2GB4A

Crystal structure of thiopurine methyltransferase (18204406) from mus musculus at 1.35 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
231
structure length
231
Chain Sequence
DAEVQKNQVLTLEDWKEKWVTRHISFHQEQGHQLLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNLSYTEEPLAEIAGAKVFKSSSGSISLYCCSIFDLPRANIGKFDRIWDRGALVAINPGDHDRYADIILSLLRKEFQYLVAVLSYDPTKHAGPPFYVPSAELKRLFGTKCSMQCLEEVDALEERHKAWGLDYLFEKLYLLTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiopurine S-methyltransferase
publication title Crystal structure of Thiopurine methyltransferase (18204406) from Mus musculus at 1.35 A resolution
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 74
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.1.1.67: Thiopurine S-methyltransferase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05724 TPMT Thiopurine S-methyltransferase (TPMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2gb4A00
4AUKA 3THRA 1VL5A 3JWJA 5E8JA 3KPVA 1X1DA 4RTMA 2P3QA 4RTJA 2BZGA 3R9XB 2O05A 4CTKA 3HCAA 4DCMA 1SQFA 4QDJA 2BR5A 5DM4A 2OO3A 1JG3A 3O4FA 2CL5A 4FT2A 4YUWA 2H11A 3QOXA 1NBHA 3LDGA 5EEHA 2IPXA 5BP7A 5E8RA 4RTKA 4OQDA 5CVUA 5LSAA 2NXNA 3EVZA 4CKBA 1D2CA 3HCBA 2B78A 2HV9A 1IXKA 3M6UA 2O0LA 2AOUB 2H00A 2OKCA 4PGGA 2PT6A 1RI4A 3I53A 3B5IA 3KQPA 3FUVA 4R6XA 5K0EA 3B3GA 2PY6A 4HGZA 4WXHA 4LECA 3FUWA 2H1RA 5EMJA 3REOA 4ER5A 4C04A 5DM1A 2FK7A 4GOLD 4RVDA 1QANA 5EKUA 3HTXA 3M6VA 3G5LA 5DSTA 2P41A 2QYOA 3EVGA 3PT9A 2FCAA 1NV9A 2AOUA 3ELWA 4E30A 1NW7A 2ZTHA 1NW8A 3KHKA 3P9IA 4HC4A 3HA7A 3OZTA 5EHIA 4MQ4A 3TR6A 3HVIA 1I9GA 2ADMA 1YZHA 4HTFB 4QPNA 5K0GA 3M70A 3PFGA 4RTLA 1RJEA 3GWZA 3C3YA 1XVAA 3JWGA 2OBFA 3KQWA 3TLJA 2YR0A 3A26A 4RVGA 2LD4A 4BP1A 4F85A 2F8LA 3DXYA 3EVFA 4EQZA 2I62A 3MGGA 1KR5A 1QAOA 4HTFA 1MJFA 5GINE 5GIPE 3HCFA 3CJTA 3OE4A 4CKCA 2AOWA 1G60A 2ZBQA 3GO4A 4C4AA 3PS9A 1JTEA 2HNKA 1NBIA 2FRXA 3M4XA 1R8XA 4DQ0A 2NXJA 4PCLA 4C08A 5LR6A 2Q41A 4MWZA 3DTNA 3E05A 2QE6A 4HG2A 4NECA 3ER8A 4C05A 2QM3A 2IH5A 5MHTA 5GWXA 3GGDA 3C6MA 4QQNA 4BLVA 3FTCA 3G88A 3AJDA 5EIWA 2EG5A 2JJQA 3TQSA 1JSZA 1WS6A 2NNWB 2P40A 3LDUA 5HFJA 1X1BA 1EAMA 4AZWA 4EKGA 2UYHA 3EGIA 1M6EX 1QAQA 4ATNA 5CVVA 2PWPA 5H02A 4AZVA 5K09A 5E1BA 5DT2A 4XUEA 3RW9A 1IY9A 3SMQA 5EKXA 3KKZA 4KW7A 5JUWA 2PJDA 4QDKA 5GM2A 4FSXA 1JSXA 5EVJA 3DMFA 3SSMA 3A7EA 5E9JA 5K0JA 3ELYA 1SG9A 2OB2A 3LECA 1ZG3A 4OBWA 3NVKI 5K0FA 3MERA 1ZGAA 2OY0A 3X0DA 2AZTA 5LQRA 1SVUA 1O9GA 3FTFA 3PVCA 2ZZMA 1XDSA 3B3FA 2AN3A 2E5WA 2NYUA 4V0QA 4RX1A 3ORHA 3GNLA 2O07A 1R00A 3A25A 3GRRA 3OFKA 4AZSA 3KQOA 4PYQA 4EK9A 1D2HA 3BWYA 1HNNA 2ZWVA 3IYLW 4FZVA 3MCZA 3WSTA 3UJCA 4KWCA 4DMGA 1XJ5A 3OFJA 3GRYA 2Y1WA 2GPYA 4ZTBA 4ER7A 4YUVA 3FPEA 3Q7EA 1B42A 4X60A 5DPMA 1NV8A 2GH1A 1P39A 1BHJA 3P97A 1Y8CA 4K6MA 1R18A 4H0NA 4AZTA 4EVIA 2P7HA 4OA8A 5E9WA 3NWBA 5F2NA 3FPHA 5DM0A 5DTMA 2ZZNA 4PYLA 5FWAA 5CIYA 3M6WA 3KPYA 3FPJA 5FCDA 2ZBPA 5GIOE 1QAMA 4PINA 2IIPA 2ZWAA 4KDCA 1RJGA 4YUZA 5K0BA 4EKIA 3AWIA 4E2ZA 5FULA 1VE3A 4OA5A 4CWAA 3KPWA 4E2XA 3BZBA 3B89A 4ER3A 2BR3A 3ER9A 2HR1A 3HA3A 4BY9E 3BKWA 1I4WA 2UYCA 3C3PA 2CWWA 1O9HA 5EEGA 3E8SA 1KIAA 1NW3A 5CM2Z 3MHTA 9MHTA 3MQ2A 2G71A 4OX9Y 5P8WA 3PB3A 2ZSUA 2FHPA 2IDJA 3KQYA 3FUXA 1L3BA 1P1BA 2V7EA 5KVAA 1D2GA 2AOTB 2EX4A 3KU1A 4DF3A 1NW6A 4YUYA 3FTEA 3KQMA 2FPOA 3UJ8A 3FZGA 4YV2A 4DM3A 5LQKA 3A4TA 4FP9A 4XCXA 4Z2YA 7MHTA 5CVEA 3TRKA 4RV9A 2P3LA 4RVFA 1KP9A 1ORHA 3BGDA 4HH4A 1F38A 4GOOD 4C06A 3ME5A 1ZKDA 3KQSA 3SM3A 3SXJA 1L3IA 5E2BA 5ICFA 2AOTA 2ERCA 2AOVA 1KHHA 2PX4A 3AXSA 3CJRA 1NKVA 3MAGA 2XBMA 3OPNA 2VP3A 5HZMA 1YUBA 2OZVA 3R0QA 4E2WA 2FK8A 2JHAA 1O54A 5E9QA 3V8VA 4FGZA 5C0OE 3DR5A 4HGYA 2ZULA 3GXOA 4PNEA 1AQJA 3HCEA 3MB5A 4ISCA 3AXTA 3OZRA 1VP3A 4DZRA 3LCUA 5M5BA 1DUSA 1RI2A 5G02A 5HIKA 3BGIA 2B3TA 2QRVB 4ER6A 3BWMA 5LQCA 3BWCA 3GIWA 2A14A 3BKXA 3P2KA 3FYCA 4QPPA 5T64A 2GAFA 2PXCA 4P58A 3GJYA 3OCJA 4PONA 3G5TA 4U7PB 4FR0A 3EVAA 3OU2A 2P8JA 4FS8A 3G8BA 5HIMA 1BOOA 2AVDA 5EG5A 2QRVA 1ZHFA 1KPHA 3JWIA 4PWYA 5KYGA 4M7RA 2WK1A 3IV6A 3CCFA 4X1OA 2IBSA 2YXDA 1RI1A 5EZSA 2OB1A 1YB2A 3A27A 2JH8A 3G7UA 3GDHA 1VQ1A 5CCXA 5EOVA 1ORIA 2ONZA 3K6RA 3TM4A 3NTVA 3KR9A 4IKPA 5FA8A 4UOEA 5DWQA 4BLUA 4E2YA 3UJ7A 5KS2A 3EEOA 1G6Q1 1AF7A 2IBTA 1XDUA 2YVLA 2AN4A 3KR0A 1H1DA 5IH3A 4YV0A 2Z6QA 2JHCA 3U81A 5EMKA 4CXMA 2QY6A 2R6ZA 3BXOA 4KVZA 3LCCA 2HTEA 1Q0SA 5DSXA 3SSNA 3NWEA 4P7GA 3UJ9A 2GA9A 3GU3A 2UYQA 4RTNA 4DA4A 5K01A 3LL7A 4YV1A 5HEKA 2YXEA 3GRZA 5E2AA 4P7JA 2C7PA 8MHTA 2EJUA 3CGGA 1G38A 3NVMB 2XVAA 5IKMA 3TFWA 4GQBA 4GBED 4LG1A 4PYIA 4X61A 5CUQA 3K0BA 5KQSA 4O29A 2NP7A 5K0CA 2IGTA 5ICGA 2P7IA 5C1IA 2PXXA 3GCZA 5HIIA 1FPQA 4EMSA 3B3JA 3HCCA 2NXEA 2C7OA 2VDWA 1XCJA 2PSSA 4IV8A 5EZQA 2PXAA 3D2LA 3UA3A 1PRYA 1YF3A 5DX0A 4Y2HA 3SX0A 3P8ZA 3EVEA 3FYDA 2PGXA 3B7PA 1U2ZA 5CVJA 3G2PA 2ZVJA 3PX3A 2PV0A 2G1PA 5FTWA 2PVCA 3TM5A 5FUBA 4CTJA 1QYRA 5BXYA 1EG2A 2ZLBA 4E31A 3LGAA 1DL5A 5KQRA 4GOMD 3DOUA 3DLIA 4BLWA 1MHTA 1FJXA 1JQ3A 4GUAA 2B25A 3KPUA 4C07A 5FQNA 1DCTA 4X41A 3LBYA 1NT2A 1X1AA 3OU6A 4JXJA 5GP1A 4E32A 2ZFUA 4YUXA 5CD1A 3TKYA 4XUDA 4HSGA 