3Q9LA

The structure of the dimeric e.coli mind-atp complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the structure of the MinD-ATP complex reveals the orientation of MinD on the membrane and the relative location of the binding sites for MinE and MinC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle, hydrolase
molecule keywords Septum site-determining protein minD
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3q9lA00
4P4SB 4GOJA 5KOYA 1T8TA 2ZI9A 4BE7B 1OFUX 4LBVA 3I3SR 3LLMA 3ZIAD 5BYKA 1XPOA 3PXGA 3AP3A 4BECA 3EIEA 2CL0X 4LBYA 3SZRA 1FNMA 1QBKC 2IYQA 2FFQA 3AF0A 4DLYA 1UEIA 2N46A 1GNPA 2CL6X 3RNLA 4C0BA 2IS6A 3MJRA 2QGNA 1IHUA 3RDPA 1GITA 4TMTA 4OHWA 5TMPA 1HV8A 3Q5DA 4DUGA 4TZ6A 2O52A 2IK8A 3PEWA 2MMCA 2VF8A 4M1OA 1U9IC 3T61A 1E4YA 1N0WA 2JATA 1LVGA 2O5VA 4CW7A 1E2PA 2R62A 2WMNB 4BFUA 4FWTA 2MMGA 2CDNA 4DHEA 4I81A 1Z6YA 1RKBA 3IPXA 4CEIB 2RHDA 3TAHA 1JECA 5FH9A 2F9MA 2QN6A 2JA1A 3QKRB 2XGJA 1NN1A 1DAGA 1OB5A 3L0IB 4B76A 3SJAA 4IOMA 1SVSA 3CF0A 2F55A 3WRYC 3TVTA 1UF9A 3AKCA 3GJ5A 1E0SA 2R6AA 1KI6A 3ZLJA 4Q19A 1A7JA 3A1SA 3GLIB 4KFTA 4FMBB 3BK7A 2C99A 3CNLA 1W0KA 5AWFC 5JECA 1E99A 2CK3A 2IEZA 4DBLC 4UXHA 3PCRB 5CM9C 1WQ1R 1S3GA 3SJBA 2W58A 1B23P 1I4LD 4NPHA 4BFVA 2ZTSA 3EIHA 4LX0A 3PV0A 4ASUA 5FR2A 1N6LA 1Z0KA 1OSNA 3LRPA 3W8NA 2WKQA 1SKYB 3TSWA 1DPFA 3AV0B 3QF4A 3GEIA 4PANA 1NJFA 2RGNA 2D7DA 3I61A 2QAGA 4F7WA 3LNCA 3U7GA 2NMVA 4YC7A 4ACAA 4XJXA 2GF0A 1CU1A 1X8KA 2QMOA 2WM9B 3C7KA 3IGFA 2F43B 1S4QA 2I3BA 2BCJQ 4XVRA 4AY2A 4PPNA 1W7AA 1J70A 1KK2A 2ZU0C 4Q1FA 2BMDA 2RAPA 4RZ2A 2A5JA 3ZZUA 4B43A 1S96A 5IK2D 4DEXA 1SXJC 3UWKA 1W2GA 2VBCA 3A1UA 4ILEA 2IWHA 4O25A 1XXHE 2Q21A 3TRFA 1MRSA 2NZJA 3TQCA 3EWSA 1F6BA 3U5ZB 4ESVA 1VDZA 1HA3A 2QMUA 5HCIA 3A4MA 2AN9A 5C4MA 3IHWA 2R2AA 4II7A 2HCBA 4ZDIA 1A1VA 4PQYA 2GETA 1K5DA 3RS5A 2I1VB 2H8KA 4KU4A 2UVQA 4NYJQ 1E0JA 1FTSA 2OILA 4DB2A 2MSDB 3AVXA 2QEQA 4M9XA 2R6DA 4RJLA 4U00A 2J9RA 1R6BX 2DY1A 2VH5R 2ZVQX 3WYAA 1JJ7A 2B7BA 4F4IA 4PAMA 4R7ZA 4I4LA 1KK0A 1EFRD 1VYTA 4FCVA 1FFHA 2FN4A 4B71A 1NN0A 3ADDA 1YQTA 3TNFA 1H8ED 5E3HA 4CEJB 4HATA 4B34A 4GP6A 1RE0A 3K0CC 4B32A 3U3JA 1YR9A 2D2EA 1TUIA 3CWQA 3O8DA 4DCTA 2IT1A 3A6PC 2WICA 4M21A 3KB1A 1XPRA 4D4LA 4J0QA 2FF7A 5B2ZA 3VKWA 1E0KA 5F98A 1DE0A 2VPPA 1VCOA 3KDSE 4IEEA 4QFMA 4P0TA 2X2EA 1RW4A 5AJZA 3QPVA 3QJYA 1QHNA 4TWZA 1Q3TA 3K0AA 2Z43A 1B0UA 4Q02A 1A2BA 4M1SA 3AB3A 2REOA 3LV8A 2ORWA 5FOTA 2WPDA 4Q9KA 4KBFA 1LW7A 4M1MA 3GMTA 1E6CA 3EPJA 4PC3A 4JVLA 4LHVA 2RGDA 5EP4A 3B8HA 1DARA 1G7RA 3ZQ6A 1KDRA 3L0SA 3UG6A 3SE0A 4TYNA 4Q00A 2F6RA 4LJ8A 3P1JA 1E9AA 2HLDD 1KO5A 3OAAA 3SFVA 2CE7A 2IWRA 3CX7A 1XCMA 1NBME 1Z0FA 4L5BA 4QM6A 2OFOA 4RD6A 1SVLA 3I73A 5FPTA 1E0AA 3FFBA 3RRZA 5G40A 4B35A 3X1DA 1G3QA 2D74A 2C5LA 4ASUD 2GCOB 5FTKA 4Q5IA 5A5GA 4PC2A 3Q7QA 5JS7A 4BPBA 1TADA 4HB4A 4HYYA 3LWNA 5CK5A 821PA 2JLQA 1KSJA 4GMXA 3AKYA 3VX4A 2J0UA 1CRPA 1DAFA 2ZS9A 4UJ3A 2I1QA 2BMFA 1G1MA 3QEJA 1PVOA 1XMJA 1Z0DA 4MRRA 1L8QA 4ZV4A 2J3EA 1U8AA 3KQNA 4GSYA 4TMVA 1DO2A 3GFTA 1XMSA 2FSGA 4PO8A 4PR0A 3VKGA 2OBMA 3NH9A 1R2QA 1NVWQ 2GZAA 1I4TD 3TQFA 1LF0A 2F7SA 4NTZA 2FV8A 1AZSC 4EPRA 2W0SA 3Q9LA 4KI0A 1P6XA 4LV6A 4PAOA 1J90A 1GG2A 4NZYA 5AUQA 5JWHA 4ACBA 5BWMA 1N6PA 3CIOA 1VCMA 3CB4A 4HI0E 2BKUA 5ELXA 3H84A 4CGZA 2QL6A 1KJZA 2ZIAA 4TZ0A 5D3MA 2NG1A 2HT6A 5B58C 1BYUA 1N6RA 1KI3A 4DSNA 2QBYA 3BH7A 1XTQA 1CULC 4TLBA 1N6KA 2RGCA 5F3WB 2ATXA 2VQSA 3NKVA 2ZAOA 4IEIA 5TDHA 2IYSA 1NN3A 3FHCB 3KQHA 4LBZA 3ZD7A 3CO5A 2PCLA 4TQUS 3VMFA 2PH1A 4B3BA 2IS1A 2BBTA 2A9KA 3RLFA 4KITB 4Z1MA 4QRHA 4DVGA 4B3DA 3BXZA 3DM9B 1KJWA 3EIQA 2ZRNA 3DOEA 2F1HA 1J2JA 1GVNB 4QHTA 5C1BA 1WMSA 2H1LA 5J4YA 1D2EA 1YZKA 1YZUA 1ZNZA 2IBMA 3D8BA 5DIFA 4HUTA 3AGQA 1P7CA 4N1AA 2V9PA 2OBLA 1LS1A 1TEVA 2GXUA 4DLVA 2XJ4A 2DFLA 1FP6A 1X8JA 3W90A 3SHFA 5FUWA 4W5JA 2ZJBA 4EPWA 1Z47A 3MWKA 2GNOA 2AD1A 2P3SA 2AFHE 2P5SA 4GZMA 1GNQA 4BRUA 2IYWA 5FI1B 2R6FA 3RS3A 2YHSA 3U44A 1Z28A 1XTKA 1F48A 4FWIB 1TF7A 3I4LA 3U3OA 3VFDA 5JMTA 1T6NA 5KYKA 1X8LA 3EASA 1KOFA 1HE1C 1GKYA 4YXWA 3KUCA 4NYIQ 3SJCA 4YMSA 3FMPB 1W5SA 3K0FA 4URVR 2Z6VA 3QBVA 3SHWA 1SXJB 1W0JD 2RB4A 1E2JA 1M8PA 2RCNA 5LB2A 5EP2A 3B1XA 4H1UA 4HDOB 4LC0A 4I99A 2ZSEA 4NYMQ 1GAJA 1JB1A 3BE4A 2F1JA 2W83A 1D6JA 2FPLA 1OPXA 1CRQA 1E2IA 2Q9BA 2ZUDA 4QXAA 3QPWA 2G77B 2R8RA 2FGKA 5HE8A 2WWFA 1ZU5A 3THXB 2BC9A 4XVQA 1VMAA 2CCJA 2ZJ2A 5CYOA 1ZCAA 3N5CA 1VG9B 3IKJA 4PSVA 3W6NA 2AK3A 3VR3A 5CDFA 3WNBA 3FE2A 4DT1A 2XNDD 3GLFA 1Z6GA 3ZH9B 3I5XA 2GCPA 3CWZA 3QKUA 2ANBA 4AYXA 3B85A 4ARZA 2WWYA 5G53C 1TL7C 3EARA 4AC9A 1V5WA 3VHLB 1XTRA 4DDWA 1I2DA 4TL8A 1E1RD 3LBIA 4JVSB 3KQLA 1OF1A 1YZTA 2KE5A 1D9ZA 1VYUA 1OXTA 3TUJC 4KYIB 1MT0A 1C9KA 4TLEA 3T1OA 4JBXA 4W9MC 3TMKA 2OZEA 4KLNA 5FTJA 4D2IA 4DZZA 2NPIA 3ZJYA 4KV9A 2OLJA 4RFVA 3SS8A 5KPJA 4Q01A 4ARZB 4QHSA 1P4SA 2QTFA 2YWFA 1P2UA 4K46A 1W0JA 3G82C 3KTAA 1R0XA 2RGXA 4L8GA 5AJXA 4FXPA 1IN4A 3H2YA 4H9GA 3GLIE 3CH4B 1QVAA 3OZXA 2OXRA 1ZD8A 3CZPA 3IBYA 1CLUA 2OHFA 3SYNA 8OHMA 3GJ6A 3AF1A 1CJUC 1Q1BA 1W0KD 1AS3A 