1SUIA

Alfalfa caffeoyl coenzyme a 3-o-methyltransferase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
227
structure length
227
Chain Sequence
KSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeoyl-CoA O-methyltransferase
publication title Crystal Structures of Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
total genus 82
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.104: Caffeoyl-CoA O-methyltransferase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1suiA00
4BLWA 2UYOA 3G5TA 2OYRA 3I53A 2DULA 3M33A 3BZBA 3NTVA 1Q0SA 2GAFA 2JG3A 2VDVE 2NNWB 3G89A 3LCVB 1QAOA 3EVFA 4QVGA 5EZQA 3OFKA 5ICFA 3TR6A 2OB1A 4BY9E 3FTEA 2AN3A 3G8BA 2QM3A 2PX8A 3SSNA 2OB2A 5DX8A 1G6Q1 5CUQA 5G02A 4OQEA 5DWQA 2NYUA 1MHTA 2Z6UA 5HILA 3KPUA 2N47A 1BHJA 3KHKA 5KQRA 5GM1A 4DZRA 5HEKA 3EVEA 4M38A 1F3LA 2IGTA 3LSTA 4PYKA 3TKAA 5GIOE 2ZTHA 3GO4A 3FTDA 3A27A 3NW9A 1NBIA 2G8NA 3E7PA 4FP9A 3ME5A 4LG1A 2ZCJA 3LGAA 2HV9A 5DTRA 1T43A 5FQOA 3DXZA 3EVBA 1P39A 4ZTBA 3DLIA 2AVDA 2BR3A 2CL5A 2GA9A 2BH2A 4RSRA 3QOWA 3T7SA 2PXCA 1NW6A 3T7TA 3MHTA 1JSZA 4EK9A 2ZBQA 3DR5A 3HVIA 3GDHA 5DTQA 4GQBA 2JHPA 5EEGA 3C6KA 3ID6C 5H02A 5HZMA 2VS1A 2R3SA 2FPOA 2UYHA 1XXLA 2PGXA 2ZBRA 3KPYA 3KPWA 4F84A 4RTPA 2HWKA 1X1BA 4C08A 3B89A 3LBYA 4YUXA 1FBNA 5LQUA 2AS0A 2O05A 3OFJA 4FSXA 4RYLA 2AOUB 1VIDA 1HNNA 3LX6A 1SVUA 1VP3A 4EMSA 2ADMA 1JG1A 2GS9A 2YVLA 2FK8A 2NXEA 4YUZA 4GOND 3UJAA 3MGGA 3R24A 5EMLA 2P8JA 3NJRA 1XTPA 4HTFB 2O07A 1O54A 5ICEA 2PX5A 4AZVA 5HOQA 1KR5A 4RVGA 4R8RA 3P97A 4FGZA 2QE6A 3TMAA 3GJYA 5KYGA 3PT9A 5BW4A 2OXTA 2JH9A 3LDUA 1I1NA 2O0LA 4X1OA 4IV0A 1SQFA 1TW3A 2BM8A 1RI2A 2PXXA 4GOOD 2ZFUA 1M0EA 4M36A 3ELDA 1XCLA 4PWYA 5LQJA 3G2MA 1PJZA 3FYCA 2BM9A 2EG5A 4LWPA 4PYQA 2OY0A 4L7VA 3R6TA 5E9WA 3MTIA 3CJQA 2ZBPA 3OE4A 3KPJA 5D1NA 1ZGAA 4C04A 3IYLW 2YQZA 4Z2YA 2ZIGA 4P7JA 1L3IA 4YUWA 2ONYA 3M6XA 3NDJA 4GEKA 1VLMA 3CJTA 3KQOA 3DMFA 2NXNA 3THSA 3EMBA 1G8SA 4RTLA 3UJ6A 5IKMA 3C6MA 3ELWA 3BWBA 4PYMA 2O06A 5F2OA 3SX0A 4E33A 4RWZA 5P8WA 1RJDA 5DTMA 3GRRA 4E31A 1ZG3A 4PYOA 2VDUE 5DX1A 3FPFA 3GNLA 4GUAA 2Y1XA 2PXAA 3OZRA 5E9QA 4BLVA 2CKDA 1QZZA 3M6VA 3PTAA 1ORHA 4PYIA 2AZTA 5E8RA 3GGDA 2PWPA 1UFKA 4CKBA 4CKCA 3LL7A 5KS2A 3BWCA 2B9EA 2AOUA 4LECA 2AR0A 5FA8A 4EKIA 2HTEA 5GP1A 1VBFA 5DM0A 5K0GA 4ER3A 3PS9A 2PT6A 5CCXA 3FYDA 3EEOA 4PIPA 5E8JA 4PINA 2C7PA 1NBHA 3O31A 2V74B 2GB4A 2YXDA 4HTFA 4RTKA 1AV6A 1ZGJA 2PJDA 1KPGA 2UYQA 4X61A 4M7RA 4QTTB 4AZSA 1VE3A 4CKEA 4ER6A 3MAGA 1EAMA 1NE2A 2BR4A 3P2EA 3G5LA 4RVHA 1NV9A 1O9HA 1P91A 2ZIEA 2ZVJA 3IV6A 2K4MA 3QOXA 5GWXA 5HIIA 4KDRA 1YFJA 5EVJA 3P8ZA 1IXKA 4QDJA 3MQ2A 3FUWA 1NV8A 2IDKA 2VDWA 4FT2A 4CWAA 5DM1A 4OA5A 1WZNA 1EIZA 1QAMA 2ESRA 4OBWA 3P2IA 2B25A 5CVEA 3G2OA 1JTFA 3FPJA 4O29A 3UJBA 2P7IA 4KWCA 4PCAA 1XDSA 2H1RA 4DA4A 3GRYA 3BXOA 4DMGA 4F86A 5E1MA 2FCAA 2IDJA 3DULA 5EG5A 5EMJA 4WVLA 4EQZA 5FHRA 1ZQ9A 2ZZKA 3B3FA 2ZIFA 2WA1A 2BR5A 2Q41A 3UJDA 5K05A 2NP7A 1L1EA 3HNRA 3A26A 5ERGB 3SSOA 2G1PA 5EKUA 1V39A 3LCUA 1P1BA 1KHHA 1FP1D 2Y1WA 2AN5A 3UJ7A 1D2CA 3B7PA 4DQ0A 5ICGA 2C7RA 2IBSA 5CIYA 2YX1A 4OX9Y 1NW3A 3B5IA 2OBFA 2OKCA 3DH0A 2HNKA 3GU3A 3M6UA 3TRKA 1DUSA 4KRGA 4C4AA 3GIWA 2UZ4A 4RTNA 4R8SA 4UOEA 4XUEA 3OU7A 3UJ8A 3EVGA 5C0OE 5FQNA 5K01A 5DPMA 3LBFA 3UJ9A 4EVIA 3ER9A 5FWDA 4E2ZA 1R8YA 3TM5A 3IHTA 1ORIA 1YFLA 1B42A 5LQAA 1YZ3A 2HMYB 5EMMA 3WSTA 5EIFA 1BC5A 1G8AA 3LDFA 4PCLA 3REOA 1IY9A 4KVZA 5B1SA 3VC2A 1R18A 3DMHA 2EJTA 3DLCA 2YR0A 3A4TA 5K03A 4NECA 3OU2A 3I64A 4X63A 3P9KA 5LQRA 4HSGA 3LCCA 1SG9A 3HCDA 3TM4A 1NKVA 3SVZA 5DRYA 4U7TB 1G60A 5HIKA 5K0FA 2Z6AA 2IBTA 3FUTA 1VPTA 3FUUA 3PX2A 1MJFA 1JQEA 1RI3A 4LWOA 4GBED 3AY0A 3JWHA 3DMGA 2E5WA 1SKMA 1Q0TA 3K6RA 1XDZA 3AXTA 4MHTA 2P1DA 3LKDA 4PYNA 3SR4A 5E1BA 2PVCA 3T7RA 4QQNA 3BGIA 5LQKA 4HH4A 4K6MA 3BWYA 1L9KA 4GOMD 2GH1A 5FTWA 3OU6A 3GWZA 1BKYA 5FCDA 2EJUA 4OA8A 2ZSUA 3DOUA 1EJ0A 2KW5A 2PSSA 5DSTA 5EEHA 3FUXA 5T64A 1SUSA 3RIEA 3E8SA 3KU1A 3U81A 3OZSA 4V0RA 2HR1A 4MTLA 4RTRA 3RW9A 5BP7A 1R6AA 5FADA 2ZWAA 4RV9A 5K0EA 1WXWA 4QDKA 4XUDA 4A6DA 1RJFA 1WG8A 3CVOA 2WA2A 4MWZA 4QTUB 4WXHA 1H1DA 4P7GA 4BP1A 2FRXA 1IM8A 3BKXA 2LD4A 5DM4A 3FPGA 3K0BA 2AOTA 4JXJA 1JQDA 2JHAA 1RJEA 3G7UA 3IEIA 1D2HA 3FRHA 1X1DA 2I62A 2DPMA 3EPPA 4IWNA 2QRVB 4RTJA 3KQPA 3D2LA 2Z6QA 5CVVA 5MHTA 3LHDA 1FPQA 1G55A 1OR8A 3HCEA 4FR0A 4P7KA 5DM2A 5DXAA 3CC8A 5E2AA 5F2KA 2P3QA 4E70A 4QPNA 4HRAA 2ZZMA 3KR9A 2I6GA 4MIKA 1YZHA 3HA5A 4AZWA 3HTXA 3OE5A 5HIJA 3FUVA 5KVAA 5GOZA 3ELUA 3ANXA 2ZWVA 4HC4A 3OZTA 5K0BA 5CCBA 1D2GA 3TQSA 5DLYA 1R00A 3HVJA 5DRTA 4PGGA 3CKKA 4Y2HA 3NMUF 5K09A 3HEMA 2NP6A 2B3TA 2OZVA 1SUIA 1R74A 4KIGA 2B2CA 3EMDA 2ORED 1M6YA 3VSEA 3KQYA 3PB3A 1P1CA 3VYWA 5K0CA 5CVJA 1JG3A 5EZSA 3AJDA 1KXZA 3H2BA 5FUBA 4FZVA 4POOA 2PX4A 3F4KA 3UFBA 3FTFA 2AVNA 4PONA 3R9XB 3HVHA 4BP3A 3KQVA 4CXMA 3MB5A 1U2ZA 2H11A 2G72A 2EFJA 1XVAA 3FRIA 2B78A 5T6BA 3TLJA 4YMHA 2AN4A 4C05A 2JJQA 4RVDA 4X41A 1RI4A 5CVDA 1L3BA 3BKWA 2AOXA 2G70A 4DM3A 4E2WA 3O7WA 1KPHA 4MQ4A 2XVAA 4CTJA 4YV0A 5JR3A 4KDCA 3NDIA 4YMGA 3ORHA 