 3FHOA 2ZJYA 2IHYA 3EX7C 2O0JA 3IO5A 221PA 3TK1A 3NBZC 5J4LA 3QXXA 4OQNA 3O8BA 1NSFA 1KY3A 1RYFA 4D80A 2ERXA 4NYMQ 1W0KA 2RGAA 3QXHA 3VHLB 2CEAA 3MAAC 3GCGA 4U5XA 4NP6A 1XTKA 3GJ0A 4DCTA 4KJZA 3PENA 3TVTA 2JAQA 2L0XA 4Q1FA 1E2NA 3NXSA 4Q7KA 1ZC4A 2QGZA 3FMIA 2RGGA 4HAXA 4LHWA 1Z6AA 5FOXA 3FFBA 1JR3D 4KHZA 3GLFE 3B7GA 2O8CA 5ELXA 4FN5A 3SHFA 1SGWA 1CRPA 1N6LA 2REOA 2OXCA 3I32A 1E9AA 2OCBA 3FMPB 4PFSA 1NVVQ 2V4ZA 1UKZA 3OEHA 1KI6B 4AKHA 1E2HA 2H8KA 2JLSA 1KO1A 4GOKA 4LOAA 3GLIE 1GRQA 5UKDA 2JDIA 2KBFA 4DSTA 4KBFA 4WW0A 3T15A 3B9QA 5CB8A 3TRFA 4I99A 4NYIQ 4QNMA 3EARA 2X2FA 4XWKA 2Z43A 1J7KA 1GL6A 3ZIAA 4RZ3A 2OEPA 1G5PA 2YHSA 3C5CA 3UATA 1GOTA 3F3YA 1R4AA 4Q4HB 1EXMA 1Z22A 4BFWA 1YR6A 2GETA 3SFVA 1CRQA 1KGDA 1SZPA 3CX8A 3GLGB 3OAAA 3AVPA 4D0GA 4JL8A 2IYUA 3QE0A 2ZI6A 3K9GA 1H8ED 2V7QA 1AZTA 2J7PD 2O0KA 4G5QA 1A82A 5FUVA 1KHTA 3ND8A 4KSBA 2TMKA 2PZGA 3HP1A 4JJKA 1Z6XA 1NMXA 3HU2A 5CK4A 3SHWA 2V9PA 1JQJC 2RHMA 1A4RA 2VHCA 5G40A 1I2DA 2GF9A 4M1OA 3H84A 1GSIA 5DYGA 2CHVA 2CJWA 3AVWA 1NKTA 2KSQA 3PG5A 4HZIA 4EJSC 1G20E 2H17A 3TIFA 5K8TA 3GJ4A 3MLEA 4QL3A 3HR7A 3DOEA 2R62A 1T3SA 5F98A 1FP6A 3GP8A 3UG7A 3C14C 5LPNA 2W2XA 3TSWA 1CJTC 2ZITA 2BBSA 1UDXA 2ZRFA 4P31A 4HB3A 5DHAA 4A0RA 4MDFA 1Z08A 2BJWA 2MSDB 1IONA 1EGAA 1GFIA 1OIWA 2CK3A 2GEUA 1GRRA 2WBLC 4HUQA 3W6NA 1D5CA 3E5HA 2J0UB 2NZ8A 3I72A 1A5TA 2GK6A 4Q03A 2Q21A 2QA5A 2ZREA 4CT4B 3VNUA 4B48A 1LTQA 2H16A 3TE6A 2ZRAA 1QDEA 2CE7A 3GFOA 1VPLA 2NIPA 3LW7A 2E9SA 1T3HA 2JLQA 3P27A 3D6TB 1W0JA 4CYMA 3K8YA 2ZJOA 1RFLA 2AKAB 4IFEA 2ZUCA 2BVNA 4D4KA 1TMKA 4FXPA 5LB2A 1RZ3A 4XWAA 4WIAA 4NYMR 5AWFC 4NCKA 3WHKA 1F2TA 2JJ1A 4RFSB 2C2HA 2C98A 3I92A 4P4TA 4CVNA 1DAFA 4C2UA 4LZZA 4EPWA 2VF7A 1Z0FA 2FGKA 4JLAA 3BBPA 1E2JA 1J99A 1M6NA 4G5RA 4ZI3A 3I8SA 1F3OA 4AYTA 2O8EB 1KSGA 1KI2A 3K70D 2D7DA 3RWMB 1KO4A 2OAP1 1E0SA 4OL0A 3NC0C 2PX0A 1EFTA 1C1YA 5C1BA 2WKQA 1IAQA 4G1UC 3PUXA 1TADA 4B44A 1YZNA 1JB1A 2QM8A 1AS0A 1M7GA 1AZSC 5AJYA 2ZE8A 3KQKA 4C0JA 4BRUA 4W5JA 3JZAA 4GPTA 5DN6D 4M1WA 4QGAA 4RCZA 4LX0A 2OFXA 2ZJZA 1P60A 4ZDKA 4ZI2A 2GA8A 1RRPA 4U7DA 4KFRA 4OHVA 4W5WA 1S3GA 1DADA 5KDLA 2AR7A 4JLNA 3Q7QA 3GLHE 5FTKA 2XNDD 5FR1A 4YQFA 4AURA 4XVUA 5JMTA 1JAHA 4F38A 4OK6A 1T5LA 1CKEA 3BXZA 4II7A 4P3YA 4IEIA 2A5GA 4S35A 3UXMA 1X1RA 3QOFA 4US0R 2QAJA 3WY9A 2R6GA 1R5BA 3GJ5A 4Q4LA 5FPHA 1PVOA 3ADBA 2EFEB 3H2YA 4XD7A 1RW4A 1XXHE 1GWNA 3IPXA 3K0AA 2Q6TA 2REXB 2F9LA 4JS0A 4QFMA 4Q9HA 3CIOA 3TUIC 3U4QB 4EPTA 1XMIA 5GVRA 3LV8A 1DBSA 1Z28A 3VR1A 2HXSA 5L3SA 4LPSA 5KNDA 2O8FA 2ODWA 1R8SA 4OQXA 1UBEA 2FSHA 4MKFA 3W8NA 3T5DA 1YJ5A 1XTIA 5BWMA 2VBCA 4NDZA 4CF7A 2JLUA 4TQUS 3M0EA 4DDWA 4DRZA 4F91B 3RC8A 3K09A 2WJIA 4RVCA 5JLJA 3GJ3A 2C04A 5BYJA 1DEKA 1JEDA 1RKBA 4KI0A 1RPZA 2D2EA 5BW8A 4J0QA 3GPLA 4M9ZA 2W0SA 2MMGA 2LKDA 2AN9A 3F5FA 5B64A 2FPKA 1ZM2A 3RYTC 4IEEA 2C8VA 3R20A 3CZQA 1FX0A 2ODNA 2YV5A 4WZ6A 5FTJA 3REFA 2CCGA 4HB4A 4UNPA 1P6XA 1EFCA 2GNOA 4KXFB 4YXWA 3ZD7A 2FEOA 3QXJA 3AKDA 1KMHB 3RANA 5JEDA 4M9SA 2JGNA 4PXAA 2JJ8A 4GNKA 3AM1A 2NZJA 1KI1A 1OXXK 2QGNA 1E2DA 1W44A 1MOZA 4LYFA 3AF2A 1Q0UA 2GXSA 3TMKA 3B2EA 1BMFD 4DLUA 3EXAA 4XD7D 1OW3B 3C16C 4JVLA 4MUBA 1VYVA 3AUYA 4JLOA 4Q21A 621PA 4NKRA 1Z0DA 1A1VA 4JKYA 2JLWA 4Q48A 4FMCB 3FB4A 1ONBA 3CNNA 4LV6A 4HLUA 3U44A 2ZYWX 1HQYE 5AJVB 1XD9A 3B8HA 4K8OA 1G16A 4YMTA 1KJWA 5CB6A 4QJ5A 3L0PA 3KQUA 5EJEA 3BORA 3DMDA 5FPYA 2ONJA 1E79A 1TUIA 2IA5A 4Z54A 1B23P 5HCNA 2G83A 3CR7A 4JLJA 2XAUA 1EX7A 2FSFA 1X6VA 1JXMA 4Y0AA 2CLSA 2OSBA 1XTQA 4XVRA 1IXZA 2GBLA 5KSZA 4XTRA 1VIAA 3DM9B 2NO0A 4WXPA 121PA 1IY0A 2BEJA 2OFWA 3ADKA 4DLTA 1N5KA 1CULC 1Z07A 4KLZA 4A2WA 2A5FA 3HYRA 1LV7A 4JL6A 821PA 5DE3A 1NBMA 1VG8A 3VX3A 4BEJA 4HDCA 4ZDJA 1R5NA 2QY9A 1KKMA 1TPZA 3C8UA 4ABYA 2VPPA 3AVOA 1U8ZA 1KOFA 1WP9A 1GZSA 1GL9B 3G82C 4YXWD 1OPXA 1MR3F 2ORIA 2BKEA 5HZHA 1SXJA 5L8VA 2GXQA 2XGJA 1RC8A 1OE0A 2P6NA 2AXPA 2FZ4A 3EASA 4KV9A 5KUTA 2WSSA 4E5UA 4FI3C 2QP4A 2ZXUA 3W9YA 4LJ7A 1UF9A 3KXLA 2GK7A 4A2PA 1U8AA 2V54A 5J4KA 2OXRA 2EFGA 1KK1A 3DKVA 3HJNA 3P4YA 3CF2A 4IOMA 1Z3IX 1G4AE 1NJGA 1T0JB 4B3XA 1F2UA 2GWHA 3RS2A 3EIEA 3ZS8A 4OQLA 1TU4A 1YKSA 1QF9A 3SYKA 4EPYA 4XIGS 1ANKA 1FUUA 3RWOA 4IVQA 5JS7A 3L8YA 3IQXA 3KKNA 1KDTA 1DAEA 3LVRE 3TKLA 4DEXA 4NHOA 4NYJR 4DDTA 2BMEA 4PQYA 4C9BA 3KQNA 1XP8A 3ONWA 3ZH9B 1OIVA 