2GB4A

Crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
231
structure length
231
Chain Sequence
b'DAEVQKNQVLTLEDWKEKWVTRHISFHQEQGHQLLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNLSYTEEPLAEIAGAKVFKSSSGSISLYCCSIFDLPRANIGKFDRIWDRGALVAINPGDHDRYADIILSLLRKEFQYLVAVLSYDPTKHAGPPFYVPSAELKRLFGTKCSMQCLEEVDALEERHKAWGLDYLFEKLYLLTEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiopurine S-methyltransferase
publication title Crystal structure of Thiopurine methyltransferase (18204406) from Mus musculus at 1.35 A resolution
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 74
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.1.1.67: Thiopurine S-methyltransferase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05724 TPMT Thiopurine S-methyltransferase (TPMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2gb4A00
3A25A 3MGGA 2QYOA 2ZSUA 2EX4A 3KQYA 1KPHA 1XCLA 3P97A 4RYLA 4IKPA 3IV6A 5FWDA 4YUXA 3FZGA 4PYMA 5GIOE 1QZZA 3EGVA 3FUUA 1JR4A 3KPVA 3L8DA 5EIFA 1VP9A 4QDKA 5C0OE 2P40A 5EEGA 5EGSA 3TR6A 3G5LA 4HG2A 5F2NA 5H02A 1N2XA 3G88A 5HIIA 2IDKA 3KQPA 3UWPA 4E2WA 1RI1A 4RTKA 3X0DA 3LBFA 3TLJA 1NV8A 3FTCA 2YXEA 5IH3A 4QQNA 3WSTA 1UIRA 2YTZA 2CKDA 4BY9E 1QAMA 2HV9A 1O9GA 4GOND 3QV2A 3SSMA 3CJQA 4MHTA 4PIMA 2OB2A 5DX8A 1RI4A 3FUTA 5G02A 1T43A 2YX1A 1O9HA 3FTFA 2HTEA 1ZKDA 1Y8CA 5EHGA 1NW3A 4LECA 1AF7A 3KR1A 2JH9A 1R8YA 1ZQ9A 3EEOA 4HTFA 2F8LA 2AOUA 4YMGA 3BUSA 2NYUA 3FPHA 5E1DA 3MCZA 4FGZA 5EKUA 4RTSA 2FRXA 5E1BA 1XXLA 4AZVA 5K0NA 4P58A 4PWYA 4FP9A 4RTQA 4DM3A 2UYQA 3KHKA 3P71T 1QAQA 2FHPA 2IBTA 3GCZA 2VZ9A 3OE4A 3ELWA 5DM2A 5DSXA 3EPPA 5E9QA 1FPQA 5KQSA 2YUIA 4AX8A 2NXEA 4OA5A 5LR6A 1NKVA 2PX4A 3DXYA 4M38A 2NXCA 2ZVJA 3GO4A 2GAFA 3SR4A 5DSTA 1L9KA 5EZSA 4HGYA 3OFJA 4XCXA 4AZWA 3HA3A 3HNRA 3SVZA 1MHTA 3EMDA 1Q0TA 2FK8A 1EJ6A 5DTRA 3OU2A 3E8SA 3OPNA 3FTEA 4GQBA 3NDJA 2Y1WA 3GIWA 1R00A 5FTWA 2OXTA 1WXXA 2ZIEA 4DCMA 3G7UA 4KDCA 4WXHA 4HSGA 2XVAA 2VDUE 3THSA 5ICFA 2B2CA 2V74B 5EMMA 2PWYA 2AOTA 2R3SA 3LL7A 1QYRA 4P7GA 3BWBA 1M6EX 4PGGA 3KQQA 1P1CA 3QOXA 3CJRA 1U2ZA 2PXXA 5P8WA 3TRKA 3TQSA 2PV0A 1INLA 3SGLA 2P1DA 1Q0SA 3M6VA 2ONYA 3O4FA 4PINA 4XUDA 1R18A 3CJTA 3MTEA 5GIPE 4E2YA 4GC9A 4RSRA 4YV1A 3NVKI 2JHPA 3ELDA 5MHTA 4KDRA 5T64A 2NP7A 3C3PA 1QAOA 3M4XA 3NW9A 2O07A 5E9WA 3GRVA 3VSEA 4X63A 3UJDA 3PTAA 1UFKA 3HVKA 5E2AA 2BM8A 4RTJA 5HIMA 1RI5A 1KYZA 3M6WA 5K8VA 1YFLA 2HMYB 3B3FA 4HGZA 3ER9A 2IH4A 3HA7A 4IV8A 3DOUA 3HVJA 4Y30A 4V0QA 4O29A 3HCCA 4X41A 3GXOA 3H2BA 2B78A 4RTMA 2AOWA 3G89A 1BKYA 2ORED 3M6UA 5CVVA 3DLCA 3KQOA 3CVOA 3CBGA 4DA4A 3KQTA 2AS0A 2VDVE 3EMBA 2QE6A 3LX6A 3E23A 4PGHA 2C7OA 1BOOA 3AJDA 4EK9A 4MWZA 2AOXA 5K0FA 4V0RA 3GRZA 2YXDA 3TM5A 3AXTA 3DMGA 2PX8A 3G2PA 4GUAA 5KS2A 3A7DA 1KR5A 4GF5A 1ZHFA 2AZTA 5E9JA 4QTUB 1WS6A 3M6XA 3CCFA 3NJRA 2VS1A 5CCXA 5E1OA 2PT6A 5K0BA 5DM0A 2O05A 3OCJA 5M5BA 1NW8A 2OZVA 5EG5A 4FZVA 2P41A 1RJGA 1FP2A 1IM8A 3FTDA 2ZWAA 3HEMA 2QRVA 3B3JA 4PYQA 5CM2Z 4BLUA 4RTRA 4IWNA 5C9ZA 2ZTHA 4R8RA 4RVDA 4HRAA 4M7RA 2OBFA 1JSXA 1TPYA 5DXJA 5HILA 3UA4A 2HWKA 3DH0A 3I9FA 1NT2A 3KU1A 4CTJA 2ADMA 2BZGA 1F3LA 4PYLA 5CCBA 1RI3A 3OU7A 4R6WA 4M37A 5FA5A 5K09A 1X1AA 2EJTA 3HM2A 3OFKA 3G5TA 4PYIA 4HH4A 3HTXA 4PIPA 2YR0A 3KR0A 2N47A 3Q7EA 2IGTA 1JSZA 1XDUA 2ZLBA 2ONZA 1JQ3A 1P1BA 3LDUA 4RVFA 2PY6A 5E8JA 1QANA 2IDJA 1UWVA 2E5WA 2HNKA 2I62A 3UJAA 1I9GA 2OO3A 2ZIGA 5JR3A 5K0LA 1VE3A 3G2OA 4YUYA 1O54A 4HTFB 5FA8A 3UJ9A 2VP3A 1ZGJA 3V8VA 5EOVA 3EVEA 4FS8A 3UZUA 1P91A 3DUWA 3NWBA 1JG4A 1XJ5A 1XVAA 3VC1A 2Z6UA 3D2LA 1XDSA 3BWYA 2P3QA 3PFGA 4FT4A 4GOOD 1I4WA 4P7FA 2JJQA 2ZULA 5EPEA 1L3CA 1VP3A 2AN4A 4PCAA 5JUWA 3O31A 1M0EA 5KQRA 3EGIA 4RVGA 4E33A 2P3LA 3P2KA 5DLYA 3A4TA 3TFWA 3FRIA 2XYRA 3KR2A 4FR0A 3DTNA 1IXKA 5U4XA 5CIYA 8MHTA 3IHTA 4QVKA 5GM2A 1PJZA 1WY7A 3BKXA 3VC2A 4EKGA 2AN3A 4PYJA 5BXYA 3V97A 2IFTA 2IIPA 4GOLD 5ERGB 3THRA 2Z6QA 5EIWA 5GP1A 1RJFA 3EVGA 3LGAA 3G2MA 2WK1A 3G2QA 3PB3A 5LQRA 5BW4A 1F38A 2PJDA 1FBNA 3LCUA 3NMUF 2IP2A 5FCDA 1SG9A 3AXSA 3KQMA 1NW6A 2HR1A 5E2BA 3K0BA 3HCEA 3RODA 3LCVB 1RJEA 1WZNA 4FT2A 2IH5A 3BT7A 2ESRA 3PT9A 4BLVA 2OPBA 5HEKA 3SM3A 3R9XB 4ZTBA 4F85A 3MHTA 5CD1A 4GBED 10MHA 2JG3A 1RI2A 1FJXA 3E7PA 4PYKA 2FPOA 3LCCA 4E31A 4QPNA 4DF3A 2PWPA 3B89A 1YZHA 3C6KA 3MQ2A 4ER3A 3OZSA 4QVGA 3KPUA 5D1NA 4YUVA 4RTOA 5HZMA 2PKWA 1JG3A 1VPTA 4P7KA 4OBXA 1TW2A 2YXLA 4B17A 5LQCA 5EC8A 3PLAE 1KP9A 5DT2A 3TMAA 4OBWA 4KVZA 4Y2HA 5KVAA 2IBSA 5EMLA 2ZCJA 3MCTA 2PGXA 1ORHA 4DQ0A 3GJYA 5LQAA 5BW5A 3UJCA 3EVCA 1D2CA 2ZBRA 3A7EA 5CVUA 1XCJA 2XYQA 3OE5A 3SMQA 2NP6A 1AV6A 4OA8A 4C06A 5ICGA 3AY0A 4X60A 3HP7A 1R8XA 3AWIA 5EHIA 3CC8A 5DM1A 2Q41A 2B3TA 3P2IA 2V7EA 2YVLA 2NXNA 3EVDA 3F4KA 3ME5A 2G8NA 3LDFA 1Z3CA 3PX2A 4P7JA 4PONA 4LG1A 4GEKA 4OQDA 4C05A 5LQKA 4RTPA 1M6YA 3I53A 4KRGA 2FK7A 1G8SA 1KPGA 3I58A 4F84A 3B7PA 1NE2A 2EG5A 5CVDA 2JH8A 5HFJA 3BWCA 2PXCA 1G38A 3K6RA 1EJ0A 4EKIA 2GB4A 2ZZMA 5FUBA 5DRYA 5EMJA 3S68A 4C03A 3GRYA 2ZWVA 2BR3A 3M33A 1NW5A 5F2OA 3MAGA 1EIZA 3KQVA 1NW7A 2P35A 3MTIA 3EVFA 1VIDA 2BR4A 4E70A 7MHTA 1X1CA 3A27A 1XDZA 2ZW9A 1FP1D 