1SUIA

Alfalfa caffeoyl coenzyme a 3-o-methyltransferase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
227
structure length
227
Chain Sequence
KSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
molecule keywords Caffeoyl-CoA O-methyltransferase
total genus 82
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.104: Caffeoyl-CoA O-methyltransferase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1suiA00
3EVAA 3GXOA 4LG1A 4XUEA 2Z6QA 1KXZA 4NECA 2PWYA 3SSOA 4A6DA 1RI5A 2G70A 3SX0A 1KPHA 2BR4A 3P71T 4BLVA 1WZNA 3P2EA 4IKPA 1IM8A 1VQ1A 2AOUB 1KPGA 1I9GA 1XDSA 3GDHA 4FGZA 1JG1A 2G8NA 3KKZA 3BWCA 1QANA 3LCCA 3P9IA 4A6EA 4RTLA 3B5IA 1B42A 1YB2A 3HA3A 3OE4A 4G56A 5EZQA 2YVLA 3KR0A 3UWPA 4AZVA 5LSAA 7MHTA 3R0QA 4HH4A 2PXCA 1QAOA 3EMBA 1AV6A 3DMFA 2CMHA 3HCDA 3I64A 3O31A 3OU2A 1M0EA 2XYQA 4HG2A 4YMGA 5LQCA 3BXOA 3PB3A 4POOA 4YUZA 1TW3A 3TQSA 5GIPE 2P3OA 4U7TB 5EPEA 1KP9A 1RJEA 2ZIEA 1EJ0A 3V8VA 5E1DA 3SVZA 4GBED 1NBIA 2NYUA 3LKZA 4QPNA 2ZFUA 2B9EA 4E31A 4X60A 3T7SA 4QDJA 1YUBA 4R8RA 4BP1A 3FPHA 4ATNA 3CJTA 5CVVA 5FULA 3ME5A 3MHTA 5K0JA 2QRVA 3A7DA 3C0KA 3TMAA 1KHHA 3C3PA 4CXMA 2AS0A 3HVKA 4PNEA 1FPQA 3NW9A 3TKAA 3OE5A 3OFJA 5DXJA 4AZSA 5EZSA 4JXJA 5E1BA 3G2QA 3DXZA 5K0BA 3G2MA 1TPYA 3LL7A 4PCLA 4DKJA 1FP2A 2N47A 3KPYA 3MB5A 3I5UA 2JHPA 5D1HA 3HCEA 2IP2A 2OY0A 4C4AA 2HWKA 1JTFA 4ER5A 5K01A 1JTEA 2LD4A 1HNNA 1P1CA 3KU1A 3FUTA 3FRIA 5E2AA 5DM0A 3UFBA 4ER7A 4XUCA 2ZZKA 1BHJA 5FTWA 3EVEA 1YFJA 5D1NA 3KQQA 2HTEA 5DTQA 5ICEA 1L3IA 2E5WA 3M4XA 4HGZA 1YZHA 1ZGJA 1F38A 2XVAA 5E2BA 3REOA 5EMMA 5HZMA 1RJFA 2ZIGA 3T7RA 4P58A 2H11A 4QQKA 2UYCA 2QY6A 5BP7A 2YXDA 3PFGA 3MERA 4DA4A 4OX9Y 3LPMA 4RV9A 3GWZA 4GC9A 2BR3A 4Y30A 3LX6A 3KPUA 3NTVA 5DM1A 3TM5A 5EG5A 1DUSA 5H02A 1L9KA 1NW5A 4RWZA 4WXHA 4EMSA 3DP7A 10MHA 3BGIA 3T7TA 1RJGA 4YUWA 2O57A 4PYNA 4LECA 3CKKA 5EMLA 5FA8A 2HV9A 2NXNA 4DM3A 3G7UA 3LDGA 3DTNA 1G55A 3B3JA 2ZBQA 3SM3A 5CVEA 2IGTA 1T43A 1JG2A 5DM4A 2JHCA 3PX3A 3SXJA 3VC2A 3MGGA 8MHTA 3GO4A 5LQJA 2FYTA 5T67A 3C6MA 2B78A 2IFTA 3UJCA 2I9KA 2ONZA 1BOOA 3BWBA 2IDJA 3BWYA 3M6VA 4CTKA 1L1EA 3P2KA 5LQKA 2OPBA 4P7FA 5E8JA 5FHRA 3V97A 1AF7A 4YUYA 4BLWA 4Y2HA 3CBGA 4GQBA 1FJXA 5EEHA 1P39A 5EHGA 5ICCA 1JR4A 2PVCA 3DULA 4FSXA 4R6XA 5DRTA 5MHTA 2YR0A 2ZTHA 3MTEA 3HTXA 3KQPA 2Y1WA 4F86A 2R6ZA 3KQWA 4MHTA 4IWNA 2OZVA 1VLMA 5LR6A 3QOWA 4PGHA 4ER0A 3RW9A 3LDUA 5EMJA 4M36A 4PYQA 3LCUA 3MQ2A 5T64A 2NP7A 2YQZA 5K0CA 3DR5A 3G88A 1ZGAA 5EHIA 1EG2A 4AZWA 2P3LA 1PJZA 1TW2A 5HOQA 5CCBA 2IBTA 3FUWA 2PV0A 1G8AA 2AVDA 2XYVA 4ER3A 1G38A 2OYRA 5ERGB 3TKYA 2CKDA 3PFHA 2B25A 1NW6A 2P7HA 2ZLBA 3GRZA 5EVJA 2QE6A 4LWOA 5E1MA 4KDRA 4MQ4A 4RTPA 3GU3A 2GA9A 3GRVA 4ISCA 2PXAA 3M6UA 4YV0A 3LHDA 3UBTA 2ZCJA 5LQAA 2P8JA 4PGGA 5IH3A 4DZRA 4YMHA 4B17A 2P7IA 3M6WA 1EAMA 3M33A 1KYZA 2ZBPA 3ELDA 2P1DA 2CWWA 3KPWA 4PCAA 3TPZA 5KQSA 2XBMA 1R74A 2P41A 5HIJA 1RI2A 3AXSA 1G6Q1 3P97A 1NV8A 1SG9A 4PINA 5DPMA 1MHTA 1BKYA 1M6YA 3JWJA 2WA2A 2NXEA 3OU6A 4OA5A 5FHQA 5GM2A 5HILA 5K05A 3FTDA 1WG8A 3ELYA 3U81A 2ZZNA 2C7OA 1R6AA 5GOZA 1F3LA 4RVDA 2V74B 2NP6A 3UJAA 5B1SA 1IXKA 3R3HA 1YFLA 2EJUA 1FBNA 1OR8A 3JWIA 5P8WA 2WA1A 3EVDA 2YXLA 3BT7A 5DRYA 5E8RA 4KRGA 4E2XA 1SQFA 3IV6A 3LKDA 1XVAA 1R8XA 2JH8A 5K0GA 3G89A 3I53A 3VYWA 2AOTB 3SSNA 3KR1A 1L3CA 5FUBA 5E9JA 2AOVA 4GUAA 2GH1A 2IDKA 3TOSA 4QQNA 3PTAA 1O9GA 1R8YA 2ZWAA 3CC8A 4FT4A 5DX1A 3G2PA 1I4WA 1QAMA 3EVBA 2P3QA 5K03A 4RTSA 3OZTA 3EGVA 2GAFA 2QM3A 3ID6C 3FPEA 2PX8A 3NMUF 4X1OA 4WVLA 2ZBRA 2OXTA 3S68A 3M6XA 2OB1A 1KIAA 2FCAA 2IH4A 5EQJB 4P7JA 2H00A 3EVGA 2AZTA 5DTMA 1Q0TA 2PXXA 3M70A 1G8SA 4HTFB 2DPMA 1RI3A 3FPFA 4C04A 4CWAA 3DOUA 2IBSA 3EGIA 4RTRA 5CVDA 3KPVA 3B3GA 4BY9E 4HC4A 5K0EA 2AOXA 3GNLA 3G5TA 3UA4A 2HNKA 3EEYA 3KR2A 3Q87B 3FPJA 3O7WA 5EEGA 3UJ8A 4M38A 5GINE 3FYCA 2CMGA 5ICGA 5KQRA 3BKWA 2K4MA 2BZGA 3FTCA 4PYMA 4QDKA 3BUSA 3LECA 2QRVB 2G72A 1VP3A 3H2BA 3C6KA 3HA7A 3IHTA 2Y1XA 4ER6A 1L3BA 3KPJA 2EFJA 2FHPA 2PLWA 1WS6A 2AN4A 4DF3A 2WK1A 1YZ3A 1PRYA 3HM2A 3BKXA 3MTIA 4M37A 3R24A 1JQEA 5DX0A 3F4KA 4QTTB 1VIDA 1ZQ9A 2B2CA 2G1PA 4OQEA 3X0DA 2Q41A 5DX8A 5G02A 3LSTA 3A25A 4OBXA 5EMKA 2ZULA 1WXXA 3AJDA 4KW7A 3EMDA 4RX1A 4KVZA 3UJBA 4E2ZA 1WXWA 2OB2A 2EG5A 1NW8A 4AZTA 5GM1A 3A4TA 1Z3CA 4AX8A 4KWCA 4C03A 2GS9A 4FZVA 3NVMB 5GP1A 4QVGA 3KQTA 2F8LA 3FTFA 3K0BA 4E2WA 3L8DA 1SUSA 5FCDA 4F84A 1XJ5A 3IEIA 1D2CA 2QYOA 3LBFA 1WY7A 2GLUA 3BGVA 3ELWA 1UFKA 2PKWA 3PX2A 5EC8A 5EKXA 2O06A 4EKIA 4EQZA 4HSGA 4BP3A 5FQNA 1D2GA 3KQYA 4M7RA 3NWEA 3CJRA 2O05A 3CCFA 1XCJA 3UZUA 5BW5A 3JWGA 1SQGA 4PIPA 2R3SA 4FP9A 4PYJA 3HCAA 3HCCA 1N7JA 5DXAA 2XVMA 1ZHFA 2I7CA 4RTMA 1DCTA 5GWXA 3OU7A 1NT2A 4V0RA 2C7PA 3FUXA 3MCZA 3OCJA 3D2LA 4F85A 3KQOA 5CD1A 3E7PA 1R00A 1XCLA 4YUVA 3SR4A 2ADMA 4GOND 2VS1A 2DULA 5K0NA 3SMQA 1YF3A 3ERCA 4FT2A 5JUWA 4P7KA 5K8VA 5KS2A 1AQJA 4DQ0A 2ESRA 4CTJA 1X1BA 4RYLA 4RTJA 1NW3A 1NW7A 2PGXA 2PJDA 3UJ7A 4RVHA 1EJ6A 2BM9A 1D2HA 4RTKA 1HMYA 1I1NA 3G8BA 3R6TA 2Z6AA 3I58A 2FK7A 3NWBA 4LWPA 5CM2Z 5C1IA 3GIWA 3HA5A 4XUDA 1N7IA 3QV2A 2UYHA 