3Q9LA

The structure of the dimeric e.coli mind-atp complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, hydrolase
molecule keywords Septum site-determining protein minD
publication title Determination of the structure of the MinD-ATP complex reveals the orientation of MinD on the membrane and the relative location of the binding sites for MinE and MinC.
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q9lA00
3AV0B 3B1YA 4HUQB 5TXGA 2CCKA 4OJQA 4CT5A 1Z2CA 2GXUA 3RRZA 2ZI4A 3U6BA 2WWGA 3RWMB 1W4CA 2BCGY 5DE3A 4DLZA 1M8PA 4JLMA 2VSFA 2GBLC 3AP3A 5CDFA 2B8TA 2DY1A 2C77A 4OI1A 4HDQB 2NO0A 4IDQA 2IS4A 2ZS8A 3RS2A 3K0SA 1G8HA 1QF9A 4ZDIA 2QP3A 3RWOA 2QORA 1NRJB 3O8RA 2GHIA 2ZUCA 1SHKA 5JRZA 3FKSD 2IYRA 2IWRA 1NBMA 4GP7A 3UG7A 4B71A 3GFPA 4B3XA 1VIAA 3KQLA 3T34A 1CULC 2WAXA 1VG9B 2C03A 3CZQA 3NBYC 2OZEA 4LJYA 4NL4H 1EWRA 4WXPA 2FEOA 1P2VA 1U8AA 3VHXA 4TSFA 1SXJC 4DCVA 4OL0A 4P3YA 4TL6A 4B3FX 1ELOA 3AKCA 4GOJA 2QRZA 1SGWA 2QY9A 3LXXA 5A5GA 4LV8B 1Z6GA 3K53A 2OBLA 3SJCA 2QSZA 2O8CA 3MMPA 2XZOA 4TN1A 2WJVA 2HYDA 5DN6D 1RYFA 1YZKA 2V1UA 2D06A 3C7KA 5F98A 2O0KA 4BZQA 4DT1B 2HYIC 1XMVA 1IY2A 1XMSA 1ZM7A 4CEJA 1GL6A 1VYUA 3TH5A 3ZVNA 3E1SA 3RSOA 5CLLA 4ZDJA 4IJMA 3K09A 1WRBA 2YHSA 4KFTA 1Z6YA 5KYKA 3KX2A 2WOOA 3QNUA 2JLYA 4RD4A 1M7BA 3C5HA 2QP4A 4POAA 1PUIA 2XSZD 2IX3A 2CL0X 2ZUDA 3KJIA 4Q1FA 3TUJC 1NJFA 4UXIA 3TSZA 1M7GA 2WWIA 5BN4A 5H1YA 421PA 4CEIA 3A4NA 3VR4A 1DO0A 2ZSFA 2JLRA 3KFXA 1Q12A 4DRZA 1OXUA 1IBRA 3K1JA 1YHNA 3NEJA 4URWR 3H84A 4BFZA 2QL6A 5LD2B 2JLSA 3ZVRA 2OV2A 2SHKA 1OXVA 3NVAA 1F48A 2CCGA 4Q1BA 1OXXK 3GLIA 4Q18A 2D7CA 5FTLA 4QOSA 1MRSA 3THYA 2GNOA 1S8FA 1XTRA 2AK2A 2QUZA 4LJ4A 3U4QA 1DAEA 2V1XA 3GJ3A 3DM5A 4JT4A 2RCNA 4AKHA 1SVWA 4XSGA 3FHOA 1W47A 5GJWC 1ZC3A 5L3SA 1P73A 1AK2A 3KXIA 4U7DA 1N5IA 4V02A 1VG0B 2VSXA 4ZIRA 2XB2A 3AF4A 2BBSA 2W2XA 1XD2B 3KKMA 3ADDA 1ZIPA 4LJ7A 3IEUA 3K0AB 3OIWA 4M22A 5EXTA 3SJBA 4BEBA 2NOAA 3QKTA 2GF0A 2OM2A 1W49A 4AI6A 1ZBDA 2QPTA 2RGAA 3MUFA 4I81A 5BYKA 4QHSA 4KJZA 3SFZA 1P3JA 2IF2A 4J0QA 1GITA 1E6CA 3B8HA 2ZETA 4QG7A 1E9RA 3N5CA 821PA 4K8OA 1GL9B 2ZU6A 4TTRA 2OUKA 4MKGA 4N1AA 4M9ZA 2GJSA 1M6NA 2BWJA 2DWPA 2W2TA 1TTTA 2GAAA 1G1MA 1KMQA 3MWYW 4JYCA 4JZKA 3I62A 3FYHA 3VNVA 3TVTA 1O3YA 1XXHA 2O5VA 3I4LA 4M1OA 5G40A 3K0EA 3V4RA 1Z0JA 1ZRHA 4R98A 1K8RA 2OG2A 1WQ1R 1DARA 3CRMA 3EA5A 1XRJA 3KJHA 4I1UA 4HLUA 1SVMA 1TADA 4LJ6A 3SBEA 6Q21A 4M2LA 3VKHA 4C0LA 2G77B 2ZRIA 1F2UA 4G5SA 3B60A 4LBVA 4G5GA 1HH4A 1VYVA 5J4YA 5F9HA 3KQNA 1E2GA 2IYZA 2YOHA 4Q7KA 4L16A 5EJEA 1MABB 4LRWA 1Z0AA 1II8B 1KKLA 2GRJA 3FFBA 3BK7A 4QGAA 4NE2A 3QEJA 3TBKA 3BFXA 3HR8A 2ZJ5A 3MG9A 5A0FA 1UPTA 1Q57A 4OQMA 3PUYA 2FPLA 1FX0A 2YJTD 2GK6A 4UNSA 4X8LA 3PUZA 1XWIA 3BORA 4TQ9A 4QNMA 3EZ7A 3B1VA 1I4LD 2QE7A 3CRW1 5FI1B 4EPWA 2V55B 4B6FA 3OEED 2FF7A 4B76A 1H8HD 4LDJA 1G3UA 4BE7B 1KSHA 1TQ2A 4OYHA 1IN4A 4JVSB 1G19A 1IN8A 1LS1A 3W3AA 2VF8A 4ARZA 4QM7A 2YKGA 4Q47A 1E0SA 1GNQA 4LCBA 5AUNB 1Q0UA 4IOMA 3QF4B 3K0FB 1P6XA 4MYCA 2G0TA 3I32A 5JI2E 1TUIA 2XTMA 4C4PA 1UAAA 3ICEA 5TV2A 1R7RA 2GTPA 3LVQE 4C0AC 4Y0VA 1F60A 2Q3HA 4HAVA 4L8GA 4PQYA 4AYTA 1OIXA 4GFDA 4JL5A 4GZLA 3T61A 4Q21A 3K09C 4XVRA 1PV4A 2NIPA 2WWFA 3U3MA 4US2R 1COWD 2I1VB 4RKEA 2G6BA 1LB1B 4UKDA 5JEDA 5L3QA 3THXB 1E98A 1KGDA 2ZS9A 2JIZD 4BWYA 2ZM5A 1RC8A 4US0R 1JR3A 3LW7A 2NMVA 4XTCS 1E94E 5D3MB 2ZIAA 4NH0A 2OCYC 2HEIA 1NSTA 5BN5A 1Z07A 2CCJA 2A9KA 2RGEA 3UMRA 3I72A 2B6HA 3L0SA 3KJGA 4KSBA 2ZRFA 3ZZTA 3C14C 3D3QA 1RYHA 5J5CA 5D3QA 3CW2A 3ADKA 2HJVA 2EYQA 4R7ZA 1X1RA 4B35A 2XOKA 1T3SA 2ZYVX 3IHWA 4EDHA 4U02A 4TTPA 1O87A 1P2SA 1CP2A 1TQ6A 2IHYA 3LA6A 1LY1A 5H68A 2J45A 2XXAB 3AKEA 1R2QA 1XTIA 1W4BA 1XCMA 1VTKA 4YONB 3BJIC 5SZHB 2ZSBA 2A2ZA 2F7SA 2QAJA 1VHLA 1MH1A 2J0UB 1R5BA 3G0HA 4FIDA 1VMAA 4R2HA 3GPLA 3LVRE 2F1RA 2BMJA 1Z0IA 4OQFA 2D74A 3PV0A 3VX4A 3K9GA 4F4IA 3P20A 1AZSC 2OAP1 1VDZA 2ZR9A 2GA8A 3IQXA 3QG1A 2AWOA 2G3YA 1SXJE 2DFKB 2FFQA 3F8TA 4YC7A 5B2ZA 1XCPA 2X77A 1KZGB 1KMHA 4TZ0A 2GEVA 1UBFA 2FGKA 5HKKA 3GJ8A 3EG5A 1IN7A 1MV5A 5C18A 2X1VA 4KCGA 4DLWA 2EFEB 3FMIA 4OQNA 4C0KA 4ESVA 1G16A 2ZR0A 2ZI9A 3PEVA 4TMKA 4B3DA 3U7FB 4KLZA 2ZTSA 4HLUC 4A0FA 4LSGA 4Q02A 1RRGA 2CJWA 2CNWA 2IC5A 1GILA 4QBHA 2IHBA 2F6RA 2AKAB 4UJ5A 1PLJA 3GJ6A 2ZRMA 3RSLA 2LCFA 3GP8A 3U2QA 3S1AA 1CS4C 3VTKA 4ASUD 3CR8A 2N1BA 4NYJR 4DLXA 3GLGB 3UKDA 2X8AA 2VBCA 1L4YA 4WZBE 4D4LA 3QJYA 1Y3AA 1CJTC 3C41J 3GEEA 2B8WA 2GZAA 2GESA 1S0UA 4NYJQ 2IS2A 1SULA 2WJGA 1WF3A 2GZHA 1TQ4A 3X1XA 4NZYA 4PSVA 2C96A 5EE0A 1U98A 3L82B 5B30A 1JECA 4LHXA 4Q1CA 4JYBA 3NG1A 4QHYA 1OH7A 5JS7A 2W6ID 5JSZB 2QBYA 4KAXA 4BZPA 3MAAC 4NHOA 1YRAA 1G7RA 2QMHA 1TQDA 3NBXX 4MRSA 1MO5A 5CM9C 1WCV1 5DLQC 3BB4A 1W5SA 4YDHB 2PEYA 4A8JB 1XPRA 3EZ9A 1X8LA 4EKDA 1Z6AA 2IYQA 2WZQA 4LUCA 2BKEA 2YC4C 4TLCA 1Z3IX 1VG1A 4QRHA 2UVQA 3PUXA 4CDGA 8OHMA 2GZDA 1KO4A 2QT0A 2ZXUA 2HXSA 2QG6A 1K5GA 1OW3B 1ZUIA 1UBGA 4R2IA 5TB5A 1FW6A 2IEYA 2A5FA 2FV8A 3OESA 2ZRCA 4M8NE 4XTRA 1HY3A 1K6MA 2ORWA 2QPAA 1NMYA 2BIFA 2BDTA 3PCRB 4HZIA 4LYAA 5CIQA 5EE3A 