1SUIA

Alfalfa caffeoyl coenzyme a 3-o-methyltransferase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
227
structure length
227
Chain Sequence
KSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Caffeoyl-CoA O-methyltransferase
publication title Crystal Structures of Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
pubmed doi rcsb
source organism Medicago sativa
total genus 82
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.104: Caffeoyl-CoA O-methyltransferase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1suiA00
2OBFA 4FP9A 1YB2A 3CBGA 3E7PA 3NVMB 1ZG3A 4PYKA 3LKZA 3DMHA 3KQMA 1O9GA 3DMGA 4NECA 4PINA 5K01A 3FYCA 3MGGA 4C05A 2HV9A 5GM1A 4DA4A 2IH5A 2P40A 2PVCA 3GXOA 4PYNA 3P2IA 4DCMA 5KVAA 1EJ0A 2P7HA 2O57A 2OXTA 4DM3A 1JSXA 2YUIA 2ADMA 3P8ZA 5ERGB 3HCAA 3P2EA 3F4KA 5JUWA 4ISCA 4IWNA 3EVZA 3ME5A 1VLMA 5DXJA 1FJXA 2NP6A 5K0JA 1SUSA 3OZSA 2PT6A 2YXDA 1VPTA 5IH3A 3T0IA 4UOEA 3M6UA 3GWZA 3SMQA 2IBSA 4YUZA 4EQZA 4FR0A 2AN5A 4A6EA 1QAQA 3OU7A 5ICGA 1P39A 5K0BA 5GINE 2XBMA 2PT9A 2DULA 5EEHA 3FPHA 1EAMA 3V97A 3B3FA 5CM2Z 3DULA 3JWHA 3NWBA 3M4XA 3CJTA 2ZBQA 2PWYA 5FA5A 2PX5A 2BH2A 1P1CA 4RTLA 2EX4A 4PCLA 1WS6A 2P7IA 3FRIA 3CC8A 1DL5A 2NYUA 1AQJA 3PX3A 1N2XA 4X63A 3SSOA 3TFWA 3C0KA 4CTJA 4FS8A 5LQRA 1Q0TA 1SG9A 3A26A 3GRZA 1SKMA 3HA7A 3KQQA 4LG1A 4YUYA 5E1BA 5CVJA 4CXMA 2I62A 5ICFA 4QDKA 3DLCA 1L3BA 3ELUA 2QM3A 2G72A 5MHTA 3G8BA 1R18A 2B25A 2OB1A 3KPVA 5DM0A 5EGSA 3BWBA 5DX0A 1D2HA 1YUBA 4XUCA 5BW4A 3G2PA 4Y30A 4RTJA 1XDSA 3KR0A 3LX6A 4HGYA 3GNLA 5E8RA 3R0QA 5EMKA 2VP3A 1FP1D 3LPMA 4R6WA 5JR3A 2Z6AA 3FTDA 1INLA 2OB2A 4PGGA 1I9GA 4GOMD 3G5TA 4BP3A 2EJTA 4R05A 2PX4A 4F86A 1KPHA 3HA5A 3R9XB 5FQOA 4E33A 2AOUA 3G2OA 1ZHFA 3CJQA 2FPOA 1AF7A 2IDJA 5E8JA 3DTNA 5EMMA 2C7RA 3GRRA 3FTEA 4GQBA 1G55A 4GOLD 5HFJA 5EHGA 3EGVA 2JHPA 5F2OA 3NJRA 3MTEA 2N47A 5CCXA 1XDZA 3UJAA 2IH2A 4C4AA 5B1SA 2HWKA 2H00A 2PY6A 4YV1A 1U2ZA 4LWPA 1PJZA 1SQFA 3B3GA 5DRTA 3C3PA 3QOWA 5CVUA 2UZ4A 3GRUA 1YFJA 5D1HA 3TM5A 3M6VA 4EVIA 5K0FA 2EJUA 3GU3A 4HSGA 4YMGA 4X41A 2YVLA 4P58A 4CKBA 3GGDA 2AOXA 2CWWA 2PSSA 3HNRA 3G5LA 5KYGA 3KR9A 2GB4A 2XYVA 3EVAA 5FCDA 4QPPA 5EC8A 2IDKA 1YZ3A 3OZTA 2P1DA 3C6KA 2BR3A 3ER9A 3A7DA 3R3HA 5EEGA 2OPBA 1NV8A 3EGEA 3P71T 3EVDA 2AOUB 2P8JA 10MHA 4FSDA 2NP7A 2VZ9A 3RW9A 4QVGA 5C9ZA 5E1MA 5HIMA 5C0OE 4ER6A 3KQSA 1SUIA 5K0GA 5K09A 2QRVB 3EEYA 4LECA 3E23A 5CIYA 5E2AA 3CVOA 1WG8A 1JR4A 2BM9A 1QZZA 5FTWA 2ZBPA 3A7EA 5P8WA 4MQ4A 3AY0A 3FUTA 5GWXA 3UA3A 4YV0A 2GAFA 3K0BA 3PTAA 1ZGAA 4MWZA 4WXHA 2ZWAA 4RTNA 5EKUA 3CCFA 5DSTA 1JG3A 1RJGA 2JH8A 4PIPA 1RI5A 2JHCA 2JJQA 3O7WA 2H1RA 3DLIA 1XDUA 1FPQA 2HTEA 3GIWA 3NDIA 1QAMA 3MERA 1R74A 1KYZA 1KYWA 1F38A 2BM8A 3G88A 4OQDA 5K0NA 5GOZA 4A6DA 3KQYA 2R3SA 4P7KA 5GP1A 5DXAA 2IBTA 3SXJA 3TR6A 3NVKI 3MAGA 4QTUB 5C1IA 4C08A 1QANA 5ICCA 4OBWA 3OU2A 2PBFA 3LCCA 2OKCA 4C06A 2NNWB 2HNKA 2AOTB 5GM2A 5IKMA 3MTIA 2C7PA 3P9NA 3OU6A 1IY9A 5EZSA 2QE6A 3HCBA 1L9KA 4PYIA 5E1OA 4E31A 2AOWA 1YFLA 2GS9A 3O31A 3THSA 5F2NA 4BP1A 4MIKA 5DTMA 3BWYA 5DX8A 3D2LA 5EIFA 5HZMA 3I64A 3OCJA 5CUQA 1TPYA 5HILA 3HVHA 5DTRA 1R00A 3KQPA 2AVDA 4QVKA 4E2XA 3R6TA 5DTQA 1FP2A 3DUWA 1TW2A 4RVDA 4DQ0A 2JHAA 5DM1A 2ZZNA 1XCLA 4R8SA 2V7EA 3ERCA 5EMJA 2ZCJA 4HGZA 3TKYA 2ZW9A 3ER8A 2UYQA 3FPEA 2KW5A 1JG2A 1SVUA 3UJ9A 4FZVA 4GOND 4OA8A 3KPUA 3QV2A 4GBED 4ZTBA 5BXYA 1Y8CA 4X1OA 1AV6A 4XUDA 2NXNA 5CCBA 3EVGA 1R6AA 2E5WA 1D2CA 4X61A 5DRYA 1UWVA 2H11A 3EVFA 4OQEA 4E2WA 4E2ZA 2P3OA 1KR5A 4EMSA 3JWJA 4GUAA 3E05A 2HMYB 2ESRA 2IPXA 4PGHA 1ZKDA 5DX1A 3PB3A 5E1DA 4RTQA 5KS2A 1UIRA 3A4TA 3BGIA 1O54A 4WVLA 5FA8A 2C7QA 2G1PA 3NWEA 2CMHA 3SSMA 3DXZA 4BLVA 1X1AA 3HA3A 1KIAA 3R24A 2AN4A 4DKJA 1HNNA 5EPEA 2I9KA 3NDJA 1UFKA 3GRYA 4HG2A 4ER0A 1BKYA 2BR5A 1RJDA 2O0LA 2YX1A 3KQWA 1KPIA 3C3YA 3U81A 4PYJA 3DXYA 5EMLA 2G8NA 3HEMA 3FPJA 4FT4A 5DLYA 5F2KA 5FQNA 3TLJA 3JWIA 4OX9Y 2I6GA 4MTLA 5FWDA 3UJ7A 3VC1A 3NW9A 3DP7A 4R8RA 4ER3A 5K0CA 2ZZMA 5E9QA 4GC5A 2QRVA 3H2BA 2OZVA 3OZRA 1PRYA 3P9KA 4KW7A 2Z6UA 2O06A 3PFGA 3G7UA 3OE4A 2AVNA 2CMGA 1JG1A 3HCEA 4ER5A 3ELDA 2V74B 1WZNA 1YZHA 3UJ8A 3EEOA 5E2BA 1T43A 3FUUA 4AX8A 5K8VA 4E70A 4EKGA 5GIOE 2OYRA 3A25A 3FTCA 3P97A 5FADA 1M6EX 1X1DA 3LKDA 2PX8A 2XVAA 3BZBA 1ORIA 3UJCA 2ZBRA 2UYHA 2BZGA 4OA5A 2ZLBA 3FUWA 2ZTHA 4AZSA 2AOVA 3SR4A 2I7CA 4M38A 2ZULA 3PS9A 3REOA 3TRKA 2YXLA 4C04A 1M6YA 2UYOA 1WXXA 3LSTA 4Y2HA 5CVEA 4L7VA 1XJ5A 2P41A 3UFBA 1SQGA 2ZZKA 2PGXA 3GJYA 5KQSA 3TKAA 2AOTA 1G38A 2EFJA 4ER7A 3VSEA 1H1DA 4RVGA 5CVDA 4FT2A 1I4WA 4PIMA 5KQRA 2G71A 2F8LA 3P9CA 3IYLW 2YXEA 3M33A 4LWOA 2ONZA 4CKEA 5LQNA 1IM8A 3EVCA 3NMUF 1L3CA 5E9JA 5LQJA 2ZIFA 4IV8A 3BT7A 4F85A 2VDVE 1BOOA 1F3LA 2ZFUA 3BGVA 2PXCA 1X1BA 3M70A 4KDRA 4PYOA 4RVHA 5DSXA 4E30A 4PNEA 2AZTA 4YV2A 1NBIA 1XTPA 3LHDA 1KHHA 3MCTA 4PWYA 5FHRA 5T67A 1XCJA 5GIPE 2XYQA 3ELYA 2IFTA 3AXSA 3PVCA 2B78A 3SVZA 4G56A 3KPWA 1G8SA 3FZGA 1EIZA 4P7GA 3G8AA 4X60A 5H02A 1JG4A 3T7SA 4QQKA 3EMDA 3VC2A 1B42A 3AXTA 4BY9E 3LDGA 5DT2A 2XVMA 4AUKA 1ORHA 1KXZA 1NW6A 1RI4A 3LECA 1P1BA 2ZIGA 