2CHGA 3LBNA 3AF4A 5SZIA 1W5SA 1KZ7B 5JRJA 2C96A 4JBYA 2BIFA 3GLGE 3GLIB 2BC9A 1L2TA 1N6OA 3KFVA 4QM7A 3KKPA 1G8HA 2F55A 4TTRA 5HZKA 5AJZA 5CJ2A 5TXGA 2PCLA 4OI1A 1II8B 2D74A 2P6UA 3WYAA 2VSOA 3DMNA 3J81k 2YOHA 5H70A 1U99A 2PBRA 4NBSA 4LHVA 3MWLA 1XDBA 3IUYA 4HLCA 3BH0A 1VG1A 2C03A 1VIYA 2QPTA 5J47A 3B1ZA 4CEJB 5JJKA 2IWHA 4IJMA 4NL4H 1K5DA 3D8BA 4BZQA 1LFDB 2BV3A 4CEIB 4RZUA 1GTVA 2OLKA 2C9CA 5GJVC 2W83A 2FJUA 2I1VB 2QE7A 1IJFA 3MFYA 4WZBE 3PVSA 5E7MA 1A7JA 1TEVA 1W2HA 4IDQA 4LRWA 4MGKR 1VDZA 4IKEA 4XJXA 1TTTA 1JI0A 1SVSA 4C0KA 2B8WA 2GAOA 3T1VA 4ACAA 3OEEA 2GESA 5FOVA 3THOA 3UKDA 3N5CA 3AV0B 5EP1A 5KHOC 2Q0HA 3QKRB 5P21A 3WBJA 1C9KA 2YC2C 1N0UA 1VHTA 1TF7A 4Z1MD 2PH1A 3KTAA 4DC9A 1R5OA 1XCPA 2ZIAA 2HXYA 3U3MA 1X3SA 1YZLA 1W47A 1ZVQA 2ZYVX 1US8B 4DHEA 4LBZA 5JEEA 3N2EA 4R98A 1G7CA 2QUZA 2DHRA 2O8BA 5DI3A 3OFNA 1TX4B 1VKJA 1JBKA 3FHCB 3SNHA 2P65A 1XD2A 2RB4A 4LJ9A 4DCVA 3I5XA 4TYPA 3DM5A 1KAGA 1P72A 5CITA 3CX7A 4HDQB 4C3ZA 1KI7A 4QXAA 2PJRA 1PZNA 5FUXA 1GNPA 3CPEA 4V0OA 1PLLA 5DISB 1IN4A 2J59A 3DZDA 4F93B 2KI5A 3BFVA 3FKSA 4JYCA 2Z0MA 1TU3A 3M1IA 1KJZA 2ZS7A 2AL7A 1MO5A 3DPUA 1CJMA 4X8MA 1VMAA 2QL6A 3I8XA 4AYWA 3O8RA 4U02A 2J1LA 3OIWA 3P32A 3EZ9A 3OHMA 2ZSEA 3THYB 2H7VA 3DHWC 4TN1A 4CEHA 2ZE5A 4RD3A 5GVSA 2ANBA 5B58C 2W58A 3MD0A 4Q18A 4MKHA 3ZQJA 4OHWA 2WOJA 4GOXA 4D6PA 5D3MA 5JSZA 1Z8FA 4HLDA 3CH4B 3UMRA 2ZRPA 3LLUA 1P9NA 5B57C 1T4GA 5CDFE 2QG6A 3Q5EA 4DT1B 2GTPA 1J8YF 2J45A 1WQ1R 5AR1A 1MH1A 1UBFA 3GLHB 4ZDIA 4PC1A 3WP0A 1QBKC 4DXAA 1ZU5A 5HKKA 4DCUA 3W5IA 1GNQA 2IC5A 4B3CA 3C15C 3SE0A 4DIDA 3BERA 2GILA 1DO2A 3P1JA 5FPTA 5JS8A 4LJYA 4DDUA 2IX3A 1WBDA 1VG0B 5AJWA 1XXHB 2FFQA 2BBTA 1GG2A 3IQWA 5J40A 2PCJA 2Z5FA 1R0YA 4PR0A 2D62A 2FV8A 4M53A 4UQOA 3O47A 1N6KA 2IYZA 4LJ8A 1E32A 3UIEA 1NIJA 5JHGB 4CRWB 1FUKA 2W6IA 1NNEA 1P2SA 5CIQA 1DELA 4AG6A 1M74A 3TW8B 3TH5A 2ZPTX 4FIDA 2BOVA 2C9OA 2A5DA 4MH0R 1YU9A 5ANRB 2W6JD 3AVXA 5AUQA 3TQFA 3WYGA 4TL6A 4TQAA 5IHPA 4C0HA 4ESVA 3VU9B 5F3WB 4MRNA 3W3ZB 2GAAA 4PPQA 5H68A 1G7RA 1XJ0A 3PUZA 1SVWA 5TY0A 3T34A 2P67A 1N6PA 2ZU0C 3E1SA 2P0EA 4A6PA 1MABB 3KQLA 1SVMA 6Q21A 2O8DA 3BB4A 3B82A 2NO9A 5EXTA 3GEEA 2RKOA 3ZZUA 3EA5A 1OXTA 3NG1A 1KJYA 3WMEA 1I4DD 1J90A 1Z6YA 5CYPA 4ZIRB 2JASA 5FOWA 1DO0A 5M04A 3MUFA 1L7VC 2IS6A 4CGZA 2QBYB 3L0OA 2IYLD 1XEXA 2IHBA 4QM6A 1HTWA 4GI7A 4QJ3A 1KK3A 1P62B 2OZEA 3K0FA 4PO1A 3KJEA 3VQTA 3EC1A 2WWFA 3D3QA 2FGJA 4NE2A 4EFMA 1CLUA 1JR3A 2WJVA 4V0LA 5IDVA 1ELOA 5JWHA 3U60B 2I1QA 1ZUNB 4URUR 5JZVA 1S3SA 4GDFA 5IK2D 1G19A 3MWJA 2DB3A 1JPNA 4DCNA 1NSTA 5KU1A 4H1VA 2PLFA 2QN6A 1NF3A 2BMDA 4A4DA 4LV8B 2CE2X 2G9NA 3F8TA 3JVUA 1FPMA 1P75A 4JLPA 3SS8A 1XPRA 3QBTA 4D4LA 4HAVA 1OF1A 3QXCA 1G6OA 1G6HA 2JJ2D 4DSUA 4BLTA 4Q1AA 2Z6VA 3SBDA 2ZJ5A 2XTZA 3OIVA 5EZ6B 4DLYA 4EFNA 3CRQA 1U0JA 1E1QD 1R0ZA 1XRJA 4K81B 4KFTA 1TQ2A 4JSTA 2IYTA 1E9RA 1H8EA 2J3EA 4FWIB 2J7PA 2P5TB 4AKGA 1NBME 1VTKA 2F1HA 3QNUA 3QF4B 3QIAA 2YJTD 1G21E 4B71A 1G5TA 5FUYA 5J5CA 2ZRGA 2HT6A 4Q9KA 1OH5A 3KKMA 3GJXC 4LHYA 1GIAA 1FP7A 1QHHA 3MWKA 2IXFA 4UKDA 1SXJE 2WAXA 4O0MA 4LYJA 3B1XA 1YHNA 3Q85A 5J4HA 1Z83A 1CJKC 2AX4A 3Q3JB 5B30A 2GJSA 4TTPA 2QNRA 1M7BA 4HB0A 3LD9A 4BFYA 3OIUA 4BLRA 3ADCA 5FL7D 2CDNA 2BJVA 4R9UC 1ZW6A 4A6XA 4DEYA 4GP6A 2IF0A 4C4PA 3LWNA 1OKKD 5AUNB 1KI6A 2NTYC 2OESA 3HWSA 4DVGA 2CMKA 1G64A 1XZQA 2WJHA 1XWIA 2OBNA 1XF9A 2CNWD 2PT7A 4F7WA 1UM8A 4L8GA 2FWRA 4YDHB 4OI2A 3CWQA 1E2GA 3FMFA 3OE7D 3QY0A 3LVQE 4KODA 3NDBB 2WV9A 1YVDA 4DCSA 4ZCIA 4POAA 3AVTA 3IDQA 1ZMXA 4Q4HA 4H1UA 2XJ9A 3PCRB 1ZBDA 3VR4A 3ZD6A 4TT3D 3HR8A 1ZJ6A 1EWRA 3FHTA 2X2EA 4TZ6A 1Z63A 1CS4C 2NO6A 5DO9A 4TL8A 3CUEF 1XCGB 2OAQ1 2O0HA 3RLFA 4BEBA 4LBWA 1O87A 1HT1E 3K0SA 4WBSA 3A37A 2A78A 5KOYA 1GL7A 3KL4A 3KXIA 3QPVA 2EFHB 4MRVA 2AHOA 1Q20A 4JLKA 1Z6GA 2IWRA 2ZYUX 1W4CA 2XZLA 1J70A 4DSOA 3LLMA 2AKYA 4GT1A 4V03A 1Y63A 4TYQA 2H1LA 4LK2A 3CF0A 5G3YA 1X8KA 5DN6A 2BHRA 2RH5A 1E4YA 3QVUA 3QG1A 3QKTA 3MRSA 2F43A 3RRNA 3TR0A 5KSOA 1E96A 2JLRA 4PHGA 4XOIA 5CJPA 3L43A 3VKGA 1LW7A 2KB0A 3BWDD 4KITB 4O3MA 2J0UA 2XNDA 1Z0AA 1M34E 2GVDC 4JVMA 1W36B 2FX3A 2ZJBA 3KKOA 4LJ6A 4DLVA 3OIYA 3U61B 5KTYA 3NH6A 4XVQA 3PEWA 4TTQA 3KQHA 4WVFA 1Y3AA 5H8WA 1CBUA 4L5BA 3PUVA 2QTVB 4KFSA 4M1MA 1QRAA 4QJ4A 4B3BA 1NVUQ 4YC7A 3LXXA 2QP3A 5KNBA 2XZOA 1EFRD 1SQ5A 3IO3A 4BLSA 