3B5IA 2GH1A 3Q87B 4X61A 2C7PA 3FPGA 2BR5A 5K0CA 1JQEA 2EFJA 4RVHA 3C0KA 2A14A 4XUCA 4YUWA 5LQJA 3TPZA 2O06A 5EKXA 2JHAA 5ICEA 5DTQA 4DMGA 4YV2A 4CKEA 4G56A 2DULA 1AQJA 3ELUA 1YB2A 2PXAA 4A6EA 2C7QA 4QTTB 1I1NA 3OZRA 3ER8A 1DCTA 2Z6AA 3JWHA 1D2GA 1ORIA 4ER7A 2R6ZA 5EVJA 4UOEA 4F86A 1X1DA 2PBFA 3OU6A 3IYLW 3UA3A 3REOA 5D1HA 1N7IA 1BC5A 2KW5A 2I7CA 5DX1A 4ER0A 5DWQA 2ZZKA 4DKJA 1DL5A 4QPPA 4BP3A 2P8JA 5FQNA 4HC4A 2IPXA 4X1OA 3RW9A 1KPIA 1PRYA 2G72A 4MIKA 1JG2A 3SSNA 1VBFA 5BP7A 4ATNA 4MTLA 1G6Q1 3UFBA 3MERA 4KIGA 2ZBPA 1SUSA 5E1MA 3C3YA 3GNLA 2G70A 4EMSA 2FCAA 2PLWA 3I5UA 3IEIA 3KPJA 5K05A 5K03A 3PVCA 3TOSA 5T67A 5IKMA 2G71A 2WA2A 2AOUB 2CL5A 2PVCA 2Y1XA 3LHDA 5FHRA 3GRUA 3LKDA 4PYOA 3R0QA 5CUQA 3TM4A 1EAMA 2PX5A 2O0LA 2VDWA 4LWPA 3NTVA 5FQOA 4PNEA 2H1RA 1KXZA 3KR9A 2B25A 3HVIA 5K0GA 4E30A 2GLUA 2XBMA 5GWXA 3LBYA 3NDIA 3SXJA 3B3GA 3BXOA 3HCAA 5E8RA 4CXMA 2UYCA 5FULA 1V39A 2H00A 4AZSA 3RIEA 2B9EA 3A26A 2CMHA 3CGGA 3P9KA 2NNWB 5EMKA 2C7RA 3TKAA 1G60A 3UJ8A 4AZTA 3DR5A 3P9NA 3I64A 2AN5A 3KPYA 3PX3A 4M36A 5EEHA 1NBHA 5FHQA 3UJ6A 3VYWA 5DTMA 2QM3A 3ANXA 4CKBA 3LKZA 1P39A 1AQIA 1KYWA 4KW7A 3T7RA 1HMYA 4Z2YA 4YUZA 1H1DA 4FSDA 3FPFA 2GS9A 3PS9A 1YF3A 5K01A 3DLIA 3SSOA 5LQUA 3GRRA 3LDGA 1YFJA 3BZBA 3DMFA 1VLMA 1XTPA 3FPJA 4KIFA 4NECA 5DRTA 4A6DA 2BH2A 3TKYA 1B42A 4YMHA 4R05A 4JXJA 2AOTB 3HCFA 4CWAA 2AR0A 3FPEA 5CVEA 3T7TA 5DM4A 2I9KA 5T6BA 2WA1A 3EGEA 5DPMA 3UJBA 1L1EA 3ELYA 4XUEA 1G55A 5K0JA 3FRHA 4C04A 3BKWA 4WVLA 1SKMA 2CMGA 5EZQA 5CVJA 4LWOA 3MB5A 4CKCA 4DZRA 2P3OA 2QY6A 2XVMA 3C6MA 3M70A 2P7HA 3KPWA 3R3HA 2NXJA 2PX2A 3HCBA 2LD4A 4FSXA 4RV9A 4RWZA 5K0EA 3LSTA 4QDJA 5FWAA 3JWGA 3GDHA 1YZ3A 3ORHA 5GOZA 5C1IA 2I6GA 1D2HA 4E32A 4IV0A 4AUKA 3BGDA 3G8BA 2P7IA 3JWJA 3DULA 1OR8A 1ZG3A 4GC5A 3U81A 3T7SA 2FYTA 1IY9A 1EQAA 4U7TB 4C07A 9MHTA 1MJFA 1VL5A 4ER5A 4RTNA 5GM1A 1JQDA 2EJUA 2O57A 3CKKA 1R74A 4QQKA 1JTFA 2K4MA 5LQNA 3QOWA 3NVMB 3EVBA 4BLWA 3GU3A 3T0IA 4RTLA 4MQ4A 2ZBQA 5HIKA 2PT9A 3P2EA 2ERCA 5DX0A 1NV9A 1SQGA 3P9IA 4R8SA 2UYOA 3DXZA 4ISCA 1JTEA 3FUVA 3NWEA 3UBTA 3HVHA 2AVDA 1BHJA 4PCLA 4PYNA 5B1SA 5KYGA 2UZ4A 2BM9A 2AVNA 3LPMA 4EVIA 3HA5A 5LSAA 1KHHA 2GPYA 3JWIA 3GGDA 3R6TA 2OY0A 2XYVA 1HNNA 3EEYA 1TW3A 3DXXA 4RX1A 5HIJA 5F2KA 1NBIA 4L7VA 3FUXA 1G8AA 3BGIA 4POOA 3EVAA 2DPMA 4KWCA 4OQEA 3UJ7A 1R6AA 3R24A 4YV0A 1X19A 3O7WA 4R6XA 4ER6A 2G1PA 1N7JA 1YUBA 3FUWA 2QRVB 4E2ZA 1EG2A 5GINE 3OZTA 3BWMA 2YQZA 1WG8A 2JHCA 3E05A 2ZZNA 3LECA 3P9CA 5FADA 4CTKA 3EVZA 2PSSA 2OKCA 5EQJB 1SUIA 2GA9A 4C4AA 3ERCA 1DUSA 2OB1A 3P8ZA 4E2XA 1WXWA 3BGVA 2H11A 2CWWA 3HCDA 4K6MA 4U7PB 3PFHA 3KKZA 2IH2A 4C08A 2UYHA 3FYDA 3ID6C 1SVUA 3SX0A 1ZGAA 1JG1A 1SQFA 1X1BA 4DCGA 1RJDA 1VQ1A 3G8AA 4OX9Y 4BP1A 4EQZA 2ZIFA 3DP7A 3KQWA 4GOMD 5HOQA 1KIAA 2ZFUA 2OYRA 3GWZA 5DXAA 1L3IA 1L3BA 3FYCA 2AOVA 3DMHA 3KQSA 5ICCA 4H0NA
chains in the Genus database with same CATH superfamily
2CNLA 4YS6A 4HS9A 2UDPA 3V32A 2XQGA 3OQIB 1SUAA 3BWDD 1KEKA 2YWRA 3EGVA 4D7AA 1ISJA 2R1ZA 3GJRA 5D8DA 5C0OE 1Q7GA 2FY8A 1EIWA 2JFOA 3IP7A 2YVQA 3H9BA 4ILEA 2FSGA 4CCWA 5ITVA 2B37A 1N2XA 1TXGA 5CBPA 1JPVA 5JJKA 2FMTA 3HU1A 2J0UA 3KQPA 3T7AA 3RLFA 2WM2A 4IDEA 5GVSA 1KZHA 1NXXA 1AG9A 2GF2A 1Z2DA 4R51A 4CMEC 2ZJ8A 4KJZA 2Q4OA 5AI0A 2CKDA 2D7DA 1VL1A 4BUZA 3W5UA 4PIMA 3MMZA 3CVJA 5K8UA 5EP1A 1QOPB 3F8SA 2AG1A 3OKFA 4OHBA 4LF9B 3FTFA 5EHGA 1T6NA 1XP5A 2VF2A 3DKPA 3TF5A 1DV1A 4MI1A 4LYYA 2ZSEA 5BPHA 1E9VA 3DHVA 5ECGC 2HBZA 2JH9A 3JATA 1ZQ9A 1JXMA 3CE9A 3G7NA 2HK7A 5CDTA 1GPKA 2R7LA 2FW9A 4EH1A 4HYYA 1WDLA 5HQ3A 3ICEA 3QFFA 2Q5IA 3ODGA 3MOGA 3VZRA 1NDQA 3LP6A 3MD9A 3OTOB 3CZRA 3HXOA 3GP8A 3DOFA 3OY2A 3VPDA 1GAEO 1P9LA 2A8YA 2ZUEA 3GLKA 4OA5A 1NKVA 2NNLD 5CDUA 1P7PA 3DM5A 1QKIA 4JLAA 4KDFA 2HIMA 4WKBA 4BFLA 4CQMD 4PCVA 3AEYA 4Z2AA 4ZGWA 1E9EA 3ITDA 2NZJA 4NEHB 5DSTA 3GNQA 3TX2A 4LJ6A 5CP8A 2DM6A 4AJLA 1EEXB 4DTCA 2XWBF 4UUMA 1RXYA 4LI3X 1E1NA 4RVNA 4XTRA 1WP4A 3E8SA 2O3RA 3FM9A 4O1MA 5CNMA 5FTWA 3NDJA 5IVDA 3IRVA 4JP8A 4N47A 2B0CA 4KQGA 5M34A 1ZAKA 2F9LA 2OTCA 2ZIEA 4KDCA 5I3ZA 3B51X 1RBYA 3R0XA 3H5TA 2GARA 2Y71A 3IAUA 3DAOA 4GRDA 4F3KA 2PJZA 1NI5A 2B4QA 1OFUX 2KBFA 3KHUA 1IJBA 3PXDA 2AKEA 1QYRA 3K8OE 5AK0A 1AGPA 1M6EX 1NSFA 4Q47A 1SKYE 3TQSA 5IDWA 5LQNA 4YJ3B 1GGNA 2V5AA 3DT9A 4UM8B 3WLFA 5DNEA 3FKJA 1EUCA 1UANA 3ZK7A 1ZN7A 2IHUA 3KYCB 5EA2A 3SGLA 4LNAA 1QVRA 2VBIA 1IPHA 1Z5VA 5DYNA 1F8UA 5SZHB 4C89A 1N7GA 5JDIA 9LDBA 1JQBA 1BEUB 2XAUA 4D8UA 5JANA 3GEEA 5FL7A 5GIPE 4YQZA 3ZHVA 5HXAA 1YQQA 4C1BA 4JA0A 4O8ZA 5L6MB 2FP4B 3AUKA 2ENWA 2UZ3A 3S4YA 2V45A 3NW9A 1ZNWA 4RGQA 2GD1O 3TQIA 3WIOA 1JAZA 1P5RA 3P0EA 4ZAXA 2NZYA 4C6RA 2Z2YA 5ELLA 3O47A 1UFKA 1XTRA 2OZKA 3HU3A 3M1AA 1J5EB 5E2AA 1HNWB 4ENSA 3KCNA 2QVLA 1Z22A 3E7XA 3QX3A 4EY6A 5EKSA 4X3PA 2WKSA 3TZEA 5CFLA 1B00A 3ER9A 4JBGA 3V46A 3EGDB 3DOUA 1HFEL 4FC7A 4HEHA 2DBYA 3I01M 4GI3A 2DTXA 4UAGA 3GDGA 3B3QA 2YHIA 1H23A 5J2UA 1E7WA 1G63A 4DY4A 4C4YA 4U0JA 3A11A 4HAUA 3KQTA 4KMMA 4RA9B 4W6QA 4P31A 3EY4A 2NWQA 3LX6A 5FV7A 1TQDA 1KO5A 4MWZA 1Q19A 5KNBA 2DFVA 2V03A 2WWRA 4Q19A 4Y1RB 3VU1A 4CF3A 2RGYA 3W90A 4JAVC 2XGGA 