1L3CA 5EMKA 4E2XA 3EVCA 4OQDA 4Y30A 5IH3A 2WK1A 3P2KA 3DXYA 3BT7A 3I9FA 2PX2A 2IH2A 3FZGA 4AX8A 1JQ3A 5FHQA 3NWEA 3HCCA 1N2XA 3HA7A 3SXJA 5EKXA 2XBMA 1AF7A 2G71A 1XDUA 2PWYA 2QRVA 3G8AA 3HP7A 4P7FA 1ZHFA 3TFWA 3EVZA 3SMQA 5U4XA 3RODA 3UA3A 3VC1A 3BUSA 5EGSA 2CWWA 3PFGA 3SM3A 5M5BA 4RTOA 1EJ6A 3CCFA 3M6WA 4PYJA 4IKPA 5DXJA 3G88A 3HVKA 2XYQA 3KQSA 5EOVA 5DSXA 4GOLD 5FWAA 3Q7EA 5LR6A 5ICCA 2XYVA 2YXEA 3I58A 1INLA 2AOTB 2P41A 3S68A 1JG2A 2PBFA 1FP2A 5E9JA 4ER7A 5K0JA 3X0DA 3FPEA 3MTEA 4RX1A 1NW7A 1VP9A 3ERCA 8MHTA 1BOOA 1X19A 1X1AA 4M37A 5E1OA 4FS8A 1VQ1A 3EVDA 3GRUA 5T67A 2P7HA 4PYLA 2P35A 2YXLA 4R05A 3O4FA 3SSMA 1NW5A 1QANA 2P3OA 1WY7A 5K0LA 5GIPE 2I9KA 10MHA 1DCTA 3A7EA 2VZ9A 3P9IA 1NW8A 1TW2A 2ZW9A 3DTNA 1I9GA 3LKZA 4GC5A 3PVCA 3UJCA 5DT2A 4DCMA 2PLWA 5C1IA 5D1HA 4DF3A 3UZUA 4YUYA 1N7JA 3AXSA 3DP7A 5BW5A 1M6EX 3B3GA 3LECA 3NWBA 5HIMA 4V0QA 3PLAE 2PT9A 3GXOA 4EKGA 2CMHA 4RTQA 7MHTA 1JG4A 3KQMA 3ELYA 5FA5A 3UBTA 5LSAA 1N7IA 1ZKDA 2PKWA 1KIAA 1KYZA 3EVAA 4XUCA 2IPXA 1KP9A 2JH8A 3T0IA 4CTKA 4AZTA 4C06A 2AOVA 3UA4A 2C7QA 2R6ZA 5E2BA 1SQGA 2PY6A 2ERCA 3KR1A 2OPBA 3JWIA 3KPVA 3BGVA 4PIMA 1JTEA 2BZGA 5E1DA 3DUWA 5K0NA 3HA3A 3P9NA 3C3PA 2ZLBA 3A7DA 3CBGA 4QVKA 4ER5A 1AQIA 3BWMA 1UIRA 1XJ5A 5EIWA 4KW7A 2IFTA 3MCZA 4AUKA 2P3LA 1EG2A 3QV2A 1Z3CA 3DXXA 3E23A 4OBXA 4YV1A 3LDGA 2I7CA 2A14A 5KQSA 3R3HA 3THRA 1X1CA 1Y8CA 2F8LA 3KR2A 1WS6A 5C9ZA 3HCFA 3KQQA 3KQTA 5EQJB 3SGLA 5F2NA 1RI5A 4H0NA 4HG2A 4IV8A 1F38A 1G38A 3ER8A 2IP2A 3MCTA 3HCAA 4RVFA 5EPEA 2GPYA 2CMGA 3UWPA 4P58A 5LQNA 4C07A 1WXXA 3JWJA 3HCBA 5EC8A 4ER0A 3TOSA 1YUBA 2ZULA 2AOWA 3OCJA 3M70A 5GM2A 4ISCA 4RTMA 2YTZA 5GINE 1DL5A 1YB2A 2NXJA 3M4XA 4FT4A 4X60A 2P40A 4F85A 5BXYA 1KYWA 3CGGA 4PGHA 4R6WA 3TKYA 4C03A 2XYRA 1AQJA 2IH4A 1QAQA 4DCGA 4GC9A 3EGIA 3PX3A 1QYRA 2OO3A 4G56A 5DX0A 5FULA 4PNEA 3CJRA 3FTCA 3HM2A 2FK7A 3AWIA 3NVMB 3I5UA 3OPNA 3KR0A 2VP3A 2IIPA 3FPHA 1HMYA 3C0KA 1FJXA 9MHTA 1EQAA 4B17A 2GLUA 4E32A 1PRYA 3C3YA 3JWGA 2IH5A 2NXCA 5LQCA 3MERA 4YUVA 1RI1A 2V7EA 3KKZA 4E2YA 3EEYA 5HFJA 4HGYA 4R6XA 2FHPA 5EHGA 3P9CA 4A6EA 2JHCA 4XCXA 1R8XA 2YUIA 3Q87B 5K8VA 5CM2Z 3KQWA 2ZZNA 1TPYA 3B3JA 4QPPA 4U7PB 2EX4A 2FYTA 3A25A 3EGVA 1RJGA 4QQKA 3V8VA 2QY6A 1VL5A 4DKJA 2XVMA 1YF3A 1NT2A 3EGEA 3V97A 5CD1A 4E30A 3L8DA 3PFHA 1JSXA 1I4WA 4HGZA 4ATNA 1KPIA 3NVKI 4BLUA 2O57A 3P71T 1XCJA 3BGDA 2PV0A 3GRZA 2QYOA 1O9GA 3GRVA 4FSDA 4GF5A 2ONZA 2H00A 4RTSA 2UYCA 3GCZA 3E05A 3G2QA 3G2PA 5EHIA 2C7OA 4KIFA 5CVUA 3LPMA 3R0QA 4YV2A 5JUWA 1JR4A 1UWVA 3TPZA
chains in the Genus database with same CATH superfamily
1QG2A 4BMNA 4NZYA 4HNAB 2ODBA 2Q6KA 2VUSA 4Z1MD 3U7GA 3OZWA 4NOKA 1FUUA 1A82A 1I5EA 2EDCA 5HGJA 1E2GA 5F23A 2ZXUA 1QAOA 3IODA 4MUYA 5BVGA 2Y99A 4MR9A 3H1TA 3ZYZA 3R9WA 3REQB 5KMGA 3S3TA 2FEMA 4ILKA 3SSNA 3IUMA 2AXNA 4YALA 2PUWA 2Q8NA 4Y2UA 1RZVA 3GLTA 4CU2A 1KC3A 4OG2A 3UJ3X 3SLKA 1D5WA 2YS7A 1NOIA 4I08A 1K92A 2DQYA 3VH2A 1G1MA 1RPJA 1ITZA 4M9QA 2FFHA 4YCDA 3GPCA 5FUYA 1YR1A 4KZPA 2R00A 1JEDA 3GN1A 1M8KA 2XWQA 3FJOA 5L45A 3OMXA 2JRCA 5CDFE 3L9WA 1AKTA 3SFTA 3G6WA 4DIOA 4ALKA 2WICA 4FE4A 1MO2A 2GUGA 2MSEB 4Z54A 3SHWA 4AJKA 1ML4A 1XRSB 1QV6A 2VPXA 4RABA 3V2HA 3K70D 1RBMA 5CDUA 2GA9A 4KI7A 1NI4B 1YI1A 2IDMA 3AP3A 3H87A 4XCQA 4JT2A 2IX3A 1QFMA 3R6DA 5JD6A 1CY7A 1CRZA 3CY6A 2RC6A 1CW2B 3ND7A 4L1KA 1RYHA 1DG9A 4H1TA 2NVUB 1DTWB 4HWRA 3KPWA 3GF4A 4NXMB 2D1FA 1PHRA 3EIWA 3GBSA 3IAM1 4K9NA 4Q4DA 1YQ9A 4Z9FA 3EC2A 4EB6B 3TJRA 4DNOA 4D4HA 4Y2PA 1XNRB 1ZSVA 3OTOB 3CISA 2PGLA 5BY2A 3G0OA 1DPFA 2ZTSA 4I5EA 1XZQA 1LPMA 1T6BY 2XUGA 4JYZA 1P7CA 3AJ8A 3CKLA 3PUZA 3FW1A 3R0IA 4HTFB 4C7XA 5CDHA 2BFNA 4UPEA 3WYNA 4TMYA 2GN8A 3AZPA 3CURA 4BO7A 1OLXB 5BRNA 4P34A 3IQEA 4F8EA 5L7WA 3WRYA 2ZRNA 3ILXA 3DO8A 3DVQX 3KVYA 3ZHSA 2R1UA 2EF0A 3B9BA 2ZRMA 3WK6A 1KH2A 5EP3A 1SQFA 1UMCB 2VIIA 4J0CA 3DT8A 2ZFUA 1K86A 1XCLA 1Z15A 4PWYA 1E1RD 4D5GA 1FFCA 3AU8A 2J32A 5AKGA 1ZL2A 4KGVA 3VDRA 5CB4A 2VBCA 5E7IA 5B3LA 3LP5A 5AOBA 4D6YA 3OHPA 5JH7F 2ZB4A 3EXFB 1G5HA 1DCFA 4YCBA 3UOWA 1YKSA 1EWTA 3BE4A 4RA9B 1F17A 2NTVA 1XNGA 4ECAA 3O1HB 4DN6A 3L43A 1E3MA 4DWOA 3CZMA 1OI3A 3LUGA 3P2JA 4FMCF 3EF3A 1J39A 1JQLB 1OF1A 3U6BA 3IB3A 1MT0A 5IZCC 4FMBB 3A6ZA 4K6KA 2Y1DA 4KIUA 5GVSA 4KREA 4PC7A 1VCNA 2B8NA 4OP3A 4ND8A 1HZZA 2XJ4A 3FBWA 3SD7A 3NALA 3IP9A 3TEMA 3VSDA 3N5CA 5HVNA 5AW1A 4P3NA 1Z4JA 2P4HX 1J70A 2KSQA 2I3GA 3EQ8A 1LQTA 4D9CA 2IYUA 2SICE 3PQ4A 4DSNA 4YDQA 2GD2A 4YROA 1E1CA 1MX1A 1ORWA 4PYIA 3OI7A 4B3FX 5C37A 4FDVA 4RD2A 2Q1UA 3HG7A 4BQIA 2A35A 2AR0A 4Y2YA 5AOAA 4MB6A 3VPDA 2X0FA 4CQMD 3RYTC 1EVYA 3PS9A 1HDYA 5B4TA 2C4TA 1TO6A 4XIFA 1GKKA 1BNCA 2FA9A 5DV9A 3ULKA 3L4BA 4TWZA 1Q6ZA 4B09A 5BR1A 4E15A 1JSCA 1KPGA 4ZT4A 3ZGXA 3PZBA 2D8MA 2GEFA 3EZYA 2NQ2C 3IV6A 2WSMA 3NH6A 5AT1A 4L8FA 4IWYA 4RJTA 2BEUB 1S2DA 3P8ZA 4RLHA 4D92A 4DQLA 3FUWA 5EJMA 2VSNA 1G7RA 3G23A 2ZRGA 5FLEX 3VGJA 5FL7D 2Y3IA 4Z8YA 3QYAA 4DIUA 2VSYA 4ZDIA 5JNVA 4RK6A 2ZJ4A 4JLWA 4S1TA 4LAFA 4CDMA 5JXJA 1REQA 1JALA 1NNI1 4O4LB 1CIPA 1C81A 2NM0A 1HZJA 1R6XA 2X9GA 4ZCQA 5D00A 1NUHA 3LY7A 