1N3BA 4LC1A 1NG9A 3TAUA 4D82A 4JLBA 1D2NA 3A1TA 4URWR 4JBWA 2QP9X 3AVUA 4C0SA 3RC3A 1E2IA 1Z06A 1ZD9A 2Z4SA 4C2TA 3AP1A 2KWIA 2V55B 2OE2A 2H57A 4GMDA 4Q7LA 1M2OB 3L82B 4HAUA 4M9XA 3VHXA 5A5GA 4BGDA 4UNNA 1NVVR 1FMJA 5FI1B 4MYUA 1UBGA 1XTSA 2YWFA 2J9RA 4US2R 2P6RA 3AUXA 2OBLA 2GCOA 3KFXA 1X8LA 1VHLA 4RJLA 3SI7A 4RCYA 1JR6A 4OYHA 5KPDA 4NYIR 4Z8XA 1XTJA 4ZPXA 1UDWA 3T1OA 1S9DA 5KDDA 3AF3A 4OBEA 3KX2A 1GILA 1KO8A 2YOFA 5JHHB 2UVQA 2ZRNA 4JSYA 1G5RA 4G5OA 4HSEA 2XXAA 4B75A 4EIWA 1KI8A 1RJ9A 3SOPA 4B6FA 4PANA 1DAMA 1EG7A 3H86A 2PEZA 4NCIA 2XSZD 1XNJA 4A2QA 1F5NA 1NN0A 3VR2A 3U3RA 3DDCA 3LY5A 3R8CA 2JATA 5KSYA 3K0CA 5DNYB 4N1AA 4FMCF 2A30A 3NBYC 4IXNA 4GFDA 2R9VA 1DTSA 4OJKA 1E98A 2VF8A 1BMFA 1BKDR 4Q7JB 4B3DA 1G18A 1T9HA 5FI0B 1G41A 5FUWA 4BASA 5HPYB 4E22A 1D8TA 3KB1A 1B0UA 1NY5A 1M1YE 1SVIA 3JZMA 3M6AA 2WWYA 1OH7A 1W7AA 3X2SA 4YMWA 2PJZA 5L3VA 2H18A 3W3AA 4KU4A 2ZETA 3X1YA 4BFUA 3ICQB 1WE2A 3VR5A 3PJRA 3BRWD 4TMVA 1DG1G 4M1SA 1K5GA 3T1TA 2G1JA 3GJ7A 4XSGA 1UEIA 1U90A 3LXRA 4MYHA 5G41A 1DARA 1EFHA 3A1SA 3K0AB 4HI0E 4AYXA 3CONA 4IVRA 3IILA 4RZXA 1GP2A 4PTLA 1UPTA 4KSCA 3X1WA 4KLNA 1CR1A 2BMFA 4XTCS 4QRHA 4QGGA 4RD0A 4TMKA 721PA 1UKYA 1ZM3A 1KTVA 5F9HA 2IS2A 2HDNB 3KZ1E 3ICEA 1YZKA 1V5WA 4OQFA 1XPUA 1ZUHA 2FE4A 4E07A 3AGPA 1T5IA 1IHUA 5K8IA 4AIIA 3OESA 3NHBA 1YRAA 2B7BA 1BOFA 1MO6A 2ZRKA 1AM4D 1G1MA 1ZAKA 2B6HA 4KAXA 4Q1EA 4A1FA 5FH9A 3ZGXA 4Q4AB 5G3ZA 2K5UA 4M22A 3WMFA 3TUJC 1N6RA 4EAQA 4C7OB 8OHMA 4Q66C 1E9DA 1AJEA 3IHWA 2PX3A 2FOLA 2EFCB 3IGFA 4A82A 4ZKEA 4DJTA 2A9KA 2RGXA 1P5ZB 2VYFA 4U00A 4X8LA 4IDOA 2X1VA 1D2MA 4ZO4A 2IXEA 1Q12A 4BE7B 3QI2A 3CLVA 5EE1A 2HUPA 4B35A 2E1RA 1Z0KA 1E9SA 5JI3E 2DPXA 2WPDD 2KJQA 4YMUA 3V4RA 4JZKA 2AFIE 4TYNA 4TLBA 1JR3E 4HZUA 5JECA 2FU5C 1EFUA 2R8RA 2YVUA 1OFIA 3U44B 2GJ9A 2X19A 2IUUA 4V0MA 1G291 4EDHA 1GUAA 2DFKB 1Q21A 4ZDWA 4YMSA 2X77A 2GCNA 2FPMA 2GVZC 4B2PA 4UXHA 4FCVA 3AB3A 2V3CC 1WCV1 3NIBA 1LF5A 2WMOB 1VECA 2C95A 1H65A 2Q3HA 4M8NE 5CM8B 3AKCA 1E3MA 1HE8B 421PA 4PSAA 2WHXA 1DPFA 2VP0A 2GF0A 1NJFA 1AGRA 2I3BA 1Z5ZA 2R2AA 2ZS9A 1TQ6A 4IDPA 2OCYC 3CW2A 4H9GA 4JLMA 4PZLA 4AC9A 4B74A 4RSGA 3BC1A 5AUOB 2F1JA 2JCSA 4MRPA 3EPLA 3R9WA 2R6DA 4HAYA 4PQRA 3SYLA 2IUSA 4PPNA 1NY6A 3VKWA 4WZAE 1N6HA 3EZ7A 2YWHA 3QF7A 3NVAA 1YRBA 2ZR0A 1LNZA 3FTQA 3AF1A 3NWJA 4D4MA 1E9EA 3A6PC 2XITA 2J87A 1GM5A 4NTZA 3I5YA 2DFTA 2IF2A 1SXJB 3U6BA 1PUJA 4UNSA 5CM9C 5E4FA 2ODEA 3WP1B 1NN3A 3MCAA 3ZQ6A 1OHHD 1T91A 4PZYA 3V4FA 2D2FA 2UZIR 4M0LA 3GLFA 3FWYA 2REBA 4IOKA 5EXSA 2A7QA 1OJLA 2WJGA 3CRW1 4Z1MA 4GOJA 1ZUIA 1RRFA 1U94A 4LSGA 4RY2A 1IXSB 1S96A 2G0NA 2F3TA 3Q5DA 5G53C 3RHFA 2WSMA 4PQFA 3GLIA 1E2PA 1N0VC 2HCJB 4OHYA 5DIFA 1F2UB 2DYKA 3BB3A 4LC0A 3QVVA 4BQSA 1LF0A 4JT4A 4G5GA 1Q3TA 3B1WA 5F9FA 1P4SA 1OXVA 5K8LA 1OV4A 3AH8A 1F60A 1OH8A 4PO9A 2I4IA 5L3RA 4D0NA 2JIZD 1XEWY 5BN4A 1AK2A 1HT2E 1Z0IA 2VHQA 4URZR 3CF6R 2DFLA 5HCIA 3VR6A 2RGDA 2ZR9A 1Q57A 1PJRA 2UZ3A 3U6KA 2ZAOA 3S1AA 1ZM7A 4LHZA 3WNBA 3I4LA 3ASZA 2ANCA 4UXJA 1IQPA 2YOGA 2E87A 1RRCA 2ZRBA 1Q3HA 4CEIA 2GJKA 1M7HA 2OLJA 3FMOB 3IKJA 1Z47A 3MJRA 4P4SB 3R7WB 4DIEA 4PX9A 3KJHA 4L9SA 3SJZA 1XPOA 1MKYA 2YWEA 5EP3A 2BKUA 3EWSA 4ZCMA 1R10A 4JLVA 3DL0A 3X1XA 2IYRA 1KI3A 5DSZA 3IIJA 1UFQA 2VEDA 2FH5B 1N5IA 2CCKA 3WMGA 4HAZA 4AG5A 1G9XA 4JL5A 1VCMA 4I1OA 4TYYA 4AI6A 1A2KC 4NH0A 2D3WA 2N1BA 2CLDX 4URVR 1XD8A 3B85A 1N6IA 1Z6TA 3LX5A 5AUPB 1XBTA 1Z2AA 1CTQA 2WWWA 2QORA 4P4UA 5J4VA 2QEQA 2G77B 4GBMA 4JLDA 1OXUA 2OO7A 1RYHA 1ZM4A 1G3UA 3EG5A 1KI4A 2J5XA 4NPHA 3IBGA 5GJWC 4OK3A 3ZZTA 2FF7A 4NMMA 4XWOA 3ZZ0A 4YDSA 3SYNA 3Q7PA 1P9WA 2HJVA 3A8TA 3K09C 3IEVA 2ZE7A 1Q1QA 1ZNZA 2QRNA 3SQWA 1OSNA 4ITRC 2SHKA 3THWB 3U5ZB 3NEYA 1U98A 3EC2A 1BO6A 4R2IA 4DUGD 1JAIA 1NN5A 2ORVA 4QBHA 1XD2B 2CL7X 2FN4A 4DB4A 3THYA 1NN1A 4Q47A 1FOEB 2QAGB 4HB2A 1AN0A 3HPRA 4Q19A 1CR4A 3DOFA 3CNOA 3W6OA 3T5GA 2FG5A 4MA4A 2C77A 2W6JA 3GFPA 2WWXA 1AQUA 1TQ4A 2QU8A 3QKSB 4A9AA 1ODFA 4IW3B 3THXB 1IN5A 1ZIPA 4L15A 1HQCA 1PLJA 2V1XA 3ETLA 4JIMA 4KYIB 3LQQA 3PEYA 5FPSA 3LA6A 4DLXA 4YMVA 3AGQA 1NRJB 4I4LA 2IW3A 4RFVA 5FTLA 2VSFA 2V8OA 3AP3A 2AWOA 2CHQA 3GJ8A 1NLFA 4Z8YA 3ZDQA 4BWYA 2XB4A 3GLHA 1ESNA 1XMSA 4TL9A 1IXRC 2Q9AA 2BCJQ 2WIAA 3EPHA 4EJSA 1QHNA 4PPFA 1FTSA 1GITA 2VIIA 4NONA 4HYYA 2EW1A 1KAOA 1TAGA 5D3MB 5JFGA 1SHKA 5JSZB 1JJ7A 