3U3RA 1IHUA 3GLGE 3C15C 4JLBA 1U8YA 4P4TA 3T1QA 3HJNA 1VKJA 3W8RA 3WP0A 3IEVA 5AJVB 2WKPA 3TSOA 3SBDA 4Q19A 5JJKA 1IJEA 4JS0A 2QM7A 3BERA 3UMSA 2VL7A 3L8YA 3A6PC 1G7TA 2ZVQX 1E2QA 2YNMA 2R6GA 1UEIA 4M1WA 2J7PD 3DZDA 4ESHA 2HF8A 3ZIAA 4M21A 1ZD8A 4WXRA 4EPTA 1QVAA 3FWYA 3SYNA 2C8VA 3B82A 5AJXA 3WP1B 1YKSA 3W5IA 4UNQA 2C04A 1KJYA 4JL6A 1AKEA 3NH6A 3WHLA 3WNCA 2X19A 2FFBA 4DB4A 2WJIA 1J7KA 1XDBA 3IPXA 4A0RA 5CDFE 5FOSA 2P6UA 1TMKA 2IXFA 3CPJB 2DFNA 4DKXA 1DAMA 1LW7A 1XTSA 3LH5A 3TNFA 3F5FA 3U61B 2TMKA 3TAUA 5HE8A 2IW3A 4FXPA 5JBQA 1XTKA 221PA 1ZCBA 4B2IA 1QHXA 1ZP6A 1N6OA 3W6PA 3K9HA 3QSYA 1P2TA 2ZRHA 4B47A 1EX6A 2JATA 1ZNZA 1G21E 3G5UA 3LW8A 5DSZA 4ZI2A 4A6XA 2ZRDA 3QEOA 4EFMA 2OEPA 4PC2A 4DCUA 1E9AA 3ADBA 1XD2A 1G64A 2HT6A 2OLKA 1FOEB 3ASYA 1OB2A 4L4UA 1BO6A 1KJWA 5KNBA 5HPYB 4G0NA 4RCYA 1OF1A 1KK3A 2ZI3A 5JI3E 4S35A 3CPEA 2ZE5A 2F55A 3OE7D 1JQJC 2VH5R 2RHMA 2EFCB 2YWEA 2PBRA 1TF5A 2B21A 4I99A 1RRCA 2DFLA 1JBKA 3OIUA 4ZCMA 3B6EA 2IYTA 1BOFA 2Z5FA 4RJLA 1WDTA 1Z47A 4ZO4A 5HE9A 1W36D 3EZFA 2RMKA 2D62A 4UXHA 4ERNA 4PHGA 3GJ0A 2O8BA 3ZZ0A 3FTQA 4YXWD 5A4JA 5HR5A 1KSJA 4JLJA 2WKRA 4PC3A 1JXOA 4Z51A 4LBYA 4LOAA 4FMBB 2IA5A 2Q9BA 1Z5ZA 3GQBA 1G5RA 1Z22A 3QE0A 3U5ZB 4B33A 4D0NA 4FWTA 4HZUA 1M1YE 2DPXA 1XEWY 1WMSA 4B2LA 3PQCA 2GKSA 2FPKA 4DDVA 3Q3JB 3QKRA 5FPTA 4EPXA 1OV4A 3A8TA 4RFSB 3R8FA 3L2OB 1ZM3A 2WAYA 1WXQA 1D2NA 2F9LA 1JQLB 3I5YA 4TT3A 3AF0A 3WRXC 5KDOA 3GFOA 3BB3A 4NONA 1VCMA 1N6IA 1UF9A 3VKWA 4UNNA 4M1TA 3ZZUA 5ELXA 4EPYA 1IY1A 1KI7A 1T91A 2V54A 3NDPA 2VP0A 1NN3A 4AKGA 3VR6A 2RGNA 2ATVA 2YYZA 2RHDA 4AYWA 1N6PA 2OFOA 2VP9A 1SQ5A 2RGXA 3A1UA 2P2LA 1JR6A 3JVVA 4QC2A 3O8BA 5FL7D 5CK4A 1SXJD 3AVUA 1KHTA 3EPKA 1OSNA 2YWHA 2YINC 4Z1MD 1NF3A 3HDTA 2QM8A 4QL3A 2CVHA 4OHYA 4E5UA 1KK0A 2PH1A 4LV5B 2ZJ8A 3BWDD 3C16C 3VU9B 5JCZA 4XWKA 4W5JA 1N2CE 3B1WA 2BJVA 1PJRA 3KTAA 4BLSA 2ZR7A 1JI0A 4CT4B 4K46A 1VHTA 2OE2A 1MKYA 2AHOA 4RZXA 2QTVB 2WSMA 4Q48A 1V5WA 3HYTA 4JJZA 1MO3A 3T06B 5JECA 4IW3B 2KE5A 1YVDA 2O8EB 2PMDA 1WBDA 4M1MA 1PZNA 3AGPA 5FOVA 1Q1QA 4D26A 4TMVA 5FOUA 4TLBA 3CZPA 1EESA 1BKDR 1OFUX 2IL1A 4L5BA 2OT3B 4DZZA 4PPGA 3QXHA 2OCAA 5JJLA 3OF5A 1MRNA 1ZJ6A 2I3BA 2MMCA 4FI3C 4LI0A 4R71A 4IRUB 2VP4A 4LBWA 3OEHA 4QBGB 3PEYA 3LQRA 2RGGA 2GWHA 3TUIC 3NTUA 2XXAA 4LHZA 4URVR 3H4MA 4BLTA 1N0UA 3SJAA 2H7VA 2C95A 1FP6A 4B75A 4LJ5A 2W83A 5FI0B 2NPIA 5TDHA 5EP2A 1OHHA 1CF4A 1KNQA 3Q9LA 1RFLA 2J7KA 3BE4A 2XNDA 2AKYA 1CRQA 2X2FA 3CM0A 1OKKD 1E9BA 2WWYA 1BS1A 1T3HA 3VR1A 2EWVA 3M1IA 4QFMA 3WNBA 2V6JA 5FR2A 4DCTA 3SI7A 5DNYB 4C0HA 4ON9A 1IOZA 1U0HC 2AX4A 1G9XA 3KJEA 2ORIA 1JAIA 3L0IB 3KUCA 3RC8A 3D7MA 1KDRA 3OFND 4CRWB 2CK3A 2OBMA 2KI5A 1GNRA 2BM1A 1KAOA 1TU3A 3GLHA 1X1SA 2J1LA 4BLQA 1Z6TA 2XB4A 1QHSA 1CU1A 1LFDB 1NLFA 2J0VA 3LNCA 3M0EA 1IXRC 5FBWB 5DISB 3LRPA 5CJPA 4D4JA 2A30A 4EQ6A 5KSZA 1NP6A 2BKUA 4M4SA 3TMKA 3GCGA 4KFRA 5KSOA 1H8EA 2MSEB 2ZSEA 1I4DD 4Q7LA 3QPUA 3RC3A 2FEMA 2PCJA 1E1QA 2H5EA 1BMFA 3EIQA 1X6VA 2IUTA 4I1OA 4XD7A 3TVDA 3J81k 3AVXA 1UDXA 3ND9A 4DSTA 4BFVA 2OBNA 5G3YA 4E07A 2D7DA 3QKSA 3FMOB 3CWZA 4HI0E 4URXR 4DLYA 5KPJA 1OH5A 2XZLA 1WP9A 5KPDA 2CHVA 1XNJA 2Q9CA 1GRNA 4DIDA 1XZQA 4OI2A 3PUWA 2RGNC 1RIFA 1G3IA 2V8OA 1NBMD 3AP1A 3ZS8A 3PIRA 3WMEA 3R7WA 2G9NA 3F3YA 2JJ1A 5AUQA 5LB2A 4IVPA 2JLXA 3U44A 4TSFD 1ZU5A 3WYFA 4C0JA 5FPSA 2PJZA 1IN5A 3O8CA 1ZMXA 4HAUA 1L8QA 1CBUA 2WJHA 4MGYR 1R0ZA 2C2HA 1P9NA 1T9HA 4OK6A 2ZAMA 2RH5A 1GSIA 4M0LA 1YE8A 4EPVA 5JMTA 3MWLA 4RSGA 3KB2A 5KO2A 3ZQJA 5F9FA 1SZPA 3FKSA 3LBIA 1DELA 2J3EA 5JEEA 3U7HB 1HE8B 3ZDQA 2ZRKA 3H1TA 4E22A 1W2HA 2VEDA 3QVUA 1IXZA 1A7JA 1R5OA 2GJ9A 3CIOA 4CVNA 3WNDA 4G5RA 1KI1A 4OHVA 5CM8B 3BFVA 1ZNXA 2HF9A 4FN5A 3B1ZA 1S1MA 4M9XA 1KIMA 5EXXA 4TYWA 2F43A 2F3TA 2GETA 4PPQA 3X1ZA 2IK8A 5DN6A 4E09A 2BOVA 4HSEA 4H9GA 1DO2A 4EAQA 4O3MA 2ZI7A 3Q85A 3SQXA 2QTHA 2H57A 4KSCA 1XTQA 4F92B 4MKFA 5FPKA 1G6OA 2IEZA 5DYGA 4PHFA 1QHIA 3MJHA 2FG5A 5FBLB 1XCGB 3LX5A 2IUUA 1Q1EA 3RRNA 3QXXA 3KQHA 1G8PA 2NTYC 4HEJA 4CEHA 4NBSA 2R6DA 3NWJA 2CE2X 3QG5A 2QAGA 2RB4A 4MRNA 1G7CA 2G0NA 3N2IA 4V0MA 4EJSA 2FSGA 3IGFA 1II0A 1NJGA 4XVQA 2R44A 4D4KA 3T5GA 5AUOB 1P60A 4MYHA 4NCKA 3KKQA 3DMNA 4YLGA 3NH9A 1BYIA 1AS3A 5EE1A 4QJ3A 3TR5A 1XF9A 4MKHA 5P21A 2O8DA 3KQUA 2ATXA 2KJQA 3FE2A 4AURA 1JALA 3QPWA 4GZMA 1ZW6A 4LHWA 1RRPA 2HCBA 2ZVPX 1FMJA 1W2GA 4WZAE 2NO9A 2RKOA 3WY9A 2J0QA 4N3NA 1DAFA 3AGQA 4I4LA 1D6JA 2WIBA 3JZAA 4Q4JB 5FL3A 2V6IA 2O52A 3K0CA 4QBIA 4V0LA 5DI3B 2WTUA 2CL7X 1P2UA 3NC1C 1C1YA 1I2MA 3IQWA 4LYJA 5FOWA 4D80A 2N42A 3SDZA 2ODNA 3EASA 3WXMA 5FH9A 4B3GA 3R9IA 3GD7A 1KSFX 1E2FA 1NN1A 3DHWC 4HB3A 1H65A 1KSGA 5F3WB 3FMFA 1W0JA 4PO8A 2NZJA 5FPYA 1MR3F 1KOFA 1LNZA 2HCJB 2QN6A 4RVCA 2HT1A 2FDCA 1W36B 1OIVA 5G53C 4DUGA 5KU1A 3AVOA 1US8B 2DYKA 2VP2A 1P9RA 2EW1A 2IBMA 3B9QA 4LBZA 5IDVA 2QT1A 1N5KA 1NNEA 2QE7D 1LTQA 3CPHA 3WMGA 2VA8A 1OIWA 2J87A 3ASZA 3SHWA 4IDOA 3SU8A 4BFWA 3AH8A 3W9YA 2C9YA 2ZRLA 4WZ6A 1SVOA 3MWJA 4RKFA 3T5DA 2F9MA 1EG7A 1CR4A 1A2KC 1HTWA 4KODA 4LX0A 1TEXA 5TMPA 3SZRA 4Z54A 5H70A 3D31A 