1TQ2A

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
402
structure length
395
Chain Sequence
NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
total genus 131
structure length 395
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tq2A02
1U9IC 2W0MA 5FR2A 4ZIRA 1XP8A 1Z47A 2QAGA 3LLMA 1MV5A 1TQ6A 1N6RA 2DFNA 1S3GA 1IM2A 4LJ4A 4B6EA 4LZZA 1KDOA 4ZDKA 2QSYA 4HSEA 2JLYA 1NVVQ 1ZC4A 4JLBA 1CXZA 2J3EA 1EGAA 2CJWB 3SBDA 1Z0AA 2YJTD 2ODNA 4WZAE 1KSGA 1UKEA 2PBRA 4I1VA 4Q7KA 2C9YA 1F6BA 1H8ED 1QVAA 3FPAA 2GEVA 1YZNA 1EXMA 2XSZD 2QE7A 2O52A 3KXLA 4AYTA 1WF3A 2A5JA 4UNSA 1ZUNB 2BMJA 3MG9A 2WJJA 2RKOA 5LB4A 3UKDA 1CJKC 1Q57A 3EA5A 4E07A 3T1VA 1VDZA 1YR7A 1ZM4A 5DN6A 3QKRA 2FPLA 3KKQA 4JSTA 1QDEA 1J99A 3WBKA 5FL3A 1Q0UA 1TF7A 3VTKA 1G19A 3OIWA 1KDTA 2AK2A 2BHRA 1G64A 2Q9BA 1VHTA 4MRSA 2ZI9A 1XF9A 1KMHA 3SYKA 1HE1C 3A4MA 4NH0A 4O3MA 3W5JA 4URXR 2ZJ5A 1W0KD 1D9ZA 2OESA 3MWKA 3U3OA 3U3RA 2OHFA 3KJEA 4TL9A 3SEAA 1DOAA 4AC9A 3QG1A 3D6TB 4PPNA 5FOWA 4LSGA 3CM0A 1Q20A 4BRUA 2XZPA 2DFKB 4RZXA 4R9UC 1XEXA 4JJZA 3A1VA 1W36B 3REGA 4DDVA 4P3YA 1OH5A 1DTSA 4HLCA 3TIFA 3ZIAD 1RE0A 3V4RA 3TVTA 2CCJA 2F1JA 3NBFA 2ZE6A 3HU1A 4P4UA 2FF7A 1WRBA 2QRNA 3UWOA 1E0KA 2GHIA 1HY3A 3I5XA 3SFZA 2W2XA 1UKZA 1CKEA 4RCYA 2GXSA 2YWGA 2FFQA 4YXWD 1VCIA 3HDTA 3OIUA 4MA4A 1W49A 1I4TD 3VAAA 2BM0A 4FCTA 2JLXA 4PQYA 4BZPA 4CZ2A 1E99A 1LTQA 3MWYW 2IBMA 2PZFA 4OHXA 4TQAA 6Q21A 4URZR 1G18A 1JR3E 2PZGA 4JLOA 2QI9C 5EXPA 3DOEA 1KK1A 4ZDWA 2PCLA 2QTFA 4JLPA 3U6KA 2JLUA 2D3WA 5JWRA 1BMFA 1FP6A 2C98A 4UNRA 2R6AA 4D80A 2WSSD 3LW8A 4KJZA 3AVWA 3SJAA 3AVPA 4FI3C 2ORWA 5TXGA 4M9SA 5A5GA 3Q7QA 1G8GA 1QVRA 2G6BA 2ZS8A 2ZUBA 3L82B 4OI2A 2IT1A 4C0QC 1OW3B 4B2LA 2CNWD 4KU4A 5EXXA 3HWSA 1KI8A 1L7VC 1VCMA 4F7WA 3X1ZA 4Q7LA 3GJ8A 4Q9IA 3T06B 1E0AA 3AGQA 3OHMA 4N0DA 5CLLA 1FMLA 1FX0B 3LFUA 1UEJA 4LV8B 4DIEA 1CU1A 3HYTA 2O0JA 1KI1A 2JIZA 5B2ZA 1T0HB 2GETA 2WJVA 3RRYA 3PUWA 3TAUA 4EDHA 1BO6A 5FPTA 3SOPA 2RGGA 4PZLA 3QQ5A 4B6FA 4E09A 1IY1A 4HB2A 2B8WA 3AUYA 4OK5A 1G1MA 2EYUA 1S2MA 2HF8A 3B9QA 1U2RA 2JDID 2PEYA 4MUBA 3BFKA 3P20A 4XVRA 2XXAB 5CK4A 1FUUA 1DAHA 1MH1A 1Z83A 4D6PA 2JGNA 3FOZA 2ZJBA 5JRJA 4EPVA 2IYSA 3BAFA 4EJSA 2CL0X 3SJBA 1TAGA 5L3VA 4DLWA 4B3DA 1XTIA 4LHWA 1KK0A 3KL4A 2HF9A 1TTTA 3GLIA 1F2UA 4TMVA 1W4RA 4IKEA 3WP0A 3K0AB 4Q4JB 3CB4A 4TWZA 4GZLA 2IEYA 3UPUA 1D2NA 5HE8A 3O8BA 1W4BA 2C99A 2V7QD 2ZI6A 5AK0A 1SULA 2DY1A 4LHXA 3HR8A 3K70D 1KOFA 3I92A 2H16A 1ZM7A 4GPTA 2VPPA 3CX7A 2A7QA 1E2DA 4P4TA 2I1QA 5FOUA 2AKAB 2WJHA 3CH4B 2QU8A 1NVUQ 3A37A 2VYFA 1P9NA 4FCWA 3ADBA 3BBPA 2FSFA 4GOXA 4JVLA 4PC3A 5B58C 2VL7A 1YVDA 3MLEA 2OXCA 3I8SA 4QJ3A 1XB2A 2ZITA 1OH7A 4TMTA 3AP1A 2PX0A 1RRPA 2PL3A 2AD1A 2VSFA 1KZGB 2IX3A 1YZGA 2JJ1D 1XJQA 3KJHA 1XMJA 3VU9B 3KQKA 1FMJA 5HZKA 3IEVA 1Q1QA 4OHZA 1JQJC 4HAZA 1ETUA 2QP4A 1N2CE 4JBXA 1UBEA 4U00A 4X8LA 1E2EA 1DG1G 4MGZR 4DWJA 3AVXA 4ERNA 2ZM5A 3M4YA 2RGNC 3EZ6A 1M7HA 1GP2A 4EIWA 1CJTC 2C9OA 3LLUA 1F48A 3GFPA 5E3HA 1T3HA 3P4XA 3VMFA 1UBGA 2CE7A 4ACBA 1G6HA 3AP2A 5SZKB 1NVWQ 3EA0A 2KE5A 2VEDA 3TGPA 5FBLB 1LF5A 4PSVA 2WBLC 1GG2A 4A8JB 1BH2A 3N5CA 2QZ4A 4LI0A 1E9RA 1NLYA 2IWRA 1ESNA 2VF7A 3AEZA 4M1SA 5KSZA 1E2LA 2WSMA 5J47A 1QHXA 1SZPA 4HZUA 2QGZA 4U7DA 4OQMA 4A2PA 1Z0KA 4CT5A 4EFMA 1E4YA 1FFHA 3SN6A 4IHQA 4MQBA 1GOTA 4GRAA 2OLKA 3KB2A 3ZVRA 1KYIA 1VIYA 1JEDA 3GLGA 2W0SA 1NKTA 3RS4A 2XB4A 5TARA 1IN7A 1HA3A 1XCMA 1E79D 4ESHA 1R8QA 4FMDB 5LPNA 3AVYA 2IHBA 3WHKA 2ZI7A 4Q47A 5ELXA 1PUJA 1XTJA 2ANCA 3MJHA 1I2DA 2IYVA 2IS4A 3RABA 2IS6A 2WMNB 5EQTA 2DWQA 4QGAA 5KDDA 3RANA 2ERYA 3CF0A 2D06A 3GFOA 3P27A 4EQ6A 4D0NA 3U61B 3SI7A 3L2OB 3U7GA 2MSEB 4DB2A 5CDFA 2J0SA 2WJIA 1OXUA 1II8B 3BORA 4KBGA 1QBKC 1UKYA 2ORVA 1HEIA 221PA 5FI1B 1P2VA 4A15A 3KUDA 3NBYC 2MSCB 1PVOA 2BV3A 4R7ZA 4B43A 2NZ8A 3AKEA 2IXGA 4LUCA 5TY0A 4FMCB 3GJ0A 2HDNB 2OCYC 1JPNA 2WPDA 5AUOB 3I62A 1N6IA 4GI7A 3OEHA 4V0LA 4DUGA 5EXTA 5JBQA 5CYOA 3QPVA 3V4FA 3HPQA 2F9MA 2ZS9A 1SVKA 3QNUA 2J87A 4HDOB 5J4YA 2QEQA 4NDZA 4A92A 1IQPA 2AXNA 4NYMR 4LHYA 4Z8YA 1IN4A 2W83A 1Q1ZA 2BMFA 3Q9LA 4NHOA 2CHVA 3LX8A 2GCOA 5JWOA 4B48A 1IAQA 3TUJC 1M34E 2F43A 3KKNA 3QVUA 4M1TA 5H70A 1GWNA 4PHTA 4Q7MB 3L0SA 4DZZA 5FBVB 1LS6A 5CYPA 2OO7A 3UANA 4G5GA 2IXFA 4IOMA 1W36C 1RPZA 2K5UA 4DC9A 2BCJQ 3GJ7A 3ZYCA 4C7OB 2HLDA 4KFRA 3GJ5A 3P32A 1ZVQA 5DGXA 2WTUA 3QKTA 4NYJQ 1OE0A 3U5ZB 1O87A 2W58A 4DT1A 2BIFA 1TPZA 4QJ4A 