2FFHA 2CCGA 2ZSDA 1W36C 3LD9A 4MYCA 4UNPA 3CW2A 1NNEA 1G64A 4BASA 4YMUA 4K8OA 2P65A 3A1VA 2GXAA 3DO6A 4C30A 4B3XA 5F9FA 1HURA 1SKYE 3FMOB 1AM4D 2QA5A 2BBSA 3KXLA 1CJKC 1SVIA 4EFMA 5J4HA 1JPJA 4ZCLA 1MKYA 2X77A 2R65A 1N5LA 3WHLA 4BEBA 4YQFA 4RCYA 1WBDA 3B1WA 2F43A 3CLVA 2ZE5A 2F1IA 1E2GA 3MAAC 2ZSFA 3NC1C 4IVQA 3QEOA 1XU4A 4LBWA 4OI1A 3H1TA 1F5NA 1A5TA 3D3QA 5TV2A 1EX6A 4JLPA 3CF6R 4HLCA 3QOFA 5JLJA 1U2RA 1CXZA 2I4IA 3CX8A 1JQLB 1XB2A 4RD4A 2JEOA 2PZFA 2VHCA 5BW8A 1G7CA 1E9DA 1W47A 1DOAA 3GLHB 1U8ZA 2QG6A 1NIJA 1XZPA 4DLSA 1RJ9B 1X1RA 4POAA 1Q0UA 2DWQA 3G0HA 2J41A 2G83A 4B75A 1NMZA 1FNNA 4Z1MD 3K9HA 1HT1E 3ADBA 5DISB 3ETLA 4KLZA 1ZBDA 4C0QC 1AZTA 5KSOA 4E22A 1D5CA 1U8YA 3NBZC 2RGNC 2GF9A 3DOFA 4EPYA 4G5OA 1IY2A 1DVRA 3UMFA 2A30A 4Q4AA 2WWWA 3W3ZB 2ZPTX 1KGDA 3LBHA 2VTKA 4OYHA 2ZRAA 3IUYA 2XSZA 4G0NA 1G7SA 1Q44A 1UDWA 1WA5A 4JLAA 4OHYA 4A8JC 2GXQA 2QP9X 5C46F 2IYRA 2ZE8A 2DWPA 1U94A 1R7RA 1U99A 2D3WA 4LCBA 3C8UA 4WOPA 4DLTA 3WP0A 1F3OA 4JL8A 3P27A 2ZRLA 5LD2C 5TB5A 1Q21A 4R2IA 5FOWA 2ZYTX 4XH9B 3W34A 2IYUA 2B8TA 4Q1CA 3DMNA 3RAPR 1ZNYA 4FMDB 3KQKA 4QBFA 1GKUB 2BVNA 2WKRA 5HZKA 5KSZA 5AUNB 1JALA 4MDFA 5AR1A 2GA8A 4PHFA 2A3RA 1US8A 3P4YA 2QAJA 3SBDA 3RC8A 4BZPA 1HT2E 3GJ4A 2PMDA 1LFDB 1YZLA 3W5JA 1KZ7B 5FUYA 3P20A 4LOAA 1GM5A 3THYA 2BM1A 1CR1A 1RRGA 3MGCA 4LJYA 5LB4A 1NN5A 5LDDC 2JLYA 2QORA 3B1ZA 4A2WA 4RD1A 3GLFE 3BRWD 3K0CA 2QSZA 4CT4B 5FFMA 2ASEA 1DADA 1TF2A 4QNRA 3U3KA 3B7GA 3WHKA 1BH2A 1KO4A 1HH4A 3P32A 3C41J 4H1VA 4QGHA 3KFXA 3SBEA 5SZJA 1E2DA 4AURA 3X1XA 1X1SA 2ZRFA 4GOXA 4HDCA 3X1WA 3W3AA 5B57C 4X8LA 4P31A 3R9IA 3NHBA 4LJ6A 3SQXA 3HPQA 2WOJA 1XEXB 1X86B 4D6PA 1G3UA 4TL6A 4EFNA 1ZJ6A 3MWLA 2OT3B 1G16A 1YR7A 2BCGY 2JJ8A 4QHYA 3QF7A 3PITA 3ICEA 5KUTA 1KI4A 4BFWA 5L3SB 4PPFA 1RZ3A 1TMKA 3QXJA 2GK6A 4LRWA 1AKEA 3SYLA 2ZRMA 1I2MA 1AN0A 3O8RA 1ZNWA 1U0HC 3B82A 2VHTA 4I1SA 5GVRA 4HB0A 3S1AA 2GKSA 1JNYA 3HR7A 3O47A 1GP2A 3MWJA 4PO1A 2BOVA 1VHLA 2QP4A 2IC5A 3BD9A 4NYJR 1CEEA 1QHIA 4URYR 4LYAA 1GSIA 5E7JA 2JAQA 4S2EA 4DIEA 4D26A 3PFIA 5FOXA 1GILA 1W44A 2WWXA 3I62A 2J45A 3JVUA 1VKJA 4HAXA 1WF3A 3CR8A 4FD2A 3IQXA 2EYUA 4AD8A 4BFTA 1AS0A 3B60A 3VNVA 3EA0A 1JEEA 1WB9A 3S1AB 1UBEA 5EZ6B 4IVRA 5DN6A 4JLMA 4XWKA 1AKYA 2FEOA 1G21E 5EE3A 3ZVNA 3EA5A 3U4QA 1UBGA 4TYPA 4UNNA 4F91B 3REGA 1Z07A 2OO7A 3LLUA 1X6VA 1JPNA 3GEHA 4Z8XA 1NP6A 4BQSA 3K09C 3QF4B 1II8B 3KKPA 1Q1ZA 4Q47A 3KQUA 2CNWD 5JZVA 1KI9A 2W6JD 1UEJA 1P2TA 2YC2C 2YOHA 1IN5A 1MH1A 4HAYA 4M9QA 3WP1B 5G3ZA 1FMJA 4IDPA 4B33A 5HPYB 1G17A 2EW1A 2HEIA 4C4PA 2ZVPX 2GAOA 3AF2A 3BH6A 4WZAE 5J4VA 2Q9AA 3P26A 3MD0A 4FMDF 2TMKA 1KIMA 3WYGA 1K6MA 2FFAA 2QPTA 5A4JA 2VSXA 721PA 2VP0A 2FOLA 2GDJA 4TYQA 2SHKA 4TLAA 3RWMB 5FPKA 4TMXA 5CYPA 3EWAA 4HUQA 2O8CB 2RHMA 5DHFA 5FBLB 1JR3A 5DI9A 1Y3AA 4Z51A 4JLOA 1FL9A 3PIRA 2IXEA 1FUKA 1TX4B 2XNDA 3KB2A 5DYGA 1HTWA 2AK2A 1C4OA 1JQJC 3ZVRA 1Z3IX 3MSXA 4O2LA 2WJVA 3K0FB 4D25A 3LXRA 4QBGB 221PA 1UKEA 2J59A 1M2OB 5KSPA 3AVQA 4MH0R 2C9OA 4BLOA 3FHTA 1ANKA 4OK6A 2IYXA 2JCSA 4C0SA 3C5HA 4RFSB 5DO9A 1US8B 2H92A 3IIJA 3QBTA 1XMVA 3U6KA 2JIZA 2LCFA 4NMMA 1M6NA 3WNDA 4PFSA 2ZM5A 4V0MA 3ASYA 2IHBA 1DAMA 3X1ZA 1T5LA 1JEDA 4Q9JA 4ZDWA 4A2QA 4MUAA 2G3YA 4RVCA 4BFXA 2BBOA 3ZIAA 2FSHA 1CP2A 3PR1A 4CIDA 4URXR 1EESA 1IJFA 4XD7A 5DI3A 2C77A 2ZS7A 5BQ5A 4DT1B 1HQYE 2FZ4A 1Q22A 1GUAA 5GJVC 1GL9B 4Z8YA 2GEDA 2YWEA 3Q8XB 3QXCA 3ZVLA 2JLVA 5JWRA 4C7OA 2IUUA 1DBSA 3Q7PA 4D4MA 3B9QA 3IEVA 2C2HA 4OJKA 1NY6A 3GFPA 3HU3A 4HLUC 4RZUA 1Z5ZA 1V43A 3QKSB 3ZQJA 2CHGA 4DB4A 4MITA 5CDFE 1NBMD 3R9WA 2XX3A 2J1LA 4FCTA 4DC9A 4A92A 1ZMXA 4DWJA 3QG1A 1G3RA 2WVJA 2CEAA 1LY1A 3I72A 3NIBA 3TAUA 1G4UR 3GFOA 3LW7A 3T1TA 1E3MA 1O3YA 4Q48A 2OUKA 3KTAB 1N6HA 4C0AC 3UIEA 3OFND 3QXXA 1N6OA 5E7IA 5IK2A 3QKSA 1RYHA 1KI7A 4BRWA 1ETUA 1TAGA 5H70A 4Q21A 1OT3A 5EJEA 2NQ2C 4WBSA 1W36B 1JI0A 2VIIA 2ZRHA 4FW9A 4XIGS 2ZUBA 1IXZA 1L4UA 3R8CA 1FX0A 1J8MF 4BZXA 2QM8A 3GQBA 1Q3HA 2XXAB 4HB3A 3WYFA 5JHHB 1R0WA 1BO6A 4UJ5A 5SZKB 2AX4A 1OB2A 4A9AA 4DCSA 2GEUA 3RS0A 2JDIA 3LX5A 4MKIA 3A37A 4LV5B 3QSYA 1N5IA 4OL0A 4TTQA 1QHXA 2AHOA 5GJBA 1IY1A 1ZCBA 2F1RA 1ZD9A 3AVYA 2FSFA 4HSEA 4MQBA 3GLIA 3QVUA 2ZE6A 3BAFA 1XMIA 2JLXA 1II8A 2NO7A 3ZYCA 1XJ0A 1NVVQ 4TTPA 4KFUA 1P9NA 1XCGB 1Z29A 2A2ZA 4P3YA 1Q1EA 3NG1A 5JCPA 3JVVA 1XP8A 2RGGA 5K8TA 5BXQC 3LXXA 5E4FA 1M34E 1XFAA 1UBFA 2HYDA 3MG9A 4JMPA 4JBYA 1GTVA 2YOFA 3U2QA 3IDQA 2FZLA 1FOEB 3GLHE 4M1TA 1R5NA 2WWHA 3U7FB 3MLEA 4AI6A 1T3HA 3M0EA 3PUYA 5EE9A 3N2IA 4IOKA 2QRZA 2W6JA 1MABA 2BKEA 4B74A 1L7VC 2NO6A 3GJXC 2BMEA 2J0SA 3O8BA 3HU2A 2GZHA 2ZI3A 1S1CA 4NL4H 2F3TA 2ONKA 3NEJA 2V1UA 1SVKA 3MWYW 4OKSA 1OIXA 4JKYA 2GWHA 4ZKEA 5K8IA 1D9XA 2J7PA 2QPOA 4BGDA 4TMWA 2ZU6A 4NCNA 4R71A 1E9FA 2R44A 4JLBA 4D80A 3NWJA 2C9CA 2VHQA 4LV8B 5ANRB 2BIFA 4DDVA 4RKEA 2WJYA 1CR4A 2L0XA 4UKDA 2FJUA 1H8HD 1XEFA 1ZAKA 4HAWA 2OFWA 4JS0A 3EG5A 2H7VA 1YZQA 4AG5A 1T91A 1R0ZA 4DIDA 4EJSC 3Q3JB 2QT1A 4IXMA 1F60A 1RC8A 2Q3HA 4XD7D 5CM8B 4PZYA 1ZM2A 3NBYC 4PAQA 4E03A 2XB4A 2CLDX 3CPJB 4US1R 2MSEB 4B6FA 4Q7MB 2VSOA 