3Q9LA

The structure of the dimeric e.coli mind-atp complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septum site-determining protein minD
publication title Determination of the structure of the MinD-ATP complex reveals the orientation of MinD on the membrane and the relative location of the binding sites for MinE and MinC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle, hydrolase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q9lA00
2QTFA 1NVWQ 2BM1A 4QBIA 4JJZA 2JJ1D 4RZXA 3T5GA 3G5UA 1QG2A 2DFLA 2XJ9A 4HLDA 4DXAA 4F38A 3FWYA 4NYIR 1W1WA 2O8BA 1R0YA 2EVWX 5DI3B 3X1YA 1CF4A 1A2KC 4MQBA 4DSNA 4KI0A 5P21A 2BBWA 2QMUA 2XNDA 2O8CA 3QIAA 4F4JA 5DI9A 1A1VA 3QKSB 1M7HA 3VKGA 2ZRGA 3NC0C 2CLDX 3KKMA 2NOAA 4DLZA 1SZPA 1JEEA 1KK2A 1U8AA 3BWDD 4LHYA 2C99A 2FZLA 3WNBA 3GJ7A 4CT4B 4XIGS 1HQYE 1E1QA 2KBEA 3WY9A 2IYQA 1XCMA 3RS4A 2QSZA 2JJ2D 4JT4A 2ODWA 1CJUC 2BCGY 3GFPA 4DB4A 3LVRE 1U90A 2QT1A 4E03A 1C9KA 3EARA 4NCIA 3FPAA 4G5GA 4QKQA 4Q03A 2DFNA 5KYKA 1ZD9A 3OEED 1Z28A 1M34E 5E95A 4TQAA 3GLIE 1XJQA 4F4CA 1U8ZA 1QHGA 3ZDQA 5F98A 5L3SA 4DB2A 3EXAA 4QGFA 4UJ5A 1GVNB 1T5IA 4LPSA 2WTUA 1OIXA 2QENA 4TTPA 5DGXA 4A36A 1CULC 3IIKA 2J0UA 4G5QA 1AKYA 3CH4B 5FOUA 2MSDB 2IYLD 4BFSA 3QXJA 1EWQA 4AYXA 4JSYA 1GM5A 4EJSB 1KO8A 1MT0A 3TKLA 2UVQA 1CJMA 2FDCA 2REBA 2ZRFA 3VX3A 1N25A 4LWZA 4LBWA 1R10A 4EPYA 1NY5A 2GJSA 4GSYA 3AVXA 1E6CA 1ZNZA 2VQSA 4C0SA 1OB5A 1AQYA 3LQQA 1Q1QA 4Q21A 4WAUA 4AYTA 1FPMA 4TMKA 5HKKA 3VNVA 1CEEA 3NBYC 4Q4HB 3IKJA 5TB5A 1NBMD 2P3SA 2HT1A 2W2VA 1VCNA 4WBSA 4KFUA 3B82A 1FX0A 2WPDD 1AQUA 1GDDA 2XXAB 5J4LA 3NEJA 2B7CA 4KSCA 4RY2A 3PFIA 4H1VA 4N3NA 1LV7A 3ZD7A 4PZLA 4TMVA 5BN3A 1YKSA 3NWJA 4LHXA 2XZLA 3MWLA 3AVWA 1G7TA 1TU4A 2G88A 2G6BA 4ZPXA 4IOJA 3T1OA 5CIQA 4POAA 4JL6A 2R6FA 1TL7C 2ZQ5A 5H70A 3ZZUA 2HV8A 3AF4A 1KDPA 4QXAA 4C2TA 2ANBA 2ZJ5A 1XMVA 2Q9BA 3F3YA 4CF7A 4KFSA 4TQUS 1OJLA 2IYRA 1G8PA 3OE7D 3RHFA 4A6XA 1LS1A 1WE2A 2OAQ1 4NCNA 3W34A 3OIYA 4E5UA 2O8DA 2ZI5A 4GMXA 2IA5A 1X86B 3CO5A 4YXWD 4JBXA 1GRQA 3EPJA 4A0GA 1GIAA 3EA0A 5KPDA 4KAXA 1Q0UA 3U3MA 4PC2A 1IHUA 3QXCA 3AUXA 4N0EA 1KI4A 1F48A 1W0JA 3OAAA 4Q1CA 3ZVMA 1XMJA 1YR7A 2I3BA 2F6RA 4OI4A 1XJ0A 4G5OA 1N6KA 3VR4A 5KSOA 5FPHA 3UKDA 1E2IA 1XMSA 2QP9X 4PSVA 3ADBA 4UNSA 2ZJAA 3AUYA 3JZMA 4C3ZA 1VG8A 2GTPA 1COWD 1N5LA 2WKRA 1IY1A 1HT2E 2JIZD 1T5LA 4NCHA 3RSLA 2PJZA 3VKHA 5SZKB 1W2GA 3CB4A 1P2UA 4UNPA 4DLWA 4XWKA 3K09A 3QE0A 1I2DA 1HE8B 2HF8A 1VPLA 1C4OA 1VYUA 1JBKA 3IEVA 1GTVA 1G4AE 5DN6A 3LFUA 1E2JA 4P3YA 4NH0A 2OCPA 5G40A 4Q1BA 3U7GA 4BPBA 1ZUIA 2G1JA 3DOEA 1KI3A 4P4TA 5CYOA 2XZOA 2J5XA 2JAQA 1H8EA 5AJVB 3RVBA 2A5JA 1OFTA 1Q44A 2GXSA 4M0LA 4M1WA 4CEHB 2HT6A 4Z1MD 3F8TA 3KTAA 4XSGA 2FF7A 4TLEA 2OXCA 4Y0AA 3W9YA 1Q3TA 4TTRA 2YWFA 2J7KA 4LBYA 4C7OA 4LJYA 2PEYA 3A37A 4I1OA 1OV4A 3TVTA 2VH5R 5EZ6B 1ZIOA 5J4YA 4TLBA 3E5HA 5FTJA 4DEYA 1S4QA 2ZYUX 4LI0A 2YKGA 1OF1A 3PENA 3WNCA 3VR3A 1AKEA 3L2OB 2FGKA 4BLRA 1ZM2A 4O2LA 3P20A 5CITA 1C1YA 4LHZA 1K5DA 5EUMA 1GKYA 5CJPA 3NIBA 1TNDA 1NSTA 4NCKA 1IN4A 2Q21A 4KYUA 4ARZA 4TT3A 4A0FA 3KJGA 2CJWA 1KSGA 1FFHA 3Q5EA 4PO8A 2GCOA 4CRWB 5FPKA 4LPKA 2J7PA 4DCTA 1OXUA 5KUTA 1EWRA 1KKMA 5KNBA 2J59A 2EFHB 1ELOA 4IXNA 3SNHA 4OHYA 1N3BA 4PFSA 3SHWA 1GG2A 1W47A 2D7DA 4B32A 1AM4D 5GJCA 2EW1A 3K8YA 5DHFA 2QE7A 4IOLA 5KU1A 4V03A 2IF0A 4DVGA 2IS4A 2XGJA 2CE2X 3A36A 3D31A 1II8B 3DVLA 3OFND 3I5YA 2OFOA 3U7FB 4B71A 5TMPA 2ZYVX 2QZ4A 4ZKDA 2FN4A 1DS6A 4ABYA 3I8SA 4TMTA 1DBSA 3MG9A 3FFAA 1L2TA 3TUJC 1AN0A 2AXNA 2WIAA 2PZEA 3LVQE 4CDGA 2IYSA 2GJKA 1HH4A 2QMEA 1E9BA 3CF6R 3X1ZA 2K5UA 1XXHE 1FOEB 1J8YF 1NN1A 4TMWA 1IN8A 1SXJE 3GLGE 4LRWA 3P32A 3D3QA 4BRUA 1FL9A 2BKEA 3DDCA 4Z8YA 2WJJA 2ZRIA 3IHWA 2X1VA 3HYRA 3C14C 3L82B 2MSCB 2GZDA 4HAVA 5JCZA 2WOOA 1OIWA 2PH1A 4PPNA 2HLDD 3Q8XB 3A1WA 1R0WA 1SXJA 3F0TA 3GLGA 2F55A 2F9MA 2C5LA 2WWFA 4AKIA 4G3XA 1KAGA 1NSFA 3I3SR 3RRNA 2YWHA 4LC1A 1G1MA 1YZNA 4FI3C 5FOXA 4PQRA 2AWOA 3HR7A 4Q4JA 1RVDA 3VTKA 4C0HA 2QMHA 3NTUA 2UZIR 4IDPA 2PBRA 2WAXA 3TK1A 1TUEA 5JWRA 2AKAB 1Q1BA 2FV8A 2KB0A 5IK2D 1JR3E 1WP9A 1R0XA 3AVPA 4A1FA 1BYUA 4IRUB 5KSZA 2JA1A 1F2UA 3PIRA 2XTMA 3ASZA 2C04A 3T1VA 5AWFC 3VU9A 4DLVA 2IUUA 2XJ4A 4ITRC 1NRJB 4MRRA 1CRQA 3U3JA 1P5ZB 1UKYA 4LV6A 1G3QA 1G3RA 4B47A 4KLZA 1JEDA 1YVDA 3ZZTA 3BBPA 4KLNA 3U2QA 2F1HA 3R9WA 4HDCA 4QM7A 5KOYA 3CR7A 3C41J 1IJFA 1HV8A 4IDQA 2OZEA 5DH9A 1CR4A 2BJVA 1A2BA 4H9GA 4Q00A 2QAGB 2O0JA 3WRYC 1WF3A 1DO0A 3H84A 3QKRB 4PPFA 3WBKA 2QP3A 4U00A 3ND8A 4LJ5A 3SS8A 3S1AA 1D2NA 4Q1AA 1JAIA 2Q9AA 2HCJB 1E2NA 3LW7A 1G16A 3ZIAD 4YC7A 1W5SA 4DCSA 4NCJA 1JI0A 3G82C 3VMFA 3EWSA 4ZIRA 2QAJA 3ND9A 3I32A 1W44A 4FCVA 3SHFA 3GLFA 3MWJA 3FMFA 1JB1A 2KWIA 4KITB 3CPHA 1OH6A 4ILEA 1E2MA 1Q1EA 2IC5A 4M1YA 1E2GA 5EP3A 4C0KA 2GJ9A 3QPWA 4LYHA 2A9KA 2YHSA 5DIFA 4LX0A 1P2TA 5EP1A 1QBKC 4C9BA 1SXJC 1VG1A 4HZIA 2J1LA 1IONA 1E9EA 4NYJQ 4EPTA 3Q72A 4D80A 3THXA 2NO6A 3CIOA 4LGMA 5G53C 1W7AA 4QRHA 1TQ6A 4MRPA 1X8LA 2B8TA 4IFEA 4RD1A 2ODBA 4IDOA 3CRVA 4JLMA 2X2FA 2PMKA 4A2QA 4LJ8A 1Z0IA 5LPNA 5ELXA 5G3YA 