5IT5A 3B1WA 5GVRA 3U44A 2ZSAA 1DG3A 2HT6A 3CNLA 1OB2A 2ORIA 3REFA 1E2HA 2GEUA 2IYLD 2JEOA 1EWRA 3GEIA 4JKYA 1IJEA 4PXAA 1NMZA 2GVZC 3HYRA 4AG6A 2OLJA 1KI9A 2N42A 1WQ1R 3UMSA 4P4SA 2BBTA 4ON9A 1US8A 5FR1A 5G3ZA 3ZGXA 4DVGA 4AI6A 1BIFA 4WXPA 3FFAA 1CBUA 3HU2A 4C0LA 1IONA 1OIVA 3A1UA 4A0HA 3Q3JB 2RGXA 5EE3A 4EPWA 3THWB 1OB5A 4HB0A 1KI4A 3W5IA 3ZLJA 4MDFA 1G8HA 3GMTA 4JLAA 4A6PA 1TF2A 4DCUA 3X1WA 2O8FA 2RGBA 3C4JA 4R2HA 1YZTA 2FV8A 4AKIA 5DH9A 4DLVA 4QC2A 2G3YA 4Q4LA 1G8PA 4D82A 1SVMA 3V00A 4PHFA 4A9AA 4GP6A 1Q1BA 3K9NA 1YZQA 3T5GA 3RS2A 2FU5C 2V54A 3BS4A 4I99A 1AN0A 1S1CA 1G7CA 3PITA 2F55A 2CCGA 4ASUA 1LNZA 3LO5A 3ZZTA 1DAIA 4M9QA 1WA5A 4QL3A 5KSOA 3TRFA 1AIPA 1GKYA 2XOKD 3IPXA 2A5DA 2O5VA 3EPKA 1Z29A 5CK5A 3VKGA 2W6IA 5HCNA 2ZPTX 1F2TA 3GLFB 3GP8A 3AF3A 3DOFA 3F0TA 3G0HA 3O8RA 3LBHA 1ZIPA 3NVAA 3U2QA 1BMFD 2EU8A 5TMPA 4DRZA 621PA 3IEUA 1RFLA 3QSYA 1L4UA 4ZCLA 1XXHB 4PSKA 4BFUA 4NZYA 4A6XA 2GF9A 2QM8A 2XJ9A 2GXUA 3EXAA 3ZVLA 4HAYA 2LCFA 1G9XA 2DWPA 2JJ2A 2PMKA 2QM7A 3KQUA 4Z54A 4LBWA 4BZQA 3RRNA 3DDCA 2FMXA 4Q48A 1GILA 1OH6A 1GM5A 1A5TA 4ZKEA 2YYZA 4KAXA 1M74A 1MABA 3O8DA 1RZ3A 4PZYA 5JSZA 4LJAA 1R7RA 2BMEA 1W2HA 5JZVA 1P73A 2HCJB 4LY6A 3I61A 2O8DB 2J7PD 4HLUA 1CR4A 4LJ5A 3CLVA 4DLXA 4Q1AA 2JIZD 3IO5A 4PO9A 2C2HA 1XTRA 1NVVR 2IYUA 2BMDA 1U8YA 3EZ7A 1G16A 5FTMA 1HYQA 5TB5A 2MSDB 2CL7X 1Z07A 2ZR7A 4ABYA 3QVVA 4NYIR 2H8KA 3QUSA 3VHXA 2ZQ5A 2GK6A 5CJ2A 1R6BX 2TMKA 1ELOA 3QEOA 3CX6A 2Q6TA 1VG1A 4ZI2A 2WWIA 4NMMA 1P2UA 1CRPA 1U90A 2GKSA 5GJCA 1A4RA 2QAJA 1ZP6A 1IN8A 2I1VB 2WMOB 4RZUA 3LX5A 4DCSA 1ONBA 4D0LB 3CWZA 2HUPA 3BIFA 5FOXA 2VH5R 1PUIA 3TSZA 2QY9A 4M21A 2B6HA 2IXEA 4EPTA 1X8LA 4FCVA 4RD3A 1P5ZB 5DHFA 1ZIOA 2OV2A 4YMTA 1KK3A 1S96A 1NN5A 5KPDA 2IYQA 3VR6A 4OQFA 3AM1A 3R9XA 4A8JC 1G3MA 2A5YB 4TTQA 4A36A 5L3QA 5HKKD 3A1TA 4XJXA 3KX2A 4R98A 1QG4A 4NBSA 3N70A 3ADDA 4TL7A 1QHGA 4WA7A 2WZQA 1J8MF 3K09A 2WKPA 5EXSA 5SZHB 4KLNA 2F1HA 4EFNA 4YQFA 2QTVB 3CUEF 4CEJA 4II7A 3UG7A 2RGAA 1TL7C 5CM9C 5FUWA 1MR3F 1N0VC 1S8FA 3UWKA 3QPUA 4BLQA 1VPLA 4URWR 4QG7A 1NP6A 4JLDA 2ZS7A 1HUQA 1JPJA 3A4NA 1HT1E 1KAOA 5FPYA 1QHSA 2AX4A 3IPYA 1AKYA 3T12A 2ECKA 3NG1A 4D26A 2FH5B 2BBOA 3FE2A 1DAKA 4HDQB 1XEXB 2VQSA 2ZUCA 3NBZC 1OV4A 2ASEA 2C8VA 2VSOA 3AVVA 2JLRA 1R5NA 3EIQA 3WNDA 1DS6A 1XDBA 2J5XA 2AKYA 4UJ3A 4TT3A 2REBA 4TMZA 2OT3B 2PZEA 1T91A 4ITRC 3OZXA 3MGCA 1GSIA 3EZ2A 1U9IA 3SDZA 3E2IA 2X77A 4A4DA 1J2JA 4MRRA 3SU8A 3DKVA 3RLFA 2GCNA 4PR0A 3LVRE 2JCSA 3BJIC 1NSFA 5JFGA 1G4AE 1DAEA 2R6GA 5FOSA 1XTKA 3UMFA 2Z6VA 5B57C 5FUVA 3N2EA 1ZINA 4PAQA 5K8LA 1ZAKA 4B3BA 1TU3A 3EPJA 2BBSA 2XNDA 4MYCA 4LBYA 3B1VA 4URVR 1TQ4A 3GLFE 4PO1A 2F3RA 3VQTA 4YLGA 3QPWA 3K0CC 1XEFA 1XZQA 2NPIA 2JLZA 2V6IA 3NTUA 1XXHE 2G83A 5FFMA 3T1OA 5D3MB 4CYMA 1KNXA 3T35A 2WJYA 1G7SA 5LB2A 3L0IB 3W8NA 4Z51A 3M0EA 3TVDA 1Z6AA 1LB1B 1T8UA 1CR2A 4IDQA 4JKIA 3C8UA 4HZIA 4PX9A 1YE8A 4YONB 3OFNA 5KU1A 2OEPA 4LJ8A 4G5RA 2Q0HA 3AVTA 1H8HD 1OF1A 4L16A 1X6VA 3SJZA 121PA 3QF4A 3SE0A 1NNEA 2XTMA 1T0JB 5EE9A 3Q5DA 4A0GA 2IYWA 4LBZA 2VHCA 8OHMA 4LBVA 4OL0A 4TMWA 5FBRB 2QMOA 3ZS8A 1VCOA 2XGJA 5DO9A 4XSHA 5JLJA 2OCBA 2ZJ8A 1N5JA 3MFYA 2YC4C 2ZRFA 1YRAA 4R71A 4F93B 1BOFA 5IK2D 3THYA 2IS1A 3AP3A 2YOHA 1WDTA 4XWKA 1KIMA 1OXSC 5AJXA 2HXYA 5KDLA 1IY2A 1EG7A 3HP1A 4EJSB 4RZ3A 1JEEA 4Q4AA 4LK2A 1NRJB 1OLOA 1XWIA 3B5JA 3RS7A 1B23P 2F9LA 5FL7A 3CNNA 4F4JA 2OBLA 2ZAMA 1LV7A 1E9BA 3TQFA 4XWOA 2QBYB 1YR6A 5GJWC 1OFUX 2H57A 4NYIQ 2XJ4A 4Q1FA 3IO3A 3BXZA 4P33A 1RC8A 1U0JA 1YJ5A 3CBQA 3TJZA 3TKLA 4Q4HA 2N46A 3KQLA 1II9A 1ZNYA 4HATA 4M22A 5F2EA 3LAWA 3B78A 4C3ZA 1P6XA 2NPFA 1W2GA 3ZH9B 3RC8A 2Q3MA 3A36A 1D2MA 4GMXA 3DMNA 2B21A 1ZYUA 5HE9A 2F6RA 2Z0MA 4IVRA 1GFIA 1GL9B 2FFBA 3OEEA 1N6HA 2V4ZA 1UBFA 4TTRA 2YKGA 1XD2B 3K9HA 2IUUA 2YV5A 3TUZC 5KSPA 5EP2A 1K5DA 2EWWA 1KDRA 5DI3A 4R2IA 1MO5A 1II0A 1P72A 1IY0A 3GPLA 1K8RA 4LX0A 2QT0A 2NTYC 1OH8A 2X8AA 2NO1A 1IOZA 3MCAA 1E1QA 1XMVA 4JVNA 2BEKA 2Q9CA 2AFHE 2WJGA 3F3YA 3IDQA 5DE3A 5JHHB 1FNMA 1G5PA 4JLMA 4W7SA 2IYXA 3U4QA 1N5IA 4WOPA 3U3JA 1CIPA 1MO6A 4AG5A 5FI0B 4KV9A 4DB4A 4Q66C 1DBSA 3D8BA 3MUFA 3B6EA 3K0SA 1Z3IX 4KSBA 2IUTA 2ODEA 1KHTA 2ZJZA 4B34A 2R6FA 3WXMA 4G5OA 1P62B 4ASUD 4TLAA 2F7SA 2F3TA 4N1AA 4RFSA 4D0GA 1NIJA 1GNRA 3TAHA 4Q9JA 1N5LA 3AF1A 3X2SA 2DWOA 4DBLC 2HJVA 5LD2B 3SYNA 4HLDA 3A1SA 2VRWA 2VHUA 3GD7A 1AS2A 1G21E 5DLQC 1M7BA 4MRPA 3NKVA 4OHYA 1AZTA 