2WA1A 1NW5A 4GF5A 3TPZA 2IIPA 3NTVA 4OBXA 1Z3CA 2XYRA 5FUBA 4RTSA 2FRXA 2ZIEA 3SSNA 1EQAA 2VDUE 5E9WA 3SX0A 3KHKA 4P7FA 3A27A 5CVVA 4KDCA 3UZUA 3OFJA 4DZRA 5K05A 3PLAE 4HTFA 2P35A 3FUVA 1O9HA 4XUEA 2CL5A 5LR6A 1VE3A 5LSAA 3B7PA 3EPPA 4GEKA 2A14A 2ZSUA 1NE2A 2FK8A 1G8AA 1JQEA 2ZWVA 2O07A 3LCUA 5U4XA 4BLWA 1NT2A 4HC4A 2FCAA 3EGIA 4DMGA 1RI1A 4RTPA 4CTKA 1DUSA 3UJDA 3UWPA 3GO4A 5LQCA 1AQIA 2G70A 3VYWA 2PXAA 2OY0A 4U7PB 3KQVA 3KPYA 1KPGA 4DF3A 2AN3A 4C07A 3IHTA 3EVBA 1NW8A 4IKPA 3UA4A 5K0LA 1I1NA 3KU1A 4CKCA 3BUSA 5T6BA 5HOQA 2ONYA 3HCDA 5DM4A 4FGZA 5BP7A 4C03A 4KRGA 1P91A 1JTFA 3DOUA 3EVEA 3TQSA 3UBTA 2ZVJA 3DR5A 1M0EA 3KKZA 3P9IA 4RTMA 2GPYA 1G6Q1 1WY7A 1ZQ9A 3M6WA 2AS0A 2PX2A 3JWGA 3I58A 4HTFB 4PCAA 2GA9A 1EG2A 3B3JA 5EIWA 3LGAA 3CGGA 5EZQA 3V8VA 2VDWA 4RV9A 3BKWA 2GH1A 2WA2A 2Y1XA 3FUXA 3HM2A 4FSXA 3SM3A 3IEIA 1NKVA 3KR2A 4V0QA 2FHPA 3X0DA 5HIKA 9MHTA 3OE5A 4RTOA 2PWPA 5FWAA 2WK1A 3THRA 4RWZA 8MHTA 5EKXA 1QYRA 2PXXA 2ERCA 4PYQA 5K03A 2AR0A 4GC9A 3FTFA 4HH4A 4E32A 1Q0SA 1L1EA 2JH9A 3HP7A 1KP9A 3I5UA 3LDFA 2FK7A 1BC5A 1RI2A 1XXLA 3T7RA 5D1NA 3OFKA 5HIIA 1N7JA 4F84A 4POOA 2DPMA 4JXJA 1JSZA 1NW3A 3LCVB 2QY6A 1NV9A 4H0NA 3OPNA 4KVZA 2VS1A 3K6RA 4R6XA 4BLUA 5LQUA 2JG3A 4M36A 1R8YA 4V0RA 3BWCA 4Z2YA 2K4MA 4HRAA 3BWMA 3FRHA 5BW5A 3HVKA 3TMAA 3E8SA 2HR1A 3ID6C 2QYOA 3WSTA 1QAOA 4B17A 4AZVA 1YF3A 1VP3A 3CJRA 3C6MA 3S68A 3HVIA 2BR4A 2O05A 2B9EA 4QQNA 5K0EA 2PLWA 1EJ6A 2NXCA 2PV0A 3G2MA 4U7TB 1XVAA 3ORHA 5M5BA 3HTXA 1RI3A 4PYMA 1G60A 3HCCA 3FYDA 4AZTA 3P2KA 3I53A 3TOSA 1OR8A 3HCFA 3B89A 1L3IA 1RJEA 3B5IA 4RSRA 5CD1A 2P3QA 2YR0A 4EK9A 2P3LA 2FYTA 3G2QA 3PT9A 4QPNA 2R6ZA 5FHQA 4RX1A 3L8DA 4KIFA 4CWAA 4MHTA 2B3TA 3O4FA 5DWQA 4YUVA 3UJ6A 1TW3A 1ZGJA 2CKDA 2LD4A 4QTTB 3EMBA 2Y1WA 5EQJB 5FULA 3LBFA 3QOXA 4YUWA 2IGTA 3GCZA 2ORED 3KR1A 4P7JA 2UYCA 5EOVA 7MHTA 4DCGA 4ATNA 3PFHA 3AJDA 3MCZA 1HMYA 4RVFA 3BXOA 4YUXA 2EG5A 4EKIA 3SGLA 3MQ2A 3GDHA 4O29A 1MHTA 2Q41A 4PYLA 3RODA 1V39A 2PKWA 2GLUA 3AWIA 2PJDA 4RTRA 2YTZA 2Z6QA 3DH0A 3G89A 3PX2A 3Q7EA 4M37A 3UJBA 4IV0A 3FPGA 3DMFA 5DM2A 3GRVA 1JQDA 4KWCA 1MJFA 1X1CA 3KQOA 3T7TA 5ICEA 1RJFA 1X19A 3MB5A 3CKKA 5EVJA 4YMHA 5LQAA 3LDUA 1FBNA 3HVJA 5EHIA 5LQKA 2B2CA 4RTKA 4RYLA 3ELWA 3BKXA 4M7RA 1IXKA 4AZWA 3LBYA 3M6XA 1VP9A 1WXWA 3BGDA 4XCXA 1VL5A 1DCTA 1BHJA 4GOOD 3MHTA 4K6MA 3DXXA 4QDJA 2C7OA 5HIJA 5T64A 1N7IA 1VBFA 3ANXA 3KPJA 2NXJA 5EG5A 3LL7A 1NW7A 1NBHA 1D2GA 2IP2A 3TM4A 5DPMA 5HEKA 3RIEA 3I9FA 2OO3A 3FPFA 1JTEA 1R8XA 3Q87B 5G02A 4KIGA 1JQ3A 3IV6A 1VIDA 2YQZA 3KQTA 4E2YA 1VQ1A 2IH4A 2NXEA 4PONA
chains in the Genus database with same CATH superfamily
3MRVA 2ZYVX 1HE4A 1J0EA 1ZG3A 4HX5A 4IJVA 3AHHA 4KQXA 4KJZA 2FN8A 3CY6A 1KDYA 5JEDA 3F9CA 2HLNA 1NXPA 3PNSA 1P0IA 1VI6A 2RGGA 1Z0ZA 1EJ0A 1A9ZA 1QYCA 4DOMA 1H6AA 2VPWA 1BKSB 3ETLA 2WIFA 3KFVA 4G1MB 2EEZA 4P84A 2GN8A 4D6YA 1TIPA 4DYDA 1VPTA 2EWWA 2KWIA 2QL6A 2WPDD 3RM3A 4U7JA 4TS3A 5KU7A 3MLAA 5H3LA 5ICGA 4ZQGA 4TKUB 1ZUHA 1W5SA 3N2LA 5CURA 1OKKA 3G7NA 3RWMB 1QGOA 2JJ1A 2OHOA 3B2NA 3JARA 3BMQB 4C7MA 2NTYC 3DULA 3F5QA 2AFHE 1S89A 2OV6A 1CIVA 3M4XA 1BGWA 2GESA 3DAPA 3QKSB 3VKUA 3VZRA 5IK2A 3QE3A 1NVUQ 2O3JA 1R0KA 3KYJB 3TB6A 3AF0A 4OFWA 1S9DA 4F3TA 3OX4A 2GZ3A 4AXXA 5IWCA 1HNZB 4AC9A 3EZ6A 2P2NA 3BXEA 4KO4S 1JLSA 3CS3A 3MT0A 4M9RA 2BISA 4MP6A 3WA6A 3BMCA 3N1UA 1A9SA 1NF9A 3MBKA 1UXKA 1VIAA 4UDYX 4YRZA 4ZCQA 3U4QB 4GRIA 2EFHB 2FPLA 3B7GA 4RXTA 1FTWA 5DLQC 1UBMS 2COEA 5TX7A 3ZPXA 2RI0A 3F96A 2R8YA 1GQOA 1SXJA 3FYTA 2YHSA 5J43A 1XMXA 3GC6A 3OIGA 1LUAA 3G9QA 1R6VA 2HSJA 2BEVA 3AFMA 1TC1A 3BGOS 2HADA 3DEKA 3FX2A 4WACA 5JXIA 2OYSA 1YJBA 2FUG6 3I23A 4JAVC 5FLEX 1ZSVA 3R0QA 1QC5A 2F3QA 2XYHA 3IOYA 3QU2A 4F1WA 3OFNA 4H7DA 2GBFA 1YCFA 2VJMA 3FMFA 3KOXA 1V5IA 4UTRA 1ESMA 2IYVA 3C3WA 1NR7A 1ZISA 2PX4A 3HBLA 4G97A 4PM4A 3OF2A 4TQ9A 4YECA 4UAGA 3STVA 4UPVA 3HV2A 3HB7A 3PNMA 4IH1A 4BQFA 1HX7A 3ZTTA 3AFGA 4BO3A 4DBVO 3D7KA 3ZNQA 4S2EA 3ZBPA 4EHFA 4MKZA 5AVYA 2CHEA 2WZQA 2VYNA 3H42B 7MDHA 3CEMA 3KKLA 4BNHA 4Q3OA 4PC2A 3O0TA 3T9DA 2OG2A 3B3GA 3NHJA 2CK3D 3V8PA 2WG0A 1BN6A 1KQNA 5KYUB 1Y4DE 1A4RA 2ECQA 2OT3B 2ZRGA 3AM3A 3E1SA 1YJQA 4QYIB 5K0FA 4W5NA 3G82C 4JB8A 2YWGA 4X1IA 2BF7A 3HNRA 3EIXA 5ALSA 5A4FS 3STUA 1OIXA 2GB4A 3S4YA 3U3DA 3VR6H 1OAOA 1HUQA 3OQHA 2W8BA 2HT6A 3ROGA 1XAJA 2OZLB 1JA1A 1NQXA 2WYIA 4RGQA 5EINA 5DBGA 521PA 4YJHB 4OBEA 4PZDA 4ZEWA 1NW9B 4IHJF 3SQMA 3CW8X 3V6MA 4B35A 1HOTA 3MYYA 4OREX 3QPUA 3ROKA 1E1NA 2PUCA 3DKKA 1S96A 4Z1MD 4D0LB 1C3OB 1UBJS 2QT0A 4ZO4A 5CTAA 3UAWA 2BFOA 2GASA 1E9EA 3FSGA 3WB0A 5CFLA 1NYTA 3ZHZA 3KG2A 4LTNA 1W47A 3UMMA 5AIBA 1RC1A 3ASVA 3JVUA 4MPPA 2QVBA 4NE2A 1U2PA 3OM0A 5EJAA 4R1MA 4ZYVA 2EP7A 2Q3CA 3NEJA 3BSWA 3F6BX 4HWOA 5E2AA 1BMTA 4HD8A 3W4IA 3SHTA 1S2GA 4FYPA 4NZ9A 4O3FA 1XGKA 3Q40A 1RRFA 3JYHA 3OQMA 1ZM9A 1NXQA 2JFVA 2NZXA 1D6MA 2DPLA 2ZYSA 1SIOA 1XK6A 1JBEA 2OCAA 4LJ9A 4V24A 2MJLA 3USZA 4D3DA 2JHCA 3D0RA 1P3JA 3IE0A 4Y2VA 1ISJA 3DYVA 2Y0DA 3GLKA 4FINA 1KZ9A 4A5SA 4D9EA 3DLIA 1YDMA 3TNYA 3B9BA 4W9MC 1R5BA 2EERA 4AFNA 1JA9A 2OZKA 2Q4RA 