1UEJA 1ZUHA 3P4XA 4GOKA 5K8IA 3TRFA 3WHKA 1Q21A 3EIHA 1FP7A 5HCNA 4MYUA 5HZHA 4ACBA 4QGHA 4TQAA 2FWRA 4IOLA 1E0JA 2VPPA 4WA7A 2BV3A 3UPUA 2CBZA 3IDQA 1W7AA 4PO1A 1DAHA 2IT1A 3ZYCA 3MD0A 4JKYA 4P0TA 4IXNA 3THWA 4D4MA 4U5XA 4PC1A 2QEQA 4NPHA 3ICQB 1D2EA 4C7OA 4OHZA 3DKPA 1VECA 2OFWA 3I8XA 4D6PA 1MO6A 4LV6A 4XIGS 3GLFA 2BJWA 3H86A 3NHAA 1JR3D 1UKEA 1BYUA 1NMXA 1S2MA 4MDFA 1RJ9A 1SXJB 1A5TA 1E96A 1M7HA 1B0UA 5AR1A 5CYPA 3W34A 1TF7A 1Q20A 2YWFA 1S96A 2AWNA 3IIJA 1KI6A 2OAQ1 1YZLA 3CR7A 3MLEA 4WOPA 2XOKD 2CLSA 1E2PA 2OHFA 5KSYA 1KK1A 4LPSA 1GG2A 2CHGA 5C4MA 1EXMA 4QBFA 4JT2A 1IJFA 3EW9A 4OI4A 3THOA 1GM5A 2ONJA 1OB5A 3U7EB 1UBEA 2LKCA 4IVQA 3VKGA 2NPFA 3UIEA 5JWRA 4PTLA 1FUKA 4BFXA 3T35A 3SR0A 1AGRA 2QAGC 4GMXA 2QA5A 3R8CA 4EJSC 4Q4HA 2LKDA 2PL3A 3GJ7A 3KDSE 3UK6A 2B7BA 1L7VC 1AM4D 1D9XA 1GTVA 5DHAA 2R65A 1Q3TA 3EX7C 5AJYA 1XMIA 3CUEF 1EFRA 4A9AA 3AVQA 4TMZA 1Q3HA 5HKKD 3NIBA 3K9LA 1XEXA 1E99A 1G4UR 4OHXA 4Q1EA 4GI7A 2I1QA 1S3GA 2QRNA 2P6RA 5BYJA 1WBBA 1NSFA 4KYIB 3ZH9B 5L8VA 1T0JB 2YC2C 1XPOA 4K81B 1MO4A 4GBMA 2ZREA 1GNPA 1W1WA 4XH9B 2J0SA 2WMNB 3EAQA 1UDWA 2CNWD 3RNLA 1N6NA 4B44A 4O2LA 2OFXA 4F93B 2EVWX 3TUZC 3TSWA 4M9SA 3P1JA 3U6KA 1KI2A 1QHHB 2C98A 3DVLA 3H0KA 3IO5A 4X8OA 3LXRA 4L9WA 1QHGA 1SVKA 1JXMA 2DHRA 1CR1A 1E9SA 2ZQ5A 4L9SA 2ODWA 3TQCA 2VF7A 4PZYA 3VQTA 2Z83A 4AK9A 1XTJA 4KLNA 2ZRNA 3OIYA 1Z6XA 4Q4LA 1S1CA 1DVRA 4HAXA 1ZAKA 2PZGA 1ESMA 3TW4A 1QBKC 3D6TB 2XGJA 4JVNA 3GFTA 1AS2A 2FSFA 4HUQA 2O0JA 4YMVA 1UKVY 2GXAA 4TYYA 2W6JA 1RKBA 4BFUA 2WSSA 3CRVA 4KHZA 3FHTA 3AVWA 2NGRA 1CJMA 1GIAA 2IYLD 1L2TA 2WJYA 2L0XA 5J4KA 4LWZA 4ZCIA 2J46A 2DB3A 1CJKC 2AN9A 3BD9A 2ZSDA 1R0YA 5KHOC 4C0QC 3U3OA 3T15A 1JJVA 1Z06A 2W2VA 1ZYUA 2AD5A 1HT2E 4I1SA 1ZU4A 1AJEA 3B78A 2BEJA 1YZUA 4RD3A 3KL4A 1G8GA 3HU1A 3LFUA 1FL9A 3W3ZB 5IK2A 1AZTA 5TARA 4JLOA 4LY6A 4PSKA 4ILEA 4EIWA 2BBWA 1JPJA 3RS7A 5BW8A 1U0LA 4MQBA 2HV8A 3CX7A 2FA9A 2WICA 1IONA 1G20E 3NEYA 2KWIA 4WIAA 4BFYA 4QGFA 2IF0A 3DO6A 2BBTA 4AG5A 3E2IA 4DT1A 1M2OB 4B32A 3Q72A 1E9EA 4JSTA 4D0GA 2FZ4A 1HT1E 1CR0A 3NXSA 1D8TA 4MRPA 1CJVC 2IUSA 2GAOA 3PEUA 2GILA 1M34E 4CYMA 3ZLJA 3PITA 3ZIAD 1ZM4A 1TU4A 2D2FA 4TWZA 5AUPB 1OXSC 4KBFA 2WMOB 4QGGA 3L8ZA 2Q3FA 2GEUA 3C5CA 2AL7A 1ONBA 2EYUA 1AA9A 2F1IA 1WB9A 721PA 1LF5A 2CHQA 2YWGA 3VNUA 2B7CA 1E2DA 4RD6A 2WOJA 4OQLA 1YR7A 2HUPA 2JASA 2IXGA 1R4AA 4NYMR 4P31A 5KDDA 4M1SA 2VRWA 3PFIA 1J99A 2Z4RA 3Q7QA 2WVJA 5EQTA 5DGXA 1GKIA 4CEIB 1MT0A 4TTQA 2A5GA 2OO7A 3IPYA 2P5SA 4DLUA 5E4FA 5EP4A 1NBME 4NYMQ 3EC2A 3VX3A 3A4MA 2RGBA 1QRAA 3RDPA 2W00A 4KXFB 1E79A 1XMJA 1R0WA 3KFVA 2PT7A 5L3VA 4TZ6A 2G1JA 3RRYA 4PPNA 3O47A 1YR8A 3GLIB 3ZVLA 1ETUA 1QVRA 2MMGA 1NIPA 5GJCA 2FOLA 1IXSB 4P4UA 3THYB 3K0AA 3U4QB 4MRVA 4DDUA 3I1FA 4V03A 2XJ9A 4RCZA 1AGPA 3OAAD 3Q5EA 4MH0R 4MYTA 1YZTA 5L3SB 4OBEA 1XJQA 2D2EA 5KUTA 3FKQA 4EPRA 4OJKA 4IFBA 4PC7A 3AF2A 3LLUA 4ZIRB 3LAWA 2P6NA 3A36A 3QBTA 4BQSA 2P5TB 2YV5A 2V9PA 3EARA 1ODFA 2CVFA 1OJLA 3FHCB 2AXPA 2WPDA 1ZCAA 4Q4JA 3W5JA 2XZPA 1S3SA 1C4OA 2HLDA 3PG5A 5CLQA 4UQOA 1Z0KA 3SS8A 4W7SA 5CB6A 2KSQA 3X1DA 4E03A 2REXB 2ZI5A 5EXPA 3U3KA 2C5LA 2G88A 4NP6A 1RPZA 5K8LA 4FCVA 2H16A 1WA5A 5C4GB 3KZ1E 3RANA 4YQFA 4JLDA 4GRAA 3IBYA 5JLJA 1XXHB 4PXAA 1W4RA 3I73A 2E9SA 2Z4SA 3BH6A 1U81A 3GLIE 4GP6A 4BECA 1MABA 1P62B 4Q5IA 3CH4B 1II8A 1DAGA 5FTJA 2EWWA 4Q03A 1B23P 1N6KA 3U7GA 2GCOB 3ONWA 4TT3D 1DG1G 5L3RA 1S9DA 2ZITA 3M4YA 2CLCX 1F2UB 2JLUA 2R6FA 4ZCLA 4KBGA 2JJ2A 2ANBA 3REGA 3DL0A 1YR6A 3FFAA 1IN6A 4DEXA 3AM1A 2VHQA 1QZXA 1KDTA 2J41A 5DHFA 1E9CA 5EUQB 3KB1A 1V43A 2VSOA 3HR7A 4LZZA 4LYFA 2DCUA 4TYPA 4UJ3A 3W8NA 4US1R 4CGZA 1F2TB 2Q0HA 1GZSA 2D3WA 1FX0B 3VR5A 4KFUA 5LB4A 1KNXA 4YMSA 4JKIA 2AXNA 2JEOA 2E1RA 3QF4A 3BC1A 1DBSA 3K0FA 4TLDA 2DR3A 2ERXA 1GRQA 2VIIA 3FGNA 1SVIA 1II9A 1VG8A 3UATA 1SKYB 2N46A 2RGDA 4AD8A 3CX6A 4G5OA 1GRRA 3ETLA 1FZQA 1N25A 4JMPA 3LWNA 3CRRA 1YZQA 1E3MA 1W0KA 4QM6A 2BC9A 4H1VA 2JDIA 1XXHE 3EC1A 3O8DA 3VMFA 4ARZB 1F5NA 2FGJA 4MUBA 1E1RA 3DKVA 3QUSA 1FQJA 1FMLA 3MGCA 4DXAA 3THXA 3W6NA 2IYUA 1JJ7A 1G4AE 2DFTA 2G83A 4GT1A 4HDCA 2FZLA 3EZ6A 1Z0FA 5FL7A 1XD8A 3IILA 3GJXC 3SYLA 4IOKA 4B74A 3PEWA 2JJ8A 4EUNA 5D3MA 1P72A 5E7MA 5SZJA 2VTKA 4BFSA 4UNPA 2KBEA 4HAZA 2FE4A 4TMTA 3B5JA 4JLVA 5L3QB 2WHXA 4W5HA 2QMOA 1ZD9A 1L4UA 2OSBA 1Q22A 1DAIA 1Z2AA 2O0HA 3OEHD 4GDFA 1AIPA 5B57C 4P33A 2J5XA 4IDNA 2PMKA 2PLRA 4AC9A 3TKLA 1GP2A 5KDLA 3MJRA 3MRSA 1X8JA 1SKYE 1HUQA 1OE0A 3LBHA 4ZKDA 3T1VA 2FSHA 4DLVA 3CBQA 3RYTC 2HJGA 4AG6A 2J0UA 1OHHD 4P4SB 3EA0A 1MOZA 1S9HA 3PENA 4A1FA 3A1VA 1D9ZA 4ZKEA 2XNDD 2XTNA 2QTFA 1KZ7B 2RGCA 3SNHA 4GNKA 4NYIR 5E7IA 3VR3A 1XPUA 4O0MA 4V0NA 2XEXA 1ZD1A 1ZIOA 3EWSA 2UKDA 3GJ4A 3EWAA 1R0XA 1VPLA 4PAQA 2GJ8A 1NLYA 4NYIQ 4RD2A 3NHBA 3LO5A 3AVVA 3GMTA 3SN6A 2OCPA 5IT5A 2PX3A 4FW9A 4BLOA 4A15A 3GLFE 1E2KA 4HLQB 4C3ZA 4KYUA 3LX8A 4A4DA 2BMFA 1JR3E 4Z8XA 1RE0A 2JA1A 1A4RA 5G41A 3A4LA 1KMHB 4KVGA 3L0OA 5KOYA 4PZZA 4PR0A 3DEFA 1GWNA 3T1OA 4PANA 3F0TA 2R62A 4QKQA 1SVLA 1EWQA 2Q3MA 3K8YA 1H8ED 3TW8B 5FBQB 3HYRA 1ZM2A 4OHWA 