2P5TB 3FHOA 5G3YA 3RSLA 3EX7C 2FEOA 5BYJA 1G41A 4RD4A 3VNUA 3W34A 4Q19A 4M9ZA 1VKJA 2ZJ2A 1D6JA 1D8TA 2JJ2D 2ERXA 2R6DA 1UPTA 5UKDA 1XCPA 2HEIA 2IF2A 1ANKA 1JR3A 1UFQA 3FB4A 5KDOA 3IQWA 3GEEA 1T3SA 2BOVA 2IYTA 2R62A 2FPMA 2ZRDA 3OF5A 2PJZA 4CEIA 4BLSA 2DHRA 4ZI3A 2QMEA 1T8TA 1X86B 2O0KA 4OI1A 2RHDA 3RYTC 2CK3D 2LKDA 4ARZB 3ADCA 4LWZA 1M6NA 1E9DA 3TW4A 4U5XA 2W6JA 2Q3FA 1KI6B 1NG9A 3ADKA 3QXSA 1I2MA 1DARA 3L8ZA 3W6PA 1JI0A 3MSXA 2UKDA 3Q8XB 4NYJR 2ZRJA 1TEXA 4PQRA 1DEKA 4W5WA 1U98A 4CF7A 3B60A 2JAQA 2J0UB 3BB3A 2ZU6A 4RKEA 3L0OA 4Q9KA 3O8CA 3B7GA 5CJPA 1NN0A 3S1AA 3FMOB 3K9LA 4C2UA 1ZMXA 3QXJA 4PC7A 5H8WA 1QHHA 2I4IA 1N6KA 1KKMA 1ZC3A 2BDTA 1KKLA 2NGRA 2Q21A 3CONA 3CRVA 4EPRA 1AA9A 2ZXUA 2JLSA 2GILA 1FUKA 1AGRA 1XJ0A 4UNQA 4ZDIA 1SVWA 1W4AA 2A3RA 2O8EA 1G7TA 1W46A 2ZUDA 4LOAA 1R5OA 4DT1B 3FKSA 4KXFB 4P0TA 1Q12A 3QBTA 4MGYR 1AKEA 4B2IA 2G0NA 2VIIA 3SQXA 2YVUA 4LYHA 721PA 2IF0A 4QGFA 4V0ME 1M7GA 4EAQA 2QGNA 2C78A 3AVOA 4I81A 3M1IA 1ZW6A 2ZRNA 2CJWA 3FKQA 3BH6A 2YC2C 3AVQA 4RD6A 1T5LA 3ICQB 3RAPR 2X1VA 1R0YA 3FYHA 1NG1A 1OIWA 2JJ8A 821PA 1AQYA 1ZNZA 4JT2A 2B92A 3QKUA 4JZKA 4TL6A 4POAA 1SXJA 4XVQA 1BKDR 4HLQB 4BWYA 4QGHA 1RJ9B 1EFHA 3X1YA 5G40A 4MKHA 2VBCA 5JEDA 4IDPA 2GJAA 2FFHA 1P2TA 1U99A 2ZRHA 3TSOA 3NXSA 3W6NA 1G3QA 1YZLA 4B47A 2R8RA 2RGDA 4US2R 1VYVA 2GAAA 4C30A 4LC0A 3U7FB 3AKCA 2BBWA 1IBRA 4NTZA 1XPRA 3HJNA 4YDHB 2KB0A 3K8YA 4KSCA 1A2BA 1FP7A 3GJ4A 3JZMA 3C5CA 4KFUA 2HXSA 4N3NA 2ZRPA 1TX4B 3PENA 4NCKA 3SC3A 1K6MA 2V55B 2FJUA 2C9CA 2QMUA 5KNBA 3WRXC 1JJ7A 1HURA 1NIPA 4TSFA 3R7WB 3LNCA 3U7HB 2NIPA 2G77B 1KI2A 1K5GA 4XIGS 2XNDD 4C0BA 1R10A 4O2LA 5F3WB 4BUJA 5H68A 2FNAA 2Q9AA 4PHHA 5DHAA 1SGWA 4DKXA 3VFDA 1W7AA 2IC5A 4F4CA 1CS4C 3RRZA 4B76A 3DZ8A 4Q9LA 4D4JA 5GJVC 1XTQA 2AFIE 2EYQA 3ASYA 4EJSC 5BWMA 2EFGA 4DCNA 5J4VA 2ZR0A 3ONWA 2ZYUX 1SKQA 1UADA 1ZNXA 4GNKA 4IVPA 4BFZA 3WBJA 4QM7A 5C2JB 3THOA 3R9IA 2ZSBA 1DAGA 2GJSA 2X19A 1OJLA 3W90A 3QKSA 5CDFE 4UXIA 1JECA 4OQNA 2WVJA 3LV8A 4QXAA 2WV9A 1RVDA 2IYYA 4JLJA 3D3QA 3OFND 4QBGB 3EZFA 3K0FA 4GBMA 5J5CA 5D3QA 3NDPA 5EJEA 3T1TA 2EW1A 1OT3A 3FDIA 4Q18A 2KI5A 2ANBA 4DSTA 2CE2X 5EE0A 1TMKA 5JECA 1VCNA 1P9RA 4DLUA 1ZD1A 2CL6X 2J45A 4P31A 2GCPA 2YWHA 1Z08A 3EIHA 3NBXX 4TL8A 3DHWC 5EE5B 4F92B 3P26A 3VR4A 4BFYA 1IN6A 2OBNA 5JJLA 3P4YA 1P2SA 3RRMA 1Q44A 4HUQB 2A78A 1JQLB 2BKUA 3TK1A 1HV8A 3OAAA 2P5SA 1ZM3A 1S3SA 4W9MC 2XITA 5L8VA 2AWOA 1R8SA 3D31A 3ND9A 4HAXA 2OCAA 4NE2A 5AWFC 1L8QA 2D4HA 3LD9A 4DLRA 2J9RA 1DO0A 2C5LA 1DPFA 5L3RA 1UDWA 3BH7A 2H17A 3W3AA 2VP2A 2GJKA 4OI4A 2QPTA 2Z43A 4URYR 4G01B 2XXAA 2D2EA 3IHLA 2J1LA 3DL0A 3KTAB 4OK3A 1AK2A 1LVGA 3KXIA 4S35A 1HT2E 1E2NA 2VO1A 4BFTA 2O8BB 2QE7D 2SHKA 3I1FA 1GIAA 3SHWA 4PO8A 3K70B 1WMSA 4NCNA 4QHTA 4UNNA 2OE2A 4RJLA 1AS3A 3SZRA 4P32A 3AVUA 2OFWA 4IW3B 1BYIA 2L0XA 2QP9X 3RHFA 4ZCIA 1VG0B 2YZ2A 2PT5A 4LJ7A 1PLLA 5DN6D 1NMYA 4B32A 4B44A 3RSOA 1GITA 3K0AA 4M0LA 4Q4JA 3VR2A 1N6NA 1L4YA 2H7VA 2WKRA 4Z8XA 3TR0A 4UXJA 5LD2C 3SR0A 3W3ZB 3CX8A 4H1UA 2VLIA 2GJ8A 1X8JA 4QJ5A 2WOOA 4PPGA 3LXRA 1G3RA 4IVQA 2X2FA 5DISB 1XNJA 5DNYB 1Q3HA 5EP3A 4C0JA 3PR1A 1Z06A 2J41A 2MMGA 4FMBB 3KQHA 1OFHA 1P60A 2VF8A 3BD9A 3KJGA 4OYHA 4L9SA 3GLHB 4RZ2A 2FA9A 3P1JA 2LKCA 1WCV1 1OXVA 4AD8A 2REOA 1KO4A 1U81A 2FG5A 2P6UA 3VU9A 4YMSA 3I72A 1OIXA 1CLUA 3BB4A 5TDHA 2ZANA 4Y0AA 2IEZA 3RNLA 4DLZA 4Q9HA 3QIAA 4FW9A 1TF5A 4A2QA 5KNCA 3DKPA 3H1TA 5F98A 1N0WA 1JXMA 3LBNA 4MH0R 1W4CA 4HAVA 1CJMA 2FZLA 4BPBA 5BYKA 3ZIAA 5GADl 5L3SB 1T5IA 4IDNA 1UAAA 3MWJA 3LQRA 3PQCA 4QHYA 2ZIAA 3DMDA 4RY2A 1G6OA 4A1FA 4A8JA 3AF0A 4JLKA 5FTNA 2YWFA 1AQUA 3UATA 1JAIA 4LRWA 1E9EA 4BASA 1E32A 2R9VA 1ZCBA 3BK7A 3THXB 1X8KA 2FOLA 4DXAA 2OUKA 5FTLA 1WBDA 3TW8B 2QN6A 2DFTA 3B1XA 4KHZA 2BEJA 2EFEB 2V1UA 2ZE7A 2HV8A 1GKIA 1S9DA 4BGDA 5B30A 3LDAA 1NBMA 2CVFA 1D5CA 4IXMA 5FBQB 3KUCA 3T61A 5CITA 2P6RA 1UBCA 1R0WA 4XH9B 1Z0IA 4FXPA 2HT1A 1CEEA 3NWJA 5IHPA 2EFDB 2PH1A 1W1WA 3ZZ0A 4D4MA 4TZ0A 2WSSA 1OFIA 1XTSA 3MAAC 3I3SR 4EKDA 4ZDJA 3DVLA 3AF2A 2PJRA 4RCZA 1DAFA 1E2KA 1NJGA 3PEWA 2CLCX 3JZAA 3EARA 2W2VA 1EFTA 2OSBA 1T4GA 4KFSA 1II8A 3GJXC 1VIAA 2KJQA 4C0AC 4IOKA 3CKLA 4C4PA 3H4MA 4DSUA 2ZETA 2VP4A 1VG8A 4IDHA 4CEHB 1CRQA 2CEAA 3IIKA 3IQXA 4JBWA 5C18A 4ZIRB 5B64A 2QAGB 3X1DA 2V9PA 1NI3A 1IXSB 3Q7PA 2WAXA 4JL8A 2R44A 1TEVA 4UNPA 1R0ZA 4V03A 4QKQA 1F60A 1QRAA 2C77A 3TE6A 1NKSA 3CO5A 4RFVA 4DLTA 4F91B 4N0EA 