4NONA 1VHTA 2WIBA 5H1YA 5M04A 2CVFA 4QBHA 2BM0A 1DAEA 1OXUA 3FYHA 2FE4A 3C14C 5KSYA 4KYUA 4CEHB 4C2TA 1W5TA 1XWIA 2E1RA 2VP5A 5FTNA 1DTSA 3T12A 3GD7A 1FMLA 3REFA 521PA 1WCV1 2EYQA 2QT0A 2Z0MA 5FTMA 2QTVB 2AKAB 3LFUA 1ZD1A 3BFVA 2ZI7A 1R5BA 1TQDA 5K8LA 2WHXA 4DLZA 1VTKA 2OCAA 4ZIRA 3EXAA 3EPHA 1EFCA 2HJGA 2CJWB 1BKDR 4HDQB 5JEEA 1Z2CA 1N5KA 4NYMR 4A36A 4OHVA 1IOZA 1BOFA 3FPAA 1DS6A 3VU9B 2ZXUA 1QF9A 1W48A 1RRCA 1Z08A 2PT5A 2ZSBA 2OLKA 4G1UC 2IA5A 3FKQA 3OHMA 3SDZA 5JRZA 1D2MA 2UZ3A 4DSTA 4XWAA 5CJPA 1TQ4A 3MJHA 4MKGA 3PEYA 3K8YA 4HLDA 4AKIA 1T0JB 4Y0VA 3N70A 4JLVA 1UKVY 3K53A 3B2EA 4JL6A 2ZJAA 2D06A 3KXIA 1KZGB 4N0EA 2C95A 2QY9A 2QE7D 4HZIA 3SQWA 2RGAA 1OYWA 4G5QA 1XDBA 1F2TB 1Z8FA 2WWIA 3AF4A 5FBQB 2YJTD 4ZO4A 2VP6A 3BORA 4OJQA 5AUPB 1DEKA 3HP1A 3OIUA 1ZUHA 2QP3A 3KX2A 4PC6A 3W6OA 1OIWA 3LDAA 2CCKA 2ODBA 1DELA 3BERA 1SULA 1XJCA 1SHKA 4URZR 5CJ2A 5P21A 1LS6A 4DJTA 4LY6A 4CEIA 1NVXQ 2PL3A 1D2NA 1OFTA 1Q1QA 4URWR 2J5XA 3EZ6A 3B13B 2EFEB 2NIPA 4AKHA 1E2QA 1GWNA 2ZR9A 1OKKD 2VEDA 1T3LA 1F2TA 2LKCA 2QUZA 4WXRA 4ZPXA 3QY0A 4YMTA 1XX6A 2V55B 3TSOA 2AKYA 4MGZR 3AM1A 3GLGA 3U61B 2GCNA 3K9GA 5H68A 4JLNA 5FTLA 5G41A 1UAAA 2O8EA 2ZJOA 3HJNA 2ZJZA 4Q9HA 4NCIA 4OI0A 3Q5EA 5FOUA 4M9SA 5EZ5A 2ZJ8A 2H16A 3FGNA 2BHRA 5L3VA 4CVNA 1S9DA 3WMEA 4E5UA 4IJMA 3OESA 1EFRA 1YZNA 1E2MA 1WDTA 1ZC3A 2H57A 2R6CA 2QQ0A 4DLUA 2B21A 1G291 3V9PA 1GRRA 1QVRA 5EQTA 3RYTC 1E1QA 5JHGB 2YWHA 2QE7A 4NBSA 2A5FA 4QJ5A 1U98A 3D31A 3PG5A 1TU4A 2AL7A 4CT5A 4D0NA 4YXWD 2W0MA 1NBMA 3NXSA 2GJ9A 3UXMA 4PSKA 4EPXA 3T1VA 5AJYA 3J81k 3MRSA 3QI2A 5DNYB 1G5TA 3QUSA 1T9HA 3EPKA 3OEED 1XTIA 2CBZA 1RPZA 3C15C 4V0KA 3PUVA 4QKQA 2WJGA 4OHZA 3FOZA 1HYQA 1OKKA 2PX0A 1ZUNB 2JLSA 3K9NA 3TK1A 2GXSA 1KMQA 2C9YA 2OCYC 1PLKA 2XZPA 4Q7LA 2ZI4A 2KI5A 2XTZA 5BYJA 4HLQB 4DCNA 4E09A 3BB1A 1P3JA 4Q9LA 3BBPA 4JLDA 3RSOA 2FMXA 4P32A 3TW8B 3AVOA 2PT7A 1TTTA 3IILA 3LBNA 1L2TA 2V7QD 4L15A 2HJVA 4DDUA 5BN3A 3GJ7A 3UK6A 4A2PA 2DB3A 2NO0A 1IBRA 1DAKA 3A1WA 4U5XA 2O8FA 4AK9A 4ERNA 2HF8A 4AIIA 1PUIA 3EW9A 3U7HB 4WXPA 2D7CA 4KVAA 3SYKA 4C0HA 2A5GA 4EKDA 1N25A 1T0HB 3RC3A 1P9WA 2GJAA 3BGWA 4ZIRB 5CB6A 4CEJA 1OLOA 4OQXA 4LJ5A 1E32A 3AEZA 4W7SA 1LB1B 2CJWA 2CHVA 1QDEA 4D4KA 5CLLA 1AJEA 5AUOB 4L16A 1G8YA 1Z6AA 3ADCA 2VSFA 3SR0A 1UBCA 1CBUA 3IIKA 2YVUA 4OK5A 3ICQB 1OV4A 4G01B 4B3GA 1KNXA 3CH5A 3GJ0A 1NSTA 3THXA 4NDZA 4KCGA 1LF5A 1M1YE 2ZETA 4BEJA 1RFLA 4V0OA 2QSYA 3GJ8A 4NKRA 3ZZ0A 1XPUA 1ZRHA 3TUIC 3VR2A 2Q0HA 421PA 3LA6A 5TY0A 2NTYC 3L8YA 4I1OA 3R7WA 1E9RA 5FI0B 1WRBA 1LTQA 1IXSB 1TF5A 1XEXA 2ZSAA 1YR8A 2IYLD 4ZI3A 5KNCA 3JZAA 2WSSD 5KDDA 4TYWA 3QQ5A 1FX0B 2JASA 3M4YA 1QHHB 2ZANA 2RGEA 3A8TA 4R2HA 4JJKA 5FBWB 2ZE7A 4MRPA 1T3SA 3ZS8A 1GNRA 4WIAA 1NVUQ 3W5IA 2FG5A 4ITRC 3CONA 4JT2A 4YDHB 4S35A 3VKHA 3CM0A 4GI7A 1A4RA 3OIWA 2O0HA 3QE0A 1RRFA 2CE2X 1AIPA 1SKQA 3DMDA 4XSHA 5L3SA 1SXJD 1E1RA 4EDHA 4KJZA 4JVMA 3KZ1E 5DSZA 1J8YF 4PQFA 3KJIA 1BMFA 4V02A 1YRAA 4IOLA 4PSAA 1SVOA 4JT4A 5FUXA 2J46A 2QAGB 1W4RA 1J99A 2ZYUX 3QKRA 2QM7A 4TL7A 3LX8A 4MRSA 5J40A 4F93B 2H5EA 2Q3FA 4HB2A 4D82A 2AR7A 4C9BA 1QHGA 2DHRA 3BWDD 3PVSA 3AVVA 1GFIA 3IEUA 3U4QB 1S2MA 5IF9A 1KI6B 1COWA 2ODNA 1P62B 3B1YA 3NC0C 4XTCS 4RD2A 2DPXA 4GDFA 4TMKA 5K8UA 2C8VA 4LZZA 3SI7A 4F4CA 4GOKA 2VP9A 3FDIA 4GNKA 4Q4JA 3PJRA 3WBJA 5LD2B 3VHXA 4RZ3A 1CJTC 2IXFA 1YU9A 1XJQA 4DXAA 5DGXA 5EUMA 1KMHA 5J4KA 4A0FA 2IS4A 4DRZA 1XD8A 4IDQA 5IHPA 2BEKA 2ZRBA 4Q18A 4CDGA 4FN5A 1A82A 2VO1A 2HXYA 2OAQ1 2O8DA 1OIVA 4FMCF 3A36A 3TJZA 2ZS8A 2BJVA 4LDJA 2IYTA 4LWZA 5KDOA 1G19A 3UMRA 3NHAA 2UKDA 3DPUA 1RRPA 2VRWA 3EX7C 4LYJA 3WNCA 5HZHA 2XZOA 1NG1A 3EZ7A 5HKKD 3BOSA 4O2RA 4DLRA 4OBEA 1OH8A 4QC2A 4B48A 2Q9CA 4U7DA 2JJ2A 1KKMA 4BLPA 1PV4A 1OH7A 1QRAA 4N0DA 4JKIA 5C2JB 3EZ9A 3F5FA 4JYCA 1KTVA 3DVLA 3ZDQA 1N0VC 3QIAA 2P6RA 4HUQB 4GBMA 3W6PA 2XB2A 1TNDA 1Q20A 1VIAA 2PLFA 2YOGA 3PUWA 3AGPA 5GADl 1K8RA 1AGPA 2KB0A 3IO5A 1U0JA 3KFVA 3OE7A 4FCWA 1II0A 4MUBA 2WJHA 3AKDA 2G9NA 1Q57A 2A5DA 5CITA 1AQYA 2ATVA 3KKQA 3SC3A 4V0LA 5KO2A 3OIYA 4TT3D 2PEYA 4DEYA 1MO4A 4B2PA 2J87A 2JGNA 3UMSA 4O3MA 2IXGA 2VP4A 2CMKA 4JIMA 4OI4A 1OJLA 2GK7A 3QVVA 2QRNA 4PHHA 5DHAA 3ZD6A 4YONB 3G5UA 4Q4HB 3BH0A 4CEHA 4Q1BA 1G4AE 2O0KA 1KKLA 3W8RA 1KK3A 3TIFA 3PEUA 4M53A 3HU1A 4KBGA 4KSBA 3AUYA 5L3RA 1CIPA 3LH5A 2G1KA 2EU8A 2ZEJA 3F0TA 2WTUA 4DLXA 1XNJA 4WZ6A 1JAIA 4UQOA 1JAHA 4KVGA 2IS2A 1ZIPA 2WIAA 1CS4C 4Q4HA 2QI9C 4LHZA 5TVKA 4IDHA 4DSOA 1OFHA 3H4MA 5JI3E 2C98A 3AH8A 1CTQA 4M2LA 4OK3A 3WRXC 1MRNA 2YWGA 5A0FA 2CK3D 3V4FA 2G6BA 1N2CE 2QGZA 5IT5A 1YRBA 4LHXA 3FTQA 4GZLA 3ASZA 4UXIA 5FR1A 4BLTA 2HXSA 3BFKA 4MA4A 1NI3A 1ZINA 2EFGA 4MYUA 4XOIA 5DH9A 1E69A 1KO7A 2IX3A 4HAUA 2RKOA 4LYFA 4QL3A 2OV2A 1FTNA 1L4YA 1OXXK 3T35A 1EFTA 3UATA 4Z54A 2ORVA 2XSZD 1T5IA 3NBFA 4TTRA 3FWYA 1E1QD 4TL9A 4BFSA 3LY5A 4M1KA 4Q9IA 1EG7A 3VNUA 1ZC4A 2JIZD 2WBLC 3UWOA 4EQ6A 5TXGA 1GRNA 1GZSA 2W2TA 5FL7D 1Y63A 1R5OA 4LJAA 3B9PA 3U6BA 3QKTA 1LNZA 3GP8A 2XZLA 3HR8A 1R10A 1NF3A 1TU3A 3THWB 4HZUA 1PLJA 2ERYA 2XXAA 2R9VA 4JJZA 1TEXA 1XD9A 