3ANXA 3EVBA 4E70A 4CKEA 5B1SA 3VYWA 1EJ6A 3G8AA 3M6XA 3RODA 1RJDA 4DKJA 1L1EA 1Q0TA 4RTSA 2JG3A 4OBXA 5DTQA 3C6KA 1N7JA 1R74A 4PYKA 1XDZA 2P1DA 2DULA 2PX5A 2BH2A 1KYZA 3LSTA 3R3HA 2IFTA 4GOND 3EMBA 4L7VA 3BT7A 2XYRA 1OR8A 1WZNA 2HMYB 2HWKA 3DH0A 4GEKA 3E23A 4AX8A 4ER0A 3FTDA 4PIMA 2IH2A 3VC1A 3MTIA 2G70A 3DULA 4R8SA 1RJFA 5K03A 5ICEA 5D1NA 2CMGA 2VZ9A 1FP1D 3GRVA 4RYLA 5DTRA 2O57A 2ONYA 1F3LA 3LKZA 1NW5A 3GRUA 3PFHA 5E1MA 3G2OA 3NJRA 4M36A 1SUSA 2GLUA 2IDKA 5DX8A 3ID6C 5U4XA 2ESRA 2Z6UA 5ERGB 2V74B 4M38A 1N7IA 3OZSA 1BKYA 3NDJA 5DRYA 2O06A 2AOXA 5LQJA 4QTUB 1PJZA 2WA2A 3A7DA 1T43A 4X63A 4GF5A 5DXAA 3FUUA 1AV6A 3T0IA 4LWPA 5K05A 1KPGA 2P3OA 1XXLA 3BWBA 3KQQA 3MCTA 3LKDA 2JH9A 1TW2A 2N47A 3PX2A 5HILA 1YFJA 3KQTA 4RTPA 3NMUF 3EGEA 1TPYA 4R05A 4R8RA 3CJQA 5D1HA 3TOSA 5EMMA 5DRTA 3SGLA 3HVJA 4KRGA 3DLCA 3HP7A 4LWOA 5DX1A 4YMHA 4BP3A 2OYRA 1JQEA 1VPTA 4KDRA 1QZZA 2XYQA 2NXCA 3FPFA 1M6YA 4PIPA 1L3CA 1UIRA 3FRIA 5CVDA 2OXTA 3T7RA 5F2OA 1JTFA 2DPMA 2B9EA 3PLAE 3I64A 2XVMA 4WVLA 1FP2A 1EJ0A 1ZGJA 4Y30A 4PYJA 3CC8A 3RIEA 4RTRA 2YQZA 3QOWA 1RI5A 3VC2A 1P1CA 2CMHA 1BC5A 3HCDA 3UA4A 3UBTA 5F2KA 5E1DA 2NP6A 1XCLA 5K0LA 3DP7A 3UJ6A 1V39A 4P7KA 4F84A 3OE5A 3LX6A 1XTPA 2AN5A 3OU7A 4A6EA 3P71T 3DMHA 2VDUE 3UFBA 4DCGA 1EIZA 4RVHA 2AVNA 4B17A 3IEIA 2VDVE 3TKAA 3HA5A 4QTTB 2EJTA 2I6GA 3LDFA 1UWVA 4KIGA 5EHGA 3TMAA 1KXZA 4F86A 5LQAA 3ELDA 4GC5A 2Z6AA 2IH4A 5LQNA 2ZW9A 1X1CA 3FUTA 2UZ4A 3KPJA 4R6WA 3LPMA 5DLYA 1INLA 1I1NA 3E7PA 4OQEA 1TW3A 5GM1A 3UZUA 4MHTA 2G8NA 5HOQA 3HVKA 1G8AA 4PCAA 2KW5A 3EVDA 3QV2A 2YXLA 1FBNA 3P9CA 4U7TB 4MTLA 5HIJA 1Z3CA 1L9KA 2PBFA 2ZIFA 3DXXA 2ZBRA 1JG2A 1N2XA 2Y1XA 2AR0A 2P35A 3EEYA 1YZ3A 3EPPA 3H2BA 3JWHA 1IM8A 3HEMA 4RWZA 2BM9A 1R6AA 3SR4A 5FADA 5FHRA 3EMDA 3UJBA 4YMGA 4PYNA 1JR4A 5EC8A 3S68A 4KIFA 2IP2A 3CVOA 1JG1A 4P7FA 3P9NA 5FA5A 3T7TA 4C03A 3FPGA 2GB4A 1X19A 3HM2A 3UJAA 1P91A 3Q87B 2ZIEA 10MHA 3G89A 1JG4A 5K0NA 5DXJA 5GOZA 5EMLA 4RSRA 1HMYA 2FYTA 1EQAA 3NDIA 2ORED 3DXZA 3P9KA 1YFLA 2I7CA 2C7RA 2BM8A 3G2QA 2I9KA 2GS9A 3L8DA 3P2EA 5JR3A 3DMGA 2PX2A 3M33A 1VLMA 2YX1A 4FSDA 4GC9A 4FT4A 3NW9A 4HRAA 4M37A 1UFKA 3SSOA 2B2CA 2EFJA 3LCVB 2ZZKA 4QVKA 4RTQA 1WXXA 2WA1A 1VP9A 2VS1A 1WG8A 3FRHA 5K8VA 1VIDA 5FWDA 3KR2A 3I5UA 1VBFA 2PT9A 5E1OA 1NE2A 1ZQ9A 3HVHA 1G55A 1SQGA 3UWPA 1AQIA 3KR1A 2PKWA 3R6TA 4G56A 5EGSA 4PYOA 3I9FA 5FQOA 3V97A 1M0EA 1JQDA 2YUIA 3CBGA 4IWNA 3BUSA 4QVGA 2ZIGA 3BGVA 3O7WA 4PGHA 2PWYA 2AS0A 5C9ZA 3KQVA 5T6BA 3R24A 1SKMA 3IHTA 3ERCA 2K4MA 1WY7A 5CCBA 3EVCA 4QQKA 3C0KA 3CKKA 3O31A 4A6DA 2UYOA 3LHDA 5BW4A 1WXWA 3DUWA 4V0RA 2ZCJA 1SUIA 2JHPA 3HNRA 4MIKA 5DM2A 5EIFA 4PYMA 4E33A 5EQJB 1KPIA 3PTAA 3LBFA 4XUCA 5FHQA 2R3SA 3UJDA 2YTZA 3EGVA 1KYWA 4IV0A 2XYVA 3MTEA 3SVZA 2OPBA 2BR4A 5BW5A 1G8SA 3AY0A 3TPZA 3VSEA 4POOA 2PLWA 2CKDA 3F4KA 3I58A 3T7SA 5LQUA 5ICCA 2C7QA 1RI3A 5EPEA 1R8YA 5T67A 3ELUA 2PX8A 3THSA 3P2IA 2G72A 3G2MA 4RTOA
chains in the Genus database with same CATH superfamily
3S28A 1Z36A 3BICA 2NVUA 4RQTA 3UWKA 4MZDA 4YQZA 4LYGA 3OZBA 1A9YA 1FY2A 2YWJA 4R5HA 5FOWA 4V2UA 1J90A 3PJDA 1XZIA 5FJJA 3WK4A 4ZZIA 621PA 5KTYA 1O0SA 1Q0ZA 3VPDA 1TJ4A 3QBVA 1P9RA 1SAYA 3DJFA 3NBMA 2H11A 5HZGA 3FPAA 1XHFA 2W2LD 4C7OA 3LDGA 1XU9A 1XTBA 2EDCA 3ITNA 1FDIA 4D80A 1VMAA 4Z9YA 1LZLA 2VH2A 4MQEB 4PGGA 1CQJB 1M2FA 1XU4A 2IXEA 4UEWA 4QSMA 3UT0A 4KNYA 1ZI9A 3T5DA 4DNXA 3C2QA 4LDAA 1L7XA 3GPDG 1OLUA 2HSGA 4JOBA 5DM1A 4C04A 4WHMA 1E2UA 3LIIA 2VG8A 5IBPA 2AN1A 1GNTA 4C88A 2FWIA 4P92A 2V7QD 1UKBA 2FZCA 4KDEA 4OLHA 1B3BA 3CWQA 3I1JA 3UANA 4HNUA 2ZPUA 4FX5A 1M2VB 1MJHA 3OPYA 1I9GA 4JL5A 3B7WA 2J0UA 1YQGA 2IV2X 2ACVA 3WE7A 5BSTA 4QPNA 1QB7A 5K3OA 5H83A 3FYSA 2ZJ5A 1RMQA 3RU9A 3DMNA 2QW0X 2YFQA 5GZ6A 5JSZA 3O3NB 4YJ2B 3TLJA 3QVJA 1YZGA 3CRMA 2DJ5A 3KVVA 2C1XA 1LJ8A 4BO4A 3D2CA 1KR5A 2PZLA 3ZWWA 2B4TO 3CLSD 3ED1A 3IBFA 4HTFA 5TEWA 4EHBA 5HKBA 2M9MA 2AZXA 2L2QA 1V9CA 5TMDA 1VL2A 1W1IA 1SPBS 2PUCA 1Y9ZA 1CJBA 2GDJA 1NBIA 3G7NA 1Q91A 1QG4A 2J3IA 3G9UA 4LKOA 3D59A 4C7MA 1E0KA 4JI4B 2Q2OA 3WOHA 5EKSA 2I54A 4PZLA 3P0RA 1N2CA 4QQNA 1D1QA 1I5OA 1YR2A 4F38A 2N0SA 4CLOB 2OT3B 4C29A 4B09A 2JIDA 1S7CA 1MT0A 1B7GO 2FWBA 2HFJA 1JDPA 4WNIA 4F8YA 4MAMA 3OIGA 4RZSA 3CRRA 3G5AA 4EZIA 4XVCA 1KOFA 2DETA 5A02A 1BHQ1 4Q16A 3KKZA 3CPEA 4DPMA 4R51A 1MFZA 1BX3A 4GPIB 3DMFA 3ROMA 3SR0A 4QG7A 3INGA 1VDMA 3N2KA 1N2EA 4L4ZA 1SKAA 1ZGAA 4H1VA 5K3EA 1W73A 1MIHA 4BJ3A 4PCUA 2PEZA 2XA2A 4I19A 4UBNA 4YBRA 2AN3A 2O2SA 3E2MA 2IIVA 1J8DA 3NBUA 2QUZA 5IUKC 4QUAA 3ZU4A 1AK9A 1FX0B 1S0UA 3COVA 2GZDA 3L7KA 3QLEA 2VSYA 3OC0A 1O03A 1D2HA 5SZKB 4Q9IA 4DC9A 1EHCA 4I3GA 3ML1A 1ECFA 5BSEA 4DMGA 1V37A 3G82C 2Y3IA 1OFHA 4KFSA 1E3MA 3ND9A 4YRIA 4R40A 4YUVA 1AKYA 3CONA 3Q7EA 1I94B 1GPUA 4BFLA 1P39A 1PJ3A 1HEYA 4U0JA 5CFPA 2OFOA 1W6RA 3ITDA 4FE7A 4YO7A 4DR2B 2GJKA 4PFKA 4K86A 2J0EA 5MGNA 2R4TA 2VCYA 1LX6A 1UJMA 1CWUA 1DDIA 1DAFA 3M6WA 1M83A 4WXEA 3EFBA 3JASB 4PQEA 5CGZA 1E5TA 3EISA 5CBKA 1E3EA 4HOYA 4JP3A 4MYRA 5DSZA 3A11A 1WKBA 2BEUB 4Q37A 4KBGA 1MR3F 4MUEA 5T4HA 4URYR 2C8KA 3EDOA 4P3YA 4WCVA 2RKWA 3BE4A 3TNLA 2R2GA 4RV5A 1TCAA 4MWEA 