1TQ2A

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
402
structure length
395
Chain Sequence
b'NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLKLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interferon-inducible GTPase
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 131
structure length 395
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tq2A02
1P72A 3NDPA 4HB3A 2QT1A 3A4LA 4U5XA 5EE1A 4BEBA 1ZD1A 3NEYA 4TWZA 3AVWA 2QMOA 1GWNA 2J0UB 4QJ4A 2A5GA 3GLHB 2GXQA 3IIKA 3X1WA 4V0ME 2AXPA 3BB3A 1OXVA 2B8WA 2QM7A 3EW9A 2IXGA 1WE2A 1YZUA 2UKDA 4TT3A 3L43A 1IN5A 4US0R 1JR3D 1ZM3A 1RRGA 5JSZA 4QJ5A 2C2HA 2DBYA 1NN1A 4LPSA 3GPLA 3MSXA 1D9ZA 3PJRA 1II9A 5EE9A 1XMJA 2EYUA 2CCGA 4CYMA 2CVFA 1E9SA 1TEXA 4DSUA 4DCUA 4Q7KA 2YC4C 1UEJA 2C9YA 1JXOA 3THWB 2GXUA 3THXB 5L3SA 3HYRA 1LF0A 3GQBA 2VSXA 3NWJA 1VHTA 2EFDB 5GJWC 4EJSC 3LA6A 4M1WA 4BLOA 1R8QA 1I2MA 2V6IA 4RD1A 1WDTA 3U3KA 4E5UA 2ERXA 3I5XA 3UATA 2XNSA 3S1AA 4AYWA 2W0MA 4KSCA 3U7FB 3L0OA 1G3QA 3CZPA 4G5QA 1OV4A 3DMNA 4JKYA 4C30A 4IVPA 1VCMA 4HLUC 3HU2A 4M4SA 5KHOC 4MUBA 1RZ3A 1XWIA 1YR7A 5DYGA 5IRCD 3TSWA 5AUQA 5CB6A 3U5ZB 2ZRHA 3VKGA 5CDFE 3LV8A 3KZ1E 2GCNA 1NN5A 4FWIB 3CRVA 4LJYA 2GK7A 4NYIQ 2GESA 1QG4A 2QSZA 2G88A 4BLTA 5K8LA 4FIDA 3FTQA 1Y3AA 5LD2B 3K70C 4RD2A 3EXAA 2RB4A 3RC3A 1KJYA 1F48A 5K8TA 2WMOB 3B85A 4NDZA 3A36A 3EIEA 4MRSA 2IUSA 1ZU4A 1HQYE 2QY9A 2WOOA 2QMEA 2J9RA 4DCNA 3LX5A 3PFIA 2WSSA 5C2JB 1NIPA 3HPRA 2QL6A 1SXJC 1DS6A 2F43A 3FVQA 5B64A 2FGKA 1QZXA 4M9QA 4XH9B 3VHLB 3CF2A 3PIRA 4WVFA 5AJVB 3B7GA 3K1JA 2GBLC 3LX8A 2MSDB 2X19A 4A15A 3BC1A 3DKPA 1G7TA 1R0ZA 4LHYA 3GP8A 1OH5A 1EFRD 1KY2A 5LB4A 2BJWA 2QENA 3U44B 4FMBB 4AD8A 2JATA 1M74A 1OPXA 3WNDA 4LJ8A 1XCGB 1IM2A 5FPHA 4Q4HB 2CBZA 2F1HA 2PLRA 2CK3D 3V4FA 2OLJA 2QP3A 1T91A 2RGCA 2FE4A 3NHBA 4M9SA 5FH9A 2PZFA 1CJVC 2NQ2C 2JLRA 2ZJAA 4Z51A 1WRBA 4AY2A 3UPUA 5HKKD 4ESHA 5B58C 2QORA 4DB4A 2YV5A 2B7BA 3LLUA 2F1IA 4FN5A 1UBFA 4QGAA 4TSFD 2O8CA 1L4YA 3VX3A 4C0BA 4IOKA 1W0JA 1XXHB 3SBDA 1YZTA 1LV7A 2ZRJA 1H65A 4IVRA 5C46F 3D8BA 1FNMA 1W2HA 1JALA 1NBMD 3GLIA 1NY6A 4EPTA 3DL0A 1ZBDA 4LHZA 4PFSA 4HI0E 1E1RA 4A6XA 4AURA 2ATVA 4B48A 2V1XA 1XTIA 4EKDA 3PUWA 3THWA 4WZ6A 1YR8A 3CRRA 3OAAA 3I5YA 1NKTA 1E4YA 3VQTA 5L3QA 1FMLA 4DLUA 4QNMA 2H1LA 1A5TA 3TUZC 2ZVQX 2JJ2D 3WP1B 2H92A 2Q21A 4DCVA 4BQSA 3UMSA 4HUQA 5KTYA 3T34A 5KSPA 5IF9A 3RS7A 3GFOA 2IC5A 1ELOA 5GJCA 2Z4SA 4R7ZA 4A92A 2W6JA 4MH0R 3ZS9A 1W0KA 4QHYA 4PQRA 1KGDA 5DO9A 2YWGA 1Y63A 2ZJYA 5EE3A 1Z5ZA 5E7MA 2IXEA 4JVNA 3KQLA 2GJSA 1FW6A 4Z8YA 1GTVA 3ND9A 4HZIA 3V00A 1G41A 2XX3A 5FR1A 4QM7A 4R98A 4KV9A 1G4UR 3IBGA 1S9HA 2XZOA 1N6LA 2ZRDA 3SHFA 3I1FA 2YVUA 4DKXA 2R6GA 1G1MA 2WJVA 4B2IA 4F93B 3GJ8A 3AVQA 2PEZA 1LNZA 1Z6AA 3BS4A 3WHLA 5FL7A 2XSZD 2C9CA 4BWYA 4IDQA 5KYKA 1Z0DA 1F2TB 2FG5A 2HJVA 4G5SA 4JT4A 3QI2A 3WMFA 3WXMA 2V1UA 3EZ6A 4A0GA 2E9SA 4ZDJA 1LS1A 3HPQA 1MT0A 2XXAB 4OYHA 2R62A 3GJXC 1S1MA 4M1KA 5HTKA 4KBFA 1CEEA 1MR3F 4XTCS 1ESMA 3QY0A 2W2TA 1JJVA 1WXQA 3SC3A 1ZUIA 3FE2A 3NIBA 4LV8B 1QG2A 5L3RA 3U44A 3CUEF 1HY3A 2RHMA 3HR8A 1MO6A 3FHOA 5LB2A 2OZEA 1E2QA 3N2IA 5DGXA 1XJQA 1SZPA 1XEFA 4P31A 3CZQA 1RC8A 4AWXA 4B76A 3K70D 4G0NA 1NMZA 3A1WA 4TZ6A 1MABA 5JI3E 2K5UA 5DSZA 3A1TA 1YZKA 2ZITA 2WWHA 1P9NA 3IHWA 4MRRA 1CR2A 4BFXA 3T61A 2F3RA 4KI0A 4DDVA 2Y8EA 5M04A 2JCSA 3Q8XB 2FMXA 4AI6A 2G0NA 1DEKA 3MG9A 1PZNA 3PQCA 4HSEA 4A82A 1SXJD 4BLPA 3QBTA 2R6DA 2ZRLA 1TQ2A 3SJCA 3LDAA 3AVUA 1KI8A 2P3SA 3ZIAA 4DSNA 4UNQA 3IGFA 4YMWA 3EARA 2O5VA 2XITA 4MKGA 5HCIA 3EPLA 1E9BA 1R0YA 2VQSA 2ZEJA 2Z43A 4QM6A 2BJVA 1N5LA 3GLFA 3IPXA 4LY6A 1ZVQA 2E87A 3V4RA 1VG9B 5E4FA 1W2GA 2DFKB 4NCKA 2YWEA 5DN6D 3E2IA 3H4MA 2FZLA 4L5BA 2YOFA 2RGNA 4A8JC 4L9SA 1CJMA 5TDHA 3PENA 1YR6A 3TAUA 3AVXA 2OO7A 3X1YA 1BYUA 1IJFA 2B8TA 3VU9B 3ZDQA 1ODFA 3OESA 1P2UA 2HV8A 1HH4A 1G5PA 2H8KA 2DFLA 3FHCB 4AC9A 4DLRA 1C4OA 2MSEB 2CJWB 1GKIA 5G41A 4YQFA 4I1OA 2ZANA 1UF9A 1VYTA 2ZETA 2ERYA 1PLLA 3OEHD 1MRNA 2QN6A 1TAGA 1N0VC 1DAHA 2ZYVX 2JJ8A 2WJJA 2YOGA 3AKYA 4RZXA 1EWRA 1K5DA 3HWSA 3RNLA 1CU1A 1XTRA 4IOMA 4M1MA 1SKYE 5KSZA 2GVDC 4OK6A 5B2ZA 1N5IA 2G83A 2Q6TA 3BFKA 4L4UA 4BUJA 1LFDB 1N6PA 2X2EA 1ZJ6A 1XNJA 5KU1A 2ZI9A 5DI9A 4Q5IA 4YMVA 3IQWA 1G6HA 4JIMA 2XB4A 2BEKA 2V54A 1UKEA 4DWJA 2Q9AA 5FTLA 4CDGA 4GSYA 4DT1B 1OXSC 5KDDA 4DLXA 1NN0A 1QBKC 3IPYA 2ECKA 1MRSA 2NIPA 3GJ4A 1AN0A 1HTWA 2UVQA 1KNXA 4PHHA 4DZZA 1NSTA 2XJ4A 4A1FA 1UJ2A 3P26A 3IIMA 4LOAA 5L8VA 4NYJR 4WW0A 3CB4A 3FMOB 2QP4A 2W00A 821PA 5F9HA 1E3MA 1F2UA 2A9KA 3OEEA 1COWD 1CKEA 3K0CA 1JNYA 2DWQA 4NP6A 1SKYB 3AP1A 4LX0A 1OHHD 2AL7A 4KJZA 4IVQA 2HEIA 1XTQA 5JJLA 4JYBA 1Q22A 1EFUA 1WMSA 3VX4A 2IS4A 3PR1A 1PV4A 4XWOA 1QHXA 4G5OA 2XJ9A 2GHIA 2ZI5A 3CNLA 1VPLA 1XFAA 1XJCA 4UQOA 4CW7A 4S35A 4CEHB 1OIXA 1TUEA 5FTMA 5JBQA 2REXB 3SYKA 3WYAA 4Q9IA 3TIFA 3C5HA 2VF7A 4FXPA 3F3YA 2CDNA 2J59A 3A1VA 1ZRHA 4NBSA 1T3HA 1QHGA 2BV3A 2WKRA 4RFVA 1SVWA 4V02A 2OSBA 5D3MA 5AUOB 4NCHA 4QNRA 1E0SA 3NC0C 1JPNA 1XPRA 5B30A 4Z1MD 3FFBA 2VP5A 3SJZA 1IN8A 3TAHA 1XTKA 