1TOAA 4YCLA 5BMVA 4ZYUA 1MV8A 3GFVA 2VQ6A 2VWPA 1SBZA 1ACJA 1GKYA 5D3KA 3TKLA 2DWOA 2A3RA 3V1LA 1IDOA 1MW8X 5EKUA 4GXQA 2WTMA 5F12A 1NVGA 4FX5A 4ZOLA 4DQ0A 1T9ZA 2AN5A 1KDTA 3H1FA 2R96A 3P9PA 4FHDA 4ZRDA 4DGSA 3HVRA 1N2SA 1FOEB 1M66A 1R6TA 1EE2A 3SQLA 3GAZA 2OKCA 2IOYA 2I2XB 3JSXA 4M21A 1VG8A 1MB3A 2BUCA 2E3JA 3GIWA 3HC7A 3QXCA 4C4AA 3SWWA 2DBYA 5AI0A 3MWJA 4PS1A 4EEXA 1BU8A 1YR8A 4W7HA 1IQPA 5DPMA 4Q4AA 4DMCA 4UUQA 2OFXA 2FMIA 4XPIB 3LMKA 2Q5JA 2AZDA 3O75A 1R8SA 4QGHA 1BX3A 3SZLA 4C2TA 2J85A 3DBLB 4YCMA 2YHSA 3GGPA 3UWDA 2ZBUA 1ZH0A 4MGKR 2YQ4A 3RG8A 4BNMA 4NZOA 4TQAA 1I4DD 1ZH8A 1YZVA 2X58A 4QHTA 1K6IA 5LDGA 4DG8A 1M1NA 1SCIA 3AOEA 4LXGA 5IBQA 3N2LA 4QM6A 2C2XA 3TYXA 4QM7A 2AJLI 1QDEA 1VPTA 2C3MA 2WTNA 1X77A 3G02A 1IIRA 1ZINA 1H0HA 5CURA 3TOCA 3N8GA 1P4GA 3EBLA 1LSUA 1JQKA 1ZIOA 3KEQA 4GBED 5CHEA 3I37X 1SKMA 3JAKA 3K6RA 3E18A 4GNRA 1GA1A 1NP3A 3WX0A 5CH5A 2VH5R 2NYAA 1D0IA 1TJ4A 1JJVA 4GM4A 1BKYA 1HOTA 3QX7A 2CLMB 4I4CA 3DOUA 4Y0VA 1QRRA 4PHHA 1BE0A 2R1TA 1RLMA 4C4SA 1GPWB 1E99A 3R7SA 4XOUA 3OZSA 1V5GA 1BFUA 5BP7A 2MSCB 3VYRB 5K0EA 4RV9A 5JO9A 4QDKA 2ZSEA 3SP1A 2XGOA 4FDLA 5JRZA 3OA2A 4JIGA 3B8EA 2WWIA 4O08A 3EFHA 4N5DA 2B2NA 1NATA 3Q4GA 4P7GA 3IAUA 1EVJA 1IJFA 1MX3A 5IX8A 4BOYA 1ELOA 4OHRA 3QBDA 1JB1A 1ZL0A 1JHVA 1Z7BA 2Q4RA 1OXTA 2V54A 4MO2A 1RJEA 3AI7A 1ZHOA 1DTEA 2JD0A 3IXQA 2FN4A 1QIMA 2ZUUA 3DC2A 5AUPB 3SG0A 2G5CA 2G5TA 2YRFA 4BNYA 4DMRA 4IFTA 1VMIA 4U4AA 1T4BA 3HACA 1CF4A 1R15A 2ZREA 4P4NA 3VDNB 5CPBA 4BMXA 3AEKB 2WU4A 1SUPA 4ZEOA 3VM6A 1T9KA 4ZAFA 1V9CA 2ZAOA 1STOA 3WLLA 1YZHA 4IF4A 5GZ3A 1WXHA 4JLUA 1V3VA 2QRMA 1OZHA 1LK7A 4ARZB 4D9MA 4S1OA 4JFRA 4CUKA 4DLRA 5CBPB 2QGFA 4RQBA 3ANXA 1KH1A 4Y6QA 4ZICA 4FHZA 1YAJA 2QTFA 4MGIR 2FHSA 2Q2WA 3R0JA 5HRUA 1SQ6A 3TLBA 5LZ4A 1YQDA 2OZVA 1T15A 3EZ9A 3E81A 3IAHA 3T7DA 1TQ8A 3D81A 3NRCA 3VSEA 3OEHD 3QFFA 2YDYA 5TPWA 1TJNA 1YDMA 1ENZA 2QQEA 2QK4A 1GCUA 1K7SN 2UZ3A 4BP3A 1W88B 3D4LA 3LP6A 5FXMA 3ZWOA 1EVLA 1KNXA 3UXMA 4LC0A 3CLVA 3VUFA 3ENVA 4TPKA 2NU6B 2DSNA 1ZD3A 4UASA 4WECA 4DJDC 2W6QA 2ONKA 3QUTA 5E7JA 1Y7PA 4UEJA 3CLTD 5FWYA 2C99A 1W6RA 2DM6A 2Z8YM 1PVDA 3OE7D 1P45A 4ODIA 1RZRD 1ZK4A 3FYHA 7GPBA 4WJZA 2WK1A 1X3LA 4BTLA 4HWPA 1WDMA 2BEWB 4JBWA 1R88A 1AMUA 2IQIA 1IBSA 5CFZA 1THZA 3GLHE 3A6FA 1KJIA 2YYSA 3MTJA 2WM3A 2OPHA 3RABA 3WY9A 3AIOA 4CBVA 4NDZA 1NWCA 1JEYA 4GKJB 5FHQA 3NWEA 4BO6A 1A7AA 3CX6A 4Z51A 1P2GA 3RNLA 2ZDQA 1NM5C 1XXHE 3DYVA 5FX2A 2GPNA 1WNTA 1RKQA 5CIWA 1Z6TA 3A28A 3GAAA 3PNLA 4MKXA 4F3RA 3MC1A 1EM6A 4BPRA 1JE0A 2CLFB 4S12A 3VJLA 5B12A 4LBZA 1TL7C 2IU6A 2JVJA 5LYYA 2GZAA 2VQSA 5LP6F 2C88A 2XMQA 4GSYA 3I58A 4HLQB 1K27A 2AOTB 5AI8A 1IZ7A 3WFJA 4DBZA 1H4VB 4UUBA 4HVLA 2PBFA 1P1FA 1UL1X 2ZJOA 4ER7A 3IR6A 4RZQA 3ESCA 3EPLA 2ZSJA 5JI2E 4MJ7A 4XVRA 4FGUA 2BM1A 2JFOA 1MGOA 3CNNA 3FWHA 2CUTA 2H8KA 2HLHA 5FTKA 1V3TA 5IBCA 1YONA 2P9GA 2WM9B 4S05A 2QSJA 4U6QA 3A7EA 2B4AA 4RACA 3AY7A 2VF8A 3I92A 4WL0A 2QRKA 2ZW9A 1RQNA 2VTKA 1U0HC 2FFRA 1TQDA 4REOA 2DFKB 5F52A 3UNXA 5EE5B 3EGWA 5FV7A 1UDBA 4DJTA 4KO4S 3OCZA 1FYXA 1Z88A 1NQVA 2GN6A 3LECA 4RVOA 3M9WA 1R0BA 1P7YA 5G1NA 3AETA 1C0EA 1SC4A 5KDOA 2DPYA 3T99A 4ZVKA 1WCIB 2VJYA 4FQ7A 4OLJA 5FBRB 4J29A 3ZI7A 2C9CA 5LSAA 3AUYA 4HN9A 4PO3X 1CZLA 3AX6A 4YP7A 3RUCA 4LXYA 3A3KA 5COQA 1WVMA 2W2XA 2UZ0A 3ZJYA 4ZTUB 5AVTA 2BZSA 5EHQA 2QJRA 3UAZA 3VMFA 4AKIA 2R6ZA 1P9RA 2VT2A 2G9ZA 4RD6A 1PTJA 1FYEA 4WOKA 2X4DA 3H05A 4I9NA 3R20A 5FNZA 3CXUA 3TCXB 5G1OA 3A6LA 1KZGB 4QYSA 3R3ZA 2FJ0A 2EX0A 1CRQA 1FB5A 3H75A 1T13A 1UM9A 3KEFA 4MQUA 1FDOA 5IJ0A 3TQFA 1D04A 4COKA 5EHZA 1NVMB 1IG0A 3NEAA 4J0QA 4HK4A 4MWBA 4XIIA 5ER9A 4ZARA 1BEUB 4DSTA 3UGQA 1EG2A 5IYZB 4D4JA 1IULA 5FYDA 3I09A 3NGMA 1A4XA 3IKVA 2QUKA 3DKKA 3DVLA 4JLSA 1Y9AA 2J3QA 2RKBA 2PIDA 2CLOB 4WADA 3RSGA 2J41A 1WS6A 2PZFA 3HCFA 2QAGC 1JFVA 1T9HA 4WEQA 1RI5A 1FFSA 3GP3A 4CLHA 2H4ZA 4DFDA 4HG2A 3IC5A 4HB0A 3X44A 2QAGB 2C2KA 3ZZ1A 3DNFA 3SC4A 1WSDA 1UAGA 2QMUA 2QTRA 1I1QB 1UDAA 3RTGA 1KO7A 5EC8A 2ZULA 4ON9A 1JH9A 2PMBA 5BSEA 2G0NA 1JHXA 1VKJA 4HATA 1QKJA 3S29A 4AWAA 3RFUA 2W6JA 2YTZA 3BA6A 3CUSA 3X2EA 5B1HA 4CDNA 5AJYA 5BVGB 3KSRA 1N4DA 1YB2A 4LE1A 4Q12A 4NPCA 4LYDA 3SN6A 3URMA 4X60A 2I3BA 1RAIA 1ZJ5A 2P40A 2O6HA 1M3SA 4XJTA 1RM4A 5J9FA 3TKYA 5CFMA 4D80A 2BT4A 4LS3A 3QKIA 4DGQA 2Z58A 4AWXA 1I4OA 3EGIA 3AF6A 3DOEA 1BMDA 1RIIA 5FULA 3WNDA 2R00C 2FDRA 4UMVA 4W6QA 2YJ6A 3EIHA 1LLDA 9GPBA 3K05A 2H1WA 3TSYA 3DCJA 2OC9A 5TR9A 1WBJB 3HXTA 1SUDA 1CRWG 2FOIA 2NXCA 4WASA 3MERA 2EGHA 1RI1A 3SFZA 2F62A 3F5MA 2QAJA 2Y1EA 4C78A 2QRGA 2PZLA 5DLDA 5EHGA 3WBJA 3WFZA 1I24A 4DQXA 1QF7A 5CM2Z 2B8EA 5A04A 4RC9A 1RC1A 2EX4A 4NZMA 1T34A 4AULA 4BRWA 3JASA 4JZYA 3TLYA 3V8VA 4JMPA 4ALMA 1KEEA 4JXXA 2XT0A 5TF4A 3E15A 3CLRD 4W99A 1FK8A 1NMQA 2HLDD 3VJMA 2UYYA 1FBTA 3TXAA 2CLEB 3NVKI 2OBMA 3IAS6 2PL9A 4BDTA 5FBVB 3R3SA 2FPMA 3GRZA 3KZNA 3D7NA 4P7BA 1VOTA 2WUVA 1I32A 2Z1MA 5DBHX 3CRZA 4EJ6A 2ZRJA 3IILA 3S8EA 1F7UA 3SJCA 4N7RA 2ALJA 4BKPA 1WMAA 3NEJA 2Z4SA 1ZITA 1VM6A 4IQ4A 3IP3A 1DT3A 1CRPA 3LV8A 2WV9A 5JNWA 2PMWB 3H1PA 