4QAQA 2X8JB 1TAHA 4RJ2A 4REQB 4ETMA 1CUZA 2HW8A 1IHPA 1CWUA 1RYMA 2BAGA 2QSZA 3R5SA 4HNSA 5I3ZA 5ICCA 3ZHCA 1DXQA 1KFEB 3GA7A 2VEOA 3AY6A 3HZRA 3M81A 1UKBA 5IKMA 1S1MA 1R6XA 4ZT3A 2QRGA 4CTMA 3I1YA 1R88A 3NU1A 4P35A 5L95A 2CD7A 4O6VA 1EWVA 4TQUS 3AJEA 2VBCA 3FIJA 1LU9A 4KNYA 1L4HA 1LXCA 1G41A 1QIMA 1GPWB 3QUAA 1VLVA 5DYNA 3B38A 1WDMA 1U81A 3E58A 5J59A 1OXSC 4F8YA 2QG6A 2CBGA 3LHFA 5JC1A 1GPMA 4RVDA 1P7YA 3JQ8A 5CK4A 4JR2A 1WSBA 1F8YA 5DM1A 4G65A 3EGCA 3K32A 5ISMA 4EH1A 5KKNB 5H1YA 4G5HA 1W0KD 2OXRA 3UB2A 5I9NA 3KZOA 3V4OA 3I45A 4QWWA 4TV9A 1VG8A 1XEFA 2WU4A 2P2YA 2XVXA 3HYTA 3M9XA 3ZCQA 2PH1A 3JW8A 1QFJA 1UZNA 2B0JA 2ISQA 2JGDA 3SBXA 1IM5A 2XNDD 1R6BX 3HKEB 4GI5A 5IASA 5HRUA 4FTWA 4XUGB 3BXGA 1P0MA 1ST3A 1X1EA 2VWGA 3DLPX 1R6AA 2IOQA 3IUBA 4MEAA 3NEAA 4QYWA 1YGPA 3I1FA 4PX9A 1RYBA 3ZWMA 3CEPB 4H2DA 2QJOA 2QKYA 3KAKA 1XDDA 5DHUA 5EJ5A 2Q07A 4G4GA 3C97A 4P93A 5LZ2A 1XTBA 3THYB 3D4NA 2FTKE 1UIRA 2QLFA 1XXHB 5FUWA 4RACA 4WVLA 2VAWA 2Y1GA 4JYMA 2C7QA 4KVAA 2HFJA 2X1LA 1N6RA 4B33A 3RUIA 4BLSA 3H7IA 5SZHB 1GZDA 2OM6A 2WF6A 1ATZA 3L4EA 3R24A 5EPEA 2J7PD 3TZKA 2VXYA 4CPDA 4CF6A 5BVHB 5KYYB 3GRYA 4W82A 3TZQA 1RJDA 4B8WA 3HBMA 3IPRA 1CXZA 4M0EA 4QUKA 2W42A 1ZZGA 3A28A 1G6HA 2YS7A 1WMEA 2VUUA 3D6TB 3T9AA 3W78A 1E62A 3AVPA 5AVKA 3GLSA 2J9GA 4OQQA 1H93A 1P73A 1W0JA 5D5PA 4BNMA 4MV7A 4HLDA 3UK0A 3QU9A 4IEEA 4BWYA 3UEOA 4B2PA 2CMGA 4NYJR 3WKCA 1M1YE 2GEJA 1QKKA 1ZMBA 3LLSA 1F1JA 4GR5A 4LJ4A 1NTOA 1KEKA 1N3IA 4G26A 5CDGA 1PEDA 2PCJA 5B12A 3WHKA 3B7WA 5K8VA 1TMGE 3ORFA 2VDOB 5GIOE 3DD1A 3QBTA 2JAXA 3NAGA 2WKSA 4B3FX 4Q82A 3Q1KA 4OA5A 5K2OA 4YN3A 5BYJA 3C3MA 1SPBS 1W8DA 4LKOA 3WL3A 1D1PA 2ZULA 3W9UA 3E4DA 1RHKA 3O47A 4NV1A 4BNJA 2MYPA 2CLCX 5AM3A 1EIWA 2A0UA 1P6XA 1CP3A 4JLVA 1Z6XA 4GP7A 1A8PA 4AJ2A 1C0PA 1OQAA 2IXFA 2WJVA 4B46A 1AGXA 3GRKA 1H2WA 2GTIA 3HYCA 3ZUGA 4AT1A 3QBJA 1H1DA 2C2YA 4PSAA 2HLDA 4KQEA 4PCVA 4Q3AA 3VR6A 3VU0A 2NM0A 1N78A 3BFKA 2YXPX 1H4VB 2G71A 1E2PA 3VYTB 2Y0BA 3IYLW 1E5XA 2E6KA 3UXYA 2GCOB 1QCDA 5BQFA 4CKEA 2YRFA 3IUYA 4Q1AA 2CT8A 3NMUF 2ZIFA 5C1BA 3T52A 3ISTA 4KZKA 4W8HA 2VPXA 1K5DA 1E2LA 1ONNA 3A4YA 3VJLA 3H11A 4XM2A 5AXAA 1W7AA 3CQ9A 4L28A 1WR8A 3K2QA 1AG9A 1FQJA 1ZO8A 4GPAA 4P32A 4Q4LA 2HWWA 5LZ5A 3CFYA 3S55A 3WK6A 4MNTA 1KNQA 2RGXA 1YJAA 4TT3D 2WF8A 3M4ZA 3PCTA 3RSLA 1T6BY 3CE9A 1TJYA 2DECA 1PJ3A 3BTSA 4HJRA 4GHWA 4TWJA 5LXTA 3ORYA 3U7RA 1TL7C 2WWYA 4MKFA 4TV8A 1PZNA 4CYMA 3TLYA 2NU8A 2XCOA 3AEQA 2HI0A 4LI3X 2HU7A 2IE0A 4U5XA 1GGHA 3ABZA 1EFCA 5TRTA 4PHHA 2R4QA 3P1JA 1NLZA 3OBBA 3PKJA 1D2RA 3S28A 1V8BA 5DLPA 1SA0B 4QU0A 4NBUA 3P9RA 3ER6A 3HY4A 3WMGA 3I1JA 3KJFA 2XUKA 1R4NA 1VE5A 3B3AA 3E9RA 4IUDS 4QRHA 4IXTA 3DQPA 1ZX1A 4PG7A 3HUFA 4IIUA 4LUCA 1JDNA 1KOGA 2P68A 2WTAA 1BA3A 2V3VA 4OQ4A 1NZFA 2RGCA 3I8SA 1HBJA 3JY6A 3LPNA 4WCDA 1AGYA 2BSQA 2EU8A 3L1KA 1AHIA 1AXEA 2CZQA 4TSFD 3FCYA 2QL9A 5CT6A 4E08A 3OTOB 1O95D 1FK8A 2ADOA 1UJMA 3D8RA 4TYPA 4GYYA 1RC8A 2NSYA 2WTNA 3LUBA 5KOIA 1YHNA 1ZJZA 3IAS6 1BVRA 1ZI8A 1KPGA 1WEKA 3K0CC 1P33A 2ZJ4A 4MUEA 3C7AA 1NL3A 2HDWA 1Y8QB 2HA4A 3ML1A 3IURA 3QUSA 4WOJA 4AIIA 1U7TA 4NF2A 3MXOA 4UZEA 4ZOQI 4XX1A 2CBXA 1C81A 5BP7A 1M1XB 2FGKA 3INTA 3K0SA 4BE4A 1CRWG 1M0EA 4YQFA 3DWGA 2ATIA 3Q7PA 3RIYA 4CF4A 2G9VA 1G6Q1 2K87A 3N0XA 3WR5A 1A88A 5AVSA 4Q9LA 2DC1A 1V4NA 3HUEA 4BMCA 5EYPA 4XVHA 3D1VA 1T2VA 4KPEC 2G6BA 3QK7A 3K1JA 2ODEA 2QN9A 1LRJA 1QO0D 2WFZA 4MGEA 3IP5A 1UM9B 3ZH2A 2FW0A 5C5CA 1M8PA 5AKHA 3ORRA 4WE3A 2HWUA 3WQRA 3EWAA 4B5LA 3WJ1A 2A0KA 3H9BA 5EKXA 5IBQA 4MDHA 2PFKA 5KYXB 1NJGA 2ZI6A 4MW9A 1M72A 2HF9A 3QKRA 2JGRA 4HWSA 4UNPA 4D0GA 3A6DA 4RH1A 3FLEA 4GYKA 2VP6A 1LX7A 4M87A 3RC3A 4LHSA 5CHYA 3V1UA 3A4MA 1EFDN 4DXDA 3I8OA 2DPMA 2P2SA 1SRRA 4HXYA 1RYDA 2ZSKA 4M3NA 3O8BA 4DRZA 2QY6A 1OLXA 2WJ6A 4EJSB 1FLNA 2FMXA 2BZSA 3K92A 3EGDB 1IY0A 4RMNA 4FOPA 3FRHA 4D97A 1D1SA 3J81A 3AVWA 2AHOA 4X71A 4B17A 2WYHA 5AW1A 3NUQA 1MHPA 2C94A 3ZXYA 4QDOA 3G0HA 1QG6A 4TZ0A 3OURA 2OCKA 1L5RA 3H86A 1JHXA 2Q1XA 4OJKA 4TMFA 4HAXA 4XDHA 5EJ9A 3D0QA 3DDNA 1QS0B 2CVOA 2NWQA 2A35A 3NATA 2JI6A 1EUCA 3FJYA 4JIMA 2X0DA 2IV2X 2C0QA 2QJTA 2QR3A 4XYMA 4J94A 5GZ6A 4G1UC 4DADA 4G9GA 4IQ8A 1SAYA 1MG5A 4TSKA 2I2BA 5C8ZA 4P4SB 3D5EA 1W4AA 4JJ4A 4R31A 3U39A 4LF6B 2J46A 3KHSA 1PL0A 1BEEA 1JZTA 1O96A 4GYWA 1I1QB 3U17A 3ONEA 4IG4A 1LSJA 2O5VA 5EUBA 1PCXA 1G64A 2VHUA 2ZIXB 1G4AE 3KTFA 4LBYA 4XDZA 2Y1WA 4O1MA 4QYSA 5EQJB 3OLYA 4UMVA 1QVAA 1EJ2A 2VTEA 5FLXA 1E6KA 2ODQA 4WN9B 7MHTA 2Z8YM 2BPOA 2HXGA 3PIIA 4WDRA 5AOVA 5ECDA 5BYBA 2FPPB 2PTHA 1RXUA 5AI8A 1HMYA 2AA3A 4B4DA 1YUMA 5A71A 1PNRA 1QIGA 4KR0A 4OMUA 3QTBA 5H83A 2BUCA 3BRSA 4BU1A 3ED5A 1NLFA 4GLLA 1XL1A 3FHTA 1GAJA 5EZYA 3VR2D 4BO9A 3PX2A 3HDGA 1OLSA 1XTQA 4FLEA 5DM2A 1JQBA 1DADA 2O6LA 4TROA 5GONF 3S5JA 3RIGA 4J90A 4B80A 3VKGA 4JWKA 4MA0A 1FQOA 1V45E 2QTVB 5F3DA 3GZNB 4C87A 2FG7C 5EVJA 3ASZA 2DUUA 2QENA 1J49A 3OLWA 1NURA 2RG7A 1VL2A 5AMXA 5F1OA 1R8QA 5EPOA 4ACBA 3HVJA 4Z9XA 1LV8A 4IY1A 1BXGB 3L77A 4U8GA 3WL8A 1MN6A 4M7RA 3PEFA 4MV8A 3GAZA 4ZYWA 1QCCA 1AKMA 4F9GA 1QTQA 4HRYA 1DJNA 2ZUSA 