2FFHA 2N46A 4A9AA 3RS5A 1YU9A 1E0AA 2J0QA 4I81A 2W58A 3CONA 1W36C 2ZE5A 3C15C 1U8AA 1EXMA 3BB4A 3Q9LA 5EQTA 5J4KA 1U98A 2VPPA 3A37A 3UG7A 4FINA 4H9GA 1ANKA 1U8YA 5FTJA 4WXPA 1AQUA 3KDSE 5DHAA 1A82A 2RH5A 3RVBA 2J45A 2J5XA 2GZHA 5TXGA 3VU9A 1YRBA 4BZXA 5EJEA 2IEZA 5FPSA 5F3WB 3QKSA 4WBSA 3VKHA 1KI1A 1Q20A 2EFGA 5FTKA 1EX7A 1R0XA 1FOEB 1GOTA 4O0MA 1Z0JA 3W5IA 1V5WA 4XVRA 2NZ8A 3B82A 2W2XA 1HQCA 4UNNA 5FUYA 1P61B 3RHFA 1QHHB 4UNPA 2G77B 1IXRC 2EWVA 1Z0AA 3DM5A 1W5SA 4QBIA 3I92A 3SEAA 1TL7C 2EW1A 2VHQA 1CTQA 5IK2D 4HLDA 2QQ0A 4ZIRB 4KVGA 4DVGA 3AF2A 1JJ7A 1X8JA 1XZPA 4NCNA 4TMTA 4ZCIA 4JZKA 4D4LA 2XGJA 2O8DB 2JASA 5FOTA 4GP7A 1AS0A 1W4BA 4URZR 1PLKA 3AF3A 4O2RA 3FMIA 4MKFA 1E1QD 1JAHA 1UADA 2GCOA 3DHWC 1P7CA 2EVWX 4YONB 2OLKA 3W34A 1XJ0A 4N0DA 1J7KA 3IIJA 3BFXA 3WNCA 5BYJA 1U8ZA 4BECA 1KK1A 3UWKA 4X8OA 4XSHA 1PVOA 3KQHA 5C1BA 4UXIA 5JLJA 3CM0A 5KDOA 1E6CA 2J41A 2Z4RA 3I8XA 3ZQ6A 4TTRA 4AKIA 4BFWA 3X1ZA 1US8B 4HEJA 1T0HB 1RJ9B 1RW4A 3GEHA 3MWLA 2N1BA 4LSGA 5KO2A 4TT3D 1IY0A 2JEOA 4PPFA 1KNQA 3ZH9B 3Q5DA 2GF0A 4QJ3A 3ADCA 5JS7A 1IXSB 3PCRB 1F3OA 4TYNA 1YHNA 4RZ2A 1JBKA 3UG6A 2OCAA 4PC2A 2V4ZA 2JDIA 1E2NA 4GP6A 1OFUX 3REGA 3BK7A 4M9ZA 1T4GA 3HR7A 4X8LA 1VCOA 1X86B 4P4TA 4OHYA 2FSHA 1XMIA 1G8FA 1NY5A 1SVKA 4HB4A 4A2WA 1XEXB 2BCJQ 3BAFA 3K0EA 4IKEA 3AVVA 2EFCB 5AJWA 3K9LA 4MDFA 4Q02A 2H7VA 1VIAA 3GJ7A 3KTAB 3DZ8A 2WZQA 2X8AA 3SFZA 4UXHA 1JEDA 2FH5B 2ZSAA 5J47A 1Z22A 3ONWA 4M22A 3FMFA 3QG5A 5FI0B 4Q03A 1E9EA 2IYTA 1I4TD 1M34E 3SQWA 3CH4B 5FOXA 1ETUA 3LQQA 1Z0KA 3O8RA 3AVPA 3DO6A 4CEIB 1Z08A 3EPJA 3ZD6A 2R2AA 1Z2AA 3W3AA 2Q9CA 2G1KA 3AVOA 5JJIA 1E2DA 5P21A 3A4MA 3LWNA 4QBFA 1CF4A 5EP2A 3PXGA 3BWDD 3PUXA 4MYTA 3M6AA 2NPIA 3NXSA 1G17A 1AGRA 3U7EB 3GMTA 1KMHB 2XAUA 2YC2C 4RZUA 5KNBA 4E09A 3C41J 3EPHA 1FX0B 2QGNA 1Q1EA 4QGGA 3MRSA 2PL3A 1X1RA 3CR8A 3F8TA 4TMVA 2B21A 2WSSD 3LXXA 4P4SB 3UMFA 2PMKA 1IOZA 3AH8A 4C2UA 4AIIA 3AQ4A 3SDZA 4DHEA 1KTVA 2PCLA 3E1SA 4JSTA 4B75A 4TL8A 2NO9A 2WWIA 1G5TA 3LW7A 2R6FA 2W0SA 3T06B 2P5SA 5EE0A 2VEDA 5CYOA 2QTHA 1E0JA 1XMVA 4C3ZA 2JAQA 1ESNA 3QF7A 3Q85A 1DAGA 1W36D 5TV2A 2O8DA 1OXTA 2QTFA 1CR0A 1XBTA 2WAXA 4LYAA 2ZQ5A 1NG9A 1YZQA 5GVSA 2FPKA 4QXAA 3ND8A 4F92B 3KQNA 4TMXA 4WXRA 3SS8A 2DY1A 2UZIR 4HDQB 2WKPA 2IWHA 4MYHA 2ZPTX 2F3TA 5CLQA 2HT6A 1T3SA 2V6JA 3N70A 1DADA 4Q4AB 4K8OA 3BB1A 3PITA 5FBLB 3TUIC 3B9QA 1AKEA 2JLQA 2WM9B 3SU8A 1W0JD 3ADDA 4URXR 1U94A 3KXIA 3GEIA 4LC1A 2ZI6A 3B8HA 1Q3HA 3KX2A 2FPMA 1MKYA 4A2PA 3CNOA 4TMZA 4DSOA 4F7WA 3KXLA 4KYIB 3SHWA 3LRPA 3QBVA 2Q9BA 2IYSA 1KI3A 3KXKA 1E1RD 2W83A 3TW4A 1YZNA 4JLDA 4W5HA 3QVVA 5CIQA 4DLVA 3MGCA 4URWR 1NL3A 3LVQE 4IDHA 3FWYA 4BFSA 1H8EA 4TLCA 3OAAD 1QDEA 2D2EA 1E2KA 2FV8A 2R44A 2X77A 2GJ9A 4B35A 1JR3E 2GETA 3T5GA 3FKSA 1GNQA 1MO5A 1XEXA 1CS4C 3IQXA 3M4YA 5JWHA 2FU5C 1JPJA 1K6MA 1II8A 1RIFA 2ONKA 1TX4B 3AB3A 4OI2A 4ZI3A 1VG8A 5JI2E 1QHIA 3F0TA 5KNCA 2O8EB 1W4RA 5KNDA 4CF7A 1M6NA 4D0GA 1N0UA 3KJGA 5FBQB 4BFTA 3CBQA 2OAP1 2G6BA 3Q3JB 3A1SA 4LGMA 2W6JD 3DOEA 1E96A 1NSFA 2JJ1A 1W0KD 2OFOA 5C4GB 4BLSA 2UZ3A 3LBNA 1G64A 3RRYA 1MOZA 3IEUA 2BHRA 1EFTA 4D81A 2ZYWX 2ZRCA 1G3MA 1V43A 5JHGB 1Q21A 2WV9A 5CJ2A 4O25A 4PZLA 1E2FA 1Q1ZA 1EX6A 2CMKA 1F60A 3DEFA 4JT2A 2AKYA 3AKEA 4OHZA 3TJZA 4D4KA 5J4YA 4OHVA 5BWMA 5FPTA 5EP1A 4ITRC 4TQUS 3DOFA 2OV2A 4EUNA 2WPDA 4KBGA 4P0TA 3QPUA 4Q9KA 4TYWA 1NVVR 1TF5A 4CT5A 5DHFA 4B6FA 2ZI3A 1ZNYA 1DPFA 2DWOA 5FL7D 4JLPA 2ANBA 4UJ5A 2IYUA 5BYKA 4F91B 2IYWA 4KO8A 1N0WA 2D4HA 1NNEA 4QHTA 2KSQA 1KDRA 1FX0A 5DYIA 1PUJA 2AWNA 2JLVA 4PQYA 4MUAA 4PHGA 1WQ1R 1II0A 2QG6A 1Z3IX 3VR5A 2ZXUA 1R0WA 4PC7A 4IRUB 3AV0B 3V9PA 4PSAA 2CE2X 1NIJA 2EFEB 2WJHA 3B13B 5G40A 2B6HA 2A3RA 1GKYA 1ZIPA 1G7CA 2C78A 4IHQA 1TQ4A 2I1QA 3TR5A 5FFMA 3GD7A 1XP8A 1M7GA 3VR2A 5E3HA 1XXHE 2ORVA 1GP2A 4V0LA 3RYTC 2I3BA 1UBCA 1JXMA 4D80A 1CR1A 2OILA 4EDHA 1G4AE 5FBVB 2F6RA 3CPHA 2A78A 4KU4A 4HAWA 4NU0A 2F55A 5FOVA 2GKSA 3NG1A 3QKRA 4Q4AA 3E5HA 4BFZA 1CJTC 4JLOA 1P75A 4JSYA 2NMVA 1KOFA 1GKUB 1O87A 2CNWA 2ZJ2A 4GOJA 4LCBA 2ZS8A 4OBEA 4CEJB 1JQJC 3QF4B 4I4LA 4YXWA 5B57C 6Q21A 2H5EA 2CLDX 4WOPA 2NOAA 4HAXA 3ZIAD 5JEEA 4GBMA 2J0UA 1RFLA 4B3BA 3THOA 3GLHA 1P5ZB 5FI1B 5ANRB 1VTKA 1TU3A 4NH0A 4XJXA 5BW8A 1R10A 4RD6A 4C0KA 2O0JA 1QRAA 5K8IA 4E22A 4JVSB 1XF9A 3ZVMA 1AQYA 4NKRA 3GFPA 1NBME 2JIZA 4ASUA 4KYUA 2NO1A 3KQUA 1GL7A 5FOSA 1G16A 3MD0A 1XCMA 1Z63A 1KO1A 421PA 4BZQA 3NBZC 2O8EA 5JJKA 4LJAA 1HUQA 2Q3HA 3TE6A 2A5YB 5GJVC 2H18A 4AG5A 3THXA 2F9LA 1Z6TA 3DPUA 2PBRA 3K0FB 1VYUA 3AVYA 1KI9A 3SBEA 1L7VC 4RD0A 2PT5A 5H70A 1CRPA 4HAVA 4URYR 2ZM5A 2Z83A 4XTRA 1VHLA 3I8SA 2D7CA 1AIPA 1NN3A 2ZI4A 2QT0A 3KJHA 4NYJQ 1H8HA 5EXXA 2BCGY 5CYPA 5J4VA 2VLIA 2W6IA 3W6PA 2J1LA 1E2GA 1DAMA 1NMYA 2PCJA 2ZJOA 4V0MA 3AM1A 1GZSA 4KFTA 1J90A 4HLQB 3G82C 3KUCA 4JBWA 2HYDA 3BD9A 2ZE7A 4GMXA 5JRJA 2CLCX 1X8KA 2FNAA 2FDCA 2GRJA 4PO8A 2OESA 4C7OB 4URVR 1E2LA 4AKGA 5JCPA 3QPVA 3P32A 3TR0A 3WYFA 5A4JA 3KB1A 1TMKA 4Q01A 1XD2B 2WWXA 3KKNA 2XZLA 1N5JA 2ZJ8A 2PEYA 3KJIA 3T12A 1P9RA 2FEMA 1KZGB 4P4UA 4URUR 5AUPB 