2H17A 2REBA 4JYBA 4TQAA 2Q3MA 1NLZA 3LVQE 3LAWA 2ECKA 3QG5A 4G3XA 4EQ6B 2FSIA 1TUEA 1KY3A 3I32A 1Z0JA 3MMPA 3TUZC 3L2OB 4OI2A 4EPTA 3L0OA 4A8JB 2P2LA 2ZJ5A 2QROA 3T5DA 2FA9A 2FFBA 4XSGA 5E7MA 3THWA 4MGKR 1HEIA 3P4XA 4IOJA 4WZBE 1NRJB 3RHFA 1K5GA 2Z4SA 2X19A 4PZZA 4QNMA 1AS2A 2JLRA 1KDTA 1E9BA 3QNUA 2KBEA 4IRUB 1FUUA 4QJ4A 3SJZA 1VG8A 3AVTA 4I1VA 5EXSA 3K70B 1KDPA 1W49A 2G0NA 1P60A 5B64A 2FDCA 3EZFA 2CNWA 5KDLA 4YMVA 5JFGA 1BIFA 4PPGA 2GJSA 4FIDA 5LBIA 1E2LA 1OH6A 1EFHA 2OSBA 2QTHA 5DLQC 4ZCMA 1G41A 1MOZA 3N2EA 1YR6A 1UDXA 4A0GA 1WBBA 2O8BA 2FH5B 4GMDA 2JJ1A 5TARA 1S9HA 4OQLA 4AYWA 4QGAA 5J47A 5CK4A 4A6XA 2EFDB 4G5RA 1ESNA 3VR5A 3SU8A 1NL3A 1XRJA 2PX3A 1DG3A 1BYIA 2BWJA 2IYVA 2OAP1 4UNQA 3NH6A 3SN6A 4ON9A 4Q66C 3K9LA 4EJSA 2F9LA 1IY0A 3NTUA 4EUNA 2B8WA 121PA 5EE0A 1SXJA 2J0VA 2W2VA 4E07A 3OAAD 5KNBA 4ZDJA 2WSMA 1AQUA 2X1VA 4NP6A 3BFXA 4KODA 2QZ4A 4X8HA 3RS7A 2CL7X 3RANA 4C3ZA 3VR1A 1KJYA 2GILA 2V4ZA 1KK1A 2OM2A 1XTSA 1KO1A 1P2VA 2EVWX 3CX6A 4HLUA 1YE8A 4D0LB 1ZVQA 1ELOA 3VR4A 1S3SA 5JBQA 2E87A 4YDSA 3EPLA 2IF2A 1WE2A 4R9UC 2GBLA 1E94E 3WY9A 1NJGA 1NLYA 1W1WA 3CF2A 1JR3E 3U44B 1PZNA 4G5SA 4Y0AA 4LPKA 4PC7A 1ZUIA 1ZIOA 3EZ2A 1G20E 3O8CA 1XEWX 3HYTA 2JDID 3RRMA 2PJZA 3TLXA 4AKGA 2EWVA 2ZYVX 4NE2A 1MR3F 3AKEA 3E70C 3SNHA 2FU5C 1WP9A 1S8FA 4P4SA 2V6JA 2HT1A 1RYFA 2JLWA 2QQEA 5JJLA 1QG4A 5L8VA 2ZRDA 4MDEA 3KJEA 4NCJA 4AWXA 1EGAA 2GJKA 1W36D 1PJRA 3RSLA 1M7GA 1U81A 2P6NA 1N5JA 1ZYUA 2WV9A 2B6HA 2D2FA 2XITA 3OE7D 4IVPA 1MO6A 4F92B 3FVQA 3CKLA 1OHHA 2ONJA 1JJVA 3DEFA 2ZRIA 1NMXA 3NVAA 1KI1A 1GIAA 3AVPA 2GCOA 3AUXA 1OXVA 3BB4A 1M74A 5FBRB 4B3FX 3VU9A 4A6PA 2OEPA 4QM7A 1P5ZB 3RS2A 1XTJA 4NYIR 1HE8B 2N1BA 4B6EA 2DCUA 4QOSA 4LSGA 1E2HA 1KDOA 2X8AA 3K09A 1F2UA 4HAVA 1P73A 3F8TA 1VCNA 3OIVA 4L4UA 1E2NA 2V6IA 3RVBA 2D4HA 2ZUCA 3GEEA 3TGPA 1UJ2A 1XBTA 3B6EA 1U0LA 2G0TA 2WAYA 3WMFA 5C18A 2WWGA 5JSZA 2E9SA 3NBXX 1VG1A 2FPKA 2DFNA 4M4SA 3RRYA 1Z83A 2NPFA 1P9RA 3A1TA 1H8EA 2YV5A 4A8JA 4X8MA 1NY5A 4GP7A 2KBFA 3CRMA 1IN6A 2BV3A 3L43A 5F9HA 4CYMA 2VA8A 4BLSA 3CRW1 4A15A 3C16C 4BWYA 1IXRC 5EXTA 3T34A 3JZMA 1FQKA 2ZI5A 4RKFA 5D3MB 3BIFA 4WAUA 1COWD 1TQ6A 2ZR7A 2MSCB 3TH5A 3OEHD 2QNRA 3FKSD 4FMCB 5EP3A 4IHQA 2PZGA 4JSYA 1XD2B 3HDTA 3GLGB 1FP7A 2ZRKA 2C96A 1RJ9A 3C4JA 4C0LA 1ZNXA 2O8EB 4AYTA 4V0NA 4NCKA 1NMYA 1R8SA 4B2LA 2DBYA 2O8BB 3LW8A 3ZS9A 4TYYA 3VR6A 2QU8A 5SZIA 2JJ2D 2IW3A 5GJWC 1KI2A 4RCZA 1IM2A 3SFZA 4NHOA 4B73A 3WMGA 1UPTA 2GAAA 1H65A 2ODWA 2OG2A 3CR7A 3I1FA 2VP2A 3TBKA 3NEYA 2J0QA 1E2FA 4EJSB 1E9SA 5AJVB 2PLRA 2YINC 3IBGA 3PQCA 4A0HA 3KKMA 1KYIA 5EE5B 5JCZA 4BLQA 1QHSA 1CJVC 2WPDD 3EC1A 4IKEA 2EWWA 5HR5A 3SEAA 4FINA 5DE3A 1SQ5A 2V3CC 2IHYA 4ZCIA 3NDBB 2ZRPA 4NH0A 4RFSA 4KFSA 4Q1EA 5LPNA 3GLHA 4KFRA 2YKGA 4BLRA 2BJWA 1BMFD 3E5HA 3ECCA 2AWNA 1G7TA 2EFHB 4OQFA 1KSFX 1NIPA 4JLKA 4OQMA 4WW0A 4A82A 1SGWA 4IDOA 2B7CA 4U02A 4B2IA 1LV7A 1SXJE 2JLZA 2KWIA 3RWOA 1YVDA 1XEWY 5GJCA 1AA9A 5UKDA 2VL7A 3V00A 3AP1A 2FWRA 4Q7KA 4LHWA 4UNRA 2O8FB 1IONA 1GDDA 2OFXA 4GPTA 4B44A 4KO8A 5D3QA 2X2FA 4NCHA 2IL1A 1NVVR 1NKSA 4PC1A 2BEJA 2CLCX 3X2SA 3R9XA 1VECA 2WKPA 1KI8A 3I92A 4OHXA 4UNSA 2HDNB 2W2XA 4R98A 4RSGA 3TKLA 2IF0A 3OF5A 4PX9A 5JS8A 5J5CA 1SZPA 1MV5A 1JXMA 3ZVMA 2P6UA 2P67A 2PMKA 3PUZA 3DKPA 3KXKA 3KL4A 3T5GA 2OCPA 3PEVA 2QPAA 2PJRA 1MO5A 1HQCA 1ODFA 2FGJA 3Q85A 4C2UA 1G3MA 4LHYA 4PPQA 3DZDA 1NLFA 1U90A 3FHOA 621PA 1P2SA 1UKYA 1G6HA 3ONWA 4JLJA 3TE6A 1R4AA 3M6AA 1G8FA 2RH5A 1YHNA 2A78A 4I1UA 2OCBA 1Z6XA 1EWQA 4MYHA 2WAXA 5KHOC 3D6TB 1UKZA 2XAUA 3DM5A 3GJ3A 3PUXA 4CZ2A 4F38A 1F2UB 1CR0A 2JLUA 1M7HA 2ODEA 2W6IA 2ZREA 3THYB 1E9EA 4KHZA 1ZM7A 1YKSA 1P72A 3BC1A 2AXNA 3R7WB 1IQPA 4KXFB 1QHHA 1KSHA 1XZQA 2REXB 3U60B 1H8HA 2HUPA 4MKFA 4RD0A 1WXQA 1ZP6A 4MGIR 5EUQB 2DYKA 5CB8A 3FFAA 2IEYA 4US2R 4GL2A 1OHHD 2J0UB 4M0LA 5JJIA 3U3MA 3K70D 1BS1A 2YZ2A 3ZGXA 1GRQA 2Z83A 1QG2A 4PQRA 1EX7A 1XXHA 3DKVA 4HZUB 1DG1G 3V4RA 2ZRGA 2IUSA 4LI0A 1UFQA 1Z6TA 4EFLA 2WJIA 3K0SA 2QAGC 1G8PA 3E1SA 2Q6TA 2C03A 1DO0A 3TVDA 3C5CA 3K1JA 5EXXA 4US0R 4IW3B 4L9WA 2KSQA 4LJ4A 1XF9A 1FW6A 2OXCA 1GL6A 3UPUA 2XTMA 5AK0A 4EIWA 4TQ9A 3R20A 5KNDA 4MRNA 2DWOA 1OXSC 3MCAA 1N6NA 5FOSA 3ND9A 1VPLA 3BJIC 2QENA 4DLWA 1EWRA 4TMZA 5JI2E 5KPDA 5IDVA 1S1MA 1II9A 4P4TA 5FOVA 4XVUA 1G3IA 4M1YA 1Q12A 2QBYB 1ZM9A 2XOKD 4ZI2A 1O87A 1E98A 1RVDA 1SHZA 4PXAA 3TSZA 4C0JA 1NKTA 4PZLA 4XTRA 2VYFA 1FZQA 1E2KA 4F4JA 2HYIC 1ZM3A 2J7PD 1VYVA 3T1QA 6Q21A 2FX3A 1GL7A 1J7KA 4O0MA 1IAQA 3KUDA 4BZQA 2ZRCA 3CBQA 3EAQA 1Z2AA 3H86A 4DSUA 2GESA 1IJEA 2IUTA 4PHTA 2BMJA 2PEZA 3UKDA 1T8UA 2G1JA 4W5WA 4JZKA 4OQNA 1JXOA 1OFIA 1QHYA 4Q4AB 5CIWA 4GFDA 3AP2A 3DHWC 5FL7A 1CKEA 2XTNA 4BFYA 1E2EA 3BB3A 2YYZA 3DZ8A 3TR5A 3QXSA 4PTLA 4YLGA 4LGMA 2B92A 1G5PA 4Q7JB 4B47A 4JL5A 4Q1DA 2G88A 2GHIA 4JBWA 2DFKB 3U7EB 4CF7A 1E4VA 2GRJA 3D7MA 3PENA 4ZDKA 5HKKA 4P4UA 1OH5A 2XEXA 5BN4A 3UANA 3DL0A 1YJ5A 3KKNA 1VG0B 3Q72A 4TSFD 2V7QA 2PBRA 2XNSA 2LWIA 4GT1A 2ZI6A 1CJMA 3CNNA 4TN1A 1VCIA 3M1IA 2O8CA 2QMHA 3IIMA 1X3SA 1U9IA 3IHLA 1G18A 1W2HA 2RMKA 2R6GA 