5SY4A 3HADA 3P2YA 1O9HA 1VE7A 1EBBA 3AR8A 2Q4EA 4QARA 4OTZA 5KSYA 3TZLA 2W70A 4C22A 4B7ZA 8LDHA 4ON9A 4D4MA 2UKDA 1BE8A 2X0KA 2XEDA 3LTNC 2EZTA 4NNJA 2IRWA 2V7EA 4RVCA 1GCOA 2Q1XA 1RQGA 2QAGC 1YC2A 1YV9A 5FUXA 1P4JA 2WNHA 3D81A 4QQFA 3SF8B 2O5EA 3MUOA 5LQKA 1F20A 1XO1A 2AA3A 2VK8A 3ND7A 3L8FA 3F4BA 1PJSA 4LFBB 4L95C 3HBLA 1V45E 1EGQA 4RV9A 4XUGB 4BBPA 3FE2A 1KSFX 3RTBA 2AZ4A 1ORHA 2XOXA 5IC4A 2NZ2A 3EHDA 3FLEA 3QY9A 4LI3X 3I4LA 2DU8A 4YMTA 5HK9A 3ZCPA 2B5OA 1KHHA 3NIBA 4IM7A 3RBAA 5HZMA 4QU0A 2DQKA 2N42A 5JXWA 1KVUA 4EBBA 3REQA 3IAM6 1DBVO 4TWZA 1B8UA 3LM8A 3Q7SA 4YY3B 3EZGA 3RYHA 1ZK0A 1Z4OA 2D1YA 2WKRA 2E55A 3AXTA 3K05A 4B76A 5BRJA 5FEUA 1JIXA 4JI5B 2BFEA 4WAUA 4YCJA 3PQ5A 4AF8A 4F6LA 1U6JA 2BMWA 2Q3LA 1ZRHA 2P9BA 1DTWB 2R66A 3HJCA 3UG7A 3EIWA 2EAUA 4IXWA 3R5HA 3GIDA 3KZMA 3RFUA 4EYSA 1K88A 2GAFA 3IE2A 4MCHA 5G4LA 2SHKA 4QT4A 4BL5A 3DCNA 4C76A 2KMLA 1P2GA 1XYVA 4EO4A 4LJ8A 3QXCA 4MUXA 3AFMA 1ODLA 2E6UX 2EHJA 2XCQA 3LSYA 4PZ0A 1KPHA 1BVYF 2R7KA 1J1IA 3ZDZB 2JIQA 1KEEA 2WK1A 5DFAA 2Q4OA 3QOFA 3ZBTA 2OD2A 2IBSA 2FAXA 2YHAA 3D8UA 4GRDA 3QELA 1UMKA 4JLWA 2HL6A 4U7HA 3VPFA 5D51S 1I7NA 3PFWO 5CBPB 1VIVA 4KOAA 1TMKA 3OH8A 4ZYVA 2IYYA 4PBTA 3L79A 2GM3A 1TYZA 2Z2YA 3GRKA 1U98A 2ZJ8A 3T41A 2ZK7A 1Z39A 2GZRA 3FRJA 4H7EA 1ZJZA 2HLHA 4TWJA 3ZWCA 1MG0A 1WXHA 4ZCMA 1GQRA 4O1IA 2ZG6A 1T2VA 1UBMS 1GCIA 4HTAA 1B73A 4UFPA 3BMCA 5EWJA 1HDXA 3N59A 2GX6A 2GO1A 2QD1A 3LT1A 4M8NE 2SICE 1TQ6A 1AGRA 4R83A 5C4IA 4HAWA 2QY6A 1YAHA 3FB4A 3STHA 2VCHA 5TQJA 4PCVA 3OPYI 4I5FA 4BGEA 2VYCA 5JROA 3UAWA 2QT0A 2WD9A 5EI5A 1UAYA 4OEHA 1EFVA 1V7ZA 3FCAA 1QF6A 3UPUA 1IAVA 1XNGA 3PGMA 1XRSB 2NP7A 4IIXA 1G5RA 1P0QA 2I1LA 13PKA 1FYEA 1GQQA 2P7IA 4GWKA 4D9KA 3I34X 2GD1O 2VRCD 3VO8A 4O4LB 2QM8A 2ZRIA 4M1MA 2NQ2C 1IY8A 2D5AA 1D0SA 2FRVA 4TYMA 1NF2A 4F6RB 1RMYA 1X7GA 5TC4A 3DMPA 1W1UA 3EPJA 2QTFA 4FLMA 5TSDA 3S55A 4Y2HA 1GSAA 1T4DA 3P8ZA 2WWWA 3QYJA 5K3FA 5CXXA 4KO4S 2HO5A 1NMSA 1UT8A 2BTQA 2JPDA 2XNCA 1PFGA 2YV2A 3PX3A 3D4OA 5AK6A 4HADA 5F1KA 5F2EA 1DWOA 3W2IA 4EEKA 4MVWA 5EYPA 5FL7D 5FNZA 1VL6A 2ZLBA 3B51X 1HDIA 4GOMD 4O2BA 3U3OA 3FSJX 4JSTA 4AG6A 1JQ3A 3IKJA 1GGNA 2B25A 2I67A 1T10A 3JZDA 4C07A 5J4LA 4QGFA 1JNXX 3TIVA 1V6AA 3S8MA 2OKGA 2HSDA 2R7NA 4JBNA 4PZYA 4AKGA 3L0SA 4OBXA 1XRLA 5IKOA 1R74A 3LBNA 1T2EA 2KBFA 2G9QA 1KYZA 4GOND 3IE0A 3MYYA 5CXSA 1KQGA 3NBYC 1Y8RB 4P8RA 3GUCA 1UAGA 2REXB 5BSRA 1NQAO 3C5WP 4Q4DA 3IMEA 4CL3A 2B83A 2Q5QA 2F3TA 2VWHA 1KO4A 1E66A 3N58A 4H31A 4JEHA 5JO9A 2BGGA 4MZXA 3GRVA 2OE2A 2R7LA 3HDVA 4GPBA 5AO9A 2O57A 2J3DA 3RSOA 4XWOA 2HFKA 4L8WB 5D2CA 1VJDA 5DYWA 2IYNA 1I14A 1KDVA 5JQGF 1U11A 5ITWA 3ZOZA 1PR1A 4PBSA 4R9RA 3VSAA 1O97D 1OSNA 5FBKA 3SC3A 3CUTA 3R6GA 1XK6A 1C4XA 4TUYB 3HK2A 3S27A 4CCWA 1U7XA 1ZJYA 1PK8A 3A7DA 2AUMA 2EQ5A 2RK6A 1VHQA 2REQB 3AI7A 4LBVA 3VNBA 3EUEA 3T0IA 1IATA 3FDZB 3WMRA 4I50B 3CF6R 2J4DA 2G1JA 2X1VA 5HILA 3MAAC 3PX2A 1GZ7A 3PZBA 4RJJA 2SNIE 4E4TA 3NMUF 2JA2A 2ILTA 1P4AA 2C9DA 5KYWA 4RELA 5DRTA 4D42A 5E4FA 2VSOA 2EX1A 4Z1OA 2AH5A 3LQRA 3PKIA 3GBPA 1ZCBA 5I4CA 5MF6A 4BP3A 4G09A 3IDAA 4RZ3A 3WK8A 1GN8A 4BFSA 1QZZA 3CLUC 2HF8A 3FNEA 2G6TA 5I9TA 2RHOA 2ZOSA 4QBHA 2X5NA 1EVYA 4QYIB 2J9ZB 2XA9A 3HQ4O 4K9QA 4TV9B 2OXTA 2VYVA 4OGWA 1P45A 1YQQA 3B1XA 4L9WA 3FR8A 5A3JA 1TF2A 4CFZA 4F4FA 1B8NA 2QRNA 3OM9A 5KYKA 2F6RA 1EFUA 1E62A 1SUCA 1M2EA 4MQFA 3ADBA 2YIDA 2BZ1A 2P2LA 3SEZA 3SHQA 2PYDA 3STXA 3MS2A 4CODB 2ON6A 1GADO 1YCGA 1P9OA 1KVTA 3DOHA 1JQBA 4TLDA 2ZITA 4UHJA 4HNQA 2AWNA 4ENTA 2QLJA 5HF5A 3W6NA 1Q1ZA 1NQXA 1ECCA 1GEGA 1C14A 2OESA 4J3FA 2VPQA 3NHPA 4I36A 3RTGA 1NC1A 1FSPA 1GV1A 3OIUA 4FDVA 1ZM2A 4LNAA 2AHOA 5AUNB 3NNSA 3A4IA 4LFCB 2IEZA 3NU1A 3PHJA 2X2EA 5JT1A 3MJCA 1RRGA 4IJ5A 5DBHX 1ZX1A 3G9TA 1DIRA 3QEMB 4Z4EA 1RRMA 3AB3A 3Q2KA 3ETGA 4NU8X 5IBQA 3C3KA 2LBPA 4MWBA 1KQ3A 1UT5A 2YMMA 4TTSA 3K0AA 4NJEB 2EW1A 4J0JA 3R7NA 1Z5OA 2I3GA 2G17A 3G9QA 3KWFA 3EVDA 4DGSA 2JGIA 1BU8A 3JRNA 5IDQA 2I2FA 2JGMA 2WU0A 3DWEX 5IVPA 1AV6A 4HWTA 3WLKX 4CR8A 5AW5A 3TOSA 3JWHA 1AB5A 3IVMA 3W6PA 1L5WA 2BM9A 3BK2A 5AJTA 3QPAA 3HJUA 2ICAA 3A3KA 2H1OA 5FA5A 5LNK6 4B2YA 4OQZA 2C82A 2HXYA 3OKPA 4DY6A 1JLRA 2HZBA 2VTDA 3MJHA 3QE3A 5B58T 4YUAA 1WD5A 4DLZA 1SHTX 3AIOA 3GRAA 1S7GA 3KT3A 2VZLA 4S1WA 3VR6D 2Q6TA 4LRQA 1GPH1 1NVKA 3ONDA 4RSRA 4BO7A 1JWLA 1FXUA 1ZK3A 1QOQB 1AN0A 1NBMD 1SZPA 2CWDA 2K5UA 4KQ1A 4KTTE 3MILA 3NBQA 1F0KA 4LXTA 3FNGA 2B4QA 3PE6A 4S1OA 4HRXA 4TXNA 4BUZA 2YY7A 1N4DA 5ER9A 4RGYA 2C54A 2E48A 4UE3S 2IEGA 1BA3A 3C6ZA 3HBJA 4I8IA 5KC8A 1VIDA 3L7IA 1BIFA 3NPMA 4B35A 4X62B 3LFUA 2IK8A 1I2BA 2C98A 1SD1A 4L3OA 1AKEA 1SZJG 3QWFA 3UEOA 4CIVA 2WQ7A 3DDWA 1W7AA 2EDAA 3IX7A 4GKBA 2GXUA 4PYOA 3THXA 1XBTA 4IWNA 5KTSA 4ZYTA 1URPA 1WR8A 1VL8A 1CUZA 3BUSA 3PGVA 1HDRA 3WIEA 2C4TA 3T35A 5BMVB 1KFCB 4BTLA 4JDUA 1VE9A 1ZM3A 2I2CA 5ECGC 5CLGA 1Y34E 1UKZA 3K73O 3N7TA 5CB4A 3V8BA 1XXHB 2JFGA 3C0KA 4ND6A 4A6DA 3D4IA 3OECA 3U31A 5FFFA 3WLRA 2YH2A 3FCOA 5DNWA 1ZNZA 3VR2D 2QUHA 1T91A 3LBIA 3D7LA 1LF0A 3F9CA 4JR2A 3GFPA 4I81A 4OFWA 3KOMA 4HZUA 3I1IA 4EJFA 1JW9B 4GMDA 1N92A 3I4FA 4LIPD 3W7BA 2EFCB 2VF8A 3EGVA 4HGRA 5A6SB 