3QG5A 2JDIA 2CBZA 5FTJA 2V3CC 3BGWA 5K8IA 4CRWB 4GDFA 2Z4RA 3O47A 3K0EA 4IRUB 2CCKA 2ZTSA 3AKDA 3W9YA 2BKEA 3FKSD 4OQXA 2ZSDA 5KTYA 4GFDA 3IGFA 421PA 4TQ9A 4BRWA 2GF0A 2H1LA 2X2EA 4AKEA 4BEBA 1GZSA 3ZVMA 4LGMA 4HDCA 3QKRB 4C7OA 1G8YA 3DM5A 4BLTA 4D4LA 2ZYVX 1G7RA 1UF9A 1HE8B 3GJ6A 2C03A 4Q02A 2ZRMA 5DI9A 1RRGA 4EUNA 1B0UA 1M2OB 1SVOA 2H5EA 1SXJD 3AQ4A 3UMRA 1KMHB 1FQKA 3EWAA 4L8GA 4WW0A 1YKSA 5C4MA 1E2QA 5SZIA 1KY3A 4DHEA 1E96A 1RYHA 1A82A 1UM8A 2ODBA 3FVQA 3PV0A 3E1SA 3HR7A 1LW7A 3L43A 4MGKR 4HAUA 1P61B 1JJVA 3EZ9A 1FL9A 3AH8A 1SHZA 3KJIA 3KQNA 1RIFA 3FMIA 2EVWX 3I4LA 4ZO4A 3WNBA 4QBIA 4DEXA 4ZV4A 5FUXA 3GLHE 2G88A 4HB4A 2VP0A 4BLOA 3H86A 4OJKA 5AJWA 2XZOA 3Q72A 3ASZA 2JJ1A 4ZPXA 2G1JA 1XMSA 3THWA 3TR5A 1E1RA 1TADA 2RMKA 2QORA 3SYLA 1YRBA 1KJZA 3KFVA 4BLPA 2R2AA 1KI7A 4HYYA 1P9WA 2Q3HA 2IYRA 4Z1MA 2P65A 3PEVA 3CNOA 3EC2A 3C7KA 1GDDA 4C2TA 1S4QA 1W36D 3NHAA 5BQ5A 4CDGA 5KOYA 1Q1EA 4TYWA 2QUZA 3FWYA 3B82A 1CTQA 1XD8A 4TSFD 1KSFX 5CLQA 5J4KA 4Y0VA 3KXKA 1ZRHA 3B1YA 4L4UA 1ZM9A 5JCZA 2OBMA 2QP3A 4QRHA 4TLDA 4OBEA 3ZD7A 4JIMA 3CPJB 4L9WA 4Q1BA 4C9BA 3A1WA 1MRNA 3BOSA 1Z0FA 4I1OA 4LHZA 3ICEA 4Q01A 4DDWA 3KKPA 4JMPA 4BFXA 2GVDC 1KI3A 4JSYA 3WMGA 3ECCA 1GKUB 1MO4A 4G0NA 4IDOA 4KI0A 3TSWA 4EFLA 3UG6A 3GLFA 4D81A 1G3IA 3VKHA 4G3XA 1E3MA 3BFVA 3MMPA 5J40A 1GNQA 5HZHA 2E87A 5KUTA 4HB3A 4CEIB 1N25A 2OAP1 1UJ2A 1XXHA 2BJVA 2FZ4A 5LBIA 4DDTA 1GUAA 1M1YE 4NL4H 2PCJA 1ODFA 4B71A 3K70C 3LW7A 3FMFA 3QJYA 2BWJA 1KK2A 5JHGB 1NMXA 2GESA 2JA1A 3SJCA 2HJGA 2WPDD 2XTZA 5DYGA 3BRWD 3OEHD 4I1SA 3T1QA 2HCBA 4DUGD 2XEXA 5J4LA 1E9AA 1NF3A 2CHGA 4HAWA 3V9PA 1NL3A 2WWGA 3R20A 4TYPA 3F8TA 3EASA 1XMIA 3G82C 3OAAD 3KKOA 4MDEA 4OI0A 2NO9A 2OG2A 4IXNA 1TUIA 1OYYA 2O8DA 4GL2A 2NG1A 4PPQA 3CR7A 2DYKA 1W48A 3B9PA 3SS8A 5EZ6B 3CZPA 2AXPA 5AUQA 2RGCA 4K46A 1EESA 1Z22A 4A2WA 2RCNA 3VX4A 2D7CA 3GLIB 1F2UB 1XD9A 5M04A 2HLDD 4H9GA 4LJYA 4OQLA 1T6NA 1ESMA 2FDCA 1ZM2A 1Z0JA 3SHFA 2O8EB 4NP6A 4PC1A 1G20E 1XZPA 2ZEJA 1JBKA 2JATA 4XD7A 4Q21A 2P67A 2WIAA 4G5QA 3UIEA 1DE0A 1GRQA 4B3GA 1J7KA 2G0TA 3IHWA 1KNQA 3PIRA 3N2IA 1FOEB 4ZKDA 1EK0A 3L0PA 3BERA 4PQFA 1QHIA 4GOJA 3VR5A 1ZJ6A 3ZQ6A 5JI2E 2H92A 3PUXA 5JEEA 2F1RA 1ZD9A 3NC1C 4I1UA 2REXB 3B85A 4F38A 1G17A 4EPYA 2NMVA 4AWXA 2J46A 5A4JA 4KYUA 2WM9B 3NH9A 1O3YA 1YHNA 2A30A 4LYAA 3K9GA 2C96A 1SXJB 4LYFA 1BYUA 1LFDB 5AUNB 1OPXA 2NZJA 5GJBA 1COWA 2GZDA 4TQUS 4LDJA 2OM2A 2FSIA 3KFXA 4FMDF 4A0RA 2QRZA 3W8RA 5JMTA 2ZJOA 4IJMA 5A0FA 2VHQA 2XTNA 3T5DA 2GBLC 1C1YA 1KDPA 3GFTA 4G1UC 4WXRA 2O8CA 4JL5A 1ZD8A 1A2KC 2GA8A 2V1XA 3LRPA 2NOAA 3CRRA 1E2MA 3QBVA 2OZEA 2ZVPX 3JVUA 4MITA 3QXXA 5DSZA 4ACAA 2ZJAA 4QGGA 1MOZA 4YC7A 1TU4A 4M9XA 5K8TA 2QL6A 4HZUB 4MRVA 2RAPA 5EUQB 3UK6A 5C46F 3T34A 1Q3TA 3NEJA 4JYBA 4B3XA 2GJ9A 4PFSA 1BS1A 3PCRB 3QOFA 1JNYA 3E5HA 1MO3A 2IK8A 2D7DA 4X8HA 2RHMA 3PUZA 1OYWA 4PPFA 2IL1A 3GLGB 4LPKA 3B2EA 2W6ID 1AGPA 1RW4A 3TMKA 2QMHA 4FMCF 2IHYA 3RS5A 4NCJA 4UXHA 2FE4A 4AIIA 1JAHA 4JLVA 1EX7A 1OXTA 3W6OA 2QQ0A 1XPUA 4RSGA 4L5BA 3IKJA 2QAGC 1TUEA 3OIVA 521PA 1FPMA 4JT4A 2XOKA 4K8OA 3U3KA 3I73A 4WBSA 2DBYA 4EQ6B 1EFRA 1QZXA 1UEIA 4FN5A 1NBMD 2OFXA 4BEJA 2GNOA 3K1JA 3C16C 2KBFA 2W2TA 3QKSB 4Q03A 4FWIB 4BQSA 3MRSA 4HI0E 1NY5A 1JALA 1N6PA 4XTRA 2OILA 3K0FB 1L2TA 4DLYA 4B2PA 3DM9B 3FMPB 2RGNA 3ZZUA 1TNDA 5D3MA 1G291 2KBEA 4XSGA 3WYGA 3IBGA 2WWYA 4BE7B 1XX6A 4RD2A 1HQCA 2XNSA 2VP6A 2QSZA 1FW6A 2ZRGA 2YHSA 3CH5A 5G53C 3BFXA 4GZMA 2AWNA 2EWVA 4PHGA 4M1WA 5JCPA 3J81k 4KODA 2LWIA 2XX3A 4G5SA 4NCIA 1QHYA 3ZJYA 1YR9A 3VX3A 1LS1A 4YMVA 4AY2A 1YZKA 4YDSA 3H0KA 2D2FA 2PLRA 2VSXA 4TMXA 2GCOB 3GJ3A 5FUYA 3FGNA 4CIDA 4F4IA 3R9WA 2J7PA 1TQ2A 1U94A 3TLXA 2BCGY 2F43B 1J8YF 4V0NA 1AJEA 2CLSA 1RKBA 3EAQA 4IEEA 1PZNA 4MYUA 4KLZA 3RC3A 2GXAA 3MJRA 5FOTA 3F5FA 4PAMA 3DEFA 1R5BA 3DO6A 4WIAA 1G5RA 5JS8A 4TLCA 1OSNA 3SQWA 4B3CA 3AV0B 4Q5IA 3GLIE 4B74A 1ZU4A 1XU4A 3H2YA 1LF0A 5GVSA 5KNDA 2ZRAA 5E7JA 4D4KA 2PX3A 1Z0DA 2WWFA 3CPHA 1ZU5A 1ZCAA 2EFHB 2AK3A 3BB1A 3U44B 1CF4A 2QROA 2RGEA 3IBYA 1G3UA 5AUPB 3ETLA 4XVUA 2FGJA 1PJRA 1S1MA 1GL6A 4A0FA 3LH5A 3FFBA 2ZROA 4QNRA 1A1VA 1Z28A 4QHSA 4QM6A 2WWWA 3I8XA 4KITB 1HH4A 5FOVA 3X1XA 1RRCA 4M1OA 2QBYA 4P4SB 1US8B 1E69A 2A5GA 2R65A 3CIOA 3CF2A 4IEIA 4LJ6A 2ONKA 4M2LA 5DYIA 4GOKA 2B7BA 2QENA 3BC1A 4IOLA 2PLFA 3PUYA 1NVXQ 3WMEA 5HKKA 4V0MA 4IOJA 1KJWA 1SXJE 1NJFA 1WE2A 1E0JA 5KHOC 3B1ZA 3CRW1 4YMUA 4KFTA 