1VCIA 1D2EA 2F3RA 3W8RA 2QPOA 3CO5A 2HEIA 1HV8A 1TF2A 1QHYA 1OYYA 1P2UA 3K53A 1XXHA 3U7EB 1HH4A 3UK6A 3P20A 1IOZA 2O5VA 1LS6A 2HLDD 5CIWA 2GDJA 4ILEA 4ASUA 1N5LA 1CXZA 2BDTA 3A1UA 1VCNA 3PV0A 4B47A 2ATVA 1HA3A 2NGRA 2ONKA 3MSXA 4OI4A 1NMZA 4WXRA 4ARZB 4URXR 5IK2A 4A36A 2QT0A 5IT5A 1U9IC 2NOAA 3MMPA 4JT2A 1N0WA 2AK3A 1Q1EA 1L4UA 1I2MA 4Q9IA 2LWIA 4N0EA 3ND9A 4KVGA 3HPQA 1VYTA 4A0GA 5TMPA 1L4YA 2IYYA 5TVKA 1KSJA 3D7MA 2ZQ5A 3DVLA 2JJ2A 4LY6A 5LDDC 3F0TA 1XJCA 4Q00A 1G4UR 2PT5A 2Q9CA 5AK0A 5F2EA 3IBYA 5SZJA 2IYQA 2DWQA 3PQCA 3PUYA 3OZXA 1E1QA 4PAQA 4Q1BA 2R6AA 4QHYA 4A92A 1SXJC 5LD2B 1ZD1A 4Q4JA 2B8TA 3BH6A 4FMDB 1MABA 3NC1C 1W5TA 4RKFA 1OIXA 3AKEA 1E9CA 2BM0A 4M4SA 2PLRA 5EE3A 5DH9A 4EQ6B 3RDPA 4DZZA 4PAMA 1HURA 3RS4A 3SQXA 1SHZA 2FDCA 1VYUA 3A1WA 5DLQC 4ZIRA 1CJUC 3RS5A 3SZRA 4TMWA 3AEZA 3QBVA 4RZ2A 4A0HA 1U81A 1JQLB 1A2BA 4D0LB 5D3QA 4OHXA 3FYHA 1XMVA 4NU0A 4V0NA 1CU1A 4KYUA 4D81A 2Q3MA 1N25A 1I4LD 3B9PA 4MRSA 2YINC 4AKEA 3R9IA 3BB1A 1AQYA 2GJAA 2O8DB 3LBIA 4QHSA 1GDDA 4R7ZA 2XJ4A 1YR7A 4Q7MB 1FZQA 5FL7A 4ASUD 3VX4A 4MRRA 2KBEA 3FPAA 1R2QA 2XTMA 2VH5R 1R6BX 4IDNA 3RRZA 3W5JA 4B32A 1TQDA 4Q5IA 3TSZA 1OKKA 3RVBA 3NBFA 1QVAA 1KIMA 4FW9A 2QSYA 2AD1A 4A8JB 4D4JA 1WF3A 5L3QB 3TVDA 2MMCA 4O25A 1FW6A 3GQBA 2CNWA 1T0HB 2WWGA 1E1RD 1V43A 4FINA 4V02A 5FOUA 2RGNC 3B6EA 4KVAA 1ZNXA 3MJHA 3REGA 4QGFA 3OE7A 3LDAA 4Q1DA 2HYIC 1KDPA 3BAFA 3KDSE 3P26A 5BN5A 5JJIA 4FCWA 1AS2A 2RMKA 4X8HA 3WRXC 1T8TA 2Y8EA 3AVYA 1KSHA 4EPRA 1QHGA 1HEIA 3C4JA 1U2RA 4TT3A 4GMXA 2Z4RA 1K6MA 4AD8A 3R9XA 1UKEA 2WIBA 2PMKA 1ZNYA 4ZKDA 4TLAA 1JALA 3LFUA 2HT1A 4W5HA 5C18A 2F1IA 3TQCA 2ZI3A 3CB4A 5GADl 1COWD 2FPLA 4HDOB 3FVQA 3CH5A 2ZRJA 4KFUA 5EXXA 5DGXA 3N70A 3T1QA 3NBXX 1U0HC 4RD2A 3BGWA 2HV8A 5C2JB 4B6EA 2GEDA 3L0SA 5FBVB 3B1VA 3B60A 4L16A 1W2GA 4LJAA 4NZYA 1II0A 2NO7A 3K1JA 4Q01A 4C30A 4DLRA 1QG4A 2FSGA 3A4MA 1FQJA 5K8UA 4L4UA 1GKIA 1P2TA 4BFXA 4F92B 3KJGA 2JLZA 1PV4A 1KK2A 2DCUA 4URYR 2PZEA 3NDPA 3QG5A 2WOOA 1W1WA 1OB5A 1YQTA 3DZ8A 4D26A 2QTFA 2QMOA 1QHHB 3B1YA 2FFHA 3V9PA 2WTUA 1X8JA 1YR9A 2F9MA 3CRMA 1LS1A 3QEOA 2WM9B 2JLXA 3A1VA 3QEJA 1OFHA 1W49A 2HCBA 2C9YA 5CLLA 2O8CB 4MITA 2QAGC 4RD1A 2QZ4A 5BYKA 4CZ2A 4O2LA 1XTRA 5EZ5A 1JPJA 2NPFA 1E2MA 4IOLA 3A58B 1MRSA 4LI0A 1EFRA 3NTUA 3TSOA 3GLGA 3I1FA 2DWPA 2ZUDA 4ERNA 2ZI4A 5EE0A 1D9ZA 5A4JA 5JWRA 3K9NA 4B43A 1NIPA 1OXSC 3RABA 1S1MA 3UWKA 4BFSA 3VKHA 3GMTA 1SVLA 1BIFA 4TSFD 2ZROA 4TMTA 1KSFX 4Q1CA 2EQBA 2N46A 1Z29A 2EYUA 1FQKA 1E2KA 3I3SR 2R6CA 3CBQA 3NKVA 1I4TD 1P61B 3WHLA 1II9A 4TWZA 1TNDA 2OBMA 3QPWA 3WRYC 4V0KA 3MWYW 4QNRA 1SKYE 1G7SA 1ZCAA 5HE9A 2GXAA 4OQMA 2YZ2A 4P32A 3DEFA 3PUWA 1OH6A 1ZC3A 4Q02A 2V6IA 2QROA 3K70B 2X8AA 3I73A 3EZ2A 5HE8A 1CP2A 4BFZA 1CEEA 4US1R 3RS7A 4B2IA 1PLKA 2WWHA 2ZRCA 1JJVA 2CJWB 3SN6A 2XSZA 1Q1ZA 1E69A 3U7GA 1W0KD 3ZYCA 3BIFA 5FTNA 3CPJB 4R71A 3QPUA 2CXXA 1XJQA 2P3SA 3CPHA 2QMEA 5IF9A 1JEEA 1M8PA 1ZINA 5J4YA 2F6RA 2IK8A 2QPAA 1R8QA 5BQ5A 1YR8A 1NI3A 2EVWX 3BFKA 3ECCA 1K8RA 1WMSA 2O52A 2RCNA 2WICA 4GRAA 2MSEB 4WA7A 5EE9A 3HU1A 4JJZA 2F43B 4D2IA 4A15A 1FL9A 3G5UA 2ZTSA 4RFSA 4TLDA 3OEHD 1OB2A 4HUQB 4M1TA 2QT1A 3TLXA 3UMSA 1ZIOA 3W90A 2RHDA 1GRNA 1HE1C 2JDID 3VNVA 5E95A 4JBXA 2BBOA 3HYTA 2IYXA 4LV5B 2WJJA 3U3OA 5LD2C 1SVOA 2O8EA 4LHXA 2G6BA 2VHUA 3C7KA 3ZIAD 4D25A 1IM2A 2KE5A 2VSXA 2QMHA 3AQ4A 4IXMA 4N0DA 4F4CA 2AD5A 4TMZA 1F2TB 2LCFA 2FFAA 3N2IA 2D7CA 1W4RA 3OAAD 1F6BA 3PITA 4ACBA 3TR5A 3AVQA 2B7CA 2OCPA 4IHQA 1H8HA 1FTNA 1N2CE 1HUQA 1XX6A 4DKXA 2V7QD 4DDVA 1UKVY 4UXIA 1AKYA 2IL1A 2AFHE 2VP5A 3U3JA 1G8PA 2FSIA 1P7CA 4G01B 4E03A 1UJ2A 3EAQA 4C0LA 3EZ6A 2DR3A 4QOSA 5DHFA 1P3JA 3SFZA 1W36D 4P0TA 2J41A 3ADDA 2ODBA 4MDEA 5JJLA 2DWOA 3JVVA 2GCOB 2R44A 2WMNB 1KI9A 1G3RA 3TAHA 4EPVA 5CYOA 4ESHA 1G3IA 2C78A 4A8JC 2W0MA 5FTMA 1E6CA 2IYSA 5CDFA
chains in the Genus database with same CATH superfamily