2RONA 3LKBA 3AOGA 5LN1A 4HEA6 1W5FA 1JHUA 4EA7A 3I34X 4M0DA 5E3HA 3K2IA 4RLFA 3C24A 5DNUA 2ZRNA 3FPFA 3UK1A 1R8XA 2BFBB 3QFHA 4KIGA 3KJZA 3DFIA 2Q7XA 2YNMC 3KQTA 3PHJA 3HSKA 4GAEA 4RA6B 4BGEA 1KH2A 5DV9A 4Y0AA 2R8OA 4RFLA 2A9PA 3SIPA 5CVCA 3EX7C 1A9XA 2QV7A 2IHVA 4HPJB 5LBIA 2YHUA 1PIWA 1R2QA 3TQHA 4M1TA 5GM1A 4DQUA 3PHCA 2FX3A 1R66A 1NU6A 1VKJA 3PPYA 1ZH6A 4QUAA 4PYNA 4CLXA 2PEYA 4C0HA 3R0IA 2XUPA 5I4BA 3IBCA 2AKAB 5TPZD 4KQKA 2P5TB 4JEMA 3CXRA 4N7JA 2ZQ5A 3I9KA 3PTLA 2P6RA 1FJXA 4XYLA 3BWDD 3WNBA 2AHRA 1OH5A 1YR8A 3HBFA 3DZ8A 4PFJA 4X0EA 4F8EA 1QFXA 1UQTA 4JLJA 1QAQA 5LD2C 1M6HA 3N2EA 2ST1A 1GUFA 3MINB 2NUAB 3ZWBA 1Q3KA 1T4BA 3B3FA 1P2TA 2VUIB 5H5JA 1IN4A 1Z33A 2HU8A 1UBHS 4GZ3A 1DIAA 3HU2A 1KEVA 3K5HA 1ZNWA 5FA5A 4ZIRA 5A7GA 1ENZA 1B8VA 2EBWA 3LNCA 4K9KA 3U7EB 3ROQA 3FROA 4FOLA 4YDQA 5BN1A 1TAGA 1DIRA 3K4QA 1DC8A 2HL6A 1J24A 3WLTA 1E98A 1WS6A 1JB9A 2P7IA 1NAIA 4GXNA 3BMOB 4KVFA 4URUR 1JFTA 1ZEJA 3LZDA 2EJWA 4B82A 4LC9A 1RWKA 1U99A 4KAAA 4LPKA 2VDKB 3L7LA 4QJ4A 5K3BA 3TWOA 3LWBA 1VCNA 3M34A 3MUNA 3FBGA 4F4HA 2CHGA 3EMVA 1K8QA 5CT8A 4R16A 1HFWA 2GCGA 4G0OA 3UBMA 1IQ0A 5A9RA 1IXZA 4UTXA 3DCNA 2PUTA 3OEHA 5D6NA 1KEUA 1QLWA 1HEIA 1R18A 2YZ2A 2XYGA 1HQYE 2OB1A 3O4RA 1LVGA 4HB4A 3TE6A 3OETA 3KVVA 1E2QA 2FN4A 2LPMA 1RLUA 3E2PA 4D96A 3NFYA 4CF5A 1G42A 2NQ2C 3N0WA 5EXXA 3SJ7A 5J4VA 1NX6A 1A9YA 4MYTA 5A0FA 3T7AA 3W34A 1PV4A 2AOUA 1R1DA 5E3JA 3W2FA 3VDNB 4F5DA 1F0YA 2OZEA 4S1WA 5EKDA 1C0EA 1I6WA 1Y5NA 4GOLD 4V0LA 1Y1RA 4M98A 4RDHA 3RVMA 1EINA 3Q12A 4KYVA 4Q7QA 1KU0A 1UKZA 1XU7A 3WWDA 5KO2A 3GN1A 4ZGWA 2ATXA 3TTXA 1FFSA 1SOAA 1YC2A 3O8RA 3OKFA 1EXDA 4LVCA 3GT7A 1QV7A 1NVGA 1VKNA 1BX1A 1CUFA 3EXHB 4AO8A 4X6LA 3UK7A 5GZ3A 4NXNB 1RXIA 3EY4A 3A9UA 3CSUA 1ZGCA 5HUJA 4MRVA 5DN6D 5IDXA 5FCDA 4DJEC 4MRRA 1CVRA 4BEWA 4B79A 2AKYA 3H1AA 3VDRA 3WFZA 2Z0MA 4C3UA 1I6LA 3OE1A 3FVTA 1DP4A 2DWQA 3CPHA 2EQAA 2OPBA 3WK9A 1NV8A 4EG3A 1DDIA 4D9NA 4Z4FA 2I7DA 4UTPA 3VM6A 3AR2A 4ZVSA 3S40A 5A02A 4NHEA 1PYDA 2WTUA 1FDVA 1CS0A 2WIJA 2I4IA 5JPIA 3D7RA 2PLNA 3SCZA 4E4TA 5B37A 1PSWA 1THZA 4IZIA 1MAHA 3SKVA 3RC8A 5GJBA 1T5BA 3JQBC 2O8BB 3KL2A 3QZUA 1T8UA 1YZLA 3DLHA 2C31A 3IJ5A 4EEZA 3CEJA 1E2HA 2YJTD 3QPDA 1XC7A 3WKBA 2ZAOA 2NZYA 4IUYA 1B16A 2EBUA 2EZ4A 1MEEA 2I1QA 1B6GA 1CR4A 2FWAA 2PRZA 3OIYA 4XPIA 1DX6A 4Q12A 4ZEXA 5CDTA 2NO6A 4JQSA 4JL6A 4M1YA 1NJFA 1ZC3A 2JAPA 4W1RA 4JY7A 3G0GA 3GIWA 3O8NA 3QMWA 4FMDB 3T6KA 1A8UA 4AWAA 2PUAA 4BTVA 2ZWMA 2IOFA 4WLOA 4OGKA 5AIAA 2QVZX 1W52X 4ZVQA 3CRQA 4IQ0A 4DTIA 4JB3A 3CT4A 4C08A 3ZE8A 3CVJA 4OBWA 4X45A 2VH5R 4ND2A 4CV0A 3VR3D 5LQSA 3WGKA 1GU7A 2H1IA 1L7NA 2FRDA 4W6ZA 1I2DA 2BOVA 2DPXA 3B9PA 2PZJA 5ITVA 4B2YA 3P2JA 1V4BA 4IXMA 1E7YA 2W6PA 2HX1A 3EIEA 4OQZA 4QSMA 4ZRNA 2QIOA 1SHKA 4DCPA 4OIFA 3RS8A 2C2MA 4P7BA 3S1AB 3JTMA 3THSA 3TSCA 4A4DA 4BUZA 2QYTA 1OLUA 1NIPA 3P2YA 1UFRA 1NN5A 1HT3A 2QMUA 3T3IA 3B1VA 1T1SA 4EJ2A 1TJ4A 2JD2A 1BKDR 1Z2EA 2KHZA 1KDOA 3BCHA 3DT9A 4W9RA 5DCLA 5PGMA 2ZM6B 3ZDDA 1TW2A 4CT0A 3HYLA 4X66B 4DQ0A 1HQDA 4B7XA 4LSGA 2SHKA 3CZ4A 1KK0A 4JYAB 1RCTE 4R7GA 4US1R 3GXBA 1W88B 3K6SA 5AM2A 3HXKA 1XVUA 5EAIA 1QHNA 3OH8A 1JEAA 4XI9A 3KT6A 2GCIA 4K81B 1QFYA 2QB5A 1H6CA 2VPTA 3JAKB 1S8FA 2GEBA 3RFFA 4IOKA 4C0KA 1E5LA 1N5KA 1UKEA 3UWOA 4G0MA 5B3AA 2IEAA 4BQRA 1A72A 3OZWA 4ICIA 3HKCA 1TGVA 5LC1A 3TNJA 3L93A 2FPWA 4L08A 4DQVA 2F90A 3G2NA 1YE3A 3NBKA 2WJPA 3T4PA 3O4IA 3ZC3A 3ZNOA 2B1GA 1G21E 3L7IA 3ZKWA 2C3OA 3DVLA 4NMMA 4OY3A 3RVBA 5GTDA 3OWXA 2H63A 1TUIA 3P9QA 4RPLA 3QVSA 4ZCLA 3ZCXA 1AUVA 3SSMA 3DXZA 2V0NA 4QDTA 2QY9A 3WNQA 3AGQA 1SD5A 2W6JD 1YFZA 4AUNA 3FTQA 1L7MA 1X3LA 1SQ0A 4TXMA 4B7CA 3ZJUA 2C5LA 4EKDA 4C4XA 2OCBA 3LRTA 4GM0A 4BNXA 4D9MA 5JMTA 1H0HA 4DCUA 4B4UA 5JSZB 2I54A 2ODWA 4G23A 3BXFA 1WMDA 2OV8A 4P1ZA 1I5RA 2C4HA 4RD6A 2I3DA 2RHCA 1PP4A 2GGSA 2WM2A 3MWDA 1PRYA 2ZBEA 4N7BA 1R9MA 1MF7A 4KX5A 3T15A 2HXSA 3BREA 3FKJA 2PGNA 3KEQA 1JLKA 2YV3A 2VHXA 5IT4A 2GD2A 1NU8A 1ECBA 1II0A 4FQ7A 4DMHA 1Y6RA 2I4MA 1Y4ZA 1GR1A 3IQEA 3W5UA 3A37A 2XT0A 3DZHA 4KE7A 5CTJA 4TYQA 2JGLA 2YUTA 5EXTA 2XB4A 2DR0A 5D3KA 1UMKA 3HJUA 2X9GA 4LBVA 4RPIA 4LXUA 3C5CA 2CLKB 1G8PA 1N3LA 1SCBA 4ND1A 4ZRMA 2XTJA 3EA4A 5FO0A 5EIBC 4C30A 3SR4A 3MT7A 2CD9A 4HDSB 4MR9B 3REOA 3OZXA 5A1JA 3JR7A 1VGVA 4B3BA 5JHGB 3DCYA 1LBEA 5A3QA 4NCIA 1GDHA 1TYDE 3B1KA 2GPAA 4RM2A 3NPMA 5B53A 4RK1A 5JXJA 1E61A 3WNVA 3FDXA 4HQ6A 4J4HA 4YAKA 2XUDA 2ILTA 5GGYA 2IHZA 2EFJA 2I1LA 4MVJP 2BJWA 5DBFA 5AI5A 1LPMA 4DFDA 3V1MA 2BGIA 4MW4A 4C4OA 4OIMA 4AY3A 2O3QA 4UHEA 5DZSA 1VMAA 1PJSA 3DA8A 2ORIA 3NHKA 2JBWA 2EX0A 3K30A 4KIJA 4ZQHA 4BMSA 1LZLA 2P9YA 2PBZA 3VC7A 4F12A 1H2FA 2FOLA 2NN3C 2I33A 1M1NB 1X1BA 4D4MA 5L7WA 3G9TA 1UP7A 1YRYE 4NAVA 4LVOA 1WOMA 5DP2A 5GIPE 2A5DA 2C8VA 5J9FA 2FZCA 4LCJA 1PFKA 3RYTC 2AFIA 2NUTB 3A6FA 1DQYA 4URWR 5H02A 1E2KA 4A0QA 3UMFA 1ODTC 5LIRA 1E0AA 3SBEA 2UYGA 4MIYA 4X8HA 1IAQA 1SK9A 1LLUA 4B3DA 2VPQA 2ZI7A 5GGXA 3KYDA 1N6NA 4J0DA 1Z7YA 3KVOA 4KK3A 4OMFG 4UEOA 1NW5A 4WLFA 2H52A 1JDTA 1HV8A 3IPYA 5FUBA 2NU7B 4TL7A 2M1ZA 1F0NA 2QN8A 4ZYTA 3AIOA 1V1MA 2J9YB 