3AVWA 2BDTA 2OESA 5HE9A 1C1YA 2BBWA 4TLDA 2Z5FA 2NZ8A 1YZGA 4C7OB 1JR6A 1E79D 2ZROA 3GLGE 2XJ9A 2VHUA 2ZAMA 3B78A 1KSGA 2QMEA 1CR2A 4W5HA 1W46A 3KKOA 1P61B 3ND8A 4V03A 1DAIA 2CVHA 1Z0AA 5BN5A 1W4BA 4DUGD 3WXMA 4URUR 2AWOA 3CRQA 1KY2A 1ZM4A 4IFEA 5JRJA 2HLDA 3GLFB 2C78A 3IO3A 1G8GA 3KJHA 5HCNA 1S0UA 3TW4A 5C4GB 2ANCA 1N6IA 1KAGA 1IN8A 3OFNA 4M9ZA 2D62A 1NSFA 2WJJA 2AFIE 4LPSA 4IXNA 4WVFA 4MKHA 1AK2A 3K0AB 3TR0A 5FL3A 2CLSA 4D4JA 2F3RA 4Q1AA 5L3QA 2DFTA 4M8NE 4HEJA 3MFYA 3CZQA 2A7QA 2GBLC 2HF9A 3GPLA 4ZKDA 2N42A 5JEDA 3RS4A 2GVDC 2ZQ5A 4QG7A 3AQ4A 3H0KA 1SVMA 3F3YA 3HYRA 3A4NA 2AXPA 4BUJA 2WMOB 2NO1A 2C04A 1XXHB 4K81B 1KHTA 5EP1A 4PO9A 2WZQA 4LJ7A 1R0YA 2EFCB 3I8XA 1I4DD 5B30A 5L3QB 3E2IA 4Q4LA 1W4AA 4HAZA 5AJWA 5JSZB 1ESMA 4MRVA 2GVZC 2WSSA 2W00A 3CRVA 3FMIA 4M1WA 4B3CA 5JJKA 4PHGA 3CPEA 5DN6D 1R8QA 3L82B 2VLIA 4JSTA 1JR3D 3VX3A 1E79A 5JWOA 4EPVA 3HPRA 1HUQA 1G9XA 2V1XA 4RZXA 1PUJA 2Y8EA 2WOOA 1SVWA 2J7KA 3OEHA 3K70C 5G3YA 1AGRA 1EK0A 1A2KC 5F2EA 4D0GA 1ZW6A 2UZIR 3UG7A 4LUCA 1TPZA 2HCJB 3WBKA 5J4LA 4JVNA 1CF4A 3U3RA 4A1FA 3I5YA 2VF7A 1JBKA 2CXXA 5FPHA 3NDPA 3ZZTA 4DKXA 4AG6A 3R8FA 3W9YA 1XD2A 2KJQA 3BS4A 1OYYA 3OEEA 4A4DA 1UADA 1E96A 3HWSA 4YMWA 3VAAA 2GEVA 4DDTA 4RD3A 1M7BA 5EXPA 2NGRA 4ESHA 1MABB 5KU1A 4UXJA 3VTKA 3LO5A 4V0ME 4IDNA 2ORIA 2ZJYA 5E95A 3L0PA 1OW3B 3K0EA 4Q03A 4GRAA 4Q4JB 2YNMA 4DCUA 4N3NA 1EFUA 1NG9A 3CRRA 4QJ3A 4EAQA 3FKSA 2DR3A 2NOAA 1KO8A 1QZXA 1UM8A 3CPHA 1W4CA 4X8OA 3QENA 1KMHB 1DAHA 3THOA 1OE0A 2GZDA 2H18A 2GJ8A 4QGFA 3RABA 2P5TB 4CRWB 5FBVB 4AKEA 1GOTA 2P0EA 4KSCA 2O8DB 5H8WA 3AVUA 5EE1A 1KAOA 2Z4RA 1Z63A 3LQQA 2K5UA 5IRCD 1VIYA 3GCGA 2V8OA 4LJ9A 2V54A 4LC1A 1TQ2A 3SOPA 2O0JA 1RIFA 2PCJA 2ZITA 2YC4C 4M22A 3IQWA 2ZRJA 2LKDA 1G6OA 2CHQA 4QBIA 3B5JA 2JJ1D 2GTPA 4DCVA 2FPMA 1ONBA 1N3BA 5HTKA 2IYZA 2OBNA 5FUVA 2FNAA 2W6ID 1P75A 4TLCA 2OE2A 3A4LA 3LVRE 1EXMA 5FPYA 3EC2A 3KJGA 2RGBA 4IFBA 4G5GA 5SZHB 3A58B 1GKIA 1G8HA 1G5RA 1Z22A 3DDCA 1Z0IA 5DYIA 1KNQA 3QXHA 4LK2A 4MGYR 4BFZA 4XWOA 2A5YB 3AF3A 5FPSA 4ABYA 4C0KA 2PZEA 3QPUA 2VHJA 3RRNA 1Z06A 1D8TA 1IN7A 5CIQA 4TT3A 1ZU4A 1HY3A 5DI3B 5KTYA 3CUEF 3IPYA 3X1YA 1PLLA 2NO9A 3LQRA 2ZYWX 4KAXA 3T06B 4D81A 2HV8A 4QGGA 4TSFA 2EQBA 1FPMA 2ERXA 3ADKA 1MO3A 2XOKA 2AD5A 1N0UA 4L9SA 2FEMA 1XCPA 2ZR0A 3FMFA 3MUFA 3FB4A 4A0RA 3VQTA 4MYTA 4WA7A 5GVSA 4LYHA 3B1VA 4NU0A 3T15A 4RY2A 1T4GA 4P33A 4FI3C 3L8ZA 3I8SA 2IYYA 5CLQA 3CNOA 1FQJA 1E9CA
chains in the Genus database with same CATH superfamily
1BMTA 4MKXA 2C3UA 2QQGA 3E7FA 1YC5A 3PHJA 3VR5D 5LP6F 1TC2A 1JH8A 4LBVA 2OWEA 4P53A 3ZIAD 1EVZA 5CM2Z 4F56A 4LBYA 3SSMA 3SZRA 1A2OA 5HF8A 4D9HA 2FSPA 2FFQA 2IYQA 2AQHA 5A6SB 1I9GA 1UEIA 2VDLB 4RMHA 1GNPA 4XI9A 3N2GB 4Q7QA 5HQ3B 3RH0A 4EGQA 3MJRA 3GUYA 3F3MA 5TQVA 3Q5DA 3GLSA 1VGRA 2FZWA 1W96A 2MMCA 1EUDA 5FQNA 4C7XA 3PEWA 4OGKA 1L5FA 4M1OA 3PF9A 3P52A 1N0WA 5BPHA 2JATA 1T2NA 3IVAA 2RHHA 4QQ8A 4I1PA 1U65A 3TD2A 1E2PA 2WMNB 3T9BA 4FWTA 2MMGA 1EB8A 1NW8A 3RHZA 3SXUB 3A3KA 2XNHA 3PQ2A 4AJJA 2VYVA 2AN5A 1JECA 1U7XA 4II3A 3V8VA 4X66B 4TWAA 4HNVA 2NXCA 4KMMA 3SIRA 5EPOA 1OB5A 3L0IB 1YZHA 4B76A 2ILVA 3PDCA 1W8DA 1WR8A 3TZHA 4DM7A 2VRNA 3K0BA 1E0SA 1T2UA 4LA4A 1Y8RB 1KI6A 3C48A 2QUHA 3JYPA 1A7JA 3T3MB 1ZGZA 1KRXA 1EI9A 4KFTA 3UHAA 3GGOA 4EJMA 1Y6JA 4FMBB 1Z12A 1BEZA 2FQXA 3BK7A 3HJUA 3ST7A 1NKVA 3VJKA 3ZWAA 5LBTA 4FB5A 1O0BA 3ZE1B 4M46A 1USKA 2E37A 3M6UA 5JECA 3QUQA 3IVRA 2CK3A 2QF7A 1KU6A 4I0WB 3ZE6A 5EWMA 2H0QA 3MT0A 4UXHA 2O50A 5CM9C 2HKIA 2VT2A 3D9QX 5K8CA 3DCJA 3CLUC 5KX5A 3TM4A 4NPHA 4WKGA 1FYVA 1XJWA 3W78A 7MHTA 3PV0A 2DX7A 4ASUA 1NXWA 1Z0KA 4ZD6A 1OSNA 1AGNA 1SKYB 4YRTA 3D6FA 4RPCA 4AJKA 3AV0B 3ES9A 1M8JA 3WYCA 3KT0A 3KZNA 2RGNA 4LWPA 3BTVA 4NFSA 3ZEIA 4F7WA 1UFVA 1ND5A 2DBQA 4GR5A 2A3NA 2GF0A 1CU1A 1DIHA 2V7UA 3C7KA 3GFBA 1J0AA 3IGFA 4O4JB 2I3BA 4QDUA 3AI3A 4OA5A 4IIEA 3EXHA 4MK4A 1G8SA 3B36A 3G7UA 4RANA 2BFWA 4JROA 3STWA 4BLWA 4DR1B 3M6WA 4MOWA 4N82A 3UB2A 1ZKMA 3UWKA 3T7EA 2VBCA 1AGXA 3U4MA 2IWHA 2H0RA 2WU8A 2VDPB 1MRSA 3IJPA 4R1NA 1EM8A 1QYRA 2J31A 3EEQA 4UDXX 3HFSA 4LKRA 3DFIA 4WLOA 5HCIA 3UHPA 1QO0A 2YMMA 4J0CA 3E3OA 2R7LA 1RC1A 5JBIA 3L4KA 2OFPA 2PGDA 3OIGA 3UJ9A 2J5RA 2CFTA 2QVBA 3RS5A 2PKCA 1M3SA 1FSFA 5CX4A 1SCDA 1FTSA 1L7XA 1SIWA 4GOLD 4FKZA 4NYJQ 4OB8A 4U7HA 3UV6A 4X64B 1U3CA 5BV7A 4LF4B 4YASA 1B42A 2NTJA 3Q3HA 4Z4GA 4P5PA 3IH5A 3DEIA 2FPIB 2IODA 1KVQA 1O7JA 1JJ7A 1Y48E 2AYXA 3NVDA 1PK7A 2ZCUA 2B7BA 2VBIA 4XJVA 3LUCA 5BW6B 4CU5A 4R7ZA 4I4LA 4I7EA 2QHXA 1DU4A 4N7JA 3I9MA 4M76B 1FFHA 4B71A 2QLTA 1R6AA 4U2BA 3GRAA 4JJ4A 3PE6A 1CSEE 2ZAIA 3MWDB 4GLOA 2VAXA 2C07A 3IBTA 5E3HA 2GM5A 4AKSA 1PJZA 3NIGB 3W2GA 2XB9A 3NTVA 2W5UA 2O8VA 3FWHA 1FTYA 1ZUNA 3L7JA 4M21A 4HN2A 3ZWDA 1XPRA 5ARCA 1SOUA 3KR9A 4F84A 4J0QA 2A7XA 3VKWA 4M7PA 3I9V1 1DE0A 1JZSA 1NM5C 2Q7XA 4L5JA 1VCOA 2ZWOA 5JYDA 3R75A 2FPGA 1THGA 3RRJA 1UDCA 13PKA 3WOHA 1E5LA 1RW4A 4QXQA 2H54A 2I3AA 3QPVA 4UVIA 3LUHA 5AJZA 4AQYB 3JTMA 2I1LA 2IVZA 1B0UA 3ESBA 1I14A 1L5NA 1R8JA 1QK5A 2HLNA 1RCFA 4X95A 3UWPA 3D4BA 5FOTA 2ORWA 2GPYA 