3H7IA 4F4CA 5KAMA 2ZJ0A 2X15A 4OP2A 4JI6B 1FFSA 2XA2A 1ZGHA 1ZJZA 1GKIA 4D74A 1SVLA 3OLQA 3RT1A 2R8XA 5IXSA 4Q1EA 3KOYA 1Z45A 2POQX 3OBIA 4NLLA 1CY2A 4DLTA 5BUZA 3MMNA 5AOCA 5I7FA 4FZVA 1R0YA 2GPTA 1DU4A 2BGRA 4JI3B 1LF0A 2PUHA 2R11A 2JGJA 3R3XA 3V48A 4I2NA 2IOQA 5ALXA 3MGKA 4XOIA 2JIZD 1KEEA 4RVSA 4R8RA 4IGIA 4F3RA 3GRCA 1JSLA 1YQXA 2AGVA 2J3KA 2WBLC 2JIMA 2WFAA 2XW6A 2XOXA 3AH8A 3D7NA 5HBRA 2GXAA 1LI7A 3UMRA 1EE2A 1JR3D 1CJCA 5K6AC 4IFEA 2X42A 4WOCA 1EDZA 1BNCA 4MB2A 1NF3A 3CZPA 5I4IA 2CDRA 1R5OA 2NT3A 1C9JA 1AK1A 3O90A 1BFDA 1FW8A 4P0QB 1K7SN 2WUWE 4DARA 1L7NA 1KJWA 3FSGA 3NHWA 4KXNA 5B58C 1OCEA 1BXRA 4RZIA 4AULA 4UFNA 2WTUA 4WFKA 1FS6A 3QP9A 3BE4A 4H3KB 1ZW6A 2O3UA 1V7ZA 4TL7A 5K0LA 1CUGA 2X0IA 4KHPB 3UJ9A 4MCAA 1U7WA 4NULA 1MW8X 3EIUA 3EOBI 1XJ5A 1Y6RA 4J0DA 1FK8A 2VSYA 4GOOD 1UZMA 3CO0S 4P7FA 3NP9A 1GG9A 2MOKA 2JJQA 2ZULA 4G97A 4PZEA 4PSUA 3IO5A 2VHXA 1ND6A 3AB8A 5GV7A 4DABA 4QUGA 3AMVA 5ALIA 4ZANA 4EBFA 2X19A 4U9HS 4GLOA 4M3NA 5TS3A 1UAAA 4AS2A 1XZ8A 1P9NA 3OSUA 1ULZA 5DISB 4QVKA 4ACBA 3BKXA 4EW1A 3VC2A 4ZZ1A 1MAWA 2W8ZA 3CLTC 1I4EB 3JQ9C 3N8IA 4E3WA 4GGPA 2Z6QA 5JAMA 1UZNA 3EVGA 2FPKA 4QRHA 1I2ZA 3LDHA 3TLXA 2O0MA 3QVXA 1I7QB 2C5BA 2FZCA 3WGHA 1ZNYA 2IP2A 5NLLA 3CT6A 1U63A 4DILA 4R01A 3FTNA 3C1AA 1LUAA 3K0BA 3OLXA 2ZDHA 3TLEA 5B2EA 3W5BA 4I5DA 3ER6A 3D4BA 2LTAA 4C6SA 4XGNA 2H1IA 3FAKA 4U6SA 3SM3A 3TE6A 2HJHA 1SXJE 3E3LA 3F46A 3RC7A 5CD1A 2JG3A 2UUAB 2C57A 3VTZA 2QEQA 1FSZA 4Y6RA 1Q1GA 1JLHA 2AXNA 2HBRA 5KB3A 5DNVA 3L79A 4R68A 2VOEA 3CLSD 1ECCA 3HBFA 2H8GA 5DK6A 1U0FA 5HJEA 1PUXA 3KZ1E 2YIVX 3A1NA 2IU3A 2BGIA 5H59A 2UXDB 1C2YA 2D2XA 2JA1A 3CURA 2RGAA 1HLPA 2ZCJA 1E2BA 4BO8A 3LLMA 1RRCA 4PO3X 1AVTA 1E5QA 1VPLA 2PZFA 1USKA 1YR3A 3DFUA 3EVCA 4FQ7A 4RK1A 1B6GA 2A0UA 4KTVE 1MENA 4ZO7A 1QWOA 3ZVNA 5F35A 4DLRA 2NP6A 2UU9B 4FR5A 2COKA 2PANA 4DNOA 1R8SA 4OQZA 4PSVA 5JH7B 1U7TA 3IAEA 3H1AA 2QTTA 3FG9A 5B1DA 4KKVA 1ZH8A 2EW1A 4OYHA 4AKEA 1DHTA 4WZAB 4MQEA 3GLFA 1ZNXA 4NV0A 4ZYLA 5KUTA 5KYWA 1P9OA 4LTDA 2WJIA 3ZQJA 4EARA 4IMPA 5BYKA 3HO8A 2FR8C 2HSDA 2KBEA 1H6AA 5L3RA 3DKKA 3BK1A 2WR8A 3TAUA 1SD5A 5LU8A 4IUCS 2ZYHA 1SVNA 3INRA 4TMXA 1D1PA 5F2OA 3ZWKA 4X93A 5KWEA 2C4HA 2OCAA 2C5SA 4OLAA 1LTHR 3KDPA 4Q21A 2VEDA 1SU7A 4IQ4A 2JFBA 5ALUA 1OBHA 3A27A 3I01A 4TX1A 3SIRA 4UTVA 4EB0A 3WYCA 2XDWA 4K9KA 2FFHA 4TTAA 3HKEB 4X61A 5KVVA 4NZMA 2LDXA 3VR6A 1X70A 3UJHA 3UPUA 1KOJA 3EIQA 2GLXA 2B6NA 3T52A 3K09A 1THZA 1B16A 1DTWA 3ONDA 1WKBA 1AZWA 2VTEA 3E4DA 3OCUA 4RHYA 4KB5A 4Y9UA 3ONFA 4RZUA 3TPZA 5B12A 1FDSA 2D8MA 1MX9A 1E32A 5AW5A 2FZKA 2RGRA 4WK6A 5B3KA 1Y3IA 1E89A 2HZBA 2P5TB 3KYDB 1DG1G 3B82A 4HQRA 4JX8A 4TTIA 4YLGA 4DLPA 3TNYA 3A2MA 4BFWA 3SBDA 3KK0A 5EP2A 2HA4A 2MSCB 4H1VA 4PC3A 2PPVA 3R76A 5AT1A 1CULC 4Q16A 1N7IA 2Q21A 4HBGA 3FF1A 3UV6A 1JP7A 4KGZA 1TUBA 3RRXA 1VDMA 3I9V6 4X92A 2W8BB 4HN9A 1Z26A 1U3VA 1IL0A 1RXEA 3EZ6A 4Y1GA 4YLEA 2LZ0A 4IRMA 4IRXA 4WN3A 5E7MA 3JQFC 1JMVA 2C5HA 3MGAA 2FJ0A 3EDMA 3RV3A 1EUZA 3C7AA 2KM1A 1K86A 1WF6A 3RSFA 1DQRA 4EJ0A 1GPMA 3AB3A 2FZ5A 3H65A 3PGXA 3DTVB 4IZHA 5BNZA 3KDAA 1EESA 3KM0A 1UBFA 4FZJA 1JU3A 1E3MA 1W49A 1XA0A 3DZ8A 4GQIA 4L8GA 4Y2UA 4H4DA 4MW5A 1BAPA 5E3IA 3TEJA 2XZDA 1ZVKA 3WK6A 1RAFA 4JFAA 2EATA 2IYNA 2MR5A 3U3XA 5IASA 3WRXC 5C5EA 5EJ4A 5IAAA 2GCIA 1QP7A 4UU0A 4I14A 3WGKA 2IODA 3C45A 2H6EA 4NS1A 4PLWA 4QU9A 3TG2A 4FMDF 3KVNA 5LQSA 1G60A 1U1CA 1T25A 5FHQA 3OZUA 3D7LA 1WZCA 4QFDA 5DVZA 1YJ5A 3DV0A 3Q2KA 3SJZA 2LDBA 1ZR2A 3THXA 4PZ0A 4QYXA 3SXUA 3SYTA 4GP6A 2IZ0A 2AYYA 1LWOA 5IVPA 1QM5A 4OIMA 3PHBE 4BXOA 1RPAA 3DPUA 5IW8A 2F3RA 3VOAA 3FPJA 4FJ0A 4BE4A 5SICE 4CQLB 1XJQA 3LZCA 4Z1OA 3W5CA 2H1CA 1CUJA 1XL1A 4DB2A 2NTYC 4QOFA 5G3YA 1QX3A 1MRZA 4KX5A 1JDBC 1YB1A 4MV3A 1O95D 1V7CA 1AM4D 2I54A 3ABZA 3P2YA 4P3XA 2WMYA 3GJXC 4Z8XA 5EHZA 4JC8A 1TKCA 4MIOA 3EWIA 1XZBA 2EZ9A 1DX6A 2P9ZA 4XYBA 3WGMA 1UJ2A 3GPCA 5EZQA 3LIIA 1P0FA 1G5IA 1T3TA 3P19A 1PNOA 3DFIA 4LWOA 4J9UE 2DQZA 3W79A 3MWLA 2NXJA 2Q3CA 2YWCA 3LD9A 4F3CA 5K0EA 2WHQA 3NONA 4C88A 1JKXA 1RJ9A 1IQRA 1N2OA 2WAOA 4IJKA 5C1IA 3PUHA 3RKUA 4N76A 5BOSB 5JT1A 3GI1A 2VAMA 5FOQA 1LTKA 1FP4B 2IYVA 3FX2A 2JKZA 1G3RA 4NMHA 2NVBA 4OHMA 3WYDA 4IYRA 3ANMA 4A10A 4C07A 1U04A 4ZVVA 6AT1A 3WHLA 4HLQB 1K6IA 4NZ9A 4L16A 3WGQA 2I29A 2D0DA 3BB4A 2IYEA 1EHYA 5BWOA 3BXGA 1X1RA 4KKXB 4B9EA 3QBVA 3JQ6A 3AVVA 5I5GA 2VDKB 1C3EA 1R6UA 2QIOA 1K5PA 4ZRDA 4ISCA 4CI9A 1JI0A 3WHIA 2BBWA 1T8UA 5K45A 1MT3A 2PO7A 3JAMA 3A3NA 2VPTA 3HCPA 3OY7A 4JD5A 1CIVA 3K2QA 2D2EA 2IY7A 2P0YA 4KGDA 4QGFA 4K2HA 3VU0A 2Q5OA 1T9ZA 1HNNA 5D3MB 4Q4LA 2AT1A 2P67A 4W8GA 5HIJA 1C7ZA 3SYLA 3U4MA 1OTHA 1E4EB 1QCDA 4YR9A 4LDZA 1DWOA 2VRCD 2BZ1A 5DLEA 5EXDA 2QTBA 4YN3A 3V8PA 2CLLB 2AN9A 2CVOA 2OWEA 3R24A 4FOOA 3TGWA 1PG0A 3K9LA 1U1IA 3ZIAA 4X8HA 2ZR0A 5JTUA 2VNKA 1YZVA 4F4JA 1T8TA 1M2HA 2L69A 4JOSA 2JCGA 1ONOA 1E4OA 4U2GA 3P9CA 5HRCA 1R6XA 3GZTB 3L7MA 4JOBA 1TTQB 4LQLA 8GPBA 5EE3A 3IE2A 1QIJA 3CH5A 3ROEA 1M8PA 4C4AA 1M8KA 5JW6A 1QH8A 2HRCA 2VJNA 1XVTA 2VJMB 3IKVA 1KAQA 1RLIA 1SA0A 1UXOA 2XLCA 2FMFA 2ZPAA 3KWFA 1DQSA 2UZ1B 1YNSA 4OM7A 1PZGA 4Q1FA 2EIXA 3IVRA 