4D02A 4O1HA 4A8JA 1V5GA 3OT1B 3DAHA 4L5JA 1UPCA 1WY5A 3T4XA 3HO1A 3H3XA 3B1FA 4Q4JB 2N9UA 4DZZA 2CEAA 2ONJA 1E3TA 1QNFA 2P2DA 4LW8A 2J5QA 3TJRA 1O9HA 1T3SA 3DG9A 3U56A 1JYSA 1YL5A 4RL6A 1UBUS 1YMUA 2R8EA 1EVIA 1PV2A 5CDYA 5AVUA 3I3OA 2FFQA 1HSOA 2FZWA 4QDUA 2Q0SA 5DO9A 3ZEIA 3SVLA 4FHGA 4RTPA 3U3MA 4M49A 1NBMA 1O6CA 3DKRA 4BZXA 4C7VA 4U7PB 3RRNA 5U9CA 1OT3A 1E77A 2HO4A 2P9ZA 4ZZ3A 3EVBA 4CKCA 2W6ID 2YY5A 2GN4A 3R76A 4BO4A 4UU0A 5HOQA 3AGPA 1UP6A 1R9JA 2PFSA 2V7PA 1EVZA 2VYFA 2WUGA 2ZRPA 2WIGA 2Z2KA 4G2TA 1M6VB 4HDMB 1IEXA 2Q8NA 4PS0A 1RQLA 2N42A 3D0KA 3EAFA 3A2MA 4NOLA 4FNGA 3GFPA 2P6NA 2WZBA 4EPVA 4WBNA 3BJMA 5C35A 3VSDA 3DFFA 1RYHA 2JZOA 2Y1LA 2CUZA 4F4CA 4HL6A 4MOWA 5EZQA 2O3TA 3FCOA 4KPYA 2LIPA 3GMSA 1QUFA 5TR9A 3PQFA 3VHQA 3EZ9A 1V3VA 4HZUA 4I81A 4JI6B 1GPLA 1BD3A 4ED9A 3PEEA 4C6RA 3WRYA 4KH0A 3HP1A 4JJKA 1PHRA 2AG1A 4K28A 4MTCA 2P30A 2DG2A 3O94A 3FNHA 3AK4A 5IBCA 4B73A 2YBDA 5IJ9A 1YJXA 4ARCA 3B8HA 3T7RA 1XXLA 3GEPA 4KXXA 4MKXA 2OPHA 4AN4A 4AG3A 1JSZA 2E49A 4R6XA 3IDSA 5LQUA 1UXOA 3EIFA 4QTZA 4AU1A 4BLUA 2JG3A 3NETA 3FUCA 3HR4A 2AWOA 1EQ2A 5FBLB 2GX6A 2FR0A 2RKWA 4S12A 1WQ3A 5IC4A 2J0QA 3NHBA 3Q10A 5ARBA 4I3HA 3QVOA 1RMYA 5B3LA 1A95A 4IW3B 2XB2A 3VTAA 3HVIA 3L6RA 2E0IA 1KKMA 1KRHA 4TX1A 3PUXA 2FQWA 4OQNA 3PQDA 1YIAA 1XVAA 3H5AA 2WTBA 1ZGZA 2OENG 5M5BA 1GAQA 4Y6LA 1PHPA 5LYYA 3BULA 3FKSD 1EE9A 3QUCA 4K9DA 4G0ZA 1A97A 2C9CA 3LT1A 2ZS8A 1Z0UA 2ZPAA 3PJDA 3PT9A 3DOIA 1FFGA 4G1VA 5IAJA 1J39A 1KI4A 1N6PA 3K0AB 4ZMSA 3PUYA 4H4DA 4MHTA 2P0EA 4CQLB 1FXSA 1ZGJA 2A84A 4BFYA 2WM3A 1QO7A 2IGTA 4K46A 2P77A 4TQGA 2D59A 1RLTA 3OLXA 1E3QA 3MCZA 3UUGA 4TTTS 3O9ZA 1KETA 4HDRB 4Q1CA 1ZIPA 5AYVA 3SGLA 1E0SA 3TRJA 1KH1A 3L4BA 5NLLA 3H2IA 3K0EA 1W85A 3QPAA 2JFHA 2MINB 4O2AB 1KMMA 1U4SA 1Q1NA 1ZM4A 2XEDA 4CTNA 4IV0A 1GZ3A 2NUBA 2FMUA 2QE7A 1T9BA 3P0FA 3I39X 3JAWB 5CNMA 2FW6A 1I6MA 3T7TA 4C0WA 2VTBA 1HNWB 4BQEA 3F67A 4ZZ0A 5LJIA 3L04A 1NUQA 3FIUA 2QVXX 4HI0E 3UMSA 1FBNA 3MWGA 4KMMA 3FHJA 5FWXB 1AK2A 4YJ2A 4IIHA 3GP3A 4AZWA 5M2QA 1NTRA 2TS1A 3LBYA 2RGAA 3GFRA 2QAIA 3CLKA 1GXSB 2XITA 4UMDA 5HIJA 3R41A 4AMVA 1EWTA 4DDHA 4WNIA 3RT9A 2QORA 1KMHB 4AJLA 1NQ5A 5KNDD 2A78A 5KX5A 1NLYA 2GNPA 1N6IA 2OOSA 5CFOA 3BXPA 3PHGA 2WOOA 1VMEA 5F1KA 1RWPA 3ZTYA 4I5IA 1QP8A 2KPOA 5A03A 3PA8A 4F8JA 1H6DA 2QTRA 5L3QA 1E3MA 1RPAA 2P91A 1J8DA 3DVRX 4CU5A 3I2JA 4F21A 2FUNB 4EPTA 4EO7A 3P94A 5FT9A 2P7HA 4OSOA 2Q4EA 3PXGA 5JALA 4KWTA 1Z63A 3OM1A 3LCJA 3NR2A 1RYNA 3SFVA 5AVTA 2W2XA 2YRWA 5JUWA 1YGYA 1M34B 2NP6A 1UXIA 1EX9A 1U0TA 1UWLA 3TO5A 1VXOA 1JAHA 1OXBB 2H6EA 2REXB 2ES4A 1MO3A 3BJRA 3KLMX 4ND8B 5EJ7A 5FEMA 5KHOC 4G5SA 1ILEA 4H1UA 3UV7A 3C1TA 1NATA 3CRRA 1JKIA 4I1IA 3NOQA 3ICOA 4MKRA 2PT9A 3D4PA 3IO5A 4XSGA 4FC6A 1KI8A 5TSDA 5GINE 1QQ6A 1ODIA 2CXOA 3KB6A 3VNQA 1PR5A 2O20A 1DINA 2F55A 2REQB 2R1ZA 5TEVA 5KNLA 1X9GA 2L69A 3IKLA 4RTLA 1ZOOA 2FRDC 3KJHA 1N7HA 3QXCA 5FBWB 2C58A 3PVZA 4NV3A 2VQDA 4XGNA 2BFCB 4RMHA 1Z8HA 3L0OA 4ZMRA 1QQ7A 3WLFA 5J47A 5DM70 3GRZA 4JJFA 3KZNA 5DCYA 4BLQA 3DOFA 5B3KA 2J7KA 9ABPA 1XZHA 2ZIAA 1C3JA 3IRUA 2CXXA 3CPJB 4ZOAA 2C95A 4OYRA 5LVAA 1C14A 3E27A 4XE5A 3AEUB 1ZXLA 4YR7A 1EFRD 2W2OA 3GDGA 2XUGA 1YQWA 4M0UA 4TVOA 4YPFA 1DS6A 2R7NA 1D2MA 4OAQA 2YASA 4HGYA 1WPXA 4R6WA 3U13A 1F3OA 1VJRA 4Y2JA 4G4SO 4IDAA 3SEFA 2GI4A 4GE3A 4DC9A 1IZ8A 1G2IA 3MWJA 4Z4CA 5FQOA 1MBZA 4EQ6A 3G2OA 1OAKA 4F2GA 5KB3A 4NYIR 4DG9A 1G55A 2EKBA 2PZMA 3ISJA 3MTEA 4K2AA 3R23A 1NF3A 4H27A 1Y4UA 3WB2A 3WJAA 3W77A 4RU1A 2O1SA 1T0JB 4BRZA 4C4AA 5LLDA 3PITA 4B3SB 3R0ZA 4Y1FA 2FMTA 2UZ4A 3GMIA 3IKVA 4OP3A 3WE7A 5D1HA 3M6VA 2BI4A 4YMGA 1NI4B 2NVUB 5IFKA 2PX6A 3ESQA 3LY7A 1J1UA 1JQJC 1P9NA 2ZVQX 3Q15C 4A1FA 2QZ4A 1ZJWA 2HCRA 1KEZA 3E3OA 4NULA 3DZKA 3PJEA 5DNYB 2P1DA 1T4MA 2VZEA 4PVDA 3CMCO 3GF4A 3O26A 3O8OB 4B6QA 5E4YA 3TIFA 5KWVA 3U9TA 1LDBA 1TTHA 3AI3A 2VZ9A 3VO9A 1N8SA 4YDHB 1MDBA 4LGVA 2ODBA 3A4VA 2NVOA 1XRJA 1FJGB 1G291 1J7JA 1E32A 2OLEA 2V3WA 4GM4A 4TT8A 3R7LA 1SEVA 2QIPA 1UQRA 5FOUA 1AO0A 3MIIA 1DO8A 3GLTA 4H1TA 4FMDF 1IZYA 1J99A 2Z4TA 4RAQA 3M5WA 3PC7A 3RR2A 3RROA 4ENSA 4TUYB 5MFPA 5C32A 5IANA 3PIDA 2PSDA 5AOBA 3E0XA 3NT4A 4J2TA 3AP1A 4MA4A 2JLUA 3AY0A 3KKOA 4DEXA 2YKGA 3LVBA 3SS9X 2G1UA 3K9WA 5C3MA 1T0IA 1ZK0A 2F62A 4MQBA 2DSTA 5DEOA 3RTAA 4JLBA 4F5WA 2JH8A 4LDZA 4TQAA 4CT5A 5SY9A 1VLLA 3VZCA 5LP6A 1TLLA 3O7WA 3TUJC 2I67A 4RLHA 4V3BA 2SCUB 4E5YA 4I08A 4FK8A 2DY1A 1YIDA 3SQWA 3L18A 3R20A 1F38A 2E1RA 1G8MA 3JQ6A 1AN9A 2Q1UA 4UULA 4WXEA 1AXRA 1ZCZA 2FMKA 2O3RA 1R5OA 2AE1A 3KQYA 4JR1A 1DKPA 3AVVA 5AR1A 3AETB 4KLNA 3B51X 4C3OB 4D82A 4MJ7A 3MELA 4N0EA 3C6YA 2WFMA 1I3NA 2ZBDA 1SHJA 1JUDA 3NBFA 2QRKA 4V38A 5JO0A 1JJFA 3Q2IA 4YCLA 3JATA 3V7NA 1BQEA 1MAUA 1Y9JA 2VHWA 5GY7A 3T7KA 3V9AA 2F1RA 2XA9A 2XBUA 3VUEA 1YR1A 5G1PA 4ZOCA 1TF5A 1SC6A 1HM5A 4BLPA 4OTZA 4YXWD 3HPRA 1VJTA 1YDEA 3T3NA 2IELA 2QLNA 3M9LA 4JITA 4NNPA 4ROTA 4XWAA 1DQPA 2HBQA 4EHBA 2CJWA 2XR1A 2BVNA 2HMTA 1BO6A 2VO1A 3DB1A 4MS4B 4XW2A 3WSVA 1DTSA 2KS6A 4AKTA 3T5AA 1T5SA 2ZB2A 5TGTA 4H3KB 4NQRA 1XCLA 3EEBA 4BBAA 1J2EA 2GZMA 4QYTA 