5ESWA 3I62A 4LPKA 1V48A 2PUHA 2G1KA 2PS0A 1VLMA 5CVJA 3DB2A 1TF5A 3PICA 2P9TA 4QEDA 4R1QA 5LBIA 1HY3A 3L79A 4YJDA 4EJMA 3QOWA 2AWNA 3EHEA 3OQBA 4AJ2A 3LZDA 3DO6A 2A5YB 4YMIA 3IEXA 2QJWA 3BH7A 4FFPA 4BWFB 2Y1CA 4LECA 4BV2A 5B2FA 2H1OA 1YZGA 4LQ4A 5FO1A 3EDYA 4ZQIA 4W6ZA 1ZVVA 4RABA 4Q3KA 2C7RA 5E6UB 1J25A 4CLXA 2IKQA 4P81A 4UMVA 2GPJA 3BMQB 2PGNA 3KQWA 3T5MA 2IU4A 1YQEA 4Y2VA 1WXQA 1W1IA 2ASEA 4BQPA 1U3TA 4TS1A 1CNEA 3RUAA 1UJMA 4RV4A 5E6SB 2Q2VA 1BE8A 2WPDA 4UFOA 2GO7A 4EZBA 4ZU1X 3SHVA 4FCTA 1KYZA 2Z83A 3C4QA 1VG9B 4O2RA 3RJ5A 1H8HD 5L4NA 1L4GA 2WJ3A 2OHFA 2O8FB 1YK1A 3ABOB 2VBFA 2BFWA 2WD9A 2ZJ2A 5LZ5A 1WUJS 3U80A 3RLIA 4UPDA 4YCMA 3N2LA 2EZ8A 1W35A 4BLOA 3IUEA 3FNBA 2W4IA 4CCWA 1KY4A 5KVSA 1SXIA 4CQMA 1NONA 1EIWA 5H4HA 3MC1A 3LL4A 1BH2A 5ALEA 5AH0A 2PXCA 2GYUA 4FEYA 2ZI5A 3KELA 2ZJ6A 3I6YA 4M8KA 4QARA 3D8RA 1KMHA 1QGUB 2O2JA 4Y7CA 2P2LA 3SZOA 2X23A 1DAKA 2JA1A 1ZZEA 1DDIA 2B4KA 4LVUA 1K27A 4BLPA 5I4BA 1Z0SA 3G89A 1TRHA 2XD9A 3UUWA 1NHWA 5ALNA 2YQZA 4L7VA 4X90A 4MGYR 4WD3A 1CZKA 3WNCA 5TARA 3GVCA 4C7OA 1CUDA 1RE1A 4A5SA 3BRQA 3AL0C 1WW8A 1C4OA 5JE8A 4GBJA 5THKA 1FX0B 2QQEA 5EUQB 4N9QA 2EKDA 5BXQC 5CLQA 3TN7A 4BDSA 3Q41A 1E2LA 5EGNA 3KJQA 3WLHA 1H3NA 5KNCA 4BY9E 5T3UA 4BNIA 1LD3A 4CTMA 3RNLA 1LW6E 1PFYA 2IEYA 3NWBA 3L18A 3HYNA 2AS0A 2BBWA 3FIJA 4ICIA 4ML3A 4AROA 3VPDA 3PD0A 1Y9EA 3SC3A 2UDPA 1JKJA 1I5OA 3LSTA 3W8FA 1Z2DA 4K46A 3TXYA 3A10A 1M2KA 2CFSA 4RD6A 3LO5A 3ZV3A 2R87A 1N5JA 1L7EA 3V4SA 4QOIA 3WJ1A 2NU8B 3RS0A 4C3UA 1Y6ZA 5C1OA 5KTOA 2W11A 2WZQA 4AY2A 5C8YF 3M4YA 5KYKA 2G9QA 2IPLA 5FOTA 3S8YA 1DVRA 4KE6A 4J1SA 4YO8A 1QH0A 2EWVA 4ARVA 3OM8A 3L0DA 2ZSHA 4F4IA 5CDTA 1GO2A 4G09A 1O9BA 3I9V1 1GHTA 4ES6A 4S2EA 5E7QA 2IH5A 4J43A 3LRPA 3CLTD 4HATA 5C4IA 3AYXB 5LNK1 3LH5A 2QL7A 1YE8A 5IF3A 5E7JA 2FF5A 1OBVA 4HLQB 4DMUB 3FF1A 2O2IA 3I9NA 1WUYA 2PWBA 4GZLA 4MCAA 1YFJA 2YNMA 2J7KA 4FNOA 2VLIA 3V1KA 1U9IA 2XUAA 1EVYA 3HM2A 4JHLA 4FFBA 1P1FA 4IS2A 4U3JB 5TGDA 1N1DA 3VNSA 4Q9JA 3HA3A 4NG5A 3WKCA 2Q62A 1LRKA 2HA0A 4XQ0A 1B0AA 1HYBA 4IUCS 2DT8A 3DKIA 1L7RA 3ZHYA 1U0RA 4BUJA 1JMYA 5A2GA 2FW7A 3OPMA 1JIJA 4LJ4A 2AOWA 3H6KA 1J2JA 3K1YA 1V45E 2EIXA 5ADUS 4I7EA 2XB2A 4DV4B 5KTRA 3ODPA 3OO0A 5EXPA 3IOMA 3WGZA 5J1SB 5AKZA 2FOXA 1KZ9A 5JNTA 3QQ5A 4HEJA 2R6FA 2NMVA 5L7YA 3FCXA 3PKIA 3IAM1 4A27A 3BPSA 3I5AA 2OWDA 1A72A 4DFDA 1YVEI 4UAGA 2JANA 3F5QA 3LA8A 5SZKB 4J6EA 1C8VB 1UBRS 3VC3A 4UDXX 1P0PA 4E09A 4IJ5A 3UUEA 3ISVA 1RM0A 3ITEA 1QCYA 3KKQA 2D1TA 5LDGA 2IUFA 2PL3A 2WKRA 3SK0A 4E3ZA 3PFNA 3RJMA 1PGQA 3C1AA 1BHJA 4CT5A 2G1UA 1YB5A 1KY2A 1KO7A 3AY6A 3HV2A 1V2GA 3K6KA 3L9WA 1RRGA 3M49A 3RK1A 1WDMA 3SXUB 1RE0A 3ASYA 2FNAA 1BEEA 3A9TA 3EUAA 2ZRHA 5KYGA 2OYRA 1BS2A 1OA0A 1X86B 5E0KB 1E79D 4BLQA 1P5RA 4BZPA 4IRUB 4MVJA 1TEXA 1GGJA 1BCSB 3BGDA 1YCHA 4H77A 1A5ZA 4PC3A 3SFTA 3F7OA 4R1MA 1HKUA 1Y9ZA 5LP1A 3K2BA 2C9ZA 3IP9A 3JQGB 1DS6A 1DDOA 4F46A 2BFAA 4AG3A 1U5BB 3SIXA 2ISSD 3C41J 3WFJA 1TL7C 4GOOD 1FFHA 3ULKA 2ORWA 3AESA 3WK6A 2RGNA 1HDRA 4BVFA 4DUGA 2GD2A 1CQPA 4WFQA 4B33A 3MTGA 1NASA 3FDXA 3IRUA 3FR7A 4FMPA 4LTDA 1M2GA 4N7RA 1IN6A 1NQVA 2A92A 2QRZA 3GEIA 4JMPA 3U2QA 1X77A 2YY7A 2GK3A 2YWRA 1B6GA 4YJ2B 9LDTA 5IAEA 1S8FA 2Q6IA 4YEDA 4ZAZA 3L4BC 3VMFA 3P4XA 1XJ5A 1TU0A 3MN1A 1RHJA 1SXJD 2CWDA 2AOXA 3O3NB 1ISJA 4PHFA 1NRXA 2Y0BA 4RA6A 5A71A 4LOIA 3S1AB 2JFPA 3EPKA 1SKYB 2B20A 2MT9A 1IE3A 2ZBVA 3ZDBA 3KDAA 3JR3A 4QTXA 4PCAA 2P0AA 3EIQA 3PIRA 1LA2A 4BQQA 4DMFA 4AKSA 1Q7GA 4PC6A 5BW6B 2XMQA 2PSSA 3D3KA 4BNZA 2VUHB 3C7CB 4P54A 4G5FA 3MTJA 2EQAA 4DJDC 10MHA 1US8A 3HLKA 2YYZA 3FGNA 4M9QA 3QEAZ 4XX0A 5ALMA 1Y8AA 2G82A 3NT5A 2VFAA 1ETUA 5U4QA 4BS9A 1QS0A 1FRFS 1G20B 2C2OA 4JP2A 4X71A 4YAOA 5IFLA 2AZDA 3V1MA 1WUHS 1XYYA 2FCRA 3V8QA 5I8WA 1ZHOA 2ZSAA 3BXFA 5EMKA 1G8FA 2EJUA 2AKEA 3SX4A 1QYCA 1T8PA 3PDCA 3OE1A 2NO1A 2QUJA 1MOSA 4Z3DA 2Q9BA 4O4JF 4ISCA 4ARIA 5BXYA 1A8UA 4A0SA 1MXHA 4MWGA 4ZCLA 3KUDA 1DJQA 3RODA 2HLDA 2GCPA 1E2EA 4PHHA 2CKDA 2ONCA 1AKEA 1LY1A 2QRJA 3PC8C 4D8XA 1BX3A 1UKAA 2YDXA 4DLSA 4G1CA 4COOA 2DFVA 1S2NA 4Z4FA 3NAZA 1P45A 2B3DA 2IEBA 1G17A 4XB6B 1M2WA 1Z8HA 3L8ZA 4C0BA 4PZZA 5HILA 1Z6QA 4JY7A 1CDDA 5DFAA 4JC5A 3TOVA 4B79A 4K26A 4R1LA 5CGQB 5TR9A 3VUFA 4WINA 5HQJA 5IXYA 1YA6A 1K06A 2IGTA 2PZAA 4ZQEA 4BFCA 1DBQA 2RI0A 5HJ7A 3PXEA 2HYDA 4TKLA 5DLDA 2I4NA 5EJAA 3GZTB 3KXKA 4J4HA 3IIKA 1ZXLA 4NCJA 1H1LA 4QIHA 3SU8A 1I3MA 2MR6A 5B1HA 4EITA 5A62A 4Q34A 5CK5A 1ZESA 2HF7A 4C22A 2IDKA 2WWTA 3FOAA 3AX6A 3VAAA 3DFUA 4BNJA 4MWEA 1QG2A 1DG3A 5B3AA 3AF0A 5JQGB 2IBTA 1HR0B 1GT91 1JS1X 1NXVA 2OXTA 3F6RA 2QW8A 1RWXA 2JFGA 2NPIA 4ZREA 4F5YA 1YMQA 1P2VA 3VH3A 1EJBA 1RNLA 3MOGA 4YB8A 2XHEA 3OOEA 3NGXA 4RUKA 1C7EA 5B1IA 4IIGA 3CVVA 2ZBUA 3KQVA 3OQ1A 2L2QA 1Y8ZA 1CY0A 1XUOA 4PAGA 