2CDNA 2ZJOA 3IIMA 1NVXQ 1BMFD 1DS6A 4O2RA 4Q01A 2VO1A 4JVLA 4XD7D 3WMFA 3DOFA 4CIDA 3CKLA 4BEJA 4DSNA 2QU8A 3GLGA 4B2PA 1WE2A 5FR1A 1EFUA 4Q1AA 4D25A 2CJWB 1N5JA 4B3BA 4Q9LA 4WBSA 3X1WA 3QENA 4HB2A 4CW7A 2OCBA 2YVUA 2GEDA 1E2IA 1E2HA 5FOTA 3S1AB 3SQWA 1ZNYA 4PX9A 4IDHA 1E2EA 3AKDA 1T8TA 4RD1A 3PVSA 5GVSA 5JSZA 1YU9A 2ECKA 2ZROA 1OH8A 1CRPA 2D4HA 2JJ1D 2FH5B 3E5HA 1YR9A 3TIFA 3DPUA 4MGZR 3AUXA 2V7QA 4A8JA 2BCJQ 4DDTA 1X86B 3BIFA 5GJBA 1QHYA 5C46F 3DMDA 2QBYB 1ZUNB 4AKEA 1YZNA 4O25A 3PUVA 3FDIA 4JSYA 4DDWA 1KI8A 4TLEA 2VHTA 1HV8A 4PSAA 4Q9HA 4XSHA 3SFVA 3LD9A 1CJUC 3VAAA 2VP5A 2VYFA 2EFHB 2WV9A 1E9FA 3KKPA 1DTSA 5KNDA 5JFGA 1P4SA 2GXSA 1PUJA 3RHFA 1EFCA 4HB0A 4IDPA 4Q9KA 1UKZA 3IIKA 4JLAA 3A1TA 3EPJA 1F6BA 2O8FB 3AKYA 3Q8XB 1GUAA 1JEDA 3LV8A 4I1VA 2F1HA 2PEZA 1E69A 2ASEA 1NLZA 3QIAA 5AJZA 2AR7A 4DB2A 3BOSA 3OHMA 2IS1A 2A78A 5E3HA 1DG3A 3HWSA 4PAMA 3BXZA 4JBYA 1XB2A 3WYAA 1CXZA 5UKDA 3AUYA 4MDEA 4DLRA 1NG1A 3ZVMA 4B3CA 1SHZA 2ZRBA 2GJAA 3A1WA 5G3ZA 2P67A 1QHNA 4QJ4A 1T0HB 1D5CA 4PAOA 4NDZA 2ZYTX 1J2JA 3QXSA 4Q9IA 3P4YA 4B73A 1NVUQ 2NZ8A 2ZE7A 4NMMA 2OILA 2K5UA 4IVRA 2XSZA 1Z63A 1J8YF 1NVVR 4Q66C 1CKEA 2ZRJA 2IWHA 4D0LB 1C9KA 5FFMA 1Z08A 4DLSA 4HATA 1DPFA 3C4JA 4IFEA 3TAHA 1OT3A 5EZ5A 1Z29A 1J8MF 1KY2A 1NVVQ 1TPZA 1TF2A 4HAYA 2ERYA 3CNNA 2MSCB 2BMEA 4H1UA 2W58A 3R9WA 2GJKA 5E95A 2FU5C 4PQFA 1GL7A 2IYYA 2ANCA 5DYIA 1FNNA 3RS5A 2WJJA 1NKTA 2QGZA 1NY5A 3AQ4A 3MSXA 3CNOA 1A2BA 3AVPA 5GJVC 4JIMA 1EK0A 3I8SA 1OH6A 4AYXA 4DVGA 1AQYA 3LY5A 4D2IA 4G3XA 3G82C 4NTZA 4DEYA 2JGNA 5JHGB 3ZD7A 3BS4A 2H92A 1A1VA 1F3OA 1AKYA 4Q4AB 1T3LA 1W0JD 3ZGXA 1ESNA 3EIEA 2GCNA 2W0MA 3C8UA 1D2MA 1K5DA 3CWQA 4FCTA 4LHVA 4S2EA 3A58B 4TL8A 1NKSA 3A37A 4YMWA 4ZDKA 2ZRPA 4DUGD 3NDBB 2WWWA 1HURA 3B1XA 2O8BB 5K8TA 4DCNA 1G6HA 2P65A 4PHHA 5DI9A 3R20A 5JRJA 4RZUA 4ZV4A 1G5PA 4WAUA 2ZJAA 4HLCA 4A0HA 1GAJA 2UZ3A 2GCOA 1XEFA 4KFSA 4RFSA 4MITA 4D82A 3K70D 4DIEA 3CX8A 3NBZC 3W6OA 2ZU0C 4HZUB 2WIAA 2VHJA 4A8JC 3REFA 3SEAA 2A3RA 5EUMA 3P27A 1KDOA 1XP8A 2ODEA 3CNLA 4TL9A 3I61A 3QKUA 3MFYA 3EZ2A 3QKRB 4TL7A 4XJXA 5TVKA 3UWKA 4DC9A 4AIIA 4N0DA 3BBPA 1F2TA 1IM2A 2HDNB 5CITA 2OLJA 2ZYWX 4KI0A 4LJAA 3WBKA 1G18A 5GADl 3BB1A 2CL6X 1OPXA 5AK0A 3BAFA 1TUEA 1FFHA 4A92A 3FB4A 1KI9A 4C0BA 4LC1A 3T1TA 2PZFA 4NCIA 3AVTA 1J70A 1N6HA 2GDJA 4Z8YA 4DSOA 2XX3A 1W4AA 2BVNA 3OEEA 4Q9JA 1H8HA 1NVWQ 2REOA 3DOEA 4R9UC 3VU9A 2FNAA 1G41A 5IF9A 4MKIA 2IYWA 3FVQA 4PO9A 2QQEA 4URZR 2ZE6A 3SHFA 3UANA 1G291 3HPQA 3P26A 1KI4A 1TNDA 3AP2A 2IYVA 2I4IA 1T5LA 1EFTA 2CLDX 2OESA 1XEWX 3KTAB 3UWOA 4BRWA 2O8EA 4TYQA 1Z8FA 3AEZA 1KK2A 5FUVA 2VP6A 3AVYA 1TX4B 1W44A 1COWA 5BXQC 121PA 2YZ2A 1PVOA 2ZPTX 4V0KA 3ZQ6A 1P61B 2EU8A 4YDSA 2H17A 2QMUA 2JIZA 2AFHE 3QVVA 1A82A 4Q1DA 4CF7A 4IEIA 4NCJA 1YRBA 2IYXA 4NU0A 1EGAA 1XFAA 1AN0A 4LPKA 3LQQA 3B13B 2Y8EA 5SZKB 2ONKA 1KI3A 4PPFA 2GK7A 2VLIA 2V4ZA 4B34A 2PJRA 1T5IA 4P4SA 1G8FA 1EFRD 4PQRA 1CTQA 5B58C 2RAPA 4OK5A 3N2EA 1G5TA 2E87A 4V0OA 4HLDA 2FJUA 4DWJA 3TK1A 1I2DA 1IQPA 4ITRC 3HP1A 2NO7A 2GVDC 3K0CC 1XBTA 3CLVA 4Q7JB 4ABYA 5LBIA 1TAGA 3PR1A 3Q5DA 4JBWA 1ZVQA 4DCSA 2H18A 2OXCA 5IRCD 4BZXA 2J59A 1FPMA 1UM8A 4A2QA 4RFVA 5CIWA 3X1YA 1XX6A 2BMDA 4FWIB 3UG6A 3L0PA 3KQKA 1RRFA 2YOFA 5KNCA 5HCIA 3JZMA 1KO7A 3SE0A 1GVNB 1U0JA 1QG4A 3RS3A 4NKRA 1RVDA 2ZJBA 3FMPB 1RZ3A 5AWFC 1E2LA 4L15A 3U60B 4JL8A 3T12A 3ZJYA 4OK3A 2AD1A 3RRMA 3QF7A 5EXSA 3GLHB 4M1YA 1XZPA 4G1UC 1T4GA 4G5QA 4IHQA 4GOXA 2P3SA 3CF0A 2W6JD 1JB1A 1JPNA 1KKMA 2WSSD 2ORVA 4EQ6B 3K70C 3V4FA 1N6RA 3FPAA 3B2EA 1DE0A 3NKVA 2JCSA 3N70A 5HTKA 2NQ2C 4RD0A 5C1BA 4KO8A 3ECCA 1YQTA 4TMXA 1ZNWA 5ANRB 2EQBA 5FUXA 3VFDA 4ASUA 1UKYA 4A6PA 2ZUBA 3QKSB 1XJCA 3QI2A 2ZANA 3KKOA 4W5WA 5IK2D 1G3RA 4IOJA 4QNRA 4MRRA 2YOGA 5HZKA 4M9QA 4QXAA 3L43A 1S4QA 2ZAOA 4LK2A 1E2MA 3IO3A 1T8UA 1XD9A 3MWKA 2W6IA 5FUWA 3QQ5A 1GOTA 4TQUS 3I5XA 1OXTA 2QSYA 3R7WB 1HEIA 1KJZA 1LVGA 1SKQA 1OYYA 5F2EA 4DSUA 2EFGA 4ZI3A 3FOZA 1KO8A 3GLHE 1U8ZA 3U44B 2PLFA 1Z0DA 1P5ZB 4C9BA 4CZ2A 5K8UA 4AY2A 3SYKA 5KSPA 3V00A 2ZSAA 3NBFA 1R10A 3H2YA 2A5YB 2WWXA 1GDDA 2NG1A 1NIJA 2FFAA 1U90A 1OLOA 5EE9A 1CIPA 2QNRA 2ZJYA 4JLPA 1UJ2A 4FMCB 3TJZA 2O8CB 2PCLA 1Z83A 4YMTA 1E2JA 2C78A 5FBRB 4C0SA 2PZEA 1JAHA 4G01B 2O8FA 1FNMA 2MSDB 5GVRA 2W0SA 4P32A 2FX3A 1VCIA 1KO1A 3W90A 4CEJB 5JZVA 4M1KA 1FTSA 3QY0A 2ZYUX 4TLAA 1JEEA 4FMCF 1G7SA 2ZEJA 3CB4A 2ZI6A 2R6AA 5SZIA 5FTNA 2R6CA 3Q7PA 4PFSA 4MGKR 2QZ4A 3GJ5A 1CLUA 3ND8A 3IHLA 1CR2A 5EP1A 4JVMA 1Q1BA 1JNYA 1FTNA 4OI0A 3ZD6A 3ADCA 1N0WA 2H1LA 4UXJA 1E2NA 2F43B 2J7PA 3PJRA 1U2RA 3UXMA 2CMKA 2AFIE 2WKQA 5J4HA 4BLPA 2KBFA 1NL3A 5CYOA 3RS4A 2VHUA 1E79D 2QPOA 1W5TA 2Q6TA 5AJWA 5E7JA 1G3MA 1BIFA 2ZS7A 1OFIA 4II7A 2CXXA 2JLWA 2QQ0A 1E9DA 3EPHA 1N6LA 1P75A 3RABA 1I4TD 4A2WA 4OQXA 2LWIA 2BHRA 1KAGA 2VHCA 1DADA 4BRUA 2X2EA 4CEHB 2PT5A 2JLZA 1YZGA 2WM9B 2ZJZA 3ZS9A 4XVUA 2QAGB 3BH7A 1YJ5A 4QJ5A 2IS6A 1AS0A 3AB3A 4IEEA 4EJSB 3QOFA 1X8KA 2QI9C 1LS6A 4BUJA 3KUDA 1N0VC 2JLQA 2WPDD 2XAUA 3IUYA 2HLDD 2F3RA 4URUR 1GKYA 1LV7A 3QXJA 4AWXA 1GKUB 4A2PA 3P32A 