4PFQA 2X1VA 2IV3A 3U80A 4C08A 4YYZA 5DV9A 3RF7A 1ZOOA 4RO0A 2DHQA 3RAFC 3A6ZA 3IPRA 2OD9A 1NLUA 4XGKA 3RC2A 4G6ZA 4EQZA 2O8BA 4I4TF 4I1SA 4MAFA 4F12A 2N0SA 4F9TA 3I4LA 4KR0A 2ERYA 3PFIA 3EARA 4YAWA 1OAAA 1HX7A 1K92A 4XWKA 3CSDA 1ISIA 3S8YA 2CHEA 3U0BA 1DPGA 1ACMA 2X8JB 4FYIA 5CXSA 1CKEA 2SCUA 4OU4A 1YA6A 1XPUA 5DWDA 2BEVB 4MINA 2XDQB 3UUGA 2NU6A 2FHSA 4CG2A 4HG2A 3N0XA 3PNQA 3R5FA 4WXEA 4Z7NB 1U3CA 4K9RA 2P9EA 4JYAB 4UHHA 1Y3CE 3Q40A 5LFAA 3CF0A 1XHLA 1C30A 4F96A 4N7JA 2G9NA 3KJQA 1OZ0A 4WOPA 1N75A 5JMPA 3RS4A 3U19A 2A0XA 1DEHA 2YXEA 1YNOA 3BH7A 3HBNA 2ES4A 4MVJF 4HVTA 2ZVPX 4WN9A 3CLKA 3SFTA 4CZ2A 5BW8A 5IFKA 4TWRA 3HXQA 1Y9JA 3FKSA 3SSMA 2Q6IA 3UT5B 2H18A 1JT9A 4QICA 3V34A 1P1FA 3O0DA 4ALNA 4WINA 4BEBA 3ZN2A 1JRLA 1DKNA 2MSNA 2WNIA 3EASA 4UEQA 2WSYB 4BVKA 4L5AA 4ZCMA 1G8GA 3Q9NA 1ODJA 3EZFA 3DSRA 4YFYA 4CL2A 1HC7A 4I6JA 4D6YA 4QYIB 1XWIA 3GJ4A 3CNHA 4XPZA 1NHGA 1L5ZA 4AZVA 5AUPB 1KMCA 1VOTA 5TPZA 1A5AB 4AW9A 4RTQA 1WLSA 3B9QA 4DJTA 5ABPA 1BH6A 1SN7A 3R9IA 1KBQA 1XJWA 5DW3A 4CLRA 2Z43A 3RUAA 5DSXA 2JK0A 3NXKA 2RGNA 4HUTA 2GBLC 3HGTA 1YQUA 1G18A 1GILA 3K05A 2QA5A 2JIBA 3U62A 2VQFB 3X2SA 1OI3A 5IJ0B 1MR3F 3H3JA 3DZKA 4LJ9A 3R7BA 3SVLA 3DMRA 3ISJA 2F1IA 3QU2A 1MX5A 4XCXA 2H4ZA 3IP8A 3C4QA 1HNXB 4M1EA 1VCNA 2EJWA 4OHUA 5FX2A 3TH5A 4JR2A 4FYYA 1EFHA 1YO6A 1EJ6A 2HNAA 3VVCA 3TZKA 4TUYF 4D9HA 5JD4A 4GQBA 5EMNA 3VZDA 4AJOA 3W5DA 4C0HA 1OIVA 2DH6A 2XMRA 3K0SA 2QSYA 3CYFA 3O4JA 2XUQA 1D04A 1Z56C 2J5XA 2CZGA 3DOCA 3JR3A 3L82B 3JQBC 1YBAA 1G20A 2ZUWA 1YS6A 2M6SA 3QUTA 3QOXA 4GYWA 5CLGA 4ZXFA 2A0YA 2VAPA 4KNVA 5HP4A 4RL6A 1PJSA 1VKZA 1S1CA 3K1AB 2X3UA 3SJCA 2NO9A 3R3WA 2RJOA 4GD3Q 2G88A 4MJXA 1XQXA 2J5RA 5JCJA 1P0IA 2ONYA 1N8TA 3P26A 3AF1A 1MAVA 2O8EB 2I22A 3RSZA 1NU8A 2GK3A 4LNUB 5A04A 3C3PA 1VBNA 2WWHA 3LXXA 3DEJA 3QEMB 4N9QA 3FH0A 1F7VA 1SCNE 3IP9A 1I7LA 1KDVA 1SY7A 2NSHA 2WYUA 3DEYX 3MINA 4XGIA 4GX1A 2YVKA 1X80B 2EL7A 4F2DA 1W4CA 2YS6A 4TKVA 2J48A 4FDVA 3FFBA 2C78A 3M5PA 1OT5A 3LUKA 3ORQA 4RMNA 2VH1A 4BEVA 3JV7A 2CN1A 3HVJA 1I5RA 1W9MA 3HY4A 3GXOA 4L72A 2AFHB 3R3YA 2J07A 5J5CA 1SWWA 5J59A 4EFLA 5BN3B 2E4ZA 4CIDA 2DFNA 2FPLA 3KQOA 3NIBA 4KXYA 1TT5A 4OXYA 4X97A 4EVRA 4YY3B 1SXQA 1AO3A 1TLTA 3EMBA 5U1PA 5YASA 2C2BA 2P9GA 1V3UA 4WHMA 3ZIDA 3UAXA 4MQMA 4FW8A 2EDCA 4CCAA 2B5WA 1E6CA 3WQSB 1UT8A 3M89A 5K6TA 1V8ZA 4X00A 1NLFA 1KKUA 5E2IA 4HDCA 2PX8A 4JP3A 2QR5A 4ETNA 1G4UR 4B3BA 1M0WA 1L8XA 1X87A 1B1AA 2I7TA 3NI2A 1GTVA 4U3JB 1DDOA 5FOSA 2IW1A 1VZ2A 3E81A 4N03A 3UTCA 1OGIA 3AOEC 3NP7A 4LV5B 2JFWA 1FLAA 2Q2WA 2OZVA 3ZWBA 1N0HA 2CXSA 1X9IA 3RVKA 1YZQA 1OYOA 1BWRA 2CE7A 2EYQA 1WXIA 4LXIA 1WUJS 4G4JA 5ARCA 4DQDA 1TF5A 1W0KA 1Z82A 3BL6A 3E82A 5K99A 2YZMA 2X7JA 4QASA 5EFZA 4CQNA 2OC9A 3HK2A 3PRYA 4UEJA 3AFIA 3VVMA 3ZU2A 4BGIA 5CBPB 3IX7A 1CS0A 3RRBA 4YAOA 4A1FA 2J0UB 1NT2A 3AFHA 4FHDA 2ADMA 4EY3A 5CCBA 2OBYA 1PZFA 5KDLA 3GN2A 4E09A 3EEQA 2WM8A 3UN1A 4JVLA 1Y5RA 1ZHOA 2QQ5A 1NQXA 4DV3B 2ZIAA 4QBKA 2PFSA 1VIYA 1ZBDA 2HCFA 1D2RA 1I5OA 2NAFA 2ZLBA 3GMDA 4JB0A 1AHIA 4PTZA 2H29A 4TXMA 1U0LA 2VT3A 4NZPA 3RLIA 2VJPA 1N34B 2IS2A 2I62A 4OXKA 1Y80A 3JATB 4BO6A 4BFZA 1TFUA 2FE4A 3AILA 3N2GA 1RZ3A 5F4BA 1VMAA 4EVSA 1VSVA 2ZYRA 4CGYA 3JQRA 3ZI7A 2VVTA 1JEOA 3BSYA 3H75A 3HE3A 4RESA 1GR1A 4LZAA 4YAJA 4Z0HO 1ODSA 1P60A 4M0MA 5EERA 1TJ5A 4TXNA 4HQFA 4KYIB 3SZGA 4PRLA 3I1IA 3WS7A 3IIIA 4QUHA 1G7CA 2WIJA 1C0LA 4DB4A 1VKJA 2XI4A 3P2KA 4O4LA 1JA1A 4GU5A 4C0XA 5IHXA 3R5XA 4F9GA 3RC8A 1IZZA 4R1QA 3SYMA 5AFSA 2GHIA 1JEYA 1G5PA 5U4XA 1AY0A 2BISA 3D0QA 3AF3A 3E1KA 3RRMA 4MR7A 2BCEA 2QTHA 3D8SA 3V97A 4CIYA 4AT1A 5BN5A 2QMYA 4MS4A 4RZ3A 5FOWA 1G21A 2IY8A 4KI0A 5KNDA 1OH5A 3MS7A 1BJRE 5FWXA 1A50B 4I19A 1JAIA 4JJAA 2ECQA 2DT8A 4UXHA 2HJVA 4GP9A 4YK7A 3I39X 2VPPA 3AJEA 4X54A 1AKQA 3QFCA 2VQ6A 3HCEA 4BAZA 4DLAA 4NX2A 1A9XA 1J9ZA 3LW7A 4WRRA 1QLJA 3B9BA 4PLYA 4XEHA 5TRTA 1DAOA 1U28A 3E22A 5DHRA 4CF5A 3WFJA 5LD2B 4J8PA 5DHFA 3ZGZA 10MHA 3G6KA 1JFRA 4G0XA 2SNIE 3EXIA 2INGX 1J0AA 4H18A 4PYKA 1PWYE 2GJAA 5JI2E 2FX3A 1EUCB 1SQ6A 1KI6B 1X7YB 5BYAA 2Y8EA 3IT2A 4J1QA 3BJRA 4UVGA 5JCOC 2QRUA 4C0SA 4B6GA 1JG3A 2HTFA 1LQ2A 3S55A 1A8PA 1OLSB 5HJ7A 1OZGA 1KKLA 3BHIA 3TMAA 1UT5A 3BULA 3MJVA 2PD4A 4ONEA 3FKQA 1UMCA 1V11A 1G42A 2DWQA 2HLDD 4LZNA 1I14A 1QE0A 3UPDA 5LQAA 1D2CA 4WTOA 4EW2A 3D8UA 2YY6A 3GGSA 5CVUA 2G25A 2GEUA 1M2VA 3VR5A 4AN4A 3QFHA 2CFTA 4BJHB 4JBWA 5ALHA 4BMVA 2OHFA 3V1YA 2BWJA 4P34A 4C2BA 4N8EA 2ZK7A 3A6LA 3FRJA 4N6NA 1ACJA 3SQXA 1BA2A 3A4NA 4PONA 4Q12A 4CETA 1QZ3A 5K2OA 1QRRA 1JHMA 2ZU0C 4I36A 4NXMB 4AYWA 1G3UA 1LH0A 1KC3A 4B7AA 5TQ0A 5KNLA 4RF3A 4CW7A 4IIUA 3VR2A 5LOVA 4E7OA 1XU4A 1AGRA 3KJEA 1TU0A 3EFOA 3RWOA 4H15A 2XITA 1SC9A 1K8QA 1OFUA 2QENA 4ZQCB 4PPNA 3HABA 1U02A 1T5DX 3ZQKA 4E70A 3DOHA 3T5TA 3ZVRA 3C98A 1KEPA 4P92A 2Z2KA 3TLCA 3N0VA 2C7PA 3U4AA 4JYMA 2ZIVB 2FMHA 5HUHA 1KK3A 2BR5A 3TZLA 5A06A 1U94A 2W4QA 1FJGB 3T94A 2EFJA 1PSDA 2I3GA 2OAP1 1TVMA 2E2WA 4FYPA 4F6RB 1XTVA 3R75A 4TRNA 5JQGA 2O06A 3SVTA 1E7YA 1X77A 4WDQA 1ZO8A 4NEGA 4J2TA 4FFSA 4BU1A 1ZCFA 2PXAA 4U5XA 4FB4A 1SVKA 4HH3C 4TTVA 4NIMA 3L7LA 2X77A 1YQWA 