2RJ3A 1U90A 4G5QA 2MINB 3AV0B 2H4ZA 2OGUA 3LC2O 3MTEA 4R2XA 3D6NB 4YC7A 2YC2C 2H1CA 2EZ9A 2H07A 1GZ3A 2PR2A 2XRMA 3HYCA 4FMCB 1XCBA 3E7DA 3RHTA 1GP2A 3A37A 4XW2A 5JG7A 5K8LA 5IKXA 3QFHA 1M6WA 5KZMB 2A4KA 3DMTA 2MU1A 4I0WB 4DGQA 5JASA 4OM7A 1VL5A 4E88A 1TFUA 3T6KA 2HT1A 3I9V6 2YXNA 4L9RA 1JDJA 2H17A 1RXWA 3HCAA 1H69A 1LTHR 4BO6A 1JG3A 3GJSA 3O75A 1A9XB 1U5CA 3DGEC 1JMVA 2D3WA 3N8KA 1BEZA 1NVFA 1ZN2A 1O5IA 2QR3A 4PS1A 1QF9A 4CM8B 3UMYA 3B6IA 4W5OA 1XV5A 2H2HA 2DPYA 5BSVA 5IHPA 5K20A 3GFSA 2EZ8A 4IEIA 4JH0A 3CKYA 4B2IA 3C4JA 4AJ2A 1CZLA 1NUPA 1JXQA 3GQVA 3LDAA 1POXA 2B78A 1UFQA 3EQ2A 4MW7A 5AK3A 4OHWA 4EX7A 2RKOA 4FB4A 2HGZA 1U0FA 3RIHA 1NXPA 4V3CA 2X8LA 2C9ZA 4K0KB 3DKKA 3U3KA 5K0EA 1II8B 3ANYB 4ZALA 4WXHA 3IR5A 1FVXA 1H65A 4RMHA 1YZQA 2G1KA 3FUWA 3TQCA 1NZJA 2ISQA 2JBAA 2G7ZA 1OXKB 2QOEA 3AGQA 3FFWA 4LDRA 3G5LA 1CUJA 5FBLB 3BYZA 2E21A 1PG2A 3FWPA 4NYMQ 1JS1X 3JQAD 3ORSA 4R2WA 1DC8A 3P9IA 1TX4B 1W85A 2Z09A 4HC4A 1U8CB 2I8AA 4HH3C 2D7CA 4AUEA 5DHQA 5KYTA 1B2RA 4FHGA 1EWYA 1K4MA 2A5LA 2E0IA 5AVKA 3EOZA 3DEAA 1IEQA 1L1RA 2B1GA 2OGWA 3QBTA 5GJWC 4MMYB 5L51A 3HXMA 1NP6A 1RBQA 1Q3KA 4EQZA 5JS2A 2I62A 1ZS9A 1P18A 2X8WA 2O2DA 4GX1A 1C1YA 2MOKA 3A1UA 3DNFA 2FLWA 5AT1A 5F3WB 4HX9A 2XDQB 1GYRA 3S70A 3EYWA 1DAPA 3M4ZA 1FNCA 2OVFA 4C4AA 3CMCO 4EY5A 1K86A 4ZEMA 4BVJA 3R7DA 3WKCA 4QPCA 3NBFA 2A5DA 1KAOA 2Y67A 2F3QA 1VLHA 4UBLA 2NSJA 3PE3A 5C8YA 2PLFA 2QE7D 2BMJA 2FW1A 2QI9F 4TXLA 4Z0NA 1GGJA 4D9CA 5AI4A 3TE7A 1HYHA 2YHIA 4RKFA 4MS4B 5GWXA 3L7MA 4BLVA 4BKOA 1W47A 1DJOA 3LWDA 4LCBA 3SQDA 3S4YA 3O95A 1OV6A 1VOTA 4KR6A 2PZAA 5TQ0B 2AGVA 3IIMA 3GY0A 1SCUA 4QC2A 4B4DA 4B6PA 4YRMA 2MYPA 1QRUA 5IJ0A 1IK4A 4BQOA 3SJBA 4MRNA 1O95A 1RM5A 5EKXA 3ZNNA 1NVAA 1OFGA 3ZWYA 2AEFA 4EI7A 4JKYA 3BN3A 3EG9A 4HYYA 4UREA 3RS4A 1TYBE 3E82A 4WBSA 4B8WA 4XOUA 3A2KA 4ZDKA 4UUBA 1ZGGA 3VNRA 1SG9A 1N5DA 5HX7A 2ZT8A 1BSVA 2OY0A 2WW8A 4RH3A 3RC7A 4ARSA 3F7OA 1E69A 1R9JA 2G36A 2RCYA 3LIPA 3PUYA 1M2OA 1G7TA 3SKVA 1D07A 1USKA 2HK9A 4YCDA 5SYNA 4ZKDA 2JEZA 1SC1A 1DTSA 2CLIB 2WJ6A 1GNRA 2V1XA 1KP2A 2DQSA 1XL0A 3CVXA 1Q15A 2QT9A 4R1MA 1NKSA 2C2XA 5EMHA 5JNTA 3B60A 1WZCA 4PSKA 1W76A 1L4HA 2W9XA 1XDBA 2O0HA 1YIDA 3VZBA 1L7PA 4KJZA 2O3QA 2PJZA 4FLEA 5EE5B 5E4TA 2QPTA 3PVZA 4A8HA 5T6MA 2AI3A 1RHUA 5T5QA 4HK4A 4XWTA 4N5LA 4RA6B 4FYPA 1YS9A 4Q9DA 2O5VA 5ICMA 5KCZA 3JQAB 2BH9A 2COUA 4RHFA 1B15A 5BWLA 2MSEB 2XNDD 3OFVA 3PQ8A 4FOTA 5LJLA 1ZR4A 2P9GA 2NM0A 5ARDA 1JN0A 5IMSA 1ZH0A 3MTDA 4MUIA 4UKDA 3CRZA 4PINA 1C9KA 1EBUA 2WJHA 1RJGA 1Z5WA 3TUZC 2IELA 2R8PA 4KV7A 4YR7A 2C97A 3QLUA 1KS2A 3PJFA 3TZQA 1PO7A 2VP9A 3GA5A 2Z4SA 3M6MD 3SKXA 4XRGA 4UQLA 5LMCA 3AEQA 1CUVA 4NBTA 1K06A 4I9FA 1KIAA 1X3LA 3AT1A 4PE5B 5CM2Z 3HMKA 1CJMA 1ISIA 1PW5A 1U0SY 2WFAA 3L2OB 4NOMA 1ANKA 1JFVA 4QA9A 3RSQA 4DPKA 4KTVE 2P0AA 2KWIA 1L3BA 1ELOA 3IAXA 3ZS8A 1SUPA 3W5CA 1XTUA 5THXA 4JP1A 2DR0A 4FNOA 3SHFA 3N2NA 3HH8A 1G2PA 2Q6VA 2PLAA 5JCOA 1CZRA 3TQHA 1SVWA 4BMDA 2O1WA 3RWOA 2JBHA 1SH7A 4Z2YA 2L17A 1FEZA 4Z3KA 5FD8A 1B23P 3A58B 3MWEB 2AHRA 1V43A 3EQ7A 5ADVA 3I3SR 2QRGA 3MOIA 4HD8A 4HYTA 4AW9A 1OUMA 1T4CB 3KQSA 5DM70 4EA8A 1JGTA 4MV8A 5D7NA 2DE0X 4CMIA 1IZYA 2JK1A 2FK8A 1ZMBA 2P4QA 3PHCA 4G1CA 3VPSA 4B45A 3KSZO 4US1R 4GSLA 1TPZA 5K0TA 5KYUA 3ANTA 3KLPX 1D7AA 1UC8A 3HCEA 4REQB 4UCXA 3IEMA 4DZRA 2F4VB 1EFHA 4HUQB 3AC0A 1A4IA 2ZBGA 3IPLA 1YIAA 1A2BA 4KGVA 5AIBA 4KSCA 4NZPA 3IURA 4M9QA 4QUBA 2XT6A 2BDEA 2JZNA 2RC5A 1EUQA 1I30A 3P2KA 4LFAB 4MKIA 3QUSA 3NT5A 3E70C 4PONA 3ZV4A 2QM0A 1IB6A 2VPWA 3SIXA 4PZUA 1A71A 4CR7A 2PA3A 2OG1A 2XDWA 4B5LA 5JV5A 3V7WA 5EIBD 2C84A 1PR4A 2IXBA 2QW1A 2H63A 5IBCA 2QNRA 2YOFA 4NBKA 3V8NA 4YRNA 3G7UA 5TPWA 1WPGA 3ZDRA 3FKSA 2EL9A 1DOZA 5EIEA 3GGOA 1VMEA 3H5IA 2A7XA 2EKZA 1N77A 3BJRA 4IIEA 4NAVA 4CKWA 1BAPA 1L4LA 1RKQA 2JLBA 3FBGA 5U4QA 3EGDA 4ND1A 1AF7A 3MJTA 3SFTA 4DSZA 4YAEA 4Y2UA 4L3WA 3V4OA 1D03A 1Q21A 3K5IA 3MEQA 2Z5LA 2VAPA 1GT6A 5ALVA 2ZSHA 2XQIA 1S2IA 4PO1A 3LWZA 4K40A 4FHCA 1CQZA 4OB7A 1KNXA 1TQ4A 2C4VA 4YGXB 4ZIRB 5CAEA 1PE0A 3RH0A 4AIIA 1TYEB 3NPAA 4JQSA 2NZWA 3I39X 5E2AA 3QJYA 4JEMA 1RYNA 1TO1E 2H4XA 4TLEA 1QTIA 2AQIA 4R71A 1HE8B 1YD7A 4KWEA 1CF4A 4PYIA 4XB1A 2W2MA 1Q7CA 4NCNA 4UBMA 4DA0A 1HURA 1NX6A 1Z7GA 2XUZA 3P2MA 2EYUA 1B6SA 2FEMA 3AZQA 4RFLA 2C95A 3CW8X 5T4BA 1VYHA 4M7OA 4NVRA 1EMDA 2BF7A 1K0UA 3CO5A 3L0IB 4V39A 5AJYA 1ODIA 4DG5A 1EUDA 1JEYB 1Z35A 3V7NA 1LK0A 2LV8A 4FD3A 3D3WB 1U0EA 2CLFB 2O0MA 1J6UA 2V54A 3EK2A 3CG4A 3L6CA 1K9SA 4IICA 4I5EA 4IZHA 2ZJYA 2O3RA 2PV0A 4R1OA 1G63A 2PVCA 4Y2SA 3CLTC 3DAPA 4QFDA 1RDFA 2DCMA 1MXFA 3I2GA 3W90A 1YU9A 3EASA 3OEEA 4NMMA 3ROKA 5FL3A 1XA4A 4LDZA 3UB2A 4CM9D 2Z6QA 3VMFA 2ZFUA 3UAZA 1EPUA 1ZCFA 3VU1A 2Q6IA 3H1EA 3C7TA 3VYWA 3D6TB 1QHXA 2BGMA 1ACMA 1QX4A 3SYRA 2BAGA 3ODGA 5AW0A 3TD9A 4Q3DA 2P65A 5LYJA 1S8FA 4B6JA 1JA1A 3P26A 5J47A 4XYGA 1CEQA 1ZA1A 2ZJZA 3HBMA 3L77A 4HXYA 1OA1A 1R2QA 2VJMA 5DBEX 5IABA 3CNLA 3PGJA 5DF1A 3OCZA 1A7UA 1F3LA 1DOHA 3QPWA 3OM1A 3T1VA 1SBZA 3SZGA 5BVHA 2IDKA 2YV1A 1I4DD 3MJDA 3ZIDA 3G9XA 4HDMA 5ERGB 1IEWA 1YVRA 1VHLA 2YZMA 1GKYA 3CE9A 1X7ZB 5DRYA 1IN1A 1UBSB 4NDAA 1XYYA 