1CBUA 3BH0A 3T1OA 2ZSFA 1E9CA 2IBMA 3DMDA 1GRRA 1ZM2A 2VSFA 3QSYA 1DAIA 2YWFA 2GAAA 4PZZA 2Z0MA 5E7JA 4A2QA 1BO6A 1KO4A 3SYNA 2JLXA 5JZVA 3IUYA 3TSZA 3OEED 3EZFA 3ZQJA 3KQKA 5IT5A 3ASYA 4DSTA 4FMCB 3KJEA 4YMTA 1W44A 1EG7A 2QAGC 2P5TB 5CDFA 1G21E 5LPNA 5KUTA 1Z47A 4TYQA 2YZ2A 1M7BA 4TL7A 3K9HA 4P33A 3D31A 3B78A 2NTYC 4LYFA 1AS2A 1ZM7A 1RYHA 4DB2A 4JLMA 2QRNA 2SHKA 2BBWA 1ZYUA 1QHNA 4IDNA 5CJPA 4LBVA 3U6KA 4Q4HA 1ZD8A 4CEJA 3NEJA 3QF4A 4U00A 4DBLC 3QIAA 3LW8A 1NJFA 1C1YA 3NDBB 5FL3A 4G5RA 5H8WA 1GNRA 3BBPA 4EJSB 1X8LA 1HT1E 1YKSA 3NKVA 3EIQA 2KBFA 1OIVA 3TBKA 1RYFA 4F38A 3CH5A 4WZAE 4Q00A 3GEEA 3G0HA 5EP4A 1XXHA 3B1WA 2AFHE 3SFVA 3PEVA 3PG5A 3MWJA 1SXJE 2AD1A 2J46A 3K0AB 1XTSA 2BIFA 1P62B 1ZD9A 4PPQA 4HATA 3QKTA 2XZPA 3QOFA 4X8MA 3B2EA 4RFSB 2ZRKA 1PUIA 1EGAA 2VP0A 1KI2A 2QRZA 1G7SA 2BKEA 1G6OA 4AKEA 2P2LA 3GJ5A 3CKLA 2A5FA 3K0FA 1WP9A 4D0NA 3ZD7A 1G18A 1OB5A 3K09A 4GZLA 3AF0A 3K70B 5DH9A 2QA5A 2YOHA 1MO3A 2GAOA 1AGPA 1HT2E 2ZR7A 2IS1A 2D06A 4R2IA 3U3RA 2OXCA 3LBHA 3KUDA 1CJUC 4PPGA 4C9BA 4Y0VA 1VECA 3CF6R 1AS3A 2A2ZA 3LO5A 3ZVLA 2FOLA 1SXJB 1WA5A 3TKLA 3KFVA 2ZUDA 1LF5A 1SVSA 2IYLD 4XIGS 1UKVY 4M9XA 2C5LA 2GZDA 2WOJA 4TYPA 3QVUA 2ZRMA 4MGIR 3VR3A 2IYZA 1Q44A 1K8RA 2OHFA 3W6OA 4C4PA 4C7OA 5JRZA 5J4HA 3I32A 2IUUA 4MITA 4HZUB 4I1UA 5HZHA 3DKVA 1CIPA 1XD2A 2O0KA 3B9PA 1W48A 4Q1EA 4X8HA 1LY1A 2VIIA 1DAEA 1NRJB 2J0VA 5CM9C 5A0FA 4R9UC 3CWZA 3KKOA 8OHMA 4PO1A 3SJAA 4EQ6B 2EU8A 1HEIA 1ZP6A 1X3SA 3AGQA 3L0IB 3Q5EA 1NLFA 2BOVA 4JKIA 3SN6A 1F2TA 1BH2A 4YDHB 2Z5FA 1HE8B 1AA9A 1VG0B 3GLGE 3THYB 4XWKA 1E4VA 1JAIA 1SULA 3M0EA 1J8YF 1Z28A 2P67A 2PMDA 2PJRA 2C9OA 4XVUA 2BMEA 2XXAA 2EWWA 1Z0IA 3KFXA 3LD9A 2JLWA 1E9AA 1UBEA 1NVWQ 4DLWA 4UJ3A 1W47A 4JS0A 1ZUNB 3MWKA 3O47A 4A0FA 1S3SA 2JDID 4AK9A 1DOAA 3VNUA 4B2PA 4LPKA 3L0SA 2R65A 4LK2A 3MFYA 1XPOA 4M0LA 2CHQA 4ZDKA 1A1VA 4NCJA 1XD8A 3B1VA 2V55B 4M2LA 4OHXA 3U7GA 1OKKA 3RSLA 5J40A 4PQFA 1L4UA 3GLGB 4EJSA 1ZC4A 3W8NA 1RRCA 2IHBA 3DDCA 3W5JA 3BRWD 4DCSA 2O8BB 2ZR9A 4CZ2A 2ZR0A 2GK6A 4GOXA 4J0QA 3P4XA 3QPWA 4RKEA 1M2OB 3WMGA 4ACBA 5FBRB 5GJBA 3C16C 4MRNA 1IHUA 2JLZA 1U81A 2CL6X 3B5JA 1D9XA 2OEPA 2YINC 3R8FA 2BMJA 1L8QA 1OXXK 4GT1A 3DZDA 1FUUA 1E9RA 721PA 4C0LA 2WVJA 2V7QA 2D7DA 2BDTA 3NH6A 4ARZB 2AD5A 4C0JA 4QOSA 2XNDA 2P0EA 1OYWA 1Z0FA 2EYQA 3ZZ0A 2IA5A 3HJNA 4Q48A 2GXAA 4WAUA 4IXMA 3B6EA 2ZREA 3CR7A 3QXCA 4KHZA 4DDTA 4HDOB 2QM8A 2IYRA 1KDTA 5FUVA 3LH5A 4RY2A 1QHYA 3AUYA 4PSVA 5GADl 4Y0AA 3RRNA 3SI7A 4ZKEA 5TY0A 2Q3FA 4LHXA 4I99A 3TK1A 2ZRNA 5EUQB 4BGDA 1T6NA 5HE9A 2QU8A 2CVHA 3SNHA 4NMMA 1U0JA 4KFSA 3BORA 4NONA 3ZJYA 2CJWA 2J7PA 3BH6A 1UKZA 4KODA 3A58B 5HCNA 1OT3A 2A5DA 2GBLA 3SOPA 1D8TA 1W7AA 1TQDA 1R5OA 5KPJA 1E9DA 1ZNWA 1KK0A 2GJ8A 2KJQA 1E2EA 3I72A 3ZS8A 3FB4A 4QRHA 4RVCA 2PZEA 3EAQA 2R9VA 1DG3A 4M53A 3R7WB 3EX7C 4MGKR 2C03A 2DFNA 4ZO4A 3WRXC 4UNRA 3IILA 4GL2A 2ASEA 1A7JA 4OI1A 1J8MF 4NZYA 1ZUHA 2ZTSA 1U2RA 2RGBA 3I61A 4M1YA 4B2LA 3VMFA 1DE0A 4M8NE 2AXNA 1WBBA 2NPFA 4ZDWA 4Q19A 3ECCA 1Z8FA 2DYKA 5E95A 2EQBA 4MKHA 4EFNA 2CE7A 4Q1FA 4H1VA 2JLSA 1E2HA 2WHXA 3T1QA 4DT1A 5IHPA 2AX4A 4LDJA 5FPYA 2V3CC 2O52A 4XOIA 3AP2A 1ZCBA 1XB2A 1ZC3A 3R8CA 2BC9A 4C0HA 1TF2A 4CT4B 5LDDC 3TLXA 4B3CA 4Q66C 3FYHA 4A36A 2O0HA 5EZ5A 3K53A 4GMDA 1GM5A 1H8ED 1VMAA 5D3QA 1NVVQ 2ZYTX 4PXAA 4B3XA 5KSOA 1U90A 1UDXA 2ZE8A 4JL8A 2AFIE 2OE2A 4CVNA 4O3MA 4CGZA 1KAGA 1CLUA 1T8TA 1YZLA 2O8FB 2GJAA 3FKSD 3P27A 2OBNA 2AWOA 2RGGA 4KAXA 3N5CA 3AGPA 3VNVA 1OJLA 3GJ3A 4G3XA 1N25A 2QMHA 3PEUA 2VP9A 2WJGA 2ZS9A 4LV5B 4NYMR 2JLYA 2VRWA 3E70C 4UKDA 4JBXA 4MGZR 4XVQA 4A8JB 1CULC 2IK8A 1W5TA 2JJ1D 3RWOA 2QEQA 1XU4A 1W4AA 4MYCA 1JEEA 2ZAOA 2ZJZA 3EC2A 3QEOA 4KFRA 4PZYA 4WIAA 1E79A 5FOWA 4CEHA 3G5UA 5LBIA 2O8BA 2R6CA 5G3ZA 1XX6A 1G19A 3QKUA 5FUXA 1KHTA 1WBDA 3EPKA 1SQ5A 1Z29A 3VTKA 1AKYA 2HXSA 2XOKA 3T1TA 4Q4JB 3OF5A 4BRUA 2IYVA 1YVDA 1E9FA 2DB3A 4OQNA 4TYYA 5FPKA 2WPDD 1E0KA 3QUSA 1E2PA 2IF0A 2VO1A 1D2MA 1S2MA 3H0KA 1EFCA 3W8RA 3A6PC 2GVZC 2Q3MA 4IDOA 5JSZB 2IS2A 1E94E 4Q7JB 4MRVA 4IOJA 4KLZA 4EIWA 2JA1A 3PUZA 2DFTA 5SZKB 1Q1BA 1RRPA 1VKJA 1W4CA 1ONBA 2J3EA 3C8UA 4QBHA 4QL3A 1ZMXA 4TN1A 1TQ6A 4DIEA 4JL5A 2PX0A 1KO7A 3KB2A 4NHOA 4TQ9A 5L3SB 3TRFA 4B3DA 1KY3A 1A4RA 4G01B 2ZIAA 1KYIA 5BQ5A 1SVMA 4HYYA 1L2TA 1ZM4A 3W90A 2MMCA 2RMKA 4PTLA 3RRMA 3FHTA 2HXYA 3MMPA 2FF7A 2G1JA 5J4LA 4OI0A 2WIAA 1NLZA 1R2QA 1S96A 3U3OA 1IN7A 4IFEA 1XDBA 3MWYW 2IUTA 1OFIA 5CK4A 3FGNA 1T5IA 4HAUA 2GEDA 3U7HB 1KDOA 2C8VA 1QHHA 1YRAA 3M1IA 5DNYB 2WSMA 2D3WA 1KO5A 1EESA 4D26A 1R8SA 3IBYA 2D62A 4LI0A 2VBCA 4XD7A 3R7WA 4ZIRA 4PC3A 4JBYA 3OFNA 4UXJA 121PA 1NLYA 1KZ7B 3UMRA 3HU1A 4B71A 4TZ0A 2RGNC 1KSFX 3K09C 3OIYA 2CNWD 3PEYA 3UK6A 5AJZA 4YXWD 621PA 1OH8A 1KK3A 4JLKA 1W49A 4JMPA 2ZUBA 1FTNA 3RC8A 1RPZA 2CHGA 4DLYA 2IHYA 1FL9A 1IN4A 3NBXX 5JWRA 2WBLC 2CEAA 1N2CE 2BVNA 2E1RA 2RGDA 2RKOA 3OIUA 3X1XA 1AM4D 1SKQA 1HE1C 2HLDA 4HDCA 4BRWA 1G3UA 4TL9A 4DEYA 5UKDA 2X1VA 3BE4A 3DM9B 1US8A 4DRZA 2HF9A 1RJ9A 2FZ4A 3PEWA 4HAZA 4H1UA 5AK0A 5AR1A 2FFBA 1NVUQ 1SVIA 2JIZD 