1E79D 3MSXA 9ABPA 3EYWA 2PKRA 3D81A 2IUEA 3FGPA 2Z6AA 2CYCA 2L82A 3OVMA 5E38A 1VHJA 2PBFA 4MVJG 3TI9A 1KQOA 3U3JA 4PAGA 4KK4A 1YZTA 4G1EB 1FFDA 1PD1A 1QONA 4H6WA 1ESEA 1DSSG 2BKAA 1TM1E 5F1KA 3WLOA 4YRTA 4N39A 1ZL0A 2ZJAA 5TT0A 4X1YA 1OGYA 3HXPA 4AYTA 4BUCA 1J70A 1IBLB 2VHWA 3FIUA 3UFBA 2X0RA 3O83A 2MYTA 2Z9CA 3MERA 1SUSA 1ZP6A 3U3OA 2CLOB 3GNLA 2G70A 1U2RA 5BWCA 3IXLA 1JFSA 2VZ0A 2QP9X 2ZTVA 1GUDA 3C1OA 3ECAA 3BE6A 5KTSA 1EFUA 1OWNA 1PYGA 1S2IA 1ZH0A 3B1VA 3IQZA 3QVWA 3HV2A 3LRXA 4LJ4A 2XVZA 3LHDA 4QIHA 5E4YA 1GTZA 5TEVA 3T1OA 2FN8A 1YE3A 1IK6A 2YCBA 1IN8A 4MW9A 3IODA 4CM8A 1GFWA 1NGSA 2VJDA 3AONB 4QNNA 2ACEA 1XZQA 1OB2A 4J0GA 2FG7C 3O91A 1OBCA 4GBMA 4EBBA 2JAUA 4YMTA 1RTTA 2YV4A 8OHMA 3WAGA 3LQRA 4FMCB 1ZA1A 2O14A 3LCMA 4IIHA 3JAKB 5KPJA 1ECBA 2VH2A 1DWUA 2X7HA 3N05A 1W36D 2JA2A 3F47A 4LMBA 2QLLA 3D6AA 4FFDA 5CIWA 3ZY2A 3PX3A 2XNKA 4M36A 1Q83A 4Q93A 1NMYA 1BKSB 1SG0A 2OLKA 4LCEA 3W9YA 4E5VA 5IUNC 4PLVA 2JLYA 4BN4A 4ZN6A 1KYWA 1RRFA 1M6VB 5TSDA 1ZEJA 2I2FA 3A1SA 4X71A 1KI2A 2NX2A 1NP7A 4ODIA 4WUTA 2YZGA 4IXNA 4HGRA 5FORA 4DLVA 1AQNA 1YFJA 2ZRJA 3L1KA 3LUGA 4ZHQA 2Y9MB 3QVOA 4RE5A 4KR6A 2IHNA 1OX6A 1E7QA 1B42A 4CFYA 2ZYTX 3M5CA 2L2QA 4IS2A 5BW6B 5BN1A 3GXBA 5FI5A 2JGDA 1PSWA 4BKQA 5FOTA 4ZMBA 4LF5B 4JJEA 4ZFNA 1FF9A 4CM5A 4ZZIA 1A9OA 1B15A 2WVGA 4Q5IA 3V80A 4AJ2A 3I34X 1E6LA 1A82A 1PFQA 4HB0A 1WVGA 1KQPA 3FHJA 3FZEA 4QAJA 4U7GA 2NPIA 3EH1A 2J9ZB 2XR1A 1TD1A 3A6HA 3RBXA 1QOZA 1LVGA 4FNGA 3G6WA 4J3FA 5E9AA 3LSTA 1U8FO 3ZH2A 4MH0R 4QNRA 1YHNA 4JLKA 2BUCA 4BCCA 1YL7A 4FCCA 2R1VA 3WKCA 4DBLE 2WJ4A 3BGDA 5H83A 2JAWA 2QYHA 3I6BA 1KRHA 1ESZA 3K9BA 2CC2A 5AJVB 5AKKA 1W6UA 1W4AA 4UTZA 3T7SA 3TRJA 5JEEA 3AIKA 5KYXA 3H1BA 1P1RA 3ZCVA 2WOJA 3L7DA 4DL9A 2E89A 5JMOA 7ADHA 3WKDA 3MWYW 4OQ4A 3RO7A 4UUPA 3B6ZA 4MV5A 3RBVA 1GJRA 3ZCPA 1IM2A 2XUFA 4D4JA 5ALVA 5KYWB 2M32A 2WUGA 3GDOA 3RB8A 2UXCB 2B6HA 4HNVA 9GPBA 1F9AA 3HWRA 1NTOA 2ERCA 3RHZA 2RJ3A 4MUAA 3UV7A 1JSRA 1ZITA 3OWHA 4A2WA 3ANYB 2FW0A 2Q5FA 2JHGA 1TZCA 3H1PA 2OUKA 1QG4A 3I42A 2EFHB 3NWEA 4LDRA 3M9WA 5FTKA 4MWDA 4EVIA 5AQEA 4PAWA 3AESB 3UAGA 1T29A 4LZJA 4KAFA 5LB2A 1ZM7A 2ZB7A 2XB8A 4NDZA 1XA3A 2AEJA 1G4AE 1QR6A 2AXEA 2M6RA 3C5CA 1NBIA 3MMPA 3UMFA 4O3MA 3RRJA 3F3YA 5IZCA 2HYDA 1TEXA 5JD6A 1KH1A 3I73A 1DTWB 1L5HA 1MJHA 1KJYA 3NPAA 3RJ5A 4HWOA 4F2GA 4M46A 1KEWA 1ZN2A 3DWFA 3WMRA 5BMVF 5I8PA 4JU8A 1CY6A 4X84A 1EX9A 1P0PA 4DPMA 2G17A 4ENVA 2IH4A 2QN6A 3OZTA 4TT3D 3MELA 5B4TA 1Q50A 5CFMA 5HK8A 5LYJF 3W4IA 1AU9A 4I0WB 2BGKA 2Y0PA 2EQAA 3TBHA 3KB6A 5AKEA 1G3QA 4H7JA 1TCBA 3EFEA 4NYJQ 4BQFA 3HDTA 2OB1A 3W5SA 2P4HX 1EXDA 1UKBA 4C3VA 2IPLA 3GD7A 3W7AA 5LNK6 5D6OA 1G9XA 4RJLA 2IYSA 1JILA 2QTFA 2AEEA 1PAUA 1PJTA 1TUBB 1Z0AA 1XKTA 2WM9B 3DD5A 1EA7A 2LR0A 3NT4A 3QOYA 4EB8A 4P2GA 3IAFA 2WIGA 2DBZA 4MRSA 4X9XA 5KMGA 3E3OA 3LSYA 4FNOA 4F5EA 3DL4A 3VTFA 2I3ZA 1QHFA 1TAQA 3DP7A 4X8OA 3ZCQA 2VPWA 3V8EA 1RPZA 4Q3CA 3GWZA 3AEQB 4I1RA 3FYCA 5TEWA 4H3VA 3H9QA 4X85A 1PG2A 1UBMS 3L7NA 4PPGA 2ZSUA 3KQYA 3RVDA 4C1NA 5JRZA 1HO3A 1HMPA 3FZGA 3HG7A 1CJVC 5B7QA 1GPJA 2ZGVA 3NTLA 3N6VA 4MI9A 3TEMA 4L4YA 4BMCA 1K2WA 5EJEA 3HJRA 1L1RA 5TIIA 2DC1A 3LX8A 2GM4A 4NJEA 3NJ8A 4O4IA 3VTKA 4ISBA 5F2NA 1MJNA 3WE7A 3R3UA 1LBEA 4WCDA 4D4LA 2V7VA 1IHOA 1QR2A 2HJSA 2M2IA 1O7JA 2VP5A 4G89A 3LBFA 4Q3NA 1Q22A 3TLJA 1IAVA 1B2LA 1FY2A 2ZQYA 3H2SA 2G36A 3K92A 3COYA 2WYWA 3OPMA 4M21A 4Z0PA 2DQKA 3LV8A 1Q2UA 3DV0B 4UU7A 5G02A 5GQSA 5H70A 3MOSA 3B8HA 1TVCA 1IY1A 3THXB 3SXUB 1FS4A 2XHZA 3C39A 5AYVA 1IZ9A 4N54A 4M9ZA 1NF2A 3U4QA 4BXOB 1XZIA 2HQ1A 2AQHA 4HEA1 5F78A 3ND8A 3HVUA 1UZAA 4TYQA 4K0RA 4MV7A 4IM7A 1CQZA 5HMLA 5A4AA 3U60B 2J9RA 1KZ7B 5FR2A 1F8GA 1J2UA 4CM3A 4JXZA 1NRIA 1RHQA 2YY7A 3CO5A 1BKDR 1ZVVA 2NV6A 3MC1A 4X90A 1X2EA 4DNPA 2J41A 4YP9A 1T0PA 4PFKA 3VM6A 3AI7A 1RIFA 5L7TA 3GCZA 3RTBA 3G0BA 2UZAA 4QFBA 4RMJA 3T95A 1BJKA 5IBQA 2FW7A 4OUDA 3EJWA 3TGLA 3HYRA 2D5AA 4OB7A 1GN8A 1BWPA 1KJZA 3D7KA 4R2HA 4M38A 3AUSA 5A1TA 3H6HA 3QWAA 4PWZA 3HB9A 4R7GA 2PYZA 1NHWA 3L0IB 3NAZA 1RJ9B 1RHKA 3HNPA 3PNOA 1ZNQO 5JFGA 3GFGA 5J1SB 4XQ0A 4AJ1A 1CF2O 1C1DB 4HADA 1NQOA 1ST2A 2ZYGA 3M1YA 1WZIA 1QHSA 3DWGA 3UGKA 1YZUA 3AYXB 1GTG1 1M34E 3FBWA 3AVQA 1CJTC 5CPBA 4WE3A 5JMTA 3Q7QA 5AOAA 1EXVA 4KFUA 5GZ3A 4JEIA 3CTMA 2XVAA 2X4IA 1M2NA 1A7JA 1DJNA 1XROA 1IHYA 5JDCA 1T9BA 3LL7A 4FEGA 4JH0A 4HOYA 5P8WA 4AAYA 1P1CA 3N3AC 2OP0A 4UHKA 3RC1A 2V5VA 3HBLA 1INLA 3NEPX 4N3AA 2IDZA 2JJ1A 3GQBA 4DR7B 3ROZA 2NO5A 1FYVA 2ZB3A 5GJBA 3SC3A 1S9DA 2GVDC 4HDQB 4M1QA 3UB4A 1J9EA 2IIQA 3VDQA 3PT5A 3TDNA 3GA0A 4N5IX 3VGPA 3L18A 3L4BA 1QORA 1QAOA 3UH1A 5JS6A 3EHDA 1UXHA 4P98A 4CE6A 1WZ2A 3HXMA 3KFLA 4PSAA 3S2EA 1B8VA 3K16A 4PY2A 2I1VB 4BO7A 3WADA 3HLTA 2NO1A 1TTTA 5EIBD 1WXEA 2YNMD 4LF6B 1K5DA 3B13B 5IU6A 4NCJA 1YR6A 3QY9A 1N4AA 2H2DA 3STTA 3IAHA 4R2XA 3IHWA 4Z9AA 1MXFA 3CX4A 2AOWA 3MZ0A 1EWYA 1N6NA 4IP0A 2VATA 1PVDA 3GX1A 1LLDA 1U0RA 1M9NA 2I4MA 3D8HA 3LGSA 3OTWA 2Z9BA 2ZI3A 3MJCA 4MW4A 4PO1A 1KZ4A 2E87A 1QH8B 4QGAA 1IUOA 1QQ7A 4MULA 2C4WA 1SA0B 4R3NA 5K0ZA 1CHNA 1PV4A 1NONA 5FWNA 1U7PA 3TUJC 4C4SA 2F8MA 3RK1A 1SXJD 2VPIA 