4QJ5A 2ZR7A 3QF4B 4JVMA 2BDTA 4HUQB 3REFA 1OIVA 2ZYWX 1ZJ6A 3NBFA 4B2IA 2BCJQ 2RGGA 2DPXA 3TBKA 4NYMR 2ZANA 5AR1A 4EPXA 5FH9A 1KDRA 4B75A 4BGDA 4I1UA 1KO4A 5DE3A 1TQ4A 3B1WA 4PQFA 1VDZA 5CM8B 1RRCA 4XVQA 1XD2B 2BMDA 3H86A 2W2TA 2OXRA 1D9XA 1RZ3A 4B3FX 1GL7A 4A8JB 1RC8A 3EZ7A 4PTLA 1KSJA 4XVUA 4JLNA 1EK0A 2N1BA 3KKPA 4DSTA 2IS1A 1OFIA 2CXXA 2ZR0A 5K8LA 2A5GA 2BIFA 1SKYE 2QU8A 4QJ4A 2CNWA 1HA3A 3LH5A 4OQLA 1W2HA 3EZ9A 4JIMA 4Q19A 2Q6TA 2O8FA 4IKEA 3SBEA 3UIEA 3T12A 2CVHA 2OLJA 1OXXK 1QHXA 221PA 3B5JA 3U60B 4KFTA 2VBCA 2WOJA 5TVKA 2D2EA 2W6IA 4EFLA 3R8FA 2FFBA 1N6NA 1X3SA 2J9RA 4YONB 2H7VA 1N6OA 4LOAA 5EE1A 5L3RA 3N2EA 1MV5A 2YOFA 1S1CA 4LV5B 3B9PA 1Y63A 1YZQA 4QGGA 3A4NA 2YC4C 4PANA 3VAAA 4CW7A 3K0CA 2I1QA 1Z8FA 5H8WA 5JS8A 2WWIA 2LCFA 3V00A 4EDHA 1AGPA 2GF0A 4ZI3A 4OQXA 3T5DA 3O8BA 2AR7A 1VIYA 1G5RA 3CX8A 3T34A 4CIDA 1SHKA 4B6FA 1KK0A 1FQKA 3RAPR 4ZDJA 2CHGA 3H0KA 4ZDWA 3RS5A 2DB3A 1PZNA 2OV2A 2QI9C 2D3WA 4US1R 5J47A 4YQFA 1XF9A 1FP7A 4UJ3A 4GBMA 4HZUA 2QEQA 2VA8A 2D2FA 1VTKA 1Z6AA 3CX6A 3DHWC 2ZUDA 1E4YA 1EFRD 2IT1A 2XOKA 1G8FA 4Y0VA 121PA 3EZ2A 3TR0A 2C78A 2IXEA 1MO5A 1Z06A 3PR1A 3QVUA 4B48A 1KSHA 2IS2A 3GQBA 1YRBA 2FWRA 3FGNA 3T1QA 4JJKA 2CVFA 2ZPTX 2CK3D 2O0KA 5JSZA 4R2IA 1G64A 4PAMA 4DKXA 5J4KA 3C7KA 3AF2A 4BLTA 4BE7B 2CL0X 1PLLA 1ZAKA 3UK6A 3K9LA 2VSFA 4PZZA 4HB4A 1F60A 4JYCA 4MA4A 3NC1C 1E2HA 2ZS9A 4G5RA 4D0GA 5F9HA 2HCBA 5AJXA 1HYQA 1K6MA 3NDPA 5EQTA 3NH6A 4DSOA 1VHLA 2OCYC 4HLUA 2MMCA 1IN5A 2XB2A 3PCRB 1RJ9B 4MH0R 1U0JA 4B74A 3LXXA 1Z0AA 1WBDA 5J4HA 4CEIB 1NBME 3U3OA 3RC3A 4G5SA 4QOSA 4HLCA 1ZNXA 4DDTA 4Q66C 4PC7A 2YVUA 3V4RA 1DARA 1SVKA 4M4SA 2QA5A 4AURA 1A7JA 3KB1A 3QJYA 3NHBA 4RZ2A 4MDFA 3PVSA 1CBUA 1YJ5A 2H57A 5AUNB 4DIEA 1NLZA 2BBSA 2O52A 4JL8A 2O8EA 3MJHA 1XEWX 4RZ3A 5DYGA 2QBYA 3ONWA 4NONA 4P32A 2IHBA 1ODFA 2RGBA 4OKSA 4NYMQ 1EFUA 3K0CC 4ESHA 5IDVA 3G0HA 1NMYA 4TMZA 2WHXA 1D2MA 3PUYA 4HLQB 5BYKA 1N5IA 4QHYA 1TUIA 4DUGA 4C2UA 3CRW1 1CR1A 3WHKA 1T91A 1XCGB 3MGCA 1ZM3A 4PX9A 5F2EA 3UWKA 3ADCA 1BMFD 3EZFA 4LYFA 5FTNA 3CWQA 4BLSA 3FOZA 1OB2A 1AA9A 1Z08A 1Z6XA 2EFCB 2IEZA 1KKLA 3R7WB 2IUTA 3ZS9A 4P33A 4TN1A 1TQ2A 3EX7C 3LRPA 4HB2A 4EIWA 3TQFA 2HJGA 5FR2A 3SJZA 3TH5A 4B3BA 1HQCA 2GEUA 5K8IA 1L8QA 1OKKD 4TZ0A 4AKEA 1KI1A 1XEWY 5KSYA 2ERXA 3HYTA 3SFVA 2JDID 3TUZC 2GVZC 4LBVA 1DAKA 2BKUA 2XZPA 4MRNA 4PC3A 4BEBA 1XEXB 1YU9A 2ECKA 1ZP6A 4KHZA 4BRWA 5DHAA 5CDFE 2OESA 4JT2A 1N6PA 4WOPA 3HU2A 1SVWA 1T4GA 3EPHA 2GXUA 4JKYA 3KQKA 4HAXA 1WB9A 3LBIA 2C98A 4RFSB 4Q47A 3P26A 3Q9LA 3A1UA 4XWAA 3N5CA 2RGDA 2EWWA 3QG5A 4MKHA 2OBLA 2VP9A 3BH6A 4P4SA 3K70C 1R4AA 3SI7A 2HEIA 4KBFA 4YDSA 1II9A 2H1LA 3LY5A 3O8DA 4TYPA 3IDQA 2F3TA 4IDNA 4R98A 5FL7D 1XTKA 3W3AA 4BFXA 5C46F 1GKUB 3RC8A 3RRMA 2ODNA 2ZUCA 2VL7A 4AKHA 3CM0A 2OSBA 4MITA 2GA8A 3MWYW 3A1VA 5B58C 1OFHA 1NG1A 1XD8A 3EASA 4NU0A 2LWIA 2ZE8A 2PT5A 4U5XA 1S3GA 3K0FB 1RRGA 2ZJBA 1ZRHA 1BIFA 3NXSA 4I81A 4M9ZA 3U61B 3BB3A 1YHNA 1CP2A 5FI1B 3H1TA 5JRJA 2NIPA 3OEHA 2JJ8A 3RRZA 3DEFA 3KFXA 4RZUA 4LJ7A 4CT5A 3LLUA 5JLJA 4H1UA 1R5NA 5JZVA 1GOTA 3GFOA 1XPOA 1NIPA 2VPPA 4BWYA 4EQ6A 2FPMA 4NBSA 1S8FA 4DCUA 2QTHA 2G0TA 2PX0A 4RSGA 1BOFA 1KI6B 1IY2A 2VEDA 1MABA 2DYKA 4MDEA 1P62B 5F3WB 1E99A 1UBFA 2O8BB 3FTQA 5FI0B 3AVOA 5CM9C 1WQ1R 4WZBE 3BE4A 2BOVA 2P5TB 3QKSA 1OH8A 3PQCA 3JZAA 4WW0A 1VYVA 4DLXA 4TL9A 2O8CB 5B2ZA 1SVMA 421PA 2VYFA 1W0KA 3TUIC 3EPKA 3ZVRA 5EXPA 2QY9A 1SVOA 2VF8A 3HPRA 2FFHA 5C18A 2VP2A 1CJVC 5SZHB 1JR6A 2ZR9A 3BAFA 3LQRA 4E07A 2DWOA 3D7MA 1E94E 1XWIA 4PHTA 4LJAA 2HDNB 4UKDA 4FXPA 4WIAA 1I2MA 1G4UR 4MYHA 1ESMA 2IF2A 3TGPA 3AVYA 4M9SA 4D4JA 2QP4A 1DAGA 1XTSA 4LDJA 3R8CA 4TYNA 1J99A 1TEXA 4AIIA 3GJ5A 1R6BX 5GVRA 3FKSA 4F93B 2JLYA 2CEAA 1E2QA 5IT5A 2D06A 5KNDA 1E9CA 3QBVA 5K8TA 4JVNA 3PEYA 4Z54A 5L3SB 3GLIA 4DDUA 4L4UA 3U3RA 4IVRA 5AUOB 2BWJA 3GJ3A 5E4FA 1N6RA 3RLFA 2J0UB 1Z3IX 5EE3A 5FUYA 3ZS8A 4ASUA 5TARA 2B21A 4MRVA 3GCGA 1GNPA 1QDEA 3SJBA 1L4YA 3I4LA 2BMJA 1IQPA 1U81A 4FD2A 2G77B 1E79A 3FHCB 1P72A 1JECA 5AJWA 1QF9A 3KJHA 2WKPA 1E1RD 1Z0FA 5D3MB 1GWNA 4HAWA 4K46A 2FOLA 2C9YA 4DBLC 1DADA 3RSOA 2O5VA 1HE1C 5DISB 5JWOA 3CZPA 5EXSA 4QNRA 3J81k 1KK1A 2Q3HA 2X77A 2ZE6A 1U8YA 1GZSA 3KDSE 4KO8A 2BV3A 1DTSA 1R8SA 2WJHA 2XSZA 4V0NA 1DPFA 4S2EA 2NPFA 3GEEA 3M6AA 5KHOC 3L0IB 2I4IA 2C96A 1YZTA 1E2FA 1KZ7B 3BB4A 3QOFA 3BFXA 3I92A 2Z4SA 3R9XA 1ZD1A 2V6IA 2C2HA 721PA 4DRZA 2B92A 1ZIPA 4RVCA 4DCVA 4DEXA 2EFEB 1CR0A 5HE8A 1UDXA 2WJGA 5AUQA 4B3GA 2PZFA 2FEMA 3LBHA 1NLYA 5FPSA 1TTTA 2FE4A 2CLCX 2F1IA 2QRZA 1T6NA 3GLHB 4CYMA 1ZINA 3SC3A 4UNRA 2PCJA 4HDQB 1HUQA 4LSGA 1OYYA 2ZJOA 4N0DA 4NYIQ 4XD7A 1UKEA 2QL6A 1N5JA 2AXPA 4PHHA 2C95A 3TQCA 1RKBA 3CRRA 2R44A 5JJLA 2O8DB 3CONA 3IPYA 4MGYR 3TR5A 4GP7A 5SZJA 1P73A 2IYZA 2ZROA 3K9GA 1QHHA 2AX4A 4D6PA 5FBRB 2VHQA 2VO1A 1LW7A 4QM6A 2W0SA 2QNRA 1G8YA 4LJ9A 4US2R 2G0NA 2BEKA 1G18A 2GZAA 3P27A 4NP6A 3I1FA 4R2HA 2F43A 2P6UA 4FW9A 4II7A 1NP6A 3U6KA 1ANKA 3LX8A 1PJRA 1ONBA 4MYCA 5CK5A 4F92B 2GESA 2OEPA 5UKDA 4EJSC 3MMPA 1UKZA 4NDZA 3DL0A 4RD4A 1S3SA 4W7SA 3THYB 