4GRAA 5GJBA 5C1PA 3C4JA 3OT4A 4R2KA 4UU0A 3WRYC 1C1HA 2PR7A 1XU7A 1QGZA 2O8BA 1P8AA 2NZ2A 2FI1A 2QLLA 1ESDA 1WW3A 3USZA 4CIYA 1JIIA 1J7JA 4ZIRA 2V96A 2PX8A 3QTBA 2GCNA 2IYWA 4I4TA 1XT6A 5CUQA 1Y8RA 5B1IA 2C2ZA 3DEKA 4V02A 3T06B 3ODPA 1KQ3A 1HA3A 2RBKA 4QRIA 4BL5A 5E4TA 2NO6A 2QPAA 4KO2S 4QYXA 2PAFA 5J40A 4CLEA 4W5OA 1R9JA 4DCNA 5EIHA 3LI2A 1MJGA 1KAGA 3G2KA 1H1LA 5FI3A 5CB4B 4O4IF 4LRQA 1VLJA 1YK0A 4JKOA 4QBKA 3LTNC 1NBIA 1EXMA 3E7PA 1F0NA 4JGGA 1QHGA 2VYQA 3OEYA 1N2HA 3DXZA 2SHKA 4ZO6A 2OO5C 2ZR9A 4PHCA 2AEMA 1NMYA 3VC3A 1HZZC 4MP3A 1Y9DA 4BQPA 3DEHA 1QH9A 4PLCA 1E1RA 1QRUA 4ZU6X 4JJGA 3N7TA 1J99A 5K3BA 1IFXA 3C6KA 2IF0A 2RB4A 2XOXA 4ND8B 4UUOA 4LZWA 2R6AA 1XXLA 1I2CA 2HXYA 2ILTA 3I23A 3KTDA 3Q85A 5HFNA 1P61B 3FZYA 5JSYA 3PEFA 2EWVA 4ED9A 1RVDA 3VAYA 5T57A 2AS0A 1CNFA 1E1CB 3DCIA 4JL5A 2ZJBA 1GT6A 1Y5RA 2Q3EA 3L4BC 2A2ZA 1KAMA 1X1TA 4HHEA 4UE2A 2HT6A 4DDVA 3OZUA 1HV8A 1QGYA 2HU7A 1NF3A 1TLLA 4GXTA 4K5QA 2V7BA 3ETNA 2B1JA 3MCAA 4IJQA 4ECEA 5EIAA 1FW8A 5KCZA 4QXOA 5ICEA 1KE2A 2AI2A 4AMYA 4KNVA 1SMKA 2PZGA 3C39A 4FGZA 4P35A 4Y1GA 3GJYA 5BW4A 1ZIXA 1T5LA 1A7UA 4ND3A 1I1NA 4I5IA 3NFYA 1TW3A 2NTNA 2DHCA 2G3YA 1FFGA 1PT8A 3IQHX 3OD1A 4KWEA 4YREA 4AF7A 1JYSA 4EP1A 3VR4D 2RHDA 4AP6A 3GPBA 1TYCA 1JW9B 4QUHA 4UZFA 4BJ3A 2O5CA 1KQPA 4RGYA 1P7PA 4PYQA 1E3WA 3RVMA 1REQB 1XQ1A 2XUQA 3DE5X 3MPOA 4XR4A 4RHTA 4DA8A 3W5JA 3IYLW 2R6GA 3WAGA 1YHNA 2VAMA 2W2NA 4C2UA 3QENA 5JPDA 3AQ4A 5BMVB 2HM7A 2HJRA 2RB5A 3CTPA 3VPGA 2OHIA 2VT7A 1D07A 5FL7A 3SX0A 5GJCA 2WU1A 5LZ2A 4Q93A 1ZAKA 4RA6A 4ZOLB 4DA0A 5C1OA 1T2EA 1YUMA 1NQUA 1Y37A 3DOIA 3CUUA 4ZC8A 1CFZA 3IO3A 4IHKA 4HAIA 1XMJA 4TN1A 1X8LA 5DX1A 5H9VA 3V6LA 4ZYZA 5L6MB 5CLGA 4N65A 4OQZA 5JO0A 4BLVA 4G63A 1Z47A 4N7JA 2DE0X 3T1QA 4PFSA 1C14A 1UQUA 3AF5A 4GR4A 1F8YA 3QV1A 1S1MA 5AKEA 1G3QA 4IEEA 1T3SA 2QX8A 5AJXA 2B9EA 1VGRA 5HGXA 1VBFA 4R8LA 3D8HA 2WU8A 4OHYA 3PYMA 4Q03A 3L0PA 4WBNA 4JJEA 3IA2A 5ENDA 2GB4A 4DE5A 3AOEC 4BZPA 1ZGJA 4HLNA 4Q3NA 4O4JA 4X61A 4WE3A 2E5FA 2KX7A 1U7WA 3H0EA 2RBGA 1ZN7A 4RVHA 3QFTA 1NV9A 3OQJA 1M1NB 4YJ2F 1J22A 5LDDC 5IAAA 1DDOA 5F5NA 1DJOA 1GARA 5HF6A 1OYVA 1IPEA 1T3ZA 2R6JA 2WFMA 2E4UA 2JGIA 2VDWA 1VE5A 3GZ4A 4CWAA 2IEGA 4DXDA 5CJ2A 5CFNA 2VQDA 4A16A 1J4AA 2ESRA 3JAKB 3VNQA 8LDHA 4WK4B 4Z86A 2QVBA 1VIMA 1ZS9A 2W83A 1ZIPA 3FB4A 4JP8A 2XUDA 3RBZA 4W5RA 3JQ6A 4KWCA 4YCAA 3HBMA 2OHGA 1E6EA 1PK8A 3H7AA 1D8AA 4XWAA 2HA2A 4IFBA 4PQFA 4B4VA 5C5DA 1RPTA 2ZRPA 7MDHA 3KETA 1LDMA 2R1TB 3OF5A 2FMKA 1M1UA 1MJNA 1KZ9A 3LUKA 3ZE6A 2Z1DA 3ZDQA 4MW1A 2O3JA 3ZBQA 1ADYA 1KZ7B 1XYYA 3GEBA 1GKUB 3QXHA 3E5HA 3ZD9A 2C7RA 3OZFA 4I4IA 2EIHA 2J6HA 1W93A 2C3PA 3TGPA 3QBVA 4MW2A 4PZCA 4D8YA 3IL2A 2AEJA 4D57A 3I05A 3QH4A 1YGYA 3CWZA 2EKDA 1B14A 2GNPA 1OXVA 1J0XO 4LYAA 3KV1A 1EUQA 3HBNA 3N0XA 4BGDA 2XNSA 3JQFA 2RI0A 1WXDA 4R1MA 4Y2SA 2O1SA 5IULC 2VH1A 2HI0A 2W93A 3TM5A 1ORIA 2OM2A 2WOJA 4QWMA 5AJUA 2PUGA 1WR8A 4GT1A 1SBHA 3B52X 2ZAYA 3OJLA 1G8AA 1O8BA 5H70A 1RLUA 1ILEA 2E48A 2IZZA 8ADHA 3D2CA 3IAS1 4NR0A 4ZJPA 3DLCA 3RJ9A 3TINA 2GN2A 2E4VA 3R23A 4HVAA 4KMRA 5IJWA 5BUSA 3O8QA 5CH8A 1Y3HA 1T9DA 4KAAA 3TM4A 3W3ZB 2VJBA 3FMPB 3QMPA 4B83A 4B3TB 4RPIA 5BUCA 2IBTA 3M4YA 1MJFA 1OFIA 4RLFA 1XAHA 3GLQA 3W8RA 3ZY5A 4MHTA 2QN2A 3I52A 4RSMA 2O14A 5FWXA 5TPWB 4HH4A 1VMKA 4RZIA 4CZ2A 4DL9A 4JLAA 1WTCA 4IUDS 1FFHA 2QZJA 3SIRA 3LCMA 3RD5A 1LBEA 5KYWA 1HSOA 1HTWA 1Y9JA 4OA8A 3N28A 2W22A 4GPEA 4M2LA 5JSZB 3ZJVA 1IHPA 2B6HA 4QU9A 4PBTA 5FWYB 2QR3A 4RNCA 1ZONA 2F8TA 16PKA 1S2MA 2CSUA 4P4TA 2PRSA 3OEHA 5C80A 3C43A 1NDQA 2WJVA 3B70A 2XKKA 3ET5A 3V4ZA 1GFIA 1VCMA 2CLSA 5IVPA 3TSZA 4C0AC 1RC8A 2QJFA 1YB6A 5FUQA 1OXMA 3FM9A 3GCDA 3ON5A 2A9PA 3CLUC 3HZZA 1JEYB 1OZFA 2FSGA 4TLDA 2OR3A 4YRCA 4IOKA 5F9FA 3L1VA 4HAUA 2CDAA 1D2HA 4R0VA 1VPLA 1XA0A 4IINA 3SM9A 3NKFA 4XYEA 4JYMA 4NH0A 5I8ZA 3SDZA 4YXWA 4KSCA 4UUAA 5E6RA 5DM2A 4WBSA 1I14A 2FSVA 4LYGA 2A33A 1L8OA 5LXTA 4PBRA 4KOEC 4D02A 4G5QA 3GFQA 2RGYA 2WAOA 2J3MA 2L42A 4B8ZA 1ZW1A 4JB3A 3OX2A 4CEHB 4OLBA 2A4KA 1NVDA 2F8MA 4Y2VA 3G2HA 2VC2B 4HC4A 3OZTA 4BN4A 4XB2A 3P7MA 3PCXA 4U63A 5DLYA 2IE8A 2YNMD 4Q1DA 3BRWD 2D1SA 1V26A 1MO6A 2JAHA 3ZDYB 4PW0A 1ZOIA 2JGMA 2FPGB 1CJUC 2IEZA 1H4QA 2B92A 4N01A 4R01A 2QLTA 5A5VA 3DQQA 3PKJA 4FGJA 5L7TA 1U6IA 2PX4A 3ROKA 2X1HA 3VA7A 1JZSA 3AR2A 4RIEA 2HOQA 2M1XA 3CE6A 3HVHA 2P9JA 3KQVA 2PAAA 4FFMA 4OTZA 3BICA 1IWOA 4TX1A 3R5KA 1SEVA 4N6OA 2UUBB 3FVVA 3B6KA 3H1GA 4Y2GA 2DKOA 1SB9A 4G1BA 4TV8A 4G0OA 4L15A 4CTJA 3D54D 1WSBA 2ZRDA 3S8YA 2FZ5A 3O4JA 2FEAA 5CDFA 4MWTA 1GPBA 3AESA 4KAXA 4NF2A 5G0VA 3HS3A 2JLQA 4U6SA 1M67A 3AV0B 1J9GA 4LRYA 2I1WA 2G9QA 4UD6A 3SHVA 2ODTX 3DOFA 1ZSYA 4TTSA 3L01A 3M6AA 5BO5A 1PTJC 2FP4A 2Y6VA 4KV9A 5JS2A 3UWMA 3VVBA 1N2XA 4GD3Q 1G20E 4OUDA 4BWGA 5EKXA 2L69A 2PSFA 1XDUA 4WLNA 3AVPA 3FDFA 2FX5A 4CV0A 2F1RA 3TFWA 2QTTA 4NEHB 3S1SA 1CX9B 1S7CA 1V6CA 3GEGA 4LRSB 2RH4A 4WSOA 2ZT7A 2QYSA 2GYWA 4PG7A 4PXAA 3PXDA 4XX1A 4NS4A 4P08A 1UM9B 1QM5A 5CDYA 4QHYA 5IJ0B 1RYEA 2X9NA 4MEAA 4MLZA 3WZ2A 5JXWA 1XVVA 1YU9A 3I1FA 4J49A 4Y2TA 2XKAA 4RH1A 1VHQA 