4KVGA 2I87A 1ZCJA 1AGNA 2I0FA 4GF5A 2VUTA 5K05A 4IIFA 3P32A 4HEA1 2L0XA 3HGTA 4N8SA 5IYZF 1AS3A 1UBNA 1X3SA 5DHSA 4M9XA 5IN5A 1EA5A 1YFJA 3NHLA 2QIOA 2OK7A 4K6GA 1PWZA 3CJQA 4LYEA 3UM9A 4AWBA 1GJRA 1OT3A 2WAXA 2XPCA 3EGOA 1XKTA 2GVDC 1BRTA 1I5EA 1TJNA 1YIOA 4HFNA 3WBJA 3FMFA 3TK1A 3OD1A 2O2JA 4B6GA 1IHDA 2NUTA 1R37A 5CB0A 1WWKA 1EBFA 1ZGBA 2CXRA 3FKQA 4H7DA 4RF2A 1ZLYA 1M2GA 2WE8A 2FDCA 2P9HA 3AU9A 1QV7A 1Z56C 1V9SA 4PG7A 1NVEA 3QHAA 4TMYA 3U4HA 1JL3A 2BGRA 4EVRA 1OFUX 4E15A 4TYQA 2I03A 4DLAA 3EEFA 4BYMA 4EI9A 1QG2A 1ZONA 5CCDA 5CB8A 3WL5A 2CW5A 1DEXA 2F3SA 1TZMA 4FUTA 3GDFA 3VKVA 2YCBA 4X92A 3EXG2 3VMMA 2GFIA 2P2DA 1OBHA 2X76A 4B4WA 1RLIA 2CNBA 4TS1A 5F2KA 2F00A 1XRPA 2WTNA 5LUBA 5AMXA 3UJ6A 2J45A 1T0JB 1G2QA 4EAAA 1FS6A 1NG1A 3IIJA 3X1XA 4FDAA 4BNDA 1M1UA 1EIZA 1F0NA 1Z7YA 4RQUA 5EJAA 1KK1A 1O58A 1J2JA 1VKHA 2OK8A 3GVIA 1CQIB 1MB4A 4RW0A 3PNPA 1PUXA 4U9HS 5HBGA 1NVTA 4TRJA 3MT0A 4QBIA 4TZTA 4R68A 2I99A 4EHLA 3ZI4A 2XB4A 4F86A 3V8RA 3VNUA 2X8AA 3UFXA 4QUJA 3ADKA 3VU9B 2X5OA 4BJ1A 3K35A 3L4JA 4V02A 3I0NA 1E1MA 1X1CA 4UAGA 1JDBB 3T7JA 2IXDA 3I09A 5IJZA 5ALYA 3V6LA 1HDZA 1M7HA 1FVOA 3GEEA 1UDXA 2QYHA 3K9WA 1NDQA 1HORA 3QMWA 1MD9A 1UANA 5DCWA 3ZHSA 5KOYA 1MIOB 4U7TB 5HJ2A 3N8DA 3PFCA 4PRZA 2CE2X 1C30B 1RAEA 4B40A 1LFAA 4ESEA 1JG2A 1N2XA 5DEIA 4DLRA 5TR9A 3BREA 3H2BA 3WKEA 1BVHA 3E3OA 3NGMA 1K6XA 2B69A 3B85A 3ZV7A 4IRMA 1II0A 4OI4A 2YZ2A 4RYDA 3TSYA 2G0NA 1FOEB 4XQEA 3F96A 4QZVA 1UEIA 3L6EA 1ODJA 1YOVB 5AI5A 3B82A 4B9EA 3JSAA 2G77B 2QN8A 1LBTA 4AY4A 3L0BA 3DOJA 2FPGA 4Y2VA 4YCMA 821PA 1QYWA 4ZANA 4PAMA 4BKQA 3LQ2A 3NDIA 4CLDA 5BUCA 2A9QA 2QTRA 3G02A 2ZRAA 1GFIA 1K7EB 2NU8B 1WULS 3BE6A 5THKA 3V33A 1G20B 2BGIA 2P6RA 1QOZA 4RF4A 3UW1A 2EFDB 2X5JO 1V3VA 3VR4A 4EG5A 1C3LA 1S3FA 2XY4A 1AN9A 3I5MA 2IU4A 2WWFA 3N2YA 1PK9A 5DNUA 2QNIA 3AEXA 4N1AA 2RGWA 1X7YA 2A57A 2FN8A 3AHCA 3ESAA 4ZAWA 5F7ZA 1M0EA 1HFKA 3O91A 4WCDA 3OCCA 2I1QA 2O6HA 1JT2A 3Q0TA 4MQBA 3FOEC 1NSTA 1P6QA 2HCFA 1EFPB 2EP8A 5B4UA 2CFSA 1KFEB 3O0DA 5EESA 1IM2A 1L7MA 4TKVA 1GSOA 2BGJA 4EGJA 2OUKA 4X24A 5HM6A 1M0TA 4RY8A 2IDMA 1D1PA 2UYOA 2A8YA 4AJ4A 2JEYA 3VISA 1J70A 5AHRA 4H6PA 3CSUA 1O87A 2GCNA 2V7WA 3HNRA 3RDPA 1YQUA 3C7KA 2V6FA 2BHSA 5JD4A 1VRVA 4NTZA 3BFVA 1IM5A 2BFNA 3JD0A 2ZM6B 4NS4A 4Q7KA 4LE0A 1Y3CE 3HN7A 5FHQA 2P9ZA 4HO1X 1NJGA 4NPCA 2IODA 2EZ4A 4CF6A 3UUEA 2GBPA 4FDMA 2ODBA 4GLLA 2IS1A 1WMFA 4L74A 4QJ4A 3A32A 4W7IA 1GYPA 4O2AF 1MX1A 1VXOA 3E3NA 3TF5A 1QSGA 2C7QA 1HG1A 1UBGA 1UT6A 3HLYA 4KX5A 5EPEA 3AYZB 3BSWA 1NI4B 1T1IA 2D74A 4KE7A 2C7OA 3DLTA 4RHTA 3RUEA 4YAGA 5LKRA 3JWJA 1G9XA 5E8JA 1Q57A 1UQUA 5C37A 3GFVA 4EH1A 1RRVA 4NBVA 1X80B 4RF5A 4BZPA 5E6UA 5DKFA 2NO7A 3BZUA 1I0IA 3O21A 1E6KA 1PVDA 3AH8A 3KJFA 4X44A 1O08A 4DMLA 5JZOA 4RTKA 4DA9A 2Q0QA 4UNRA 1BXRB 3TVDA 2RIRA 1D2CA 3RJ9A 3R76A 1O57A 1P7ZA 3H1BA 4QATA 2O8VA 4R2IA 1PR5A 2WAAA 5CA0F 3B5IA 3ECAA 2O8EA 1T0HB 3H4MA 3NKLA 4H4DA 3EC1A 3FBTA 3D6VA 4JJEA 1YKSA 3NDBB 3WMGA 1YZUA 3PGXA 4JLNA 5CRIA 5CFRA 2ZCVA 4WOPA 3F9RA 4FYKA 3DMTC 1Z26A 1P0MA 2G5TA 4I55F 3ZKWA 1SXJE 2JD1A 1U7WA 2ORWA 4B4UA 3MRTA 3MM4A 4J16A 5LZ2A 3HA7A 1S01A 2JAXA 3ZGXA 4PLYA 2OV3A 1X1RA 5AM2A 4N7MA 4ALKA 3CYFA 4X1KB 2R751 4RTLA 3L84A 4IO0A 4W8GA 3N6RA 2WKQA 2P62A 3L0DA 2EOAA 5IF9A 3T5PA 3W4KA 3KQWA 1OAOC 4L5AA 4U6SA 4RAOA 5LZ7A 4CG1A 2X8JA 1Z45A 2WD7A 5D84A 1OHHD 3Q3HA 1K89A 4DVJA 4R41A 1UPBA 1A9TA 5HDBB 2QRHA 4ZVRA 3H9JA 3H1TA 3V6MA 1WLSA 3G2JA 4G9GA 3PA6A 4MQUA 3GXBA 3PRJA 2WSIA 4F8JA 4N03A 3ZK8A 3MOGA 4JVLA 3H4VA 4CG3A 1N6PA 1S96A 4PCLA 3O8CA 1BKSB 3IKLA 2G4CA 4B0OA 3HABA 2GFHA 2B6HA 4OO3A 1UFOA 1V16A 5MHTA 2ECFA 1VPVA 2B61A 1A69A 3OZEA 3A6HA 2FZ4A 3CU5A 3Q15C 1EAMA 4ABTA 1QORA 2I78A 3BMQB 3M83A 1PSDA 1M6EX 3O84A 3OCYA 3LK6A 4OAOA 5C4MA 4ROTA 5LL6P 2J07A 2NGRA 3BZWA 4PNZA 1O0BA 1ZDMA 1ZJJA 2YFHA 1ZC4A 3K0SA 3C6XA 1ORRA 2R84A 1QRRA 3AOEA 3PK0A 4QASA 2CVQA 2XDYA 4UXIA 3AP3A 3BCSA 4FMPA 4WZAE 5EXXA 1OFTA 3NJ8A 5GM2A 2UXDB 1JHAA 4Y6OA 3CF0A 3OZCA 2H52A 3K53A 4OFZA 2WUVA 4QOSA 1WRBA 5E9JA 4EX6A 4XIYA 2DFTA 1FK8A 4FYVA 2C8JA 1JKIA 4QDOA 2FWMX 4U0KA 4R01A 2H8KA 2WOOA 3JATA 4EA7A 3VYSB 3KSAC 4ZVNA 4RD2A 5JCPA 2CJYA 3SBDA 3D6FA 3D7SA 3KB6A 5BNTA 1H8EA 4LRTB 3V4SA 4L8LA 1ESEA 1IDN1 4KE9A 2JVIA 5AW1A 1OLXA 3OLYA 5F7XA 2FSVA 3KCNA 2QX4A 3GRYA 4IOJA 2GPYA 3LXXA 4AJJA 4BMZA 3DONA 4QOJA 4NENB 3O9ZA 2P75A 1J5EB 4N8DA 2O8CA 4NZMA 3NALA 4Z4QA 4JS0A 2B0JA 4UQOA 5B57C 4Z53A 3NWBA 5A5DA 3EXIA 4U2GA 3MA0A 3L18A 4X7MA 1ZA2A 2JFZA 4XPIB 3PDIA 5EP1A 3NVDA 5J9FA 3W5UA 1LBSA 3GLGE 3ACDA 1WV1A 2BP7B 3I2JA 3AZPA 5J2TF 1KE2A 4CM7A 2ORYA 1BFKA 4PXAA 4Q3OA 3GEPA 5ALGA 3B5JA 4YCAA 4Z3DA 3WHLA 1L5HB 1UK8A 3PFFA 4BUJA 3EWSA 4BPBA 3R7SA 1IXZA 1Z7BA 1TA9A 2QSUA 3UHPA 5M04A 4QOHA 4N39A 4P33A 4DSOA 3HWSA 3C3PA 1A72A 1SKQA 3NYIA 4DCUA 5ILOA 1J23A 3A6EA 4BO1A 2PLRA 4DDMA 3ZY6A 3O26A 1LSJA 4RADA 1DKUA 3MVEA 3UMRA 2X0FA 1WW8A 5AXBA 3D7NA 2DAPA 3Q72A 2EATA 3OQIA 1W2HA 4XYBA 3MT9A 2ZE8A 1J5PA 4DV5B 2FFAA 4IZOA 1WQ4A 3UJ8A 1X9IA 1VKZA 1HOXA 2D2FA 2R6FA 1V5EA 2Z3ZA 4WJLA 2O0KA 4DILA 2JAWA 5B2FA 2BMAA 3R23A 5J5CA 1R9NA 4V0SA 4C06A 2EW8A 1ULZA 