4ASUD 3GLIE 2ZRBA 4TQAA 2J87A 2ANCA 3TH5A 3QXSA 4LJ5A 4FI3C 1DAKA 3A8TA 2QP9X 1W36B 4OK5A 3RDPA 3OIVA 1YJ5A 3TUJC 1GILA 2C95A 3LLMA 2OBLA 2L0XA 3VFDA 3IKJA 1T8UA 2J0SA 4RKFA 4ERNA 1KMQA 1QF9A 2ODWA 1DVRA 4HB0A 4F4IA 4LBWA 2WWGA 4YMSA 1AZSC 1Z6YA 2QE7A 4TMKA 4OHWA 1U0HC 1I4LD 1Z6XA 5F98A 1R4AA 3KTAA 3U2QA 1NJGA 1H8HD 4Q4JA 2JGNA 3WY9A 2W6ID 3AKCA 2O8CB 1A2KC 1ZNZA 3EZ9A 1N6OA 3ZGXA 2QMUA 5SZIA 1P2VA 2PJZA 5BN3A 4JJKA 2ZJBA 1GL9B 2IXFA 1GVNB 3EWSA 5KSYA 3QNUA 4WZBE 4ACAA 3GLIB 2I4IA 4DUGA 4BPBA 3PVSA 1MH1A 3CWQA 1LW7A 4RSGA 2FX3A 5CB8A 2WTUA 4CEIA 4FMDB 4RD3A 3K0CC 1IJEA 4Q7LA 3IO5A 4EPVA 4HAYA 1E2JA 1T9HA 1OFHA 4W9MC 2EFHB 4V0OA 3DVLA 2HT1A 2KBEA 3Q72A 1O3YA 3GJ0A 1R7RA 4G1UC 1FZQA 1NF3A 4W5WA 3WRYC 5FTNA 4BLQA 3LVRE 4W7SA 5A5GA 4LWZA 3WHKA 1C9KA 5L3QB 2OT3B 2ZSEA 4POAA 4PPNA 3P1JA 1KMHA 1R5NA 1QVAA 4MKIA 2XTZA 3FPAA 2VHCA 5JEDA 3AF1A 1KI4A 1P60A 3OE7A 4HUQB 2ORIA 3HYTA 1W46A 1P3JA 4JLVA 4P3YA 3NBFA 1FFHA 1KDPA 1P9WA 4S2EA 3ICQB 3KKPA 4P4SA 1KIMA 3QEJA 4Q47A 1BKDR 1DG1G 5DE3A 5K8UA 3L2OB 1SVLA 2XB2A 1NP6A 4BFVA 4Q1BA 5IDVA 4RJLA 1KKLA 2BKUA 2ZAMA 4B47A 4FMCF 2ZI7A 4B3GA 3W9YA 1OIWA 2G3YA 2REBA 2WWFA 3AUXA 3EZ2A 1EK0A 4LJ6A 3RWMB 3SE0A 5EZ6B 2Q0HA 5CLLA 3LXRA 4L16A 2C99A 3CRQA 4QGFA 1LTQA 4OJQA 2F7SA 3AEZA 5TMPA 1OXUA 4FD2A 3CRW1 4YDSA 4BASA 1Q57A 1XEWX 4DDWA 3CLVA 3P20A 5JMTA 4I1SA 1TF7A 2YNMA 2IT1A 4OQXA 4MYUA 3ASZA 4F4JA 1OSNA 521PA 1UPTA 4B74A 1DAFA 2Z6VA 2ONJA 3D3QA 2YJTD 4Q9LA 4V0NA 1KSGA 2VH5R 2CL7X 2OFWA 2W2VA 1VIYA 4PHFA 1FQKA 1JECA 4P32A 4IEIA 2MMGA 3WBJA 2GTPA 4TLDA 4TTQA 3MCAA 2HYIC 1NG1A 2GCPA 4QKQA 1D2NA 1U9IA 2VHTA 2WJIA 4K46A 5DISB 5JCZA 2F1JA 2FSGA 2RAPA 5E7IA 2CLSA 2C96A 4GOKA 2C77A 4V03A 3MLEA 3GLFE 3T1VA 5L3VA 5EXSA 1XCPA 3Q7QA 1BMFA 3JZAA 1P4SA 1SHZA 2BM0A 2A30A 4Q9JA 1RE0A 4EPYA 3EZ7A 4DCTA 2P65A 2P6UA 2V8OA 1P2TA 2ZRPA 3J81k 4MGYR 3BERA 3H84A 1G5RA 3MAAC 5ELXA 1MABB 3AP3A 4BFYA 1IXZA 2C98A 3CO5A 1G9XA 1OB2A 3QXXA 2QPOA 2OCPA 1JI0A 3RRZA 5JFGA 3U61B 5H1YA 4Q1CA 1JR6A 3MJRA 1AJEA 4YMUA 5C4MA 4XWAA 4NCIA 2FA9A 2ZRFA 4D4JA 4MA4A 3FKQA 2NZJA 2YKGA 4TLAA 1VCNA 2PT7A 1T3LA 2NO7A 2IWRA 3R20A 2YWHA 4ZI2A 1AK2A 3SZRA 5EXPA 3RS0A 4R71A 4LHWA 1YE8A 2NGRA 1Z6GA 3BIFA 1S0UA 2RGEA 2CHVA 3GLFB 5GVRA 2FGJA 3AF4A 5TB5A 3B1XA 2LKCA 3CW2A 4FCVA 4GDFA 2FFAA 4OQFA 1FNNA 4E03A 1JR3A 1F5NA 1GSIA 2A7QA 3ADKA 3FMPB 4E07A 4PC6A 4JLNA 3PV0A 1G291 5J5CA 2ATXA 1LVGA 3C5CA 3L8YA 3U60B 3KKMA 4MDEA 1X1SA 1KSJA 3OZXA 4Z54A 4O2LA 5TVKA 1IY1A 4LJ7A 2WAYA 2PX3A 2BWJA 3RS4A 3L82B 2XEXA 4AYXA 3QJYA 2LWIA 4OQMA 2FSFA 2QQEA 2QBYB 1Z06A 1VYVA 4HB2A 3O8DA 3U3MA 4D2IA 3K8YA 2F1RA 3WP0A 4U7DA 2REOA 5TARA 1VDZA 2GJKA 3BH7A 1ZINA 1NMXA 4JVMA 4AKHA 1KKMA 4EAQA 1OKKD 3JZMA 4PAOA 2FPLA 4HLCA 4PHTA 1CXZA 4A0RA 3IO3A 1EFHA 3VHXA 2HDNB 2VP2A 1HA3A 3NC1C 4LHVA 2GF9A 4JLAA 2ZRIA 1BOFA 4V0KA 4KVAA 5G53C 4DDUA 1VCIA 3R9XA 3R9WA 1DBSA 4B34A 1DELA 1D5CA 1UAAA 2AKAB 2PLFA 1TPZA 1FPMA 1A2BA 1CR4A 1YR9A 3EA5A 1QHSA 1GG2A 5AWFC 4D82A 3EWAA 2NO6A 3RS3A 1DO2A 1TNDA 2AN9A 3T15A 4LC0A 3D7MA 4MQBA 1UM8A 5CITA 1N6IA 4EFLA 4M1OA 2VHUA 3QXJA 4A4DA 3U6BA 2PZGA 3O8BA 5CK5A 2WIBA 3O8CA 1F2UB 1M8PA 3PUYA 2V7QD 1XMSA 3FOZA 1KK2A 2HF8A 4ON9A 4ILEA 3LAWA 2QPAA 3UXMA 2DCUA 2VSOA 2XNDD 2F9MA 1GRQA 4GI7A 3TVDA 4DC9A 1NI3A 2OAQ1 4C2TA 5JHHB 2GEVA 4IEEA 1EFRA 1N6NA 3T5DA 5HPYB 4C0AC 3ZLJA 3RSOA 4D4MA 4NYIR 5BXQC 4AG6A 1OLOA 1XRJA 4BLRA 4IW3B 3VKWA 2B92A 3CNNA 5FR2A 1D2EA 3SQXA 3ZZTA 1KAOA 1P2SA 2DHRA 3X1DA 2D2FA 2IF2A 4LJ4A 2IYXA 5SZHB 3VR6A 2CK3A 5C18A 3I62A 3TMKA 4PAMA 5D3MB 3WYGA 4DEXA 1OYYA 3RANA 2J7PD 5HKKA 1RVDA 3R9IA 2ODEA 3FDIA 1OH6A 2VA8A 5HE8A 2HCJB 4FCTA 1J2JA 4TSFA 3C14C 1XZQA 3TVTA 4DLZA 4NPHA 1IAQA 3A4NA 1M7HA 3KKQA 4KSBA 2YHSA 3EIHA 2VHJA 4TLEA 4D0LB 5KOYA 1CRQA 4B3FX 1NBMA 3BGWA 2G9NA 3TQCA 2D74A 1E2IA 1E69A 1G8YA 4NYMQ 1BS1A 3HDTA 1OFTA 5FUWA 2ZU6A 4EPXA 2IS6A 3UIEA 1HV8A 2I1VB 4PX9A 4ZKDA 1KI7A 1SGWA 1UBGA 1KJZA 1N3BA 2KI5A 1OF1A 3PUVA 2BM1A 3RAPR 1S8FA 1YZGA 1ZNXA 2BBOA 2OBMA 4GFDA 1RKBA 1G3IA 3QKSB 2VL7A 2V9PA 1ZCAA 2J7KA 3RABA 4QGHA 2VTKA 3QQ5A 3I3SR 2BMDA 3TSOA 2BBSA 4G5GA 4YLGA 2XTMA 3MUFA 1TTTA 2JJ2A 5FBWB 3SYLA 2P6RA 2OG2A 2QBYA 3U4QB 2H16A 5AJXA 1GAJA 2TMKA 2ZSBA 4RCZA 4QC2A 3BFVA 3ICEA 1E2MA 2FJUA 3H86A 3JVUA 4DLSA 4FWTA 1SHKA 4EFMA 2WMNB 1KI6B 4KLNA 5EXTA 3X2SA 3SR0A 2G0TA 4Q4LA 3B1ZA 4JYCA 5DI3B 4L8GA 3ETLA 1XTJA 5G3YA 2BMFA 3B1YA 5AJYA 3U3JA 2WWYA 5DIFA 1IBRA 3EG5A 2CXXA 4KCGA 4DIDA 4RZ3A 1OE0A 3VR4A 3MJHA 2IL1A 3RS2A 2GCOB 1E79D 1GRNA 4NTZA 1Q0UA 4N0EA 4TL6A 2XSZA 2XOKD 1OW3B 4ESVA 2AK2A 1GIAA 5FOUA 3SJBA 4A6PA 1J99A 1ZW6A 3WNBA 1B23P 3N2EA 3Q7PA 4NL4H 1MO4A 3EASA 2IYYA 1XPUA 4JLBA 3IDQA 2GXSA 4Q1DA 3C4JA 2ZUCA 5DLQC 2QPTA 1CJKC 2QNRA 4IXNA 3K0AA 4BEJA 2AHOA 4PR0A 3CF0A 4Q7MB 2DR3A 3AKDA 4PAQA 5KDLA 3TGPA 4HLUA 4LBYA 2QI9C 1KO8A 2OCBA 1Z83A 4RFSA 1UFQA 4W5JA 1QVRA 5JS8A 2ZRAA 1N6KA 1I4DD 4JJZA 1B0UA 2GZAA 4PANA 5F9FA 4OK3A 4L9WA 3EC1A 4NE2A 2ZJ5A 4Q18A 4OQLA 4US1R 4K81B 2KE5A 1S3GA 5HZKA 3HU3A 1EWQA 4M21A 1WCV1 1FQJA 3K0SA 3VAAA 2DWPA 