5JIBA 5JISA 2C0QA 1M6EX 3DKKA 4KMRA 4M1MA 4R8SA 1C81A 3TFOA 5IXJA 5JROA 1N2BA 4EHIA 2AVDA 1STOA 4NIMA 1O77A 2RGDA 3ICOA 2D3TA 3N3AC 2Q5HA 1KDRA 3L0SA 3H8JA 3PPXA 3UG6A 5ADUS 1X0VA 3DE7X 4TYNA 2UVPA 1ACJA 1OYOA 2O6HA 3RV3A 1D2RA 1X2EA 1QGZA 4F1JA 3AL2A 1XELA 1KO5A 2IU4A 1WZUA 2Q99A 4R0MA 1HSZA 2IWRA 1GA6A 1VJ1A 1L4EA 3WGVA 4QM6A 1F17A 3DKIA 2F3QA 3LM8A 4UVHA 2FKNA 4YT5A 2PS0A 3FFXA 5G4KB 3LDHA 5G40A 1NU6A 2J9YB 1UDAA 2D74A 3E3NA 3OJOA 1U28A 5FTKA 4DL9A 3T3EA 3PQ5A 1UJBA 2GCEA 4BWVA 4DWVA 1BX1A 1P31A 1PRYA 5DOVA 5I7OA 3EVZA 4PC2A 4DA4A 1PEAA 2AZDA 2JGLA 1TZCA 1FY2A 2Q2OA 4HB4A 4RXUA 4X63A 1SC6A 3TIVA 1K7FB 3LCJA 4UU7A 3FRIA 1DEOA 3OZVA 2J0UA 1FLAA 4L8FA 1DAFA 3HDYA 4X71A 5TEVA 1IHYA 3QEJA 4KOAA 4X9XA 5BSTA 1GNLA 3AOEA 4MRRA 4ZTUB 4H7IA 4S0ZA 1HFKA 1U8AA 1EP9A 3L92A 4EW3A 3KQNA 4MAAA 3U3XA 3H2GA 1V7PC 4NESA 2F8TA 4QOFA 1TKAA 1DCTA 3PFWO 4FYYA 2WIJA 4PZCA 1J97A 2FSGA 1RZRD 1RRKA 4X00A 1JLKA 1ISIA 4EJ6A 2WT8A 1R2QA 5KEIA 1NT2A 3HVJA 1BCRB 4QUAA 3C3CA 4UEJA 4NTZA 3VO1A 1AZSC 4EPRA 2W0SA 1P6XA 4YRZA 3NWPA 5AUQA 3HWX1 4YP6A 3D8NA 3HCAA 3HVIA 2CLMB 4N8EA 3CB4A 4J4HA 5ELXA 3IT0A 3GYGA 3I9LA 4CGZA 3FLAA 2ZIAA 4BU0A 4TZ0A 1Q77A 2HV9A 5D3MA 4TS4A 3WRXA 4RV4A 3OJCA 2HT6A 5FO0A 4U2GA 1YQEA 3HBMA 3KHSA 4HKTA 3RTEA 1N6RA 1KI3A 2HBRA 4P92A 2DPYA 4DSNA 4UARA 1QGYA 4DLBA 3EVDA 1QCCA 2RGCA 4AJ1A 4L78A 1AV6A 2FWIA 4IEIA 5TDHA 1RWOA 4BX3A 3IDFA 5AM0A 3ISVA 1VL5A 3O93A 2JH3A 4NWIA 4HWSA 5JYBA 1M67A 4B3BA 5KYWA 2BBTA 4QBKA 1P45A 4KITB 1V2HE 4GIBA 5EKTA 5A9RA 4QRHA 1KDYA 1B8PA 3V4VB 1GTSA 3D6NB 3DM9B 4MQLA 3EVNA 1C50A 2G40A 1BOOA 1K4KA 3OCXA 4HDRA 5ALFA 4U7PB 5IBPA 2Y4NA 4BNXA 2ZRNA 5JSHA 2VA9A 4S1PA 5FI3A 1J2JA 1GVNB 2QRJA 3CZ4A 4XSVA 1WMSA 3KOUA 4FB4A 4N41A 1V7CA 4WOBA 3D8BA 4ARBA 4ZVVA 5B2FA 1BXZA 1P7CA 4N1AA 5LP6A 4H4CA 2W37A 3JARB 3ZU2A 4BJ1A 2GXUA 2ZJ1A 3WLPA 4DLVA 3WA7A 2XJ4A 2DFLA 1OV6A 1JEAA 1X8JA 5ELLA 4JJGA 1J42A 4W5JA 5PGMA 2ZJBA 5BN4B 4IS2A 3EZGA 2VYCA 2P3SA 1VKHA 2WAOA 3AEXA 2YRXA 3MWDA 3RJ9A 1GNQA 3DMTC 4J90A 2O2SA 2R6FA 3DR5A 3O75A 5LSAA 3CE6A 4GX1A 1YL6A 1BHSA 2QR3A 2YYSA 4BATA 4EW1A 5EINA 1PTKA 3MMNA 3S4YA 1ZGJA 3HY3A 3FPFA 3I4LA 3H2SA 2ZUVA 3O2QB 3ONDA 3VFDA 2Q29A 2C5EA 2BW0A 5KYKA 1N33B 3ENVA 5CLJA 2C3MA 3A2KA 3DL2A 4JOBA 4G6ZA 4RENA 4NYIQ 2NVWA 4TUYB 3LPNA 1W5SA 1YBMA 3K0FA 4URVR 1EEXB 1SXJB 3KE9A 1VGQA 1E2JA 1M2OA 5AKZA 4IGIA 1ZITA 1J1UA 3JAKB 3M4XA 4D92A 2NUTB 3EWNA 1H05A 4H1UA 2VBGA 2QTNA 3ANTA 2ORYA 4J2HA 3BK1A 1KP3A 1MH9A 4OH1A 5JNRA 3NBKA 1E64A 5BMOA 3GZ4A 5I47A 2Q5JA 4K6MA 3B53X 4UW9A 5BW5A 3DEZA 4EATA 2FGKA 2I8AA 1DP4A 1YMUA 3TTXA 3THXB 2BC9A 4IV8A 2VAPA 5AKHA 5I7UA 2ZJ2A 5CYOA 3N5CA 3W6NA 2VP3A 2AK3A 5FKJA 2HA0A 4JLUA 4JI0B 4KGDA 4NS4A 5A06A 1NW4A 4G81A 4EHLA 3HB9A 1KH3A 3AJRA 3I2KA 4HQ6A 4Y6GB 3WL6A 2LVBA 5E8RA 2ANBA 3L8MA 3RBZA 3B85A 4XWKA 5G53C 1VB3A 3EARA 3OCUA 1V5WA 2WSBA 1TM5E 2YHIA 4IDEA 3L77A 2QYOA 4RNDB 3TQOA 3VHLB 4DGSA 5HRAA 1XC7A 2YXDA 3AI2A 5H4HA 4XR4A 5JDCC 1X94A 2I87A 2KE5A 3OUTA 3V5NA 2KW5A 1JHRA 2GK4A 4QXMA 4R1OA 3T7AA 4EP1A 3TUJC 3OTGA 3IQDB 5AI5A 3TLBA 2D5LA 4DG8A 3T1OA 1EVYA 3WK9A 3ICCA 4W9MC 3NEAA 2PUJA 2OZEA 1E4EA 1ULTA 2P8SA 3GLTA 4UDOA 3ORYA 1LX6A 3FCUB 1T0IA 1WB4A 3N07A 4MWZA 1P4GA 4Q01A 4L0CA 3U3DA 2QTFA 5JS1A 3Q9SA 1INLA 2YWFA 4XX0B 3HA2A 5EJ9A 2F3SA 4B82A 1MIHA 5CMLA 4EB0A 1YD7A 1R0XA 4NJMB 2H85A 5ECYA 1IN4A 4L75A 2DQ4A 2B4AA 3CH4B 1MGOA 4IZOA 3F74A 5D7BA 3NHFA 4MGEA 3ENWA 2FVYA 1WCIB 1EUCB 2YFQA 2P62A 3BL8A 1JYEA 3OWOA 3QVLA 4QPPA 5GY7A 1CLUA 4C87A 1Q1AA 3G9XA 3PYXA 5DSXA 1R5JA 8OHMA 2X8JB 3RQSA 4IUBS 1Q11A 3AJ9A 3KWMA 1PNTA 3GGSA 3HWRA 5HA5A 4RDIA 3A3PA 2ATCA 4FDAA 2R5FA 2QK4A 3ABRB 4H6WA 4IJ6A 4MYCA 4UNPA 4G4GA 4Q9DA 7AT1A 5CUQA 3QWHA 4M54A 5BUSA 2X0FA 4BQQA 3A1VA 1KP2A 4GSLA 3DO6A 3O1LA 1SKYE 3FMOB 1AM4D 2XE7A 3A11A 3RYFB 1Z7YA 3C8DA 4U5QA 3KXLA 2FWBA 4RVNA 1PNQA 4MW9A 5JMOA 1R66A 1M2JA 2VPXA 1YOVB 1XJ5A 3FVVA 4E31A 3CLVA 1QFXA 3NC1C 1RAGA 1W1UA 1JDBB 4UAUA 1DOHA 4L02A 4FEYA 3A9TA 2G9RA 2C5FA 2H00A 3R5FA 4X61A 3CLUD 4B3MB 1Q1GA 1H1LA 1QIDA 2B6NA 5H82A 1C4WA 5FLXA 3K1AA 1ATIA 1DQYA 1NR7A 2DJ5A 2QRLA 2WV7A 4BV9A 5JLJA 2OG1A 3O9VA 3S2ZA 3CT6A 5AI8A 3JD2A 1XB2A 2N0SA 2QUBA 4EKGA 1OILA 2MYTA 1C3EA 3GLHB 2NUBA 4XJSA 1LLFA 2H2FA 1NIJA 4PAGA 3B70A 4B85A 1N1GA 2WYIA 1KR2A 4MB2A 4KAJA 5KYXB 3HC7A 4ECEA 2WVAA 4B75A 1PJ3A 4HDMB 1FNNA 5ALMA 3SF8A 1HT1E 2PRKA 2X5KO 5DISB 1QTRA 4TRNA 3N0XA 2PYDA 3K5PA 3LYHA 5KYUB 1U8YA 1Y1LA 4HUJA 3TLMA 1EWVA 5G1OA 2A1UB 2GF9A 4FOLA 4EPYA 5BSEA 1IY2A 3B9RA 1DVRA 3UMFA 4AZTA 3W3ZB 2WWWA 3FETA 2ZPTX 3OTIA 4UBKA 1K9VF 1L5YA 3LBHA 3L6UA 2OOSA 2C2WA 2BKLA 1U7PA 4N5MA 1BQ3A 2H2HA 1WA5A 1OWNA 4JLAA 4OHYA 3BMCB 2QP9X 3A6JA 3DR3A 3FNQA 3LOUA 3RFTA 4PYLA 3HNOA 1USGA 2IYRA 1CNEA 1U94A 1KEEB 4S1NA 1QH8B 1DZIA 3P2JA 4LCBA 4MA0A 3MMZA 5BN3B 3G2KA 1BN7A 3C8UA 4YP9A 3ROXA 1FK8A 4DLTA 3BD8A 3NIFB 3V3KA 1F3OA 3MOSA 4GEKA 4QG3A 2Q1YA 3FW1A 4RKYA 2EFYA 4YROA 2ZRLA 3VPDA 2PG3A 3B3FA 4FBMA 1IZ0A 4KNVA 4XH9B 1THZA 1HQKA 2HJ9A 2B8TA 4RH3A 1PQ4A 3FIJA 1WF6A 1YZVA 2O7QA 4Q1CA 1T2VA 