1W88A 2X41A 3QVUA 1ZHFA 4RULA 1T3GA 1PLLA 3LT2A 5E9JA 2IZ7A 4KWHA 2JIOA 3U31A 3N7TA 4IKOA 1E2JA 4O4JB 1H65A 1CUDA 5DBIA 2DAPA 3O92A 1ORWA 1M0TA 3K30A 1W4ZA 5M5BA 4MEBA 2IV2X 4KR3A 3TLYA 4H9GA 3FB4A 5F5LA 1FJHA 3I6ZA 4LDJA 2E21A 4HQLA 2SCUB 2BFDB 1QQTA 4E4TA 1KVRA 2BHLA 1Q0UA 1EQ2A 4HRAA 2NU6B 3T7EA 1JSXA 4MP6A 4R0VA 3DXFA 1NNUA 2I6UA 5J4LA 1J42A 2JFUA 3KU1A 4PE5B 2X2EA 2EP8A 2BZGA 2R8OA 4OFWA 4C5BA 2V6JA 3LP5A 1IUPA 5KVCA 4Z8YA 1L6IA 4K6KA 2A5GA 2QE7A 1OTYA 2EL9A 3H83A 4HWSA 2JK1A 2QK4A 4M37A 4MVYA 3T7DA 3UG7A 4BNFA 3V4ZA 1JDUA 3WGIA 2YR0A 5JO9A 4U39A 2FB9A 2ZJ4A 3CKMA 3MWGA 5AVKA 3NASA 5K8LA 1JQ3A 1WKCA 4KO2S 1VRVA 4WGGA 2OV2A 1J49A 1ZH2A 2IDJA 2YJ4A 1PNQA 5DNDA 3DKVA 3EG5A 4TTJA 3K31A 1VCHA 2OXEA 4YUYA 1OBOA 1V3QE 1ZGJA 2B5OA 3MT8A 1JX6A 1G5TA 2PNFA 1K68A 4BRWA 3BE5A 4PZ9A 2ZCVA 3HP1A 3TW6A 4KQEA 2C3OA 1J8DA 2GUGA 3RC9A 4BWFB 3AVOA 4OHYA 2XDYA 3DHYA 4NMLA 1DJOA 4L4RA 2GJ4A 4CLRB 4LBVA 4NU8X 4K6GA 4Q3KA 4F2HA 3V6LA 1ADYA 5H68A 3CUEF 4B8WA 4BBPA 2NU9B 3OZVA 5ALZA 3K53A 3R7LA 4LE0A 3A8TA 3H1EA 3V33A 4EKGA 4GIBA 1VKHA 1PR3A 1G5RA 1MB2A 2QT0A 1JQJC 2ZJFA 2Q1UA 1YVDA 3E3MA 2LUOA 3BIJA 3GCWA 2R0QC 1U0NA 4GPBA 4UD6A 4GLJA 4TM8A 5DJ5A 1R8JA 4OQNA 2PJDA 1W5SA 2Q1TA 3AXSA 4B3IA 2VXBA 1N8KA 5DCUA 1BEZA 2H2WA 2PL5A 4AP9A 1A8SA 1XCGB 1LWNA 5DBFA 4DN6A 4P0PB 2FUG1 1E4VA 1T2AA 1DTSA 3TZ6A 3OESA 2A59A 1D5CA 2W5UA 4KITB 3S5JA 1MQ9A 1TM2A 4LRYA 4L5JA 1WMBA 1FYXA 2QSZA 3STUA 3CTPA 4LXXA 3WL5A 4FK8A 1SZPA 5KPDA 4OATA 4Y0AA 3K9WA 1LNZA 4PLHA 3I3OA 3AUAA 5HFAA 5F76A 1TX4B 1UBCA 5IAKA 3KAKA 3L1HA 3OFVA 1Y4UA 2DWUA 3HEBA 4QTXA 3DBRA 2O1EA 4MW7A 4RKQA 1T0BA 4DXHA 3FTPA 4B17A 3JVDA 4ZT2A 5K6RA 4F5DA 4Y2HA 1BFUA 2JATA 1VLLA 1MLDA 4XAQA 3GNTA 5AK4A 4DQ0A 1D07A 2DECA 4WNAA 2G6BA 3KUCA 3NHJA 4J0CA 2ZRHA 5CITA 1EHCA 2XRMA 4UATA 1U80A 3K96A 2BEWA 3NUGA 4OA8A 4OHKA 3LK7A 5AJYA 1PVVA 4X60A 4YDQA 4RGVA 4D57A 2YOFA 1KIFA 3CC8A 5C1PA 1CUHA 4MTCA 5LC1A 4ECAA 4O3FA 3I8SA 1PJAA 1OX4A 3JR7A 2IKSA 2OOKA 4ZAGA 4BLTA 1Z3CA 3OTIA 1DELA 1X92A 1LVUA 3KTOA 1YQGA 3HRKA 3DPSA 3ZDXB 1A8UA 4UTPA 1AS3A 2BT4A 1TT5B 1V47A 1N1MA 4ARIA 3D54D 1NFRA 5FRDA 1B4DA 1YKSA 1Z0JA 2WJYA 4I55B 3ZVMA 1I3NA 3AY3A 5HFJA 1NY5A 1ZL2A 2C5AA 1EJ0A 2PU7A 5LZ8A 5CDFA 5B64A 1VKRA 1QF7A 4GYYA 3COPA 3ZDCA 3CG0A 1WR8A 4LOLA 5K4HA 3H5VA 3NKFA 4MUNA 3FIJA 3IV9A 2BR4A 2C4NA 2WD7B 4AF7A 3FMPB 5F1OA 2B0JA 2HO4A 4LS3A 4MUXA 4MICA 3NLLA 3N0RA 4O63O 1C1YA 1PNTA 1WTCA 4YEDA 2Q4DA 4DSNA 2IYLD 3CLRD 1OBVA 4WZZA 5JS7A 1JQEA 2DF8A 3QBTA 1TIPA 2PRKA 3EZXA 4YCJA 2XOEA 1X3LA 2PSDA 2Q1YA 3C2QA 5G40A 2QQ0A 2Z1NA 3LVFO 3MJDA 1OJ7A 3PPVA 4KVFA 5B3JA 4MA4A 5THKA 1NQVA 4HRYA 4P5PA 2ID4A 5LP6A 3W05A 3I1YA 1DX4A 2CUZA 2Z8XA 4FFBB 3GFOA 4O2BA 4BB0A 1S8FA 4Q18A 2GNPA 5DYIA 2B34A 2C9BA 4NATA 2D06A 4L3VA 4ER7A 1CUVA 2AMVA 1ZOPA 3H8SA 1I1OA 3IBFA 1KVQA 3IIKA 4ZVNA 4HFMA 3E8XA 4JT4A 1QZUA 3IULA 5D1HA 1DZ3A 3GLHB 4I1OA 4X7RA 1HOTA 2Z2IA 1ISMA 1P5ZB 5K3AA 3W6PA 1JQKA 1E1QA 1E66A 3N5CA 4YRJA 3K70B 5TDHA 4LFCB 4HH0A 4BL5A 2I03A 2P6UA 1SXHA 4IQ0A 2PR2A 1PBTA 4RKYA 5F73A 4P86A 3TW8A 3N2GB 4PG8A 2GZSA 1AX9A 4JQCA 4AXBA 3KPJA 1L5KA 3ZLTA 2QTRA 2EBFX 1QFJA 1UJNA 2YJGA 1ZJ4A 3CZCA 1U9IC 2B4AA 4NJOA 3RVPA 4RLQA 3O3NB 4EMBA 2VTKA 2X2PA 1KMIY 2GSWA 4WI1A 4TS4A 4B81A 4WKCA 2VDWA 1GZ5A 5FQOA 4EI8A 3QYJA 4NH0A 1Y5IA 2J4FA 3HUEA 5B1YA 2IF2A 3LBYA 1VHWA 2HRZA 2JJ2A 3A1VA 1CG6A 2IOFA 3KEQA 1ILWA 1R3UA 2H0QA 2QSJA 2WMNB 4KIWA 2VJOA 1N5RA 4DC9A 3VNBA 1A8IA 3M9XA 2EWWA 1GLGA 5FOUA 4KV7A 3UPTA 4TMWA 5BN5B 3ZG6A 5CTAA 2GT1A 3DFMA 1XLTA 4HNGA 5KYKA 1AUVA 1NVWQ 1OV6A 2GEKA 4NOKA 4U8GA 4KE6A 2D74A 3KFXA 4YJHB 5EEHA 5SZJA 1POWA 3QLVC 1NBHA 4BBZA 3E9QA 5C81A 1BDJA 1GV0A 2V7GA 3N7AA 3ANXA 5ADUS 3ZDYB 1TJ4A 1JYSA 4Y7DA 1N0IA 1OIXA 3HJNA 4GWGA 4YUZA 1A9XB 3KSZO 4K3UA 4RVOA 3W8EA 3MCAA 2QKYA 2O23A 4NOJA 2EW2A 3SSOA 4LJRA 3E22B 4BRSA 1YZYA 3WLTA 2GPAA 2JD1A 4GWLA 4ZT3A 1SCQA 2GCOA 3EXIB 5K4GA 1KJ9A 2PH7A 3VRHA 2IVZA 4OI1A 4BMDA 1TYAE 4HL6A 4JI0B 5L3SB 3AW8A 4BNGA 1U3WA 1XAIA 3L8MA 5A3SA 5B1EA 1TFRA 1YIOA 4LTNA 3K72B 1DX9A 1OAKA 4YCSA 1L1EA 3KLOA 2C2WA 5CH8A 5AJUA 4REMA 3OG9A 1G7TA 2CNKA 1Z38A 4V0MA 3U6BA 2A9PA 3SX4A 4CKCA 4DCSA 2DR3A 5LVAA 1V11B 2QNRA 4TSFA 3TS1A 4RV9A 2GD0A 3TVTA 3N2EA 3LQ1A 4MV6A 4WXYB 2Q2NA 3GA7A 5LDHA 1V95A 2OYSA 1OOEA 1SPBS 1KYXA 2GZAA 4CLXA 5CVTA 4IO0A 4RD6A 2EFDB 3V8RA 4COKA 1H5QA 3GEIA 1VPWA 1VL5A 2WKPA 3AP3A 3F2IA 3ZW8A 1G6OA 4Q1CA 3L9XA 4UE2A 3UK2A 4ZOQI 4Q3DA 4EGJA 2VTBA 1DBRA 2XAAA 3NNDA 4O4HB 1W87A 3NO4A 3VOSA 4BLWA 4YQEA 5TQ0B 2WDPA 3HWSA 4E94A 5LOVB 1WXGA 3DJYA 2DHDA 5FO0A 2CK3D 2XT0A 4LWQA 1P73A 2I80A 4PC7A 4PW0A 5LB4A 2RHWA 2VDPB 3F78A 3DTYA 1VI5A 1XMXA 4MXDA 3N8GA 2B1GA 4YMSA 3GGDA 3ZZUA 1JR6A 2FR1A 1QHIA 1DE0A 3PDWA 2PH3A 3GHHA 4G0OA 4YJFA 5I7AA 2GKOA 4XE5A 5BQ5A 3HBMA 5JJBA 1NPTO 4LHYA 1XO1A 3GD5A 2HK9A 1XQWA 3BL5A 3QFSA 1GDDA 5EVCA 3WLHA 2Q4EA 3WHKA 3O7WA 1JE1A 1HT3A 1N7JA 2X5JO 3L43A 5JH7F 1ZD9A 1PR1A 4YMVA 5KTRA 1HDCA 4BJ3A 1ZUHA 5FB3A 5JQWA 2I3BA 3D8NA 3OT1A 4RWEA 2NVWA 3EVZA 4ERXA 5EQJB 1XQ9A 1RXUA 2PO5A 4L9SA 2CV2A 4L51A 3P8ZA 3OPQA 1RRVA 4KXMA 6ABPA 1LPPA 4Y6QA 