3UMYA 5B58T 2WF8A 1WB5A 1Z7WA 3VXKA 3PEEA 1Z0ZA 1J21A 4LNHA 4XJVA 3FPBA 3TD6A 2J0SA 1PVVA 3DT6A 4HRAA 1NM5A 2RBGA 2OOKA 2B3TA 3N86A 2B92A 3ZN2A 1AKRA 1TDJA 4DV0B 2F00A 3CKLA 2FLVA 3L49A 1X7HA 4TL7A 4D3ZA 4NXMB 1S1CA 2BWJA 1AUOA 2EYQA 4J91A 3PFHA 1Z5OA 2PL1A 2VO1A 1O94C 3R8FA 3VH4A 1MEJA 4HQOA 2R4QA 4WCFB 4E12A 2HBQA 3NHWA 1H2RS 2RGEA 1OT3A 2JVIA 4PVCA 3G2HA 1J0XO 3ZWXA 4TYWA 2Q5LA 3MJSA 1KP2A 3HRIA 3WAJA 1WVIA 1ZLXA 1OFUA 4NFYA 3M9WA 1T4DA 1ZP6A 2ZVQX 3EIHA 5BUZA 2ZBRA 1RAHA 4H17A 1S9HA 1BQ4A 4NS1A 3HR4A 5TPZD 3ZUGA 3W5VA 3DKPA 2VP4A 2PZFA 2W2MA 2IZ7A 4HFJA 3FKSD 4Y6OA 4OM8A 4BNDA 2BKLA 3BXOA 4IKOA 1X1QA 4ZYUA 1EX6A 3F98A 2I62A 5C3UA 4CCSA 1PR6A 3IX7A 1HL7A 2WSIA 2X42A 3NOVA 4EW6A 3LX8A 4LY0A 2AT1A 1OMOA 5B4TA 1EK0A 2E1PA 3HGQA 4REQB 1SBNE 4ZMBA 1MO4A 2FWMX 2PTGA 4ZU3A 5KX5B 2PUBA 1TAUA 5IBRA 1L4LA 2JH8A 4L07A 3PQ6A 2ZG6A 1NC3A 3OUZA 1LQTA 3PXCX 4M1ZA 4MTCA 5LZ4A 2DY1A 3NH9A 4FYPA 2BZSA 2B5OA 2DCMA 1X7ZB 1J0CA 2FX5A 2VQSA 5AP9A 3ZS9A 4L0QA 4CIDA 2PUAA 1XGKA 3MAGA 3WZ2A 4DMMA 3E9RA 4CR6A 1Y7HA 5BWOA 4I2NA 2YKGA 1L3BA 3DZIA 4JU9A 3W8EA 3N6VA 3O92A 1PAUA 1YRYE 3VDNB 2IELA 5AHXA 3ZVLA 3QH4A 3PXGA 1XMJA 2H2HA 1QHXA 1D7AA 4B34A 2C2ZA 3ELBA 4KQJA 1FNSA 2OG2A 4PO3X 3NM5A 1VKHA 1J20A 1LGYA 3BMNB 4HX5A 5CH5A 1X80B 1KHHA 3TIIA 1QANA 1GEGA 1SUFA 5FOSA 1K2WA 3L7KA 1XA3A 3ZTYA 1QZXA 1M9NA 3V00A 1N9GB 5CW2A 4JYZA 4G8CA 1IM8A 1CE8A 2IXTA 2XOKD 1S7CA 1O6CA 2OCAA 3PK0A 4H1HA 4URHA 2NU9B 3ITDA 3IEPA 5JZSA 1WLYA 4BVBA 4L4YA 3D7SA 1D0SA 1EM8B 3MAJA 1FTGA 4TOIA 4JKIA 4MVJG 3OT1A 2F4NA 1WUTA 3CX6A 4QG7A 2O5EA 2QENA 4B3GA 3UB2A 4EKGA 3LVBA 4ZC8A 1C29B 2J46A 3Q15C 3WWEA 5C4MA 3DWEX 1RLIA 5G4KB 4EUNA 4PPGA 4DLWA 2W6ID 3LT4A 4RXTA 1AKNA 2QR3A 4K6MA 3F97A 4EW1A 3SVZA 3Q7IA 2NQTA 3Q10A 3FOZA 2RJ3A 4JJGA 1OFGA 1I7PA 2DQZA 3FLAA 4FONA 1BC5A 4D92A 4Z6KA 3DEJA 6REQA 4BRWA 5JBQA 2J3LA 2QX6A 1G5IA 4HAWA 5CEJA 5C35A 3FE2A 4ZO6A 1TUEA 4C21A 3KB8A 3DBHA 2GTHA 1B42A 1B1CA 3V4VB 4RS4A 5AW8A 1W6UA 2XMGA 2VTKA 1UADA 1H2AS 2HNBA 1OREA 1E59A 4YRMA 5TQJA 3VC2A 2Z9DA 3SJAA 3CRRA 5EOVA 3G1UA 2V03A 4KK3A 3T41A 1GPYA 2RC5A 3ZU2A 4BFVA 3HN2A 3M5DA 1NVWQ 1RM4A 4JJEA 4PZEA 3URMA 1LK7A 3M4ZA 3PCXA 4CM8B 2DETA 4D45A 4ZZ1A 5T5QA 1A8QA 4F1WA 4BYMA 1Y98A 4YXWD 1PRYA 3E9DA 3CSUA 4MGIR 2F59A 1PZXA 4AJJA 3DE4X 1ID8A 1SUBA 1LQ2A 3SQNA 3ENVA 4FK8A 5KSWB 4YI5A 3FUVA 2Q2WA 2PRYA 221PA 3TK1A 3E48A 4HQ6A 1V8PA 3WSVA 1NSFA 1RYBA 2BT4A 1YHYA 4F6CA 2QD2A 1YTLA 4MZDA 2NSHA 2XAAA 2NZXA 4UAUA 1N32B 5D6NA 2CEAA 3MAAC 3GCGA 4U5XA 4NP6A 5IDWA 2IPXA 3STWA 4DCTA 1UZMA 1J07A 3UAOA 4DBVO 1ZMOA 2DX7A 3QQPA 3NXSA 1FLNA 2RGGA 1L5GB 1Z6AA 3WE7A 1V2HE 3B7GA 2FVYA 2XA9A 3SHFA 4M88A 4ENTA 2HPZA 1N6LA 5DM2A 3AJDA 1O97C 3O3CA 3OPYI 1SAYA 4PFSA 2J9FA 3MT0A 4MYDA 2V4ZA 5DHQA 3OEHA 1KI6B 3CF4A 4ZZ2A 1MORA 3OKFA 2VNHA 3AU8A 3DQQA 4UU1A 3GLTA 3ZU3A 4CG1A 4J49A 1E3LA 1VL8A 2XQKA 1Y1QA 4RGYA 5AKHA 3RT7A 4MMYB 4IMJB 2OYCA 4DSTA 2I6QA 3V1TC 5BWBA 2AE2A 3AUJB 1D7OA 4OKIA 3B9QA 4DG5A 5CB8A 2VYND 4I99A 4NYIQ 1D2AA 4QELA 5HIIA 1M6YA 1XZGA 4XPIB 4XWKA 2Z43A 1J7KA 1XWFA 2GDZA 3ELUA 2OEPA 1T13A 2YHSA 1GOTA 3SBOA 5LIRA 4HH0A 3C74A 1EXMA 2H3HA 4ENPA 2H5JA 4BFWA 1U2TA 1WV1A 4X95A 4IIUA 1SZPA 4QNNA 3GLGB 2AZXA 4U0KA 3AVPA 1DJLA 4MRMA 1X0VA 2IYUA 1A96A 3K9GA 4TTVA 5HUHA 2G36A 1H8ED 2RH9B 3BXXA 4J0JA 2J7PD 2FSUA 3DCYA 1A82A 5EMMA 1ODIA 1IRIA 2E48A 2PZGA 1Z6XA 1ZONA 3IJPA 3V3KA 2I91A 2BFCB 5CK4A 4D9IA 1XZFA 3OG9A 2JFNA 5BSEA 2OZVA 3IT2A 3CMCO 4LISA 4MQEB 4K6GA 2GRAA 2HMTA 4KN9S 3S2UA 2QL5A 4KB5A 3AVWA 3NYQA 2D5BA 3EGEA 1NKTA 2VZLA 3Q4GA 1ZH4A 2AJLI 3PG5A 4NJEA 3EBPA 4WCFC 4F72A 3QVOA 4ZYLA 4NCAA 1AUQA 1G20E 3LCUA 3CVUA 1GGEA 4OGFA 1D04A 1G0NA 3BSYA 4QL3A 4DSAA 1QQTA 1FP6A 2WZBA 3C14C 2LZ0A 3NKLA 1NQUA 1IBMB 2YMMA 1Y6JA 2H4HA 3ZHBA 4MDFA 4P31A 2HGSA 4HB3A 4A1OA 1Z08A 3CS3A 1W19A 2BGNA 3KG2A 3L04A 3TW0A 1EGAA 2HRCA 1TKBA 1RBMA 4R9SA 2GEUA 3DOHA 3CFYA 5IT0A 5C8ZA 3EULA 2GZMA 4R05A 3EA4A 1SKUA 3R5JA 3A1DA 5A5VA 1MVOA 2ZREA 5I7VA 1WXXA 4CT4B 4TLMB 3KOXA 1LTQA 2H16A 2WF7A 4G0QA 3TE6A 4BMZA 2RH4A 5DP2A 2QTAA 1HDXA 3V8NA 1UZAA 2E9SA 2PWZA 3P27A 5KKAA 2HWKA 3B6MA 2JGKA 4S05A 4IFEA 2O2YA 2BVNA 4RF3A 3VNRA 1TMKA 2OHJA 2P4EA 1HRKA 1NSYA 1RZ3A 4FXPA 4XWAA 5LB2A 3STXA 1AO0A 1Z5WA 4NYMR 4M1EA 4KO4S 4NCKA 1F2TA 3T7TA 4O2AA 2FMFA 2PGAA 1FP2A 2C2HA 2C98A 