4B6EA 5JCPA 2WSSD 4PO1A 2J45A 2EWVA 5LBIA 3RABA 5C2JB 2XTNA 3AB3A 5A5GA 1BO6A 5EE5B 4HEJA 3X2SA 4BFZA 2L0XA 3THWA 2AL7A 3KXKA 4C0LA 3CX7A 2ZI9A 2V6JA 3TLXA 3P4XA 4DT1A 4URVR 4IXMA 1WMSA 1SVIA 2V3CC 3FB4A 4DLRA 4AK9A 4QFMA 2XEXA 2NGRA 1G6HA 3QKUA 1U0HC 1UM8A 4YDHB 3AVUA 1CRPA 3PV0A 2QQEA 2ZREA 1FNNA 1H8HD 4XVRA 2B7BA 2GWHA 3U44A 4F7WA 1I4TD 2E87A 3IBYA 2F7SA 3FMIA 4M22A 1UEJA 3UG7A 4JSTA 1IOZA 5BW8A 2ZJ8A 3QNUA 2ZSDA 2CMKA 4US0R 4LJ4A 4B76A 4QHSA 3AP1A 2IYUA 1AZSC 2YJTD 1OHHA 3KJIA 2XNDD 4ZI2A 1KYIA 2QPTA 1DEKA 1P9WA 2IYYA 2ZAMA 4L8GA 3SU8A 4C0JA 4X8LA 4C7OB 3B13B 4A0RA 2RAPA 4D0NA 1E2DA 4YMSA 3GMTA 2P65A 5DYIA 3BFVA 1N6LA 4LYJA 3RS7A 1AS2A 3IBGA 3AQ4A 1IJEA 5C4MA 2FPLA 2NMVA 3O47A 2FSIA 1E1QD 2VP4A 1P2SA 3TAHA 1OH7A 1G7CA 4PAQA 1W36B 3LXRA 1Z63A 3L0OA 3BIFA 5LD2B 1M7GA 1SGWA 1HY3A 4ARZB 3W90A 4QBHA 2GCOB 1M6NA 4JLPA 3IPXA 3ZZ0A 2WKQA 3VNUA 1TX4B 1L7VC 3Q5DA 2ANCA 4B2PA 4W9MC 5JS7A 1D2EA 4BZQA 5JJIA 4GZLA 2A2ZA 2AKYA 4RD2A 1BS1A 2OCBA 1AK2A 2DWQA 3JVVA 2VTKA 5EJEA 5IHPA 1R8QA 4JLJA 5GJBA 5CJ2A 1XZQA 4XH9B 3FYHA 2LKCA 4DHEA 3LAWA 4JMPA 4L15A 3EW9A 2GVDC 1DG3A 4DWJA 4Q9IA 3U4QA 3FDIA 4YMUA 1J8MF 2Q9CA 4EPVA 2WIBA 5BN5A 2HF9A 1MKYA 1ZMXA 1RYFA 4M1OA 4D4KA 3MFYA 3QEOA 1CLUA 1ZU4A 3C15C 3FKQA 1FMLA 1RFLA 1TF2A 2PZGA 5E7JA 5TXGA 4KSBA 4C30A 3LV8A 4AY2A 1KO5A 4JVSB 1M74A 2ONJA 3CNLA 4HB0A 4FCWA 4FIDA 4EPWA 5BWMA 3WYGA 1KMHA 2W6JA 5HKKD 1XXHA 3HP1A 3PXGA 3TNFA 3FMPB 2X19A 1JJVA 1XD9A 1JJ7A 2OFWA 4FMDF 3C8UA 3FHTA 1AS3A 3EIEA 2JLZA 1G41A 1WXQA 3E70C 2SHKA 3VHXA 1NJGA 3EZ6A 4Q02A 2ODEA 2YNMA 4Q48A 2LKDA 3SDZA 3E2IA 6Q21A 1HTWA 1OLOA 3HDTA 4LUCA 4Q4JB 4F91B 4HB3A 1BKDR 2HXYA 1US8A 2FSFA 1G6OA 2V7QA 5AUPB 4Q4AA 3BFKA 3Q7QA 3GPLA 3A58B 3O8CA 1N2CE 1OT3A 1P75A 1YR9A 1JR3A 1ZNWA 1F2UB 3IEUA 1E9SA 2OE2A 4L9WA 3T1TA 3IIMA 3RANA 3VU9B 3W8NA 2ZRNA 1RIFA 3AGQA 4BFYA 3W5JA 3A1SA 1Q12A 2XB4A 3ZVNA 1XRJA 2A3RA 2OUKA 3TW8B 2ZSEA 4GMDA 1EX6A 2W00A 1MR3F 3GJ8A 2QN6A 3CF2A 4OK5A 2QM8A 4TSFA 3Q85A 4QHTA 4MGZR 3LBNA 2P5SA 2WJIA 1ZC4A 1ESNA 1D6JA 3QKRA 1W0JD 3OAAD 5LB2A 2ZE5A 1JPNA 1NMZA 1QHYA 1N6HA 3OZXA 3K0AA 1VYTA 3VR1A 1Q20A 3ASYA 2ASEA 4IVPA 3S1AB 1R5OA 1KDTA 1NVVR 4OL0A 1FNMA 2WWXA 5J5CA 4TYYA 1WDTA 2VRWA 2P6RA 3ZVLA 5KSPA 1U2RA 4HAYA 4BASA 5KTYA 4ZIRB 4LJ6A 1M8PA 3AGPA 3QQ5A 3GLFB 1M2OB 3VX4A 4A2PA 1ZUHA 1KDOA 1J90A 3LO5A 4WVFA 1G21E 2PX3A 3RWOA 4Q9JA 5HZHA 4GL2A 1VKJA 2AHOA 1UPTA 4EKDA 1GFIA 1RRPA 2PLFA 4JS0A 3GD7A 3BERA 1OXTA 1GRRA 2AD5A 2JLRA 3GFTA 2JDIA 2WJYA 1H8ED 3B8HA 5FTMA 4X8HA 3THXB 2NO7A 1D9ZA 3QSYA 5CLQA 1G291 5FUVA 5BYJA 1KIMA 3EC1A 4IDHA 1FUUA 5IF9A 4MYUA 1JXOA 2CCJA 4UXHA 4Q9HA 4AWXA 1AGRA 1EFTA 1DELA 1MO6A 2AD1A 2GILA 3M0EA 4IEIA 4A6PA 1AZTA 1O3YA 2RHMA 2ZJ2A 3OIWA 4ZCMA 3W6OA 2XX3A 1FTNA 3SJAA 1R0ZA 4X8MA 3DO6A 2J41A 2ZM5A 2ZI7A 4ZDKA 5EE0A 4MGKR 2BBOA 4HI0E 3WBJA 4D0LB 2QG6A 1W36D 4KFRA 1J2JA 2IX3A 2WMOB 5EP2A 3A4MA 1NLFA 3AF3A 3K0EA 3VR6A 3TVDA 4NKRA 2EQBA 4TT3D 5EXXA 4A8JA 1II0A 3AH8A 2XITA 5B57C 2QAGC 4JLVA 3X1DA 3KQHA 2J7PD 5EE9A 3L8ZA 1ZUNB 1FW6A 4O0MA 2ZRMA 1Q22A 4OJQA 1YZGA 1M7BA 4HUTA 2QPOA 4RKFA 2GK7A 2GBLA 2IXGA 4LBZA 2G9NA 2R2AA 2JJ1A 4BLPA 2ZEJA 2BC9A 2QE7D 2O8FB 2CCGA 2GNOA 4OQNA 2VHJA 4C0QC 2X8AA 3B1XA 3UG6A 2VHUA 4IJMA 4TL7A 4I1SA 3UMFA 2QT0A 3UMSA 5K8UA 4AI6A 4TWZA 1GILA 3B60A 4PQYA 5L8VA 3VR5A 2C77A 3B7GA 3V9PA 4Q5IA 1F2TB 5KDLA 1KZGB 1AS0A 2Q3MA 3DZ8A 1NL3A 1QVAA 2Q0HA 3MSXA 4RJLA 3ZD6A 2E9SA 3LDAA 3C16C 4QG7A 4EFNA 2JJ2A 2OBMA 3KQUA 1EG7A 3VR2A 1H65A 4RKEA 5JWHA 2OT3B 1U0LA 2ZRDA 3KB2A 5FBWB 1UKVY 2ORIA 3V4FA 1E0AA 1G5TA 5C4GB 2NQ2C 1SXJD 4HZUB 3OEEA 1I4LD 4XWOA 2IXFA 2PL3A 3RS2A 4V02A 4FMBB 5CYPA 2GEVA 3IILA 3IQXA 4PXAA 4UQOA 1XBTA 3U7EB 2GKSA 2ATVA 1MO4A 4WZAE 5HZKA 2BMFA 3L0PA 4AC9A 5B64A 1XB2A 5CK4A 3T15A 5DNYB 2HXSA 3ADDA 2AK3A 2ZVQX 4A8JC 5H1YA 2QSYA 2J0QA 5KDDA 4QJ3A 1A4RA 2FU5C 1KJWA 3K70B 2FPKA 4FCTA 4URYR 5FOSA 2RGEA 2FSGA 4W5JA 2REOA 1QHSA 1Z6YA 3DZDA 1QG4A 2GBLC 4DDVA 3WYFA 4D26A 4ZCIA 1G17A 1ZU5A 4FMDB 1NBMA 4QL3A 3SEAA 4GRAA 3W6PA 2WPDA 2ZI4A 2GEDA 2A5DA 3IIJA 2TMKA 3IO3A 2V8OA 5FOTA 4OK3A 2O8EB 2RMKA 4BLQA 5L3VA 2J87A 3OIUA 2QBYB 3PEWA 1EFHA 2HUPA 3BH7A 5G3ZA 4PPGA 4KVGA 4CEJA 2RKOA 1EFCA 3EA5A 1E96A 4M9XA 1VCMA 1YR6A 2H17A 4ZKEA 5JI3E 3B1ZA 4GNKA 3E1SA 2ZS8A 4Q01A 1T8UA 3AF1A 3CUEF 2V55B 1UFQA 1Z0JA 4NL4H 4M1KA 3RWMB 3VHLB 2RGCA 3PUZA 1UJ2A 2ZUBA 3OE7A 2NO9A 3ZH9B 1GP2A 1G7SA 3CNOA 2P6NA 621PA 2AK2A 1KY3A 3BC1A 4YXWA 1Z2AA 3N2IA 4Q1FA 2QQ0A 2WVJA 3IUYA 2ZRHA 2R9VA 4FN5A 1RPZA 1KOFA 2GETA 4LCBA 1XEXA 2KBFA 1UF9A 2AFIE 2DFKB 3IGFA 2JLXA 1PLKA 4MUBA 2VP0A 3A8TA 1EX7A 2ONKA 1KI8A 3CRQA 1KGDA 3RYTC 1OE0A 5CDFA 4PC6A 4BZPA 2R6DA 3VQTA 3ZGXA 1LNZA 2EYUA 4PZYA 1AJEA 5FFMA 3ECCA 1UADA 2CCKA 2YC2C 1COWA 3K53A 2DWPA 2ZU0C 4P4SB 2IUSA 1O87A 2JIZA 5L3QA 2AN9A 1R7RA 1DAIA 3HR8A 4B34A 2NTYC 3BXZA 2GCPA 4DIDA 3KKQA 1YR8A 5FBVB 1VG0B 2ZRJA 3AKEA 2F3RA 5JI2E 1RE0A 2R62A 3I5XA 1Z07A 1CJTC 1N0VC 2IWRA 3SFZA 4QGAA 4OHVA 2J0VA 1JALA 3RDPA 1EESA 2BBTA 2CL6X 3GEIA 4KU4A 2CNWD 3VKWA 3KUCA 1ZD8A 3PJRA 4HATA 1FMJA 