3MCTA 2ERCA 3DUWA 4CKBA 4YV2A 1JG4A 3KQVA 4EK9A 4DMGA 3FUVA 5K0FA 4RSRA 1KR5A 3ANXA 1V39A 1AQIA 3FYDA 3KQSA 3QOXA 5CVUA 1VP9A 2I62A 3HNRA 1RJDA 1NV9A 1QAQA 3KHKA 2BM8A 4GOOD 4C08A 5DSTA 3DXYA 5DM2A 1UIRA 3LCVB 3HVIA 5EIFA 1VPTA 3B3FA 2IH5A 3NJRA 3OZSA 2JH9A 3OFKA 2Z6UA 1NKVA 2ZWVA 5JR3A 5F2NA 4GEKA 5C9ZA 4X63A 5M5BA 3DXXA 3GGDA 4RVGA 2UYOA 4PIMA 5F2OA 5T6BA 4C06A 3HP7A 3FUUA 4RTOA 2KW5A 1XDUA 1DL5A 4MIKA 3ORHA 4PYLA 2PWPA 1JQDA 4GF5A 3UJ9A 5DTRA 4E70A 3P2IA 4HTFA 2YX1A 3PLAE 2PT6A 3DLCA 5DLYA 2A14A 1Y8CA 1N2XA 2VDUE 3BWMA 4GOLD 1R18A 3MAGA 2V7EA 3CJQA 4MWZA 4R8SA 3P9KA 3ER9A 5HIIA 3EPPA 2AOUA 3Q7EA 4OA8A 4C05A 1RI4A 3G8AA 2UYQA 1P91A 1VL5A 2GB4A 2GPYA 2PT9A 3THRA 4C07A 2HMYB 3HVJA 1FP1D 3FTEA 3E8SA 4PYKA 3AWIA 3VC1A 3T0IA 3PS9A 5C0OE 2OO3A 2VDWA 2FK8A 3ER8A 1XDZA 1M6EX 4Z2YA 3EVZA 1MJFA 2AN5A 4YV1A 4X41A 1XXLA 1EQAA 1JSXA 2EX4A 3GRYA 1U2ZA 2PX2A 3FZGA 2VZ9A 5CVJA 4HGYA 3DMGA 5EKUA 3SSMA 3TFWA 4CKEA 4E32A 4PWYA 3EEOA 2EJTA 3UJ6A 2ZZMA 2O0LA 3DH0A 1KYWA 2CL5A 3G5LA 1X19A 1ZKDA 3RIEA 5E1OA 2JG3A 2FPOA 1VBFA 2AOTA 2OKCA 2BH2A 2BR5A 4V0QA 5E9WA 1NBHA 3BZBA 2VP3A 1INLA 3GCZA 3JWHA 5U4XA 3KQMA 5LQRA 1ORIA 2FRXA 2IPXA 4E2YA 3DLIA 4FSDA 1EIZA 4HRAA 1O54A 4KIGA 1JQ3A 1H1DA 2AOWA 1SUIA 4E33A 3TRKA 2PX4A 3VSEA 4KDCA 3THSA 5LQUA 3EVFA 4MTLA 2O07A 3A26A 3G2OA 2ZW9A 5KVAA 5LQNA 3KR9A 1NE2A 3DMHA 3I9FA 3UJDA 3LGAA 3FRHA 5FQOA 3HCBA 3GJYA 1QYRA 2G71A 2AR0A 2JJQA 4EVIA 2HR1A 3LBYA 4XCXA 1G60A 5DT2A 2IH2A 2P35A 5F2KA 5HIKA 3B89A 4KIFA 4EKGA 3TM4A 5IKMA 4DCGA 2YTZA 1ZG3A 3HVHA 3TR6A 3C3YA 3AY0A 1Q0SA 4R6WA 2OBFA 1SVUA 2AVNA 3E23A 5EGSA 1X1DA 2ONYA 4BLUA 5CUQA 2YXEA 2ORED 3HEMA 3WSTA 2NXCA 3B7PA 2PSSA 4IV8A 5CCXA 2C7RA 3ELUA 3UA3A 1JG3A 3E05A 4L7VA 3O4FA 2ZSUA 1P1BA 2UZ4A 3SGLA 3OPNA 3K6RA 3PVCA 4FR0A 4IV0A 5K0LA 3TLJA 1X1AA 3P8ZA 4RTQA 4OQDA 5GIOE 5FADA 4X61A 4CKCA 3P9CA 3A27A 4FS8A 2IIPA 2XYRA 4PONA 9MHTA 5FWDA 3PT9A 1KPIA 3CVOA 3P9NA 3NVKI 3NDIA 4GC5A 2JHAA 4DCMA 3EVCA 4PYOA 2I6GA 4RTNA 4O29A 5HEKA 5ICFA 2NNWB 3IYLW 2VDVE 3RODA 4YUXA 2NXJA 2ZIFA 2ZVJA 3GRRA 3AXTA 2PY6A 3A7EA 3HCFA 4QTUB 3R9XB 4QPPA 3OZRA 1VE3A 5DSXA 1ORHA 2YUIA 4RVFA 5BW4A 4E30A 3BGDA 1RI1A 1O9HA 1X1CA 4ZTBA 5KYGA 3CGGA 3NDJA 5BXYA 4OBWA 4PYIA 5FA5A 2C7QA 1BC5A 4P7GA 2B3TA 1XTPA 4UOEA 5FWAA 2PX5A 4K6MA 5EOVA 4H0NA 2AN3A 5E9QA 4R05A 5HFJA 1UWVA 2P40A 5K09A 1QZZA 3GRUA 2PBFA 4QVKA 5DWQA 3LDFA 1SKMA 5EIWA 3FPGA 1IY9A 4U7PB 1JSZA 5HIMA 3EGEA 4AUKA 4GOMD 5CIYA 2H1RA
chains in the Genus database with same CATH superfamily
1VHTA 2BGWA 4V0LA 1UDAA 2K6GA 5AOAA 1T1RA 2NUTA 4E09A 3OZXA 2Q3JA 4J76A 3ZJTA 5MGBA 2WF5A 1OQAA 3IKTA 3AP3A 4KN8A 3HJRA 4IKPA 4GYYA 1ZRNA 1FBTA 1JBKA 2JFUA 3N6VA 4AKEA 4FIDA 4A6EA 4RTLA 1QANA 1NPTO 1UJ5A 2C3PA 3FI9A 3HG7A 3UWPA 5EYPB 3A32A 4BRZA 4OUKX 1DEXA 1EFHA 3JQ8B 1HE2A 1PL0A 1Z29A 3H04A 1KZ9A 4RK4A 4OXXA 1XPJA 1G9XA 2G82A 3I9KA 3BCRA 1UJCA 3RUFA 3OU2A 3WRVA 5BV2P 1I3OA 2WR8A 3D3WB 3GBPA 3PI7A 3SYNA 1HORA 3T4XA 3WYFA 1N1EA 2ATEA 4J0CA 4RHXA 4NBSA 2Q5OA 4RF3A 1QKIA 2IIQA 2V6BA 5EPEA 4MIYA 4Y67A 1RJEA 5EKDA 1NLUA 2QN8A 2C2OA 1A5ZA 4Y2RA 1Y34E 3Q3GE 1JJFA 4OD0A 5TF0A 1VJTA 4ZVQA 1CY8A 4DIKA 3ILVA 1ZJYA 1DWPA 4YCMA 2QIOA 2GZHA 2GN6A 3SZ3A 1C3VA 2P9FA 2RH5A 2BGIA 3C70A 3CUUA 2OHVA 1ZRHA 2AS0A 5U4QA 3UG6A 4LFBB 2WHPB 5DOZA 3SQOA 1Z06A 4MR9A 1MH9A 1BCSB 1UBTS 3KSMA 3FPCA 2G40A 2J0VA 2VAXA 1MEJA 1N25A 3L8HA 4JWTA 4M9QA 4FMCF 4MEBA 1JHVA 4R2IA 1ZOSA 2CD7A 3TBHA 3V4PB 3ESCA 2VZ0A 5EJIA 1JHMA 4REQB 5BQ5A 4Z2AA 3FRIA 5CHYA 4YMWA 1C3LA 3SZMA 1RHMA 5ALUA 2BDUA 1MKYA 1QIGA 2R65A 2WG0A 4BNWA 2WMOB 1Z7YA 3G0BA 3UV7A 2B4QA 5A1JA 3KETA 2Q5LA 1TO6A 3EXG1 4IMRA 1SBZA 2EEZA 3P2MA 1VKZA 2EBWA 2GM3A 3QUCA 5M2QA 1QPZA 4PAWA 1WUTA 2R1TA 2IHBA 3GLGE 5D5HA 2GCEA 3CGWA 2GXSA 4E32A 1E1KA 4YRGA 3QJ5A 1QTQA 3EOZA 4F7WA 2DWPA 3TNDA 1XZMA 1DT3A 2IPAB 3KSAC 5KYUA 4KZPA 2BMEA 1OX4B 3JYNA 3RSHA 3H8JA 3IGFA 5TDHA 2RGEA 3AU9A 4S1PA 2ZEJA 4W6QA 1LBQA 1FYVA 3PITA 3HDVA 5DGTA 1S2IA 4DM3A 4DMLA 3J7AC 2Z9CA 3U7QA 4U9HS 1YVPA 1S9DA 1E2EA 2QX4A 1NXSA 1OGJA 2Q6KA 4K6HA 3GBVA 4Q0MA 4MUEA 1BGXT 1TZMA 2JDIA 1Z8FA 3OPYI 4D46A 4TLDA 2H9IA 3HUTA 5B55A 1BOOA 2N42A 3FGNA 4X84A 1Q15A 4HL6A 4D8WA 3OPXA 2ADFA 4KZKA 1V4BA 2PU7A 3PGXA 3U80A 1J06A 2Q4DA 3EASA 4GQBA 4QBGB 1OXUA 3FDZB 4X91A 5LNK6 1FFAA 3EZ7A 4MWOA 1YWGO 4QXPA 4TVBA 2XNHA 3R0XA 5BN1A 3C87A 1NDUA 3SLRA 3QOWA 1W5TA 2AMVA 4WGGA 1FVOA 1P2FA 1FFXA 4ZO4A 5CT9A 4YQEA 5KDLA 3TLGB 4CFSA 4DJJA 1VYHA 2EZ4A 3AETB 2I4LA 4U9UA 1I2BA 4Z1OA 5KTNA 3MLEA 1M8FA 4ROSA 1PHRA 3REGA 4LBYA 2QUIA 2DWCA 4G0OA 1JALA 3NT5A 4HPWA 1B6SA 1OXBB 3NANA 3QWFA 4FOSA 1KDYA 5JZVA 1YB6A 3MVEA 1SOWA 2ZYHA 4DXDA 2IYYA 2B25A 2B4YA 3Q3VA 2R00A 2GXAA 4IO0A 3ZCXA 1KDTA 4NCXA 1AGPA 2CYCA 2CSXA 3M81A 1E77A 4RVUA 4Y6SA 3SLGA 2ATIA 2IPMA 2R8YA 3H8VA 3QPDA 4KR7A 1PR5A 3G59A 3GRVA 4LRUA 1N9GB 2JS7A 2ZCJA 1XZJA 1KZHA 4QXAA 4E51A 4F9TA 4QARA 1ODSA 2EV9A 2JFXA 1BE8A 5SY6A 1UEJA 1FFWA 2Q4TA 3KPWA 4G1FA 2P41A 4IX9A 3LQRA 2C77A 2P9HA 2Z56A 3H9QA 1II8B 1G6Q1 4KGXA 5E7JA 3WLJA 1EUYA 1Y3AA 2QX6A 