4YP7A 3RRZA 3HLYA 3TI7A 4LVUA 1XR3A 2CNNA 3IEKA 3NIDB 3UG6A 5LL6P 5C4GB 4ZICA 5LIRA 2P9YA 1J0CA 3QLTA 1DQPA 4M99A 1W36C 1CUUA 5M29A 4EG7A 4MITA 3KQWA 1N8NA 4N65A 1IULA 1E3TA 1V16A 4MUIA 4WDRA 3V1KA 2O7SA 1S2GA 1J39A 1ZH4A 2ZJ7A 3OCYA 2WHPA 3PUWA 5HBGA 1QC5A 3TFOA 5BVGA 1RCTE 3VU9B 5IMBA 1YBFA 5LN1A 4GICA 1GPWB 4KAJA 5FWDA 4D9FA 1AKUA 1U8EA 2R2AA 4PYMA 2P9FA 1PJQA 1ZIPA 2DP4E 3W2HA 1EGVB 1M5UA 2QUHA 3ST7A 1P4SA 5C8YF 1XMPA 3N86A 4YGXB 1FRVA 2XUIA 2A7QA 2H4FA 3UUFA 4CM8B 2NG1A 1DCFA 5IJZA 3CVVA 4B3CA 2WWFA 2FI1A 4OKNA 5HMMA 1SFRA 2DVMA 4B6PA 4CQMA 1S8OA 4GM1A 2YV2A 2Z5LA 4DXAA 4MI3A 4BP9A 1RI1A 4DLKA 3A3YA 4QBFA 4OMCA 2DSNA 4G3XA 4B3GA 1BD4A 4XPIA 3UOWA 4RMIA 4NCKA 1HE4A 4QQNA 3BF8A 4KBGA 5HKKA 4NK5A 4LXUA 3TFQA 1JIJA 1FP6A 2BRUA 4GX0A 4RAQA 4KMSA 4XCVA 3PYMA 1QJ4A 5J2TF 3N53A 2P4EA 1H8EA 1NBWB 2XKAA 3L0CA 3LF2A 1RRGA 2HTEA 3IQIX 4W4TA 3DBLB 1D09A 2IPOA 4YJGA 5CNIA 1BOFA 1EP1B 3G13A 4DCPA 2FDRA 4RABA 1ZU4A 2KX7A 3IDOA 4WNIA 3VMFA 3M6MD 4BNJA 2NTJA 4CL3A 3H2GA 4ZHQB 3FLEA 2F8LA 3BC1A 5IEJA 1DWQA 3HZHA 2H2FA 5KOYA 5E4TA 5C18A 2CHVA 4JC0A 4M1OA 4OAOA 3KT3A 1TKAA 2VRNA 3GVPA 3OH8A 2JGDB 3SS8A 4KWEA 4ZOLF 4A73A 2KPOA 4ND1A 4CDNA 2EP5A 2QAGA 2BL4A 3O73A 3OE4A 2PHZA 5KQGA 5A5VA 2C0CA 3G1WA 3NBKA 3U1TA 5AVJA 4YV1A 2G8LA 1GP2A 1GPUA 1QXSA 2GAFA 4ZO8A 3GFPA 4HBZA 5EZSA 1PR6A 5FI0B 4QZVA 4WW0A 3A2NA 4UW9A 4DAEA 2W2TA 5EWMA 5A62A 2OHIA 2GNAA 3EMDA 2C4VA 3MLBA 1UINA 4GRIA 1WQ3A 5TMEA 1QVZA 1P1JA 4QE3A 3K3PA 1RHRA 1L7EA 2JAPA 4P93A 1EWRA 1YT5A 2B1IA 2N1MA 3ADPA 3VR4D 2IS1A 1IRXA 3ICCA 2VN8A 1OFGA 5U4QA 4HEJA 1JWLA 5ICFA 2EKLA 2QWXA 3NVDA 2YWJA 4TL8A 1L7VC 3U9LA 3KQQA 1T1SA 3USZA 5KQPA 1F12A 1J0EA 1RT9A 3PEYA 1Z07A 1VL2A 2PV0A 1GQRA 2XMSA 4TLAA 4WADA 1C8KA 3MFYA 1VC2A 1XV5A 2PS9A 3QBEA 3KCQA 1Q0SA 3L5OA 4XSGA 2PX0A 4Q6WA 3AG5A 1Z5GA 4CIWA 1IG3A 3W3AD 1J00A 4XD2A 4EA9A 3GLIA 3CGWA 5K2MA 2YJTD 3RKSA 4D0SA 5A71A 1Z47A 1PWHA 1XNHA 4JJGA 2WU4A 5BV0A 3JQAA 3L40A 1MIOA 2Q6KA 3HB4X 3NTQA 4HFNA 4ZU6X 3L7OA 1FYWA 1RWBA 2WJWA 4HAVA 4K9DA 1MTOA 1SUCA 5GTDA 4G1CA 3BICA 1RM3A 3GEPA 1DJQA 2BEUB 3RE1A 2B4RO 2X6RA 2BFBA 3DVAB 1T5HX 3CMMA 3EDOA 4Y30A 4NMXB 3KNZA 3QPVA 4BQRA 4YT4A 1HT0A 1FDTA 3ACDA 5GV8A 2Y93A 3H2BA 3ZQUA 4J0JA 4J91A 4HUJA 4O6VA 4DUGD 1GOTA 2GERA 2VSQA 1E7RA 4LXHA 5FV4A 5JAIA 1RD4A 3IAAA 4DA4A 3COWA 3QYFA 1SZCA 2C54A 4XFKA 2H8KA 1JBEA 1PFVA 2QN3A 3E23A 3SQLA 4EX6A 1XA4A 1ZM3A 4HQKA 4KXWA 4KH0A 3EN0A 3HDQA 3PE6A 2HWYA 2PZBA 5G1NA 4B2YA 1VLJA 2QB5A 1RAEA 2QTMA 5KMGB 1Z36A 2FPUA 3FCAA 3NETA 3BFKA 3A70A 1WCWA 1CLUA 3QLUC 4CMHA 5EJ5A 4AKTA 1WBDA 1UMKA 1YS2X 3IDSA 1GU0A 3K9GA 3NJRA 4KQ2A 3KHTA 1EZ4A 1GQSA 2ZR7A 4XJTA 3RNOA 1X0XA 2OCLA 2J0EA 3H05A 3GR6A 1GGVA 2TSYB 3TQRA 1C0EA 3MYRA 3ZUPA 1B73A 1VI2A 3M1LA 3O9MA 2OECA 1JZTA 1YFZA 4BLUA 2OCXA 5KVQA 4Q3AA 4DWVA 2XNCA 2OC4A 5IC6A 1W35A 1RLJA 5C9ZA 2R79A 3T3PB 4O4IB 1N77A 4MKZA 3M4ZA 5EL0A 1ZYUA 1DKUA 2JLUA 1KORA 1M6HA 1XQYA 1UBGA 4BKUA 3JWPA 2BOVA 3BFXA 4O8CA 3OF5A 4BPBA 3UMGA 3X2EA 1G7SA 2E4WA 3O3MB 1IBRA 4V24A 1Z25A 5REQA 5DHUA 1F8YA 4HNAB 2C9CA 1NXPA 1CPYA 3D6NB 2UYYA 4JVSB 2R8BA 3KR0A 1CQJA 3Q7EA 1Y1LA 1V0JA 1VL6A 4X24A 4JI5B 4F3YA 3L84A 5KVSA 3U4QB 1OMOA 1YR1A 2CXUA 2ZIGA 3ZGLA 4H60A 1U9ZA 3G0DA 2C2HA 2ZP1A 5F52A 3T3NA 1MB4A 1E9AA 1ORVA 5EOVA 2CLMB 3NWBA 1BXGB 1F2TA 3L05A 2CDCA 2P3QA 1Z0DA 3IUNA 3JASA 1I4WA 2YYZA 4IDGA 3RVBA 4EJSA 1NAIA 1L7RA 3R3JA 1A69A 3EIHA 3OT5A 5EQDA 4CT5A 1M0EA 4E33A 3UHOA 3LUDA 1U90A 5JAOA 2YHSA 2BFMA 3ZW7A 4DR4B 1TQHA 2VZ8A 5A6VA 4I5IA 4OUDB 1VPVA 4OI0A 2W48A 3WLNA 1VE1A 2P6NA 4KSBA 1XD8A 4HXEB 3UMJA 3E1SA 1R6BX 1Z5UA 4A91A 4ETMA 3ABOB 1YIDA 3E9ZA 4N5MA 4PYJA 4Z4IA 2XXJA 4PC6A 2G40A 1Z17A 2WTAA 2IFTA 4G0MA 4P81A 1WEHA 1QIGA 4GNRA 1WDKA 2DGDA 5EIWA 4HDAA 1J0BA 5ERYA 1D9XA 4DA8A 1S3FA 2G1UA 3G2LA 5DBGA 4GI1A 4B5LA 3DEHA 2E5LB 4O59O 2WWIA 4OKIA 2ACVA 3MRXA 1H5UA 1O97D 3V7FA 1ZMRA 4H2DA 1AC5A 2GD6A 3IOMA 4F06A 3H8VA 4UHFA 3ZKAA 5J3JA 5C51B 3PT9A 1CZKA 5IYZF 1QTIA 1ZY2A 3T9FA 3KEOA 1EUYA 3N58A 3GBSA 3PP8A 2AZMA 4J7UA 1HRKA 2R6AA 2YNMC 3RTEA 4MHOA 1DIAA 4JDPA 3F7MA 3PUXA 1FQWA 3EIEA 2HHJA 3QBDA 5JXHA 1E0JA 1X7DA 1GPLA 2GESA 1YSCA 1V1RA 4F93B 2GJKA 2O0HA 3WFIA 1F2UB 3TR0A 1SM4A 1RQRA 2DLNA 3CRMA 3FNHA 4ALIA 3G79A 4CF6A 3FVQA 5JJIA 2M6LA 4MWEA 5JD3A 5JZ9A 2XZTA 3L7JA 2XH8A 2AX4A 1PJ2A 1UBLS 3GLFE 1S3IA 1GYQA 3LX4A 5BW5A 4B83A 3I2KA 4WBXC 1KYQA 3A7EA 1A8HA 3MWFA 3FYUC 1SVSA 1ZCBA 2EEZA 3QTLA 4DCNA 1HYHA 4NQZA 4YHBA 4Z4HA 2CVZA 3OD1A 3AY0A 1ENPA 1ZK3A 2WJAA 3HCRA 2JGLA 3KWMA 5G2OA 3OCXA 2V7EA 1Y7HA 1OQAA 4PQRA 1IUNA 2RBEA 3LDFA 1ELOA 1GQFA 2Y6VA 4BMZA 4Z4EA 4S2EA 4KRXA 3OKAA 3AUFA 4GEGA 3NTXA 4GX2A 4A7PA 3N8HA 1I6LA 3ZWVA 3K5WA 2IHVA 3JCZA 1NE2A 2G0TA 5CVDA 1ADJA 3EODA 4HJXA 1X94A 4K9QA 1O4VA 2IYYA 3ASYA 1H6BA 2UVQA 4TWBA 3CU5A 1JFLA 4AG6A 1K5HA 1A1VA 2D5LA 4EY8A 1OSNA 1L7XA 3D2AA 1JHQA 1NW5A 2B69A 1W88B 3FNRA 3NUQA 3UFXA 3IP5A 2IEAA 1X7HA 4TTPA 4EB3A 5KKNB 4MYUA 3JALA 3TIFA 5A3VA 1P19A 1FSFA 4ZYTA 1JNYA 4TM7A 1FP1D 2YYYA 3ZLJA 1XRJA 1AKMA 1NVVR 1C7IA 2BFFB 1IATA 1R0LA 2DLDA 2JDIA 3M81A 4BBJA 1JFFA 5ADHA 2HSWA 1K3FA 3EMKA 3K0CC 