4EJMA 5CLQA 1KGSA 4AUMA 1UMCA 3MJFA 1GPBA 5BQOA 4CMCA 1PFGA 2HEGA 2XCSB 1B43A 4DV2B 4YRAA 3BCSA 1JR3A 4BNYA 1D8AA 5BXYA 5I7RA 1OHHA 4ZPXA 4XUDA 1KMQA 4JBWA 4BCDA 3DBHB 1PTJC 3ZHVA 2QSUA 3DTVB 2RKBA 3ADDA 1W581 3ASUA 1V9LA 2P3OA 2XRMA 4B75A 1U1DA 3MMPA 4LYGA 1XWFA 2JFZA 1I5OA 3CWZA 2FDCA 3AEXA 2AMLA 4DT1A 1T8SA 4OPMA 1KZ1A 2R7LA 2H9AA 1ZKDA 2CFTA 3SIRA 2CMKA 3GCDA 4EABA 4CMAA 1G3IA 1N2CB 1QMPA 5LDGA 3E7WA 4MRAA 4Q1DA 4JEIA 3I83A 4R2KA 2G1PA 1XK7A 4KR3A 5IZCA 1JEEA 1XTKA 2OO7A 3RS7A 2I3GA 3LBIA 4GPIB 1H2BA 2O1WA 4BB9A 4PLYA 3TLMA 3I73A 3WLRA 5D84A 1Y1PA 4NCNA 2HWXA 1V8FA 4G0PA 3R3YA 1N2HA 2B8WA 3PKZA 4FFVA 4P0QB 1JHZA 1J56A 1J0XO 2SKCA 4MROA 2HQSA 3QE2A 4TOIA 4TZKA 4YREA 4IH4A 2LP4Y 1DT3A 3EE6A 1AGRA 2LZ0A 1CJKC 1ZGGA 4R8RA 3IIKA 5FNZA 2I9KA 1J1IA 3O03A 4A0RA 2C57A 1XDWA 4ER5A 3C70A 1FYWA 3Q7RA 3WLQA 3BBLA 3KKNA 2CVQA 3N2NA 3K4PA 3QFRA 2HK9A 4URHA 4Q7KA 2V5UA 2VJOA 2AXEA 2RHMA 1BRTA 2Q5LA 2WE8A 1T43A 4FHDA 4JLUA 5BWLA 1VKZA 2WJAA 4E70A 4UM9D 3NJ4A 1RR6A 3CRMA 1P5FA 4N6NA 5AOAA 3FTCA 3IVXA 3SFTA 1VI5A 1YULA 3WRYC 2XVAA 3TGLA 2H2AA 4WOBA 3PE4A 2BZGA 1C3VA 5E95A 3QPCA 4G63A 1RTTA 2ZTHA 4DR3B 3BA1A 1N0HA 2BKXA 2D2VA 2J85A 3RTGA 1E7RA 4MPDA 1DOZA 3R4VA 1G66A 2YHIA 4XIGS 2QTWB 4RQUA 4I1RA 1VG0B 2IPOA 1OJ7A 3HFRA 3KSAC 4P8RA 1QHEA 1X8XA 2VCYA 1N2JA 2FVYA 4TVBA 1SPXA 5FKJA 2A0FA 4P3XA 1XV5A 4MUNA 4D8UA 5F35A 4TZTA 4ESOA 2X8AA 2O52A 2OCYC 3OPYI 2QSJA 3QPBA 4WI1A 1R0BA 3AYXB 4DDWA 1S3SA 4FBLA 3C3CA 4I50A 4L8WB 4PIMA 1L4KA 5AXDA 3SZ3A 1K2VN 5HBRA 2Q9BA 2D74A 3VHXB 4J75A 2E2WA 4I8IA 1E6WA 4LWOA 1TAQA 1Z7WA 1ZN7A 2EOAA 1L3CA 2YOHA 3RBZA 2OUIA 4NMHA 5TPWA 3O5AA 4IX1A 1XVVA 2VK4A 4QEZA 1XRLA 1HI9A 2AZTA 1IVNA 3Q3EA 2B1RA 4KFRA 2QGFA 3I0NA 1JBKA 3I76A 4HVAA 1XZLA 2IL1A 4M1WA 1YNOA 2QZ9A 1XTIA 2R6CA 2WABA 4OH7A 5A9SB 1XTVA 5J2UB 4XIJA 3Q6NA 4LXIA 3MD0A 4R1PA 3SHOA 1QR2A 3KPWA 3KYCA 1Z0KA 4OQXA 4OXYA 4CM8A 4PQFA 3CM0A 3K70C 2IYEA 1KJZA 3WS7A 1E18A 2GJ9A 4KQFA 3N3AC 3ESXA 4DARA 1EUDB 3GFSA 3PA6A 3LECA 2YYYA 2Y1KA 4B76A 1Y3HA 1V96A 4GF5A 4ARBA 2BDTA 2OUKA 4O4JA 5P21A 4X62B 1YS6A 3QF4B 3Q8MA 4N76A 4KDCA 4XIYA 1TX4B 3OIUA 4G89A 4UUNA 4C0JA 2WSYB 1BWSA 1ZHHA 2PAAA 2WW8A 2QTNA 1EFKA 2DTDA 4W5TA 4KR2A 4DUZB 2FN7A 3EPPA 4OFZA 4K6KA 1G9SA 4AMYA 5A1TA 1G8AA 3DEIA 3ROTA 4YVFA 1X80A 2C3YA 3ZDEA 3QVWA 4N5NA 2R65A 2I1WA 2X2FA 1YRAA 3L06A 3L7JA 5DHTA 3W79A 5HYVA 2QTBA 2RD2A 1AXGA 4J1TA 2WM8A 1DUSA 3NGMA 5J40A 5E6RB 4Y9TA 2IA5A 1UF9A 3H6KA 4G8CA 4D57A 2OHVA 3G0DA 1CQJA 1P4SA 4W9NC 3AUYA 2VHTA 1H3FA 4Z3DA 4JOBA 2XZDA 4M7WA 2MSKA 1L5FA 2F7SA 2MWMA 2GYYA 3QQ5A 5HCIA 1I7SB 1OI4A 2XI4A 4EB6A 1M83A 4LXQA 3BXHA 2PKQO 3CISA 3HB0A 2YH2A 4DB2A 4GGMX 2HCJB 3NH6A 1G4HA 2BL4A 5AJTA 2H51A 4GLJA 1LLDA 3QFCA 2YVQA 5H3CA 3OESA 1TZ2A 2ZRAA 2W6NA 1LEHA 2CDNA 3I58A 1NXWA 4I4CA 1GTZA 3VZPA 1ADBA 3B3JA 4V0SA 1IRIA 2ID4A 5DBEX 5HRAA 1CJVC 1YBHA 4RV9A 1ZGHA 3WVNA 1ETHA 2Y1XA 4DDVA 2BFEB 1JJAA 5DH9A 3X0DA 1PJLA 1U6JA 2ODPA 2OXIA 2JGMA 5I3CA 1N77A 1XLWA 3AZQA 4KQGA 2IV3A 3SEAA 1CUHA 4INAA 4MAMA 3VDMA 4QUHA 5CR9A 3BH7A 4FXOA 1DAKA 3O2JA 4R8LA 3KKPA 3BHJA 4L78A 4L8FA 1GEGA 1OXKB 4EY6A 1E9SA 3HN6A 621PA 4P9NA 4BXOA 3VNVA 5BPHA 2ATVA 1N2SA 4G8BA 4HQFA 4JIGA 4R1SA 2VQFB 1IULA 5AHRA 1GZ4A 1BC5A 4C0LA 1QV6A 2CL0X 3OFKA 4URZR 1OTXA 1ZESA 2VPYA 1P0FA 3U49A 1P2SA 4LISA 3W8DA 5DYYA 4V0RA 4P33A 3QBDA 1U90A 4FFRA 1FU8A 1KOFA 1MPXA 2QTLA 3MJDA 3PR1A 3PXEA 2R85A 4TMKA 3SF8A 1MNAA 1VP3A 4AZVA 2C4UA 3RSGA 2BR4A 3GELA 2IBMA 1A8HA 3EZFA 1DHRA 3FZEA 4NS1A 3RGGA 3IUQA 5AM5A 1ZCFA 4ZOEA 3ZLBA 2B34A 2BHSA 2XWJI 4IBOA 3CNBA 1DG9A 4I6EA 4LDAA 3QI2A 1ODCA 2V5AA 3FBTA 1QBGA 3LQFA 5TXGA 1DDGA 2WWXA 3FCSB 4NU8X 4CM1A 5BW6B 5L9AA 3AKZA 3L8MA 4LPSA 4LJ6A 2J0SA 1W5AA 2Y0CA 4PSKA 4ENRA 2XUHA 3IEUA 4X92A 2C5EA 3WYAA 3JQAB 2HQRA 4CWAA 1NYLA 4J9UE 4O2AF 5ER9A 4CQMD 5KTYA 3TDMA 1SXJB 1OUMA 1Y37A 5A5FA 4Z7JA 5FULA 1CZOA 1SH7A 1EFPA 3N2KB 2C8JA 2BEVB 4HVCA 1TT5B 5K3DA 3HMQA 4UPDA 4MMYB 1Z35A 4B0OA 4QT0A 2YFQA 1V3UA 2WUVA 1QZTA 1Q1AA 2Q3LA 5JAOA 4FFPA 3E22A 5JATA 1XLTC 2OBYA 4RZSA 4P3PA 4F9EA 3CF2A 4OUDA 4CKBA 2GXQA 3VH2A 1IJBA 4E5KA 1LSOA 1G9XA 4BDSA 4Z5XA 5JH7A 2IK8A 1E1RD 3SD7A 1IHXA 1YZKA 4B5KA 2AQHA 1MQSA 2XNSA 1X19A 3WIEA 4KI7A 1QYWA 1C7RA 5ICEA 3U0BA 6REQA 3P9YA 1AKUA 4AWXA 4N01A 4RSGA 3OQBA 4Q34A 3WX0A 2B2CA 1X92A 3UHJA 4AZ0A 2ZJOA 3GJZA 4FIDA 4OJMX 4CV1A 3P2OA 5AWFC 5K6AA 4RIIA 2O5EA 1ZRMA 4M1QA 5JAPA 1E2IA 3KCNA 1Z39A 5AKJA 1KJ9A 1PNVA 4GKKB 3IT3A 2UVDA 2G36A 1V11A 2H8KA 3OLQA 4MW5A 1SUWA 5D87A 1ONOA 5DK4A 3TZEA 2W8BB 3UXEA 2POCA 4H3SA 4I1SA 4WESB 3VPAA 1TK2A 2OFXA 1OIVA 2I2DA 3DLTA 4OAPA 4BX8A 4CM7A 4F2PA 4IIDA 3FNIA 1NYQA 3S7TA 1I2AA 1Z6PA 3SXUB 1GKUB 3F6RA 2IVFA 4R1OA 3OMWA 3RRZA 1P4GA 2EEPA 3NYWA 4OK5A 2IH4A 5F5LA 3PZRA 2AJCA 1HEUA 2Q2OA 2AG5A 3NVMB 1C4WA 3JALA 5EESA 3DMHA 4N40A 2G4CA 5K01A 1JG6A 3FYCA 1T3HA 3RJZA 1WMBA 2C3MA 1OIWA 1YL6A 2JA1A 2W2MA 3K09A 2IH5A 4IR7A 4I9FA 2F00A 4DCMA 3KBBA 1EHYA 3PUIA 1XA4A 3OFVA 4EFNA 5A4KA 3G2LA 1RAHA 1VB5A 3BFPA 4HO1X 2GJ8A 3P2EA 4UC0A 1N25A 1ECCA 3U3KA 1VHWA 2PS3A 2DY0A 