3F73A 2LCIA 3WWEA 1TJ4A 2MTBA 3LA8A 4S12A 2B92A 1DQPA 3LUCA 1KGSA 4J0GA 3TD6A 3UAGA 2VJOA 1J49A 1QJCA 2JGLA 3IE2A 3E0QA 1TVCA 4NMMA 1KMQA 5F1KA 3GLGA 1HG1A 1QO0D 2EFGA 1QFSA 2XKBA 3BORA 1F2VA 1MB4A 3WGJA 2DSNA 2ZRPA 4A8JA 2CHQA 2RGAA 1OC4A 4B80A 3AY3A 1SXJC 1AY0A 4K03A 4KIJA 1CUFA 3ZBTA 5I7AA 4BQIA 3ROTA 4RXUA 4DCUA 5FUBA 2AOVA 1VSBA 1E6LA 4GUAA 4YO7A 4BOYA 3WAGA 1CPYA 4J2HA 2O14A 3MT8A 4YJHB 4H08A 3B1YA 5C35A 2HMSA 2MR6A 3LLMA 1I4WA 1QAMA 2VCEA 3IP1A 1YHYA 3WP0A 2D5CA 1HFEL 3K9CA 1SIWA 4A73A 1EP1B 1S01A 1X70A 5KSYA 4Q6BA 1FP4B 1WAMA 1ISJA 2PUJA 4UEWA 5KQLA 3A9WA 3WBKA 2AEMA 2OHHA 4X1IB 2ZAMA 4V39A 4DDUA 2QTMA 3KEQA 1JMYA 4W1RA 4ZAXA 3W7BA 2PJRA 1DAEA 1QQTA 3K5IA 3S2IA 4WY8A 4YJDA 2D1RA 1HURA 1THMA 4MLPA 4JLJA 4NENA 1EM8A 3FNHA 4JIGA 4TXNA 4BQPA 3IMCA 2PWAA 1ULZA 3OCCA 1EMDA 2JAUA 3F7NA 2NO0A 5AHXA 2JLSA 4E5VA 1TEHA 4YECA 4BUJA 2CE7A 4ZZ0A 4E46A 4O63O 4CEHB 1L7DA 2WJWA 1JEAA 3QBJA 4ARZB 4ER6A 2J87A 4XI9A 4ZZ2A 3VC3A 1TDJA 4BC1A 1WS6A 1OT3A 2X5XA 1BN6A 3MC1A 2HCRA 4F45A 1ZVKA 3CW8X 1HPLA 3ZY5A 4H2DA 4JI0B 2F8TA 1HMPA 2WSLA 3EFHA 4UTXA 3SHWA 1X39A 5L3QA 2ODWA 4HMPA 1U90A 3CLTD 4HN4B 1DPGA 4WZBA 1L4YA 2Q41A 3M2TA 5DX8A 1N1DA 4LVNA 1OIXA 4BNLA 1YASA 4U5XA 1ZP6A 3BZUA 3DFFA 3GDOA 3Q41A 4KUHA 5BNIA 5DWVA 4AJ2A 3ZDAA 1DB3A 1ZW6A 3A4TA 3S44A 5IFKA 1Z4QA 2XMQA 1N6PA 4AJ9A 4PANA 5GV7A 1ZCJA 1T1IA 3CNNA 3LCRA 4E2WA 2V6IA 1CUGA 2WWHA 3GG9A 1DXOA 2ZSJA 3ACBA 2VA8A 1J9GA 1PJ4A 4DCSA 4IGFA 2CSUA 5C4IA 3LKVA 2VYQA 4M8NE 4BP3A 1EWKA 3KOUA 4KXFB 4NOJA 3TE7A 2FR1A 4ALMA 4BBAA 1Z38A 4EUEA 5K0ZA 2C4MA 2NVOA 1DBIA 3H18A 2I22A 3QFRA 4DMCA 2VH5R 2ZRQA 3VU1A 3RS3A 2YFQA 4LXTA 3GEDA 1E6WA 1A88A 4C4RA 1VLJA 4D44A 4DPLA 2J85A 3KVVA 4FFSA 4JFAA 2OD7A 4COKA 1CUXA 1GNVA 4K26A 1R00A 2ZB7A 5EUQB 3O38A 3RREA 3VHXB 4RIGA 1QX4A 2GHTA 1UPAA 2D4AA 2GEJA 3ORSA 1TI7A 2OFWA 1KDVA 1XRRA 1KYYA 5KX5B 1EGHA 1AUPA 3THYA 1F7UA 5KVQA 4CLXA 4RBNA 3K94A 4DNPA 1IONA 1EBFA 1X7YA 2X41A 4KQ1A 4B82A 5JFGA 3GJXC 2PX0A 1TZBA 4RVHA 4L4SA 2J3LA 4IBOA 5D6OA 4EECA 2W6QA 5A4FS 1PNRA 3QFCA 4GLOA 2W70A 5BRJA 2X6QA 4L22A 1YOVB 5ALFA 4Y98A 1UKEA 3EXFA 4HMQA 4Q39A 5M7EA 2PL3A 2P6NA 1E96A 5LIRA 1XFAA 4YJKA 5TMEA 1U7PA 3UN1A 1BMFA 2HIHA 2V7WA 1US8B 4DBLC 5KAMA 1UJMA 1JEDA 4Q66C 4UVIA 4PF1A 4KNYA 1J8QA 2CVHA 4NJMA 5D3MA 2BGMA 2XUAA 1CTQA 5K3DA 5CVUA 1SBCA 2C9YA 2FFQA 4EJ0A 3TUZC 4LRWA 3NFRA 5L51A 4BJ1A 5EERA 1ETHA 4G1MB 1RQXA 2ENUA 3DFUA 3OX3A 2J7PA 4WE3A 4NLLA 2A7QA 3OFKA 2GXUA 1P9OA 1E4EB 4NYJR 3TQCA 1JJIA 3I37X 4ARZA 5C9ZA 3Q12A 1YBAA 4LDQA 2RIRA 1R4AA 4PZYA 1KO7A 4PLTA 1EWQA 2HSWA 3VHXA 4HAZA 1NTRA 1VKHA 3HFJA 5EWJA 5KB3A 1Y6RA 4E5NA 1CEYA 2PMWB 3C1TA 3RPEA 3DEAA 4MUKA 1RYEA 4WZBB 5JAZA 5IKXA 3GMTA 4BQFA 4Q1BA 4F5YA 1ZXBA 1W0JD 1M73E 2NSJA 1YS7A 1C30B 2YOHA 1XXHA 3B20A 3P9KA 5HIIA 4G25A 1T4CA 3G8AA 5E6SA 1NQUA 2GB4A 4KYVA 1RBZA 3NBFA 4Q9NA 3CKYA 3ES9A 5E3IA 1YUMA 5F9FA 3D5TA 3KQUA 2Q46A 3DM5A 2BTOA 1VI5A 1Z08A 4C76A 2IS2A 3CKMA 2OZLA 4D6PA 2PUGA 4YV1A 4P32A 1FYXA 2DM6A 1EQAA 1FXWA 2Z2IA 3FFAA 3WKEA 3I2IA 4TKUB 4K9OA 3ILSA 4MB6A 4B6SA 1YMQA 4UM8B 5D5PA 3KXIA 2CL0X 2QSYA 2JAHA 2P5SA 2KHZA 1DEOA 3P20A 3ZWPA 4FFRA 3SQWA 1TVMA 1Y6GA 2BH2A 3KYIB 2CF6A 2ZBUA 2FB9A 1EDDA 2A0KA 2DC1A 3H2IA 2JBHA 4HH3C 3DYBA 1V4VA 4Q3NA 1N7HA 2FW8A 1SHUX 4FSDA 4WX2B 1VE6A 2WU1A 1X92A 3GLQA 1FB5A 1C1XB 1SA0A 1G8MA 1GL9B 3MHPA 2HUNA 3N2GA 1SB8A 3KUUA 4MTLA 4Z9YA 3WI7A 3RNOA 1IQPA 1I9CA 2OGTA 4TS3A 4YIKA 2NO4A 3BD6A 4IIJB 4XSVA 5HIAA 1G20E 1LS6A 1TIBA 2FPGB 2O50A 1VJCA 3RIYA 4M1OA 1XZFA 2D3TA 3NFYA 5D3QA 1UEIA 1NAHA 2VHJA 4Y9RA 3GGGA 1PS0A 1ULSA 1XXHB 2VC2B 3KZNA 1G3RA 3ODPA 1IY0A 4QTZA 5DYNA 3AJ9A 3ZUGA 3K31A 4RK6A 1XROA 2B37A 1IH8A 2CXUA 2FWNA 3PYLA 5L7YA 3RC2A 4YCCA 1Y7TA 2HJRA 1UWCA 2Y68A 4ABTA 1RC8A 1V25A 3UANA 4PS1A 1A9TA 2GN2A 3MD9A 3RYFB 2CDAA 4KN6A 2YOFA 1VTKA 4FGUA 1T3GA 1DO0A 3O4FA 4KWIA 1FDIA 4MEAA 2M6KA 4KQKA 3OY2A 4GMXA 1X1AA 2HDNB 1NI5A 3MF4A 4OFBA 1NQWA 4D5GA 4EB6B 4HH1A 3T15A 1F0PA 2FSPA 3R7WA 4DJDC 3WKBA 2PN1A 4DV5B 3PT9A 2BELA 4CIVA 5I7FA 1I94B 1S4QA 4XGRA 3OFVA 5FD8A 2RI0A 3VTKA 4BFYA 3N7AA 1Z4PX 3UJNA 5ICFA 4QM7A 3V7FA 1X80A 1A9OA 2V1XA 4FLMA 1ZZEA 3AHHA 3N59A 3AEKB 3OZRA 5G4LA 5A02A 4Q1VA 4GZMA 2FX2A 5AK6A 1Q1BA 3I83A 4RVFA 2FPLA 3KOYA 3B7GA 4CU2A 2GBGA 3U3XA 5JI2E 1IIBA 3VPGA 4N4AA 3DCIA 2XV1A 2D2IA 2C9DA 1SKYE 2OT3B 3L8MA 4WOKA 1J09A 4LYHA 4JXXA 2XXAA 4R9RA 2PX5A 1S89A 2JD0A 2JLBA 1LEHA 1E6EA 4RL4A 2AN3A 2J8ZA 3LX8A 4F4HA 2FPIA 5EJ7A 3GRUA 5I9LA 3CRNA 2OGSA 3O84A 1FNBA 2E7ZA 3GQVA 3MEQA 2UUCB 5U1PA 2F1IA 3MTQA 4I9UA 1A98A 1GQRA 1XVIA 4KWTA 4MUFA 1T4MA 1FMCA 1NUHA 1UPCA 1YZTA 1V5EA 1YS4A 3WLPA 2BFCB 4OATA 4PG6A 5E3JA 4BEWA 2WF9A 2D7JA 4RLHA 4ZVPA 5ABPA 5E7IA 4PO3X 3ETDA 4FYWA 4MYSA 4ZCTA 2AE2A 4RM3A 3TMYA 1C7QA 4CV1A 4PX3A 2OWDA 3F8SA 4Z4IA 3HHPA 4D4IA 7MHTA 4KLAA 2OA0A 2PXCA 4ZN6A 1ZU5A 1ENPA 4OUDA 1QAOA 5GZ6A 4MI9A 2W2LD 3HCDA 4DOMA 3F2VA 3VZQA 2Y1FA 1M0EA 3RC3A 1E5VA 4JEHA 2B8TA 5ALKA 4HO1X 4E2FA 4POOA 3WKCA 1QTRA 1X0XA 5E4YA 3PEWA 5GIPE 4IXTA 2GBIA 4CKYA 4EARA 1H8EA 1HK7A 1Q1AA 4HQNA 