1DBQA 4GLBA 5DHSA 5LR6A 4R2IA 3NT4A 4BMCA 4K46A 1ULSA 4JP2A 4BVJA 1JEOA 5GV8A 3TRHA 1DQZA 1SU8A 3HFSA 3MLEA 3O83A 4OFWA 5CFOA 1AK1A 1YZNA 4X64B 4XB6B 1AKUA 1X1AA 5EWJA 4FDMA 3RIHA 4A26A 4CYMA 3MZ0A 2ZWIA 3CT6A 1NW5A 3O1IC 3EBOA 1NVXQ 4W1QA 4L78A 2BWJA 3GJ7A 1GPDG 2JANA 2X2FA 1FU4A 1LPOA 3P9IA 4RE5A 1SO8A 4E3WA 4ZODA 3DHEA 1C4WA 4RHXA 3IT1A 2PS0A 2QTHA 1KQFA 2CVPA 5DT2A 5BXQC 4PGMA 2GN9A 3V5NA 1E61A 4OXRA 4ZOBA 4DT1A 5IJ9A 3WNBA 4EPXA 5BNWA 3HV0A 4V0QA 4Q9IA 2VTBA 4C2BA 1OROA 2Y4NA 3PJDA 4CIXA 1L5RA 1NF8A 1WD7A 3P2YA 2PUEA 5BWBA 1HURA 5HDQA 1GQFA 2JVKA 4EY6A 1U2EA 4Q7MB 1C4OA 4JMLA 5AOCA 3HWRA 4XUCA 1O8CA 2VDLB 3E3LA 3BGWA 3U62A 5IT0A 5JZVA 4BB0A 5FV4A 4Q24A 4EKNB 1E6MA 4UVEA 2ERYA 3OOYA 4DZTA 1VRWA 4HGOA 4ZEMA 4URHA 1YNSA 2ZBGA 3HUEA 3OY7A 5AUOB 5I7OA 4PIMA 3L7LA 4O4LF 5DM60 2XCSB 4PX3A 4P4UA 5ANRB 4EHJA 2TMYA 4JP3A 4L57A 3JASB 2GRAA 3BFPA 1YKGA 1GAEO 1KEEB 4E5YA 4IUCS 4HZUA 5ER6A 3RVJA 1WPXA 2IFTA 5JANA 1ZYUA 5I7HA 4B84A 5KC8A 3KT0A 2YWXA 5AXDA 3LDGA 1ZLXA 1G2IA 2P2YA 5ALWA 2A5GA 2COKA 5LNK6 5JYEA 3JQEA 2F1IA 1XC7A 3KR2A 3TZKA 1FXSA 1E8NA 4DIFA 1ZH6A 4IDHA 3L6DA 4E6EA 5KAMA 3KWFA 5F2NA 3IVGA 1XX6A 1G9TA 1Z4PX 3P52A 5EKDA 4O0MA 3DQPA 4TRJA 1M34E 3ZXUB 1SNYA 1X92A 2YFKA 3BF7A 3FNIA 4M0PA 4FZJA 1X39A 1QPBA 2PMFA 3UWPA 4C07A 1UKZA 2HLDA 1A9PA 2HSWA 2C04A 2C7BA 2ERXA 3E27A 4FFBA 3V8BA 2G1KA 1ISJA 2G9VA 3G2NA 2O8BB 1ZRMA 3ND8A 3UYKA 4PLPA 4FM9A 2YN4A 3ESZA 1KTVA 4ZIRB 3DM9B 3SKXA 2HIHA 2XYRA 1N0WA 4I4TB 1Y8RB 1QIKA 4DCGA 4KH0A 4UHCA 3JQAA 4RENA 1DX6A 4AKEA 4BQSA 6ABPA 4COOA 5CLLA 2XGJA 1UXIA 1V16A 2VXOA 3C87A 5CT4A 1H1LB 4BC1A 3JWGA 3IT3A 1JPUA 1YT5A 2QW1A 4FYPA 3GFTA 3KKQA 4EMBA 2Y9PB 1ESMA 3RK1A 4A6EA 4EB8A 4XR9A 2RAUA 2YUIA 3KQWA 4LDJA 2Y1GA 2B5WA 3LVBA 1DPGA 1CUIA 4QPPA 2HK6A 3A25A 3RM3A 1WU8A 3TAHA 4MW4A 5BORA 4LOJA 1UK8A 4WK6A 4MV6A 3QEAZ 3A05A 3H6GA 4KB5A 3IXMA 3HJAA 1KOGA 1LDEA 5ULLA 3V8RA 1U11A 4DLAA 1JJ7A 2PPLA 4RMIA 1XCJA 3IEKA 5AR1A 5B55A 1GPJA 4AS1A 1C3JA 3OQNA 4KL8S 3CINA 2BELA 2H00A 2XVZA 2GBLA 4EUSA 3QLUA 4U00A 2OCPA 4FGLA 5KTPA 3WIEA 2QLNA 3LCJA 5E7QA 4EB0A 5ADHA 3IEVA 5K8JB 3LPMA 2VR1A 1RPNA 2PEYA 2XZLA 1YS4A 2WZCA 2X5XA 1UWVA 1RRFA 1U0RA 5K3OA 2PIAA 4FW8A 4Z6KA 1FNSA 4OI2A 1OBHA 2ZQ5A 1RTKA 1JTVA 2WWTA 2XEDA 3BCHA 3BQNB 2A1TS 3FDXA 3G89A 3PXCX 4H4CA 4HQ6A 2JG3A 3UMFA 2G4CA 2OENG 2QDKA 1T8SA 5LB4A 2PWBA 3HB1A 5AJZA 3D4BA 4CM9D 2W7TA 2FR8C 3L46A 3MJSA 1FQWA 2Z6UA 1SG6A 2BGTA 4FE3A 5HILA 3KPUA 3ZOZA 3GUHA 5KVSA 1Z18A 1ZLYA 2XXAA 2C1ZA 3EZGA 4HXGA 4DYHA 1XTKA 1Y4ZA 3LQ1A 3DS8A 3OP4A 3MQ4A 1A2BA 1F3LA 4HOYA 3LSTA 4XI9A 1OIVA 4UBNA 2IKQA 4P22A 3BZUA 1GAWA 4EVRA 2FDXA 2P4SA 1E3WB 1LVHA 2GI4A 1WJGA 2ID9A 4CHGA 3D7LA 4G6ZA 4QPJC 4BVKA 2HV9A 3PFWO 3P45A 4X7BA 3ETJA 1L4FA 4DQDA 2HX1A 1KI9A 4F7DA 3NWPA 3AF1A 1Z5PA 3VR4A 3T7TA 4Z4FA 4M53A 2F3QA 1V8FA 2FW9A 4RA6B 4J2OA 1PGQA 1UAYA 2NO7A 3HVUA 4BFCA 3P94A 3EEBA 3QBTA 4P84A 1W25A 1DFIA 2C9BA 3RROA 3E4DA 4OLFA 2Q4BA 1JVNA 3DTTA 1GUBA 2VFAA 1XF9A 3CPHA 1W5TA 5TF0A 4UUMA 3A6PC 3F6YA 1PQUA 2PDAA 3UGKA 3FVWA 3V4FA 4F4IA 2EQBA 2PSEA 1CTQA 3R40A 4OK6A 1G291 3RC7A 2QS9A 4NZPA 5ILGA 3W9UA 5HM8A 1PNRA 3COSA 4GZ3A 1MOQA 1JGTA 1MENA 4WBNB 1VKNA 2P8JA 3LC2O 1VJRA 1GAXA 4IY1A 1DZIA 3FTNA 2ZUVA 4F12A 4O4JB 1YAHA 4PRZA 1Q92A 4NYMQ 1UBOS 2KBFA 3PC6A 1ND5A 2MYUA 3NGLA 4W82A 1Z63A 1JIQA 3BRQA 1QWOA 1W75A 2LKDA 4DJAA 1TEZA 4G4SO 1YE8A 3ZVNA 2VDWB 2Z5GA 4TMKA 5ITZA 1XPRA 3MNFA 4ZALA 1TX4B 1Z5NA 3F6BX 5B6PA 1WNFA 1GAQA 3MWGA 3TQTA 1LA2A 1NY6A 2YL2A 4BE9A 1NFRA 1T9GS 2RONA 1YQEA 3S70A 2BGKA 2X7HA 3FMOB 4OJYA 1UFRA 4RK4A 1SUEA 4WW0A 5AKYA 1P9LA 2RK6A 2WF5A 4LPSA 3W2GA 1K6XA 5EYPA 3LF2A 3RKRA 2OK8A 3DDNA 5KWVA 4A2WA 3RIGA 1HT3A 2CNOA 4MQMA 4P7JA 1B16A 4C14A 1IEQA 2PRKA 4IRUB 1JRLA 1M2HA 2HHAA 3A1UA 1NJ6A 1ZOLA 4CI0B 4WBXC 3JQ8A 1UK6A 1FJ2A 3BWBA 3RO7A 2VDJA 2COEA 1XXHA 3EZFA 2CYAA 4DLPA 3HN2A 3M2TA 2WJGA 4AG3A 2QTGA 1E2KA 2VNKA 1DKUA 2YOFA 1CEXA 1GPH1 1A7JA 1HL7A 4HN2A 4MIOA 2W6MA 3VZRA 3CX3A 3G0CA 3JQFC 1TK9A 1E92A 4B0PA 3IKJA 1NP7A 4N3AA 3H9JA 4ZVUA 4PG5A 4AURA 3ZHUA 3GLGE 5E4FA 5KS2A 4B6SA 2HJWA 4BX8A 4M6WA 5GP1A 2A67A 5AUQA 3L8GA 3VO2A 3T7KA 3MRTA 4PIPA 3RUDA 2HUPA 3DZIA 4X95A 2C4NA 2FUCA 2DCUA 1EJ2A 2GYVA 1EMDA 2JFHA 2ZQYA 5AHWA 3GJ4A 3Q88A 3S44A 1A4RA 3BQMB 1OWPA 3U3DA 3EPHA 3P2EA 3O8QB 4M49A 4TL7A 3H3JA 5ALIA 2X9QA 1UK9A 5IYZF 3L1JA 1BO6A 2H48A 2BDEA 2X41A 3S2SA 2VJQA 2NADA 1DC3A 3H3XA 2X19A 4W8HA 5DU2A 4KLRA 2IDKA 2ZCVA 3WLIA 4H1UA 5AW7A 2A78A 1XD9A 2ZDHA 3P2IA 3GPDG 1IN1A 2FOLA 2FW6A 3F9IA 1IDN1 4PLHA 5FWXB 3TVDA 4LZPA 4A0SA 2LTAA 3GEIA 4TL8A 1FMJA 1WIWA 3UJBA 1FTGA 1YL7A 3DTVD 1FF9A 2AX3A 4OVKA 3W6UA 4DUPA 1NUTA 1BGWA 5KYWB 5U9CA 2W37A 4XQGA 5EG5A 3TSCA 4EQZA 2ZJFA 4FJ2A 1X9IA 2EP7A 2QUBA 3EXG1 3DLAA 1JAZA 2YCLA 3GPIA 1RWPA 3ZCPA 4BFSA 2X5NA 4GMGA 6LDHA 3UENA 4C7VA 1MCZA 1LWOA 1P1BA 3AIMA 1ECGA 3OTHA 4DS3A 1OQAA 2VLBA 3SHTA 1QIDA 1ODFA 1SKAA 4JC4A 4NNPA 2PHZA 4ENRA 1SUCA 3O91A 3GZNA 1N75A 1YACA 2REOA 4RKWA 3QKRA 4N12A 3CLTC 2VDRB 1PVVA 1FXUA 2ID4A 1KVUA 3T3EA 5BV1A 3ODGA 1LGYA 3QW2A 4HPWA 