3IT0A 4PPQA 4YNBA 3RVKA 3D0RA 2A1IA 5HF9A 1RQRA 1ZD9A 4V2IA 4HLUC 3RFTA 1Z34A 2J08A 1U04A 1H2ZA 3CKLA 2V96A 3QLUC 1XRQA 4OB8A 5DXFA 5BT8A 2WBLC 4RS3A 3HO6A 3GXOA 2VH5R 2P6NA 3DC7A 3OG9A 3RRFA 1VP3A 2JJ2A 1YI1A 2DQYA 4IQ4A 1Q0PA 3KB8A 4BTEA 3UGJA 1Z13A 2HQSA 4QU9A 2ZUEA 4UW9A 2QRVB 1M2KA 1O5TA 4HDKB 4RSGA 3ZQKA 3AR9A 4L28A 4KP7A 3C74A 3ZHXA 5I7AA 2CMFA 4AO8A 4D8TA 4X6YA 2IVZA 2YWXA 1Y4ZA 3FYCA 3GFGA 4II3A 4HB0A 4YJHB 4ENRA 1EM8B 3OCJA 4A26A 3LUFA 3MJSA 4E5PA 3S8EA 1XA0A 5BO5A 3G8BA 4HSEA 4KX3A 3RTDA 1JVSA 1E3DA 1L7VC 3C3MA 4JYBA 2Q07A 1DXOA 2R47A 4TVOA 4DANA 1GA4A 1ZY2A 3IV6A 2FR1A 4ZVPA 1YZVA 4CTMA 4AKIA 2W6ID 4YQYA 3QXSA 4MEJA 1SVKA 4IQ0A 4B34A 5I7RA 3R09A 2MYTA 3PCTA 1N5LA 1T6BY 2JIRA 3G59A 3EGWA 2B8NA 2BKXA 2QPOA 2VDJA 5IX8A 1ODTC 4CQNA 5C5IA 3PUKA 3VYUB 4R9UC 1Y6QA 2ZIWB 3DPIA 3ZVRA 3T15A 3Q2IA 2SKEA 4FGJA 1QHSA 4E2YA 4B3IA 3BK1A 3I1FA 2F64A 1NLFA 1R6UA 1OJ7A 1SXJA 1ZCZA 1FDWA 2QM7A 3MBKA 1XDUA 4KFUA 5FR1A 3P2OA 3VZSA 2OO7A 4UDXX 1QQTA 2AN4A 2QUIA 5CMLA 2QU8A 3BH0A 1NKTA 5LBUA 1MDBA 5CDYA 5NULA 3KXLA 4D81A 3ZBUA 3B38A 2XHZA 3B3QA 1RJ9B 4HL6A 5DGIA 5JSYA 4WBNB 2X1LA 5BN3B 3QXJA 3UJ9A 5JO0A 2UYQA 4KQ9A 2FR8A 3ZZTA 4DJ5X 2YXEA 1DIOB 3Q40A 1LLUA 3KUCA 4H2DA 2EJUA 3OAAA 4CUKA 3CGGA 2O8BA 3NVMB 1G6OA 4ND7A 3SQNA 1E9CA 1JJIA 2CV1A 4MW4A 1B6TA 4ETIA 1U6IA 1C80A 5CUQA 1WMAA 4D8YA 3RS2A 2YZGA 1DX6A 4YJGA 1OVGA 3GFOA 1OGIA 2GF0A 4MEBA 4TZKA 4U9UA 4FKMA 2C0QA 3RAJA 4LSZA 2PUTA 3FROA 3FTNA 2PCLA 1ZHOA 5HVNA 2O7SA 2WNSA 4P36A 3IJPA 4W6ZA 1PRYA 4B3JA 5ARCA 3L3BA 2ZJ0A 5JXJA 1M1YB 5FFNA 1S2MA 3Q2OA 2CXOA 4I4TB 5IP5A 2WTMA 2J5BA 4XCVA 1UIMA 2HH9A 3VZDA 5BXYA 2H4FA 2Q21A 4GFDA 4XGRA 4QFMA 3NOQA 3OPXA 1NT4A 1Z2CA 4LJSA 2VJCA 3PNBA 4WZAA 4LYHA 1OPXA 3R44A 1M0SA 2PUBA 4IIHA 2BKUA 2O3TA 2FPIB 2X41A 1CZKA 1L5QA 3RRNA 2VPTA 4RLFA 2O8DB 2LNDA 3N8GA 2C94A 4F3TA 2P9YA 3EA4A 4A8JC 4ZO7A 4XSHA 3PQEA 4IHKA 5BYBA 2BKAA 2H06A 3B6MA 1IY2A 1Z0ZA 1NJ2A 1IBSA 4IG9A 1BWQA 1TT7A 2VJDA 1V4VA 2I66A 3OQVA 2A35A 5L6MB 2FDXA 5B58C 1KO8A 1V8OA 1Y7TA 1T5LA 2G70A 5TS3A 4R8SA 4ZO6A 1TI7A 1SN7A 1VTKA 2DCUA 4FGKA 4O4HF 1QFJA 5DTRA 4YR9A 4Z5XA 5KYYA 4HN2A 1SK8A 4NEGA 3FLAA 4KC0A 2EARA 2PRZA 4NV3A 4ZD6A 5IVIA 5CYGA 5FH9A 4CMAA 4MS3B 1YJXA 3B2NA 3AL0C 4QODA 1IBRA 1R0XA 2XSZA 3INYA 5TMBA 3CX4A 1V1MA 2B5VA 3V7FA 1PJZA 2WA2A 5KVSA 2ATIA 1U8FO 4IYJA 4B6OA 5JVDF 2LZ0A 1MOPA 3AL2A 4HQRA 1KRHA 1H42A 1VYUA 2JH9A 2ZYSA 3GPCA 5GOTA 1WUHS 3QUCA 2EVWX 3KQTA 2UYGA 2ATEA 4BFZA 4TS3A 5G0TA 4QPDA 5IDVA 4BQPA 1Z75A 3WYAA 3GJQA 2I4IA 5AVSA 5IAKA 3PITA 3Q0EA 2I4LA 2GDZA 4D9GA 4UEJA 2OYRA 3N1UA 4Y2YA 2DPXA 2O52A 2RI6A 3TX6A 3W7AA 4AKEA 1H4QA 2NAPA 1KAMA 2J9RA 2RGYA 3G0BA 2F1IA 4NZYA 4Y18A 5AHWA 1PP4A 2HQ1A 4F60A 4HXFB 1QBGA 2FN3A 4K3VA 1Y3AA 4GI1A 3U7IA 2C5LA 3TQTA 1JTFA 1NY5A 2P2NA 4V1CB 4HLCA 1E2HA 3HS3A 3AESB 1CS4C 2JFUA 3QWHA 4UU1A 3RT9A 4CQLB 2Y0DA 2QGZA 4RK6A 4QNMA 2GN6A 4FB5A 1GUZA 5ECDA 1TEVA 2VXBA 1HE3A 1RI5A 2JCVA 4WKNA 3U37A 1D2MA 4NBSA 2X9NA 2OAP1 3TQIA 2ZB8A 4EP1A 2O2CA 5IYZB 2GYUA 2VTBA 3NDPA 4B32A 1PKEA 2QR5A 2ZYGA 4FCVA 3OI7A 3JVEA 3WAGA 3GJ4A 3OU7A 1R6TA 4JELA 2VDUE 5F3RA 2G04A 3NHJA 1WHTB 3UMGA 3QJGA 5F5XA 3S6JA 2R00A 3K0KA 3HZRA 5LB2A 1QVRA 4KIGA 1Y8ZA 4ARZB 4LRYA 1FFSA 4MCAA 1NMYA 2MCFA 1KFJB 1OTYA 2JJMA 1X6VA 2Z4RA 3F71A 3NONA 2WQ6A 3BJEA 1SBCA 1OXTA 3FUTA 1NIJA 3KEQA 4YRTA 1R12A 1R0KA 3HUTA 3L49A 3M2TA 2YJ5A 2JC3A 4KAXA 4R6WA 3TTYA 3AUTA 2ID7A 3F73A 3LGXA 4LJ5A 1F48A 1KEPA 3K31A 2EJVA 4LHYA 1DNPA 4NBWA 4XVHA 2CLEB 3YASA 1PJLA 1VSVA 1EK0A 4BC1A 4LOIA 1U3WA 2BFBA 4QU5A 3AETB 5ERYA 3SHVA 3G3EA 3OUUA 3C43A 5D5HA 2P35A 2B7LA 1MC1A 1VMIA 4N4AA 3ZNQA 3G0DA 1J0XO 2VHZA 3ZCSA 2ZSFA 1P1IA 4BX9A 4YMGA 1BA2A 2Q99A 4XD7D 4PC3A 4Q93A 1X92A 3NEPX 5JE8A 4LY3A 1C4OA 1Y4UA 2VJAA 3S68A 1Y7LA 1YBMA 1PFYA 3K4QA 4B6SA 1P3Y1 3IHLA 1TU0A 1ZVJA 2CXXA 1G3QA 2GK7A 2R4UA 2BFAA 2WTEA 3W0LB 3WSVA 4ZI7F 2AD5A 10MHA 4R0MA 4JC0A 5CLHA 1PLKA 2QJOA 2CK3A 2ZSKA 4UPEA 1R10A 4MDFA 5FAKA 3LDHA 2AJ8A 4ZV7A 3MWYW 3KJQA 3WK6A 3QU9A 1RWPA 5GGXA 1Y37A 2DFNA 4L75A 4N5IX 4LQ4A 2OBLA 4OHUA 5TB5A 4JOQA 4BRZA 5A4KA 1U5BA 4IIUA 2ECPA 4IDHA 3IIEA 1C3OA 2WAMA 3DP9A 1EGMB 5IWCA 5SY6A 3N2LA 1W581 3OA2A 4TMZA 3EWIA 2HA3A 1SVNA 2FR0A 3LC7O 4UDOA 5F73A 5IW8A 3RS5A 2VSXA 3HSKA 4ZVMA 3WGOA 1VCHA 4J29A 1W96A 1U8YA 1EVEA 3V97A 1YB5A 1S02A 2RD2A 4LXQA 3ZTTA 2ATVA 2AYZA 1P1FA 3BVPA 1I33A 3I73A 4MVJP 5HZKA 2W2NA 4J1TA 1C81A 3E22B 1R9MA 3FN4A 4OXXA 2I8CA 2XCUA 1UMDA 2GZ2A 3FHLA 1XA3A 3KQVA 3NTXA 3CNOA 1ZW6A 2WSBA 3R24A 4FFOA 3ERCA 3HLTA 3TCXB 2PGJA 2IC5A 2I4NA 5E95A 4EZEA 1M34E 2H4WA 2VK2A 3LHDA 3RWMB 3ZIAD 3DUWA 4H4CA 1GU1A 1UL1X 4ZZ1A 3TECE 1REQA 1N3YA 2DXIA 1VLJA 1DC4A 2CFIA 1QBKC 3H9EO 2RJOA 3WB9A 5B7GA 4ZQGA 4BWYA 2DHQA 2OZKA 3P96A 5JAIA 3BRWD 2X4GA 4H3HB 4IGIA 3QPBA 4C30A 4CGYA 3OTIA 2OLJA 4JYZA 4AS1A 5CTAA 2PL9A 3UJDA 3CXRA 3PNOA 3C8UA 4US0R 3BK7A 2XXBA 4FGUA 4JCCA 5EXSA 2MDTA 4MR7A 1YMQA 2NUAB 4EHJA 4IDQA 1T35A 3AEUB 2R6AA 4KAJA 1NF9A 4H3KB 2YVAA 1USGA 3H16A 5EE3A 5LA6A 1YR9A 2WG1A 1BGXT 1YFKA 3KK0A 3VX3A 4L50A 5JAPA 3M4JA 4JU9A 4ZOBA 4UUQA 1IBKB 5LN1A 1X1DA 1UBUS 1CQXA 2B1IA 