3U3KA 2N42A 3SE0A 5FUWA 3TW4A 4O2RA 1NMXA 2H8KA 1E4VA 3A1TA 4Q7MB 1XU4A 4KYIB 1K5GA 5DI3A 3SN6A 3K1JA 3NH9A 3BH0A 2GXQA 3OESA 4UXJA 2W6ID 1KI2A 2ZSAA 4Z1MA 4R71A 4A15A 4EQ6B 1I4DD 1ZVQA 1KI6A 2C8VA 3NEYA 2O0HA 2MSEB 3KX2A 2IYWA 1XTJA 2EFGA 1MABB 2QGNA 4M21A 1S2MA 1QVRA 3I73A 1T3SA 2OO7A 4IOKA 4JLKA 2W83A 2X2EA 3OHMA 1MH1A 1LVGA 4M9QA 2JLUA 3K9HA 2KSQA 2FA9A 3W6NA 2H16A 3KZ1E 2V1XA 2EU8A 4JKIA 3EIHA 4KODA 1KNXA 2WICA 1K8RA 1RRFA 4URUR 8OHMA 3KXIA 4MKIA 2G83A 3TRFA 4FINA 3I61A 2AWNA 1E2KA 1T3LA 4TL8A 4TLAA 5JECA 2XOKD 3DM9B 4CGZA 3TIFA 4YMVA 4ON9A 5HR5A 2FEOA 3WMFA 5AK0A 3T35A 2IW3A 5HPYB 5JMTA 3OFNA 3GJ6A 2OAP1 2ZRAA 1E9AA 3HWSA 2Z5FA 1MO3A 2ZU6A 4E22A 4EJSA 3GLIB 2C03A 4U7DA 2D74A 2Y8EA 4A0HA 1TPZA 2GDJA 3CPEA 4A2WA 3B85A 3K70D 3U7HB 1ETUA 1ZNYA 3BB1A 4AG5A 3ZQ6A 2HYIC 1MOZA 5A0FA 2WWYA 1P2VA 1GNQA 2ZRLA 4Q4HA 5D3MA 4OI0A 5G41A 5TDHA 4D2IA 1S0UA 2JLQA 3MUFA 2XXAA 3UPUA 5D3QA 1CU1A 1FX0B 3LA6A 3WMGA 3SYKA 4WXRA 2D7CA 2HLDA 5AJZA 2RGAA 1ZW6A 4MKFA 4B2LA 3C4JA 4LHVA 4IEEA 2BJWA 3SYLA 3UWOA 3ZJYA 3QEJA 5JHGB 2IEYA 1NKSA 1SKQA 4JLBA 4AD8A 5LDDC 4TLCA 2EFDB 3GLHE 2P0EA 1ZBDA 5FBQB 4M1TA 1XZPA 3DPUA 3AVQA 2JASA 4DUGD 5FL3A 5M04A 3N70A 5BN4A 4Q7LA 5IK2A 1KI9A 1XX6A 1XFAA 1ZYUA 3W3ZB 1JXMA 3B9QA 3KQNA 1P6XA 3H2YA 4P31A 4JBWA 2H5EA 4QBFA 1GKIA 5AJYA 3GLHA 4FMCF 4TTQA 4URWR 3T61A 3EPLA 3X1XA 1U99A 1JPJA 1RYHA 4BFVA 4RCZA 2FX3A 2RH5A 4NPHA 5HTKA 2OCAA 5FR1A 2H92A 1E2LA 1W4AA 2GXAA 2QGZA 3L43A 5EZ5A 2DR3A 1E9FA 1GITA 1QRAA 3NDBB 1LF5A 1Z83A 3WNDA 2BEJA 3CNNA 5BQ5A 2GAAA 1QHHB 4Q4LA 1NI3A 3KKNA 1OXSC 2IYTA 3B2EA 2VF7A 3MD0A 1KNQA 4GI7A 4JLDA 1DOAA 1M1YE 5DLQC 3ZIAA 5FBLB 2RHDA 1JQJC 1OYWA 1EXMA 3PEUA 2FMXA 2F43B 4LYAA 1QZXA 3SBDA 2ZIAA 4YLGA 4OHXA 1OPXA 4KXFB 2IYXA 1XMIA 2ZYTX 2V1UA 3M4YA 1B23P 1R2QA 2C9OA 3EAQA 1GSIA 3THYA 1X1SA 2RGXA 1T3HA 1UDWA 1OFUX 2V9PA 3BGWA 1L4UA 4OK6A 4AG6A 3CH5A 1XCPA 4F4IA 2JLVA 3THWB 4RD3A 1WCV1 3L0SA 4ACBA 1SVSA 4DT1B 1FZQA 2RGNA 1NKTA 1GNRA 3LD9A 3NHAA 3TSZA 4L5BA 1FUKA 3OEHD 1GRNA 5HCNA 3MAAC 1Z0KA 4EAQA 4CEHA 2WV9A 5CB8A 1NNEA 2WWWA 3KFVA 1VHTA 3SJCA 5JRZA 2IL1A 1X1RA 4OBEA 4C0BA 2NZ8A 4BFWA 4UNQA 1KTVA 5GJWC 3KTAB 4ZCLA 3U44B 1SVLA 2QUZA 3DKVA 2KE5A 2Z43A 4PHGA 2PLRA 1KMQA 3A6PC 3FFBA 1E9RA 1U9IA 1PUJA 3GJXC 1VCIA 2DHRA 2ZS7A 2VIIA 3AP3A 4K8OA 2GCNA 5KNCA 4TYQA 3AP2A 1W5TA 1T0HB 4TZ6A 2NG1A 3QBTA 1PLJA 3C5CA 3QUSA 3TSWA 1BH2A 1XPUA 4AKGA 4K81B 1KJYA 4QC2A 1W0KD 3QXHA 5E7IA 3TAUA 4M1MA 4HYYA 2ZVPX 5EP4A 2ZSFA 3CPJB 1WRBA 2A78A 5JBQA 2CJWB 2R8RA 1XPRA 4JZKA 2IYVA 1ZM7A 1TAGA 1UAAA 4ACAA 2I1VB 5BXQC 1CR2A 4L9SA 2A30A 3AKCA 4B73A 1U98A 4D81A 3QI2A 3BRWD 2YOHA 1T8TA 4I1VA 1Z6TA 2WBLC 1HEIA 4LK2A 2VSOA 3TE6A 4DZZA 2J3EA 2VHTA 5JHHB 2H18A 2DY1A 2FG5A 3FKSD 1II8A 2F1RA 2JLSA 2A5YB 4U02A 1YZLA 1CJKC 2VP6A 2XNSA 1IXZA 2EYQA 2XTZA 3HJNA 1MRNA 4M1SA 3BORA 3AKDA 4PSKA 2WMNB 1B0UA 3IQWA 1A82A 2W58A 3MCAA 2BVNA 1A5TA 2KJQA 4GFDA 4ERNA 1T0JB 1NJFA 1NVXQ 3AKYA 3BK7A 3GEHA 4NYJR 5H68A 4OHZA 4URXR 2JLWA 1D8TA 521PA 2R6GA 2WM9B 2F1JA 4GZMA 1N0WA 3X1WA 2OBNA 3SQXA 2WAYA 4ZV4A 3EWAA 4LC0A 1CIPA 4ASUD 2REXB 4A82A 2FH5B 4QGHA 4AYWA 3O8RA 3K09C 3I62A 4E09A 2RGNC 3DKPA 3U4QB 1E79D 1LS6A 2CE7A 3D8BA 4KCGA 1KO1A 1XP8A 3EG5A 2D62A 2A5FA 4A4DA 4OI1A 4HAUA 2ZTSA 3PG5A 1N0UA 4GDFA 4A92A 1UEIA 1VG9B 3FE2A 5HCIA 1VCOA 1IBRA 4W5HA 5CB6A 4LV8B 1N6IA 4DCNA 1E32A 1VIAA 1NG9A 4O3MA 5HE9A 1LFDB 1G3UA 3QG1A 3QY0A 1DAFA 1KMHB 1P9RA 1U9IC 1S9HA 1XXHB 2GF9A 1SXJB 1KJZA 1EFRA 1ZCBA 2XSZD 2VLIA 3M1IA 4JBYA 2NO1A 3GLGB 3B1YA 3JVUA 5KO2A 2JATA 2PCLA 2PMDA 1YRAA 3P4YA 3OF5A 1LTQA 1JNYA 2YWEA 2CL7X 2CDNA 1PV4A 2ZXUA 4QNMA 2CK3A 5FOVA 1T9HA 1E69A 2CBZA 1W4RA 4OQMA 1CKEA 2ZRBA 4O25A 5GJVC 4A9AA 1LB1B 5J4VA 3U5ZB 3KXLA 3TJZA 2ZE7A 1NIJA 3AVTA 1G3MA 4LHWA 1KI7A 4JLOA 4B3CA 2ZI6A 5B30A 2FNAA 1US8B 3VFDA 3QPUA 1W36C 2YINC 1OSNA 4Q4AB 1Z29A 2HJVA 2OG2A 2YOGA 4JYBA 4KV9A 4R9UC 5LD2C 1Z5ZA 3LX5A 4XD7D 1DAMA 2JCSA 2P2LA 4MRSA 3WP1B 2YYZA 4BEJA 2RB4A 5TV2A 2Z4RA 2QAGA 3R20A 1SHZA 2OLKA 2RCNA 4NZYA 2ORVA 4M2LA 2CHQA 3UANA 5GVSA 2QRNA 1Z2CA 4HSEA 4HAZA 3MLEA 2UKDA 4V0KA 3SR0A 3ZQJA 3GJ0A 1TU3A 5JJKA 1U94A 3QF7A 3REGA 1JAHA 3CKLA 3FHOA 4BZXA 4G0NA 3K0AB 5SZIA 3P1JA 5DSZA 1TEVA 3GLFE 4V0ME 2VP5A 2FJUA 1CTQA 1GUAA 3AF0A 2FFAA 2NZJA 1J7KA 2VSXA 3Q3JB 4RFVA 4DC9A 2OILA 3MRSA 2N46A 1P61B 4I99A 4PSAA 4RD6A 3AVVA 2PT7A 2WSMA 4J0QA 1X6VA 4S35A 1BMFA 2IS6A 5E7MA 4FMCB 3QENA 1J70A 5FOWA 3CF0A 5LB4A 1JQLB 4W5WA 4XTCS 4V0LA 2YV5A 4ESVA 1V43A 1UBCA 2J46A 3BS4A 2AFHE 4QBGB 5DN6D 1KK3A 2G3YA 2ZAOA 3QKTA 1DAHA 4V0MA 1OKKA 1KSFX 1CS4C 3D6TB 3PEVA 4R7ZA 4IVQA 4OQFA 4DLSA 1DO2A 4Q9KA 3C5HA 5A4JA 2BHRA 4X8OA 4B3DA 1TF7A 3LLMA 1CXZA 4L16A 4BFUA 1IXSB 2B6HA 3T06B 4PPQA 4DLYA 3I72A 4EUNA 3HU1A 1RW4A 3QF4A 2GK6A 1LF0A 4HUQA 1XEFA 2ORWA 4C4PA 1E0JA 1V5WA 3RS0A 4B44A 1Z22A 1OHHD 1X8JA 4PC1A 3TSOA 3ICQB 5JEDA 4GT1A 3EC2A 1NY6A 1Z6GA 4NE2A 1G3IA 2W2XA 2OM2A 3SQWA 1GL9B 5JFGA 5FL7A 1XJCA 2R6AA 1VMAA 1XD2A 3AV0B 3FVQA 4Q1DA 4N1AA 5F9FA 4Z8XA 3Q7PA 2IHYA 3PUVA 1E2PA 3OIVA 2D4HA 3KQLA 4ZDIA 