5F2EA 3A1UA 2C04A 3CX7A 4PO9A 3NTUA 1U9IC 4N1AA 4M1TA 2ZRGA 1RRFA 1SXJA 3NBYC 4XD7D 4QHSA 4IJMA 4KFUA 2IEYA 1N6HA 2GA8A 3CPEA 3OFND 3REFA 3T35A 3RLFA 4Q1AA 4DXAA 4RD4A 3JVVA 2QAGB 4Z8XA 2IYQA 4U02A 4HZUA 1FP6A 2GNOA 4DLTA 4QBGB 1T5LA 3LQRA 5JWOA 2BEJA 4BFUA 2JLUA 2VYFA 2GILA 4N3NA 1DARA 4LYJA 1ZU5A 5DN6A 4ZCMA 2ODBA 1UKYA 4EQ6A 1BYIA 1P6XA 2CCKA 2FSIA 2HLDD 1GUAA 2ZROA 221PA 4B43A 4JL6A 3THYA 1SVOA 3GFTA 2ZS7A 3U4QA 2B7CA 1YQTA 3C7KA 1TEVA 1W1WA 3I73A 2VP4A 3TQFA 4B73A 4I1VA 2OFXA 2ZU0C 1KI6A 4C0QC 4EPWA 4IOLA 4FCWA 4PSKA 5DI3A 4LUCA 4GNKA 2BBTA 2GDJA 3TW8B 1F6BA 4Q21A 5CM8B 4PC1A 3NH9A 4WA7A 1G3RA 2AK3A 2ORWA 2OUKA 3OEHA 4LZZA 4JVLA 1WF3A 1TU4A 3IHLA 2RHDA 1J70A 1G8PA 4IDPA 4Q9HA 1I2DA 3UKDA 4OJKA 4UNSA 3F5FA 1IY2A 5KPDA 2QE7D 2NG1A 4EPRA 1NVXQ 3OIWA 2LCFA 5LD2C 1JB1A 1R5BA 2P6NA 3BJIC 3CX6A 4AYTA 1GITA 2QAJA 1XD9A 4ZCLA 3H1TA 3GLGA 2N42A 1ZIOA 4XSGA 2KB0A 3ZZUA 2VF8A 1GDDA 5AUNB 1FMJA 4GRAA 3W6NA 2RGXA 2WJYA 1G8GA 2PH1A 3D6TB 2HJGA 3TNFA 3CPJB 4DUGD 2QUZA 1ZAKA 2OCYC 2H17A 4MRPA 1DO0A 3HP1A 4A0HA 4D6PA 1VG1A 2QZ4A 1DTSA 4F4CA 4FMDF 1T0JB 2GEUA 1XEWY 2IW3A 2WKQA 1GL6A 4OL0A 3L0PA 4B33A 4JLJA 3ZVRA 1Z2CA 1PJRA 2FWRA 2LKDA 3VR1A 3CIOA 1GFIA 4QG7A 3LNCA 2R8RA 3K9NA 5BN4A 1Q1QA 2X2FA 4ARZA 1COWA 3LFUA 2QGZA 1IQPA 2QSYA 2WWWA 3ZVNA 5CIWA 2A5JA 2RGAA 4GPTA 2RCNA 1OHHA 2FEOA 1II8B 3GJ6A 5H68A 4B32A 1S1CA 2CCJA 3OE7D 4DJTA 4R2HA 4L15A 4TMWA 3UANA 1CP2A 2MSCB 2ODNA 4LV6A 3P4YA 2OXRA 3NVAA 1IONA 2KWIA 2FN4A 4TLBA 3NHAA 4OI4A 4ZDIA 4CIDA 4GZMA 2CL0X 3K9GA 1TUIA 2NO0A 4IFBA 4ZPXA 1FTSA 4CRWB 3OHMA 4TTPA 4C0SA 1X6VA 1UDWA 3I4LA 2XTNA 2GWHA 4LJ9A 3S1AB 1K5GA 1LS6A 1E98A 3QXHA 1HYQA 4Z1MA 3GCGA 4LBZA 1M1YE 1N5KA 1U0LA 2AR7A 2QAGA 2R6AA 1U99A 4II7A 2QROA 4YC7A 2ZVPX 4M1SA 1UEIA 4OKSA 2WICA 3AVTA 2QTVB 3H2YA 4ABYA 5SZJA 1JQLB 4BE7B 4ZV4A 3FFAA 5EE5B 3UWOA 3B60A 1G8HA 5BN5A 1KSHA 4US2R 2VP6A 5EUMA 3BXZA 1LB1B 2HCBA 3ZYCA 1Q12A 1D6JA 1KJWA 1MV5A 3CRMA 1AZTA 1BIFA 2ZE6A 4LRWA 4D25A 2H57A 4BZPA 1IN6A 3WBKA 4HUTA 1HURA 1NKSA 3LY5A 1FUKA 4KXFB 1N6RA 3GLHE 2F43B 4B6EA 2DPXA 1G7RA 2IX3A 1OH7A 1WB9A 3LBIA 3QENA 1S9DA 4QFMA 1BMFD 1ZM9A 1Q3TA 3WMEA 3EA0A 1E32A 1E99A 2ZYUX 4KITB 2HUPA 1FP7A 2O8FA 3ADBA 3QE0A 4B44A 5IK2A 3KL4A 5HR5A 5JECA 3QKRB 2ZSDA 2FFQA 1TADA 4LYHA 4RCYA 1P73A 3W3ZB 2YYZA 1Z07A 4FW9A 3BOSA 3IEVA 1G20E 1GNPA 1R6BX 1S4QA 3L8ZA 3QG1A 4A8JA 1PLJA 1E1QA 5EP3A 2OM2A 3CX8A
chains in the Genus database with same CATH superfamily
1F8XA 1SELA 3I0ZA 5JAPA 4C87A 3I0MA 3A4LA 4DPMA 1JHYA 1QS0B 4FC6A 2ALJA 2WF7A 4F60A 4RPGA 4ZI7B 3PK0A 1GWNA 1XG5A 2J0UB 3PDCA 3B6MA 2FZEA 3L0DA 2R1VB 3H4TA 3OHSX 3SNKA 3IIKA 3TPFA 3SLRA 1YQ9A 2HD4A 2P68A 2QTTA 5DM70 2ICAA 1Q15A 4JXJA 2FW8A 4QPCA 3U4DA 4F1WA 5IWCA 3NMUF 1OXVA 2QM7A 1SOWA 3LPCA 1G0OA 3SEQA 1JFFB 1SBTA 2IXGA 3RK4A 2P79A 2RG7A 4TT3A 1E3JA 1IN5A 4LKRA 4LF7B 2G7ZA 3P2EA 5JSZA 2EEPA 2C2HA 1RLUA 3GPLA 3FOEC 3HRIA 1BE0A 1TMGE 2EYUA 2JC3A 4QUHA 2CVFA 3WYCA 2BHSA 4DSUA 5K0GA 4DMMA 1MG5A 2YC4C 4L72A 2OO3A 3VR0A 3GCDA 3EGWA 3LFHA 3H9UA 5ALEA 3SD7A 5FB3A 2FP4B 2JBAA 1N33B 3RT9A 1KY4A 3HYRA 2PA0A 4JXXA 2BD0A 1M67A 3G02A 1YCFA 3NHZA 3O9ZA 3QPCA 5GJWC 4DRYA 3EJ6A 3WKBA 4OF4A 4TUYA 4QGBA 1ISMA 3STTA 4GRDA 4RD1A 1WDTA 3U3KA 2NZYA 2FW6A 3DO5A 3HCOA 4R69A 2JK1A 2A86A 2NP7A 1NTRA 1N9GB 3K35A 2XNSA 3ETEA 2VNKA 4MPJA 3S1AA 2WV7A 1QZUA 3TLBA 1OBVA 3BXPA 4M7RA 5J2TA 4HRAA 1GNTA 1G3QA 2XRMA 3CZPA 3EF1A 3L0OA 2YJGA 3DMNA 3ME5A 2YFYA 3L7LA 4FGKA 2CWDA 5JY1A 3S27A 3KIPA 1ADCA 3HU2A 4F8YA 2X8BA 2HHHB 4MUBA 3K16A 4IIJF 5IRCD 3TSWA 1YL7A 2ZRHA 2EFJA 1LD3A 3VKGA 5AKJA 3E35A 4X1OA 4FWIB 5HDQA 3FSRA 1YZVA 3CRVA 4HN2A 4BXOA 1IG0A 1P1HA 1PZXA 1FBNA 2ZPUA 5K8LA 2ST1A 4LJRA 3U49A 3WLEA 2H2AA 4FIDA 5J23A 3FJYA 4OQPA 5LD2B 2CUKA 4HN4B 4RD2A 3EXAA 4CCYA 1XUOA 1T6BY 3C4QA 3MBIA 3OMXA 2OGZA 4YP6A 4XQ0A 1TAUA 3OZIA 2WMOB 3UYLA 1PZHA 2OB2A 1SBZA 3SXPA 3ELBA 2DSNA 3EWIA 3ESCA 2OV3A 2WOOA 3Q3IA 3SQLA 1DRKA 2QMEA 4E1AA 2J9RA 1K98A 1B2RA 2JGDB 4B6PA 5C2JB 2EQAA 3ZLTA 1ENYA 3WO0A 3FSGA 5ERYA 3F49S 1GAQA 2X1HA 3TTSA 5TJHA 4M9QA 5ITWA 4ZCSA 4H4DA 4XH9B 1MX3A 4J49A 3CF2A 3AESB 5L4SA 3PIRA 2IY8A 5AJVB 2XRFA 1GYPA 1AGXA 2AVDA 4ZN6A 4ZT2A 3NWBA 3LX8A 2X19A 3EULA 4MV0A 4B3IA 4CMHA 1X3LA 1TM4E 3A4IA 3DKPA 2BAGA 3ZW7A 3QXGA 3ROGA 1TJ3A 2SICE 3GP8A 1EFRD 4R5MA 1KZ6A 1KY2A 1O9GA 1SAYA 2A3NA 2OBYA 1I0ZA 1YIOA 2BJWA 3HI4A 3HKDB 3I23A 3P9NA 1HQKA 4FMBB 1KEZA 4DY4A 5HKAA 3D2LA 1FMCA 2R5WA 1DKLA 5JR3A 1XCGB 2SNIE 5TQ0B 1Y6QA 2G9ZA 4YRZA 1P5FA 1MRZA 3ESZA 1TK2A 2CBZA 3EQ2A 3HDQA 1SCBA 2OLJA 2OUIA 1OV6A 1Y1TA 3K5IA 4JELA 1E2BA 2JLRA 1TTPB 3WMXA 2TMDA 2G25A 1QS0A 1WRBA 2IEDA 5HA5A 1ZMBA 3SFTA 3UPUA 4AY2A 2P78A 3CO0S 5FO1A 2JL1A 1GUFA 4ZI7A 4DB4A 2WWVD 3UVEA 5F7XA 2QL7A 3EXEB 2PVCA 1E20A 4QGAA 5EJMA 2O8CA 1YNSA 5D5QA 1PHPA 1EMDA 3HVHA 3SBDA 2YJZA 1DWUA 2XQVA 3IJRA 1RAIA 4AW9A 5BMVA 1YULA 4IVRA 4EH1A 5B3LA 5AW2A 3C0KA 1G98A 4AJIA 4Q7EA 2WTXA 1NY6A 2HH9A 4EAAA 1A76A 5CFRA 2Y2UA 1PGNA 3DXFA 2JAHA 4L4YA 3IKVA 4XM2A 4YIKA 1FYWA 3SZOA 4YWJA 4CF6A 4H1TA 1XT6A 3DXZA 