3NETA 2B1JA 3RKSA 2QEQA 4BVFA 1TIBA 5JHGB 5TF0A 3UB4A 5LQNA 4KQHA 1Z08A 4LZZA 2Y1EA 1C9EA 2P9QA 4D45A 1U6KA 1AXEA 3S99A 4Q7QA 1P81A 2CL5A 3O4FA 4ME6A 2VBGA 4Y8VA 5KKCA 5KJCA 1M8GA 1B8VA 1YQ9A 4E5DA 5FWNA 4FYXA 2P4HX 1DKLA 4LJ6A 5LLTA 3I8OA 3MGBA 1D7OA 3O4IA 3R3WA 4N5MA 5TT0A 4BNZA 2HV9A 1FJGB 2W5UA 5TPZD 1KI4A 5H70A 5I47A 1SIWA 1SCNE 1BXGB 1SG6A 1E1RD 3NOXA 1QH1B 3ICVA 4K6HA 1EWRA 5KSPA 3WNDA 2JGRA 4X94A 1PZHA 3GRPA 1Q7BA 2FI1A 4O2AB 3RVRA 3ZE9A 2JGDA 4A0FA 3DVRX 2FK7A 4LVNA 2F43B 3GJ0A 1ZH4A 1KZ4A 2VTKA 1XZLA 3M6VA 1T24A 3GH3A 3PXEA 1PNOA 1WP9A 3EOAI 1RADA 2X0DA 1FIUA 4S1NA 3A28A 1GM5A 5CLJA 3DZGA 1UJCA 4CUZA 4DXDA 1ESMA 1XUOA 3U56A 2CJFA 2CMDA 2E5FA 2WJZB 1AKQA 5E3JA 1E4EB 4TMTA 4UNQA 2X3UA 4DLVA 1XB2A 3JWGA 2QPLA 2PQMA 4WESB 1TD1A 4AF7A 1LRJA 4H6VA 3DHWC 3T5AA 3UF0A 4JI0B 1KRWA 5M29A 2PH7A 1UWCA 5AJWA 3VOBA 1MC4A 5CA0B 1C4KA 5EZYA 1UXGA 4EFMA 3TTSA 4YLYA 1P2BA 3C8HA 3ZOKA 3PS9A 1XZHA 2BJHA 4FFVA 3U1VA 3H2GA 2VDQB 4GLOA 2GBFA 3MCUA 2GPNA 3MINA 2JI6A 2QE6A 3R7WB 5LP6B 1PWEA 4RESA 2GBCA 4MI1A 5HG0A 4E4YA 2NWQA 4NULA 3L5KA 2EG5A 4HWKA 3W3AA 1WS6A 2NNWB 3LP6A 3AR6A 4OQMA 2B1RA 1WUTA 2JGNA 5HRAA 1IK6A 2AKYA 3CN9A 3DZFA 1RYMA 3QXGA 4RZIA 3CVUA 3WIUA 1J99A 4RF3A 3U5ZB 4XR9A 3EVNA 3WP0A 4AS2A 1VC2A 1QFYA 1V1RB 4DR7B 5K9ZA 3EXFB 1MB2A 1W5FA 2HNBA 4QRDA 4LBWA 1PJBA 1RS0A 2RARA 4YP0A 2XMRA 1E77A 1EU1A 3IOEA 1BCSA 3KP1A 1UKYA 3FYUA 2EFEB 4OBWA 4QRHA 3GJXC 2C3OA 4GD3Q 4F7WA 2W2KB 1U0NA 3L8CA 1YZKA 4HVLA 3SQLA 1O9GA 3FTFA 4BNJA 3PD7A 1OWPA 4NR0A 3CQ9A 1QIHA 5BR1A 1YQXA 3DFMA 1GHTA 3AVQA 4XJVA 4PC1A 2GEUA 3B70A 3L7LA 1JG6A 4FYIA 4GLBA 4Q5IA 1S3SA 2V3VA 1DAKA 4X20A 1ZZEA 3VSBA 4LISA 4RAQA 2HAEA 3WWEA 3BWYA 4BGVA 3RVSA 4EPXA 1FU7A 1I4LD 3HDGA 4IFBA 3HEBA 4TS9A 2ZYUX 5DP2A 5AW8A 2DOKA 3A04A 1LFDB 2ZJFA 5KOJB 3O4GA 3W2GA 3G0OA 5BV7A 4DG8A 4ZTBA 3PPYA 2WZDA 3MN1A 3EODA 4M8IA 1I7SB 3LHSA 3DFUA 5DGCA 1TYCA 3AOEC 4MWCA 3WDMA 2W8BB 1UZNA 1XVIA 2QL7A 5E9WA 3T7IA 1Y5LA 3P19A 5DM0A 2WHYA 3L0YA 1AHPA 3VR1A 2BBOA 1D9XA 3GDGA 1A96A 1I1HA 3L8ZA 3AIKA 3K92A 1FE8A 4OMFG 5GIOE 1Y0BA 1VZ2A 1JIVA 2H1VA 3PQ2A 3QVSA 1ZWLA 1Z17A 4IVQA 4HQ6A 3PR2B 5FULA 3W1WA 3T5BA 4BB9A 4L4XA 3VRHA 2D5LA 4P4SB 2AT1A 2GCPA 3I6BA 1FP4A 2JLWA 1XTVA 3KKMA 1UBTS 1KSGA 3B52X 1MB0A 3I42A 1MA0A 1Y6ZA 4CCSA 5DYIA 1GGKA 3PQDA 3MC1A 2OQIA 3X1ZA 5KTRA 1OLSB 1TVKA 2LTAA 4RFSA 3KYCB 3RVPA 3T3GA 4C2AA 2NYVA 2IHJA 4JC8A 4KHZA 5A7HA 1XZBA 1HG0A 5CFZA 2XXAA 5BSGA 1G3MA 1J0AA 3EWNA 1G5TA 4FP9A 1M34A 4IIJA 2FKNA 4GQIA 1PJ8A 5KNBD 3LVFO 3GLFE 4TTJA 2DFVA 2XODA 4JGBA 4M46A 3UCFA 2QJTA 4JLBA 4BX2A 2X0JA 1ZKDA 5CW1A 2WG2A 5J2TB 1SHZA 3ZHRA 2AOTA 3WLMA 1DLJA 1JR6A 1SO8A 2UZ1A 3FOWA 2VP3A 1IN6A 2JHAA 4GWGA 4PY2A 3WLEA 1YDMA 4JVSB 4P7BA 4WSOA 3NFYA 1XL1A 2DHDA 2KBEA 3M5CA 2AK3A 3T3PB 2Q3MA 4DA7A 1WCYA 1Q11A 5FWXA 2B7CA 4I1UA 3ROFA 3DBRA 4YJFA 2ZIUB 1ABBA 4FM9A 3RVJA 3VH2A 3DZIA 1DUSA 3FXAA 1WM1A 2ZBFA 3BGIA 4U2DA 3ZQUA 2VYQA 3HNOA 2XITA 4H3VA 5E6SA 4Q7JB 1C7FA 1GN9A 4I6EA 4GMGA 2P5YA 2BUCA 2A14A 2P2CA 3KTFA 2WJPA 1LPSA 1N2GA 1G98A 4GM0A 2DWUA 3S2UA 3VDMA 3EVAA 1FFGA 4QNRA 2PG3A 1T34A 1V4NA 4E11A 2HEGA 3VJLA 4O8CA 4QUKA 3ZD6A 4BFXA 5HE9A 1ZL2A 2OBXA 4TXMA 4DMUB 2PRJA 1H93A 3G2LA 1FXSA 3ROGA 1E79A 1KMNA 1WCV1 2OB1A 2ZKIA 1GGVA 2VJOA 3NM4A 3RYCB 4I6JA 2XKKA 1CX9B 5JPIA 2GF2A 1ORIA 3L1JA 1CP2A 4JZKA 4O1HA 4PO9A 1ADJA 1YCFA 1DBPA 2KYRA 4X7RA 1KA9H 2OBYA 1PG0A 1O6BA 2BFFA 2O2GA 3KR9A 3AKDA 4G0ZA 4IBOA 4TV8F 3B36A 1FB5A 4L51A 3R7BA 2ZM5A 4LYJA 4RGQA 4GL2A 5I7EA 3CUEF 4D9FA 3KV1A 3SIPA 4NYIQ 4U39A 3CURA 1RWNA 4KAAA 5B55A 4WERA 4OV6B 1Y3HA 3CEAA 4MRPA 2C88A 2ZJAA 3QVGB 4GDMA 2Q5EA 3TTTA 1Z22A 1QO0D 1ILWA 4J94A 1CY4A 4Q82A 3WWDA 2M6LA 3ETHA 3STWA 3H42B 3H99A 3R0VA 4P7JA 4US2R 3VR3A 2N1BA 3QPCA 2FGJA 4FSHA 2JIZA 4D1YA 1CQPA 2XVAA 4CIWA 4D8WA 5ERXA 1QIMA 4ESHA 1FLNA 3UGTA 2JKVA 3D5QA 1F51E 2QN3A 4MGYR 4TT8A 4YEDA 1VI2A 1ND5A 4WLFA 3AM1A 5DLDA 4Y6PA 4ENWA 5AKEA 3U19A 2WJVA 2C1EA 3GP3A 1XTRA 4XJXA 3WGHA 1VSUA 5BR8B 4U7JA 1SC6A 5JY1A 1SXJC 1P60A 3A1NA 3K5PA 5DOVA 3RGWS 2DT5A 1WOMA 1J2EA 1QGUA 5AHXA 2WFZA 5HCIA 4KSYA 1T1JA 3V4FA 3A6KA 2D1FA 3F49S 1J24A 2XE4A 2ZAIA 3EIOA 4YGYA 4AYWA 4CKEB 2ZJ3A 3AFIA 4EG1A 4BECA 1MRZA 1KE1A 2ID4A 2QZJA 4N0DA 4X54A 1V0JA 3ZW8A 4H7JA 4JOCA 4ZI2A 5B1IA 2Z58A 2I1WA 2Y1OA 4RIHA 5BUZA 3OWXA 1DO0A 5ALIA 4Q01A 2QY9A 4NJMB 2ODTX 4ZOEA 1NLMA 4XI9A 2HCTA 1KS9A 1M33A 2XWQA 3O1JC 5LVAA 4F45A 2J5RA 2IS6A 2C2MA 3KEFA 1TA4A 4GAEA 4E1BA 1F8UA 1J8FA 2AE1A 3M1AA 4KKXB 3SBOA 1ZIPA 3WMXA 4UHFA 4MDHA 2GEJA 2IYQA 2BDTA 2XMBA 3AFNA 4C0QC 2B30A 5B37A 3VH1A 5I4KA 1F1BA 3DQQA 5B64A 4NQZA 1KQFA 3U4QA 1Z8HA 2IFTA 2JAHA 4OH1A 3MW8A 1Y8QA 4NKRA 1XTZA 3KJHA 3A1TA 1I01A 1XLUA 4KLRA 3TH5A 1WZNA 3WB1A 5B2EA 5MN6A 3RUPA 1J39A 9LDTA 1HEUA 5BORA 2R4QA 2G09A 2OXCA 2POCA 3NHSA 2C1ZA 3RYIA 5D3MB 3GJ7A 3LKBA 4X00A 4G5OA 5ICEA 1IBCA 3Q6MA 2INGX 2Z56A 1Q92A 2J7PA 4QTXA 5EERA 3R3XA 4J0EA 5KWJA 1L5LA 1BEEA 3CX6A 3G2OA 1OB5A 1LLQA 3TRJA 3FA2A 4ZQEA 1SXIA 1UJ2A 4O4JF 2L42A 3EDCA 2V74B 5EP2A 4DV6B 5ALDA 1NNEA 1E6CA 4HEA6 3IVAA 4IH1A 3CINA 3FF4A 1BRMA 2IXAA 4FCCA 4FONA 3RUFA 5LQJA 2D59A 