2ZJZA 4URZR 1PUIA 4D25A 2NO0A 1R5BA 3ETLA 4Q18A 4GOKA 1WA5A 1ZM4A 2ATXA 3KJEA 1KHTA 3DM5A 3DMDA 1Z47A 4C0AC 2MMGA 5E3HA 4NMMA 5FPYA 4JVLA 4NTZA 1KAOA 1YQTA 3GP8A 1PVOA 3WP0A 3SYNA 3U6BA 3NG1A 4B3XA 2GZHA 3NBZC 4KJZA 3B78A 4Q7JB 2DCUA 3PUWA 4D4MA 3PUXA 2G1KA 4MUAA 1IXRC 3CZQA 1NN3A 3F5FA 4BQSA 1SKYB 3I8XA 2WWHA 4PHFA 1IN6A 1E3MA 3WXMA 1X8KA 2B8WA 4Q1EA 4XTRA 1XTIA 1DVRA 3RS3A 3AEZA 4B43A 4IW3B 3CLVA 1ZM9A 4JLAA 2ZETA 2GRJA 3CWZA 4UXIA 4HDOB 2BMEA 4V0OA 3B1VA 4WXPA 3THOA 1P9NA 1FQJA 1F2TA 5KPJA 1IY0A 1Q1ZA 1W4CA 2GHIA 3LNCA 4IHQA 3WHLA 1S1MA 1UBGA 1YZKA 4I4LA 4ZO4A 2XAUA 2ZJYA 2CLSA 2UZ3A 5J40A 4Q7KA 3IO5A 1NVUQ 1DAEA 3NBXX 4UNNA 2IWHA 1W46A 2W6JD 4TMXA 4FWTA 4NHOA 2DFTA 3ICEA 1W48A 3B6EA 1F3OA 2C9CA 1NVVQ 4BLOA 1G5PA 1TF5A 4CZ2A 4MYTA 3WMEA 3MJRA 4Q9LA 4CVNA 2R65A 4D4LA 3KUDA 4EFMA 3ZYCA 4XOIA 2IBMA 3RNLA 1IM2A 3QXSA 1MRSA 2FFQA 5JSZB 2Q3FA 2ZSBA 4KVAA 1TQDA 4IFBA 5DO9A 4GPTA 1E98A 5ANRB 2IK8A 4DLUA 1TMKA 4M8NE 4LZZA 1XDBA 2ZRCA 4TQ9A 821PA 4DJTA 1G19A 2ZI3A 2V7QD 3QXXA 1RJ9A 4G1UC 3UMRA 4P4UA 3EIQA 2GAOA 3H4MA 4CEIA 4TYWA 1JR3D 4IOMA 3UXMA 4OJKA 3KKOA 4PO9A 1LY1A 4GOJA 4MGIR 2ERYA 4OYHA 4MKGA 4BUJA 1BYIA 1E1RA 1NN5A 2YZ2A 4B33A 1DE0A 4P0TA 1OW3B 2FSHA 2QMOA 1G8HA 5JEEA 3BJIC 1WBBA 3CRMA 3HU3A 1VECA 3K9NA 4TSFD 5CLLA 3W5IA 4JL5A 1ZCAA 1QHIA 1SULA 3DOFA 1P7CA 1HT1E 1F6BA 1Q3HA 1Z0DA 2Z83A 4WZ6A 5C1BA 3W8RA 2BM0A 1G20E 3SOPA 3UATA 3CW2A 3R9IA 1NF3A 3CR8A 3NKVA 5IRCD 2E1RA 3QVVA 1HURA 2P67A 1D5CA 1P4SA 4OI2A 2A7QA 5FPTA 4XJXA 3TMKA 5FTLA 4RD0A 4CEJB 1EGAA 2F9LA 2R6CA 5GADl 5FTKA 3R7WA 4TLDA 2QPAA 1E0SA 1E9DA 3K0SA 1YZUA 5EUQB 4FWIB 3BD9A 3LW8A 2V54A 1FTSA 4YMTA 3A4LA 2J0SA 1W49A 1P3JA 3LWNA 4G01B 2FGJA 3KL4A 4D82A 2PJRA 1G8GA 3DMNA 2QTVB 5TY0A 2QORA 5CIWA 3WRXC 2CHVA 2KI5A 3L8YA 1IAQA 2QM7A 4GOXA 4Z51A 1E0KA 1G9XA 4EPRA 2ZRPA 1YE8A 1Q57A 2ZRKA 4GP6A 3HPQA 3MWKA 1Q21A 2DBYA 4RFSA 2W0MA 2WZQA 2JGNA 2NPIA 1SQ5A 1F5NA 4TL6A 5KDOA 2Z0MA 1S9DA 2VHCA 4DSUA 2OFXA 1DG1G 1N5KA 1Y3AA 1UBEA 4KBGA 3QPVA 4RCYA 2GJAA 2ZITA 3PITA 3AM1A 2QROA 3IHLA 2HYDA 1XTRA 1E2EA 1W4BA 2FZ4A 2OHFA 1XTQA 1FP6A 4BECA 1OXVA 4PAOA 3ZLJA 1XNJA 2WSSA 4HLUC 2JEOA 3NVAA 4M53A 1KO7A 1TADA 4WA7A 2V4ZA 1NN0A 1QHNA 3K0FA 3RRYA 2PEZA 3GJ4A 5L3QB 2Z6VA 5EXTA 1G7RA 4LY6A 4XSHA 1GAJA 1P60A 3WYAA 3ADKA 1GL6A 3FMOB 1ZC3A 3BOSA 3SZRA 1OH5A 1IN7A 5FUXA 1KY2A 4PR0A 4OHWA 4BFTA 4DLTA 4DDWA 2GJ8A 2YWGA 3CBQA 1S96A 4YMWA 1AIPA 1H8HA 2WJVA 2WWGA 4B35A
chains in the Genus database with same CATH superfamily
1D4AA 1A9TA 3R5FA 4HRAA 4OGKA 2JJ1D 4M1ZA 5DGIA 3DLAA 4RZXA 4F5DA 5ICMA 1ZBQA 3FWYA 4NYIR 1HPLA 3A2MA 1W1WA 1A9OA 3ABSB 2GK4A 3DQPA 5DI3B 2CZCA 3W4KA 1A2KC 1T9ZA 1BE1A 1GUYA 3W6UA 1XN1A 4W1QA 1QIHA 2ZATA 1NQWA 1DKOA 2BR5A 2FW7A 2O2JA 3B5IA 4M3NA 4MWGA 3CJTA 2HLPA 2CL5A 1U04A 2ZBRA 4EO9A 3QIAA 5I8PA 1A1VA 3VJRA 3QKSB 3GT4A 4GIBA 5I01A 1NYQA 2OMEA 1Z8HA 1EJ6A 3CSDA 1VKRA 1B0ZA 3SIPA 4EG1A 3KKMA 4D5GA 4DLZA 1QX3A 1SG6A 1V8ZA 1KK2A 3BWDD 2AOXA 4PS1A 3VR5D 2C99A 2ZBFA 2EL7A 1E5XA 2P9FA 4Y6PA 1J6UA 2AJLI 4IJWA 3WNBA 2AI2A 5FHRA 3GVCA 2JCXA 3CLKA 5IWAB 2C4MA 2GMWA 4ZYXA 3R23A 4EKGA 2IDKA 1B6SA 4RGYA 1ZSVA 4RZSA 2QSZA 2ZIVB 4JT4A 2ODWA 4LZPA 2JFUA 4R9RA 1K06A 2F1KA 3RO7A 2R87A 4U2DA 4E03A 3DWIA 4UFPA 2OQIA 2GYYA 2ZKIA 4WKNA 2HB6A 4LTDA 2AZ4A 4Q03A 1O97C 2R7AA 3CZ4A 2J4CA 2AN1A 2ORYA 1ZD9A 3F3SA 3OU2A 3S8EA 3GDOA 3U62A 1Z28A 1DTEA 3C1AA 3FI9A 4HDRA 1TCVA 1V7PC 4XQ9A 4C5BA 1PUXA 1WTCA 5DYYA 4RGVA 4ENWA 2P69A 3KAJA 1UK6A 1RMTA 4JXZA 2JI6A 1IWOA 4JI6B 5KTMA 1BN7A 1U3UA 4A36A 5DGXA 4ARAA 5JSUA 5CR9A 1XQVA 1G0OA 1I01A 3Q10A 3LCCA 4G5QA 4Y6OA 3K5WA 1AKYA 2WW8A 1CUWA 1Z88A 1ATIA 4F6RA 4BYGA 1CQPA 1B43A 2Y0EA 4QX6A 4YPFA 1VMEA 4DZTA 3RTBA 4JSYA 5LOVB 1LRKA 4RF3A 3UUFA 1L7OA 1QLHA 1MT0A 1A1SA 1NPYA 2OQ2A 2WD7A 4IIUA 4KEAA 3RE1A 2REBA 1QGZA 4UAGA 3TOVA 1UK7A 3M6LA 4GC5A 2EGHA 4ZOCA 3G8BA 3PWZA 1RAAA 4D9KA 4EG8A 3F6PA 3AVXA 1ZNZA 4RVOA 7AT1A 2R47A 5KYTA 1JG2A 2PMBA 3MN1A 2XF2A 1T24A 4C0SA 4Q21A 2GPTA 4TMKA 5HKKA 1C9MA 1UWKA 2VNKA 2ZWPA 4Q93A 5A4IS 4Z99A 3TTXA 1CEEA 1OD6A 2HT1A 1XZCA 1DKMA 3EEBA 1UFVA 3LHDA 4KFUA 1FX0A 3HZZA 2J33A 3KHTA 1L6RA 4P7JA 3WYDA 5K05A 5ALUA 3EDOA 4OQYA 4KSCA 1NYTA 4OQZA 4WJKB 4RY2A 3TSCA 5IJ9A 4H1VA 1OI4A 3G9QA 1GAWA 2DPGA 4FHGA 3ZD7A 2QX4A 3H87A 2AOUB 3TLMA 2RE8A 2GDZA 1G7TA 3M81A 2G6BA 2BKXA 3AR9A 4DYHA 1P1IA 4ZEVA 1FF9A 3H1PA 2XUPA 4IIYA 3GU3A 2ZQ5A 4CMHA 2D0DA 1RYNA 3SQDA 3ZZUA 1YQXA 2LVBA 2FR0A 2ANBA 2ZJ5A 1XMVA 2GKGA 4L8YA 4YX9A 3F3YA 3G2HA 3EQ2A 1IZ9A 5U4QA 4BLUA 4EHLA 2M6LA 1OJLA 4WLOA 3IE2A 2IYRA 1IOLA 3VVMA 1PEAA 1I9CA 3ZEAA 2ZI5A 2ISCA 4U0KA 2FK7A 2IA5A 2JBWA 3IRVA 3KU4A 1QU2A 3K8ZA 3LKVA 2J6CA 4QD3A 3NWOA 3OZDA 3PQ6A 4GAEA 1Y8QA 2FPPA 4D3SA 2DPLA 3EA0A 4N9QA 4UUOA 4BB6A 4KAXA 4MCAA 3J7AC 3U3MA 4AX4A 2BCEA 3AUXA 1C4KA 4YIKA 1GZUA 2D3TA 3PJGA 2C0QA 1F48A 2VYCA 3IA2A 2OK8A 4FHCA 3IEMA 3ZVMA 1J0CA 3MCVA 1YVPA 4RY9A 1XMJA 3ZJTA 3DTVA 1JMKC 1ZR4A 1E5DA 2F6RA 2Q27A 5L40A 4G5OA 3M4XA 4EHNA 1E2IA 2FPIA 2QP9X 4GXTA 4PSVA 4ZEOA 2J32A 2HWXA 3AUYA 2RI0A 3BDIA 3QX8A 4BIMA 