2O8FB 1Z6TA 2GK7A 2P3SA 1Q22A 3RWOA 4CVNA 3ZVNA 1PV4A 1N3BA 1SQ5A 1Q21A 1KTVA 3M6AA 4TT3D 1XD2A 4NKRA 1Z2CA 4QBFA 4LPSA 4TLBA 2UZIR 2GZAA 3A58B 4M53A 5ANRB 4KBFA 4Q00A 1E1RD 5AJYA 1C4OA 1P75A 4QOSA 1W0JA 4Z1MD 1KJYA 4FWTA 1Y3AA 5K8UA 5IF9A 1KAGA 3FHCB 4B3FX 2WHXA 1NN1A 4XWAA 3AKYA 1YR8A 3JVVA 1S9HA 1G8FA 4RVCA 4UQOA 2WKQA 3PUVA 1CJVC 4MKIA 2ZVQX 1KO5A 3WHLA 3K53A 4X8MA 4CT4B 1E4VA 2AR7A 3GLGE 5E4FA 1F2TB 2BJWA 2CVHA 3PFIA 1WBBA 3EW9A 4MUAA 4RKFA 4LYJA 1E9SA 1KZ7B 1XJCA 1NN3A 4X8OA 2ZRCA 4JL6A 1IHUA 1VG9B 1NLZA 1XEWY 1MT0A 3CF6R 2WWXA 1JR6A 5FPHA 1OKKA 3OESA 4K81B 2ZE8A 4LV6A 3NH6A 4LV5B 2C95A 5HTKA 1WXQA 3WY9A 4NONA 4AYWA 4QFMA 2HYIC 1XCGB 2VHJA 3DPUA 1F5NA 3GEHA 3PVSA 1WB9A 3LBIA 2YOFA 4JLNA 3WP1B 5HR5A 1MABB 3OIYA 5JSZB 1GTVA 4TZ6A 5EP4A 1KO1A 4US0R 1Z6XA 1SVLA 1VECA 2ZYTX 2EQBA 2H18A 4KVAA 2FWRA 4HUTA 3I32A 3IIMA 2A5FA 2IWHA 4O2RA 1CJUC 3U7EB 1W47A 1QF9A 1XFAA 3OE7A 3RVBA 2UVQA 3BE4A 3HPRA 3KDSE 2NO6A 4IFBA 4AKHA 1M8PA 4BFWA 1XBTA 2QT1A 1FX0A 1JXOA 2ATVA 5KO2A 1SKYB 4OK6A 5KSYA 1SXJC 1H8HA 1Z6YA 1OHHA 2WWHA 4JBYA 5CB8A 4ARZA 2ZR9A 2EFCB 4NU0A 2CLDX 1KI6A 2PEZA 2G9NA 1ZBDA 4JVMA 1NSTA 1X3SA 2QA5A 4RD0A 1PLKA 4MKFA 2J7KA 4TYQA 1RYFA 2BVNA 4NCHA 2ZRLA 5AJZA 5FL7D 1J70A 5P21A 1T9HA 5CB6A 5JS7A 1VYTA 1YU9A 2J0UA 4TN1A 5IK2A 2VP5A 3RS3A 5BN3A 4XD7D 4Q1DA 4MRNA 3VKWA 3SFVA 2JLVA 2Z83A 3EPHA 4EPXA 5E7MA 2VTKA 2ZRBA 5L3QB 2ZRIA 1Z2AA 3NHBA 3CW2A 2WICA 5JJKA 1T3LA 3IUYA 1VMAA 2XAUA 1KMQA 2P0EA 2FX3A 4GT1A 4BECA 4DIDA 4WAUA 5HPYB 5BN4A 1GL7A 1X1SA 2QPAA 5FPSA 3BWDD 1Y63A 2JLQA 3CWQA 3C5HA 1CR0A 3TUIC 1DELA 2B7CA 1D2EA 1GRNA 3OEED 2AHOA 3R8CA 4A82A 4CW7A 4CEJB 3EIEA 2RH5A 1H8EA 4OJQA 1SVSA 3WRYC 3GQBA 4B35A 2F1IA 2XSZA 3U60B 5F9HA 4BZXA 3L8YA 5KPJA 2IUSA 1QG2A 4CGZA 4FINA 4OHWA 1EFCA 4E03A 3MWLA 4XTCS 1COWD 3LXXA 2ZI4A 1CR1A 2OAQ1 4V0OA 4JVSB 2ZI5A 4WVFA 2FFAA 3FHTA 4Q7JB 1E1QD 3Q85A 5F9FA 2ZE5A 3CRMA 2GTPA 2CDNA 4DJTA 3PJRA 2FGKA 3LQQA 3WYFA 4I4LA 5DIFA 3C41J 4AK9A 1XEWX 5TVKA 2AN9A 2CXXA 2RB4A 3ZD6A 3GCGA 3A6PC 4W5JA 2CHQA 3KKMA 4B75A 3QENA 4QNMA 1E2PA 4DLSA 1W0KA 3QI2A 3TNFA 3NDBB 2QG6A 5CIWA 1ZNWA 1RJ9A 5JI3E 4UKDA 4TYNA 2P2LA 4OHVA 2ZJYA 2JASA 1KO7A 1P3JA 1E94E 3AGPA 4M1YA 1C9KA 2WIBA 4U02A 2NO7A 4QBHA 1Z63A 1IXRC 2E9SA 3NC0C 1YZUA 2G1KA 4JJKA 1NLFA 2B8TA 3NIBA 4L15A 1V5WA 4MYHA 1DADA 1VYUA 5CM8B 1W5SA 2MMCA 4NPHA 3QEJA 3B13B 5AJVB 5BN5A 1E2IA 1R2QA 3FTQA 3HU3A 5SZJA 2KSQA 4KO8A 1P4SA 2D62A 1E2JA 4TMKA 2GRJA 2ZI3A 4YXWA 3AF4A 4AURA 4TTPA 1CP2A 3VR3A 3R7WA 3IIJA 1ZUHA 1W5TA 1JR3D 2IA5A 1EFRD 2BM1A 1N0UA 1KSHA 1YQTA 3CR8A 4GSYA 4HEJA 1NBME 2PT7A 4Q1EA 2Z5FA 2YNMA 3Q5EA 3PG5A 3QE0A 1FTSA 2FPKA 3PEYA 2FSHA 1E2GA 1N6LA 1OXXK 4FD2A 3LA6A 2DR3A 5IRCD 4MYTA 4TYYA 1QHNA 1NY6A 2FN4A 1Z8FA 3TQCA 3QF4B 1E2FA 2WOJA 3RWMB 1I4LD 1R4AA 2W6JD 1AS0A 4C0HA 5AR1A 2CNWA 3SBEA 4DDUA 4PC6A 4IFEA 2P6NA 5FPKA 4JYCA 4LJ9A 3WYAA 4FIDA 3CRQA 4KVGA 3U6BA 2Z4SA 3LWNA 4LCBA 1EWQA 3THYB 2YINC 2O0HA 4PAOA 2GZHA 1WP9A 2QQEA 2YWEA 1SKYE 1FQJA 2CK3A 4AYXA 1U0LA 1X1RA 3PEUA 3EC1A 3WNCA 1N5KA 1GNPA 4Q4AB 3ZDQA 2JLWA 1E98A 2VP9A 4E22A 3UXMA 2J59A 2QNRA 2DCUA 4H1VA 3A8TA 3D7MA 4UJ5A 4HUQA 5J4HA 3C14C 2V6JA 3KZ1E 2ODWA 2FEMA 1AZSC 2OXRA 3AUXA 1KGDA 2WAYA 3C15C 3K0CA 2DPXA 5JJIA 4Q4HB 3AB3A 1EFUA 4B73A 1E9CA 1E9FA 4KCGA 3EPLA 1HQYE 2J0QA 2BC9A 4US1R 1U8ZA 2KWIA 3VNVA 2I3BA 1GVNB 4RD1A 1P7CA 1FNNA 2AL7A 3PXGA 3RS0A 5EE1A 1SVIA 4D25A 3T15A 1IN5A 2ZYWX 3KTAA 4MGIR 3CZQA 5LDDC 2VHTA 2V7QA 2O8BA 3DZDA 3EG5A 5H1YA 4DCTA 1Z6GA 5FTKA 4NYMQ 4BFSA 1KO8A 1W44A 2ZAOA 1N6OA 5DI3B 3B8HA 3VR1A 1IXZA 4WZ6A 5HCIA 4PC2A 1MKYA 5FBWB 3RDPA 4TLEA 1AM4D 3WMFA 5C1BA 1DAMA 1G4UR 5E95A 4PTLA 5EUMA 2C04A 5EZ5A 4M1KA 5C4GB 4PSAA 1XRJA 2O8CB 3U4QB 1D9XA 2QTHA 4E5UA 1H65A 4DCVA 1DO2A 1E0SA 2OFOA 5TV2A 4LC1A 2OCPA 4Q1CA 5EP1A 3QF7A 1SHKA 2A9KA 1W0JD 3QXCA 4URUR 4HLUC 4W5HA 5G41A 5KYKA 4V02A 2YOGA 3NEYA 1KY2A 1UKVY 3GLHA 4RFSB 4PZZA 3ZS9A 1RRFA 4MKGA 1J90A 1JB1A 3I5YA 3ZQJA 2GEDA 3SNHA 2DFLA 2ZREA 2IW3A 2GWHA 1A7JA 1U0HC 2IYZA 4J0QA 2GXQA 3ND8A 2J0VA 3TH5A 4DSNA 4D2IA 4O25A 1TQDA 4BFVA 2NQ2C 1G5TA 4BLRA 1E6CA 1HTWA 4LHVA 4B33A 3LVQE 5BXQC 1CULC 3BH0A 3KB1A 1KSJA 3G5UA 1OKKD 1Z5ZA 3IILA 2Y8EA 5L3SA 2V8OA 2W00A 4O0MA 3A4LA 2GDJA 4DEYA 4ILEA 4WZBE 1DVRA 1E79A 5IDVA 2ZU0C 3H84A 1IJFA 5E7IA 2HYDA 4ESVA 1GRRA 2CMKA 3VHLB 3U3MA 3CPEA 4KYIB 2XB2A 1OFTA 2VA8A 2N1BA 4M4SA 1UDXA 5CIQA 3QXHA 4ZCMA 1VHLA 3THXA 4GMDA 5JRZA 1LY1A 2NO0A 1EX6A 3EWSA 4OKSA 4V0KA 1MRSA 2GBLA 1V43A 3K09C 4DSOA 4JS0A 2PMDA 1S0UA 2QPOA 4C0SA 2AD5A 1F3OA 1PLJA 3OE7D 1FZQA 2ATXA 1R0XA 4GP7A 2R6CA 2ONJA 1XPOA 3LY5A 4AKGA 2ZSEA 1OHHD 4PANA 4C0KA 5JWHA 3S1AB 1GAJA 3E70C 3TBKA 2A2ZA 1FTNA 4S2EA 2DB3A 1QHHB 5FH9A 2D74A 2GAOA 2E1RA 2IS2A 4YMWA 2UZ3A 3QY0A 2ZSFA 2FSGA 4M1MA 3R8FA 3MD0A 2XZLA 1ZUIA 1U8AA 5BW8A 4CEHA 1VTKA 4M8NE 4XOIA 2ZRKA 1I4DD