3B9PA 2O8DB 1DEKA 5DI3A 5J40A 3TR0A 4FMDB 2ZRGA 2Z6VA 2AK3A 3CO5A 2QMEA 2R9VA 4ACAA 1EX7A 4W9MC 3BRWD 4Q4AA 3AF3A 3OAAA 2NO6A 1G8YA 2ZJ2A 4FMDF 3HU3A 5DIFA 1PLLA 1N5LA 3OE7A 4PZLA 1ZC4A 3OIVA 5C2JB 3QBVA 1NN0A 4BLRA 5JCPA 4BPBA 2C9OA 3DM9B 1DAKA 1QDEA 2A5JA 5JS8A 2A5DA 4KU4A 1QG2A 1UBCA 4YMUA 2FFHA 3RAPR 5J4LA 3D8BA 4C30A 4DLTA 3WYGA 4TYNA 4LJ8A 2Z0MA 2JJ2D 2JAQA 1SVSA 1US8A 5TY0A 3GEIA 1U9IA 3BH0A 4YXWA 4A0GA 2KB0A 4DBLC 1ZINA 1E4YA 1HQCA 1PLKA 1DOAA 1KO5A 4KVAA 4V0ME 4WVFA 5EE5B 2BEKA 2EFDB 5BQ5A 3TE6A 2REBA 5CK5A 3M6AA 3LBNA 4DHEA 2ODBA 1VIYA 3A1SA 3LDAA 3DZ8A 4MA4A 1R6BX 5LDDC 2ZRAA 4FD2A 5LPNA 3CH5A 5FBVB 3V9PA 1E4VA 1Y63A 1P7CA 4X8HA 1NN5A 3BFKA 4JLKA 3I3SR 3VHLB 3TGPA 2IXEA 3K70B 1VYTA 1HQYE 2DWOA 3B7GA 3HPRA 1OFTA 1FUUA 1W0KD 3CF6R 2GBLA 1CEEA 1UFQA 3DDCA 2JDID 2FSIA 1BH2A 3SOPA 2B92A 4F91B 1E1RD 1NMZA 3CONA 2PX0A 2F1JA 4OKSA 2FPMA 4A36A 4BGDA 4C2UA 1G17A 4JBXA 2HXYA 2VQSA 1W46A 3CF2A 3SC3A 2C9CA 5IHPA 2QENA 4NCNA 4XWOA 3LLMA 4DJTA 3CRQA 3GEHA 1M74A 4IKEA 1AQUA 1SXJA 1LF0A 4D81A 2IYSA 4Z1MA 4UNRA 4B48A 2R8RA 4X8MA 1NG9A 2V3CC 3THWB 4FINA 2WBLC 4HUTA 3NC0C 3AF1A 5LD2C 1EFHA 4C7OB 4LC0A 2H8KA 4QHTA 3IKJA 3KKNA 3GLFB 3HU2A 4LHYA 1Q1ZA 4HDOB 1KYIA 4Q7MB 4RY2A 4U00A 2J9RA 1HE1C 1RJ9B 2FMXA 5DH9A 1TEVA 2DWQA 2QROA 3QXCA 4MGIR 4N0EA 4WW0A 4EFNA 2FN4A 3I92A 3WRYC 1RW4A 2G1KA 4BFTA 5JWHA 5FTMA 4PC6A 4F4CA 1IY0A 2DBYA 4NCHA 2CE7A 1OFHA 1VCNA 621PA 5BWMA 4AKIA 3TQFA 1KI6B 4GL2A 1TL7C 4BASA 4GSYA 4F7WA 5H8WA 4C2TA 4XWAA 2R2AA 2XNSA 3K9NA 3R9XA 3RLFA 1IAQA 4JJKA 3UMFA 1ANKA 3E70C 3RVBA 2C99A 1G3QA 2GCPA 4MUAA 5CB8A 3VR2A 2QGNA 3TLXA 4JLNA 4TMWA 4XOIA 2Q21A 2JLVA 4Q4HB 5JWOA 4GPTA 1P9WA 4A82A 1U99A 3B85A 4F4JA 4RZ2A 5JJIA 4M53A 1HYQA 2GXQA 1R8QA 2CK3D 3MCAA 1R5NA 3KXKA 2Z43A 3BGWA 3U3JA 1X3SA 2WWHA 2A7QA 3IBGA 2QP9X 4HAWA 4RZ3A 4LGMA 1U94A 1XEXB 2BM0A 1Z28A 2XJ4A 2GVZC 1UADA 2ZE8A 4LYHA 2BBOA 3SJZA 5FUYA 1XU4A 1OKKA 5J4VA 4PHTA 1E0AA 1VCOA 1T6NA 2XTZA 521PA 1QHHA 3EPLA 1NI3A 4Y0AA 5B64A 5DO9A 1KDPA 1KY3A 3KXLA 2UZIR 1E0KA 4ZPXA 1E1QD 1J90A 1OYWA 3WBJA 1R8SA 4URYR 4B6EA 3EXAA 4GMDA 1HA3A 1W36C 3OFNA 1FQKA 2NO1A 5CJ2A 5J47A 2P0EA 1U9IC 3RS0A 4IXMA 3JVUA 1KTVA 4LJ9A 5EZ6B 1E32A 3QPVA 4KITB 4HB4A 4KV9A 5JHHB 5FPHA 2Q9AA 1W48A 3X2SA 2XITA 3PXGA 5KTYA 1ZM9A 4EFLA 4F38A 2GF9A 1NY6A 4FCWA 4B43A 3OZXA 5FOXA 4HYYA 5BN3A 4ZDWA 1N3BA 1GFIA 2CEAA 5EP3A 4Q00A 5FTKA 2OXRA 1Q44A 2V7QD 1XJ0A 5M04A
chains in the Genus database with same CATH superfamily
3AV0B 4HUQB 1V35A 4H08A 4HYQA 2FPOA 4X1KB 3T5AA 3O90A 3FTNA 4CT5A 4MW7A 1VBNA 1K7XB 1P1BA 2CUZA 1PX2A 1T15A 1TK2A 3DYIA 1UL1X 2WWGA 1T2FA 1LRJA 1W4CA 3JQ8B 1SU4A 4K3UA 1ECCA 5TF0A 5AVSA 4MLDA 3JD4A 1Z82A 3N8HA 4Z7QB 2GBLC 5BUQA 3CXUA 1VPWA 3OPYI 4MB0A 3ZTTA 3ZBPA 1F0YA 4OI1A 1WUHS 2J4FA 1S4MA 3ZTYA 2NO0A 2AB0A 2C3UA 4EH1A 2IH2A 1HMYA 2FSSA 1OU4A 2IEIA 2G09A 2XT0A 3EFEA 3F96A 4O33A 3K6SA 4HYEA 2JANA 2G25A 2JGDA 2O4CA 3O8RA 4UM9D 3TZKA 1FTYA 4RHXA 2IYRA 1HSZA 1W75A 4GP7A 4GAEA 1BN7A 1U3WA 4X7RA 3UMYA 3DDNA 1VG9B 1J1IA 5KOIA 2WB2A 1EZZA 1U8AA 2JB9A 1SXJC 1GN8A 1G21A 4BNTA 4JU8A 5EWMA 5EIAA 4YX9A 3ZW7A 4U6QA 2QT9A 3NC4A 4LV8B 3GJRA 4TROA 3K53A 2JIMA 3L5KA 2FOXA 4C7KA 4DJFC 1VKHA 4IDCA 1FTGA 1UMBB 2GN2A 3LWBA 1E5DA 3F1LA 1SBTA 3AO0B 3MMPA 4XR9A 1DC6A 3R7DA 3T5BA 5JC1A 4CN8A 5JQGF 3WIEA 3CUVA 3QUTA 1EK6A 5F98A 3C7KA 1CHNA 2O0KA 1QV9A 4DT1B 1UBJS 1XMVA 2IOFK 3OU6A 5IZCA 4CF5A 1JI3A 4RFLA 1VB5A 2C3YA 1CUEA 2ZVJA 1F7VA 2OP1A 5F4ZA 4Y2PA 3FWNA 4JQYA 3LXMA 4IJMA 4R8KA 4YWJA 3K09A 2O7RA 4M76B 2N3ZA 3BD8A 5JTTA 3K9QO 3CUWA 4CTOA 1NJ2A 4WGFA 1UMDA 3C6YA 3KX2A 1ZGHA 5DT9A 5EKSA 1U7OA 2H4WA 4RD4A 4ZU1X 5KVQA 3VPBA 2ZUWA 4JYPA 2O3QA 3VKUA 1UJ6A 2IX3A 1NJFA 5CLGA 4U2DA 1M7GA 2WWIA 2KS6A 3II6X 3IOBA 1PJ2A 3LGSA 4HG2A 421PA 3ND5A 3VR4A 3PHIA 5F1OA 5IMBA 3PR3A 1P0PA 4O29A 4YDRA 2IY9A 4URWR 1YHNA 3IP3A 2CL5A 1WQ3A 3H84A 3WSVA 4DM3A 1NDQA 5K8VA 1XZAA 3PI7A 4MQFB 5EIXA 2RBEA 2SHKA 3OQIB 5CFPA 1WJGA 1F48A 5E0KB 3M1AA 3F3KA 3CO0S 3ITKA 4KPEC 2QGFA 2X5NA 2XV1A 4YJ3F 5EPEA 1MLDA 4M8SA 4F2WA 2VT3A 2NVOA 5FTLA 4ENQA 1YL7A 3L8FA 2GNOA 3THYA 4X1YA 4RY0A 4I2NA 3U4QA 2VNHA 2ILTA 4JT4A 3LHFA 2B34A 3X1JA 1JHMA 1SVWA 4XSGA 1COZA 3OOEA 1W47A 3O1HB 1CZUA 1L8AA 3KXIA 3OO0A 1Z17A 4CKWA 1FBNA 5JPDA 1CYEA 4PLPA 2QTMA 1ZJJA 3L4BC 1V26A 1X7GA 5BMVA 2I33A 4KAFA 4FNOA 2XB2A 5EVJA 3ADDA 1V4VA 2Z98A 2EJWA 3PYMA 4I5GA 3BQNB 2NOAA 1CEQA 5AHXA 1PJQA 2R8BA 2QPTA 5LUBA 3R3UA 2Q3BA 4KJZA 4QYIA 5KTKA 5SYNA 2PSJA 3GMSA 4J0QA 3B8HA 4H7PA 2YTZA 5BWBA 5ITSA 5F35A 4UD6A 1PS9A 3MT8A 1YQGA 3UCEA 2WDPA 2VJNA 3DP7A 4AMGA 5HJ7A 3KPWA 3M1LA 4D97A 1WW3A 1FFCA 2WTAA 2JEZA 4P58A 2AYXA 2GM5A 3PJEA 3C45A 2GJSA 3KALA 1M6NA 4RJKA 4UQPA 2BWJA 4KIJA 2GCGA 4KN5A 3MWYW 1P77A 2TMDA 1N2IA 3QLEA 3VNVA 5KNLA 1O3YA 1XXHA 2GZSA 3PXDA 4M1OA 3V4RA 2I6XA 4G0UA 1Z0JA 2I22A 2Q8PA 3WR5A 4C76A 3PEEA 1D4OA 1EE1A 1JKIA 2OG2A 5GGXA 5H3LA 1L5NA 4ZZIA 3DVAB 1XRJA 4I1UA 3FYSA 1SVMA 4HLUA 5HRCA 3C8DA 4C0LA 1F2UA 1OOEA 2DFDA 1JU4A 1FDTA 3QOWA 3U3ZA 1ABFA 5FWYA 1SC6A 1VIVA 3QIVA 3RT9A 