5IU6A 1COWD 1L5VA 3N39C 5DTQA 3GGPA 3T6KA 3RU3A 2VRNA 1IY1A 3L7MA 4ZYZA 1NHWA 5KYGA 4L7VA 4F7DA 3VKHA 4FSHA 4GXNA 4M38A 1A9RA 3TJMA 5REQB 4C20A 1JKXA 2FRDC 2ESRA 4MQ5A 4DLWA 1V3QE 1FDUA 3K09A 3E35A 3EXIA 3HCNA 3RYHB 1I2DA 1FFGA 3KQQA 3FYUC 4JBNA 1HYGA 1C4OA 5F52A 1VYUA 1K7EB 1F4VA 1M8JA 1GTVA 1OAOA 1G4AE 3GFGA 3K5IA 2JLCA 4KNVA 5CNJA 2X7HA 3PR2B 3U1VA 2XKBA 3KQMA 1VSVA 3GARA 2R6JA 4EEXA 5EKXA 5FA5A 5G40A 1ZUIA 2ZJ4A 4D3FA 3ZZMA 4MR7B 4YJHA 5C1OA 1YRLA 2XZOA 1BX0A 3UJCA 4BNLA 3IH5A 3JRNA 3C39A 1Q44A 1JAXA 4X7MA 1AO0A 1PNTA 4M0LA 2F8TA 4WCFB 4JOBA 1V7CA 2HT6A 3MA0A 3IMKA 4Z1MD 2VJOA 3SLGA 4RPHA 4TLEA 5ECDA 3HADA 4R84A 1NQAO 4TTRA 1ZL0A 3RRFA 1GZ5A 3QQPA 2J7KA 2PEYA 3A37A 1D2GA 4I1OA 4BQPA 4D44A 6REQA 1H4QA 2P0YA 2R97A 3OECA 2QVCA 3E5HA 4GI2A 5FTJA 2ZYUX 4X60A 4ZQBA 1OF1A 2O6HA 4ZOLB 3G17A 5DTRA 1MF7A 2FGKA 4O4JA 2PXAA 3I9FA 1WEKA 2KLBA 4O2LA 3K0HA 3WLOA 5CITA 2JIMA 4I08A 4IQ4A 3A1NA 1QVZA 4O02B 3G85A 4XZ3A 1P2GA 4NCKA 5KHLB 4ARZA 5HNKA 3OOEA 3Q5EA 3GXOA 1M6VA 4PO8A 2GPYA 3MT9A 2J7PA 3DAFA 3RIMA 2K7FA 1WCIA 5ALKA 2ZIWB 2WUWE 4JCCA 1WAMA 5I7RA 4EA6A 4B3TB 2EFHB 4IXNA 1L5WA 4OHYA 1N3BA 4PFSA 3NDJA 3SC2A 2B4AA 1FUIA 1RRKA 4TS3A 1W47A 2HSWA 2D7DA 1AM4D 1ZVMA 3KVNA 3ZY4A 4ZVUA 2EW1A 3GYGA 1FXUA 4GYWA 5G0VA 2HCTA 1ZQ9A 1CQZA 3M6WA 3UCXA 4OA8A 4PLVA 3WRYA 5DIZA 5J2TF 1XV5A 2FQQA 2IYAA 1QRDA 1GA4A 1A9SA 3D4IA 3I5YA 4V1CB 3U7FB 1IY9A 1BCRB 4YJDA 3TQTA 3VNAA 4D9EA 1BU8A 2Z57A 2ZBEA 5EIFA 5B53A 5I8WA 4H3HB 1DC5A 3G9TA 1GKLA 1DS6A 1WXIA 1GTJ1 2FN4A 3PNOA 1UPXA 4LY0A 4ABYA 2I71A 2SCUB 4AUKA 2ZB4A 3HYLA 5H16A 1ZI9A 3MG9A 3PFWO 1CQIB 1L2TA 4EHFA 1AN0A 2WIAA 3LVQE 4CDGA 5BN5B 4MW6A 4ZVKA 4KMOA 2YXPX 3CF6R 2O54A 4ZZ0A 1N1DA 3KQYA 1QRTA 1XXHE 3NNNA 1DT3A 5GPBA 1IN8A 1SXJE 3CBGA 4D9MA 3FPFA 4G0OA 4X95A 4BRUA 2FZWA 3RFFA 2BKEA 2B9VA 3IHWA 5E6SA 2X1VA 1L4LA 1PCXA 2Y9PB 2A7XA 3C14C 2WILA 2HK9A 2GM9A 4HMQA 1B74A 1NJ5A 1AKVA 1DMSA 1PJ2A 1TA9A 2JAOA 3N8NA 4Y18A 2CUNA 4RK4A 5HIKA 3IP1A 4HN9A 4HNHA 4PPNA 5BNZA 3Q8XB 4BNJA 1OMOA 1LRJA 3C3KA 2EGUA 2F55A 1YIDA 3AWIA 3H83A 3ZY3A 4OY3A 3RRNA 4MO9A 2V96A 2ZSKA 4LC1A 2GM3A 5EJ2A 5ALMA 4R8SA 3BMXA 1V4VA 1PV2A 1Z5OA 2HXGA 3VTKA 3WGLA 1KYQA 2ONCA 2BY4A 1KQNA 2PBRA 2DBQA 3TK1A 3JWGA 2O3QA 1WP9A 3ICOA 3I2FA 1B0PA 2RGUA 4A1FA 5D5PA 1QP4A 4IRUB 2EKPA 4LRQA 1RKXA 3VHRA 4RPKA 2V9CA 4DLVA 2BKAA 5AWFC 3VYSB 5KVSA 3GK3A 1AQ6A 4Q3NA 2IUUA 3TB6A 2XJ4A 4IVNA 1AQNA 4FNAA 5ULLA 1DXYA 2LIPA 2QTGA 1PQPA 5CT9A 2HU8A 3SNKA 3LK6A 1QP7A 4IINA 3JYQA 3AHCA 1B7GO 1VKOA 3ZWYA 3ZZTA 3U2QA 3PXDA 2YHIA 4QM7A 3K15A 5KOYA 3C41J 1IJFA 2RKBA 4LQ4A 5KTRA 4K88A 4Z6KA 1YQGA 4JC4A 5DH9A 1YS1X 2O2ZA 1E1DA 5DSXA 5JDIA 1CF9A 1IB0A 4DA8A 3IOBA 1DO0A 2QDXA 3GAMA 1L4GA 4Y0NA 4KNWA 2QP3A 3IURA 4LJ5A 3G2OA 2P4UA 4ND2A 3SS8A 3TZEA 3WIOA 1LX6A 1WABA 1Y6JA 4HK4A 4BNHA 1E2NA 4L7QA 4U7GA 1IEWA 2RH8A 3CLHA 3ZIAD 3PDIB 5GM2A 3WIVA 1L4HA 3VJKA 5JZ9A 4YC7A 1Y8AA 1W5SA 3H9JA 4XGNA 1AY0A 3VMFA 1SIBE 1JFTA 4FCVA 1EHCA 1HE2A 4A8PA 1H5NA 5TS2A 3TW6A 1JB1A 2KWIA 3TEJA 3JQAD 3KZXA 3PQFA 4JX9A 4COOA 4UBKA 3CPHA 3P71T 1OH6A 1ESEA 3WZ2A 5BURA 4M1YA 3OZTA 1E2GA 1ADFA 5DHRA 5EP3A 4EI7A 1QGUB 2IP1A 2E4XA 2PGLA 5AK3A 2GZMA 5ITVA 5LQRA 2GN6A 3MW8A 2ZCUA 1U9ZA 1P2TA 5EKDA 1QBKC 3NM5A 4AP9A 4OXKA 1VG1A 3PHHA 4HZIA 4WY2A 4NYJQ 3NFYA 3KOZA 4EFKA 2NO6A 1N2GA 3CIOA 2IIQA 1EP9A 4R2MA 3G0GA 5EJ6A 1G21B 3OQ6A 4RD1A 1KHHA 1C9DB 1XFDA 1ZLYA 2GPBA 4LWOA 3T8YA 1DNPA 2NZXA 4IHJA 1GUZA 1TRKA 5HQ3B 3W5AA 1RBZA 4L6AA 2ZZMA 4CTOA 2FB9A 2P62A 3EMBA 5LPNA 1QORA 3JYNA 5G3YA 2Y1FA 1GUFA 3RUFA 3VVBA 1Z2EA 5ICGA 1CSEE 2BDTA 2EJVA 1P4HA 4G86A 1PVVA 4HUQB 4PLTA 3REFA 5C3MA 1ZJ6A 3ESDA 1N3IA 2OCXA 3QVGB 4YMIA 3SC4A 4UOZA 2CLOB 1R6TA 2RGGA 3P2OA 3TBKA 1K6EA 2ZANA 4WJZA 4CM1A 4GRIA 1KDRA 1Y4DE 1YJXA 3DMHA 3L92A 4B75A 1NR1A 3OQVA 4Y9DA 1RJDA 3THSA 5JXIA 3G7SA 3KT0A 1TQ4A 4DRXB 1JHAA 4AZ3B 1IZZA 3B1WA 5KOJB 3L8HA 5CPBA 4BS9A 5J5AA 4UBNA 3TOCA 2NLOA 3WSTA 1D9XA 1FBNA 2OCIA 1XN4A 2EBUA 2CNOA 3LM8A 2QB5A 2AMJA 4A8JB 4PNEA 1RC8A 3EZ7A 3KWFA 4JLNA 1EK0A 3KKPA 5LNK1 4XM2A 1NZDA 3DZKA 1OFIA 2FW1A 3FSJX 3RC9A 2CXXA 4XYLA 2AMFA 1HA3A 3ZIDA 1W2HA 2DF8A 5B1HA 2O8FA 3DYIA 2FXVA 4IKEA 3SBEA 2CVHA 1J2TA 3D3KA 1QHXA 221PA 4Y9RA 3WQSB 3LMKA 4LMPA 2D2EA 2W6IA 3TPFA 2QYSA 4IQ8A 1N6NA 2K2WA 2J9RA 2PYDA 4YONB 4MW4A 4Y6RA 3R7BA 2IOQA 1FFXB 2INGX 1M2EA 3Q3CA 2YOFA 2Z2XA 3V55A 4LV5B 1Y63A 1YZQA 5G4LA 1BEZA 1JUDA 1U6KA 3A4NA 4PANA 1RLJA 1EP3B 4B4VA 2I1QA 3VNRA 3O4FA 1Z8FA 5H8WA 3JD0A 2O3JA 1PD1A 4E5PA 1CYEA 2WWIA 1XPJA 1ZNQO 2QT9A 2Y0BA 3K5PA 1PEYA 4N6OA 1N5RA 3V7NA 2FWBA 1ODIA 2GF0A 3JY6A 5DM2A 3EPPA 1XMPA 1G5RA 3CX8A 2GVNA 4FB5A 4FFSA 1KK0A 1QXSA 3T7JA 3EQ8A 1DRJA 2A9RA 4ABTA 3OJCA 3E9DA 4BVJA 1TAUA 3AJEA 3EF0A 4K9NA 2F3UA 4U4AA 3RS5A 4RIEA 2D3WA 2R6ZA 1GU0A 1HZZC 1QNLA 1WV1A 2HRQA 2W4MA 4N5DA 1Y6FA 4MKZA 5KVAA 1Y48E 3MTBA 4YQFA 3TZHA 1I2AA 4B8WA 2A0WA 2P4SA 1DP4A 1KAMA 4V0QA 2ZUDA 3ECAA 1EFRD 3L06A 1SBZA 2BFEB 2IT1A 2J3MA 2XOKA 2P90A 1TUBB 1A7UA 1IPEA 1U2DC 2YXBA 3EZ2A 4Y0VA 2X41A 3EG9A 2OGTA 5CLJA 1IUOA 5ALRA 3T3IA 5J2TB 