chains in the Genus database with same CATH superfamily
2VWQA 2BZ1A 4LSWA 1TKBA 1U9IC 1YOVA 5AXDA 4AWBA 4BMNA 3ZOZA 2X0KA 1YU6A 2RJ3A 1OTHA 3B9BA 4JIGA 3DP7A 3SQDA 3ZV4A 3UHPA 1IM2A 1F7VA 5JMPA 5EZSA 2C83A 2FQQA 3GVHA 4YACA 1PEAA 2C7OA 1NVVQ 2JNWA 1G20A 2J3EA 1EGAA 2QGFA 2Y76A 4RF3A 3TE7A 1D4FA 4O1MA 1YS1X 4FLMA 1H8ED 4Y2HA 4MGEA 1EXMA 4AYTA 5ICEA 1YTLA 1EUDA 3Q7SA 4WA8A 1I6KA 4O2BA 4J4TA 4KGXA 4ZZIA 1U7PA 3IRVA 4E5NA 4CM3A 3LCUA 3UKDA 3Q8WA 5I45A 3R74A 1PEDA 1RQGA 4FDLA 4LZOA 4MIYA 5DN6A 3JPWA 1J99A 4MVJH 3WBKA 1GNTA 2QRHA 1L1RA 2BUAA 1TF7A 1UFKA 1VBFA 2I7DA 3OIWA 4FFVA 1JHQA 2BHRA 1DV1A 3VZDA 2O2ZA 1JX6A 3IPLA 4KZKA 3A4YA 3FGZA 1KMHA 2XT9A 3SYKA 1HE1C 2KLHA 3A4MA 3N8GA 3SF8A 3W5UA 4B3HA 1AKQA 4O3MA 1D9ZA 1LBHA 2EV9A 5DTRA 3KJEA 1C7EA 4TL9A 1YL5A 1NKVA 5FOWA 4IIXA 1DCMA 2C2GA 4LSGA 1R6UA 4RZXA 5AMXA 4R9UC 4JJZA 3ZIAA 1EJ0A 3ANMA 2WG2A 5CUQA 4P0QB 3TIFA 3PRKE 4R2XA 2PUJA 3HB1A 4G0YA 3OLXA 2WAMA 3AM5A 4ZK6A 2FB9A 1C4KA 2EHJA 3K96A 3KHKA 3W5CA 1YGPA 3D59A 1F9AA 3QUCA 4F11A 2OD7A 5CT4A 4IUCS 1V5GA 2AOTA 2ZE6A 1H5NA 2FF7A 4QUDA 4K9PA 1WRBA 3HMKA 2JGEA 3V55A 4C29A 1E0KA 2YW9A 3NIFB 3P96A 3R7FA 1HY3A 3HZZA 2QUIA 4M99A 4R2JA 5J1SB 3I5XA 4B0OA 3MTGA 1XHLA 2O07A 4H16A 5DGCA 3WZLA 1E18A 2GXSA 3T1NA 1H9BA 2DHDA 2WUEA 2YWGA 1QGYA 2R86A 3NPMA 1Y7PA 4MA4A 4HNAA 3QH4A 2BM0A 4FCTA 4JELA 4X0EA 3M33A 5FO0A 3VAZA 4B6PA 2JLXA 1F8UA 1J7JA 2CXUA 4UTNA 4I1IA 1E99A 1LTQA 1JFFA 3HXOA 4L57A 1JR3E 3D54D 4ZU6X 3NNSA 3U6KA 5HF8A 4DDHA 2PCLA 1MAVA 3UWDA 4XZ3A 2C98A 2Q0QA 4UNRA 5C8VA 2QZPA 2HR1A 1GTMA 3E5MA 3LW8A 3AVWA 2BF7A 3AW9A 2EKZA 3SJAA 3AVPA 1U65A 2OHVA 3O8QB 3CZ9A 4JI6B 5TXGA 3WADA 3G3EA 1ENPA 4JX8A 1C0EA 1GCIA 2REQA 2VUHB 1NULA 3Q7QA 4ATNA 4OI2A 5TQVA 1JSRA 1YE3A 4C0QC 5I7OA 1OW3B 2BH9A 3Q3CA 1XIVA 4B2LA 4BNMA 2JCVA 4I8XA 1ADFA 4KU4A 1CUEA 2CNDA 3NOVA 4X3CA 5ENVA 4Z4CA 1V8DA 3DYVA 4CPDA 2G71A 3HHPA 3QBJA 3V1NA 4M0UA 3FSEA 4L0QA 4XASA 1FYFA 2WY2D 2CWWA 1KE2A 3GT0A 3T06B 1E0AA 2W2PA 3ML1A 4DCPA 1C2TA 2FJ0A 3E7DA 4RLFA 1UEJA 3R8XA 1LPMA 5FA5A 2O2CA 2HWYA 2SKDA 5I5GA 5D00A 4AZ3B 2Q99A 4MQ5A 2W6OA 3ONDA 2PKRA 1QLJA 1UT8A 3HL0A 5FPTA 2RGGA 2DBZA 3QQ5A 4EG3A 5BV8A 3QE9Y 3B3GA 4NAVA 1E8NA 4GYWA 2EFYA 2AMVA 3ESXA 1G1MA 1WU7A 2JFHA 2C5BA 1HT0A 1MOSA 1S2MA 2HF8A 3B9QA 3DNPA 2JDID 2C9MA 2PEYA 5DM2A 3BFKA 4Z9AA 3V1KA 1LVUA 3DAYA 4UHFA 1CUCA 3GEGA 2BFMA 5A6VA 4WOKA 4CMBA 1BG6A 1SKBA 1FUUA 2Y0EA 4EFLA 4YAIA 3M6WA 3R6DA 5A62A 6ADHA 1B8NA 4S2UA 4RH0A 4JJFA 1EVJA 4IRXA 1WP4A 2B9VA 3DTNA 1WOMA 4MV0A 4QFDA 4DSAA 4NJMB 4EPVA 1VFNA 1KYVA 3HFGA 3EA4A 1Q16A 2CL0X 2P5UA 2WLSA 5AW0A 1OLUB 4FGZA 5HS6A 1L4LA 2X0EA 1GCAA 1U2TA 1F2UA 1G5IA 1W4RA 3GVCA 4BLUA 1BVRA 4Q4JB 4TWZA 4ND3A 3VJKA 4GZLA 3EVCA 4WK0B 4B2YA 5JZMA 1X7WB 3Q12A 5CVDA 3PUJA 3GXOA 2C99A 4KIJA 3CEJA 1FBNA 3UTCA 4YCNA 4NE7A 3HR8A 1QVWA 2I2DA 1U1GA 3DAFA 5EN4A 3K70D 1KOFA 1D1SA 1CRWG 3EYWA 5F4ZA 4BNFA 4EJFA 2VQEB 4GPTA 5HBRA 4XDYA 1Z33A 4RH3A 3SQMA 3H87A 1E3IA 2AN4A 3GMDA 2UZ1B 5KYXA 5AW9A 2EG5A 3CH4B 1C4WA 3DBHA 4J9VA 3ADBA 2ENUA 4JVLA 2HMWA 2X14A 1DKQA 2OXCA 3I8SA 1C30B 3AERB 3HJTA 2WNIA 3MRVA 1OH7A 5DTEA 1ACMA 4TMTA 4I1YA 2Q3EA 3OFKA 4CCAA 4A91A 3JAKB 4RGVA 4QDOA 1JL3A 3I53A 4RL4A 1FY2A 1E3QA 3BTOA 1MXHA 5AM5A 3GN2A 4YV2A 1XJQA 2BONA 3VU9B 1OROA 5GGXA 1G98A 1R8XA 2XRYA 3HDQA 1ETUA 2B99A 1DINA 1X80A 4HAZA 4HC4A 4X54A 4L8WB 1ZR4A 2H9IA 2UVPB 3AVXA 3C24A 4CR8A 5JNTA 1Z39A 1LBTA 2DJ5A 2RGNC 2ZQZA 4J1TC 1FS5A 2O2EA 5EGSA 3HZOA 1CJTC 2VRBA 4N6GA 1XQXA 1YDWA 2C9OA 1JIJA 1F48A 1IG0A 1ZX1A 2IPAB 3C3XA 3E53A 3GFPA 4XDZA 5YASA 3KBOA 8ATCA 4ZV9A 4ACBA 1G6HA 1NUPA 2WF5A 2XNHA 2D1TA 3AP2A 1I14A 3E9ZA 3EQ7A 4BVKA 3EA0A 4HSGA 1WCIA 3A05A 3RV3A 4P5EA 5FBLB 1ISSA 1MC4A 2Q5EA 3PHGA 4KBYA 1N8NA 1SBYA 3EDRA 3L7YA 4UM9D 4EL0A 4A8JB 4LI0A 1E9RA 1NLYA 2PHZA 1ESNA 3C85A 3PFKA 2RH8A 4M1SA 4P7GA 2C5GA 5FYQA 1MU0A 1X7XA 3RRBA 5J47A 5LJIA 3OPYA 1DZ3A 1N1EA 3OOSA 3OKPA 4ZOLA 4U7DA 1W0CA 4P3OA 4CT5A 4EFMA 3SN6A 