3UJ8A 1WF3A 1MEJA 2ACKA 2FSVC 2QSUA 1W2WB 4OB7A 4EVIA 3AOGA 4OHFA 2C5SA 4B3MB 2FN8A 1T5IA 5E6RB 1JJFA 4DNXA 5KKNB 1XEWX 2HMYB 5LQAA 4RDXA 5MFZA 3DAHA 3ORRA 5LXTB 3R7BA 2YV4A 4UE6A 4G4JA 3ZK7A 1R18A 3SZGA 1C0KA 3GVPA 3G59A 4O8ZA 5AKLA 4N48A 3M5PA 2V7XA 4FWBA 4JJ7A 5C46F 3GDWA 2LW7A 1L7VC 1R9NA 4PYRA 3KB2A 3CBQA 3BL8A 4EHBA 1JU4A 4A1OA 1AXEA 5KYXA 3M81A 5T3YA 1P2TA 1DAOA 1XFDA 2EFDB 1LNQA 2B7LA 1Y3DE 2J9ZB 1N0UA 2AC7A 3CWQA 3CR8A 2Z04A 1IUKA 5FO0A 4EYOA 4YIHA 4GKKB 3VO8A 5FDFA 3HHPA 1Y6FA 2IEIA 3F7TA 1SA0A 4J7XA 4RD3A 2VJOA 5AHXA 3PRJA 5LQKA 3WV4A 1T26A 2VYCA 2VAWA 5ALDA 6AT1A 3BWYA 2Q8QA 3KOOA 3MD0A 4CMKA 3OJ0A 4JT4A 3T7AA 1NQOA 3IUPA 5I8PA 5LLDA 3TLGA 1DIGA 3GC6A 1JDZA 4WKPA 5JASA 3LW8A 2BLLA 4JN6B 1CJTC 2VBFA 1CUJA 1CCWA 2YNMA 4Z9AA 2F17A 3PPVA 3A4VA 2W2LD 4TV8B 3NATA 1BDJA 2DBRA 4O25A 1XO1A 4BNUA 2DUUA 4YTEA 2PSDA 1J23A 1Z36A 2ZJ8A 4YFVA 5J4LA 4O1MA 1GA4A 4AIIA 3U4AA 5LLSA 4O3MA 1IB6A 1PL6A 3F7OA 5DM4A 2ZIZA 4F97A 5K6AA 1NXWA 2FP4B 2JC3A 4OP2A 1JQDA 3IEIA 3G7UA 2JFGA 4OUDB 4P6VF 5DLPA 5IU6A 3JAMA 1TDJA 3D6FA 4EHAA 3EPPA 4MUGA 2Z6QA 2BC9A 2HC9A 5CB4F 3D0KA 1LQUA 5G0TA 3DBRA 2C9MA 2FKNA 4F3CA 3PQ7A 4GS5A 2RCYA 5F2KA 3CC8A 3ICOA 4QUGA 4JDUA 4YP6A 3M3DA 1AA9A 4YMVA 3AR9A 4TTQA 2UYHA 2IYQA 2ORYA 2YW9A 5KTKA 3BSYA 1KVSA 1A8IA 4A15A 3PWZA 5JC8A 3F6EX 3WFIA 2H85A 2ZWVA 1BCRA 2QP3A 2HDOA 3CPJB 5J58A 2B7BA 1LNSA 5KTOA 5IKPA 4PGGA 2EZTA 2HHCA 2XECA 2GN4A 1P5ZB 4QPDA 2FFJA 5A3JA 3ABOB 3JQQA 5EWJB 3KQYA 3NTXA 1P2FA 2X42A 1UJ2A 4IO1A 4PGFA 4LGMA 4RE6A 3EPKA 4GMXA 3UKOA 1JG6A 1M33A 4B6QA 3PUXA 4TRMA 3V80A 5L3ZA 1F1BA 3PFFA 4X7PA 1IXSB 5CLFA 3W5CA 5B2ZA 2G72A 4G1FA 4DBVO 1MDBA 2JLWA 2FVXA 1CUHA 4M7OA 2JJ2D 3GP8A 4DT1B 5IJ9B 3SNKA 2JHFA 1O4VA 2AF3C 2CE7A 4WJLA 3IV7A 3ORHA 3Q8WA 4TOIA 2OCIA 4MWGA 1EFKA 2VTBB 1AKEA 1ZRHA 3U3XA 4DADA 2I71A 2Z3WA 3I9FA 5EJ7A 4HX9A 1Y98A 1JYFA 4MQLA 1Z0AA 3QVOA 1J2YA 4YV7A 4AX8A 2G40A 2JAPA 1PR3A 4YRNA 3DV2A 5F5XA 2XBMA 4J16A 1I2ZA 2GJSA 5JFTA 4OFXA 1DXHA 5HRCA 3EZ2A 4FW9A 3SM3A 5AWFC 2HRBA 3DFKA 2WWFA 1AV7A 2GPJA 1B8VA 5J1SB 4IIUA 3PQDA 2FSSA 4KXXA 5DXJA 4AI6A 1B2LA 4FOOA 5BMVF 3KLPX 4KN6A 4HNSA 4JELA 5KWEA 3IVRA 3EG5A 1DO0A 4UUPA 2PLAA 2VJCA 3WQHA 5HW0A 3DE1X 4FNAA 1WZCA 3CM0A 4RHUA 1GNQA 5DIFA 5A5FA 2P41A 4KVGA 1E4VA 4MI6A 4Q7EA 4B6GA 4ZOLF 2FF7A 1I7SB 1HF3A 1ZMRA 1QCCA 1A2OA 2H6EA 3FPEA 4G07A 2P2SA 1NULA 4J1NA 1NN0A 1T0BA 3ERCA 3CLRC 1HEYA 4F9GA 4EW2A 3AIKA 5DVZA 5HKLA 3AYZB 3BRCA 1QYIA 3MXOA 1NVFA 4LY3A 1AUXA 3OJEA 4RL6A 5DGHA 2WB4A 2X4IA 3C8HA 4BIIA 3BOSA 4DR5B 1NW8A 2Q3CA 3ASZA 1I9GA 3ISJA 3LKZA 4FFBB 4HWKA 3EXG2 4CVNA 4LI0A 5D1HA 5F1YA 1TJPB 2PBLA 2V97A 4DF3A 4LJRA 4Y0AA 1VL8A 3ZD7A 1G8JA 1M6EX 2VI5A 3GBPA 3NBAA 2W0SA 2OG1A 1KA9H 2G1JA 3VPBA 3F0TA 2GFHA 3EH1A 1PJLA 3DOCA 1LS1A 2VNHA 3JQAB 5EAIA 3TQOA 2VRCD 3RBAA 1VL1A 1WUYA 1Z5ZA 4KBYA 3OUUA 1XTRA 2IPXA 2XUFA 1V16B 3NUZA 1P31A 1DQRA 4WXMA 4D79A 1TQHA 5LYJA 4YRPA 2C7QA 2WU3A 2GHTA 1ZICA 3PDCA 2OPBA 3KP1A 1ONSA 2QX4A 4NYJQ 5AW8A 4Z4IA 1I5OA 1NQTA 3TI7A 1L4HA 1E4YA 2QDXA 2ZLBA 3SJ7A 4KXMA 4PO9A 4RPLA 3FWPA 5I7AA 1DQPA 4ALIA 2I4OA 1Z4QA 1U3UA 1UIRA 2FW7A 3JRXA 3LUPA 3ZW8A 4CUZA 3GLFE 3MOIA 3VHRA 2P3LA 5TY0A 4GYYA 1OVMA 1PSZA 2ZKIA 1CF9A 2GBLC 3EIUA 2A14A 3QLUC 3LT4A 5C2JB 4A10A 3A1WA 3DAPA 1GT91 5FPSA 2PKYX 4FYHA 4G84A 5CNJA 4MDEA 2HT1A 3QWFA 2VSXA 3QSGA 1S3FA 1M6WA 1TGVA 1GTVA 3GA5A 4XM2A 3UHOA 1RWNA 4UPDA 4M76B 4F91B 1DEAA 1G38A 1S4QA 4FFRA 3ZGNA 3W2HA 3VU3A 3BJEA 3UWKA 4WN3A 1DX9A 3BFXA 4P58A 4PZDA 5DNDA 3CVVA 2OMKA 5FAXA 3RHFA 3AL2A 4HJRA 1DIHA 2V7PA 3L8MA 1CUUA 4Q34A 1YK1A 4FCCA 4LTMA 1DL5A 2R9VA 3HSSA 4C1BA 1NBWB 3KKEA 3P4UA 4LBWA 1PK9A 2GD6A 5EA2A 2XPCA 2ZPUA 5CX4A 1BVUA 2JHGA 4PGHA 2Y0PA 3LU1A 4MR7A 1AQJA 2UUOA 3Q8KA 1QYRA 2NQTA 2Z09A 4G56A 4MDHA 2OWDA 3V7YA 1EZ1A 1JI0A 1ZCBA 2FK7A 2I4LA 2VO1A 3AWIA 3I5UA 3PTZA 4ZCTA 1O0BA 2XXAB 1BKSB 2GDZA 2OCBA 9MHTA 5H0IA 1JWLA 2W2QA 2K6GA 5JAHA 4G0MA 3MVEA 4B43A 3KKZA 4BX2A 3CPSA 3HKBA 5G0WA 4CM4A 5HQ3A 1I30A 1RE0A 4X93A 3TW8A 2OORA 1TC1A 4INAA 4DAEA 4EBBA 1L4YA 1IZ9A 3FETA 5I51A 3Q8LA 3EXIA 2VQEB 2Z56A 4OYLA 2AI3A 1A77A 5EE1A 3QHAA 1KYXA 5F35A 1XN4A 3V97A 5CD1A 2XCRB 4ATNA 1KPIA 4OU5A 4EABA 1WP9A 1IE3A 3COPA 4O0LA 1O89A 1WW8A 3O6VA 1SN7A 1UT6A 4P53A 5EI5A 1NURA 1TVEA 1PZNA 3GYGA 4U7WA 5A2GA 2AC2A 1E32A 1DQNA 3QE9Y 3RU2A 4DMKA 3SQOA 1WB9A 1FDVA 3NHLA 4UQOA 4QG7A 1GFWA 2PS3A 3MM4A 1TQ2A 3K35A 1JR4A 4MP6A 4YBZA 1JQBA 4AECA 3WHIA 3PXXA 1YZGA 2DULA 1E9DA 1UK7A 2X15A 3NU1A 4KE6A 3L0DA 4XDYA 3LCVB 1YMUA 3FTPA 1GL6A 4JLNA 2E6KA 1H23A 4FDAA 3EQZA 3BDAA 4RF2A 3SEQA 2D5IA 4A7PA 5LP1A 3GG9A 1TF2A 1SOWA 1WULS 3KVRA 2DH6A 4DIMA 1GFZA 1JQ5A 1F6BA 1O97D 4LXXA 4B2IA 4NBUA 3K71B 4C0XA 5ITZB 2AX4A 1GRVA 1BQEA 2IOFA 4LDRA 3ROMA 1EHYA 2K7ZA 2JARA 2E55A 2PYDA 3O1LA 1ZJ6A 3C24A 3CE9A 4NTZA 1USKA 2AFRA 2FN7A 2KLHA 3HJTA 3LPCA 4BNFA 4CLRA 1H2EA 3NPMA 3LGAA 3PJFA 4J4TA 4YRLA 4S0XA 3Q9UA 4JBNA 5EYPB 5TX7A 4A8TA 1HNXB 4EAQA 2GXSA 3OQHA 3FOBA 5CT8A 3WMWA 5ELLA 3JQ8B 4KBFA 2F9FA 3ZY3A 2D74A 1XXHB 3AINA 2W2OA 5DTQA 4GQBA 4R2HA 1P74A 