5SYNA 2BFBB 3OWXA 3K5WA 4M88A 2OLJA 3OJ0A 3AR9A 4RAQA 2UXDB 5EJAA 3HUFA 1V8BA 4MVJI 5JNTA 3DBHA 2B9EA 1ID8A 5TEVA 3V6MA 2FPGA 4GYKA 4R8RA 4LV5B 5I01A 2XE6A 4PIVA 3PYMA 3TINA 1Y9EA 3TL6A 3U7EB 4D9NA 3D8RA 1U0FA 2YYAA 5DK6A 3CTMA 1A69A 5L40A 2GEKA 4JSYA 1FS6A 1UXOA 2I78A 1EDOA 3CH5A 4HB4A 4ZRNA 3OIGA 2WPNA 2AC4A 3BCSA 1KVRA 3DXZA 2WILA 1IU9A 2F2TA 2JB9A 2JIOA 1E4YA 4BO5A 3TXXA 3LZCA 5CLHA 2IOFK 4HDQB 1SC6A 4KRXA 5DVZA 4QBFA 3OQNA 3OSZA 2YN2A 3C4QA 3SJ7A 1KVUA 1Y8QB 1TMYA 2P3SA 3DQQA 3WMEA 4EB6A 1KSFX 3IMFA 3ABRB 4QX6A 1FXUA 1X86B 1BNCA 2VF2A 5D7BA 1K3FA 2YVAA 2YV2A 3EVEA 3K9HA 1YFJA 1HNZB 1PSDA 5KZMB 1L3IA 2FDRA 4ITRC 1LDNA 4MUYA 1NP6A 5D6NA 2XKAA 3HJFA 4DNFA 4JL8A 1LNQA 2XQJA 3CW2A 4N12A 4ZAFA 3R23A 1UINA 1IVYA 5ES3A 4OQQA 1E5QA 2BR3A 5EVCA 3WOVA 5JCZA 4QDXA 4NBRA 1SEPA 1VSUA 3KQHA 3BD7A 3O03A 2X9NA 4Z53A 1DUSA 1VG0B 3QVGB 4GR4A 4HOYA 3IEVA 2R6JA 3DMYA 4EMSA 3DP7A 3C8DA 1CP3A 1XLTA 2IHKA 4ARSA 2C2WA 2YIDA 1HDEA 4IFEA 2E3JA 4PX5A 3EARA 4MV9A 5EZYF 3OFNA 5KKAA 1WV1A 1P61B 4LC9A 1CU1A 1RSZA 3MSCA 2X1MA 1URPA 3AUJB 3KWJA 3HKDA 3QEMA 4NCKA 4F2WA 1T43A 2VBGA 4XDZA 4ZOBA 3PX3A 2GK7A 2JGJA 3MGGA 2H85A 3A31A 2ZBDA 2VIIA 1JYEA 5FWXA 4NCAA 4D8UA 2IWRA 5K8LA 3T4UA 1JZQA 1Z0SA 3BWBA 5J5VA 3GVXA 3KFXA 4YRBA 2PS0A 3OLYA 2HA2A 5C8XA 2XDQB 3N05A 3C5CA 4RY8A 4BYMA 1G9SA 3UFXA 4DYDA 3N3BC 2OQVA 5DI3A 4FEEA 3ZH9B 5EHGA 4WBSA 3L79A 4FSXA 1A3CA 5JCOC 1JT9A 4BQQA 3BDVA 3HWWA 1XC7A 3BB3A 4HGNA 4NBVA 3GB9A 4G8CA 4Y0NA 4C2BA 2G1KA 3JXEA 5HDBB 3TTSA 4B6EA 4X7RA 3RYIA 2WU4A 4HLUA 3FRJA 3DEFA 5IEJA 1CUZA 1G8KA 2E4XA 4M1YA 1E18A 2CKMA 3RKRA 3ADPA 1L5HB 1VPWA 5AK3A 1UKAA 3HB0A 4WN9A 5ER6A 1ZMBA 1KP3A 1Q17A 2H18A 3T0FA 3VKWA 2HA3A 5ES4B 1Q57A 1SCNE 3L7CA 4MS1A 3TAHA 3FYUA 3ZS8A 4B48A 1Y7IA 3WWCA 3DHYA 1J70A 3F6PA 3K96A 1U3VA 2QT0A 3OTIA 3ZY2A 2C7BA 5IFLA 1CJVC 1G8GA 3HU2A 3CEPB 1NW6A 2A5DA 2P7HA 2GCNA 1YKGA 1DTWB 1Z07A 5EVJA 2FF7A 4KE8A 1NRXA 2JI4A 3IXLA 3OJFA 3CKLA 4JL6A 4BE4A 4CM9A 3AJRA 4MQ4A 1MX9A 2QTTA 1PS9A 1RQLA 2XDWA 3UWDA 3OT1B 4I50A 3CTPA 3DZBA 2ZQ5A 1MQSA 2C2YA 5K3FA 3HXOA 3P0RA 4EPWA 5EKSA 1N5LA 4JLWA 4Y2GA 4MKXA 3A1UA 1RJWA 2V7QD 4DTCA 3I30X 4WOCA 4O2LA 4CMGA 4JMLA 3I0NA 4MQBA 1F5SA 1B6RA 3ELYA 1J2RA 4KFTA 3QRWA 3MUOA 2PRIA 2PKRA 4MQMA 3V8QA 1BTOA 1WD7A 3E2PA 3B38A 3R20A 5BMOA 2BV3A 2RC6A 3A05A 1O5IA 1PEAA 4G67A 4WGFA 3WL5A 1YZYA 4NZZA 5CPFA 1SBTA 3O91A 4G26A 1C41A 3VU3A 4BO9A 1U8UA 2JFFA 4CIBA 3GUZA 3TMKA 1F51E 5IN5A 1JEOA 1O8CA 2P67A 2XUDA 1I2MA 3GJQA 2BGNA 3G89A 4W63A 4YBZA 1Z68A 2CNOA 3FFWA 4EY3A 1WCV1 2AUTA 3AVXA 1D4OA 2FG5A 2ZTMA 1JI3A 1E1RD 1Y7HA 2FSUA 5NLLA 2ZSBA 4NOLA 4ALNA 2GPBA 3IIJA 4I14A 2IDKA 2WHXA 4N03A 4DTIA 2VRWA 5KNCA 1UWLA 5I3ZA 4YP7A 4EA6A 3AIIA 3KSZO 4BPRA 1RVV1 1H0HA 1XIVA 3DLAA 4DLWA 4QELA 4Q9LA 4RFSB 1UQRA 1YZLA 2BFFA 3W3AA 1JHQA 4FDAA 1V3VA 5IJ0A 2R1VB 3P0IA 2OO7A 1KIAA 4KVGA 5H9WA 2PHZA 4MVJA 1M2JA 4KR3A 1L2TA 4QGAA 4AZ3A 1Y4ZA 4NKRA 2GM5A 4TLBA 4TWAA 1RYBA 2RHGB 4MNTA 3UJHA 5EJ8A 3AF4A 1BRTA 1TUGA 3JQFA 3RRMA 4LF8B 4FCCA 1D2RA 1WXQA 3R0ZA 3EGIA 3QU9A 2G06A 1T9KA 3IAAA 1WU7A 5EXEA 2Q4RA 1QCZA 2YRWA 3CONA 5KTPA 3QLTA 4MV5A 5G1PA 4DPMA 3CLSC 3R3VA 3OAAD 5F51A 3A14A 3HDTA 2VUTA 3D31A 2UXBB 5KQRA 3EWNA 2O4CA 4N3AA 2JEOA 1RAAA 5ALEA 1NZJA 1RHQA 4OMFG 5KWVA 1P7CA 4O2BF 1KYXA 1MDFA 3SHTA 1HLGA 5LU9A 3H3JA 1ZSVA 4GZ5A 2JW5A 1CDZA 5AVUA 5IJ9B 1GV0A 1UBGA 4D1YA 2PKQO 4L8WB 4MHSA 5DTEA 5HQ3A 1SBQA 4C0HA 5TXGA 2PM8A 4W4TA 4D97A 3QEAZ 1R0BA 1IHUA 1YIAA 4CMAA 3BFXA 4YYEA 1O6BA 2JD2A 2QVYX 1GTVA 4KPUB 1G2OA 1PVDA 1F2TB 4B32A 4F5DA 2ACVA 2D2VA 3MGBA 4RX1A 3T7EA 4PG7A 3WL7A 1DT5A 2ZATA 3LZDA 3L7DA 4B6QA 4AZTA 3DGEC 5BO5A 3G5AA 1DXHA 2DSTA 3BMNA 2W22A 4WNIA 2HEIA 3T54A 5J2TB 4IJQA 5DNEA 4BL5A 4WCFB 2HFJA 4EGQA 2BGTA 4UUOA 3S8MA 4NEHB 3GH1A 1A4RA 3UGTA 3WIUA 3D8TA 4RSMA 1RR6A 4WK4B 3NM6B 3W79A 2Q1SA 4K6OA 2CYBA 2J9XB 2FEAA 2I1VB 4WKOA 2H4ZA 1GDDA 1QFJA 3CJRA 2Z1MA 3NWEA 4A3SA 4AN1A 1L5FA 4CDNA 4EUHA 4KSBA 1I7DA 1A9SA 5BW5A 1SQGA 2HIAA 4FP9A 1GRVA 1EBBA 3RVSA 3CLHA 3UTCA 4XQGA 3EY9A 4GUDA 3GCDA 2C95A 4FHCA 1CE8B 2O7VA 4X1YB 4S35A 4CCSA 4GX2A 5C8YF 4YMSA 3V2GA 4NFSA 1G16A 1SFRA 4J16A 1PTJA 2R7LA 2W90A 2J08A 3W9SA 4QODA 3SCZA 4DT1A 2GI4A 2NSLA 3F96A 3UMRA 5IXYA 3C3CA 3DAFA 3SDZA 4DB4A 1Z4KA 2R25B 4U63A 1LI5A 5HMLA 3IL2A 1B23P 2WRZA 3WYAA 1YKFA 3GPDG 2AR9A 4CTJA 2HSEA 1NQ5A 4F8YA 2R2GA 2A0XA 2AT1A 1YHZA 4PY2A 1KEZA 3IXQA 5ER9A 5A0TA 1JH8A 2D7CA 3E1KA 2EZ9A 2JAWA 1E79A 1AXGA 1J1IA 3IVXA 3PHJA 4O0LA 4LJSA 2ENWA 3EWIA 3W90A 1DFIA 4LI3X 1UZAA 3MYYA 3RSOA 3QQPA 3EXG2 2PIDA 1UODA 3D8NA 3GIWA 3U4AA 4BWFB 4D41A 4C2UA 1USGA 1QKJA 1IUKA 3H0KA 2EYUA 4FE7A 5CJ2A 3RU2A 5I5EA 1M72A 3JQBC 2X4IA 1VPEA 3GDFA 2J0UB 3RFXA 3TZHA 3M1AA 3ONFA 4RQUA 4H6VA 5FBHA 3RS4A 1ILEA 1BG6A 1FFEA 3FVWA 1C8BA 1SQ5A 4PXYA 2QMUA 1QAQA 3HE3A 4GLFA 3OOYA 4ZD6A 5DSTA 3NHYA 5A9SA 4JJIA 4G5HA 5DIZA 3V1KA 2ZBFA 5BVGA 2QUJA 3HVIA 4LWQA 4NV0A 4HHEA 3IILA 3ZWMA 1UBFA 4OY3A 4ZJYA 4QBKA 4L08A 1CE8A 1Q3HA 2OZLB 1W8DA 2QD5A 2NNLD 5ARBA 4NCBA 3UT6A 3ZCVA 4G5FA 4B4KA 3ZCUA 5BNTA 