3LKBA 1IHDA 4NV0A 3BHIA 3GQBA 2Z1MA 5JFOA 1FZTA 3G1TA 3T1QA 3TNLA 4FGSA 2CVFA 4TPKA 4XAQA 4ZVPA 4J3NA 2O0KA 1L4EA 5JSZA 4UHBA 4PAMA 3H9CA 4X00A 3BJZA 5HF5A 1KQ3A 5K6AC 1O95D 1R9JA 3AF2A 4GOOD 4BLTA 4C7JA 3UK6A 4K6FA 5JYDA 3QVTA 5COAA 3NC1C 1E2HA 1QUEA 1ZK0A 1ZK4A 3JALB 3NNDA 3Q2IA 4R2JA 4XM0A 5DM60 5AJXA 1I4EB 3NDPA 4HFMA 3OPNA 3NH6A 3OSUA 3F7OA 4HLUA 1HDIA 4XYBA 1RJ9B 1JKIA 3FOWA 3HXMA 3PX3A 3SYTA 4WZAB 1CUAA 4R7GA 3KM0A 2Q5EA 1Z0AA 1DRUA 1DUVG 5B1YA 1WBDA 3U3OA 1BDHA 2DUUA 5K0GA 4HLCA 1ZNXA 1WSDA 3DLHA 3V4RA 4HCJA 2YMQA 1EQAA 3C7AA 1QYCA 2QA5A 4KN9S 4M4SA 4BJ5A 1YZFA 3KOMA 3Q9UA 1L6IA 5AHWA 1D1QA 3PVSA 2HD4A 1YI0A 4RAQA 1ML4A 1YJ5A 3F1KA 3FRJA 3L7JA 3RUAA 5AUNB 1NLZA 2O8EA 4NJMB 1VL8A 3OJLA 3MJHA 5CTJA 5DYGA 2QBYA 2VLBA 1V47A 4LNUA 1SC4A 1ODFA 1YXMA 2IHBA 2NVOA 2RGBA 3CNQS 3D81A 3FPHA 3QI7A 4IGFA 4W1RA 1N0IA 3K0CC 4PGMA 4XASA 3JQBA 1GFWA 4ARSA 3G0HA 4OQQA 2UYQA 2WSIA 3JQ8A 1I1HA 4NU6A 3DUFA 5HWSA 3WMXA 2EKBA 2FWPA 4QHYA 1ENYA 3W2IA 3JQGB 3CRW1 1CR1A 1NM5C 3U4IA 3WHKA 1T91A 4ISBA 1XCGB 4FFWA 2C92A 1U7HA 3UWKA 3ADCA 2BTOA 4B3RB 1Q11A 1X7WB 2K7ZA 5FB3A 4ZV7A 2P8SA 3FOZA 5MHTA 1GQ2A 1WB5A 4QPJC 5F23A 2IEZA 1KKLA 3R7WB 1SUFA 4IUYA 3ZHOA 4BRZA 3AEUA 4HB2A 3HLYA 3TQFA 2HJGA 3MAGA 1TGYA 4U9UA 1FFBA 3VPSA 1NQTA 4TZ0A 2G82A 2PUAA 1KY5A 1ZMTA 2Z2KA 1KI1A 5HVNA 2ERXA 2FPXA 3R7AA 1EUCA 4NOLA 2O6LA 2IPXA 1DIOB 3IODA 3MCTA 2IZOA 2BKUA 3PRKE 4LBVA 1U0NA 4EY3A 4B4OA 4OAOA 4BEBA 4DNPA 2H63A 2ECKA 3QJ5A 3RODA 1USUA 3W9UA 5KX5A 1VHWA 4AS3A 1ZY2A 5DHAA 4EOGA 2BZ0A 1G5FA 1G42A 4P98A 4WOPA 4DIKA 4DLLA 4DQ0A 1W25A 3F5SA 4MTCA 5B1SA 2HFKA 2NWQA 3BHJA 4D3YA 5CDYA 4HAXA 1XWWA 2DHDA 3R75A 2V45A 3LBIA 3QLJA 2C98A 3AJDA 3P26A 4JI3B 3FAZA 3MWEA 4K7JA 4MKHA 3BH6A 2AG1A 1EWKA 3CIFA 4BFLA 1FNDA 2IXTA 3LIPA 4YDSA 3NYIA 4ZZ2A 1II9A 3WLTA 4YRJA 2H1LA 3R3HA 5AVOA 1NI4A 4IGAA 1I3CA 4WEOA 1ENOA 3E9YA 4X85A 5JHHB 3T3NA 5FL7D 3KQPA 3MWDB 2BGTA 2QRJA 2NW6A 5EJ7A 4F1KA 3RC8A 3H3FA 1IU9A 2ODNA 4Z9BA 1Q7EA 1CLEA 3CM0A 2OP0A 2OSBA 3AL3A 1IAVA 2Z30A 5H02A 3BXGA 3BICA 1RQXA 1OFHA 4FI3F 1L7XA 1XD8A 3GAAA 2LWIA 2ZE8A 2Q41A 1Q14A 1S3GA 3D0QA 3K0FB 3O8OB 1KOJA 2QX9A 4NE9A 3LCUA 3NXSA 1UBRS 3O2SB 5AJTA 1SOAA 1A8SA 3BB3A 1CP2A 4JX8A 5FI1B 1Y8CA 1R16A 1P1HA 3FPSA 2ZUTA 5JRJA 4F11A 1C1DA 3DCNA 4UZEA 2ZG6A 1U8FO 1VDMA 2QUIA 3QEBZ 2D5BA 2EQAA 2B4TO 4LXYA 4MI6A 5JLJA 2NVUB 4H0CA 3GFOA 1XPOA 4BWYA 2FPMA 3QV2A 4DCUA 4G41A 4DNFA 1W8DA 2G0TA 2ETXA 5CHYA 1ESCA 1OXKB 4E33A 3JZDA 4BX8A 4TTIA 5CYFA 5K45A 2PL5A 3LQYA 1ZISA 3ESRA 3FJ1A 1MABA 2Z8YM 4BGDA 3EZNA 4DDHA 1X1AA 4KN5A 3GBPA 4ND5A 4UBMA 2FETA 3HO8A 4S1NA 2HWWA 3G13A 3TCXB 4DWOA 1QTQA 4KR2A 1N3LA 3O91A 3KZNA 5ILQA 3KR2A 3PQCA 2ZJ7A 3JZAA 4Z2YA 4WW0A 1VYVA 5LBTA 5B2ZA 2QW0X 4ZI5A 2O2HA 4Y3UA 4LQLA 5T64A 2VYFA 2DZDA 3O7WA 4C08A 4OXNA 2C2ZA 4RETA 1X80B 3HUDA 2R7LA 5NULA 2Y99A 5TPWA 1NATA 1WU8A 5C18A 4CF4A 3CLSC 1CJVC 4LDRA 5HJ5A 4BJHB 2RHLA 1WQ3A 4GWGA 1FRQA 3UENA 5J2UF 4CLDA 2FUG6 4LYYA 4TS9A 1MIOB 3R09A 2ZUFA 2HDNB 2VK4A 3ASUA 1CZKA 2APJA 1PR4A 4P80A 1C3EA 1J9GA 2Y2UA 1DAOA 5CMLA 5AKEA 3BRWA 1V8DA 4PYOA 1YJAA 5DM4A 5JJBA 3WGZA 2YJZA 3KG2A 1CEQA 1DAGA 1HQDA 1CUFA 1XTSA 1BA2A 1F14A 1N8TA 4XOUA 4RJJA 4RJTA 3AHJA 4G4SP 1R6BX 1SURA 4MS1B 3E22A 3G02A 2Q5OA 2JLYA 1FBTA 2OO5A 2QTNA 1UQUA 2QRVA 4DMHA 1PDOA 2DLDA 1X9IA 3UMVA 2XMRA 5FWDA 1BJKA 5DEIA 4WNAA 3JASB 2BHNA 5L3SB 2Q6OA 1PJZA 4DDUA 1UJBA 4L4UA 3U3RA 5EMNA 4HGZA 3T3MB 3UV7A 4P3XA 3RB8A 1RAEA 2J0UB 5EE3A 5FUYA 5AJHA 1XZMA 3OIFA 4ASUA 5JXWA 1YE3A 3DBRB 3GCGA 4NNJA 1GNPA 3NTQA 3K6KA 4MV8A 4ZT5A 2NUPA 5A5EA 4I5FA 3RM3A 2C9BA 4FJ1A 4HH1A 5AESA 1FE8A 1U81A 5GAJA 4JUFA 3AOEC 1GO2A 1P72A 3HR4A 5D3KA 3TIVA 3UFXA 1E1RD 1G8KA 1THZA 3E9EA 1Z0FA 2H3HA 1JHRA 4OJNA 3QW2A 4K46A 1QC5B 3CJRA 3N7TA 2F48A 4DBLC 4IXWA 2F2TA 3RSOA 1G8JA 2O5VA 1KY4A 3BXPA 3CZPA 3AHGA 4QNRA 2AN4A 7MHTA 5BQOA 3RU7A 2X77A 2FJ0A 2IEBA 2ZE6A 3ABZA 3KDSE 4KO8A 4M1QA 3UA4A 5AW1A 2VZEA 4V0NA 2HRRA 3SGLA 2QN2A 4CMGA 2PNJA 3UZUA 2ZCJA 4ZEWA 5A4DA 3QXGA 4JK3A 2I4IA 4P83A 2C96A 3MMXA 2DLCX 1E2FA 3BGDA 4KACA 2LP4Y 3K6SB 4EZIA 4PY2A 1HZJA 3I92A 1HKUA 1XL1A 4O29A 1M9NA 3GX1A 2R7NA 3PQ7A 721PA 4MAMA 2QUBA 1XOIA 2VUSA 1EVZA 3G23A 4KB5A 1P0QA 1UDXA 2WJGA 2XMPA 4WESA 4B7CA 3FTEA 1NXWA 2R8PA 4Y7CA 1ZICA 3FPKA 2WK1A 3QTLA 2FE4A 5K01A 1THMA 4HF7A 2F1IA 4DMCA 1T6NA 1CNFA 5LMZA 3FYTA 5KYNA 2PXHA 3L7AA 1MQSA 4LSGA 1OBVA 4IF6A 1ML3A 4XPIB 5GGXA 2N1MA 4N0DA 1MIHA 4XD7A 1KMIY 1WP4A 4WKCA 3VO2A 4O63O 3TBHA 4YRNA 3TW0A 3S2EA 3CURA 5F5XA 4GKAA 3CRRA 4G8JA 3UJNA 5LMCA 3G2JA 4LGCA 3ONFA 3WSVA 5L95A 1P73A 3F6RA 4YAIA 4DPKA 4J4TA 1DV2A 1TQ8A 3ZY5A 4NESA 5FCDA 4D6PA 2BEUA 1J39A 2YBEA 1UMCA 2QNRA 4FONA 3LOQA 4IX9A 2ZUVA 3UAOA 2WUEA 4CLEA 1RXWA 1A5AB 2JBHA 1FU4A 2GZAA 4GI3A 5DRYA 1X14A 3P27A 4NP6A 1LSJA 3W06A 4MO2A 4FW9A 1NP6A 1DX9A 2Q2VA 1WPRA 4ENPA 1SCUB 3SCZA 1EFPB 2I03A 2BUCA 5CK5A 3HM2A 5LC1A 3X1MA 4YAKA 5JW6A 2QI9F 4KMRA 2OEPA 4RHUA 4YCNA 1QFZA 5LLDA 2IXDA 1NRWA 3D5QA 3Q1KA 1YK0A 2AHRA 4GMKA 1H2YA 1UXIA 5E1DA 4A8TA 1HMPA 1M1NB 5AHKA 5ALNA 1JLLA 1BRTA 