1KMMA 2V55B 1KPGA 2P3OA 3BWBA 3HKCA 4HH0A 5EJ2A 4XWAA 1G6KA 3LUCA 4MAFA 4H77A 1O8BA 1KU0A 1XU7A 1JU9A 4EW1A 1F8XA 4UNSA 1IIRA 3C70A 1GG9A 1DDGA 4O5OA 4OUDB 2FP3A 2GCOA 2HJSA 3H4TA 5ENVA 2C2OA 2JGEA 4L02A 4WACA 5EP4A 3S5UA 3B7GA 4J0QA 3UJ3X 3MIZA 4WY8A 1PVVA 2IA5A 4MR9A 1MNQA 3SNKA 1N2HA 3OE7D 3AM5A 3DYIA 4D4JA 2GSWA 1DEKA 3F74A 1ZOLA 4W82A 1D4OA 4HJRA 4V0LA 1KOLA 1MX3A 2FPRA 2PL1A 3TO5A 3V2GA 5BSMA 2OEPA 4FFBB 4JP8A 5ESDA 1PIWA 3GD5A 3UTDA 1FSGA 1KXJA 1Z5UA 2UUAB 2DPMA 4G5GA 3B1KA 5KHAA 2L82A 1OROA 1C1HA 1QIJA 4XKJA 4MVYA 4B47A 3LUKA 5I7HA 1P1CA 5CA1F 1PZFA 3IKMB 1MJNA 4RY0A 3GLFA 4G6ZA 4HBGA 3UWDA 2ZQZA 1QGZA 1WOYA 1V1JA 3O83A 3DP7A 2R6CA 4MJLA 1YRAA 5G53C 4F84A 1QLWA 5JH7A 2WZQA 5AM1A 2A3NA 2JANA 5F9HA 2V9PA 2Y99A 2A0YA 3DMHA 1CRLA 3VPAA 4RVHA 3VOTA 2I80A 3BL8A 3IEIA 4TTTS 3GLVA 4M9ZA 2NU9B 1HEIA 4U7FA 1DAIA 3HU3A 4Q9HA 2QJFA 1GXSA 3C87A 4UD2A 1HH4A 2I6GA 1MF7A 3LDFA 5FNVB 1SD2A 2EP5A 1TXGA 1CR6A 3JQGB 4MW2A 5KVVA 4N65A 2UU9B 5CNJA 4RXTA 1N1DA 2O8FA 5IANA 2FWAA 1LI4A 1R0YA 3TZCA 3VJKA 2IOYA 3PC3A 4P2GA 4WCFA 3QSGA 3WY9A 5K99A 4R81A 1OIWA 1SXGA 2H0RA 2HX1A 2J32A 3EARA 3HXLA 1X0VA 2EYQA 4KK3A 1KC3A 1BZYA 4MYHA 1Z18A 1WNFA 1T1EA 1X42A 2V6JA 3Q9NA 1YNSA 2G80A 3B2QA 3COWA 3CZRA 4ZYWA 5KTTA 3CUVA 1A82A 4J7CA 4YA6A 5KPDA 5IVHA 3OTGA 3DXXA 2WJ3A 3ANLA 2WSMA 5F2NA 3AR7A 5H8WA 1IHYA 1QG6A 1M0WA 1RJWA 3N76A 3N6XA 1MFPA 1ZW1A 1NQOA 4P86A 4A10A 2R1VA 3AR5A 5EJ6A 5KC9A 4FFPA 1S1MA 3SC4A 3UMJA 1X1EA 2R00C 1DKQA 1RWVA 3N74A 1A8IA 1P91A 1JPVA 3QE9Y 1NLUA 2YNMA 3JYLA 5K0NA 4KO8A 1E9AA 2HF9A 2WC1A 4DSUA 4HFJA 3GW8A 1EQAA 5KUTA 5JRDS 5LIPA 1I2ZA 4PC6A 4S12A 5EINA 2A0KA 3F9IA 2YX1A 3DT8A 4FCWA 1WXGA 3EEIA 3GN1A 3LCVB 3W1VA 1VP9A 2KPOA 5K8VA 5EKDA 3FVQA 2CUKA 3VU8A 2IUFA 1VBFA 1YULA 2O1XA 2M6SA 4JT4A 2WY2D 4OBBA 3SJ7A 1AT1A 1T9AA 2E4XA 1U2EA 3F5QA 3NXSA 4KXUA 4B33A 3H11B 3V34A 2AFHB 3IMFA 1RKUA 2QN2A 4MQMA 4DFDA 2ID9A 2AQ8A 3HXOA 4PGHA 2AX3A 3ZCUA 1Z6GA 3ZW7A 3KWMA 3ZWMA 1WY7A 2FPXA 4KH0A 2FSHA 4R8KA 4WT7A 5ECYA 4UTPA 2BE7A 3AQ4A 4BO9A 5BW4A 1NAIA 2OFPA 3FUCA 4IGKA 4K28A 4RJLA 4V0RA 5JJ5A 2CXUA 1HE1C 1G2IA 1KPIA 1PZNA 4JA0A 3F5FA 2RH9B 3GPBA 4JXKA 4LCJA 3UK7A 3GVHA 3T1QA 2QZSA 3A3NA 3BMNA 2DFLA 3P1JA 4HY3A 4UBJA 4ZCTA 3U16A 5J23A 1GFWA 3MRSA 4LGCA 3IP7A 4F91B 2GJSA 1LH0A 2LVBA 1PFUA 3TSCA 1CNEA 4MUKA 4OG2A 1MA3A 1KZ9A 5EXTA 2GJAA 5TE9A 1KI8A 3T4UA 3F4KA 4RZUA 2XE7A 4UMDA 1SZCA 3A05A 1VJ1A 2H1SA 2C2HA 1BFUA 4EFLA 4HUTA 3IB3A 4YRZA 1W93A 5IEJA 2CHEA 1IG0A 4O59O 5B6JA 1AUXA 4AVYA 4W5QA 1FUUA 1QHIA 2WICA 4IJQA 2CLMB 2GHQA 3CWZA 3Q9SA 2BZGA 2OFWA 1LK5A 4E08A 1EZ1A 2WD8A 4PV7A 4E5VA 3QE2A 3H9BA 2X9VA 3WIVA 5HJ7A 2PFSA 3GGPA 3M81A 4ZO9A 3ZYZA 1JZSA 2G82A 1YR6A 3IIIA 3VVBA 3WK9A 3OJOA 4EHAA 5CVUA 5KWIA 1ZP6A 5ELLA 4AQ7A 5ALXA 1IH8A 3R0ZA 4WXYB 1H3EA 1UBJS 1FQKA 1IBMB 1IXKA 3DKIA 3F46A 2H00A 2PQ6A 2ZATA 1JSRA 5KJ6A 1RI4A 3U1BA 5KMGB 1L5KA 3PHLA 4B87A 3OURA 2AXEA 4D9EA 3RC3A 4MLZA 4GSYA 3JRWA 1E9BA 1WSBA 1ADYA 2QZ9A 2RK3A 2J1LA 3VSDA 4AKHA 2QTZA 2VXYA 5ICSA 3DNMA 1E2GA 5ALPA 1PT5A 3FSGA 3NOVA 4G8DA 2O7NA 4HAUA 1JI0A 1R6DA 3HB0A 3K8YA 5DBFA 2FWPA 4U4AA 4J3NA 4AZ3B 3OEWA 1XKLA 2W93A 4TMXA 3G2KA 3IRUA 4CKCB 2A86A 5AVWA 3D3JA 4A5OA 3RKUA 1Y9EA 3A26A 4QBFA 1GPDG 3GG2A 1XEXB 4KXYA 2XE6A 1UPFA 4ENQA 2F8LA 2GNOA 2YQ5A 1KI1A 2KJQA 2ZUUA 4NNOA 3LUBA 1QIDA 4MULA 4X71A 1JU4A 2CKMA 1BGWA 3UQZA 3K8OE 3U7QA 3VBCA 1G60A 4YAFA 5LKAA 1KEZA 1WIWA 3KCQA 4MIYA 3CEHA 4DV0B 3M4XA 3QF4A 4GQAA 4YAOA 4KMRA 3WWCA 3MPUA 4GX2A 4U2KA 3E05A 4OHCA 4YXWD 2WWXA 2PH3A 4C05A 1WE2A 1CW2B 1XPJA 3P4YA 5AM0A 3ZWBA 2FDRA 2C9CA 4L7QA 1KKLA 4MPTA 2RHDA 2I91A 1T5HX 3GLKA 3R74A 1PJQA 1YJBA 3ASUA 3EDYA 3EH2A 8ATCA 1AV7A 4EY4A 3ZHTA 1HRDA 3HUDA 3IT2A 3P9RA 4ATNA 5IDXA 5H02A 2VHYA 1DXHA 4AZVA 3UO8B 1DBQA 1NYTA 1GG5A 4LW8A 1KP3A 4XVQA 1H3FA 1KYIA 2IEIA 3ZY4A 4DDVA 1F7UA 4F3KA 2PX3A 4B3GA 3DW3X 4HATA 1COZA 2H65A 3B6EA 4TLLB 4L0DA 3Q12A 5I45A 5L4NA 1CRWG 5A2QA 1WZUA 1QNLA 3AF4A 4AECA 4JBHA 1P44A 1GZUA 1RFLA 2F2TA 2H2AA 4UTZA 5T7BA 3UOWA 2QG4A 1WZIA 3LC1O 1DBIA 4Q03A 4JC5A 1CDZA 1Q1BA 3A06A 3DV0A 3N05A 4WPGA 4DJEC 3LOUA 5KYVA 4JBLA 2GWRA 2ZR8A 4S2EA 2QAGB 1DVRA 1N7GA 1W5TA 2O20A 4RM3A 2XUQA 3NORA 4INAA 2WKPA 4EIWA 1VRWA 4EK9A 5JFOA 1ZZGA 4JY7A 1OGYA 4NMWA 4CHTA 2JA1A 3L1KA 2GYWA 3NAGA 4D9IA 5A9SA 5BQXA 2ZSEA 1ECBA 5DNYB 3COJA 4MV6A 5IAOA 2BIFA 1WF3A 3AUXA 3MTJA 4YMVA 5TF4A 3HCNA 3WXMA 4YMUA 2QVCA 1RNLA 5I8PA 1KDPA 2BBTA 2OMKA 1JLLA 2Y1DA 1CB7A 3EIUA 3T34A 4EVIA 2A0WA 3C41J 2E85A 4MUFA 3ZH9B 1FA9A 3RCBA 1Y6FA 2WINI 1ZU5A 3HV2A 5CDGA 1RPAA 2ZBEA 4QELA 1T8PA 3IDSA 3ONFA 1K3TA 4WZBB 4I9HA 1QCYA 1NI3A 5HS4A 1DIGA 5AHOA 5K0BA 3MLBA 4TVSA 3MUEA 3ER9A 3DYVA 1PQPA 2Y2VA 1SBYA 2R9VA 2PMEA 3PYLA 5KYXA 4JROA 3QX3A 3AVYA 2M1XA 4IUBS 1T1RA 1GCUA 1SVLA 2CHFA 2YJGA 4OL0A 4TKUB 4C6SA 3KFLA 3Q7TA 3B1VA 3OF2A 3EGXA 3AR3A 4G5SA 4KLAA 4QREA 3DBLA 1UMCA 3R6WA 5KVAA 4QYWA 1Z63A 2DTDA 3HB4X 5FRDA 1RCUA 2YWDA 4C4YA 4EHFA 3FTEA 3NHBA 1W88A 3FZGA 1QCDA 5EWLA 3KAKA 2PKQP 5I4IA 3X1WA 2NN3C 4ESVA 2Q5CA 5CVEA 4DTCA 1XN1A 1MZVA 1VE5A 2P3LA 5A7GA 1S8NA 3OZFA 4IJMA 3WGTA 1ZJ6A 2PRIA 4JUBA