3T1YB 1LDYA 5LIRA 3FNGA 4HNGA 1EA7A 5BNIA 3G1TA 4GOLD 4AURA 3WLIA 4NU5A 2V1XA 4FDVA 5EN4A 3PXCX 3ROKA 4EKDA 4KR3A 3N76A 4KO2S 2XZTA 3CRRA 1UBMS 2PKYX 4MV6A 1NKTA 3E9YA 4RMNA 4CMBA 1FPQA 1ODSA 1T1JA 3TSYA 2CZGA 4D42A 2H1LA 1YA6A 4OOEA 3TTVA 2ZVQX 2PUBA 1WF6A 2EXXA 2Q21A 2VJMA 2YW2A 3OM8A 4DCVA 1D4AA 4TTTS 3G1UA 4QWWA 4L76A 1PTJA 4Q3KA 1ACJA 3O3CA 4DIUA 1RZRD 1EWVA 2IZ6A 1C9DB 1G8SA 4JDUA 1UJNA 2CN1A 1T8PA 4OHFA 2QTRA 2Z4SA 3S5UA 3U9LA 3N8DA 2MYPA 1OGIA 1Y5NA 4QHYA 4UVIA 1KGDA 1LV8A 2GPTA 1V48A 1JEOA 4FOOA 4ITUA 4YALA 1Y63A 2ZJYA 4AB1A 4MDYA 3G9UA 4JT9A 1I2AA 1YCGA 1Z5ZA 5IMBA 3PLAE 1TO2E 4JVNA 1ENOA 2IU0A 4D3SA 1GTL1 1PS0A 1WSBA 3AILA 4Y7DA 3ER6A 4ZVTA 2AI1A 1M2HA 2XX3A 4UFPA 3EPPA 3IBGA 4KV9A 1S9HA 5K3CA 1T25A 4MUNA 4HFNA 2XCIA 2G9QA 4DTIA 5BYAA 3KHUA 5C5EA 4PEVA 1LSOA 2YVUA 2R6GA 4NK4A 4L7VA 4QEKA 4F93B 1UK6A 3AVQA 4LXUA 2PEZA 2AMLA 2Q5OA 1LNZA 2R8XA 2V9ZA 3AFMA 3B70A 3O93A 4JNKA 4UM7A 4IDQA 4BWYA 5L7TA 1HTBA 3L1JA 4XSVA 1PT9A 1B1AA 2ZTUA 2HMWA 4G5SA 4JT4A 4LC9A 1DKUA 1MGOA 4ARUA 3U4GA 1TKCA 3WMFA 4HQ6A 1NFRA 1JDNA 4A0GA 3VYSB 4ZDJA 2W71A 4NS4A 4ALKA 4Q16A 5DBIA 1QIHA 4TQGA 3O95A 3N2GA 2OENG 2R62A 4LOLA 3IQGX 4O59O 4L8LA 3ZK9A 4M1KA 4YQZA 4CFZA 4KBFA 3AESA 1A8PA 3M34A 4F04A 5IWAB 2IJGX 2FPIB 1MJFA 1M2FA 1N4DA 3QY0A 2W2TA 1V26A 1JJVA 2CW5A 1A88A 3RVJA 3DTNA 2XUOA 3ZY4A 1K8XB 4N6GA 2J5QA 1ZUIA 5F3RA 2N1MA 3L4SO 4OJTA 1T4DA 2ZUVA 3CUEF 5I7EA 2FTKE 2RHMA 5EWLA 3JQEA 4TS9A 2FR8C 5K3FA 5MN5A 4LY9A 3PGMA 5CNKA 1RCUA 9ABPA 2OZEA 2RH8A 3IR5A 1RPTA 4RS3A 1CIVA 5EEGA 4AWXA 1P18A 4LZNA 4QO8A 3A1WA 3ZOKA 3CGWA 1K89A 3PNSA 5JI3E 1DIAA 1M8KA 3L4BA 2VTVA 1MA0A 1P9NA 4LDQA 3FD8A 3LCUA 1CR2A 4MRRA 1I3CA 4BFXA 3T61A 4CTNA 3QUTA 3AL0C 3G5TA 4DDVA 4Q3NA 4BQOA 5F21A 2P9HA 4OLFA 1I6MA 2FMXA 1CUYA 1DEKA 2I71A 4HSEA 4MWOA 4BLPA 1DKQA 1G66A 4RNCA 3LDAA 3AVUA 1BOOA 3ZIAA 1JPUA 1VJ1A 2ACWA 3GFVA 2FX5A 3IGFA 3K96A 1CY4A 1JLSA 1N36B 4H35A 2XITA 5ITSA 2HI0A 5ALGA 1MAVA 1R0YA 2E4YA 4GX0A 4Y2GA 1BCRA 1SJ9A 5CFMA 5KKNB 1A9PA 2Q3BA 1DZ3A 3AF5A 2PRYA 3K32A 5AW5A 5EJ8A 5E4FA 3NRBA 1XMQB 1YASA 1MFPA 3UHOA 3E2IA 2FZLA 2DFDA 1T1EA 4G1VA 3S68A 2NZ2A 1EK6A 4RXUA 3VZSA 4EY4A 1F7UA 5FWAA 1ATZA 2ZTLA 1ISHA 3HVJA 1T2AA 2RGUA 3BCRA 2B2NA 2SCUB 3OE4A 3BL8A 3ZH2A 3EY9A 3X0DA 3O91A 5AM4A 1XI2A 4H3SA 4Q6BA 3RIMA 3UMJA 3ZDQA 1ODFA 5FI3A 2GBGA 4II2A 1VFPA 4FFSA 2C9MA 1G5PA 4AC9A 4DLRA 3K72B 1JG4A 2BEWB 4BB5A 3D8HA 2B1JA 4DTCA 1PWEA 5JCOA 4BN5A 1WDMA 4AZSA 4I1OA 1MP0A 3MSCA 2W6MA 5JO0A 5KBYA 1YRHA 2ZETA 1UAYA 4YAUA 5P8WA 2IZ0A 4IHKA 1RQPA 4Z9BA 3OEHD 5KYYB 2AW5A 3A2KA 4D9EA 1AQLA 1H23A 4ZRNA 2C2XA 3NORA 4Y6LA 2ZZMA 1PZGA 4J0DA 5JALA 4BQIA 1WM1A 2YOGA 1LSJA 1W88B 2HQOA 4NJEB 4ZT4A 3HSYA 1SKYE 4IP0A 1T5OA 2QWXA 4OK6A 2ROQA 5B2ZA 5EHZA 2HLPA 4C20A 1N77A 3N6VA 4GVLA 2UUOA 4M9CA 4ZO6A 4U2DA 4DR1B 2BI8A 1LFDB 4JMLA 4H7DA 4NBKA 1ZJ6A 1M10A 3LT0A 1Q16A 5KU1A 5DI9A 5A71A 4Q5IA 4YMVA 2BSAA 4N41A 2XWJI 4JIMA 1EM6A 5A6SB 1UKEA 4GXRA 2FQYA 3VBCA 4A2CA 2B83A 2Q9AA 4CKYA 1C0EA 1XPJA 1K9VF 4FEAA 4GSYA 3X2EA 3KAQA 3OUZA 3PC3A 1QBKC 5KVCA 1PFQA 5K1ZA 4MRMA 3F9IA 1HTWA 2J3JA 1K7CA 1KNXA 3IMFA 3JQFC 3ONVA 1RI2A 1E0DA 2FPIA 2ZBQA 1G42A 4DZZA 5H9WA 5JJBA 2H7XA 3VVLA 3GDFA 2ZBPA 1FXSA 3EGVA 5L8VA 2ABWA 2PWYA 2C5SA 4O4LF 5BY2A 3EGXB 2VDVE 4DCGA 2NU7A 3U4IA 4YR7A 1LC0A 1N5OX 2Q29A 1XO1A 1NQ5A 3P9PA 1JU4A 1COWD 3D4OA 3K0CA 3DOUA 3GFBA 5KQLA 3LX6A 1YUMA 3NBAA 4XJVA 4HX5A 3PCTA 4G2NA 5D3ZA 3THRA 5JJLA 3TSCA 3L05A 4LHSA 1Y3IA 2NUTB 1UK7A 1UFKA 3VX4A 2IS4A 2PT9A 2FQQA 2VCEA 1PV4A 1WKCA 2GHIA 3CNLA 1VPLA 3L7MA 3UK1A 3UJ6A 2OHHA 3UTDA 4WY2A 3EQZA 3LVBA 3TGLA 1JVSA 3AY6A 1YBMA 4MICA 1SN7A 5FTMA 4BGVA 3SYRA 2XZDA 4HDKB 3OPVA 1RI5A 2PZLA 3C5HA 3NASA 5LA6F 1AD2A 1Y3BE 1C9NA 2GSDA 3EEQA 3BSSA 3ZNOA 4FFNA 3ROMA 4GXNA 3D7SA 1FXUA 5BQOA 4DN6A 1E0SA 1JPNA 3VOSA 4MPRA 5EZYA 2OQ2A 4UFOA 4FYMA 3TGWA 1U7UA 2XHEA 4X1YB 3VSCA 3QEMB 5JYCA 1IN8A 1Z0UA 1URPA 3TAHA 2FFHA 4A9AA 1K4YA 2EL9A 1T1IA 1L8XA 2GGSA 4I81A 4DMFA 3KETA 3PPXA 4LKOA 1IH8A 3HI6A 2GUGA 5EUCA 1MV8A 3LLCA 4ZREA 3BB4A 2PQ2A 4JITA 5HK9A 4HEQA 5EQTA 1JTVA 4LRTB 5H0IA 5J4KA 3BQ9A 2IUEA 3D0RA 9ATCA 2MWMA 3QTLA 3RKSA 3VYWA 3JPWA 2G5TA 3G8AA 3F2IA 1TEHA 3LDFA 4U3JB 1UJBA 4TLMB 1UXKA 1A82A 3THYB 4DWVA 3F96A 5TXGA 3TRHA 4EJ6A 1G9TA 2IEZA 3E7XA 1NVDA 1H9BA 4X9XA 3M7IA 3MT0A 4MS4B 5F3WB 3VKHA 2ZQYA 3RLIA 4IIFA 3D59A 2VTBA 3EEBA 3GRCA 3UK0A 1EX7A 2BZSA 1RAHA 3ZGYA 4BO6A 2ZYAA 1XTPA 2OMKA 1CVLA 4HRXA 4PF1A 5IVKA 1OX4A 1Z0JA 2EKQA 3QU2A 5M5BA 1QRSA 3OT4A 4A6DA 2IZ1A 4WBNA 2QV7A 1BDBA 1D2AA 1VLLA 3EIUA 5KYYA 3UN1A 1WY7A 3SR4A 2DBRA 2P7IA 5A5EA 1U5AA 4YAOA 4PS0A 4GU5A 4AMBA 4U7JA 1BX3A 3S2GA 1PI3A 3JQ9C 1W88A 1Q1AA 2PKCA 3LIIA 4QVKA 3SEAA 5J43A 5IK2D 3ESRA 4HLDA 2QQ0A 1ULAA 3LUDA 4FOLA 2BRUA 1LBQA 2A0KA 2PH5A 1LX7A 4NCNA 2XGJA 2O8DB 2JASA 5FOTA 4GP7A 4URZR 4O2RA 2WVHA 3AF3A 4Z99A 4OP2A 3RODA 1P4JA 1RHQA 4LF5B 4HWOA 3LHFA 1JEQB 2GPNA 2QR3A 4ZOBA 4MAMA 1MDFA 1I01A 3LWZA 5CB4F 1JDTA 2MJLA 3H87A 4F3CA 5A6SA 2EVWX 4YONB 4F2WA 1XJ0A 4N0DA 3IIJA 3W0LB 5BYJA 4FYIA 