3UT5B 5E1OA 4HX5A 4PCAA 2FPIA 2R1ZA 4NU6A 2GEBA 1WPQA 3ILYA 3JQ9C 5D6NA 3TN7A 4EFDA 2XEDA 3AHFA 3BDAA 1KYIA 1VIYA 3AW8A 3K30A 3ZX4A 3KQUA 4LYDA 2HBQA 4WZZA 3T9AA 4Z4EA 2XB4A 4PLGA 3E9EA 3IODA 3RB8A 3PYLA 1B74A 4ESHA 4ER7A 1EFPA 4B45A 4AJNA 5LPNA 3AVYA 3WHKA 4YJFB 1EJ6A 1PUJA 1SBZA 2FN3A 3MJTA 4QRDA 5EJ6A 4OJYA 4K2HA 1I2DA 2HSJA 3AEUB 2G1PA 3ETHA 3WMWA 3CSUA 4CCSA 4Q15A 1EM8A 4IBOA 4QGAA 1M2KA 2P40A 2XCIA 1MAHA 3D4IA 3RR2A 2HK7A 1X38A 4KOAA 4U8HA 5AXBA 1M2GA 3P27A 3TSCA 1NWCA 4IJUA 1BAPA 3H97A 4CN8A 4EQ6A 2MSEB 4JOCA 4WEOA 3T7EA 4DB2A 3OCUA 4OPMA 1W9MA 3B3FA 3FRJA 4YXFA 2PGOA 3BORA 3BULA 3QE3A 1JYSA 1E0DA 3WIEA 3OIGA 2YV2A 3V4VB 4B84A 2HXGA 4GE3A 3PICA 5FPPA 5BR4A 4B43A 3BXGA 4LQDA 1BA3A 3SMQA 3T0FA 2IXGA 1JW9B 1WKCA 3Q6NA 1R4NA 4JBHA 4LTNA 4WECA 4ZEVA 1KC3A 2OCYC 3WK9A 1AGXA 3NTOA 3ZLVA 2V45A 1K9SA 2ZYDA 4ALNA 2QTWB 3I62A 4HFRA 3CJTA 3KPUA 4MRMA 3C5EA 1LLCA 2Q5JA 4V0LA 5HFJA 5EXTA 2I54A 3EGXB 4PEVA 3QPVA 3HSSA 5CBPB 1WMFA 1HKUA 4HDOB 2Q5HA 2HPVA 3O4IA 5FWYA 2WABA 4KQMA 4Z8YA 3D1JA 1D1PA 4RFSA 4RSMA 2W83A 4J7XA 2VZ0A 1T9GS 2IDJA 4NHOA 4R1SA 2CHVA 3BL8A 1RZRD 3HYSA 2PRIA 1NBIA 3VTFA 3O83A 3C39A 1NXTA 3KHSA 4BQEA 2F48A 3K4QA 4M1TA 1OX4A 1ICIA 3G02A 3ZD9A 5HFAA 1GWNA 2IGTA 1I10A 2VK1A 4PM4A 1ORWA 4NDAA 4Q7MB 5BUQA 1QU3A 2LV8A 3KOOA 4PAGA 4Y2GA 4RDIA 4IOMA 3WFIA 5CCBA 3I37X 4HUJA 2K5UA 2BCJQ 4KQ6A 5A3RA 3IDFA 2AG6A 3M81A 4LY9A 4C4TA 1P0IA 2DGDA 1OE0A 1U28C 3L9XA 4DF3A 2HSDA 3U5ZB 2Q41A 4LAFA 4EB6A 2BIFA 1TPZA 2B20A 2K6GA 3ORYA 1NDHA 3PE6A 2P9CA 4BEWA 1JKFA 3B1WA 3MS2A 4IZIA 5GVRA 3U44A 1DG3A 2BYTA 1ZH4A 4BX3A 1M2FA 1I0ZA 4IRMA 1UIRA 3N8HA 3F71A 3ZGNA 1V11B 1F2DA 4AJ9A 1DAPA 3HC7A 5K3CA 2CLKB 4PYNA 1BQ3A 2EKBA 4KNWA 3E23A 1NW5A 1U7XA 3LX6A 5E6RB 4AO8A 2GXAA 2IJGX 3VPFA 3SF0A 3HKEA 5EOVA 3IVCA 1BZYA 3V46A 4L73A 5M34A 4GL4A 2Z6AA 4N9QA 3UMSA 5G3ZA 3MB5A 1IB0A 1O57A 1BIFA 4ZJUA 2PZJA 4RHCA 2FOXA 1IONA 4C43A 1OIVA 1PEYA 1Z7GA 3DDOA 3AFHA 3W7VA 3DR5A 3CUTA 1JEQB 1NE2A 1SC3A 1TZBA 1NFQA 1SVNA 2VDNB 3OA2A 3W5IA 3SE7A 4MDFA 4C01A 4CQMB 4GF5A 4GH5A 2AYXA 3BMXA 3C6KA 1TF2A 4J3NA 1GGFA 2V0NA 3DLTA 1RC1A 1UZMA 4W5RA 4OFZA 2XAAA 3C4JA 2ZAYA 1YZTA 4JFRA 2CYBA 2FV8A 4EIWA 1DBIA 1WF6A 4L28A 5DH9A 3SSMA 4DLVA 1T3TA 2G3YA 1MP0A 5EJ7A 3VGJA 1Y4ZA 5AM0A 2YBDA 3ZCTA 2HHCA 2P1RA 4IG9A 4NEGA 4OEHA 4PSDA 5G1OA 1Q1BA 1SB9A 1KWGA 1XAJA 3NAZA 4ETMA 2ZT8A 5TR9A 3KQYA 2W6MA 3FWKA 1PKEA 3T5GA 1T29A 1V8PA 4HWKA 2HADA 3HFJA 4FSDA 4EHLA 2AOUB 4ZT6A 3PITA 1XN4A 3DT6A 3I04M 5IVIA 5IT0A 1QV6A 2AC2A 3WJ2A 4YJ2A 3DYIA 3LO5A 4NMWA 2GZSA 1DAIA 4WEQA 2VK2A 4XYEA 1WA5A 5BSRA 2M6LA 1AIPA 2XOKD 4FC6A 4E51A 4MR9A 5EJ4A 5KYTA 3PPWA 3EPKA 3EGCA 1Z29A 3GU3A 1ABEA 5CDHA 3K6KA 4ZAFA 2RK6A 3E9RA 2XE4A 5AOCA 5HCNA 3AF3A 4NMLA 4YRKA 4KREA 3F0TA 3CE9A 3NVAA 5DWVA 5TMPA 8ABPA 3TECE 4DRZA 4MUNA 1RFLA 3JARA 2OZLB 1MQ8B 1B2RA 1NVAA 4ZCLA 2DEUA 4PFJA 1U3FA 3IP6A 1TRKA 3MTBA 3JPYA 4KWHA 4MROA 4X6XA 4K9MA 3A1NA 3CBGA 2ZZKA 3EXAA 3AUKA 4HAYA 4EW1A 1G9XA 1KL7A 2DWPA 2JJ2A 4DPMA 2VHYA 3U4IA 3D6FA 5AI6A 2PY6A 1WJGA 3IJEB 4I55F 4CNQA 1L5LA 3OTHA 1GSAA 4X1YA 3D4BA 2DSNA 4BZQA 5TX7A 3RRNA 2R8OA 2XGGA 3FPKA 4OMCA 4CIXA 1WHSB 1UT5A 1M74A 2QLBA 3A2NA 1MABA 3QYPA 2P79A 1DMRA 1RZ3A 1VHWA 2CB0A 2P9BA 4Z6KA 5DX1A 2BMEA 3H05A 4YT5A 2BDUA 1F8YA 3ITNA 2ZZMA 1XRLA 1FLAA 5EJ2A 2G08A 5IWAB 4HLUA 3TOZA 1JWAB 5CT9A 1IUNA 1CQJB 4BKRA 3TLJA 4MUXA 2DULA 2BW0A 3C3AA 2C2HA 1JR4A 2BMDA 1U8YA 1K8QA 1T4BA 4ZALA 4FSHA 5LN1A 1P1JA 4ABYA 5A5VA 3QVVA 3W8EA 2JIPA 2H8KA 4MHTA 3JRNA 4C6RA 4CWAA 1FS4A 1LI5A 1RSZA 4BNUA 4GOMD 3QEOA 4WFIA 3SM3A 1A88A 3ANLA 1XCOA 1YI0A 1ZOPA 3OLQA 3Q41A 4FZVA 1Z36A 3ZCPA 2CXPA 1UBRS 5LA6F 3OQIB 1A4RA 1P3DA 2MYTA 1SUEA 3R24A 1ZP6A 1IN8A 2I1VB 4NU5A 4OHMA 3Q6MA 4AF7A 3G1WA 4E6EA 1Q92A 2EW2A 4R31A 3TSAA 4DXDA 5JVDA 2PL5A 5KYGA 5LP6A 3FNIA 1BA2A 5DSXA 3L41A 5H02A 2QVYX 4H7DA 4DQKA 1S96A 1NN5A 1M0WA 2IP1A 4NG5A 3JWHA 1O03A 2X5JO 1VLHA 1E5VA 4B85A 1JG1A 3COWA 5ED0A 1ULSA 5LMUB 4A8JC 4UBKA 4HQ0A 5B3JC 4A36A 5IVKA 2H1HA 4WXYB 2H2WA 3TLBA 5L3QA 2XYPA 5HKKD 1WDMA 5JBIA 4DV7B 3DFIA 1ZXBA 2G9QA 4EATA 3WGIA 4R98A 4WCFB 2RGRA 1AXRA 1QG4A 4G4SO 4GR4A 4TL7A 4WA7A 2D0PB 3PJGA 4YI3A 3PNQA 3TTXA 1SBQA 3CZCA 5AW3A 1AC5A 1QORA 3SY8A 4OV6B 4RIFA 3OQNA 3IE1A 2FN7A 3CUEF 4B83A 4CEJA 4ECAA 3DHEA 2RGAA 1TL7C 3QTLA 5CM9C 1RT9A 3TXXA 5C7OO 1MR3F 1N0VC 1S8FA 3U4HA 3OKAA 2BJHA 4BLQA 1FYXA 4EHIA 1RWWA 1ADBA 4IDFA 