5IYZA 1DT5A 1H4TA 3CN7A 4LK3A 2BVNA 2B4KA 2G7ZA 3EBPA 2PA3A 1JALA 2XUDA 4NOLA 5AR1A 2GN6A 1YS7A 2WFLA 4DC0A 3SY8A 4MDFA 2A3RA 4QDOA 3SBDA 2F9FA 3RBXA 1HT2E 3GJ4A 4NK4A 4FPXA 3WGKA 2ZW9A 1LFDB 2I2DA 3ANSA 2BGUA 3EB9A 3AFOA 4RHFA 3VR0A 3QFFA 5B3JC 4LOAA 1I4OA 4HNRA 4NMLA 2WZBA 4X1KA 5G2OA 3UCFA 2IQ5A 1MDFA 4LJYA 9MHTA 1NN5A 4ND4A 1K5PA 2CYBA 2XEDA 2R6HA 3TS1A 3GJTA 3KOXA 2XGGA 3I05A 1U2GA 1UC8A 5ISMA 5KINB 2V7TA 4QU8A 1QF7A 3K0CA 1E4EB 1I2CA 1U8FO 3P9YA 1NULA 3LNTA 1BHQ1 2PWPA 4QNRA 3B7GA 3Q2OA 4YJ2B 1WXFA 3ZX5A 1J0EA 2DY0A 4EY7A 3NVMB 3BMQB 1GTL1 4Y6LA 2Z4TA 3ANNA 3KFXA 1EDDA 3SBEA 2ZP1A 3SC2B 3MBKA 1TJ4A 1XZFA 2W22A 1U2ZA 1FE8A 3C1TA 3X1XA 1LVHA 1W4LA 5B57C 1YVUA 1LQTA 2RB5A 1A88A 4KQ1A 4LJ6A 2WOJA 5LC1A 5I7VA 1X86B 4EFNA 3IMFA 3Q7EA 3BZWA 3B6KA 3ZK7A 3LF2A 2JANA 2W4MA 1T2FA 3LT5A 3Q0TA 4MLPA 4N8DA 4QHYA 3UB4A 3CVYA 1UMBB 3PITA 5JT1A 4X1OA 4U63A 2HGSA 3VYWA 4ENSA 3V2IA 5B7PA 5BMVF 4KK4A 2VJMA 5IJZA 5AOBA 1T3ZA 1SD2A 3DXYA 4X3PA 2ZTMA 1L5QA 1WD7A 4NDAA 4QT0A 5FNVB 3ZY2A 1TD1A 5KKCA 2MDTA 1O5OA 1OR8A 2WHPA 4EG1A 1X1EA 3ETNA 1KFCB 2BLLA 2WT9A 1JNYA 3O47A 2IKQA 1GP2A 1KETA 3SC4A 2BOVA 2QP4A 2C4HA 4N4AA 3IA2A 4NYJR 1RR6A 4MKZA 4LYAA 4W1PA 3QBJA 3GT0A 3LZDA 5TF4A 2JFBA 4GC9A 1HDEA 1C4KA 3VV2A 2QZSA 4IX1A 2WG0A 1WF3A 4FD2A 1RIIA 4PBTA 1YS1X 4MWOA 3R74A 4AD8A 3RC9A 1PO7A 1NRIA 3B60A 1KEVA 3O7MA 1U1FA 1LBEA 1VJGA 1WQ3A 3EA0A 3H83A 3S1AB 1UPUA 1VP9A 1K89A 1PF7E 5A2GA 1H69A 1U02A 1ULUA 1G21A 2BT4A 2PGIA 4RV5A 3CW8X 2Y71A 3DAOA 2WEKA 2JLAA 1TYAE 3GN1A 3H2IA 3U4QA 5BQOA 3ZVNA 3I9V6 3KR0A 1LLQA 3NXKA 4TYPA 3REGA 1FDWA 2EIHA 3HMKA 2OO7A 2H08A 1M76A 4UUQA 5EQJB 3DCYA 3OICA 1CUHA 4YQEA 1B8OA 4BQSA 4Y9UA 3W4KA 4AECA 3OUZA 4MUKA 3QIVA 4WUTA 4JBHA 1I7DA 1OWMA 2UZ1B 1WVMA 4ZVUA 4TVSA 3ZDDA 1VLHA 1JQ3A 3RASA 4Q3CA 2D5IA 4HAYA 4L0MA 3WP1B 3A6ZA 1ILEA 1UPBA 3G88A 1FMJA 1R4ZA 4IDPA 3ZUGA 1H94A 2WLSA 2EW1A 1U7WA 2IPMA 3PGXA 4OQYA 2ZVPX 2GAOA 3AF2A 2JZOA 4N0MA 4WZAE 4CQMB 1VE3A 4HEA6 1ES9A 2TMKA 3WYGA 2IZ0A 2QPTA 721PA 4Y2GA 2ZIXB 1WZCA 4TYQA 1WLYA 1EIZA 1MN6A 1O9BA 4TLAA 1ZFNA 4YVFA 3RWMB 2XMCA 1VJ0A 2Z5VA 4XAQA 4FFPA 4TMXA 5AKXA 5FPKA 4S2UA 5AO9A 4E2YA 2DR2A 2G8LA 1RPTA 2IIPA 2RHMA 4GPEA 2R84A 5TGZA 5FBLB 3TCNA 3W7VA 1U9CA 4COOA 2J3LA 4Z51A 4AS1A 3OZAA 4JLOA 1FL9A 5LP6C 2IXEA 1TX4B 4HS4A 1U80A 2CMFA 5AKKA 1ID8A 2NAPA 3UV7A 2IGTA 2VYVD 2MU1A 2B34A 4MV4A 4I3GA 1C1XB 1L7QA 3MSXA 1COZA 2I4TA 2BFDA 1KH1A 1G9SA 2PLWA 2QV7A 2RBGA 2CUZA 2V3WA 3MOGA 4FFVA 4K86A 4WKNA 3SKVA 3SLKA 3UHOA 5EHZA 4OBWA 4JI6B 3PXCX 1WQ4A 3OE5A 5FJJA 2G7MC 4ITUA 3IOBA 3ZW9A 4F5WA 1V8ZA 3JWHA 4A26A 1QOPB 5HILA 2JCSA 2WDPA 4C0SA 4RFSB 5C1DA 1US8B 1WXWA 2H92A 1FU4A 3IIJA 3MS7A 3QBTA 1JG4A 3OU6A 4MYDA 4PRLA 4QLBA 1QZZA 2QG4A 2ZM5A 3DLBA 4ZEXA 3B7WA 3ASYA 3FCAA 4TN5A 2VDRB 1G5QA 2MINB 4AUMA 4D96A 4I08A 4RVCA 4XQCA 3ZIAA 1CP2A 3PR1A 4IH4A 3WLAA 2YFKA 1UOEA 3KLMX 1E6WA 3PTLA 4MS1B 4BCCA 2NZVG 3FWNA 1HQYE 4OD0A 4KPEC 1GUAA 3KDPA 2YWEA 3Q8XB 2JLVA 3OHPA 2IUUA 2FJPA 1DBSA 1E7RA 4FSXA 3U48A 4PINA 5GM1A 3TR6A 4F9FA 1R16A 2A35A 3B9QA 4XJTA 1J56A 3DAFA 1T2CA 2V5UA 2M6KA 1AU9A 1I33A 1NY6A 3FNRA 3HU3A 3QOXA 4H6PA 4JSRA 4RZUA 5ALNA 2BN4A 4MWSA 4MQFA 3ZHOA 4LZAA 2ID4A 1NBMD 4JB8A 1TA9A 4YAEA 4JXKA 3U3ZA 3GGJA 5IAOA 2XX3A 5A4FS 3O82A 2N47A 4Q3DA 5JARA 4TVOA 4E2XA 3QG1A 1UOPA 4ZXPA 4H7KA 1LY1A 3I72A 3C1OA 3GFOA 1PEKE 3LW7A 5BNFA 2OQVA 1O3YA 3GAFA 3I58A 4M99A 4Q6BA 5KMGA 2YHBA 4NFYA 1BW9A 4C0AC 1QK3A 2AR9A 2C4VA 3GA0A 3QKSA 2ZGVA 2Q2NA 3H1EA 4KMOA 1KI7A 1PJ8A 3QVJA 3EPPA 3ODGA 4QULA 1ETUA 4KPFC 3U7JA 4UBLA 3X3HA 4Q21A 1P1FA 1NQ5A 2P68A 5HFJA 4ZYLA 3JR3A 1U4OA 4WBSA 4ZI7F 3JQ9A 1VFPA 2ZULA 2G72A 2ZRHA 3R6WA 1G6KA 1XK7A 4MWGA 4J4TA 4QUEA 4FFSA 2WIFA 4GPAA 4Z5XA 3PXDA 2YJ5A 1QM5A 4BZXA 2B1IA 1E3EA 3GQBA 5KAMA 3VPHA 4AY6A 1QWSA 3P0FA 4G24A 4PCUA 3WYFA 5JHHB 1X74A 3NEPX 3ZI0A 4J9UE 4Z4FA 3LPCA 1X80A 4R8VA 3E9CA 2JDIA 4OMDA 3A37A 2RHBA 2YHAA 3R24A 1NFRA 2QKYA 1L7BA 4HWRA 4LW8A 3VC3A 5JMPA 3AY3A 1UJ5A 3G2MA 3W6UA 3F73A 3RIEA 2QZPA 4GICA 3CUTA 2EF1A 3G2PA 1JIKA 1IY1A 1ZCBA 1WU8A 4L85A 3QMMA 1TM4E 1V48A 2RAVA 1LFAA 1KY4A 4ZCRA 2ZE6A 2G67A 1JDBC 5GP1A 3EFOA 1NATA 3KZKA 1W85B 1JAYA 4DMGA 4YCBA 1X14A 5JPDA 2B30A 4N54A 3ZLUA 1N5MA 3ZWNA 1XJ0A 1KBZA 2UDPA 3LYLA 4LZLA 4P3YA 3NG1A 5JCPA 3W6OA 1WEHA 1L5LA 3VI4B 1G9TA 5EIHA 4NQZA 3DT8A 3P9XA 4EGFA 1C3VA 4PNEA 3VPAA 5BXQC 1GNSA 4K0RA 2OMEA 3C3XA 1M34E 1V6SA 2HYDA 3SICE 4JMPA 5LZ2A 3PX7A 1JDZA 4JBYA 1BWSA 1GTVA 1VE1A 4G1EB 3RPEA 4UTPA 3HA7A 4Y2SA 4M1TA 1R5NA 7REQA 4ZYVA 3DBHA 5JZOA 5L7WA 2WD7A 4JJ8A 1QORA 2JC3A 3PUYA 1W73A 4G0MA 4IOKA 5IT4A 3WQHA 3W05A 3S68A 4BO0A 1P0IA 3IUNA 2G4VA 3ZNQA 1MABA 1U7UA 3QWIA 4RJJA 3BCRA 4RPGA 1M6HA 3GJXC 3OKAA 4WESB 3CVUA 3KLPX 3HU2A 1GHTA 4PU0A 2F3TA 3DZJA 2RG7A 5T57A 4U3JA 2XYQA 1QBGA 3C70A 2Z2JA 1QIKA 1D9XA 3KKZA 2CXQA 4ENRA 3A6FA 3KWJA 4PLCA 1N4AA 1T9AA 4DVJA 1K8XB 2QJFA 1JQEA 2HQRA 4C0XA 4R71A 1E9FA 1MX5A 5FCDA 5KREA 3RF6A 3QXGA 4D80A 3L1HA 2P27A 5TNXA 1I5OA 2FZVA 3C7TA 4N3BA 4R9RA 3UAWA 4LV8B 2PWYA 3IAFA 5CH5A 4DWOA 5FHQA 2L0XA 