1ZA1A 3V3TA 1ZK2A 1T6XA 1H6AA 3S70A 3O4VA 5EL0A 3AB3A 4PIVA 4BFZA 5A9SA 4TKZA 1J06A 2GUWA 2L0XA 5FNZA 3PUHA 2O8NA 2TMDA 3AY3A 1RSZA 2J48A 3TLXA 1OROA 3BF7A 1NJ6A 2L2QA 1NRIA 3WNVA 1U3VA 4DM7A 5HG0A 1SVIA 2P2DA 3FB4A 1C2YA 5AW3A 2NGRA 1F0PA 3P9KA 1G6HA 2Y4OA 3QKUA 4A23A 1IH8A 1V8FA 3W9BA 3PV0A 1QHFA 2QYOA 1V9CA 2ZDHA 4MYRA 3CFYA 4DRYA 3X3HA 3U44A 2AC7A 3UGJA 1V9SA 1EFLA 5T5QA 1I4TD 2H2AA 2GPNA 4DABA 3FMIA 4EKEA 5BW8A 2ZJ8A 2ZSDA 4E5YA 4C78A 3I8OA 4AQ7A 5HKAA 1Q7GA 2WD9A 1OHHA 4TX1A 3LGXA 1DEKA 1P9WA 2IYYA 3FVWA 3SU8A 4KN8A 1XRQA 2B4KA 4O33A 4X8LA 2VPZA 3V1NA 4WCDA 2VNIA 1FY2A 4INJA 4R2KA 4L07A 2RAPA 5CVEA 2XYGA 1E2DA 3JSAA 3PF9A 2C4UA 4ZOEA 5DYIA 3VYRB 1SUSA 2XVXA 1N6LA 2I87A 3RS7A 4ZQGA 3IBGA 4YP9A 2H11A 1B2LA 2HL6A 3HCOA 1IJEA 7REQB 5C4MA 2PE5A 5TMBA 3O47A 1LI7A 2WRZA 2ZP1A 3LRXA 1OH7A 3G89A 5EHNA 3TFQA 1K97A 4K0KB 1W2WB 3NU1A 4KO3S 2V7TA 3C6KA 4L8VA 5FNVA 2R5WA 1Z63A 1PHPA 3NGLA 1SGWA 2PRJA 6ABPA 3FA2A 4QXPA 4FOLA 5IC6A 4DA0A 3SM3A 3R8XA 5KI6A 4OYYA 4L75A 2X76A 1FTYA 2WKQA 1KQFA 2GFQA 1JHUA 3MTQA 2TECE 3I2JA 3Q5DA 4G25A 3R77A 4H15A 3JPYA 1LWOA 1HKHA 2QL5A 5JS7A 1D2EA 4PG7A 1V2HE 5JJIA 2JLBA 5LXTA 2VATA 2AKYA 3HA5A 4CFYA 4ER6A 3VU1A 1AK2A 3S0JA 2PLAA 1WXEA 5TGDA 3PC2A 3JVVA 5EJ5A 3O1JC 3CVUA 3PWKA 1NQUA 4HL6A 3A9CA 4NBTA 5EEGA 4Y2GA 1T1SA 1TA4A 3FWKA 4JP8A 3F7MA 3FCXA 3WVNA 2LKCA 3MSCA 5DOVA 4CNBA 5GIOE 1M0WA 2G09A 1EWTA 1VZ3A 1LPMA 1D7AA 1J97A 3LAWA 2P75A 1KVRA 2E4WA 2MT9A 1JW9B 1M2HA 2WM8A 1OZ0A 2YWBA 1BE8A 3D6UA 3H8JA 7GPBA 2IOHA 3PI7A 4QVIA 1L4BA 2A35A 2Q9CA 4L5JA 1FK8A 1ZUD1 5J2UB 2AVDA 2NU7B 3D54D 1N5DA 4M1OA 3MFYA 1ZU4A 1Z12A 3C15C 1LBSA 2CNBA 2PGIA 3GOHA 5TXGA 3RYIB 4AY2A 1BX1A 4C30A 1S02A 1NULA 2G9UA 1KO5A 3KOWA 3MAJA 3N59A 1G38A 4LK3A 2WU8A 4EPWA 1TAHA 1J7JA 1RRMA 3QUAA 1KMHA 3VISA 1XXHA 4L6CA 1Y4UA 3E1GA 4AO6A 4KREA 2VSYA 3AEXA 2AC4A 2Z2YA 4WCFC 2QIOA 5JXJA 1UK9A 5GOZA 1T5HX 1P2FA 4J0EA 4YXFA 3FHTA 3EIEA 1G41A 1PE0A 1JSCA 1H2HA 2V7GA 4QJBA 4RJ2A 4XUEA 4BO6A 4BQNA 3F5DA 1EXVA 4FR2A 3E61A 1T9CA 3EZ6A 4R83A 4TS1A 5BR1A 2FUEA 2XUFA 1LXCA 2O3UA 2W37A 2YNMA 1A98A 1XJWA 4Q48A 3WE7A 4AZ0A 3SDZA 3HM9A 2XCOA 3E2IA 1TVKB 4XR4A 4NBLA 1TLTA 1E9VA 1HTWA 4F91B 3K20A 3E23A 3BE8A 3R3SA 1Z5PA 2ET6A 5H83A 3TLBA 2A88A 4HB3A 4INZA 3WBBA 3OZAA 3GJYA 4IILA 2I3AA 2V7QA 4B83A 5J58A 4RDIA 1N2CE 1JSLA 2BDUA 1N32B 1UQTA 4MVJH 4EG5A 2Q5FA 3PZRA 3IIMA 2VOJA 1Z4IA 2XGMA 3RANA 4W82A 3W8NA 5A4MS 2EARA 5K4GA 1MQAA 1RIFA 2Y1OA 2CNDA 4PU0A 2J4DA 4XB1A 1Q12A 2JVJA 3ZVNA 5BSRA 2OUKA 3TN7A 3GZNB 3TW8B 3S81A 1ICIA 3KLBA 2H4XA 1LDNA 2XBUA 3CF2A 3WK5A 4WGFA 4E94A 2HQSA 4E14A 3F1LA 3GVIA 3HVUA 1DJQA 2OZLA 2C2MA 3Q15C 3Q85A 5CD1A 3LBNA 5CTAA 2JF0A 3L4SO 2ZR8A 2HPZA 3D3WA 1ECPA 1W0JD 2PKQP 3QKRA 1EK5A 3OZXA 3ZVKA 1NMZA 4H7PA 1N6HA 1SUPA 1T2DA 4WL0A 5AOCA 2Q6KA 1Q20A 1MOSA 3ZV7A 2ZJ3A 3N6RA 2ASEA 4MV0A 3S1AB 4YRDA 2QLTA 1XRNA 2B8JA 3ROKA 4AW9A 2PD3A 2AOWA 5J5CA 3AR5A 1WDTA 2VDQB 3RGGA 3KYCB 1U2RA 3VJLA 2WAOA 1BDMA 2VI5A 3IV9A 4PLYA 3DW3X 2JIBA 1V96A 1P77A 1VJ0A 1FFCA 2JIRA 4CTMA 3BMNB 1M8PA 2EBWA 2O57A 1IM5A 2I5PO 2YV4A 3GLFB 4HNRA 3K1AA 1J90A 4AN0A 4NRDA 4PZDA 3DBLB 1UDCA 4G8CA 3HI4A 4MPRA 3TX6A 5HZHA 1Y3IA 2GZRA 1VKJA 2AHOA 3JQFC 3V4ZA 5DMHA 5CXUA 3RJMA 1KMMA 2RBKA 1GFIA 2QZ9A 4KQFA 1RI1A 1C3OA 2C5FA 4XX1A 4E4TA 3Q12A 2POQX 2X9NA 4LZAA 3B8HA 1QYVA 1H8ED 2UV8A 1VI6A 1W19A 2JLAA 5CLQA 2WA1A 5IBPA 5BYJA 1FNSA 3SZMA 1UC5B 4CETA 5IAAA 2XZTA 2DPYA 3DLTA 3E3MA 4ZQEA 5C9ZA 3BHNA 3FGOA 3PA6A 4KQ9A 4YJGB 2DCMA 4UQPA 4UXHA 1Z3CA 3DFUA 3ABOB 4KE9A 1O3YA 2A0FA 4RU1A 2YRFA 1M5UA 3OIWA 4KDCA 1ZN2A 3W6OA 4LKRA 5JBQA 3W4IA 3BCSA 4QUEA 3SF8B 1AGNA 2XX3A 4LGYA 3AHDA 4PN3A 1X19A 2BSQA 2ZQZA 3ELDA 1L5RA 1REQA 5JZSA 2NU6B 3IB3A 2FWIA 4Y30A 3RK1A 4ZDKA 5BSHA 3DE0X 2BBOA 2QG6A 2YCBA 1USGA 2WMOB 2IV2X 4B6GA 2QMQA 3KOXA 3TMYA 4PNZA 4BO3A 2PRKA 5DKFA 3PPYA 2I3DA 2J3LA 4CIYA 2RC5A 3R7FA 3AH8A 5KOHA 1W96A 3FOAA 4JLVA 3G1UA 4M0FA 3INYA 5EE9A 3L8ZA 3I04A 1ZUNB 1CS0B 1FXSA 4EHDA 1YZGA 3KQVA 4MXDA 4RKFA 2GK7A 1FRFS 4AS1A 4GS5A 4YPOA 2O5CA 2GBLA 2AG5A 1MC1A 3DFFA 4MB0A 4ZO7A 1J21A 2AQIA 2JJ1A 2C1XA 2E21A 4G09A 2JFVA 1VFNA 2CCGA 4OQ4A 1TMOA 4R1NA 4CM7A 1E1MA 4J0FA 4MVJD 4N6NA 4E4YA 3A6EA 3B1XA 5EUBA 2G06A 2CLEB 1F7UA 1QOZA 5EJ9A 1NW8A 2PAAA 1AGXA 3EVFA 3G7NA 1QH8B 5BUSA 1KAQA 3AT1A 3EXHA 4NFHA 3OZUA 4H7EA 3Q8MA 3RIEA 4AI6A 4FW8A 3P0RA 3WWPA 4F96A 1SKMA 4IEFB 2CHEA 2WPNA 4LAFA 4RKQA 4C4AA 5L8VA 4ZYYA 2FQXA 1P5JA 3VR5A 4OD0A 5IARA 5K3BA 4AJNA 4AUNA 4EUSA 2HIGA 2Q3CA 4TTSA 5ES4B 2RIPA 4ND8A 2Z08A 4YS6A 3T38A 3HXLA 5I7HA 5JTUA 3DZ8A 2Z5VA 3EF1A 3R7LA 1A96A 4WN9B 4GM1A 3TOZA 4QPNA 3ZGYA 4JSRA 5BT8A 1JEQB 2OBMA 2B8NA 3K2QA 3NCHA 2QVZX 4TZTA 5KQMA 1YSCA 5A04A 3H9EO 5JD6A 2PBFA 4J3JA 3L7LA 1HF3A 1L5ZA 3DF9A 2EW8A 4FFMA 3D5EA 1UUFA 3HXPA 1UKVY 2ORIA 3KB2A 3OCJA 1C9YA 5FBWB 3QU9A 1E0AA 3BL6A 2UU9B 5HGXA 3WLRA 1UPBA 2O59A 2Q1XA 4NIMA 3EMKA 3PKZA 4HZUB 2PGXA 1I4LD 2NAFA 4TN5A 4W7IA 4XWOA 3IX7A 2QL9A 4FMBB 2A1UB 4J6EA 1JIUA 1J9ZA 1NE7A 3WL6A 4BAZA 3NAZA 3D8RA 5A9RA 1W88A 1OAAA 3HY6A 4QO8A 2Z6UA