6YASA 2B99A 4R51A 2EKLA 4OH1A 4C06A 1DBRA 2OXFA 2QY9A 4QQ8A 1IWOA 5T6BA 5F98A 3OE7A 1BDBA 1KGDA 1TQ2A 1Q19A 2VHEA 3K9NA 5JD5A 4CM8A 1W48A 3G1WA 2WB4A 3LA6A 3IUPA 2QRGA 4IFBA 4UVDA 3T99A 3L7JA 2DKNA 4KK3A 2Q4EA 4FHEA 4MR8B 1SD1A 3E7XA 1PKXA 2FDXA 5LPNA 2UYQA 3BE6A 4POAA 3N07A 4IWXA 3A58B 1QO9A 2VNJA 5I47A 3U4QB 1ESDA 3HH8A 1L5KA 4Z54A 5BNZA 1U8ZA 5CYGA 3EFOA 1E2MA 2GLTA 5AVSA 1N5OX 3GPCA 2CHFA 3MPUA 3RV3A 2FKAA 1HEUA 4B9EA 4NAHA 1GYPA 3T3HA 1UQTA 3GRYA 1NNI1 1OPXA 1U2ZA 2B1RA 3HP4A 1TK9A 3PZRA 2I3AA 2CDRA 1DWUA 1KQPA 2O0HA 2R86A 5H3CA 4MIOA 3QITA 4FLEA 4PZPA 3ZU2A 1PJ8A 5A6SB 1A04A 1QONA 1M83A 2RH8A 2VEDA 4B34A 2OKCA 3UMFA 2MT9A 1M76A 4CEJB 2HN9A 3OCUA 4V0QA 3LQ4A 3LXUX 4DY4A 1MO3A 2CVZA 2GDJA 4HDCA 4YTEA 4DQUA 1UBUS 4C7XA 2BTEA 1DKPA 1BGWA 3HDJA 4R2JA 3S2ZA 3WLEA 2UU9B 1RKBA 3G9TA 2VHUA 1CY7A 1P7YA 1PYOA 1U4NA 2CZQA 2G5CA 4KLNA 4CDRA 5JWRA 2PUBA 3VSEA 2BEJA 2AEJA 2IYVA 1XD8A 5AJXA 2VYND 2M6LA 2ICAA 5EA2A 3R7BA 2QMQA 4P36A 3X1JA 1VXOA 3UICA 4DV6B 1O0BA 1XTQA 4QXMA 4UBMA 1SXJB 2JAQA 4UZSA 3HCBA 4OLBA 3GJYA 1XF1A 2FMHA 4J6EA 2O5EA 1S6YA 1T5HX 2GPSA 5AOCA 4KACA 5L3RA 1SVSA 4XWGA 1LBEA 2W4IA 5FB3A 2RK4A 2A78A 4QEZA 2ODEA 4CT4B 2VVTA 2HPHA 1FX1A 1LLDA 1W5SA 2CLEB 3RAGA 4EF4A 1EIWA 1PGQA 2OBFA 3LLUA 1N3YA 1K0FA 1X1DA 3K53A 4G9BA 4MZDA 2GYVA 1LPAB 1EI9A 5CTAA 2DQYA 3OC6A 3LT4A 2TYSB 1AZLA 3PF8A 1Z7BA 2WKSA 4FCVA 4KYTA 4NEQA 2C7RA 2RDMA 4M1QA 2UZ4A 1X7YB 3OPNA 1TTQB 1QYCA 1NHWA 3HL4A 3ILHA 2HGZA 4OXNA 4ZOCA 3W2IA 4YDQA 3TG8A 4TV9B 4RULA 3HXKA 1YS9A 1PFUA 4HFRA 3OEEA 4FFNA 1Y3CE 3TOCA 4X65B 4EJSA 2VKQA 2Y4NA 2ZDGA 3RRXA 4MJ3A 5SYMA 3MBKA 1N8SA 4OP3A 3RTAA 5BVGB 2JHAA 2JIBA 4LV6A 2I6GA 1WQ1R 2LBPA 3DMTA 2B1JA 2WJJA 3JAKB 1P2TA 1PJ2A 1P7VA 2Q7XA 5AI9A 4ZYWA 4BZWA 3DE4X 1D4ZA 3TAUA 2EKZA 2PY6A 4DXHA 2H1FA 3UPTA 1ORHA 1CT9A 2IDZA 3IUSA 3DUFA 2DCUA 5EE0A 1E99A 5BW4A 3CE9A 2HPVA 3GFVA 3LY7A 1JFTA 4OHCA 1RI1A 4K0KB 1WVMA 3PF9A 4LMRA 3N2YA 3IBSA 1NXOA 2IUTA 2JIZD 3NDJA 5LBIA 2XE4A 4DRZA 5KJFA 1ULUA 4ZFNA 4RH3A 4PYIA 2C7QA 2PZFA 3AB3A 2FG7C 1XTPA 1YL5A 2OE2A 4MROA 4P80A 4CIYA 1Z16A 1QK3A 5E9QA 1MQAA 4QJBA 4HB2A 5EP1A 4CV3A 4MKZA 5DGDA 2ZWMA 1CZHA 2Y76A 3IUQA 1HFKA 1Z6GA 5FI1B 4BNUA 4KR6A 4GXQA 4NF2A 5FX2A 4GI1A 1EX7A 3G02A 2FW9A 1P7PA 2H1RA 1Y7PA 1A71A 1MJ5A 2H07A 1XVLA 2AG0A 2REQB 2QRPA 4XUEA 4YHBA 3ZGYA 2H4JA 2QYSA 4Z6KA 4NECA 1YAJA 4ZVRA 4D45A 1ZI6A 2ZYUX 1TQDA 4DSNA 1NM5A 1HE3A 3DV9A 3B1WA 2BR4A 2P6MA 4I9HA 4Y2JA 5ALOA 3VDNB 2CW5A 5I7RA 5IUJC 4FOTA 1IM8A 2GCGA 2AOUB 2WIJA 4B09A 2X8AA 1FJGB 1FL9A 1QV9A 3KKZA 4M1EA 4RADA 4B6JA 4BKUA 3FJOA 1YRYE 4EJMA 4X71A 4ARUA 2PLFA 1E3IA 1FSPA 4EFLA 4TLMB 1JDBC 2AMJA 2W6PA 3H86A 4X1IA 2BC9A 2VR1A 1JU3A 3EAFA 4CI0B 4EY5A 3I64A 3SHQA 1AH2A 3K0CC 4YMGA 5JC1A 3ICCA 1YDMA 1TC2A 3TQSA 3VKVA 4PGFA 5JYEA 3MLBA 4TZTA 5LQDA 4U7TB 2CDBA 3CEHA 2VUHB 3DQZA 3VZDA 3VNBA 4BEJA 3I45A 3OMXA 3S5UA 3PEVA 1VLLA 3GVIA 3DVAB 4EHNA 3MCAA 5LMNB 2DQKA 2I8AA 4EFNA 5C32A 4JLKA 3B70A 1U9JA 3EBOA 5FYDA 3TCNA 3IIMA 4E5SA 1LC0A 2YBDA 4C6RA 4HDAA 2D7DA 4KQ2A 1NVFA 3ROXA 1QQBA 4KFCA 5JRZA 1AK2A 1M1YE 4QBTA 4R8LA 5B3KA 1ZD4A 5DV9A 2QENA 5BN5B 5EYPA 3UV3A 1WXGA 1GZDA 2P6OA 3BCUA 4RY0A 1GGNA 4IILA 1UMBA 3N0VA 3NC1C 3OOEA 5B53A 3ZNNA 4RPLA 2J67A 3NHBA 1SJ9A 4HDOB 1UBOS 3TK1A 2SECE 1TVKA 3OX2A 3UFBA 4ER7A 3QVXA 3HDYA 1QG0A 3ED5A 4IKOA 3NONA 5FTWA 4AMZA 4V38A 4O4IB 4E88A 1OLXB 4JQZA 4YMTA 4RVNA 4BKRA 4FFOA 2QMHA 1ZGJA 2XVAA 1VMAA 4QGGA 2HCFA 1FDWA 1LKZA 5D84A 3CVJA 2H11A 5IDWA 3TE6A 2J9YB 3IPXA 2XMRA 2B20A 1RXSA 4HS4A 1PZHA 3ZXUB 1N6KA 3P32A 3LY8A 3DNMA 2PJZA 3TW8A 1NFRA 3ZLBA 1FXWF 4REMA 4BE9A 3RT9A 1F1JA 4UOQA 5EG5A 5JH7B 4U39A 4YT5A 3DPSA 2N3ZA 2I4TA 2DLDA 2P2SA 4WLOA 3T7TA 1CUSA 3L8EA 1BFUA 2J3DA 3FH0A 4PYNA 2G3YA 3O8QA 2FPXA 3V55A 3MBOA 1KSHA 3Q2KA 5CK4A 4PO1A 3RS7A 4LCEA 3E53A 3U6KA 1L4EA 2ZKLA 3NIGB 2Q2OA 1VL8A 1U2TA 1SU4A 4N0MA 2W2MA 1DFGA 4R69A 1JAZA 2GPJA 4WLVA 5B1IA 1H2EA 3LY5A 5CU7A 1IN1A 2RB4A 2Y9MB 1WOMA 1RHRA 2OPBA 5CIWA 2H8KA 3TR0A 4BRUA 5C8VA 1LH0A 5IMBA 5C51B 3OTOB 1KY2A 1AF7A 2EW1A 1B6TA 1PEKE 1Q3TA 1W52X 3REQA 3O8DA 4G5YA 3D7LA 4KSCA 1H1LA 1GUYA 1SOUA 2FZ4A 2QUKA 1SZJG 3O0TA 3PNYA 1TVKB 3CNLA 1Z4JA 1ZICA 1B76A 2AZ4A 2P69A 3EIXA 3AYZB 2DUJA 3W1VA 5L6MB 2IYQA 3SJBA 4D0SA 2Q50A 1E9DA 1M6VA 1XLTC 5K0CA 1J9EA 3WB2A 2LDXA 3AILA 4NU6A 4P86A 1TE2A 2ZAGA 3O95A 2WVAA 3W8DA 1RMYA 2DH5A 2QDKA 3LXXA 1N9ZA 1RLJA 3H7IA 5FTMA 2BFCA 3GJSA 4ER3A 2A4KA 1YK0A 1BOFA 2NU7A 1FTSA 2B4RO 3HXPA 4W1SA 4BKOA 2EWWA 2EX0A 4GPBA 3UC5A 4WINA 2IEYA 4WRRA 4ZV4A 3GMIA 5BN4B 1Z39A 3D8BA 1OLUA 4G0VA 2X42A 3QVLA 1X7WA 3RTDA 3OKFA 2PXAA 5EWLA 2NSDA 2V59A 1TEZA 2C07A 3CZ9A 3ZNOA 5EJEA 5DM60 1FFDA 5KQSA 4PCAA 2H2FA 5FUYA 4J94A 2DB3A 1F20A 1TB4A 3AXSA 2O20A 2GCIA 3JY6A 2GDZA 4AO7A 3IP3A 4X3CA 1Q12A 1JPJA 3V33A 5FHQA 1AJEA 5B7GA 1QGYA 3NRJA 1UKYA 3U81A 5JYCA 3HCNA 3TDMA 1DG3A 5IM4F 3H1FA 3IOBA 3TXAA 1J4AA 2DT8A 4PCUA 3ICEA 2XXAB 1G8YA 4KH0A 4FW8A 4OFWA 3N7TA 1Y3IA 5P8WA 5EJ2A 1MR3F 2VJYA 2YXLA 4CF6A 3FYUC 2IY7A 4NDNE 2XR1A 3WLNA 1DKRA 3AM1A 4R1LA 4UDYX 