4ZWNA 1IY8A 4ML3A 4E4RA 1MO4A 1Y3DE 2VRWA 3CZCA 2JJMA 4X44A 2Q0QA 3IC5A 4YUZA 4NFSA 3S44A 4K26A 5IMBA 3IH5A 3NP7A 4S1TA 3IA2A 1V3QE 3EIWA 4INZA 3C8UA 1GQQA 1UKAA 1KJYA 2V03A 3E5RA 3JTEA 4NCJA 3M9WA 2DPHA 4REOA 4S1VA 4XOIA 4QGSA 1K89A 1WSDA 4HQLA 1J0BA 3PJFA 3V2HA 2PX5A 3GLUA 1K27A 2BT4A 3X1JA 4UNIA 2GM4A 5BNFA 4RK0A 5K3EA 5KNBA 1HDOA 3GDFA 4LOIA 4NZPA 1H8HD 2MR5A 2HSWA 4RD0A 2ZREA 3ZWKA 4PCLA 3V4RA 1A2QA 1QKIA 1DL5A 3EGXA 5FH9A 3R2JA 3ZIAA 3CLRD 2ECOA 4BB6A 1X8LA 3A26A 4N8EA 3BZWA 1C29B 4FFMA 2M6LA 1AMNA 2JAHA 3H8JA 2FXIA 4M21A 2HMWA 4P3NA 5CT9A 3D54D 5AK0A 5KYNA 2GJ4A 1YWGO 1E3JA 2NW6A 3WQHA 1JVNA 3WICA 2G0AA 1UDBA 1VHLA 2PKXA 1RZ3A 2VNIA 2Z1DA 4F71A 5DX0A 1EVEA 1D2HA 3OPXA 4Q7MB 3UXHA 2C3UA 2AJBA 3HZOA 2YZKA 3KOUA 5B3JA 3WYGA 1YBVA 1I9GA 2LIVA 4BP8A 3K9HA 2EJTA 5D85A 1AU9A 1WPRA 2DWPA 1KPHA 2C88A 2YV1A 5DASA 5THXA 3Q8LA 2QBYA 1WUKS 3K1AA 4OL9A 4CL8A 1O94D 2QP4A 1ZHFA 1OVGA 3OP4A 3RBVA 3VR1A 4YY3B 3AHJA 3OC0A 1IOWA 3DTNA 3VPFA 1OZGA 3GH3A 4KFUA 2N1MA 3HP4A 4QOJA 3VYSB 3HRHA 2IH2A 1J2JA 1VB3A 4JBIA 2FJUA 4YV1A 1NF8A 5EJ8A 4UQPA 1JIIA 1S1CA 3W2HA 2HA5A 1UJ4A 5JECA 4G5GA 3C3PA 1B00A 1O0BA 3BD7A 1MFZA 3VXKA 4IHJA 4DIBA 5IZCC 1BHQ1 3GWGA 5D2CA 1MRNA 2NT4A 1ZNQO 3GOHA 1JHQA 4P22A 4N18A 2WNSA 2YMPA 3DNPA 3EXIB 3GGDA 3N2GB 3EVAA 4PRYA 1HFEL 4GLFA 2OC4A 5EC8A 4TUYF 2X5OA 1T4CA 1UBLS 1CDZA 1C9EA 2A4KA 2ZAYA 1ORTA 2GXSA 3CRNA 3N7TA 3DDSA 3EGEA 3UHAA 2PJRA 2IF0A 1QOZA 4FFOA 3B6IA 1J23A 5IM5A 4O02B 3RJMA 3V8EA 3IAS1 3JYPA 4QBTA 4PIVA 1BA2A 1NVMB 4ER6A 5COAA 1PYGA 5KC8A 3GJQA 4IS3A 5ENZA 3A3PA 1VTKA 2IX9A 1EYZA 3BJZA 3OX1A 4FGSA 1TCBA 1UJ2A 3DE3X 2OL4A 4DANA 3IB3A 4L4UA 4WFQA 4CE6A 1N6KA 2C99A 1TO6A 3QPWA 4KOEC 2R6AA 2Q7OE 1KVQA 2QN3A 1QCYA 4AF7A 2PS9A 5GWXA 3PTAA 2WJWA 3WGYA 2XMCA 1TU4A 2B8NA 4BNWA 4V1CA 3U37A 4GICA 2RHRA 3RU9A 3CCFA 1E3WA 3CKYA 5IAKA 2HRZA 2Z08A 3KC2A 3PYXA 3BRQA 3KZCA 4EI9A 3ND6A 3SEQA 2HRDA 4BFCA 1U8UA 1QTIA 4MUKA 4YJGB 2UVQA 1HDCA 3PSAA 4LIPD 4YJFA 1HDEA 2FPIA 4L50A 3AZOA 1XMIA 2P11A 3FI9A 9LDTA 3NKLA 1V7PC 2L42A 5B6IA 4RMGA 1DX4A 4OGWA 2MT9A 4OQDA 3W7BA 1UBCA 3FZNA 2YVUA 2B9VA 4XFJA 4P7KA 1TRHA 4KUEA 2HDHA 4R0VA 3ZGOA 2RE8A 3RYFB 3D6FA 2YL2A 3TR6A 4DLUA 1DJPA 1E2NA 2C59A 4LX0A 4NZZA 4WIAA 5DNWA 3UQZA 4A0HA 1HMPA 1RIIA 2HJWA 2E18A 4ZQBA 5LCXA 2PBFA 4JQZA 3V9PA 1F2DA 2R5WA 4DMCA 2XA2A 3OCWA 5HP4A 3L46A 3OJWA 4IEFB 1NN1A 3IP8A 1BH6A 3ZVLA 4JWTA 4AP5A 4BGVA 4DYHA 5CX1B 2GM3A 2QYHA 4D43A 3PFFA 1EK1A 2GS9A 2ACWA 3DR3A 3TH5A 1R50A 4QUGA 4JZYA 1QYDA 4OATA 5ENDA 2BSAA 3VNAA 3I64A 4CKEB 2P9GA 3TZHA 3EXFA 3NM6B 5C7YA 2PU5A 1E2GA 3IRVA 2NO4A 3KQPA 4RD2A 1GQSA 4QLBA 2X0NA 3QWIA 4M8KA 1LA2A 3F6PA 1UMDB 2YWJA 2XB9A 3H11B 5TDHA 4OKIA 4ZQIA 4WXYB 5ALWA 3N3BC 1U8CB 3ETHA 1ZK1A 4ZZ2A 1X86B 1ISIA 2NLOA 4PNHA 2VEDA 3EEIA 4JFAA 4RZ3A 1GLVA 1N1DA 4RJLA 3GJ0A 3RTCA 2BELA 4MO2A 4RZXA 5FR1A 3ER8A 2A3NA 5CLGA 1KAGA 2RCYA 1HG0A 2Q6LA 3OJEA 4R8KA 3UJ9A 2A5YB 1L5HA 2B4YA 2HGZA 2WWFA 3AEQB 4BTEA 1VJ0A 4X1OA 4UU8A 1FRFS 1GKKA 4RF4A 1TYEB 1SHLA 3WYDA 4A2CA 4OB8A 4M9XA 4DLAA 1YZYA 4P31A 1NOKA 1VYTA 2H9IA 2P9TA 4BMPB 2V7QA 5A4JA 3EQ9A 3ZU2A 2FWNA 2PWAA 3U4IA 5HQ3A 1IZ9A 4PGHA 2XXJA 4RTQA 3K3PA 3PB3A 4D46A 4ZCMA 4NFLA 2Q5JA 1JDUA 2SICE 3DC2A 3G1WA 4XA8A 4J1TC 1PS0A 1JKMA 1NVWQ 1NBEA 3I61A 1Z07A 2A1TS 1IK6A 1K0UA 4HNHA 3PE6A 3O4GA 1T3GA 3UUWA 4PAQA 1C3XA 5NULA 2HCTA 2VHJA 2X19A 2HRBA 3K1YA 4R2MA 2GSWA 3FOWA 3GX1A 4B3HA 1WTCA 3PQ7A 4J16A 4QRDA 4TTPA 2G8NA 2MDTA 2RH4A 4Z99A 5FFMA 3TN7A 1RAIA 2O5RA 4JHLA 5F2KA 4KUGA 3D2AA 1JHAA 3IFSA 4MTLA 5ES3A 3PG5A 3IAFA 5F7OA 2JFPA 4TS1A 2A67A 4QO8A 1T26A 1HZZA 4MVWA 1VCIA 1DFGA 2WZCA 2YY7A 4KQMA 4MRNA 5EP4A 2Z6UA 4E46A 2HA2A 2O06A 3PFGA 4R01A 1AUPA 4AY4A 2QL5A 1YT5A 5B6PA 5BR4A 4E5SA 4GPEA 2CFIA 4B85A 4Q4CA 1WCWA 2VQ6A 3I6ZA 3RKUA 1DJLA 2JAQA 5E6SA 3WJ7A 4CHGA 3DE6X 1EWKA 4EB8A 5ICSA 3EEOA 2D1TA 2IHYA 4S0XA 4OEHA 1OTHA 2HRQA 3Q7QA 3S70A 1PSDA 3NBUA 2ERYA 3P97A 1L5YA 3I12A 5BN4B 2O1XA 3TRHA 4DM4A 5IHPA 4HMOA 3L8CA 16PKA 4AJJA 2XKBA 2ZBRA 4CM4B 3ABRB 2C2BA 3EC1A 4HDAA 4OAOA 5HDQA 4CCYA 4EW1A 1DJQA 1NHGA 3EXG2 3FCAA 3A11A 3O38A 4NQZA 5JYDA 1CJSA 2EGGA 3ET5A 3I6BA 3KJGA 5DNVA 3PS9A 1CNFA 1FL9A 1E2EA 2P5SA 2GVZC 4QXOA 3TRKA 1DCFA 2WE7A 4DIKA 4EMTA 4YRQA 1JHMA 1Q91A 3QKRB 4Y2HA 4XD7A 2XXBA 2ETVA 4UEJA 1JV2B 1X0XA 4B9AA 2A5GA 4HNRA 6GPBA 4KO8A 1ZR2A 2QYSA 3W4KA 5ULLA 3UGTA 4M4SA 4ER7A 4YRKA 4KHPB 3M3PA 2FJ0A 1UZMA 2NU6A 1K4MA 3G6KA 5J2UF 3C87A 1WZIA 1VBKA 1ESEA 4PV7A 1BVUA 5LWHA 3M33A 1WMAA 5ADVA 3EVCA 3I6IA 4UM9B 2FPUA 3OEYA 5JJIA 1PR2A 5KQLA 1GZVA 5HKBA 3P19A 4B48A 1E1CA 4RZUA 3CX6A 2X9QA 4KACA 1FP4A 3KALA 4H1HA 4R9SA 1WXIA 1EUCB 4EYKA 2BP7B 3A1CA 1SKAA 5CCDA 2J07A 4NL4H 3MWEB 2A33A 2W83A 2ASEA 5F98A 3ZX4A 4BIIA 5F23A 4CF3A 1VA4A 1Z29A 2XYQA 4YRGA 2DFTA 2JBHA 3W6NA 2NPIA 4WERA 4GMDA 4INJA 5FBZA 2OVFA 2BW0A 2JFOA 4C5BA 4P6VF 2PUEA 1JG4A 4LZZA 1CEEA 1GA1A 3W8EA 3AXTA 4YO8A 3W05A 3OKAA 4IHKA 5KJ6A 1YS4A 1SZPA 4Z1OA 4QC2A 2J0UB 4D3SA 2XQJA 2Y2UA 3AB8A 1JI3A 1MQAA 3HJNA 4ASUD 3RV3A 3H2JA 3D4OA 2H18A 3EFHA 2GUGA 3SX0A 3KHKA 4QODA 