5F73A 3EVFA 3A6KA 5J4YA 3BKWA 1GU1A 2IYZA 2PKXA 2YOHA 3O03A 4F85A 1II8B 5GWXA 2P9GA 2C2YA 3F5SA 4Y1GA 1QRRA 2RHOA 1TUGA 4NE2A 1FFXA 5K2MA 1Q57A 1RM4A 2FSUA 3OP4A 4ZMBA 1HLFA 1M2VA 3RC1A 4FYHA 3DV2A 4UNSA 3PUZA 5A4FS 5B30A 3QTLA 5TJ9A 4HDRB 1CF9A 1GKLA 3QV2A 3CPSA 3EZ7A 3B1VA 3ZWMA 1BMTA 4BO3A 1CEXA 4LF7B 3GLUA 2NW6A 1WBJB 4AJ4A 3RS9A 3OEED 3U3XA 1P81A 1H8HD 4H18A 4O1MA 1KSHA 4X93A 3H4IA 3BX1A 4CMKA 1IN4A 4JVSB 4PGFA 2J31A 2I4TA 4QM7A 1SAYA 4ARZA 1YA6A 1A9QA 2QYHA 4LCBA 5AUNB 1Q0UA 2GWRA 2D5IA 1E6KA 1QPBA 2HJWA 4JEIA 3R9KA 1VSVA 2GEFA 2TS1A 2OQVA 3QVSA 1MW9X 4R16A 1P6XA 4MYCA 2G0TA 2OHOA 3RB8A 1TUIA 2IHNA 5U4QA 4C0AC 4RULA 1ZXBA 2JBWA 1UK9A 2Q3HA 3AEKA 3MA0A 4HAVA 4Y0VA 4EY3A 2HR1A 3VDXA 4L8GA 1LDMA 4AAYA 1OIXA 4GFDA 4EFDA 1WCXA 3H2HA 2C2MA 4JJAA 4XVRA 2NIPA 3IPLA 3R7AA 1HT3A 2C7VA 5GZ3A 1COWD 4QPZA 1CNEA 3WWEA 5JD5A 1E3WA 2PGNA 3DDSA 2VTEA 1PTJA 2FXIA 4DRXA 4TM8A 3D2AA 2JIZD 4KQIA 1UAYA 4MV0A 3U1BA 2ZM5A 1CUWA 3QHAA 4RIGA 3VC3A 1JR3A 3G1WA 3LW7A 2NMVA 5EWLA 3TIIA 4D8VA 1JBQA 1NSTA 3GFFA 1Z07A 3VR5H 2TMYA 1W93A 1JSZA 3L0SA 3F7NA 4YYZA 2WI8A 1LI7A 2FJ0A 3PXBA 5EJ5A 1DEAA 3F97A 1GZ4A 1NW3A 1SZCA 2C2GA 3O3CA 2L19A 4IQ4A 4WBXC 3WGYA 5LLDA 4R7ZA 4ND8B 5B12A 4KH0A 5AVKA 3MW8A 3GPDG 1BXKA 2XOKA 2X42A 3IAS6 2UV8A 2EBFX 2NXWA 1OGYA 4JASB 4EOGA 2FPIB 3L8HA 4LKOA 1O87A 2IHYA 1JQEA 2C5FA 3DNMA 5H68A 1NF8A 3L06A 3K4QA 3HBNA 4LRYA 4RW0A 3RR2A 2Y2VA 5HGXA 4HNVA 1A69A 1A8PA 2AG5A 4EMUA 1Q6YA 2R60A 2QAJA 1I1QB 5EI5A 1R5BA 3H11B 2ZYHA 5IS2A 9MHTA 1AV6A 1KH2A 1P31A 1X14A 4XDYA 2CVQA 3I28A 4DMKA 2D74A 2RIPA 2C82A 2A0FA 3OIFA 3NT5A 1LJ8A 3PFNA 4IWYA 4P1ZA 4MQEB 1GQRA 1QP8A 2A0XA 2VJMB 1V5IA 2WD8A 4KQ6A 4OREX 3PVZA 4F2PA 1WWKA 3IQXA 4L8YA 2G3YA 4ZT7A 4MVJF 4YC7A 2X5KO 3F8TA 4Z9YA 5B2ZA 2FFJA 4BBPA 1PZEA 4D3SA 3L7CA 4EEZA 4M7WA 4TZ0A 4X3CA 4Z3OA 2P3OA 3RVSA 5M29A 1YIDA 2H8GA 1KVSA 2ZWMA 3CWCA 4MNTA 4R8VA 1I6LA 1K9SA 2J3IA 1BS9A 2AJCA 3I9LA 3K2EA 5LLSA 2EAUA 4GX5A 4OYLA 3EVBA 4R81A 1TW2A 2Q1SA 4PFJA 4C0KA 5LQCA 3GT0A 1SOVA 1ISJA 4DR3B 1G16A 2V98A 5CFZA 1TYBE 1FCJA 3F7TA 3GUCA 4KLZA 4LS3A 5JTUA 1RRGA 1GILA 1W9HA 5E8JA 2WU4A 2F6RA 5JDCC 2HRDA 4F8JA 2DLNA 2YV1A 2FB9A 3D3WB 4URHA 1PLJA 3CUUA 3UAOA 4AJIA 4DLNA 4KDFA 5ALJA 2A84A 2BP7A 2LCFA 1VE5A 2R11A 3U2QA 3GP8A 3VTKA 4HS4A 1KXZA 2N1BA 4XUGB 4CCSA 3GLGB 3UKDA 4D8YA 1WXGA 1BZYA 3FBWA 2D7JA 2P9HA 3C97A 4OX9Y 1VA5A 2I2AA 4PGGA 4F9GA 1CJTC 3PFKA 1ZFNA 1WVMA 1ENZA 1XALA 2GZAA 1S0UA 2W4IA 2QL9A 4NYJQ 1ENPA 1TQ4A 3MMNA 1LW6E 2Q2QA 2C96A 1LPOA 1U98A 2Z8ZA 3L82B 3M81A 1QJ4A 1JECA 1HE4A 1Y4UA 5E9WA 5F77A 1BOOA 4Q1CA 3KL2A 4JYBA 3NG1A 2YCLA 3BD6A 3I53A 4HEHA 5DX1A 2JGFA 4GM4A 2GEJA 2AC2A 2WG2A 1WW8A 3FUVA 2PUHA 1B8PA 1Q0HA 3MAAC 4HF7A 4HMOA 1MJ5A 3WL7A 1QB7A 1YRAA 4L3WA 4TXNA 5EL0A 3ZQUA 3NBXX 1Z5UA 4LZPA 1MO5A 4MRSA 5CM9C 5I47A 4MCJA 4CLOA 5AW7A 4AZVA 2D5LA 5FEMA 4L4YA 3BSWA 2PS3A 1XC7A 2GK3A 2YC4C 3KZVA 1W8IA 2SBTA 3KEOA 4JJ7A 4ICIA 4Q4DA 4QRHA 4ETIA 1X7DA 3WGQA 5DM4A 1MPTA 4HGZA 4BDSA 3VA7A 3D7KA 2GZDA 4ESEA 5A7HA 8OHMA 2ZUFA 3FSGD 5EJ9A 2VHXA 2QG6A 4XX0A 5I3CA 2XKAA 3QGMA 1UBGA 2QSJA 4G4JA 5TB5A 3W79A 3GARA 1FW6A 2XCSB 2ZRCA 4M8NE 4XTRA 1K6MA 1VB3A 2QPAA 2BIFA 2BDTA 3PCRB 2GPJA 1LV8A 2AG0A 3KEMA 4LYAA 1CUVA 2E2WA 5LYYA 4PG6A 4F1KA 5E38A 1Y8CA 4FYMA 1Z8DA 3UT5B 3V8BA 2Z9CA 2AG8A 4GF5A 4P4TA 3T1QA 4ALKA 1SUEA 2NACA 3CR3C 3FOBA 5GONB 4ZVOA 3W8RA 3KLNA 3LF2A 4W6ZA 5B1HA 1ONPA 5CD1A 2GD2A 4WZAA 4CCWA 1DNPA 3CN7A 4DR2B 3H5LA 4YI3A 1Y4DE 1MJNA 3UB4A 3VYTB 5DV9A 4L74A 4PQGA 4HVCA 3COJA 2ZVQX 3OQHA 3GNLA 5EQDA 2QL5A 2VYCA 4YT5A 1UEIA 1UC9A 3NHJA 4KLRA 4M1WA 5I01A 3ZIDA 4ZN6A 2HH9A 2HF8A 3ZIAA 2ZUSA 5BNTA 4Q24A 5AT1A 4EPTA 1CUHA 2RI6A 3GC6A 4PLYA 2FVXA 2ZULA 2DF8A 1SIUA 2WJAA 1X70A 1T0BA 5CA1A 1NA5A 1E4EA 1CK4A 4Y2QA 4UNQA 3LL7A 5HMMA 5J2UF 1QZZA 5EJ4A 1AKEA 2YHUA 3M4ZA 4J0JA 3HYSA 2NXJA 4DIKA 3IPXA 4IRXA 1UXGA 1IZ9A 1L1FA 4XD2A 1Y7PA 3CPJB 2PZLA 5EIHA 4BGEA 3L7AA 1NNLA 2CZQA 4U2FA 2FY8A 4WH0A 3TLZA 2AH5A 4B1FA 4IZHA 1N8NA 3PJGA 3QE4A 5ICGA 3UK1A 5JBQA 2B9EA 4YLYA 1DRVA 1U2TA 1IM5A 5JVDB 3I4FA 5BPHA 1GLVA 3WE7A 1I01A 4HX5A 4AWAA 3A4VA 3QSYA 3IVMA 4ENTA 2ZRHA 4LOLA 1GAWA 3A04A 2JATA 2PFSA 1BRMA 1G21E 4MINA 1QM5A 4OBWA 5D51S 4BWGA 3I6QA 2OEPA 1TVKA 2OWDA 1E9AA 3ADBA 3ANTA 1BXGB 4EFKA 4AJOA 1Q6ZA 2FQXA 2G08A 5T41A 1G64A 1K0FA 1NXSA 3C6KA 3FROA 3R7LA 5CGQB 4LNAA 2MT9A 3KKKA 4DG5A 1JQ3A 1QK5A 2UUPA 1DXQA 4OYYA 4K2HA 1P7YA 1Y89A 2ZE5A 2G9QA 2IXDA 3W2IA 1JQJC 2YWEA 5TF4A 3FSJX 4DLPA 2PBRA 1KJQA 1KHHA 1RRCA 4XDHA 3V2UA 3OIUA 3WGHA 2Y93A 1BOFA 4LSZA 1U5BB 4W5QA 4C22A 3DAYA 3W5VA 3N2KB 2HJSA 2XVYA 5TJHA 3EZFA 4PG8A 2V6MA 5HKLA 4YO8A 4PHGA 1URPA 3EH2A 1TYAE 3QFRA 3THSA 3D1VA 2G36A 3MTIA 2NWQA 4WCVA 4PZPA 3FTQA 4IIVA 3E3AA 5HR5A 3ANXA 2FWBA 2XT6A 4V38A 4D6XA 5IBCA 5IZ4A 2WKRA 3H2KA 2PUGA 1JXOA 4DJEC 1Z45A 3GQBA 1G5RA 3E1GA 3WQBA 3BA6A 4JR1A 3SQNA 4YV1A 4FWTA 3P9NA 3T0GA 3DNPA 3IT3A 3TEFA 4DIOA 4MW1A 3PQCA 3AB7A 3GEBA 3KLMX 4FE4A 2OFFA 2EV9A 2H7YA 3JQEA 1G5HA 5FWAA 3L3BA 4AQDA 3K20A 1X1QA 2V5VA 2Z1NA 3I6ZA 1H05A 3H5TA 