2NQ2C 4ZCPA 2JH8A 4FWTA 1OLXA 1PJ3A 4BCDA 3QHPA 4E5UA 1V5WA 2VK4A 3KB6A 1CQJB 1DBVO 4LJ4A 1CUHA 3SSNA 3TF5A 3ND7A 3RHFA 2BF4A 1RRVA 4F4JA 4Z4FA 4DM4A 2DBZA 3I2HA 5CNKA 5IT9A 4C0XA 1CFZA 2V03A 4C7OB 1RLMA 5BURA 3PUHA 4YAJA 2HLDD 1BIFA 4PSCA 2DWQA 1A7JA 1WCIA 1R8QA 1SEVA 1UK6A 4NRDA 4IIYA 5F12A 2FE1A 2ZUBA 3HI4A 3L4BA 4HB3A 2QK4A 1LFDB 3N28A 5E95A 3OM8A 3QKRA 2YL2A 1SHJA 1N1GA 1KP2A 1A8UA 1JHXA 3NH6A 3PCXA 1Z74A 4MO2A 4DQLA 2HHHB 1SIUA 1ISPA 1KJZA 1G8SA 1FRNA 1X9GA 1MOPA 2ECOA 3INNA 2C2GA 1X6VA 3EA0A 3M82A 3MAAC 1XU4A 5A5EA 3K0SA 4G23A 4MVJP 4AI6A 1NQOA 1RPTA 8ATCA 1QHYA 1ZCAA 3KPVA 1FNNA 1E3TA 3B3GA 4HC4A 3W6ZA 1GNRA 4CI9A 1XJQA 1TJYA 3BPSA 2Z5VA 1XQXA 3GZNB 3E6AA 3A0UA 2ILVA 1JDSA 3EMVA 3UJ8A 4AMVA 1FYFA 1S7GA 1LJ8A 2ZI6A 3P9SA 4TSRA 5I45A 3CF6R 3KTAA 4DC1A 4AJOA 1MCZA 4PZLA 2Z9DA 9LDBA 1PSWA 2HSJA 5JC8A 4JB8A 3ROEA 3D8UA 2Y6UA 1Q7RA 4LX8A 1L3BA 1BEZA 1Z15A 5AVTA 4F97A 1Z82A 2XCRB 2BL4A 2IKSA 3PYXA 3USZA 2NTYC 1P5ZB 4YASA 5KBYA 3T4EA 1I24A 4AIIA 5JCJD 4NNPA 1X14A 1JQEA 2ZRGA 3DCNA 3KD3A 3NAQA 3UGKA 5ESWA 3TIXB 4AJIA 3FNEA 5BSWA 2XGMA 2DHCA 1G3UA 2GEVA 3FYHA 4OQEA 1V1MA 1YJBA 2YYZA 2CY0A 5LMUB 1FTGA 3OCYA 4I55F 4M6WA 2WT8A 3MTJA 1DBPA 4KTVE 4L5IA 5KHAA 2BSQA 1DOAA 2IV3A 4E2ZA 3SYLA 5CW2A 4K6KA 4BO8A 4F6LA 4NFYA 421PA 3C4JA 3S99A 5DO9A 1R15A 2WZQA 4YXWA 1T2EA 2Q49A 1P0PA 4BKMA 1YR7A 1OXTA 2I34A 3KQTA 3X44A 1GUDA 5TV2A 4F9FA 5GVSA 16PKA 3NXKA 3DT6A 3L7OA 5HKLA 2Y71A 2QYOA 1F8GA 5GONA 1T5IA 1D7OA 2O5VA 2P5UA 3LCMA 1V8FA 4TSFA 4EKIA 2ZM6B 4QM6A 2QR3A 1AZTA 2VZ8A 3GWGA 5JO0A 3K70C 1EWYA 3ND6A 4URYR 1GEGA 1Y89A 4LGVA 4ZJPA 3E48A 4UTNA 5L7WA 2PQ6A 3AONB 3ELBA 4U6SA 1ISFA 5CDTA 3BXXA 3ENNA 2PH7A 4O3FA 4ZHQA 4BPBA 3T7DA 1PNVA 2FJ0A 4HDRB 2PVPA 2RHWA 1QORA 5CNIA 3K35A 2V0GA 1OXXK 3TCXB 5CD1A 3BXHA 1UT8A 5TX7A 3RTEA 4GKJB 3F8TA 1UEXC 4JA2A 1O77A 2ADMA 3R74A 1FMFA 5F64A 4QO8A 5G4KB 1YI1A 5KQMA 3JALA 4X1KA 4XDGA 5K8VA 3L77A 4JEUA 4YJ3A 3L6RA 1DOHA 3MJSA 4QFMA 2GZ2A 5JSKA 2VTEA 1BRMA 4UDNA 1OAOA 2KYRA 4XYGA 5AQEA 4RTJA 3I05A 5FUWA 4TV8A 2XNCA 4OK6A 2FNAA 4UDXX 5CLLA 1KZ1A 5CG1A 1HL7A 1B8PA 1V41E 1D2HA 5DGXA 1Z6ZA 3F49S 1NNUA 3W8NA 4D4HA 3R6TA 4LHEA 3I58A 1G18A 1L5WA 3A37A 4A0HA 3HB5X 3U40A 4GNRA 4RA9A 4LF4B 1GA4A 1JR3A 2RB5A 3LP5A 4IO1A 5JD4A 1B43A 6NULA 4Z1MA 4Y2SA 5T4HA 2P6UA 3DJYA 3KXPA 3RRYA 1V5FA 3SJZA 3QOXA 4RD0A 2Q1WA 3HLTA 1MVLA 1UDWA 5HW0A 3HBJA 1PWEA 4KU4A 4PLWA 5DM2A 4NSNA 1GTMA 4EGAA 1QP0A 1I4LD 3QFSA 4FKBA 4DCNA 1O95C 1VBKA 2R7NA 4DBVO 1IXRC 2BKXA 4I4CA 5M3BA 3Q85A 4LW8A 5F5LA 4F3RA 2YHIA 3A0RB 3K2QA 4PR0A 3B6ZA 1NBEA 3P96A 4PRZA 4K46A 5AUPB 4PIMA 4KVFA 4XGQA 1E2PA 1N2OA 4P9NA 5DU2A 4BAGA 5C5DA 5KOJB 4RTOA 5T4EA 4CG3A 1EXDA 3NHAA 4DKXA 3R7AA 1U2DC 1NRIA 4OG2A 4K6CA 4YB8A 5DLYA 2ZYIA 2AA3A 1ONOA 3WO0A 4BLQA 1DQYA 1TLFA 1ZGGA 1K3TA 2GVZC 4JJ7A 1KO1A 4IS3A 3V9PA 2Z3VA 4Q3DA 3RRBA 4HMOA 2PGOA 3GJTA 4FHFA 1Z5ZA 1IG0A 4N5IX 5JI3E 4XVQA 4IP0A 1K88A 4YR9A 3RVKA 4N3CA 1PR3A 1R37A 5DM70 1QYWA 2NTEA 4I0WB 1A9RA 3P4UA 4GOKA 3ZE9A 2QTVA 1HSZA 1VL2A 1EVYA 4Y1GA 4YDHB 1RJ9B 2LP4Y 4LYAA 2CNKA 3FOEC 3UYLA 1Z2AA 2OECA 4IIUA 3LIIA 1HXHA 4D9HA 3RH0A 2NMVA 2ID8A 3JYLA 4J0HA 1K1EA 2E0IA 1ZPDA 3KELA 2PU5A 3VNUA 2FUKA 3SP1A 3K2BA 1YTUA 1Q7CA 3L1UA 4BFZA 1BMTA 4N82A 1JILA 3S29A 1HDGO 3UM9A 2D8AA 3OQIB 3THSA 2V9CA 4MUAA 3EVFA 3RIXA 1MMFB 5KOIA 4AXXA 2WINI 2W6JD 1WNFA 2IQIA 2R6CA 4K9MA 3AUUA 3SNHA 5IPFA 4PLZA 2AR0A 2X4DA 3M6LA 4E3ZA 1V2GA 3ZZMA 1V8DA 5AKIA 5HUQA 5J4VA 1UMCB 3I1FA 1K0UA 1PTJC 4FKMA 1NX9A 2HX1A 2R8BA 1Z83A 1M0SA 2UDPA 4PAGA 2YTZA 1I7SB 1QHHB 4H7HA 1CRQA 4BV3A 5BQ3A 4CQMB 4H4DA 3H2HA 4JSRA 4PSUA 1W34A 5D85A 1IL0A 4A5SA 1EXVA 3KCQA 4YRDA 2ORED 2C82A 2FR8C 2ZT8A 2PSSA 3DDZX 3NBYC 2DPGA 3HXLA 1P0MA 2YZNA 4BO1A 1TVEA 4PNPA 2HLPA 3GOQA 2ZSUA 2W6MA 1SVWA 4PBTA 2ZAYA 3PQ7A 3TLJA 2IYZA 1PE0A 1RCUA 3G6KA 3EQ2A 4H4EA 3KL2A 5B1EA 5AUNB 1GL6A 4A5OA 3U61B 1I13A 1DEHA 3R7DA 3SBEA 3KJNA 1ZH6A 4NV1A 1JAXA 3HY3A 1IMOA 1C0IA 1IEWA 5BR7A 3GLSA 1QRUA 1QSGA 4JBGA 3HBNA 1VPDA 1EEXB 2PCJA 5FV7A 3UJPA 3ZY3A 4ZOAA 4CT5A 1X7DA 3A7EA 4LCBA 4Q9KA 2X5OA 1DKUA 3OVMA 4DSAA 2QN3A 2NPFA 1U3TA 3GFFA 4WUTA 1SVIA 1T6NA 3NTRA 2XECA 3QOFA 1I8TA 3QI2A 1MAUA 3LP8A 4G4JA 2H92A 3W06A 3LFUA 3W3AD 2PH3A 1QUEA 3EGDB 1FZTA 4YRTA 1BQ3A 4YJGA 1E2BA 1ZITA 4BUCA 1OWMA 2I1QA 2IPOA 1KI1A 3ZIUA 3TTXA 4BN0A 1HYEA 1T24A 5EP3A 1A5BB 2B82A 3B9QA 3GLHB 1D6NA 4P4UA 5IARA 1JSZA 3U39A 3VPCA 1DQRA 4YAUA 1LBHA 4GOMD 2WKPA 5CIYA 4HLUC 4R1TA 3V1TC 1JV2B 4KV9A 4G1BA 4LG1A 4P7BA 2OCAA 1I6WA 3R5TA 1GQQA 3ZDDA 2GJKA 2IE0A 1MW8X 1ACLA 3SSOA 2XE7A 2BTQA 5JRDS 5HXAA 5DEIA 4JQSA 2BUCA 2VUUA 4FGWA 2Q5HA 5DM4A 8MHTA 4FFPA 2RHLA 1TADA 4DDWA 4LN1A 5E6RA 4BZQA 2XUGA 3BEOA 2WTAA 3H9JA 5ENVA 4PGAA 2EKDA 2CK3D 2R66A 1ADBA 2Z30A 4IEEA 1ZUD1 1XA4A 3QE4A 3L8ZA 3G7NA 1IVNA 1F12A 1XMQB 2EW8A 3UAYA 4FFMA 4OHRA 5CJJA 4DLKA 3MGKA 3UOAB 3KLNA 1I30A 4I5FA 3MWKA 3OTWA 2FX3A 4XPIB 3U1TA 4BNFA 5LA6A 4FS3A 1Q1NA 4QUGA 4IJKA 2DLNA 3EQZA 3QWAA 1NQAO 4L4YA 4B3RB 2VYVA 1TM5E 2VAPA 2YCBA 3G8YA 3HDHA 1N2JA 2D1QA 4J1SA 4ILKA 