3RYHB 3G1TA 2W6ZA 4LDRA 3UZUA 4C22A 4XARA 2YC4C 1YK1A 1Z17A 3QEMA 4HTFA 3C39A 1Z28A 1UJ5A 1Z4PX 4ACAA 3NNSA 3P2MA 1R0LA 5EZYB 1VE3A 3UKOA 1NX9A 4QD3A 2OMEA 4MCJA 1UAGA 2X2OA 1LNZA 4UEWA 4EBFA 1NVAA 4ZV4A 1JQKA 2RBKA 1J5EB 1GGFA 4BLWA 1U1FA 5K8JB 3TIXB 4OU4A 4AKGA 4K8OA 4CMJA 5K6AC 2ZE7A 3QX3A 2DGDA 2F67A 3DP9A 4ZTZB 2BFAA 4IDDA 5JS6A 1D7AA 2X58A 1MU0A 1U28A 2M2IA 4FI3C 5LQCA 3IEVA 1TZJA 4H6PA 3RRXA 3H75A 4G85A 3TQTA 3SKXA 4B6PA 4YWJA 4CQJA 4EITA 3D3WA 1W36D 2CCKA 3CWCA 1I1HA 2GILA 4NOKA 3F3KA 2VSOA 2JIMA 1JDBB 1HRDA 4D98A 2IE8A 3EYWA 3I6MA 4BKMA 4DA8A 1N2ZA 5LOVF 3X1MA 2WV9A 4OHVA 2G82A 2P6UA 1MC5A 1NI5A 2C1XA 3UT5B 3R0JA 1SCJA 3RRBA 5B55A 3R5HA 1FW8A 2W2LA 1P1FA 4U2BA 3IOMA 1KWKA 2ZTSA 1RMTA 2DFNA 4XSVA 1NXVA 2RGUA 3I5XA 1G0NA 3EIQA 1NJ8A 4D5EA 3ABSB 1RYFA 2DFVA 2E3JA 2J3KA 3FNRA 3L8EA 3ZGLA 5BOSB 4CUKA 2JLBA 4UZSA 4LKRA 2EXXA 4F11A 3PNPA 2CXUA 4IF6A 1Z74A 3SM3A 1Y8AA 3GARA 3MF4A 4V0QA 1CE8A 4RKFA 13PKA 2BIFA 1E3SA 1Z73A 3GGGA 3OEED 5JVDB 4WKOA 5KREA 5KBYA 3IALA 4H6XA 1JBQA 4PZ9A 1G8YA 1JR2A 1D2NA 2BKAA 1FRVA 3LTEA 3D6MA 2FK7A 2IEYA 3SZRA 1NC1A 2Q6KA 5HIIA 1N7JA 5JJBA 3JWPA 4RMJA 1AS3A 5JANA 3PKIA 3LL4A 3QG5A 4DBLC 2WLTA 3GVIA 1JIJA 1LFDB 4NJOA 1QRUA 4Q3EA 5B1IA 1Y80A 3W6OA 1IUNA 5K8CA 2X76A 5CD9A 3ID6C 4ZVMA 3WSTA 1PD0A 2PO7A 3Q8KA 1O6BA 4ZDKA 1RXCA 4D0NA 1HQKA 3A4LA 3M1AA 4B4OA 1U4NA 2ZIUB 2V9ZA 2B9EA 2PLWA 1JDJA 1JHYA 3LM8A 3HN2A 3QY0A 4NBSA 5L53A 2HDOA 1SVIA 4CEHA 2GAOA 1HRKA 3O4HA 2UUPA 4LZOA 4HKTA 1TIKA 4X3OA 1MB3A 3IL2A 1AURA 3ENVA 2FKNA 3RS4A 3LC2O 4US0R 4ID9A 4LYHA 3LFHA 4ETWA 3DWIA 5BOSA 5D7BA 3U40A 4AD8A 3JZMA 1KAOA 2GT1A 2V4UA 2GPWA 4AYWA 3FHOA 5B3JC 4GRAA 2O0JA 1EP2B 4OJNA 3V48A 1Y6FA 2G7ZA 4LYEA 1UFQA 3L6UA 3LVFO 4W1QA 1PZEA 4YROA 4BQOA 4UMEA 2J5BA 5GONA 3CGWA 4UFOA 4Q4HA 4PO8A 1B1CA 1JX6A 2GKOA 1CBUA 1XNGA 2N0SA 1TMOA 1W75A 4JX8A 3S99A 3TQIA 1ANKA 5EWLA 4O29A 5TE9A 3IAM6 4IQ4A 1TUBA 3FLMA 4NRDA 1D0IA 2QQ0A 5CH3A 5AKKA 3A10A 1Z6AA 2I7VA 1X9HA 2COUA 4XTRA 3PL5A 1JQDA 1ECLA 2FSFA 3GLGE 3BEDA 3KUDA 1TCUA 3WG9A 5BORA 1NVVQ 3HLKA 3NBAA 4MLZA 4YAUA 1DAFA 4GWGA 5ELLA 2Z56A 4WKGA 1QH9A 2GARA 4XQEA 5IAOA 5A06A 1PQWA 4MV1A 4PF1A 3ASYA 4P0TA 3IHWA 3ZBTA 3ZXSA 4CG2A 5JXWA 1DHTA 3UT0A 3MCWA 4MHOA 1S4QA 2J59A 4MDFA 1E3DA 1IOZA 2XHZA 4Q03A 4DRYA 1E4YA 4PWZA 2REBA 4TKUA 3ZHOA 1SUAA 3HNOA 3JQ7B 3QE9Y 3BMQA 1SCIA 1U8FO 5DPMA 1X1QA 1Z15A 3BSFA 3T7DA 3D3NA 3IV6A 2PL3A 3B9RA 1BWQA 3IP6A 3WLEA 1I7LA 4UU7A 4EY5A 1Q7EA 2X5JO 3MSXA 4AVYA 3WGQA 4LOAA 3TLXA 1IEVA 1XMJA 1Z0DA 2NGRA 5JAZA 3GPCA 2WYWA 1BQ3A 2O2ZA 3RK1A 2PUBA 1JNXX 4AP6A 1AS0A 4M0KA 2P9FA 4L3VA 2GWHA 2Y1CA 2IXEA 2A1TR 2OXTA 3DBVO 1K98A 2YUIA 4KBGA 4LBWA 4MA5A 5BSRA 2C7VA 2I7TA 1T10A 4RHEA 1FYXA 5DXJA 3RUEA 4NEGA 2PT6A 4KMRA 4RCZA 3T9BA 4D3ZA 3OECA 1TQ4A 5D7NA 2XY4A 2KBFA 4XPIB 2FVXA 3NHUA 4XH9B 1A9OA 1O89A 3GP5A 5CVTA 2DULA 3OJXA 2XBMA 4DNXA 4OI0A 4YAIA 5CITA 2QT9A 4EKYA 1FU4A 5MDHA 3IE2A 1W19A 2MMCA 3NWBA 3I5YA 3DLBA 4ZHQB 1BJTA 1J6UA 4QOGA 1YB1A 5FAKA 1E6EA 4GO1A 3TTTA 5D3QA 2XE7A 3ZWVA 1SZJG 1XLVA 1Y34E 1JEQB 3A9TA 3EWSA 3WKEA 1XJ0A 1K7CA 4I1VA 4CFSA 4JV5B 4F97A 1J9EA 2YDYA 3WWCA 4BFWA 4CL2A 3OQOA 1N2XA 5JD5A 4QX6A 4LJSA 4AJHA 4LWQA 2IYAA 2GD0A 3R3UA 3HA7A 1ADGA 1R37A 2BH9A 5KYUA 4ZVKA 3SXPA 4QYIA 2PR2A 5ICFA 5B36A 1G3QA 4KLZA 4C0XA 4ADSG 2VDMB 3RBAA 2WWRA 2PLAA 1WB6A 1NR5A 1X7HA 1Z7GA 2L82A 3M4YA 4Y6OA 1W36B 1WXGA 1K92A 1L4FA 3G2PA 4N1AA 4RTJA 4PRZA 3MTDA 2NADA 4IFTA 5JR3A 1CY2A 4QYMA 2UVPA 2JD1A 3A05A 3WGVA 1XZIA 1INLA 4K6FA 4UBNA 4N5MA 3G5TA 2IEBA 4MW0A 4DDMA 4HB3A 3HA5A 4X7RA 2IIQA 1PK7A 1Q21A 1WSAA 3QTTA 4WZBE 3PQ5A 5AJUA 5BV0A 1BE6A 3K6SB 5JCOA 1C3OA 1AF7A 2IDJA 3Q0IA 4NMXB 4O8CA 5KYWB 4CLOA 2JHPA 3ZX5A 2EFCB 4XQ0A 3PDJA 4B6FA 5HSGA 1C1YA 2EHJA 4HB2A 3A70A 2DT5A 2QTGA 5F52A 4JI0B 4A1OA 2RH8A 1P1RA 4LWPA 4OK6A 2FWBA 1LW6E 4U0KA 2ZCVA 1J8VA 4AQDA 3S1SA 5CLFA 3QOWA 2Q28A 1P0CA 3DFZA 4QICA 1C7ZA 2WAXA 1Z2DA 1Y6JA 2ZE5A 4GT1A 1Y3AA 1ZYUA 3GLFE 5AO9A 4YRIA 1E20A 1E5TA 1TM7E 5A7HA 2AMVA 1E7SA 2GLTA 4KO2S 2BN4A 4MMZB 5JCZA 1NY5A 4TS9A 2IW3A 3EC2A 4YYZA 1E9AA 2CNBA 4R5MA 2WJYA 1CQPA 4M1ZA 1G2OA 2X8JA 3WGNA 1E6LA 3ANMA 3K9GA 3E03A 3QWBA 4Y2PA 3NC0C 1O97C 3EQ7A 5CM8B 2R6FA 2I6UA 1YRWA 3CH7A 2VDNB 3D8SA 3UWMA 2ZYTX 3MWDB 3EEYA 2IC5A 3MGCA 4MITA 5AJYA 3HVRA 4Q93A 4ZC1A 2QTTA 4HPWA 3NKVA 4HY3A 1DCMA 1ZA1A 1WDLA 4JDUA 5ALGA 3H4VA 3PUHA 3T5CA 2CUTA 2X4LA 3L0DA 5C7IO 4NJEA 1PJBA 4ZI2A 3FUTA 2GAFA 1Z37A 3CNOA 2J6CA 3O7MA 4MWZA 5CFZA 4Q3NA 3SZOA 5DSTA 1U7PA 2AI1A 3WYCA 4MQLA 3DL7A 4ZCIA 1V0JA 2PLRA 3VR4H 1H65A 1FX1A 2J9XB 5BRJA 4LY0A 3F7NA 1L5VA 2H1RA 2RJNA 3KV1A 4ALNA 1QAMA 4YT4A 4C4RA 3TUIC 4HS9A 1KYWA 4RELA 4C5CA 5T41A 2V6FA 1AMOA 2XUJA 2R60A 1JDVA 1VG9B 2CXSA 2Y0EA 4FIZA 2IBTA 2X6TA 3F3SA 4OHXA 1R15A 5CNJA 3QE0A 1V8ZA 2Q6TA 1ZU4A 4XR4A 4I19A 1LQUA 4WGFA 4Y6RA 4A0SA 3VGPA 3FOZA 3HKEA 4P4UA 2CNKA 1OYWA 2HNKA 2V6IA 1JMVA 5CH5A 5EY5B 3R7DA 1NQTA 3E6AA 5DW3A 4QHTA 5LJLA 3AHFA 3G9XA 1TM3E 1VYVA 1BXRA 1EDDA 2X5XA 4RVOA 4D81A 4E31A 3SJUA 4E5UA 4HDKA 5EPUA 4ALLA 1URPA 3A9WA 2E6UX 3ANTA 4KAFA