3LPNA 3ZDDA 4E7PA 2P2ZA 1I3OA 5EP4A 4Q02A 1MNQA 4JLMA 2I87A 2ZRBA 5ARBA 3FOEC 5IJAA 1QV7A 3WQQA 2DWPA 1TYZA 3QHPA 4RULA 1JJIA 5SYNA 4BZWA 5IEJA 3DZ8A 4Y2RA 1T4GA 1E3EA 4CR7A 3ADBA 2VF7A 3AV3A 3KOWA 4PQEA 4M6WB 3ILSA 5AM2A 5CHYA 4AO8A 1WLYA 2ZIVB 4MRMA 4CN9A 4E1BA 3G7SA 1YRBA 2AZ4A 1KOFA 2Q3BA 1LPNA 1XTPA 2QRUA 3KS9A 4IJ5A 1SB8A 4PFKA 4RXUA 3R5JA 3VSBA 3T5AA 3BHIA 3CEHA 1QZUA 1K2WA 4MMYB 2MSLA 4LJLA 1GADO 1J0CA 4WOCA 5ELMA 4DLYA 4UTZA 4DDTA 1RSZA 5JVDA 4IXMA 1K5HA 1FW6A 1P5JA 5TS2A 4H0FA 3N39C 1YZTA 4H6XA 4QICA 5DNAA 3PNYA 3UO8B 2Y68A 1JN0A 2CCKA 4BLSA 4CFZA 3FYUB 1P17A 1RP7A 4KDFA 4LWPA 4DJFC 5JSHA 4P5DA 2NIPA 1RM0A 2DR3A 2NPOA 5TQ2A 2HBZA 1GTJ1 5K4AA 1MO4A 3OE1A 3QLJA 3WE7A 3CF4G 4BCCA 4PQYA 3F46A 1L3IA 3CU5A 4WCVA 1AN0A 1YMQA 3KBOA 3WNVA 4HV4A 4AD8A 2GT1A 2V3WA 2C5FA 3DMFA 1QXSA 4FZRA 1G8SA 5AK5A 5H16A 5HFAA 4WAUA 4D81A 1OB2A 2R47A 2FZVA 5B1DA 2NT4A 4K2HA 3NKLA 5P8WA 1PX2A 4HQRA 2O7SA 2NTEA 3I04A 2H31A 3KCNA 4G5RA 4PAMA 1QRSA 1F51E 3JD4A 1VJ5A 2XMDA 3GZNB 2NZUG 3DTVA 3OEED 4LDPA 1DRKA 2CYCA 3BE5A 3H0KA 3QKRB 1MNAA 4I50B 3K09A 1D7OA 1MOPA 2BDTA 5B58T 5F51A 4OXQA 1QKIA 3KYBA 1A9SA 2E0IA 2ECPA 5FA8A 2OQ2A 5HUJA 2F6RA 2RC5A 2MINA 1H6AA 1R8JA 2ATVA 1ZOOA 4POAA 5JSUA 3MWFA 2WWVD 3V9AA 4FB5A 4LJYA 4DDHA 1I1OA 1VB5A 3FLAA 3LO8A 2XMCA 4QELA 5BV7A 3F7MA 2NV2B 2PGJA 3TD2A 2P9ZA 2NNLD 3HYSA 4V1CI 3COJA 2OC4A 3MAGA 4RJJA 1UCFA 3G5LA 4A3SA 1P91A 3RSFA 3II6X 4G97A 5KYXB 5BW6B 3S7ZA 3ZV6A 3SEZA 3L4JA 1SD1A 3D4IA 3EFEA 1ZI8A 1RWVA 2LPMA 2ZKLA 1KAHA 3FBTA 3NHPA 4ARUA 2Z57A 3JXEA 1T29A 2GR9A 4PFQA 3FSRA 1RRKA 3PYXA 1EIZA 3QPCA 1ZOPA 4MUMA 4WA7A 3WLMA 2KE5A 1V3QE 1UPCA 3LQRA 1NE7A 3UGTA 3G2OA 4R84A 1SA0B 1YXMA 2UUCB 4OX9Y 2CL6X 1W29A 1GPYA 5B4VA 3CUVA 2YNMC 2VJPA 1PNVA 3TLGB 5EMJA 3B36A 4WVLA 1TYAE 4XM0A 5F3WB 2BL4A 2BIFA 1ZQ9A 1LPSA 2IJGX 2REXB 2WA1A 2QTAA 5D6OA 1PWYE 1Z6XA 1Q0ZA 5CCEA 1QG6A 2HWWA 1BE6A 5KVVA 1YS2X 3DDOA 4UMEA 5G41A 5AK6A 1UOQA 3WNCA 4MVJM 3SS8A 3HCOA 5K6AC 1M0TA 4ZDWA 4C7JA 2F64A 1R0WA 3WK9A 1QX4A 3S81A 3GL9A 2EEZA 4I4TF 4Q9JA 1DC4A 3NBKA 4HXEB 3VUEA 3B85A 2YZ2A 4KRGA 1CEYA 2R6FA 2B1QA 3EASA 4MJ3A 2W98A 2NN3C 3U3KA 2F3TA 1ECBA 2PH3A 2VK2A 3OU7A 4ZCRA 4HDCA 4MV7A 3EG9B 2XB8A 3NNDA 1QB7A 2FPWA 4KSYA 5JXIA 1M6VA 4HY3A 4ZT3A 5FF9A 2W2LA 4MRAA 3DBRB 5C8YA 3D8BA 1NXTA 2YWDA 2GEJA 4KJXA 1F0YA 2KI5A 1QFYA 5EIFA 1D6NA 3F2IA 4IRXA 3U1BA 4BIMA 2DERA 4D25A 2R7NA 1JF8A 1CHNA 3DKPA 4FJ1A 1SQSA 3LBAA 4IGFA 5EMHA 5ALVA 4DR2B 5IFLA 4M83A 3FFXA 2PT5A 1E3SA 1M34A 3VR0A 1K8RA 4E4TA 1SURA 3I64A 4D8UA 1WMDA 4ZCMA 1SC9A 5I7UA 3B6ZA 3A36A 1BCRB 5TPZD 1QMPA 2FVYA 3FSJX 3FFBA 3U60B 1U4NA 3C3DA 1FRQA 4ZJZA 3HE3A 4EPWA 1JQEA 3DDWA 4LRUA 2HYIC 4XD7A 1A5ZA 4WLUA 4I7EA 1Q0TA 2JLCA 4CQNA 2IXGA 3H2IA 4XUGB 4G26A 1V5IA 2WSSD 4TMVA 1JEJA 3KTOA 3ZCRA 1EI9A 2JJ1D 4TQ9A 3F7NA 2P9TA 1H6CA 6PFKA 4XFDA 3JSAA 3JYPA 2RE8A 2OD2A 4YDSA 4KXFB 4HZIA 2Y4OA 2R8BA 2O2HA 4W1PA 3QIAA 1ZIDA 3WSVA 4DXHA 1V47A 4G0YA 2RHHA 4F38A 1R0KA 4IQ8A 2MHCA 2E89A 5I7RA 1G4AE 5CFRA 1UP4A 3PPYA 1NNEA 4F4HA 1SKYB 4A6DA 5T7BA 2C5LA 5FPHA 1VG1A 3E7XA 1V8DA 4YI5A 1U4SA 3NOVA 2Z9DA 1L5GB 4IG4A 3BKXA 4J16C 4Q3CA 1Q1AA 4R7TA 3HLYA 4EYGA 2QX7A 2QOEA 3AGPA 3SDSA 3DKIA 2AD1A 1YMVA 1Z4KA 2JJ2A 4FWIB 4F4JA 5CVVA 1SY7A 4LW8A 4R71A 2ZUWA 3OZGA 5A71A 1Y89A 4MB0A 2FEWB 2CVHA 3PXGA 4AZ0A 2C1EA 1YR9A 3JD3A 3KJHA 3BXHA 3C5HA 1KDRA 3CKMA 4Y0NA 2WE7A 4B6EA 5KPDA 4FKMA 3GRPA 1AOXA 4RFSA 4AZWA 2ZB3A 5JD3A 2X9LA 5JAZA 4Q9NA 3IQFA 1CIVA 1TCCA 3OPXA 4I46A 3U37A 1NY5A 4UFOA 5IXYA 2NSYA 5HUQA 4OM7A 5CCBA 2WMDA 3TQSA 1ZBDA 3U4IA 1FSGA 1P0QA 5JAIA 4KX5A 3J7TA 4Y2HA 1S4MA 2HZBA 2GXQA 2ZU6A 4ZCLA 4MPPA 4MUBA 1BMTA 4XSVA 1NUPA 2FWPA 3CS3A 3DW3X 1Z08A 2IQ5A 4DR7B 2P9FA 3VYWA 4QJ4A 4JBLA 3V46A 3BTVA 6GPBA 1TADA 4L6IA 4FEGA 1KXZA 3KXPA 3UATA 4FBMA 3LY5A 4POOA 1VHJA 1D3AA 2P67A 2XDAA 2XUJA 3F4KA 3LC7O 1QCDA 1N3YA 3GJ0A 4CR6A 1IWPB 3JR3A 4MW5A 5C5IA 2B99A 1ESCA 2R8XA 2OSBA 3LQYA 1TLTA 4OYRA 5IJXA 5T6BA 1SXGA 3K16A 2Q4OA 1CP3A 1KMMA 2VZLA 2FETA 4HFJA 4EY7A 4WBNF 1D9XA 5LMCA 3ZU3A 1SXHA 3EQ6A 1GR1A 4HR7A 4MQ4A 4ETIA 1W36C 1NVUQ 4REQA 4O4JF 4GHWA 1NBAA 1ND6A 2E4AA 1LC3A 3FFWA 4JB2A 4ZAGA 4D9EA 1IVYA 3FJ1A 1RYDA 2HWYA 4K1LA 5EL0A 1RBZA 1BA2A 1W36B 1GXSA 2C61A 1ATIA 5JMPA 5FWNA 2MSNA 3N59A 3ZWMA 3FZGA 3TAXA 4JJ8A 2XGMA 3DGEC 4UHFA 5DN6A 3R8CA 1J1ZA 4BO1A 5HP4A 4JASB 3WISA 3NYWA 3HV2A 1U2RA 1AZTA 1VE6A 2ENUA 2I2BA 2I7TA 3BULA 2VEOA 4QASA 5LYJB 3BMCA 1E2MA 3VRHA 1QH8A 2OHVA 1NBMD 2CJWA 5TQ0A 1NAIA 3RWOA 1OH6A 1SBNE 3NHZA 4LXTA 2J0VA 2R5NA 4XGRA 3PFGA 3IAAA 3MBIA 3ZQ6A 1BMQA 4MCIA 1OKKA 3IPXA 4MCJA 4OHZA 4DHWA 2QVYX 2R6CA 2GDJA 1BVRA 3D31A 4NU6A 3TLKA 1NJFA 1U5CA 4ENWA 2ZITA 3QVSA 4DREA 3ZGYA 3PUVA 1G5PA 2EWWA 2XYVA 4UBJA 5IN4A 5LP6A 1CUWA 2FOXA 4NDAA 1MC4A 3BB1A 3GT7A 3L7OA 1JG2A 3NBQA 2R7AA 3UHPA 3EPRA 1FP2A 3HY6A 5E9JA 4I8DA 1AG9A 3C3AA 4BUJA 1E79D 4KQ2A 2W6NA 3NM4A 4YJDA 3FKSD 4EVSA 4ZEWA 3LSYA 1SPXA 3EVDA 4HZGA 4YHBA 4CMGA 1HT2E 2YV3A 4OH7A 4V1CA 4WKGA 1BU5A 5GIPE 5HJ7A 3TS1A 4BAGA 1IMOA 1MAAA 1MH9A 4NARA 3R7LA 1AIPA 2ZE6A 3HU3A 