4MDYA 4RFSB 3SZMA 1ADBA 1ZM3A 3CVJA 4N7BA 4UZFA 3R8FA 3H2JA 2OV3A 1N0HA 1QZUA 2QUIA 3NBMA 3AF0A 1D7OA 4ZVKA 2X40A 5K01A 3IA2A 3CLSC 1NPTO 2IXTA 2X6QA 2CMGA 3BB3A 1I2ZA 1VCMA 1GAEO 4MR8B 1N6IA 3ZE9A 1UF9A 2WV7A 4LVCA 1JRLA 3PC3A 5FRDA 4M1TA 1LSUA 3E7WA 4MVJI 5DOZA 4EPYA 2V7UA 4DM4A 1IY1A 1D4AA 2V54A 4ZYWA 3NDPA 5IPFA 1VI2A 1JX6A 2RK6A 2VP0A 1QTNA 3KTOA 3QOXA 4NY1A 4EBBA 2RAUA 3I9FA 2Y1OA 1KOLA 1OTHA 2RGNA 1HL7A 1BWRA 3C98A 4ZYUA 1N6PA 2OFOA 5KCZA 1IUKA 1SQ5A 2RGXA 1JQBA 2P2LA 3CG4A 4X7MA 4HNSA 3ACDA 3ID6C 1XKXA 2YIJA 5TIIA 5LL6P 3RVRA 2O2CA 3D3NA 1OSNA 4UAJA 1NZJA 2BGJA 3HDTA 2QM8A 3MUEA 4YB8A 1QRTA 5G1PA 1Q0SA 2FEKA 2ZJ8A 1XPJA 5FQNA 5KMGB 4C04A 1IU9A 1S3FA 4KPUB 4XVHA 2CV1A 4BLSA 3KTAA 3WAKA 2OM6A 1EH5A 1JI0A 3FDZA 2AF4C 2Z3WA 3PQFA 1R4NA 1EQ2A 3JQPA 1EQUA 1PVDA 4KGDA 1NASA 3B7WA 4JDUA 1DTWB 1J39A 3OWOA 3UJ8A 4RZXA 4Q3NA 5HKOA 2AI2A 3TQHA 4PYIA 3BBLA 5IASA 3IMEA 1ZH6A 3FWKA 2KE5A 1O94D 4MTLA 4N03A 3RF6A 2AVDA 4LOIA 1FRZA 2PMDA 4HGQA 3TIGA 2VLBA 1PZNA 3I01A 1X1CA 3VOBA 5K6AA 4EZEA 1LRLA 3HEAA 2QDKA 3OQBA 4D26A 3O8NA 3NHSA 3U7QA 4TLBA 3CZPA 1A88A 5LMNB 1Z4KA 2J6IA 2FWIA 2PXXA 3M33A 2OCAA 3ZWPA 1I1NA 3OJOA 3P52A 4OU5A 3ZCTA 5AK3A 3WJAA 2OQ2A 4LI0A 4FI3C 1ZJ6A 4D41A 1IVSA 4NBVA 4GVXA 1OR8A 3UK7A 4LF6B 1U63A 3U31A 1J21A 1R50A 2GH1A 2IZ5A 3LQRA 3NWBA 3BMCA 1WS6A 4LY9A 4CN9A 1T9CA 2Q8QA 1X1TA 5B1SA 1J9ZA 3H87A 3KOOA 3JASB 3OFVA 5IAJA 1X2EA 1RWOA 1ZESA 3SJAA 2ZSIA 3QW4B 1TZBA 3QLJA 1AVTA 3KE9A 3KJNA 1FP6A 3WL6A 1Q2UA 2IOQA 3MHTA 3S4YA 1ZISA 2NPIA 4QVIA 2B37A 2A9OA 1CF4A 2HU2A 3ZZNA 4ID9A 2PPLA 4MVJA 4OHKA 2VPWA 4YT2A 5HIKA 4PBTA 3BFPA 4XQGA 1U8EA 3OCWA 4HH3C 2YX1A 4RUKA 5FJIA 4QLBA 2XMPA 3CM0A 4BKQA 1OKKD 1E9BA 1GHTA 1ODTC 3NHUA 4MHOA 3VR1A 4FN4A 4QFMA 4S1NA 1B14A 1HC7A 2V6JA 4DCTA 3SI7A 2LDXA 4C0HA 3VSBA 3JQAA 5JOQA 3WBBA 3NHKA 2C8JA 1GSHA 2ORIA 2P4HX 1JAIA 2QV0A 4R1LA 5IP5A 3OFJA 1NE7A 4CRWB 4KPYA 2YYSA 1U5CA 2KI5A 1Q92A 2AEFA 4WOJA 2J08A 5EFZA 2P35A 3MJSA 3SKVA 1U2EA 4JYZA 1BGXT 4GXQA 1Q7GA 1W4ZA 2OYSA 3TRHA 1X39A 3PEFA 1RWNA 1LFDB 4CV0A 4PYLA 5FBWB 4QFCA 4ND7A 3CCBA 1PZXA 3LRPA 1C0LA 2HB6A 5CJPA 4D4JA 1QS0B 1V16A 1T43A 3TN7A 1RS0A 1YS9A 3OT5A 1GV0A 3QJGA 2BKUA 4PICA 2VH2A 3R5JA 4KFRA 1H8EA 3G6KA 2ZSEA 1G4HA 4H4CA 4H7JA 2R7KA 4KGXA 3EIQA 2IUTA 4LSMA 1SO8A 3EEYA 3ES9A 4GYWA 4ND3A 4BFVA 3D54D 4E07A 1HMPA 3ABRB 3LUPA 3MT0A 3WLTA 4HI0E 3TCXB 1P45A 4O02B 3AJRA 3M6WA 2XZLA 2PWAA 3AC0A 3M5CA 3FYCA 1P1JA 3GY0A 2IZ7A 1TYZA 4JSRA 2XMQA 2HD4A 4UOEA 3NNSA 1FDUA 1XNJA 3AHEA 5FHQA 3UICA 1W35A 4B84A 4D79A 1XZQA 1JFFA 1G66A 4BPRA 4XQEA 3WA7A 1JHOA 3WQRA 3IIIA 1FJXA 3PUWA 3ZWCA 3B7PA 1RIFA 4MPJA 4PONA 4WKPA 1G3IA 5KNCH 1NBMD 4DMLA 3F3YA 4ALIA 2YHIA 3K3PA 3LC1O 4JWTA 4UHJA 2JLXA 5K4GA 3OCJA 4TSFD 1ZMTA 1ZU5A 3P9RA 2Y1DA 4L73A 3TIVA 2Z6AA 1IN5A 2WFZA 1TGYA 1JILA 4PZEA 3V97A 4HK4A 4W6QA 4MGYR 4PNPA 2WJHA 3IRUA 3JQ7B 2FHPA 3SHQA 3OO1A 4JV5B 3BPSA 3HKEB 4PNHA 3LUFA 4Q6BA 3GA7A 2LD4A 4ZOLA 1KERA 1KVRA 2POQX 3B8EA 9ABPA 1OLXA 2E4ZA 4FYYA 4EPVA 2D3TA 1SZPA 5F52A 3LBIA 1DELA 3NRBA 3RVPA 2J3EA 5I9NA 3U7HB 1SB9A 3RYIA 1SEPA 3R0QA 1W2HA 4QRIA 4GPEA 4QVKA 1NKVA 5AKXA 3EOAI 3CLHA 1DT5A 1T9ZA 3CIOA 2XAAA 5CHYA 1WDWB 4I6EA 4OHVA 4KO2S 3L4JA 3KELA 3DDZX 1TUBB 1Y4SA 1L4MA 2Z30A 1Y6RA 1S1MA 1DEOA 6REQB 5J2UA 4Y67A 2F43A 1VMKA 4Z4CA 1JHQA 1RWPA 2IPNA 4M1EA 4AMBA 3VPAA 2BEUA 1JQAA 2FHSA 2IK8A 3LZDA 4R8MA 3X1ZA 3EBLA 1WXEA 4ZHQF 1AXEA 3I2KA 4P54A 4QUIA 2C42A 4XIIA 4H9GA 2V9CA 3JTEA 1A9PA 3K1ZA 2NU7B 2G07A 3KB8A 3SQXA 2NUPB 2QTHA 3AB8A 1PDWA 2H57A 5C34B 1I4EB 4RLHA 5JAIA 3X2EA 3ZCVA 5DYGA 1R8XA 2X1MA 3DWGA 4PHFA 1HDRA 4QOHA 4JI3B 3ROXA 2QYOA 2IPLA 4RTMA 1CUZA 2QM3A 3WKBA 3O83A 4JGBA 1PR1A 4EMBA 4JI0B 2PZAA 1YB5A 2JAWA 3OF2A 3M9LA 3SZUA 4AY4A 2BKXA 1QYVA 2JVKA 2PMEA 3VZDA 1QHEA 2R6DA 3A3KA 3NWJA 2BFDA 3NTLA 1EDZA 3KP1A 1JDJA 1G2OA 1GEEA 1SMKA 2X0RA 2RB4A 1QCZA 4NNPA 1U2GC 2VOEA 2R6HA 4V0MA 2W6OA 3EVDA 1IUOA 2ODAA 4U6SA 2HK7A 1R9JA 2R44A 1C1HA 2X7XA 4RF4A 3T5GA 2GPYA 5DTRA 5BVHB 3DMNA 2I3ZA 4H7DA 2Y99A 2W7TA 3MWEA 3FGZA 5AK4A 4O2BF 5CLIA 4ZEOA 3TR5A 1Z74A 2XUFA 3E7PA 3Q2IA 5KWIA 1RQLA 5JXGA 1ZL2A 1PJZA 3FE2A 1JALA 3QPWA 2GLTA 1RRPA 1VOTA 2V7PA 3EVNA 3SBOA 2ZZNA 2HCBA 1PJ8A 2QZZA 5KQRA 3B53X 1XWWA 2YMQA 4WZAE 2RKOA 3WY9A 2P9FA 3F9RA 3OIGA 4BMDA 5ALVA 1D6JA 1GVHA 1IY8A 1SCIA 3K0CA 5EWJA 2OHGA 4DYDA 2EXXA 3GRFA 3WYCA 4W8HA 4Z0HO 5C1DA 3L02A 3NC1C 4ZTZB 3IQWA 2QJWA 1H6BA 3Q7IA 1VE6A 5FOWA 2YV4A 4AJJA 3IVRA 4P0PB 4UE3S 3DB2A 3SDZA 3WXMA 5K9ZA 1H4QA 2XUIA 2KX7A 2ADOA 3S2UA 1L5HA 1E2FA 3ZU6A 4U1RA 1KSGA 2OYRA 4PZAA 4NV1A 3SCZA 1SUWA 1FXSA 1T8RA 3K1TA 3K6KA 4MUGA 1F2VA 2IXBA 4GR4A 1SELA 3Q8WA 3FOWA 1KOFA 4HDNA 3WOHA 4RMNA 5JZMA 5KOJB 1LNZA 3KETA 3F2IA 3UA3A 2CLKB 1TLLA 4QXMA 4BVBA 2J4DA 1H2RS 1W2WB 1LNQA 3HB7A 3Q88A 3ZVKA 4BNXA 5KU1A 1YE3A 1FY2A 1US8B 1SQFA 4Z9XA 4ZHSA 3OHPA 10MHA 1SOMA 2W6PA 5GV7A 5KYUA 1NF9A 3V8NA 3G2LA 1N8SA 3CLRD 4BRZA 3QUCA 5IAKA 3BJMA 3ASZA 2J87A 3WMGA 1KWKA 4BFWA 1RIIA 2P75A 1MN6A 3U39A 4X97A 1BDHA 1EGVB 2O6LA 4JBNA 3CLTC 4EKYA 4RKFA 2QUBA 