4UKDA 1HX7A 1XEFA 5JQGB 3SHQA 4UFNA 4OAQA 1KQNA 4TPKA 2P5UA 4MWTA 2IPLA 4IQFA 2BE7A 2LXNA 5JNLA 1H6DA 1ADBA 1R0ZA 1RKUA 1OBCA 2Z04A 3Q3EA 1XL1A 5TMDA 3WX0A 4AJHA 2QT1A 2CLLB 1RC8A 2P75A 5F12A 2IV2X 1HFEL 4FZVA 3BF8A 3TZKA 3JAKA 3CPJB 2VNKA 2GD1O 3F4LA 3QEMA 2ZZMA 1QPGA 1R3UA 3J80A 3W4IA 1G8AA 2A4MA 4DADA 1IMOA 5C8XA 2DHQA 4Q7MB 1KARA 4YACA 3CVVA 1Y4UA 2VSOA 4NONA 3ZH2A 1J8VA 4LXUA 1DMRA 1GSOA 4PYNA 4EAAA 2EZ4A 2VHXA 5DSTA 3QX7A 1RMYA 1F1JA 2Y93A 4QBHA 3H1GA 1DAEA 1UINA 3QUAA 3U39A 1LJUA 2JFGA 2FE4A 4PW0A 3C14C 5K3CA 5KSYA 1DXQA 1W5TA 1XWIA 2E1RA 2VJKA 5FTNA 1DTSA 1HSOA 3T12A 1FMLA 2ZTLA 2R5WA 4N8SA 3G8AA 3DULA 521PA 2BGRA 3TJMA 4UOQA 4BJHB 3FOFC 2QR5A 4GMKA 2AKAB 1Y3CE 3BFVA 2ODQA 1NYTA 2ZI7A 2YIVX 1R5BA 5AI4A 5KKAA 3U17A 1TQDA 2IEAA 2WHXA 4YWHA 2EQAA 2NU9B 3RSGA 1LGYA 4DLZA 3R5HA 2IUEA 4L4RA 3T3OA 4EGJA 1OAOC 1QG6A 3EPHA 2FR1A 1J0CA 2BPOA 2OZLB 4NCAA 1HLPA 5KMGB 2CJWB 3D6HA 3I6BA 3K6SB 2LNDA 3MWGA 1Z2CA 4NYMR 4BV2A 3CLKA 4Z6KA 2GN8A 3TTSA 4DAOA 3FPAA 3VPBA 1OWLA 3UKOA 4LDRA 1BD4A 2BRUA 4F96A 5K20A 1UOOA 1Z08A 4X6LA 5DTIA 4G1UC 1FLNA 1Z5VA 2ODPA 2OLKA 2AN3A 4YJ2F 3OHMA 5AK6A 3DW3X 3PCXA 4QEKA 1F0NA 3AO0B 2BONA 3EDQA 5DT2A 4KXNA 1TQ4A 3MJHA 4MKGA 1CFZA 3PEYA 1BCSA 2QMZA 4KGVA 2P41A 4OXQA 4AKIA 4ZYTA 2I80A 1KZ1A 3C6QA 3LFHA 4JUCA 3K53A 4MYRA 5I7HA 4BJ5A 5DBEX 4R6WA 3HDHA 2ZYRA 2C9BA 1VXOA 3FYUB 4N0EA 4K9OA 3IC5A 4LC9A 5JAZA 4JB3A 1Y7IA 1PR2A 4MIKA 3RNOA 2CUTA 1F2TB 2WP8J 4L3OA 3AF4A 5KKNB 2G08A 4C5AA 4MW4A 5KTNA 4MLDA 5LQKA 2VP6A 1F7VA 5K7SA 2GD6A 4C7BA 2DH5A 3IERA 3MJVA 4J0KA 3OIUA 2QTGA 2WU1A 4OJQA 1L5VA 3PFNA 4PC6A 1E3LA 4ODIA 3S1SA 3LDAA 4KPYA 2CCKA 1JIVA 2ODBA 3BERA 3DSRA 4N6NA 3STYA 1SHKA 1ZL0A 3PGKA 2CDAA 4NDNE 4B80A 5JCJD 3HRIA 4CEIA 1NVXQ 3COYA 1D2NA 1OLSB 2QG9A 3PDUA 4ZVLA 1CNFA 4URWR 4RPLA 4RY8A 1RBQA 2YJ6A 4OQZA 2BEVB 1MVLA 3VC2A 1E2QA 5J63A 2Q27A 5JAMA 3JPWA 3ZYZA 3S99A 3C3DA 3KVOA 4O4LF 3QY0A 4YMTA 3UKJA 1YUMA 1XX6A 2V55B 3RB8A 2VCEA 1UFOA 3GNQA 2WFAA 1DOZA 2X58A 3K9GA 3L4JA 2FPWA 2MYNA 5I9BA 3UT5A 2ZJOA 1HNZB 4PLVA 3A4VA 1OWPA 4NCIA 2ZYHA 3JRNA 1FB5A 2GZ3A 1EE2A 3OJEA 3LK6A 4FS8A 5E9WA 4ZO8A 4M9SA 3WHKA 1ULBA 4MHTA 3SP1A 4EEZA 4P4LA 4MVJE 4GD3Q 2BHRA 5KTRA 4KQMA 4E5UA 3IBCA 3G9TA 1H22A 3OESA 1B0PA 3HWWA 4GZ3A 1E2MA 1WDTA 4Q3LA 2H57A 4IMPA 4BO7A 5BSGA 1AKRA 2BRUC 5JVDA 1V71A 2B21A 1G291 3NDIA 5DK6A 5KCMA 4CLOA 3S2FA 1REQA 4UHKA 2XWBF 1C9EA 5ESDA 3HS3A 3RYTC 1ORWA 3U62A 5JHGB 1X1QA 2BJHA 3NASA 3P9QA 4TSKA 3MLAA 4IO0A 4QO7A 2Q8QA 2GARA 1U98A 1WIWA 5ALYA 3OQJA 4H3HB 2AL7A 4CT5A 1QHEA 4P86A 4PSKA 4EPXA 2I3ZA 3MRSA 2FP4A 5F7ZA 4ETNA 2A1UA 1V1MA 2X76A 3WIEA 1VI2A 1TJ3A 4IZIA 2OVBA 3QI2A 2ZBEA 3T5AA 2XQIA 2BGTA 2OR3A 2W2QA 2B37A 3U49A 5ALRA 1QRDA 1T9HA 1YZYA 3H13A 3MUEA 3QUSA 4F06A 4V0KA 3PUVA 3H2JA 4XWWA 2PXHA 3KJFA 4MWCA 1JMYA 3FTNA 3PL5A 4ESOA 4NABA 2JLSA 3TK1A 5I8PA 2GXSA 2PH7A 3CIFA 3SBOA 2W6MA 4YGYA 1Y6RA 1JHAA 2PGOA 2ZI4A 2QXUA 3UUFA 4ARVA 3ZN2A 2BMVA 4A7PA 1P5FA 4BGVA 4DCNA 4CLRA 4F3KA 2R25B 2YZMA 2XMSA 1K6IA 3BBPA 4KRYA 4IKOA 4UBIA 2WHQA 3JZIA 5KU7A 4JLDA 3D8RA 4S3MA 2PT7A 3IR7A 3DMRA 3BM5A 3Q7SA 2GBCA 4X90A 2DEUA 1DIRA 3M4NA 3MIIA 3QTLA 4QSHA 4DDUA 5L95A 1ZMRA 3BBLA 3UK6A 5IDQA 5BN5B 1FFWA 4UVDA 2DB3A 4L74A 2XBMA 1DAKA 4G2NA 4U5XA 4AK9A 3G1TA 1U63A 1HG0A 5JSKA 4Y6PA 4PONA 4ERNA 3TSYA 5B37A 4PGAA 3V7NA 1VBFA 3VPSA 3U7HB 1WUKS 1D4ZA 2D7CA 3DWFA 3MT8A 4KVAA 1PZMA 2H1RA 4C0HA 3KQSA 4AG3A 5IC5A 1EA5A 2Z30A 3IR6A 3UAVA 1N25A 3N7UA 5JD5A 4U4AA 1A4XA 3H9BA 1OLOA 4LJ5A 4RKWA 2NUTA 3AEZA 4BX9A 4W7SA 1C3JA 4AMGA 2CJWA 4FYVA 2BFBB 1CZOA 3OD1A 1ECJA 4L16A 1Z6AA 5DX8A 1GDHA 5HCUA 5HQ3A 1UBCA 3KSRA 3JQRA 2IHTA 4LXHA 1U7HA 3VGPA 5C7IO 3B12A 1OV4A 3OFVA 3DHNA 4G01B 1A8IA 1DKUA 4MQMA 4ALMA 4H7FA 3N39C 1OY1A 1Y9ZA 3A06A 2H5LA 5BQPA 3TLEA 4BQPA 3THXA 1TK2A 3E81A 2OHHA 1PV2A 2ZETA 1RFLA 3J7TA 2QSYA 4NKRA 2QI9F 1BCSB 2PLAA 3ACBA 2R8PA 3VR2A 3W9BA 5J1TB 1YS9A 5FEUA 4BU1A 2AMJA 3LA6A 2OZPA 3EXEB 3KQWA 2A9JA 3NHWA 4ZTBA 3RGWS 3ZBTA 2VXBA 5HMLA 3R7WA 1N2XA 1E9RA 2IUYA 1WRBA 4V39A 4X7PA 4B40A 3PGLA 4DBZA 4YAGA 1WZ2A 2VS1A 4ZI3A 2P3OA 5IKEA 1VA4A 1I30A 4WLEA 4XIJA 1YMVA 1Y80A 4U0JA 1WUHS 4LMBA 1YRLA 3OUUA 1Z82A 2IH2A 3GFQA 3ZY3A 2M98A 3RJMA 2DFDA 2YJZA 4J29A 4QA9A 1X7ZB 1ONSA 4JJKA 2PD6A 4R2HA 4MRPA 1S5PA 4KREA 3EZLA 4LMRA 1RTKA 5I01A 3LA8A 4ITRC 1PJCA 3KSAC 1YFLA 3CONA 3QVXA 4K6GA 1A50B 3TDNA 1ISPA 1IG0A 3OIWA 5LQSA 2J3IA 2O0HA 1MTZA 1P7ZA 1AIPA 3FX2A 3DMDA 3QE0A 3R5KA 4LJLA 1SXJD 4RVFA 2OAGA 1I0IA 4RWEA 3SPXA 1P1RA 2K7ZA 3SYTA 2PUBA 4DCJA 5DSZA 4KRFA 2FYTA 4OYYA 3OZBA 2POCA 1J8YF 4D7AA 2R3SA 2VDJA 4MI9A 5AHXA 5D1HA 3DE5X 1YRAA 4PIVA 1A4IA 1T9KA 5KTPA 3BILA 5DTJA 1JPVA 3IVGA 4MUJA 2XE4A 3H8SA 3KZOA 4EITA 4EO7A 2E49A 3TQHA 2H5EA 4RY9A 4D82A 1TM7E 1XZCA 2DHRA 4KQIA 2QIPA 1GFIA 3IEUA 4B6SA 1S2MA 5IF9A 4MB0A 2AS0A 1KI6B 3O4HA 5DBGA 2W6PA 4ID9A 4XTCS 1X92A 1M2VB 4RD2A 4GDFA 1PGOA 2OO3A 2C8VA 2HHLA 2YV4A 1ZHHA 4GOKA 2VP9A 4PFKA 3SI7A 4AZSA 4M6WA 5ALLA 2WP0A 2XMRA 5MFZA 2JAOA 1LTHR 3E9EA 3KLBA 4KPUA 3F5SA 3QUBA 4DQXA 1RBYA 2J5QA 2PV7A