2FHPA 3N2KB 4RFSB 2IIBA 5JZMA 3WJAA 4G0UA 1MFPA 3IERA 3H5LA 1WVGA 4LZZA 4Z0TA 2VF7A 3L7IA 5CB4F 4C2UA 4JLAA 3BBPA 4ODIA 1GPMA 1V26A 2H08A 3RAGA 4G5RA 2PKWA 4KX5A 3DNMA 4ZI3A 1HYHA 1P7VA 3K70D 1O4VA 1KO4A 5EZYF 5AOAA 2BEVB 2DJIA 4IUBS 4R7TA 2OD2A 3V9AA 4TV8F 4EHIA 3ESQA 5FEMA 4A16A 3T94A 4GX0A 4IHAA 5KJ1A 1MVLA 2BMVA 3REQA 3I0MA 4JI5B 4B44A 1YZNA 3A2NA 3AJAA 3D3NA 4H16A 4HDRA 3IUSA 1AS0A 1EP3B 1MIOB 2Q3JA 2ZE8A 4QO8A 3SIWA 1E8NA 4GPTA 4PGGA 1L4NA 1NVDA 1GUDA 4M1WA 4B8YA 2NAFA 1CNMA 3L1VA 2ZJZA 1YVRA 4PW0A 4WCVA 1U3DA 3AL3A 1WZNA 3KZOA 5BR1A 4OHVA 4XZ3A 4KRFA 1Q0RA 4OMCA 3DZFA 4P92A 3GLSA 3BWBA 3FAZA 3F4LA 1Q7TA 1KJIA 3MCZA 1QH8B 3PQFA 3L4BA 3SSAA 4GI2A 3WLEA 4EUSA 4YQFA 1AMUA 1P81A 3FI9A 1BX1A 1GAWA 1JX6A 3IP6A 1ZN9A 2JEYA 4II7A 1FFCA 4P3YA 4IEIA 2M6SA 4XGRA 5E6UA 4UZEA 4XKJA 3EZLA 1IBKB 3ZE0B 3ZBPA 2VN8A 1XQ1A 1TA0A 3OQIB 3WY9A 4B2YA 1MOQA 4UULA 2XWPA 4FN4A 1JGTA 5ES4B 5E6SA 2FRDC 2II6A 3ADBA 2EFEB 4I46A 1EU1A 1Y7IA 2Y67A 3CH7A 1VZ2A 2Q6TA 1CT9A 4JS0A 1PEYA 2I7CA 4QFMA 4AVYA 5LM3A 4Z4GA 4X6LA 5LQMA 3NYIA 2PT6A 3W7VA 4PS1A 5GVRA 3U09A 2G04A 2YHBA 1BE0A 2HXSA 3RJTA 1RYMA 1ISMA 4LPSA 3MWDB 5BW5A 2O8FA 5JJCA 2JGJA 4QX6A 1BMQA 1UBEA 2ECQA 3O73A 1EB8A 4EHFA 1XTIA 2DQ4A 2JAUA 2PH3A 3SC6A 4B1FA 5BWMA 2QYSA 5AW9A 4ENQA 3O83A 3R24A 2AXQA 4CF7A 1L7OA 3M0EA 3QPCA 4DDWA 5DOVA 4F91B 4CLEA 3L93A 5J2UB 5H3LA 3CJTA 2WJIA 3ES9A 3RH0A 5LQDA 1AZWA 1NF8A 4K6FA 1YF3A 2JIDA 3EQ2A 2XD4A 5JLJA 3GJ3A 1AKTA 5MFPA 4HQFA 5AM0A 1AV6A 3BICA 1JEDA 1RKBA 1M2NA 1V3QE 3C45A 4KI0A 3TX2A 4ZYTA 2L82A 1FJ2A 3AHCA 2YVLA 1SOWA 4DGSA 1J6UA 3LHSA 4NPAA 2XE8A 4M9ZA 5LL6P 5EJGA 5JXGA 4PBSA 3ZCSA 5A4FS 4KRGA 5B64A 1U1DA 1YQUA 3RYTC 4DF3A 5U9CA 1NUPA 4DBZA 2C8VA 1QIDA 2YFQA 3CZQA 3VKVA 3C5VA 1FX0A 1L5HB 4QUAA 3OA2A 4QQRA 2J31A 4FE3A 2CCGA 3A0UA 4UNPA 2UYQA 2IV2X 1M1ZA 1VL6A 4YXWA 3H16A 3QXJA 4N5NA 4BZZA 3AKDA 4IJKA 4CKXA 1YJAA 4M9SA 1XXLA 1T4BA 2JGNA 3HV0A 4LCJA 2GF2A 2JJ8A 4AUKA 2I87A 1OXXK 4J0GA 4D8TA 5LKRA 1QYIA 3JWIA 4EK9A 4X41A 1ZR4A 2C1ZA 1F8XA 3LVFO 3CEPB 3LG2A 4MO2A 2XE4A 4QU0A 5NULA 1RU3A 5TNXA 2VJYA 4WEOA 2GXSA 4C87A 5IUJC 3IDSA 1VSQA 4XD7D 4JXXA 2Q6OA 1FW8A 3Q9SA 4JVLA 4MUBA 3AUYA 4BX0A 4RTRA 5IULC 1F0NA 4NKRA 1Z0DA 4JKYA 5F1OA 3ZKWB 2Q1XA 4FMCB 4LV6A 3U44A 2X0IA 1AZLA 2ZYWX 4X7BA 4A2CA 1W59A 2AOTB 2VF5X 4OQQA 3GW8A 2DHCA 3TRKA 5HP4A 5CFQA 3CF4G 1KJWA 2PKCA 3L6DA 4UVDA 2BM8A 5DYYA 3W3AD 4BO6A 4G85A 4BMXA 3E9MA 3VR5D 4FLMA 1SXGA 3I9LA 2WEKA 3OTQA 2PD4A 2ONJA 1E79A 2IA5A 4PLFA 4EYSA 4Z54A 1HC7A 4G9GA 4XQEA 3H8WA 3MS2A 1JHUA 2R4UA 5LBUA 1O94A 2FSFA 4HZGA 1VL1A 3GA5A 1XTQA 1ENOA 1M2HA 2UUAB 3DM9B 2NO0A 2W6QA 5FBKA 1E62A 2FTKE 3ADKA 4U3JA 4DLTA 4A2WA 3L06A 2C2GA 2A5FA 3HYRA 1PVDA 1OYVA 3TZ6A 5BUSA 2OAEA 3RIGA 1EZ1A 3COYA 3VX3A 3R5FA 4XYBA 1HGXA 4HH4A 3C24A 4ZDJA 5JYCA 2QY9A 4RORA 5DM4A 1OTXA 1Z16A 2VT2A 4F21A 1VJ5A 2CXOA 3AQIA 5TQ2B 2NSLA 2B8NA 5KHAA 1BTOA 5JO0A 5LSAA 3IE2A 4EEKA 3T3PB 3ZE1B 1OPXA 2WZDA 1LLCA 3BL8A 1UMKA 2FEAA 5BUQA 2BKEA 5L8VA 1SXJA 2GXQA 2H2GA 2PVCA 2EHDA 3G88A 4YFVA 3UJDA 1RC8A 5DWDA 4ALLA 5EIFA 4D41A 3EASA 2WKSA 7REQA 2QX4A 4GXRA 4YECA 3K6RA 1SOAA 3NR2A 2X5XA 8AT1A 3W9YA 3LTEA 3N87A 3NGLA 1U8AA 4MCIA 2KM1A 2RCYA 1EX1A 3NXKA 1H1DA 2EFGA 2W48A 4FHGA 1KK1A 4RAQA 1V16B 4GOMD 4E31A 1EA7A 3V42A 1ESDA 4JJ8A 4JYPA 3UT5B 4DQDA 3ZK8A 1J8FA 1KBQA 2FPSA 4WOBA 3SXUA 3WIBA 4JYAB 3JQFC 1Z12A 1Z5VA 4DIBA 5CB0A 3I6IA 1TU4A 2OZPA 5DX1A 1VPVA 2CJPA 3SYKA 1FNBA 1N0HA 2I33A 5J2TB 4UPEA 4CM1A 5BOSA 4F60A 2VDLB 3RF7A 3ROXA 4PS0A 1BCSA 4NYJR 1S2OA 2ZYIA 4W9RA 4CLRB 1NAHA 1VMDA 2BMEA 4H4DA 4DAOA 4MS3A 4JODA 4C9BA 2DOKA 1QCZA 4EJFA 1NBHA 5HVNA 2TS1A 3ONWA 2I71A 3BEDA 1QNFA 1N7GA 2CHGA 3IC5A 4YV2A 5CX1B 3CZAA 5SZIA 3B3FA 2F67A 3UYKA 4D3SA 5JRJA 2EF1A 3GLIB 3GLGE 4UCFA 4AQDA 4X54A 1LBIA 5C5CA 2Q99A 1U2QA 4Z9YA 4QM7A 3L6RA 2RD2A 1TK9A 3LK7A 3VZQA 1A7KA 1YQQA 1BXRB 1JSZA 3OCVA 4EY6A 3C2QA 3G2OA 2PCLA 1YK0A 4GE0A 2H1FA 1QTNA 3HACA 1DLJA 2AW3A 4YVFA 2D74A 2E4YA 3PC3A 4D3YA 1S3IA 2VSOA 3DMNA 3H17A 1FS6A 5KJCA 4HYTA 4LZPA 4KX3A 5H70A 5I01A 4IJ6A 1JEYB 2O6HA 1Z5UA 3GELA 4KP7A 4EY5A 2JCBA 3DBIA 2GJ4A 3PU6A 4XQGA 6YASA 3PIDA 2HRDA 3M6MD 2GD0A 4U6NA 4XGQA 3ORSA 1UJNA 3O8OB 1WB4A 3KD3A 4NF2A 1YBVA 5EUCA 2IWHA 4YMHA 3UN1A 3VOTA 3GT7A 4H27A 1HT0A 1ZL0A 2YXEA 1FSFA 5B3JC 1G9TA 4PIMA 3Q3GE 1N9ZA 