3QKUA 3QFRA 1TJPB 2GZDA 4O5AA 1IE3A 1N2ZA 1WY5A 3FPSA 3C0KA 2AI2A 1GT91 4JB8A 2OKGA 5LQJA 1SC4A 5IVIA 1H1LA 4MDFA 2WIBA 2Y1EA 1G9SA 1ADCA 3ILHA 5J63A 4KYVA 5LXTF 4G56A 4I3HA 1MC1A 3H5RA 1UXGA 5BT8A 1RFGE 5B4UA 4TYNA 3FWKA 3RVQA 1UBNA 2OLJA 3TRIA 1DCTA 3R9WA 4I9FA 1S9HA 3PR3A 3PFKA 2GRJA 4W5WA 1YUMA 4OHPA 1Y3BE 3R0JA 1HDIA 2VP0A 4IQ8A 4ZEWA 2GO1A 2R1TA 4F86A 5CD9A 2PUWA 3E8MA 3ESDA 2B8EA 3ESXA 3ABSB 1GNQA 3H4VA 4HMOA 2CL0X 2NM0A 4S24A 4ZARA 2V0GA 1HKHA 1QYVA 1RYNA 3K1YA 1ZW1A 1O0BA 4MVJM 1PFWA 2COEA 2IEYA 3WRYC 1L9XA 3KKKA 4URVR 3LNTA 4FGJA 1REQB 1JJ7A 2V9ZA 4EMSA 1ESMA 4DV4B 4PTYA 1SCIA 2PLWA 4TLBA 4KRYA 4LOIA 4UHEA 1DBVO 1W7AA 2NQ8A 1Z4LA 1E5LA 3H86A 3IMCA 1YVUA 5H1YA 1EXWA 3IP1A 4GM0A 2JFYA 2W6PA 5C8DA 1ABEA 3I72A 1UKEA 3AR7A 2J7PA 2X58A 1EAMA 4ITRC 2QU8A 3CG4A 3T38A 3WIUA 4B43A 2H31A 1TC2A 5ILQA 2AJBA 3LUBA 5JPIA 2BF7A 2J9YB 1ZU5A 2RDMA 3CUYA 4ND7A 2J5KA 2W2LD 4R8VA 3SXJA 3GLVA 5EFOA 2P2DA 2XQVA 1I13A 1JVNA 4US1R 5BR4A 4G0VA 3C70A 1Q0ZA 3MQ4A 4URYR 1RQLA 1FFHA 2B35A 5MN6A 2N75A 3DB2A 3Q0IA 2MSEB 2PS0A 4E88A 2XNDA 3DR5A 1QTNA 3I64A 2IW3A 3NEJA 3ND5A 1S01A 4XGRA 2OQVA 5IKPA 2BDEA 5B57C 1RE0A 4QYTA 1FQOA 1USWA 4KW7A 1HMYA 1NMZA 3AI3A 5AVUA 1C9NA 3KOOA 2TMKA 5BRAA 4HD8A 4XOUA 1JIVA 2G9UA 2HXYA 3DGEC 3FSRA 3R41A 1XN1A 4U7HA 1DJLA 1JBQA 3MBIA 2M6KA 4DEYA 2YWDA 3NC1C 4W6ZA 4A6DA 2C97A 1GFZA 2W83A 3H11B 4UE6A 1QKKA 3BMCA 2EW8A 1PV2A 1NRXA 1P2GA 4KQWA 5DCLA 3BEDA 5HF5A 2B8NA 3VYUB 1ZGZA 3T0GA 1OASA 1OI2A 2PWAA 3REFA 1HL7A 5T6BA 4AMZA 3EGEA 1UODA 1RRKA 1QGAA 1RZVA 3IUPA 4MQ6A 4Y98A 5K03A 4OOFA 4FSXA 3WMFA 1GPDG 4OGKA 1C7JA 1F1JA 1JI3A 1GZUA 2WSBA 2VHZA 3KXIA 4QDJA 3GDHA 1PJ8A 2HZ7A 1QUFA 1TO2E 3BMQA 3ORHA 3ZGYA 4NVRA 2BEWB 1AXEA 4DCCA 4EJSC 3U61B 3G8BA 1TRHA 4PZUA 1K2VN 2ZRLA 5AHRA 4CFZA 1ZG3A 3AFNA 3LOUA 4J90A 3VPFA 1X7ZA 2CNDA 1IY9A 1VMDA 3MEQA 4KXVA 2QV7A 1OX4B 3UJPA 3CLRC 5GM1A 3CKKA 2WPDA 2W00A 1MG5A 4QQKA 4DRXB 4L9WA 4XR9A 4C43A 5AM0A 4URWR 2IYWA 2ZBQA 3P2EA 3L0DA 1NNI1 3I2HA 1OPXA 3L8ZA 3O82A 3P9IA 4R8SA 5DX0A 2VLIA 2XTJA 4B3FX 2R60A 4MLZA 4JBIA 2MYNA 3EW9A 4PYNA 4D0RA 3BDIA 4CKWA 2QTCA 3HLKA 3T3GA 2ZRQA 3AF2A 4WKGA 4AKSA 4BNZA 5LSAA 4ZV9A 1DBWA 3T3IA 3MK31 4DWJA 4LRSB 5FDFA 1R4NA 1DIRA 1HK7A 1NXWA 2PXHA 1WO8A 1JFTA 1EXMA 3NWOA 3OQMA 3T54A 3KC2A 3ROKA 1TCAA 3OF3A 1R9JA 5FFMA 4O5OA 1J2EA 1JEAA 2FSPA 1I01A 4KUEA 4OJNA 5BYJA 1IVNA 1K3UB 2PH5A 2P9TA 4UXIA 3QUAA 4G8DA 2FWRA 4QJ5A 1KO1A 3WKEA 1WXQA 4O2BB 1IBKB 3I61A 1PUIA 2PGJA 2IYFA 2JIQA 4CG1A 4DTIA 5CBKA 3QG1A 2RJNA 3FVTA 4BVGA 1XD2A 1AMOA 5AHKA 3RSGA 5B1HA 3GAZA 1FUIA 2GA9A 5IM4A 5JISA 4IX9A 3VR1A 3F5FA 4ARCA 4WK2B 4WUVA 4JVOA 4JLUA 3DBOB 1WU8A 1S4MA 3VNRA 4D8WA 4RZQA 3EQ2A 5F9HA 4IL5A 4A15A 4B74A 3CUTA 2CXOA 5EJ8A 1N6LA 4OLHA 4I4TA 4C9BA 3IP6A 3JQ7A 2YV5A 1WSBA 2ZR9A 3ZHSA 4W9RA 6NULA 3AVUA 1LK7A 4H4CA 4E3ZA 1ZD3A 1SZJG 1AF4A 2ZFUA 4UJ5A 5F1PA 2F3SA 3TLAA 1L3BA 4OAPA 4DGQA 1CJSA 3PI7A 4JVNA 3HADA 3P9YA 1S4QA 5TB5A 1RMYA 2VSFA 1W76A 1FBTA 4YUXA 3T1TA 2VHEA 3IIJA 5ER6A 2J0QA 1KP2A 5EIFA 1M54A 1HETA 5A9SB 3ECSA 2ORVA 2QXTA 2QAIA 1YJBA 2P40A 1B8UA 5AM5A 5FPSA 1HYQA 2ZRBA 4DIEA 2OMKA 3OZIA 2HQSA 1GAJA 2WKWA 4MVJA 2V6FA 2VWGA 1J7KA 4LX8A 4OFBA 3IUJA 3OCCA 1J24A 2RIPA 5B36A 4R2WA 4XJVA 3DHWC 5T8KA 1OYWA 2CVPA 4MP3A 1D7OA 1TUGA 2FF5A 1LDYA 2JI7A 2UZIR 4JENA 1T4MA 2EZ4A 1QVWA 1YBMA 2WSIA 4B2LA 1KY4A 1DEOA 1T8SA 3OEWA 3Q41A 4ZOCA 3ND7A 2X4DA 2WWGA 3VKFA 4MHTA 1BS2A 5DX8A 4XB2A 1J33A 3PC3A 1MRNA 4FGKA 2ZSBA 1OAOA 5K0TA 2QMZA 3JPWA 1K5GA 4FHEA 4G86A 4A2PA 3AF0A 4WCVA 2PTHA 2AMJA 1DOAA 1BQEA 2OBMA 3BG5A 3TZHA 4H6VA 1EVYA 1JS1X 1RADA 2WU8A 3BWVA 5ALYA 3X1JA 4EGCB 3E61A 2C9YA 3UKOA 2QTGA 2Q0SA 3FDXA 3T9EA 5E1BA 4M86A 3LL4A 3PHJA 5ECWA 3UAOA 3RYCB 3RWMB 3KLBA 4FP9A 5DNAA 5JBIA 2RD2A 1YBHA 1YZNA 1O5OA 7GPBA 2OFXA 5HE9A 1NR5A 3U1BA 2EBHX 2YUIA 2RH5A 2DBVO 2IZ1A 2ZROA 4HK4A 1M8JA 1YOVA 2FWNA 3GW8A 4FMCF 5LR6A 4E15A 1IEQA 2Q8PA 3SYNA 4NBVA 1OZHA 3UMVA 3GFRA 1M1YE 2EERA 3F8WA 2X0NA 2OZLA 2ODAA 3O21A 4MV9A 4TUYA 1A4RA 3NDRA 4W63A 5D01A 2ISSD 4MEAA 3O75A 5DM70 4BFYA 3CLUC 3H04A 3IB3A 2VTBB 2PUEA 3R0VA 5HM8A 3A9RA 3FGNA 4I5EA 3EIFA 4PF1A 2O0JA 2AOTA 1WVMA 2PWYA 3OQHA 3DNFA 2OR3A 2O52A 3D2BA 1E2GA 1VE6A 3BXFA 3HHEA 2RCYA 4C2UA 4FN4A 5IS2A 4RGYA 3LHSA 2XEXA 3E9DA 3FZYA 4CIXA 3O38A 3T61A 1KFCB 4XUDA 1BWSA 2NZ2A 3C48A 2WHRA 4BVAA 1UBRS 1R37A 3H2YA 3SHOA 4F1KA 2IYRA 4LC0A 2QS9A 5T64A 1HY3A 4YONB 1GSAA 2FPXA 1ZM4A 5DBHX 2O07A 1UC5B 3C3JA 2KSQA 2L42A 3HRIA 4L4XA 4BHTA 4RTJA 3JD1A 1I8TA 3IBGA 4DLBA 3F5DA 2G83A 4BB9A 2J31A 1EWTA 3K0FA 2I6SA 3ITKA 3CR7A 4M1WA 4G84A 1ECJA 1CE8A 1JG7A 1Z28A 2AA3A 3PG5A 3KKQA 4KDEA 1VJ5A 4V0QA 5CK5A 5ALSA 4YRNA 5A03A 5CYPA 4QUEA 4YPFA 5IDQA 3OT1B 3OA0A 1P3Y1 2BTOA 2PBLA 5CVVA 4DMUB 3BXEA 2IYQA 1KO4A 4YO8A 2ZQ5A 3LBNA 1XMIA 3OMXA 2P6OA 3L7YA 3AJDA 4FWTA 4PAOA 4QOHA 3PDUA 4TSKA 2YXDA 3GK3A 1WB4A 2OV1A 2XCTB 2D54A 5FOVA 1SHKA 4R16A 1ECPA 1ULAA 1VYTA 1AZTA 1V6AA 2Q27A 5JS1A 2AV6A 1U2QA 3CCFA 4DVJA 3K0HA 1V16B 2X76A 4B33A 1OROA 2ZE6A 2NZXA 3E9YA 2XMZA 2X1MA 3UICA 1QC5B 2AHRA 3H17A 5BVGB 2WTBA 5EG5A 2EVWX 3BXZA 4UOZA 3FTDA