2HPVA 2XNKA 4OJYA 2WTNA 4LRUA 3W3AD 4CMBA 1A2KC 1T5BA 3QZUA 3JQGB 1ZDMA 4LX0A 1XG5A 3D31A 1FYDA 2FUKA 4KQKA 4KQ2A 5G0VA 1Q21A 4CFSA 4KO3S 4AULA 1DLIA 5ALOA 2BELA 2HPHA 4GW3A 4D44A 2FWRA 4F4DA 1QDUA 2BW0A 2VPPA 3GRCA 3LCVB 4JVOA 1RP7A 3PTAA 1Y5MA 3P2YA 3IDQA 4ECAA 4KHPB 1P44A 3RLIA 1AKQA 1DAHA 3ZI4A 4AZWA 5FAKA 1JYEA 3RYFA 3ESDA 4D3DA 3IMCA 5KI6A 2VJOA 1X42A 2D1TA 4HL6A 2GSDA 3LY8A 2DKOA 3LFHA 4JD5A 3WDLA 2R2GA 1Z4IA 2WJ4A 1TAQA 2LUOA 4XIGS 1YGYA 2A6PA 3GR6A 3EULA 4YH1A 4LKRA 4LA4A 4UMVA 1S2MA 3VV2A 1KMIY 3BSYA 2H51A 4MDFA 2NQTA 2O1SA 1EVEA 1SXJB 1C5KA 1JAYA 5TVKA 2IV7A 1NPYA 5EMHA 2QL7A 4KO4S 3STVA 5AKGA 4Y6GB 4MWBA 4ZU6X 4E4TA 2XB6A 3WIDA 2FYTA 3PPXA 4EMTA 3B2NA 2OWEA 3V3TA 5E2AA 1S96A 5LJIA 3IIJA 4PAGA 1G2QA 1BCSB 1QVWA 2AOTB 1W19A 2R3SA 3FNFA 1CB7A 3MLEA 3VUEA 3ZK8A 1U3VA 2CLSA 5FO1A 2ISSD 3DZBA 2PS1A 3QRWA 1QE5A 1FLNA 2OHFA 5FV4A 4LPSA 4DWWA 4RMGA 3RO7A 5DTEA 4IHJB 1FYFA 4CNQA 1A2OA 1LTKA 5BOSA 2SCUB 4QBFA 3UJ3X 3EW9A 2XGGA 3THOA 1C2YA 1J23A 1OBVA 3P2EA 4UVIA 3A3OA 2CFIA 4E5NA 5LQJA 4QE3A 1OB5A 3BULA 2C29D 4B2YA 1J4AA 2FRDA 3G3EA 2I7CA 5JWRA 2QX8A 4PTLA 1FUKA 4BFXA 3ZGYA 2WHQA 3O75A 1FDRA 3R8CA 1JBEA 1OI2A 2ACWA 1Q7BA 3QKWA 2R97A 4Q4HA 4IFIA 2PL3A 3A0RB 1V9CA 3EIWA 3MAGA 3NOQA 3UK6A 3GU3A 3PYLA 5IU6A 3T9AA 2PT9A 1L7VC 1C2TA 2QW8A 2XE8A 1D9XA 3TD2A 5EUMA 2ACVA 3EW7A 3E9YA 2R65A 3WLEA 1GAXA 2BSAA 4LCEA 4TUYF 2YJ6A 3R2JA 1XZ8A 4H60A 2HQRA 4NQRA 5HKKD 3BE8A 3IT1A 3AU9A 4OHXA 1G4UR 3T7DA 1WEKA 2Z1DA 3AETA 3WYEA 1AUXA 1FW8A 1I7LA 1A9OA 1S3GA 1U0FA 2R5NA 4LCJA 3X43A 4DMCA 3Q9NA 3I58A 3E53A 4EYGA 5JE8A 3NBQA 3T95A 3JQDA 3L6OO 2XUOA 4Q9DA 3OJWA 3PHBE 1SOUA 2QN8A 1T0JB 2SICE 1DLJA 3AY0A 4TWRA 5TGZA 1N34B 1MO4A 2ZREA 1GNPA 5EJIA 4YQYA 3V42A 2J0SA 3DVSX 1UDWA 3BJZA 5I51A 2VPZA 1IB6A 3WAJA 1QKKA 3UA4A 1SPBS 4BNDA 1UQUA 3U4MA 5K3AA 3U6KA 1JXQA 1KI2A 1QHHB 2COEA 1MCZA 4DQXA 2VQEB 1FVHA 3LXRA 1N2SA 1UKBA 4L9WA 1HI9A 1ODIA 2XQJA 3ONEA 2DHRA 3V4PB 5C7IO 1CR1A 2ZQ5A 4PYNA 2ODWA 3VQTA 2VF7A 4F3KA 4AK9A 4IXTA 2MYUA 4IIFA 4QQKA 2C5SA 4KLNA 2ZRNA 3BWYA 5EJFA 3DWEX 2O4UX 2GNAA 2OCDA 1IK4A 1D07A 3COYA 1ECPA 1USIA 4IUBS 1ZAKA 2PZGA 4JFRA 1UXJA 1NXWA 4P98A 2WILA 3D6TB 3TOXA 4JVNA 3GL9A 3CEHA 2XE4A 1KYVA 4JBHA 2RKWA 1NOJA 1EE2A 4BO8A 3WMWA 1K4MA 2VHVA 3ZBTA 1XTBA 1EB8A 5KWVA 3JAWB 2ECPA 1AQJA 2GXAA 2LPMA 4PG7A 3G17A 2Z5GA 3RUHA 3DO8A 4BFUA 4EENA 2DJIA 4TRRA 3LF1A 5CBPB 3Q3IA 1CJMA 1GIAA 3ZU2A 3PDIA 1L2TA 5HX7A 2L0XA 3CVYA 1E1YA 2HA7A 4L0MA 2J46A 4LWZA 2DB3A 2AYZA 4D3FA 3SOZA 2GZ2A 1ZICA 1ZK0A 2ZSDA 3IOCA 4B5KA 1VJ5A 1YJQA 5KREA 3T15A 2DQYA 3VZBA 2CNDA 4MPPA 1XHLA 2BHLA 4R5HA 1ZYUA 3LX6A 2ZQYA 4YLEA 3W5DA 5KYWB 3M6XA 3C6MA 5KHLB 4KQCA 2P2YA 3KL4A 4P36A 3G2JA 4FZRA 1FL9A 4D02A 3UGJA 2QX9A 5IK2A 1AZTA 5CXUA 4PRYA 3R24A 4BTEA 4ZZ1A 2H0QA 4WX2B 4LY3A 2JFVA 4J4TA 4UTVA 3E81A 2HRCA 4EIWA 4MICA 3WTBA 3NEAA 3CX7A 5A3JA 1J0BA 2G4LA 3SC2A 4QYMA 3NEYA 3OI7A 1ZHOA 4G89A 4WFJA 3CNHA 3D6UA 2IHKA 4Q3DA 3EOBI 4WBNB 3ANYB 1MTZA 1E8DA 4MR9B 5DRYA 2A9QA 3KOUA 1D8TA 2IE8A 1CJVC 2YNMD 4E94A 2IUSA 5IVHA 1EUQA 1U7UA 2K2QB 3MS4A 3PEUA 4UFOA 4ZV9A 1IEVA 4CYMA 1FXUA 4JJIA 1OCEA 1TU4A 1YH3A 3C3EA 1OXSC 3Q6IA 3W78A 2ETVA 2CF6A 3CGGA 4D5GA 2PZ8A 2QUAA 5HFNA 3DEYX 3DBRB 5MFPA 4MPRA 3N7UA 3IDAA 2FLWA 1WB9A 721PA 1IBKB 3VNUA 3EJ6A 1XRLA 3A9RA 4I5DA 1OYOA 3TPFA 4UTNA 1UQRA 5ICEA 1CY7A 4B09A 4B3XA 2IXGA 3EXG2 1JJIA 4NYMR 2XCIA 2DUNA 4KR9A 2ZJ3A 4WEOA 1J99A 1AGNA 2X8JB 1N9ZA 2YRXA 3O3MB 1EUDA 3Q7QA 4FR0A 5EQTA 3OJLA 1DCKA 4UPVA 2BGTA 1QYRA 1QDLB 2EX4A 2Y0DA 3IPYA 5P8WA 1YB6A 2OGUA 2Q5FA 4IDBA 4O4LA 4R4JA 3VX3A 3RDPA 4CNBA 5K05A 1U3CA 1S3IA 2QPLA 4JHXA 5LQNA 1NUAA 1VHWA 3PU6A 3RRYA 5L3VA 4PPNA 1JL3A 5B4UA 2Y1CA 1MFZA 4O2BA 1DI0A 2DAPA 2H2FA 1GZVA 1KPHA 2MMGA 5EY5B 3RARA 4CDNA 5FYDA 4LHSA 4ITVA 4MS3A 1BQ3A 3K0AA 4EATA 2FR1A 1U0BB 1MB2A 3SSMA 3IPCA 3I1FA 3SEQA 2P7HA 7MHTA 1QFSA 1YZTA 4REQB 1XJQA 3ADOA 3RE1A 1AQLA 3WI7A 3FKQA 2JGAA 5EERA 5JD6A 2QDXA 3SF8A 3AF2A 3LLUA 4ZIRB 2M2IA 2P3QA 3TQRA 3N9IA 1EK1A 5K0TA 2P5TB 3B20A 3TS1A 4E6EA 2CXQA 2C1ZA 4OKIA 3F1KA 4LQ4A 1Z25A 1FP4A 1NVGA 3M6VA 3B48A 5CLQA 1VSTA 1V4NA 3H8JA 4QJBA 2FEWB 3ESCA 3MJ4A 3Q3VA 4YFYA 5L51A 5HOEA 5K4HA 2CSUA 1OBHA 2REXB 2ZBUA 2ZI5A 3O26A 2AXEA 5BT9A 5EXPA 3RIHA 2C5LA 3ICPA 6ADHA 3PXXA 4B8WA 3H1BA 4P7BA 4B3HA 1GPDG 2WQ6A 2O5EA 3A4YA 1WA5A 4K1LA 5C4GB 3PE6A 1R6AA 1MGOA 3NYWA 4EK9A 4MI1A 2YYAA 2P1RA 2ZWOA 2GPTA 3C3YA 3IBYA 3L7JA 2C83A 1UWVA 4GR5A 1M9NA 4G07A 3T9BA 4EB6B 4FYJA 1TC2A 1W4RA 4NJMB 5JLJA 3I73A 2P91A 5CX1A 2Z4SA 3RCBA 1MDFA 4LW8A 4DIMA 3GAAA 4HNAB 1P62B 3EQ9A 4Q5IA 3CH4B 2ZT8A 1DAGA 4K86A 1Q0RA 2F67A 4ZQHA 3R7SA 3UK0A 3FA2A 4N39A 3ONWA 4PAWA 2ZITA 1QH0A 1V4BA 2CZGA 1C0KA 4N6OA 3FZGA 3K35A 5IVPA 1NXTA 1H2HA 3DL0A 4I55B 4LWQA 4LOHA 1ZI8A 1IN6A 4DEXA 4LECA 2VHQA 2PUEA 3SK0A 3OP1A 1B2LA 3M5DA 4MV6A 3A70A 1FRFS 2J41A 3GPCA 2BD0A 4BHTA 3OZBA 5EUQB 1WMAA 3OQMA 1TRHA 3VR6D 4M6WB 3NPAA 2ID7A 2IEGA 1V43A 2Y76A 1OFUA 2VSOA 3HR7A 3L79A 2AHRA 3HXLA 4LYFA 1QR6A 2YY6A 3DONA 4Q9AA 1P6UA 4US1R 1VGVA 1QV7A 5AI0A 2X9LA 5C1IA