4JB0A 4CQNA 3DTTA 2IELA 3TQHA 3Q3HA 1L5GB 4GSLA 4YCBA 3DT8A 3FPHA 3ZWYA 3O2NA 5ICSA 2QRVA 4X8LA 1DDGA 5BWLA 1RHUA 1E0JA 5EE5B 2I55A 3HVKA 3UHJA 4DLSA 1P2DA 1O57A 1O95D 3AINA 1TPYA 3ETLA 2BGUA 2VJMA 4G8BA 3LQKA 4H1UA 2QTHA 3DJFA 3TRHA 2IYWA 2YQ5A 2Y1OA 3QU2A 3L2OB 4QOSA 4LHXA 3SHVA 2D5AA 1WUKS 5KNDA 3FUTA 3UT0A 1WPQA 4A2PA 1BE1A 1SR8A 2HMVA 3ZS9A 4E08A 4EPXA 4HPXB 2E49A 4B44A 4PXAA 2VT7A 4M3NA 3SIWA 1KFEB 2PMDA 4LDAA 5HM8A 3MG9A 1L4GA 2G4LA 3GZ4A 4KFSA 2OCXA 4MLCA 3N87A 2Q0QA 2Z4TA 5AXBA 3AEUA 3I1YA 2Z8YA 4LSZA 1TEVA 2C3OA 2WZDA 1K97A 1DE0A 2B2NA 2H5IA 3EXIB 2Z5GA 4QQKA 3T7RA 4EVQA 5JS7A 1G9TA 3BWVA 1JMKC 2O6LA 5AKLA 3PLRA 1A7UA 3PKIA 3S40A 1AZWA 2JF0A 2Z8ZA 3QPWA 1LS1A 3CMCO 4B43A 1OWLA 2HF7A 3KPUA 1RFGE 2P2GA 1YBHA 2OORC 3NTVA 1YMVA 5H02A 5TS2A 2EQBA 2JGEA 1BS9A 2X0KA 4D82A 2W2LA 5JCXA 4JH0A 4LF6B 1RJGA 1LW6E 4KXMA 2C2HA 4YUWA 2O8DB 3Q8XB 2AQ8A 4GPEA 5CX1B 3UQYS 2FZKA 3HNPA 2WDPA 4C3VA 4WWHA 4GSYA 3MWYW 4D9IA 2Q3CA 3CWZA 4RF2A 1OH8A 1RRCA 4Z5XA 3IXMA 5TJ9A 4Q05A 4AG6A 1KFKB 2G0AA 4HWKA 3GJ8A 1Z17A 2VXCA 3GO4A 1PUJA 3DUFB 1S8AA 4MKGA 1HA3A 4Z4EA 2B8NA 5B4UA 1GU0A 4H1VA 1FC0A 4UAJA 1L9XA 3FPLA 4JBNA 2CB0A 2RONA 4QHSA 3GUHA 1PJCA 4MW0A 2YMMA 5F23A 2E4VA 1KAQA 2PWBA 2W9XA 4O4LA 4WOBA 5MN4A 4BMVA 4UJ5A 5ICCA 2P4QA 4C7KA 5TQ0A 2WHEA 4IQGA 3ADBA 1F1BA 3GHYA 1L5NA 2BEVA 4OHVA 3MXOA 4EIWA 1GZ4A 1JT2A 1Y1SA 1GCOA 2XODA 3BHNA 3QPAA 5LR6A 1NKSA 3ZY6A 4IDBA 1NT4A 3FVTA 2PTGA 3LCUA 4JT2A 4UAUA 3UHFA 3GR6A 3P5BA 4EYQA 1V3UA 2X58A 4JX8A 2H52A 4C89A 2GN9A 1EEHA 3H0EA 3RYHA 2IBTA 1RWMA 3CB4A 3IKVA 1AXRA 1ZO8A 1RBQA 2H9YA 2XYVA 3LKBA 4Q02A 4RENA 1OE0A 1Q0QA 4YO8A 4DV2B 4URVR 3EZ9A 3GGCA 2J5RA 3BOSA 1COWA 4GLJA 4K28A 4MWCA 1PG0A 2ZM5A 3Q3JB 4IH1A 3PHHA 4DDTA 4UPVA 3CO0S 3GN2A 1TU3A 1NZDA 5HJ5A 2ODPA 4O02B 4RSGA 1FFYA 3VSCA 3F90A 4UMDA 2PSEA 3BILA 3PCTA 4IFIA 4NCJA 2Z9BA 1ZH8A 4PAQA 4QYSA 4WNAA 2QBYB 4AO8A 4YMHA 2B36A 1Y5NA 4ACBA 3S28A 2XBMA 3K9BA 2GD0A 5FUMA 3KYCB 3V32A 3CVVA 1PJBA 3CUYA 3HU3A 1TYDE 1Q14A 4KAAA 4WDQA 1DC3A 5EWMB 1Z56C 4EL5A 1XHEA 3KUKA 3JWJA 1QRSA 5K05A 1V47A 4H0CA 4MV6A 3EK2A 4C78A 1KO5A 1YR3A 5B1SA 4W9NA 1P75A 3TLAA 1FBNA 1GRCA 1Q92A 4CFYA 3FNGA 4JZYA 4ZU1X 4ND3A 1KBQA 2GX6A 3E5HA 4CIDA 3KZVA 3HCOA 4M54A 1C1YA 2YJZA 1IEQA 4MULA 3X3HA 2ODNA 3I53A 1DO8A 4TYPA 4KO2S 1LPOA 1OVMA 2QDXA 3MJTA 3NBMA 3MJ4A 3QE3A 1C0PA 1DC4A 1KAHA 4XSGA 4PM4A 1PK9A 1TMGE 2W6NA 3WQSB 2YJ3A 4URXR 2GBFA 4FEAA 2GESA 2BMJA 2FPIB 3OZTA 3AHFA 4AG5A 4DADA 2AI2A 3S8EA 2G7MC 2RKBA 2YZGA 3DOOA 1S0UA 3IT1A 4EGFA 1JLKA 2HF2A 3LVBA 4WAUA 2XE8A 4P7JA 1SVLA 5AMXA 5JQGB 2R87A 1LPPA 3CF0A 4AWAA 2O2IA 3M70A 3NTLA 2CLMB 4FDLA 1Z2OX 1JPNA 2FJPA 5EQTA 1BU8A 4R2HA 2FU5C 4INAA 4LHYA 3AM5A 3ITEA 4QU8A 1C8VB 4GGOA 4IY1A 1MTOA 1P73A 2FHSA 2HK9A 3G5TA 3VMFA 2VPZA 4MMYB 4R81A 3Q87B 4Q9JA 4LOKA 1H3NA 1ODKA 3ANYB 4LPSA 5TT0A 3ZQ6A 2FW0A 1O4WA 3BUSA 1ZL0A 3FSEA 3SFTA 9LDTA 1RE1A 4N0EA 3FDZA 3NALA 2QAGA 4JVSB 2YJ5A 4MV7A 3EOAI 1L7BA 2IZ6A 2PRKA 3HA2A 4TT3A 4NMLA 5A7HA 3R75A 2IYAA 1F5NA 1BVYF 3Q7SA 5TGDA 1PW7A 1ZGCA 2A5GA 2ZWPA 3BKXA 3C8ZA 2GARA 1GZ5A 1PZXA 3KOZA 3MOGA 4FJ2A 2I2FA 5EXSA 5E9AA 5K3BA 5IVPA 3UY4A 3C8HA 4GVPA 5C18A 5ITZA 1TCVA 5ALTA 1ZQ9A 5K8TA 1JIXA 3AIMA 3BH0A 4U7WA 3A25A 2XHEA 3HPRA 2ZULA 2C4NA 3UYKA 4C7VA 4E7PA 3VI4B 2UUBB 3LOUA 3FPBA 1PT8A 1E20A 3V3TA 4G63A 1BMQA 4MYUA 4G0PA 1QPGA 3SI7A 3SEAA 3KKEA 3D0KA 4XQ9A 2FQYA 1WY5A 1VBMA 1ZJ4A 2W2OA 1YOBA 2JL1A 5DLEA 2V6FA 4AUEA 3NVMB 4JUAA 2WAMA 3OUUA 4WKNA 1NJSA 2D62A 2E6UX 1JWAB 3NOOA 3ONVA 4G5RA 4BRWA 3AEXA 1XTKA 1D2CA 1X1TA 1W1WA 4P8RA 1N92A 1YQGA 2AJTA 1AU9A 1ZUWA 5IT4A 4RIHA 2W2XA 2O06A 5CDFA 4C0KA 3B9PA 3PE6A 3BSSA 3V5NA 4JWKA 1ZNYA 2V97A 4EHFA 4CKWB 2P2ZA 2ZP1A 1EH5A 3LQYA 1BDHA 3V46A 3L01A 1IDOA 1KVTA 4NZNA 4WBNF 3DEIA 3GLVA 4JEIA 4ZOQI 1I33A 1N57A 3B85A 2R97A 1NOJA 5A05A 1U4OA 3KKOA 2C00A 3KQOA 4MI3A 3UAWA 3YASA 3GCXA 3MJVA 4H6WA 5JNUA 3A1EA 3ZZTA 1LLQA 3R3UA 5CXXA 3AF0A 3VV3A 4QWWA 3DZDA 3QLUC 2ZJ1A 2Y92A 1MRNA 3SPXA 4B5LA 2DUUA 4JUIA 1CFJA 1J20A 4KQCA 4QUKA 4OHWA 3P0HA 2PKXA 4Q47A 4BUZA 2LCQA 2QVLA 3FSGA 1I1OA 1ZM9A 4JCCA 3F3KA 3IP9A 1E5LA 2X8JA 5ALQA 1YU6A 5CLGA 5M29A 5TR9A 4O5OA 3P4YA 3DDHA 5BW8A 2Y1KA 5AKZA 3HA5A 2ZS7A 4R1SA 2UYHA 5IS2A 2NSHA 5CNMA 4E1BA 2ZRNA 4ZT3A 2JCVA 3D7NA 1F3OA 4XIYA 5AXDA 4CMBA 4P4LA 4DMGA 1NXVA 2XTAA 2GN8A 2J9FA 2JLAA 2QTFA 5JMPA 3K6SA 1O3YA 1UXJA 2JFWA 3GCWA 4YRPA 4BRSA 3G1TA 2RFLA 1MRSA 1P4SA 3QUTA 3AZPA 4F4IA 1ODFA 3B3FA 1BWRA 3FHOA 1UXHA 3FOZA 1GSIA 3IMEA 3VUFA 1JG6A 1QGAA 2LV8A 1Q0HA 3OQ1A 5IRCD 1OCEA 3P9PA 1WR8A 3DXXA 5CAEB 5JMOA 2R6HA 3V1LA 1YQUA 3JSXA 4O2AA 5F2OA 3TBFA 5I7SA 3WMGA 1VM6A 3E9YA 4DJEC 4BMCA 1F4VA 3R5FA 3W9UA 3DCJA 4GF5A 1XQ1A 3C7TA 1B15A 3JPWA 2PUDA 3PLAE 4EI2A 4KBFA 5IC4A 2G7ZA 3ICVA 4MWZA 3TQRA 2X9QA 3L1VA 1Y3FE 3DBVO 1F8XA 3K73O 5G41A 5CA1B 3ZLVA 5KYXA 1ECCA 4C6HA 1YH3A 1IZ0A 2ODQA 1GAEO 3RU3A 3I42A 1QNFA 1XD2A 2EBUA 1MPTA 4XJVA 5K0SA 3E8SA 1Z35A 1M9NA 4F06A 3QE9Y 3FTEA 3AF3A 1T4DA 3OOWA 4AZ0A 4KYUA 3PS9A 1MJFA 2OHFA 2WM9B 3DFZA 1WNTA 4G4GA 5DLDA 3I9V6 