3UWKA 4B3TB 2WTEA 2WKSA 4EJFA 4GKJB 2RARA 3OQ1A 3CM0A 3ON5A 3WIOA 2NUPB 1Z7WA 1BGVA 2CXNA 4JOQA 3Q9NA 1KR5A 3TNJA 3X1ZA 4DIBA 1LZLA 1QR2A 1NXSA 3CVXA 5NLLA 1J06A 1RW4A 3KCQA 3MWLA 5CFLA 4UOQA 4KQ1A 1O4WA 1R9MA 1F06A 1V37A 2JEOA 1KNQA 1PWHA 3GOQA 2I2DA 1TAQA 2WU1A 4XYBA 1VRWA 1VGRA 1G8KA 1F3OA 2B3DA 5TF0A 4BMXA 5DCYA 1SA0A 3W2EA 4TM8A 2YN0A 5EINA 1RLIA 5DBFA 3IB3A 4MW5A 2HMVA 1NULA 2PTHA 1LQTA 5BSTA 1G60A 2Z95A 4XYGA 1T4GA 3HR7A 4X8LA 1VCOA 3K71B 4OHYA 3E6AA 3GRAA 5JFTA 1EX1A 4OA8A 4CKEB 2CXRA 3ZWMA 5GIPE 1G8FA 1NY5A 1S7CA 1IJBA 5DTEA 1V0JA 2EW2A 1L9XA 1CV2A 3HS3A 1XEXB 3UW1A 4LSZA 1E1YA 3OQNA 4RVUA 4FFMA 2H7VA 3DKKA 1B76A 4XGQA 3KTAB 4FGLA 2CFIA 4EENA 5F4ZA 3G2IA 1V8BA 2X8AA 1JYEA 1JEDA 4UARA 3V4OA 1ZKDA 1B6TA 3AG5A 1EH5A 3MINB 3LOUA 6ADHA 2PUEA 4MEAA 2D54A 2XGOA 4NCXA 2Z6UA 1I1NA 4Q03A 1EB8A 1LA2A 2IYTA 2PDAA 1I4TD 3BRWA 1M34E 3H6HA 5F76A 2QZ9A 3ASVA 1Z0KA 4M37A 2IV2X 1ZRSA 3H5VA 1QH9A 2NTJA 3DO6A 4GQIA 4BFCA 4CEIB 3BMNB 3L07A 3LUHA 3JD0A 1YS6A 3EPJA 3ZD6A 3QV1A 1BVUA 2Q9CA 4RK7A 1PW5A 2B4KA 3EFOB 5JJIA 2YW9A 2VAWA 4RE6A 2WI8A 4QBFA 1CF4A 3LQ1A 3M6UA 5DGCA 4BOYA 5EP2A 4MMXB 3PXGA 4KXYA 1GTRA 3KZXA 5AVQA 1G17A 1GCUA 3FUXA 3L8HA 1NBIA 3T4PA 4RZUA 2VLBA 3MERA 3FZNA 5B1YA 4OP3A 1A5AB 5I7SA 4ZYVA 3MQ2A 1HNWB 3CR8A 2WSSD 1OC2A 3M6VA 4YT2A 4P4SB 2WSBA 3E8SA 3FYUB 4RTOA 4KGXA 2D5BA 4FHFA 2PMKA 1IOZA 1QG0A 4JQCA 4NECA 2X8WA 3TEFA 3DEYX 3ZXXA 4DMGA 2PCLA 4I4CA 1RCFA 4WK2B 5JZBA 2NV0A 1J1ZA 1OLSA 2JKZA 5GVRA 2O2HA 3S2ZA 4ZCTA 1YFZA 1CNMA 1RJEA 2NO9A 2X5XA 3LW7A 1JLKA 2WABA 1IEVA 2W0SA 5F73A 5IDYA 1UWLA 4KE8A 1XALA 2VEDA 2RHBA 4L0MA 4Y2VA 5I9MA 4UTVA 3C39A 5JTUA 1E0JA 1W76A 5ESXA 3QF7A 4C03A 3Q85A 1DAGA 3ORFA 3AX6A 1SIUA 3Q2OA 3TW8A 1O0BA 1SCNE 2IYAA 3RG8A 2O8DA 1OXTA 2QTFA 1AQNA 1TE2A 1U7DA 2WAXA 3WL3A 5LFAA 5KVVA 3GRYA 1JH8A 1YZQA 3M70A 4HN9A 3LM8A 5COAA 5DCWA 1F7VA 1UJ6A 4LHEA 4TMXA 1JEQA 4WXRA 3SS8A 1P7ZA 2DY1A 3P2YA 4HDQB 1EGHA 2WKPA 5ERGB 1WUYA 4MYHA 4D1YA 2C9BA 1PDWA 2BE7A 2EKLA 4CLDA 4KQIA 4FYKA 1DADA 5FBLB 3BB1A 4TVSA 1N78A 1WS6A 3RSSA 1RSZA 2YWBA 4D0RA 2JFYA 2QG9A 1KZYC 1EXNA 1HNNA 4YAKA 4I5EA 5ERXA 1W0JD 4ONEA 3V48A 3ADDA 4KN5A 2IW1A 3GEIA 3DZCA 4I55F 3ABIA 4LC1A 1WSWA 3VNRA 4E5NA 2JD0A 3B8HA 3TDKA 4U0JA 3WYEA 2PLWA 3Q9SA 4P83A 4TMZA 4DSOA 3KXLA 4S1OA 2HN9A 3SHWA 1DWQA 3EZXA 3ZCUA 1YB5A 3HKCA 1AXEA 2D1QA 1IHOA 3P0HA 1YZNA 1GG5A 3DDOA 2EZTA 4DLVA 3PD0A 4URWR 4DKJA 2QD4A 5I8PA 2QN8A 4OREX 4H7PA 1B6RA 3GPIA 4HNSA 4CKCB 2C54A 2EC5A 2JF0A 1E2KA 3H4IA 5CYGA 2X9LA 3EDQA 3OOHA 1HOXA 1GGMA 4B35A 1KFEB 3HE3A 3AERB 3PGA1 4RZHA 2NV2B 1TC2A 3FKSA 1J25A 1XEXA 3IQXA 5BPFA 5K6AA 3BSFA 5A3VA 1T2FA 2P35A 3L06A 1HRDA 3OICA 3OIDA 1RIFA 1V7ZA 1SPBS 1TX4B 3JZIA 4Y0NA 5DM0A 4AG3A 4DF3A 5JI2E 2DPGA 3DTTA 3IXLA 2G08A 1W4RA 4LMAA 1FFWA 1GL3A 2CUZA 2EHJA 4LOJA 3WK6A 2B5VA 2CKDA 4EEXA 4BFTA 1SPXA 2AOVA 2OAP1 3MINA 5JD5A 3X43A 4MJLA 4J1SA 2OFOA 4BLSA 4CQLA 2UZ3A 3E15A 2R1UA 3V1UA 1GDHA 4AWAA 4D81A 4O08A 5LXTB 2BMAA 1DV2A 1Q21A 2WV9A 3ZHZA 4O25A 4W4TA 3P0FA 1RAEA 4DCJA 1Q1ZA 1R88A 3DEFA 2P8JA 4C7KA 4G85A 2O2JA 3ZBTA 2J0SA 3TJZA 1U8CB 2H5IA 3BMNA 4G0VA 4EFKA 1PGQA 3ZJVA 3DOFA 2F59A 4FI3F 1OPRA 2AC7A 2D1RA 2RSLA 4CLHA 3UA4A 4ZK6A 2R85A 1NVVR 1ST2A 4YMHA 4XB2A 1NBOA 2GFHA 3ACBA 5DHFA 4X6YA 2B0JA 5DTJA 3ZGOA 1MH9A 2HSJA 5FL7D 2AMFA 3GJTA 4KP7A 2DBQA 2PD3A 1EUYA 2AOTA 1L5VA 1RTKA 2C5GA 3QUAA 3M49A 1N0WA 4IV5A 2PX2A 2PSHA 1XLWA 2KSQA 5AOAA 1AUXA 1NNEA 2GFQA 2EV9A 1N1MA 3FVVA 3ANNA 3OJEA 3Q2KA 1PNQA 2AWNA 3V8BA 2JLVA 1YKGA 4PQYA 2B6NA 1C0KA 1Y4ZA 4JJAA 1IBLB 1WQ1R 5BRNA 4GXQA 4YP5A 4ZVRA 1Z3IX 2FZKA 3DOJA 4XIYA 1QPZA 1A72A 2WJAA 4G4IA 4I0WB 2WK1A 2OXFA 3AV0B 3DMPA 3KB8A 4NC9A 2VAMA 4G0OA 3WIBA 4ARSA 1NIJA 1WV1A 3TD2A 2Y71A 2Z8XA 4EHLA 4G1CA 1GKKA 2YMLA 4RHTA 2B6HA 1KERA 1Z12A 2QD3A 1Y4DE 1LK0A 3MELA 2OGSA 2OXTA 2VSYA 1UOEA 2I1QA 5FFMA 1QIMA 4ALMA 4Z4HA 3KZOA 4BNDB 2RHTA 3GD7A 4MEBA 4P3KA 1I7PA 3M1AA 1AGYA 4F3YA 1Z62A 3FVTA 1R6VA 4FYWA 1M7GA 3GW8A 3OOWA 3BYZA 3VR2A 5E3HA 1M1YA 2ZT7A 3NHMA 4U6QA 2X2PA 4IS3A 4M6WB 1X8XA 5DULA 1Y3DE 3RYTC 1LPPA 1JXMA 1GZUA 3PRHA 3VPDA 2ENWA 1BU8A 1QZ3A 2OILA 4LAFA 3WGZA 3SBOA 3W3AH 3A2MA 5FBVB 3N2ZB 4PXYA 1GXSB 1XK6A 1BFUA 3IELA 4HAWA 2PA3A 3VHXB 2QTCA 3K94A 2F55A 2I7DA 3LSYA 5A5FA 3LA8A 2QLJA 1Z2DA 3E5HA 4BFZA 2ZDQA 4ZCPA 1D4ZA 3CYFA 4JLOA 1GKUB 2CNWA 1BE6A 3O8QB 4LCBA 4OBEA 2ZS8A 1MQAA 4CEJB 1R0RE 3DE1X 3GUZA 4I4LA 1VXRA 3DXXA 3VYTB 4D79A 4J1TA 1CZUA 2QJWA 2VJCA 3CJRA 1NR5A 3ONDA 1IZ9A 3MS7A 4MVJM 4TKLA 4WOPA 5DX1A 3EH1A 2A0FA 2P4EA 3HYSA 4GBMA 5CLHA 4QU8A 2ZZNA 2V7EA 4OIFA 5ECYA 1S7GA 4G89A 3GLHA 1OYOA 1P5ZB 1C30A 2H7YA 4R2LA 3THOA 5ANRB 1MZPA 4NH0A 1ISIA 2CMDA 1QHEA 1CY1A 5F9MA 1LEHA 4H7JA 1N2OA 2VWPA 4AJ1A 5K8IA 1YQEA 3WL8A 2GCEA 3L0YA 2YFQA 3GFPA 1NBME 4NKRA 4ASUA 3KQUA 4ATNA 3ETCA 2WLTA 1NP7A 2VDMB 3MD0A 4IRXA 1CQJB 4CM8A 5FX2A 3LUKA 1A97A 2BFBB 3NBZC 2IUFA 4MVYA 5JY6A 3IMKA 1BDHA 3O4FA 1YBVA 4ZHQF 2Q3HA 2Q5QA 2FCRA 4Y9UA 5GJVC 3THXA 3A06A 2WU4A 2G4VA 1Z6TA 2XEDA 2XTJA 4EHJA 1WXHA 2PBRA 3E3NA 3PIIA 2GN8A 