2XQFA 5BOVA 4F7DA 2I1VB 3IELA 3MT9A 2DQSA 2Z56A 4WZBE 3EWNA 5E7MA 1I2BA 2OV3A 3OLCX 3SY8A 5CD1A 3ZUPA 5EHIA 4IKEA 1TTTA 4HMOA 4KXMA 4C7JA 3OCXA 2AI2A 3THOA 1RXWA 2J3KA 4HRVA 3VH1A 3C5EA 3NCHA 2NXCA 3BQMB 2QUHA 4O4HF 4ENRA 1N0UA 5GQSA 1VHTA 4LWOA 1M6HA 3C6KA 4WKBA 1XCPA 4GMFA 4JCOA 4PYQA 5ALJA 3U3MA 3FXAA 5D87A 3EAGA 1OAOC 3JQPA 3UAZA 1LBEA 2VBGA 4FHDA 4S1OA 1UBHS 3N05A 4KNYA 3VISA 1Q0SA 3N2EA 3A1EA 3BG5A 1DKUA 1H66A 5T57A 2DHRA 2LIPA 4O2BB 1GADO 2UZ0A 1O0BA 1QIGA 1TX4B 2XB9A 4OJTA 1VKJA 5IW8A 4G1BA 1Y3CE 1IBSA 1XLVA 3I5XA 2E2WA 3B1JA 1E3JA 4LJ9A 4Y6SA 1HDGO 3RW9A 5IN4A 4C0WA 2CDBA 4XR9A 4C3ZA 4AZ3B 4BX3A 1KI7A 4WDQA 3GCZA 3IMFA 4WRRA 3CPEA 4RKRA 3AEQB 5TPZA 4D9BA 4AF7A 3DLBA 4KQWA 5DISB 3MGKA 3B20A 3VR6D 3RUCA 3FKSA 1AKUA 3OZFA 5AVKA 2LCQA 1QP4A 3U7RA 2EGHA 3BZWA 1DI0A 2FYTA 3KXPA 3DPUA 1CJMA 1CVLA 2GEBA 3PUJA 5JANA 2HR1A 1XVTA 4C06A 3GRAA 3T38A 5JQGA 3A3PA 3QU2A 2J1LA 3OIWA 1MAWA 5IYZB 3E84A 3HEBA 1V5EA 4H7DA 3T7SA 5LMCA 2RK3A 1UZLA 5FWXA 2XCUA 3D1LA 2W8BB 1WSBA 2HO5A 2GZRA 2DGDA 1K7FB 2GZSA 4E5PA 4Z0PA 3T3NA 1C41A 4F4UA 1KBZA 2E82A 3FHLA 3FVWA 6GPBA 1TLTA 5JASA 1YACA 2JZNA 3EIWA 2YWCA 3ZQJA 1OZAA 4MKHA 4WE3A 4OHWA 1MHTA 1BGWA 1DCFA 6AT1A 1TYCA 4PG7A 3WQQA 4IRMA 5LKAA 1NI4A 3HFSA 1UXGA 3CH4B 3LLUA 4MXDA 4I50F 4LXXA 4CQLB 3FPEA 2IPAB 1YFLA 3GV0A 4I8XA 3W5HA 1FP4A 4J6FA 5H02A 1QYXA 4WEQA 4DT1B 3QM1A 3RF6A 2PQ6A 1WQ1R 3MSCA 1MH1A 3TLGB 3AINA 3GLHB 1DC3A 4IUDS 4PC1A 4Y2TA 1SCDA 5ITVA 2ODQA 3G5MA 2UYGA 1PGPA 3PUIA 3WP0A 4ETNA 5K3EA 1MVNA 3BD8A 4RF2A 4DCUA 3IE1A 1J5EB 1DRJA 3RJZA 1Q0PA 1WMDA 5DV9A 1IULA 1KF0A 4MVJM 5BO5A 3BERA 3G0OA 3SE0A 5KMGA 3RUEA 4C4RA 2WM8A 1DO2A 3P1JA 3DCNA 1LBHA 3PP8A 1BKYA 3RSFA 5JS8A 1KFBB 3R2JA 3SZMA 1YUBA 1XXHB 2AMJA 2WWRA 3GA7A 4TZKA 3IQWA 4LE1A 4YUXA 2O59A 2IOYA 4LHEA 2Z5FA 1R0YA 5T8KA 5K1ZA 1Y1TA 3WADA 2FV8A 5BWLA 4UQOA 4RHEA 2JGIA 2VCYA 2Z57A 4RM3A 1BQ3A 3I6QA 4MUGA 1YU6A 3EQ8A 1CP3A 1DHTA 1AURA 3H2JA 3P9YA 5IVHA 2H65A 1HE2A 5JHGB 4N7MA 3PWTA 1JLHA 3AFIA 2W6IA 5JADA 1TYEB 2SNIE 3HMQA 1DELA 1C0EA 2WHPB 3AHEA 5KX5A 1UZNA 3NETA 1BWRA 1MLDA 2MYPA 3ROKA 4FUQA 2G40A 4Y6RA 5CCEA 1JHDA 2JD0A 1QK4A 4QOGA 3F4BA 2JI4A 5E2IA 1KIFA 3QU5A 5LIPA 1XN4A 3AVXA 5AUQA 3OY2A 4DOMA 2I22A 2XRMA 1H1TA 5CXSA 1YSCA 3LMKA 4C0HA 4GLJA 4UUAA 5DU2A 4ED9A 5F3WB 2B36A 2DBRA 4MRNA 2GT1A 2XUPA 3LPDA 3RKUA 3W3ZB 1G7RA 2ZM6B 2XLBA 1I3OA 3CEJA 5TY0A 3T34A 4C05A 1N6PA 2BD0A 1KP9A 2JW5A 1UBUS 2XVZA 1Y3BE 3UK1A 4CKCA 4A6PA 3KQLA 3WBBA 2FMHA 1SVMA 1SR8A 2O8DA 1U7DA 3B82A 2NO9A 1HNZB 2RKOA 2B83A 1WD7A 1JEAA 2G5TA 2QM3A 3KLPX 1OXTA 3PNKA 1FMCA 3OPYB 4NICA 4P6VF 5KWEA 3PNYA 1I4DD 4YK7A 1J90A 5FV4A 4FEEA 1HRDA 2XTJA 2EX4A 2Q41A 5F2KA 4BQFA 1LI7A 1LKZA 3TKYA 4ZVVA 1WCWA 2QBYB 3A27A 1GGFA 1NMSA 3L0OA 1SHUX 2G0AA 4OPMA 3DHNA 3MCWA 3H97A 3RTDA 1COZA 5C52B 4QM6A 3IBFA 1TEHA 1VIDA 4GI7A 4HFRA 5DCLA 3RC1A 5AESA 2AOUA 4DA7A 3WI7A 2MIIA 1EM8A 4FTWA 1O6FA 2F64A 3P2EA 3D3QA 3KQMA 3NNNA 5KYNA 3D5EA 1JSXA 3V2HA 3L7BA 4HL6A 3R7AA 1YO6A 3L41A 3DP9A 5LDHA 2QLJA 5JWHA 1Y7LA 2I1QA 3LOUA 3NJ4A 3P5BA 4BLWA 5JZVA 3BXPA 1OYOA 2XA2A 4ROTA 4AO7A 5IK2D 1JPNA 1O96B 5G4KA 4E22A 3CX4A 4NQZA 1VA4A 3H19A 3UHAA 2LUOA 3OZBA 3AERA 1KJ8A 3QVMA 1AQJA 2Z8YA 1K6EA 3G7NA 4IHJB 1K3UB 3LL7A 2VYNA 4E15A 5LZ2A 2FRDA 4DV3B 5B7PA 1TI7A 2Q1SA 1GTRA 1G6OA 2JJ2D 1J8DA 3JQDA 4Q1AA 4L0MA 4WTOA 3G8BA 3NDIA 3DYBA 3F6BX 3PTZA 4XM1A 5H82A 1MQ8B 1N4AA 3RUDA 4BKRA 4UU0A 2XB6A 3R3JA 4IX1A 4LQLA 1AY0A 1U0JA 4DV1B 5KYVA 1QCDA 4I9NA 1L5WA 4HADA 3HFGA 2V98A 2BKAA 4OXKA 1ZUD1 4QDXA 3S1SA 1G63A 3OCWA 4CM8A 1C8BA 4JSTA 1IDN1 4NBWA 4V2IA 3G2KA 1E9RA 2RFLA 1H8EA 2R60A 1JHAA 3ASUA 1EHYA 2J7PA 3F6SA 1T4MA 1GGNA 2HJWA 1W5EA 4HEHA 5KYXA 2Z1NA 3QNUA 5DHPA 3ZCVA 1T2VA 3SG0A 1UC5B 2X14A 1OI3A 3LYAA 2D2IA 2X6QA 4JQOA 4KAFA 4OSPA 2ZRGA 5J5CA 3M2TA 2CZCA 3KKMA 4OHRA 2VDUE 4LHYA 2ZZMA 4P35A 4NJOA 1Q7CA 2XQVA 4UKDA 3KSZO 1KZHA 3DPSA 1NV9A 2YL2A 3OBIA 3FLMA 4M55A 4GD3Q 5KIAA 2VOEA 1Z83A 4Q82A 1CJKC 2HADA 3C1TA 3VGPA 2GJSA 3LUDA 4ETIA 1DRKA 3O1IC 2W2KB 1BXZA 3LD9A 3V4OA 3OIUA 1MMFB 1Y3HA 4BFYA 3WA7A 1G59A 3MW8A 1A9QA 2X3FA 1F6WA 2FZCA 1ZW6A 1CUXA 1OBFO 3MWFA 4MEAA 1H2XA 4GP6A 4D5EA 5HUQA 3E22B 3LWNA 3G2IA 1KI6A 2NTYC 3E03A 3HWSA 4OJNA 4DVGA 2B35A 2I6GA 3AU9A 1DCKA 2XXJA 3SQMA 1YL7A 3F9IA 5EQDA 4R8MA 5KJ6A 2CNWD 2VHYA 3KAKA