1B00A 3A6KA 5D7NA 3RAPR 3LQ2A 4A2QA 5DB4A 2V6IA 4EYKA 4HMQA 2PQ0A 2QU7A 5BOSA 3AZOA 5LOVA 3AXSA 1JNYA 3KE8A 3THXA 1USVA 3JRWA 3G85A 2IHYA 3PEUA 2ZWOA 2HCFA 4CI9A 4H31A 4MR7B 4RMNA 3NI2A 4BFVA 1U3DA 1MQ9A 1CYEA 1DRUA 3ORSA 3UBTA 4LX8A 1JR6A 2GLXA 3SQWA 4ZVTA 1GKLA 1EP9A 1IEXA 2O5EA 3FWKA 2JH8A 3W5UA 1SCKA 2FPUA 2BEKA 2GZSA 2OORC 3CLHA 2AOVA 4GBJA 2ZUFA 4C22A 2BMEA 2IHNA 2GVDC 1V4BA 4ZA2A 2FJPA 4KE9A 3HKBB 5JLAA 3WB9A 4CM4B 3R0VA 3LLUA 3TW8B 4TKVA 4YAWA 4BNZA 1XQWA 5D5HA 3LUBA 1VMAA 3P9NA 4G4SP 2FWRA 4LVNA 1QVAA 3N8HA 3L05A 4LZNA 3T54A 1CUYA 3CBGA 1UBMS 1J1UA 2WYIA 2XNKA 2JIMA 3EXIB 3N2NA 3MCZA 3WB0A 3C8MA 3WIBA 1LH0A 1CIJA 3LYHA 2VG8A 5BN4A 3PNKA 4JJAA 2CXOA 4EI7A 1XFAA 2F8LA 2OL4A 2I55A 2MSKA 2J6BA 5KOYA 3BF8A 4DM7A 4MW6A 1EDZA 4I1PA 2DPLA 3Q7PA 1P3Y1 2C2BA 2CLCX 1ZU5A 4IV8A 2AFIE 2QTBA 3ER8A 3H7IA 1XRRA 3EUWA 3Q5GA 1VDMA 3UT5B 2O2IA 3RRFA 2APJA 1R4NA 4A0GA 1WXXA 1T8WA 2IHUA 1SUWA 2II6A 3TOSA 3DNMA 4PAOA 3TD9A 3U4MA 3NBMA 4KC0A 4LF5B 5KQGA 1ODIA 1W0JA 2JGLA 4IZ6A 2MMGA 1Z17A 5LXTF 2REBA 5AJHA 5D7BA 5GINE 2FX3A 2GF9A 1A5TA 2F55A 1PZHA 2NU7A 2NXJA 4BMOB 4LXHA 1MAVA 1RP1A 3FCUB 5CPFA 1GIAA 4Z49A 1DELA 1IH8A 1XQVA 2PBZA 2QW8A 1HEUA 1RLOA 4KQIA 3KM0A 5JI3E 5CB8A 1ZAYA 1M0SA 3HPQA 1RQPA 2IIPA 2VNJA 2QV7A 3HJFA 2O1XA 1QH1A 3ZI4A 2FPLA 1AMNA 4UVIA 3W77A 3WGYA 4CLRB 4IKEA 4ZVVA 3KB8A 1II0A 4G0VA 3RFTA 3IAFA 4M86A 1URPA 1DJNA 2P4EA 3WRXA 1DC5A 3DFFA 3NONA 1D0SA 2BHNA 4CPDA 5DGTA 4BS9A 1FYDA 2J9GA 3Q8MA 2RAPA 5EHNA 3K32A 4UATA 5B1YA 2W9XA 4HDSA 1CDEA 4LJ6A 1A0OA 4ZCSA 2WLSA 3I9JA 5EPUA 5BQ5A 4TV8F 7ABPA 2VJDA 1H0SA 3MWDA 1L8AA 3K4QA 1DAEA 3QBJA 4I5FA 5TSDA 4YRIA 5NLLA 1RYBA 1XD8A 3KKNA 4AWBA 3OZCA 3Q7RA 1YOBA 3F2VA 4OV6B 4HD8A 3ZTTA 2M6KA 1L7AA 2C7OA 3UXHA 4MQEA 1RKVA 3VPAA 1G0OA 3H4VA 1GSHA 4NYMR 5G4KA 4Z8XA 5LCXA 4ARIA 1U1CA 1XKTA 3DE6X 4IXNA 4LDQA 3VR3D 4ARBA 1UBTS 4MRMB 1Z6ZA 2UYOA 3K1YA 4OMDA 1B6SA 4Q7LA 4C1NA 4EY4A 2EU8A 1N2IA 2YMLA 2Z08A 2G83A 4QTXA 1M8PA 3IHKA 2NW6A 4XW2A 4KEAA 3U80A 4ABTA 3G9QA 3R74A 1H1TA 1QTNA 2NTYC 2GCIA 3V8EA 2BJVA 1XTSA 4K88A 3RFVA 2OBLA 3FTEA 3G8BA 2B69A 1PFGA 2YW2A 3NV7A 1RXEA 4IIBA 4N9QA 3J81k 2VL7A 1K7XB 3NT2A 4Y8VA 4X6UA 3I4FA 2VT6A 5JVDB 8AT1A 1JA1A 3P2MA 4JI2B 3A06A 2XWBF 3V1YA 5TJ9A 4BVAA 4ND4A 5CJJA 2E1RA 4H35A 4MQBA 5D85A 4G89A 1KI2A 4D3XA 4ZV7A 2WJHA 4RDIA 1FLAA 1U65A 2I4NA 3HR8A 3LVRE 4J0GA 1VG9B 1IJEA 1HRDA 1KS2A 1SHTX 3QUQA 3R5HA 9ABPA 1M1YA 5TQ2B 2J08A 2VSOA 4P86A 3FMGA 2R65A 2QR5A 3VI3B 3VSAA 1F8GA 2Y1KA 2IOHA 5IXJA 1P39A 2I7VA 3A37A 3B9QA 2HZ7A 4MS1A 1Z68A 1MFZA 4BKRA 3U0VA 1AUVA 3QOWA 2XWJI 1CJCA 1KK1A 3ETCA 4LDZA 3PJEA 3MRSA 3AT1A 4OUKX 4RHCA 4EK9A 4YAKA 3MEQA 3AHEA 3K09C 3HJRA 4IVPA 4XYGA 2ZBRA 4AO6A 2G7ZA 3DTVB 4C08A 5GTDA 3EWAA 2A92A 3LBYA 1KVTA 5AM1A 2QN7A 2FKAA 3F9RA 5ED0A 1GYRA 1IK4A 1GUYA 2BTOA 3F98A 4ACAA 5B36A 3TF5A 3VKWA 2O05A 1E1DA 2G4LA 3VNBA 4RYLA 1YZFA 2R0QC 1X42A 3NR2A 1G41A 1VIDA 1SU7A 621PA 1DAFA 3T3OA 2OXCA 3VBCA 2ZRIA 2MINB 4AC9A 3KFVA 1MG0A 5K45A 1W4RA 3KWJA 1XD2A 1HFKA 4DOMA 4WWHA 3CWCA 2N0SA 3LW7A 4HDRA 4L5JA 3F4LA 4M0UA 3OEEA 4J75A 1NRWA 2DWQA 5HOQA 3L04A 2WHEA 2YUTA 3X2SA 4KNWA 4KJZA 4B8YA 1R0XA 4UBIA 3PF8A 1YE5A 1SXJE 1X7XA 2H4YA 5BN5A 3ZLJA 4CKYA 4BTVA 3PITA 2I4MA 3DEAA 1PJSA 3KVOA 1L5LA 4IHJA 4C20A 1DVRA 1PJCA 4KCGA 1EWYA 2IL1A 3RHTA 2EG5A 1TZJA 4GL2A 3EW7A 1GP2A 1DKNA 4L7VA 1UC9A 1WDKA 4PGAA 5E9WA 3QI7A 1X6VA 5JCJD 2VYFA 2WIDA 1GSIA 3EDRA 1Z25A 4JB8A 2CUZA 4JI3B 2O1WA 3BCSA 2WYUA 3BB4A 2XE8A 4LX0A 1G4UR 1M8FA 1VE9A 1T5OA 3M6XA 3CJTA 2G5GX 2JA2A 4Q66C 1ZWLA 4RIFA 1RYNA 1KO8A 2A9KA 5CIQA 5C3MA 1NIJA 5JZBA 3RADC 5JWHA 1L5NA 2GPSA 1YTLA 4LHSA 1GQYA 2CN1A 1TAGA 1PF7E 4YLYA 1XMQB 1HE8B 3UJPA 2WVJA 3RLIA 3U4QA 2GFIA 2B6NA 1UFKA 3SYMA 4DXAA 4NBWA 1M6VB 2BGLA 2P6UA 3NHSA 3DWGA 5C8YB 1ESNA 2XTZA 1Q16A 3GRFA 3IQGX 1X1SA 3C5WP 1C30A 3KFXA 3PENA 1JBEA 2EGUA 4HDQB 1N5KA 4IH4A 4R7GA 1SVWA 3KOXA 2ZRLA 1VSUA 1A9QA 1C9EA 1KDOA 1KEVA 1ZXXA 1RXCA 1F8UA 1M34B 2GYUA 4XQ9A 2QD1A 4L8LA 3CVYA 3LPAA 2PK3A 2B7CA 1N2CE 1MU0A 3H4IA 3NHFA 1EFPA 4C76A 1CUAA 1OV6A 3PUIA 4J94A 2XGSA 2GEUA 4K9LA 3DGFC 1T0HB 1E7YA 2CXSA 2BGWA 1V4NA 5FEMA 4FOSA 1ZCJA 3O9ZA 2CHUA 5GQSA 4O29A 3OFND 2ZYDA 3NAGA 1SIBE 3EC7A 3QKTA 2IE0A 2OZLA 3TJZA 3I62A 1HQDA 1JLHA 2H4XA 3ANTA 3DFIA 1ZCFA 4GBMA 1MOZA 2C2OA 4X8OA 1U8ZA 2GKSA 3DMTA 4B31A 4YAUA 2BBOA 4DA7A 1PT5A 4GKVA 2PRYA 1PFVA 3HNRA 4AN0A 4NONA 1UM8A 3AEYA 3OF3A 4FEAA 4INOA 4N5LA 4ZZ1A 4LF7B 3L7KA 2Y1CA 3PLRA 3WR5A 5KAPA 3BZWA 5BQOA 3WP0A 1N8KA 3BCRA 3HEAA 3DBHA 2RH8A 5H80A 4YT2A 2GD1O 4WFIA 1J2JA 1K08A 3UK6A 2P65A 1CY8A 4UAVA 4UOEA 2R2AA 1SCBA 3ZD8A 2J0SA 1UOEA 1WV1A 3OQIA 4RK1A 1OPRA 2XUAA 3NRJA 3PLNA 1Z12A 4QGBA 5THXA 5U4QA 2IZ6A 3WIOA 4ZMBA 5HX7A 2HDNB 5FFFA 1BC5A 2A0WA 3T8YA 4C43A 4AZ0B 4BKQA 2OZEA 4DC9A 2NZJA 5T4BA 3RRMA 2V9ZA 2H92A 4N7MA 4XVHA 5ESRA 1L8LA 4WACA 4UBLA 4RFSB 3AW8A 1DAKA 4IIFA 1R10A 1GPAA 2XWSA 3JV7A 3PUKA 2NUTA 4CODB 3SVLA 4P3KA 3Q3CA 2V9CA 1JQAA 1WM1A 1V9SA 5DRYA 1SVLA 1O95D 5IT4A 3D7MA 4YUAA 3JQPA 4DLWA 1RAFA 2VPYA 1UBEA 3DP9A 4HRYA 5ALHA