4UZEA 1WVGA 1L7VC 4F86A 5JXJA 2CFTA 2VYND 4M0PA 1L1RA 1QE3A 2ISSD 2FF5A 2PT5A 8MHTA 2HREA 1CRPA 1H5NA 2OPHA 1D2RA 2XMPA 5EYPB 3I8SA 4JI5B 1Y6RA 5FA6A 2XMGA 3A4TA 2W6ZA 2Q3JA 4NYJQ 4KVFA 5FLYA 1UMKA 2VLIA 3WKEA 2NZUG 2W6IA 3W6PA 2ECQA 4E14A 1DAMA 1TD9A 3QJ5A 4OV6B 3AM1A 3E1GA 1ESZA 3ZHYA 1GA4A 4HWSA 3ZTTA 3ZWKA 1J90A 2BFPA 4RWEA 3KUCA 1C7RA 4LY3A 3UCXA 4MQLA 4PRYA 4IL5A 3A4YA 4DIOA 3M6IA 5K4AA 4ZCQA 1X8KA 2X14A 1BHJA 2FNAA 1CYDA 4P5EA 5A06A 2FDCA 2GRJA 3IVXA 4PO8A 1L6IA 4C7OB 4XPIA 2HBRA 1E2LA 3K9BA 4TWBA 4CIAA 1AMUA 1AHNA 3I01M 4NIMA 3KWJA 2WIKA 3KB1A 3AJAA 4Q01A 3WYFA 3NBMA 1RPAA 3ZWCA 2XZLA 2FPRA 1X87A 2OZVA 2BMWA 3DAOA 3T7JA 5LQKA 1XLVA 1DG9A 1KA9H 2ZYGA 3KJIA 4MB0A 2AF4C 5G4KB 3T12A 1I7DA 3GT7A 4B3MB 4JJ8A 4URUR 5E6UB 4KZKA 4F9GA 2HWXA 3AIIA 4HH0A 4BX9A 2SKDA 1J56A 3G13A 3D3WA 1R3DA 1S8OA 3S7ZA 1E9CA 3CT4A 2AUMA 4UZFA 3OH8A 2X7XA 2WD9A 4EKEA 1F5SA 2PBLA 1ZM2A 2PZMA 5ADUS 2BUAA 4LW8A 2UAGA 3Q7SA 3R0ZA 2UUPA 4OFWA 5B1EA 3U56A 4J16A 4DA9A 1LSSA 1R4ZA 4DC1A 5LZ5A 3WKAA 2FWIA 3O1HB 4A2QA 3SYNA 2JLXA 1UZNA 1ECLA 2WQ7A 3V1LA 1GFSA 4JAVC 4AX8A 3EZFA 1EJ0A 1IHYA 3PB3A 2BPOA 4NCBA 1UR5A 4WCDA 4CR6A 5IT5A 4FMCB 1E7YA 3KJEA 4YMTA 2I2AA 1EG7A 1CHDA 2QAGC 1DXQA 1P7PA 2P5TB 4CM4B 3PDUA 4EB6B 3LT4A 2WM2A 4MR7A 1NBWB 3OPYB 4EKIA 1NXVA 3GG9A 4HKTA 1SHTX 4LYFA 1AS2A 3BBLA 1B8VA 2UZ1A 1X38A 2H0AA 2ZQZA 4J7AA 4JYMA 3UFXB 1BNCA 1TM3E 2PV0A 2BBWA 2SHKA 2IVFA 3MIIA 4H1HA 3LE8A 4GM0A 1QHNA 4IDNA 5CJPA 4CEJA 1XRPA 4DM3A 4CLOB 4BMSA 3LW8A 1NJFA 3QKWA 1SXGA 3M82A 5MF6A 1NI4B 2OLEA 5FL3A 4BGUA 1QHFA 4RTNA 4TS1A 3F3MA 3EIQA 5AIAA 3UFBA 1O5TA 2FG7C 4JWTA 2JHFA 4F38A 3EZNA 4JT8A 5IT4A 3OETA 2CXSA 3V7YA 1B8UA 3G0HA 3OE5A 2OD2A 3I2JA 4D5GA 2J31A 3VA7A 1X1DA 3B1WA 1T34A 3PEVA 3OU7A 4NNJA 2ZSHA 3MWJA 4QLOA 1GYRA 1Y3FE 2BGMA 3ROXA 1RXIA 1X80B 1V41E 1G21B 2HUNA 4GECA 1SO8A 2PR2A 1HKHA 2VKTA 4UCQA 3QOFA 3EG9B 4F3NA 3IQZA 3I4FA 1QAQA 1Z7YA 4FU0A 3U31A 1J8VA 1F0KA 1A9ZA 1E5LA 2VP0A 3C45A 1U1FA 2IOFA 1V7PC 2QRZA 1G7SA 3W5UA 5LU9A 2WVGA 5HQJA 1E4OA 3KALA 4BVKA 1DEAA 2POCA 4JOCA 1A5ZA 5K01A 4JYAB 3DE4X 4HGNA 1BXKA 3ZD7A 4CM3A 1G18A 2A0UA 1YMVA 2WUWE 3K09A 4IYRA 4RA6B 3DTVD 5DH9A 4YCLA 3K6SA 5TMDA 3RUEA 3OX2A 2FQ1A 4KYVA 2EKPA 1AGPA 1Y9AA 4R2IA 4BJ3A 1R8JA 1VJ5A 3LBHA 3M4XA 3HXTA 3KUDA 3OZEA 1YVEI 4LA4A 3WFIA 4TRNA 5JQGB 1I4WA 2R8OA 3GPDG 1VECA 2P2NA 3LT5A 5F77A 3T0FA 3A1NA 3IALA 1FDOA 4CG2A 2A2ZA 2I78A 5LYJF 2FOLA 3N07A 3BK1A 1X1BA 3O1JC 4E5VA 2ZUDA 1LF5A 2IYLD 2C5LA 2WD7A 2GZDA 4GYWA 3PDHA 2R48A 2WOJA 5EWMA 4AO6A 2ZRMA 4JQSA 3F6YA 3MD9A 2IYZA 1YZ3A 3VR3A 5JD4A 1J07A 3ZE7A 1JG7A 2ZJ7A 4C7OA 5ITVA 2GARA 5J4HA 1GPKA 5HZHA 4QYIB 2Y0EA 1EVJA 3EY4A 3AM4A 1QMGA 3NJ8A 4HNQA 2O0KA 2LVBA 4J8PA 4JZYA 3DL4A 3H04A 3HBNA 4MI1A 2XV1A 5G4KA 3RREA 1O97D 1DAEA 3URKA 5CM9C 1TCCA 3KWLA 3R6LA 5IH7A 2DMRA 2PXXA 3WLQA 1CUEA 3FZQA 4ZAVA 1V4BA 2YYYA 3KKEA 4YDHB 1SU8A 5AW6A 2PWZA 3GLGE 2H06A 3GAFA 5G2OA 2ZJ3A 2ZM6B 3PU6A 1JAIA 2H1CA 3M0EA 5FIUA 4EY6A 1APBA 1CQWA 1FE8A 1VE6A 1JHDA 4HQFA 1U1DA 4PFJA 1K63A 2P67A 4NX2A 3U7QB 2PJRA 3VXKA 4XVUA 2XIJA 5REQA 2XXAA 5CPBA 4UW9A 3P71T 1E9AA 4IG9A 4R40A 3CNHA 1UANA 1COZA 1SKBA 3U9SA 1QTIA 5EJ5A 3NHJA 2BFDA 3ZI7A 4RV4A 1QK5A 1DOAA 4OB7A 4B2PA 5DMXA 3OPYA 3L0SA 4YTEA 1U2DA 1YZFA 2OCDA 4I2NA 3ZCPA 2QN9A 2PGIA 4JJ4A 4DV5B 4JXZA 4OHPA 1WCXA 5FUBA 1SBQA 3UFXA 1V4VA 4KXQA 4YRFA 5IBQA 5EXDA 5A1JA 4K9SA 4M2LA 4X3OA 1PCXA 2CXQA 4TTIA 2Y9PB 5LBUA 3U7GA 2OVBA 1F51E 2PSFA 1M6VB 2XDAA 5CHYA 5KAPA 2XAAA 4L07A 3P94A 3FN4A 3BMOA 1U6IA 1ZC4A 4NBTA 2XF2A 4U1RA 3TLCA 3W8NA 4WGGA 1IBMB 3HCDA 3W5JA 3H3XA 4J4BA 5TRTA 1PJCA 4TVOA 3GGJA 3ORRA 4KK4A 1ZQ1A 4E15A 4GOXA 2OXEA 5IN5A 3ZV5A 4ZYZA 3P4XA 3QPWA 4LRYA 1Q0ZA 3FTPA 2VPIA 1M2OB 4D8XA 3EMKA 5FBRB 5GJBA 1EEXB 1PR5A 1S2NA 2WAOA 2BGJA 3B5JA 4X24A 4NABA 1Y9EA 1CE8B 2GD0A 3A1CA 3HXOA 1Z36A 2RAFA 3DZDA 1R16A 1SOUA 4Y6OA 5JYEA 1JQEA 4TKUA 2C5FA 5JSQA 4MVJE 5LSAA 4YASA 3TOXA 4L95C 2ZUWA 5E7QA 2YQ5A 3RV4A 4MKXA 4QOSA 3ELWA 3CKKA 3OFSA 1UL1X 2GFIA 2EYQA 2H31A 2IA5A 2FY8A 4M0CA 4RHEA 3V1KA 4WAUA 2QLLA 1HMPA 3B6EA 4DDTA 4RA6A 4H17A 3L8DA 2HA6A 2B94A 4ENWA 3I2GA 3ONNA 5FUVA 4E0BA 2ZJFA 3C6BA 3GA7A 5F5XA 4JI7B 4TX1A 3NQ41 4F5WA 3AUYA 4PSVA 2IIBA 4Z86A 5GADl 1Z73A 1CUXA 3SI7A 1TXGA 1FU4A 5JQGA 2OORA 5TY0A 3AZOA 3GVXA 3H2GA 4I99A 4LHXA 2ZRNA 3T8YA 1I0LA 1IXKA 1OAAA 4IWNA 5CH8A 1O95A 4FR0A 4GX5A 1U0JA 1JFVA 3BORA 1MG0A 1Q5PA 4NONA 1RJGA 2CJWA 2J7PA 4H3VA 3ZJYA 4K0KB 4PY2A 4KODA 1K6JA 1Q7TA 1HXHA 1K6EA 2A5DA 1ZI6A 4IUDS 4A0QA 3ZY3A 3TIIA 4DE5A 3K1AA 3AOEC 3B48A 1T24A 1KC1A 5AIBA 3EAFA 2KJQA 4GF5A 4QXPA 4XIIA 5KPJA 3ZS8A 3FB4A 4JNCA 4M83A 4FOPA 4QRHA 4TXJA 5FLXA 3UXYA 1W87A 1R5JA 2FWBA 2P9ZA 3UQZA 3EX7C 1C3XA 3NYWA 2C03A 3H1GA 4GI1A 3WRXC 4DJEC 2FXVA 1VPWA 4KXLA 4M54A 1VBNA 1ZGJA 3SICE 3JVEA 3SSAA 4NZYA 4C4YA 1Q0SA 5EIWA 5KX5F 4JR2A 3I61A 3K0KA 3CVJA 1CFJA 5BVGA 5IC5A 3G3EA 4M8NE 4M88A 4ZDWA 3H75A 5DRYA 1W9MA 2Y4OA 3ECCA 2G0AA 2EQBA 3AHDA 3LXUX 1EP9A 2CE7A 1WXIA 3GRVA 4PZAA 3OZ7A 10MHA 3P2OA 4LDJA 4XIJA 2V3CC 1V3QE 7MHTA 2O52A