3EQ7A 2EX4A 4WQMA 4YUZA 2L2QA 1QIEA 4C0WA 4EHDA 3OQMA 4B4VA 3EEOA 3T5GA 5BWOA 1OHHA 4NP6A 1NBAA 4R2WA 1GCAA 2ZZMA 3IAM6 1F2UB 3LM8A 5G3ZA 4YQZA 2IXAA 1EE9A 3WLHA 3ZK7A 1L6IA 4BAUA 5LP1A 2FPOA 3MWJA 3MT0A 4HQ0A 4LXXA 4F9EA 5KINB 3ESQA 1H2RS 2GQ0A 4RKEA 3WQRA 2DETA 1WD5A 4RK0A 1NBHA 1WRBA 3RGWS 4XXHA 4L9WA 1ORWA 4JC8A 3CXRA 3KQMA 4OK3A 4R3WA 4DLXA 3W4IA 1DJNA 1MO2A 2V0NA 4ON9A 4CDGA 5JZ9A 1W36B 4QEKA 5LXTB 4KIGA 1VYTA 4WADA 3CLSD 4J1QA 2PPLA 2JCBA 2PX4A 4MI6A 5IN4A 1OIWA 4O2AB 2QW0X 3TCKA 2QG4A 1DCFA 2IYXA 3ETCA 4CMCA 5KVAA 1K86A 3KR9A 3VBCA 3LGAA 2OGZA 2ZS9A 2QTRA 3MFYA 4GWKA 2JVKA 3K0FB 3OZEA 4F12A 2IH2A 2I2DA 2GJAA 5F2KA 2JGRA 2X14A 2CJXA 3TM4A 1TAGA 3PTLA 4DCGA 2XUZA 2JRLA 2JI7A 4JQYA 7ADHA 1J00A 1MJNA 2ZREA 4LVOA 1Q0SA 3Q15C 5FH9A 1U28A 5BQPA 3UT5B 1POWA 3EF3A 1Y1KE 2UKDA 2O2HA 3CLUD 1X3SA 1ZSNA 2A9VA 1AUXA 2LGJA 5CCXA 1J23A 2HREA 3O4GA 3HB4X 3IAS6 4DV4B 3W7VA 4BLSA 2GD2A 2RMKA 4Y6LA 4RTKA 1U8CB 1RXIA 4I55A 4EA9A 1JFLA 1FFBA 3GYGA 2J5KA 2XMGA 2C61A 2XYRA 4F6CA 2RHTA 5IJ9A 5AVKA 2Z2YA 2WYIA 1BS1A 1Z36A 2P0EA 3IHWA 5I9TA 1F2UA 2NV0A 3M34A 3EUAA 1KOLA 5EJ9A 3KVOA 1I3LA 1NUQA 3F6EX 4PHCA 5JS8A 2A9PA 1NMYA 3EVCA 1CZNA 1T1JA 1V0JA 4MYHA 4EHLA 4NU5A 2HFKA 3RODA 2NUTB 5KNBD 2FFJA 4GNKA 3ZJUA 4E5KA 3H19A 2V4MA 1KVSA 1J39A 5GONF 1UBLS 5KSOA 5DSXA 2HRBA 1P3Y1 1S9HA 3KWFA 1HT0A 1OYVA 1QGED 1E60A 3ZI7A 3BGDA 4NK4A 4TTJA 1M6NA 4EF5A 3SOPA 3NO4A 2J3JA 3VR3A 2VHCA 2ZJ6A 3IQWA 4ZDWA 5KIAA 4XM2A 1A27A 1FDTA 1XO1A 2NUPA 1PFGA 3IQZA 1A9QA 1CJMA 3OQJA 4KAJA 5FA5A 3RFVA 2B3TA 3VSAA 3WHLA 3ORFA 1JFFA 4K6MA 1E2UA 1YVUA 2R8EA 3CN7A 2OYCA 5KMGA 2XH8A 3CWQA 3LXMA 4YLYA 3HR7A 2REXB 4H7DA 4EAAA 3EXHC 2E4WA 1G1AA 4JT4A 1KTIA 3WLRA 5EIWA 1LI4A 2VYFA 3E5NA 5A3JA 2JASA 3NT4A 1NF8A 4RHTA 1S2OA 2QP9X 5JY1A 4C4ZA 4CG1A 3AL3A 1PP4A 3LLVA 1IHXA 3PNPA 2GBPA 1G59A 3MOIA 4F5ZA 1ZNWA 1G2IA 2OCPA 2X2OA 5AW3A 3HS3A 1I3NA 1IB0A 1WSAA 2WTXA 2JA1A 1WMDA 2G70A 1KPHA 4LKRA 5IEBA 3ED1A 3TIFA 4C7OA 3T7JA 1LTHR 4G0WA 3L8FA 3VZSA 1I0IA 5ALJA 2DERA 1AQ6A 2XEXA 4GZLA 1GV1A 4OAQA 2DE0X 5ECDA 1Z2NX 5ARCA 1KJNA 1BKSB 1L4UA 1DFHA 2PANA 4G09A 4UREA 4V2IA 5JYBA 3HADA 1VCHA 2AYXA 2FPUA 2J46A 2X19A 5EIBD 3C8MA 3O31A 2O0KA 1WW8A 5C3MA 5LQCA 3JZMA 2HI0A 3PU6A 1U2SA 3HUUA 4J3NA 3UB4A 3ZPXA 4C6SA 1JX6A 4DDVA 2ZJ0A 4TWBA 5FV4A 1NSYA 4EG6A 1D4AA 1CUYA 5I9SA 3NP7A 2OO5A 2CBZA 2BGLA 5F5NA 1QYIA 5ALVA 2ZUCA 2IKQA 2HHCA 1NSFA 1MENA 4V03A 3WYCA 4XQ0A 2RG1A 2V98A 3FWZA 3DZHA 1ADFA 4L9SA 1JDNA 4A23A 2SNIE 1GEEA 2FZGA 4ATNA 4IR7A 5C3UA 4HDKB 4KHZA 5DHUA 4CM4A 1L1FA 3X1MA 3LNTA 4IJ6A 2OXRA 5ECWA 3I9OA 4XIIA 5K5EA 4M99A 4J9UE 1COWD 1EK6A 2W8BB 1EK5A 4TTIA 4KQJA 5CURA 1YDEA 3ZKAA 4AJPA 2IP2A 4CODB 4I08A 4P4TA 2WKQA 1A72A 4TS1A 4JGIA 3ZOKA 4ZJUA 3B82A 4D4MA 1ZS9A 1TGVA 3R5XA 2ES4A 4E1AA 3T34A 1J2UA 2GO1A 4TTSA 1A95A 3AU8A 1VFNA 1P0FA 3DE0X 4RA6B 4DSZA 2QTWB 2NTJA 1Y5RA 4ZMRA 4Q1EA 3RG2A 2ZU0C 4PNHA 5A3VA 1D0SA 1WPGA 2DOKA 2WZCA 3ENQA 3KJGA 4II7A 4KQMA 4CV2A 5C1DA 5JXJA 4Z99A 1SD2A 2HGSA 3H2GA 3HKCB 3IDAA 1YBFA 4Z3OA 1UFVA 3TVDA 4L2IA 3ZHRA 1GPWB 1W5AA 2VBCA 4DAOA 2WD9A 3QFTA 1MG0A 3EH2A 2YXBA 1PFWA 1PLKA 4YH1A 3T94A 1YACA 1GM5A 2BW0A 3W8RA 3T35A 4C2AA 2VH2A 1NW5A 2XB8A 4P82A 4ZODA 3OCWA 3A70A 2IX9A 3C5VA 4OV6B 2IYEA 1PG5A 5F35A 3ZCPA 3V4RA 2B34A 2PO5A 4D81A 3G7UA 4O3MA 4MLDA 2X1VA 2OCDA 1YXMA 4TYWA 3DTVD 1Y1LA 3G5UA 1WZEA 4RETA 1JAYA 1JP7A 2B6NA 1XEWY 1V6AA 3SYRA 2EDCA 2YZMA 4LF5B 4MV0A 4LRTB 3D02A 1T3LA 3I32A 3AHJA 3DWGA 4MGKR 2VA9A 4MVCA 4Y7DA 4II2A 4WXEA 3SIRA 1QO0A 4ZVVA 1JJ7A 4JROA 5BXQC 2GWHA 5FFNA 2EGGA 1D2MA 3KAKA 2X9LA 5E8JA 4YP6A 4NH0A 5MFPA 1ZCBA 4JKIA 5AI8A 1M7GA 1L5RA 3G2JA 3ISJA 1A97A 4ITVA 4W5NA 2VPIA 3BK2A 1VHLA 2FMXA 5KVSA 2WTEA 2BKAA 2ATVA 1C4KA 3WRWA 3TSYA 3PICA 5AT1A 3GP8A 1EFCA 4DGQA 3EPHA 4ZP1A 4ZI5A 3TEFA 1FTNA 4ER0A 1M2HA 4FR2A 4N3BA 3ENZA 3LXRA 5BSGA 1T26A 4OOFA 2NTVA 4HB0A 3FMOB 2MSKA 4XFDA 2GUWA 4BQRA 4I5EA 1CQPA 1L4KA 2Y27A 1EZ4A 5F1YA 2AQIA 2JGIA 1CJSA 3H9BA 3U3RA 1VGVA 1VJ1A 4M1WA 2OFXA 5K1ZA 3JZDA 1KMHB 1WPXA 2PEZA 4HQ6A 4JLUA 4RDIA 2Y2UA 2P77A 1KZ7B 1N4DA 3SKYA 1KY3A 3VGJA 4HYTA 1JHPA 3P2JA 4ZVMA 4Z51A 3T5TA 5JMWA 1OBVA 2WSIA 4TSFD 1F0YA 4YI3A 1A4XA 3NBKA 4MA5A 2R7KA 2GILA 3GDGA 4AY4A 4JIMA 4CBVA 8ADHA 2WJAA 1M1NA 2PGIA 1W73A 4BGIA 1GSOA 4TTRA 1GCUA 2H1LA 2HJHA 3M6WA 3UKOA 3I04M 4Z9FA 3E9MA 3FDXA 1SG9A 5DPMA 2I2BA 3MD0A 3AHEA 4FINA 1T8PA 3HR8A 2XITA 3FR8A 3NGXA 4OA5A 2WJHA 5GMOA 3A1WA 4OQMA 1VRWA 2Q0SA 4HRYA 3THOA 4B85A 4ZCMA 3E4DA 4TV9F 4PPYA 4FB4A 3AR8A 3R3HA 3U4CA 4FZ3A 3K32A 3MM4A 2PPVA 3KHTA 3D1LA 3UWMA 1QIDA 3HYSA 1XQ9A 3N39C 1EWTA 4MS3B 5HBGA 4ZIRA 2OCBA 3K9QO 3WLOA 3HSYA 4YS6A 4M0LA 3RSZA 3CVWA 1JH9A 2Z2JA 3JPYA 1PJAA 2HZBA 3FMFA 4U2KA 4FMPA 4XWYA 4FYXA 2HU7A 1IN4A 3I9JA 3VRHA 3UH0A 1AMOA 5E0KB 1VKRA 2DKOA 2I6UA 2VH1A 5E9JA 4L4RA 5AI5A 3W5CA 2ORYA 1H4TA 1JQAA 2PYDA 3WJ7A 4FHGA 4I4IA 4M9XA 5CDYA 3ZXYA 3LUGA 1MJGM 1O9GA 4YQFA 4B3MB 3V7WA 1JXMA 1PW5A 3QUBA 4EPVA 5K2OA 3FOWA 1SRRA 3C97A 4IJVA 3ZXIA 4PHFA 2Y67A 5CBPA 3ID6C 5LOVA 3SAJA 1UWKA 4RK5A 4HF7A