4JLDA 4AJKA 5CB0A 1VMKA 2YYAA 4WASA 2IYOA 3V8QA 1V3UA 1Y89A 4K9QA 4BZWA 2PWBA 3G13A 5CVVA 3B5EA 2Q5QA 2AFHB 3INTA 3T12A 2O1SA 2BFDB 1U9ZA 1AZWA 3OECA 2IHVA 2BBOA 4DXHA 1DAKA 4GMKA 4K86A 1R5NA 4CMAA 1DXYA 3FUXA 5B55A 2NT4A 1XDBA 5JDIC 3MMXA 2AKYA 2HRZA 2CWDA 2XYHA 4UJ3A 2JAOA 1RFGE 4TMZA 3W79A 4LHSA 4DL9A 1UXOA 2DQKA 2H52A 3H2SA 4IXDA 1T91A 2HSZA 4F2PA 4NNPA 2B36A 5I7VA 2Y9PB 1EXDA 1EVIA 1GCUA 1GSIA 1SUBA 1KAEA 3NP7A 4XUDA 3OP4A 4FKBA 4WLVA 4MRRA 3ZHUA 1LLFA 2GPSA 2D2IA 1UJBA 4PR0A 3NV9A 1NBEA 1RMQA 4TT8A 2FWBA 3U3DA 1XYGA 1UK6A 3ZNQA 2Z1DA 1RR6A 1DAEA 1YOBA 4BPRA 2ETXA 2R6GA 3EUWA 3GP3A 2Z6VA 2OXEA 4QAQA 2Y0PA 1RABA 2ZSKA 2YXBA 2NZYA 3KAPA 1H9CA 3E81A 1G21B 4JQCA 2EQ5A 1TJ5A 2OFPA 2HJSA 2PS0A 3MOSA 4OSOA 1UOOA 4PRZA 3IDOA 3B1VA 4GMFA 3S2EA 4URVR 1VIMA 4RA9A 3NJ8A 5LU8A 4G0WA 2TS1A 3SVLA 3VQTA 1HGXA 4OBBA 4EMBA 4I4TF 1XZQA 2NPIA 2PZMA 1P31A 3AV3A 1B0AA 1P44A 3NTUA 4NHEA 1HRDA 3STUA 1XXHE 3M5DA 5FFMA 4CYMA 3HN7A 4IIJB 3STXA 1KNXA 3P0HA 2W6NA 4C4XA 2P41A 3RPEA 2BF4A 3L0IB 1KDZA 1IVNA 1IWOA 2RHJA 2UZ0A 4GPBA 3M0EA 5COQA 3ROQA 3UH0A 3BQNB 1EUCA 3ASVA 3LUFA 4KWTA 1T8UA 2E49A 1CR2A 5JYEA 3TIIA 1JJAA 4HZIA 4XM1A 3N8IA 3MCWA 4TV8A 4G5RA 2Q1XA 2OP0A 4OXQA 1BQ4A 3VH1A 4CR6A 3AVTA 3V6LA 2G40A 4JGGA 4L16A 3H6HA 4R69A 2BFFA 3KEQA 2GK4A 1RE1A 2DOKA 4J0KA 2I4LA 4DLKA 2PWYA 3GLTA 3H42B 1T0JB 3WLNA 3RASA 2QVLA 4L5CA 2J5RA 5KTNA 2VHCA 1UWCA 1P7YA 1ZGHA 2ZSUA 3A70A 3P0RA 1YO6A 1IHOA 2QMOA 3ZV5A 2XGJA 4DBLE 2M1XA 3MFYA 1TU0A 4C14A 2YC4C 2ZRFA 4NULA 5AXCA 4F93B 1BOFA 3EAGA 1Y5LA 3KQWA 1PGQA 3AP3A 2YOHA 5LNK1 2RDMA 5H9VA 4Q34A 1N8SA 1Y7TA 1X1BA 1NXWA 3VR0A 4TVSA 4LKOA 1H4SA 2C57A 4BWVA 5IARA 4AMZA 1ZL0A 4Q4AA 3TMAA 1EFVB 5JISA 5HM8A 2F3QA 1T9KA 4B9EA 4LF5B 1J23A 4GIBA 1LDBA 1YB6A 1B23P 5LQNA 1L5NA 3ZBQA 3RJMA 3STHA 3REQA 3P4UA 1I4OA 3GEPA 1LQ2A 2YJZA 4UQPA 4EB0A 1EUYA 4LYGA 3TQFA 2I4OA 4XWOA 5KINB 1FP2A 2H57A 2RI0A 3DMHA 4FZJA 4Q1FA 5B4UA 4FYKA 4KXUA 3H9UA 1AF7A 3FTCA 3HVJA 4TTJA 1IAVA 1U0JA 5EJGA 3TKLA 3AHGA 3CBQA 1IEXA 3I9V1 4H2DA 3KQLA 3V4LA 5HIKA 2JHAA 3PDWA 4HATA 4QOEA 2O20A 4CMIB 2NPFA 4FUTA 1RYNA 1OA0A 2WT8A 4O08A 1IQUA 3VNRA 1ZZEA 3IE0A 1D2MA 3OD5A 1FYVA 2B1GA 2DM6A 3DMNA 4NV3A 3RIEA 1E7YA 1NZDA 1R9JA 1ZK4A 2FWNA 2LVBA 1PU2A 2P6OA 1M9NA 3GZNB 2JLCA 3QTTA 5CG1A 1R6VA 4UCXA 1Y42X 3AESA 1EDOA 4JITA 1N6HA 4BB0A 1UBFA 5LDDC 2OORC 2IIVA 4TTRA 2H7XA 3NVKI 3FBGA 5FBZA 3ZLUA 1VKRA 4HOYA 4AY3A 2EWMA 5GMOA 3TUZC 3EBLA 3WHPA 4OKNA 3EDYA 2P9EA 3ZY4A 1CQZA 4K2AA 3EN0A 1YAHA 4E5KA 4WXEA 3HVUA 4BRZA 1LRLA 1T5DX 2XMQA 1K8RA 4LX0A 1J0BA 2QT0A 2NTYC 3ENVA 4UU7A 2X8AA 2IEIA 5TQ0B 3EH1A 1PG2A 3QOXA 1E1QA 4O5OA 4KWEA 4JVNA 2BEKA 5J2UF 1UKAA 3F3YA 5F7ZA 4CQLA 3EXHB 4E3WA 1RWVA 3OO1A 5F76A 1MG0A 4W7SA 1RAEA 3ZY3A 3U4QA 3A3PA 4PYRA 3GRVA 4ZOEA 1GXSA 3WIVA 1CIPA 1JHPA 1A71A 2IZOA 4OYRA 3DVRX 1SELA 3KQMA 4UW9A 4X85A 2ZAGA 1GNSA 4LY0A 2OBYA 4DB4A 5ALXA 2QYTA 3E82A 3JQQA 2O3UA 1E3SA 3MUFA 1Z3IX 1XNGA 1GG9A 2H1IA 1MRZA 3FXAA 3O92A 2IUTA 2HHHB 5EHZA 1P62B 5HFNA 1KQPA 1VLZA 2DC1A 1JIVA 3TAHA 2ICAA 5ITWA 5IJXA 3DZKA 1ILWA 4W8GA 2PNFA 4MTLA 5F23A 3L4JA 4HX2A 1GTRA 3SYNA 3ADOA 1FPQA 2WD7A 3HBJA 3IMKA 2IVFA 1YJQA 4W7IA 3SQOA 3G7NA 1M7BA 1V8FA 3NKVA 2AZXA 1K7SN 1QOPB 5KC8A 1KVRA 3I12A 1I0LA 5B5SA 2EX0A 3ZHZA 4A2CA 3EX7C 1A4XA 2BM9A 1V2GA 5A4IS 4EA7A 3QLTA 2AIRA 4EEXA 1PS0A 3VNUA 5BPHA 1GAEO 4JJEA 2R8ZA 4RO0A 5JZ9A 3LPAA 4FLEA 4MAMA 2R6DA 4JYPA 2JJ2D 1UPAA 4P22A 1V7QA 5UKDA 2CVZA 4XA8A 5TQJA 1UFQA 1ANKA 5IDWA 3E7FA 1NJ2A 4L8LA 5JAIA 3ABIA 2OCIA 2IYTA 1M75A 2R62A 3ZZNA 2YY7A 4PXYA 3D3EA 1THMA 5FB3A 4MWGA 4BLSA 1PZFA 4ZI3A 4NENB 2JGIA 5LNK6 3VTAA 1T8TA 1C1HA 1NJ1A 1QK5A 2WTMA 2RHDA 2Y4OA 3WTBA 2V65A 3WYBA 5K05A 4QU9A 1DUIA 1RZVA 2D5IA 4LWZA 2V6GA 4WCFC 1WMBA 2NV6A 1YDGA 2PYIA 5I4IA 3I9FA 3IIEA 2Q3FA 1KI6B 4GR5A 4PYLA 3QXSA 3SOZA 1XL0A 1E9VA 1DARA 1SCUB 4ZYTA 3L8ZA 4IIFA 3TQSA 4YP0A 1RM0A 2UKDA 2ZRJA 3I9NA 4PQRA 4FX5A 3L9WA 3PLAE 1DEKA 4W5WA 4YEDA 4DIOA 3K6RA 2Q07A 1NVKA 2J0UB 1PW5A 1NXQA 1FNSA 4CKWA 2ZU6A 4LJSA 3GOQA 3I9V6 3L0OA 4Q9KA 2BGKA 5LLDA 1U7DA 3B7GA 3GLUA 1OA1A 4DM7A 4ZU1X 1RBYA 1ZHHA 1OJ7A 4C2UA 4JK3A 1U0EA 5AOVA 1Q11A 1QHHA 2J9XB 5EXEA 2I4IA 1N6KA 3FNGA 5KVQA 2UXBB 4DRXB 3VYTB 4CFSA 4EPRA 1KKLA 2EIHA 2Q21A 2PRKA 2YRXA 2C5HA 3CRVA 2DUWA 4C4SA 4LDRA 1Q7GA 1R0SA 1Y9DA 2Z8XA 1HYHA 5JANA 2A9OA 2Q27A 2Q6KA 2GILA 5BO5A 3KZNA 2E4XA 1SVWA 4MKZA 1ES9A 1SJ9A 2NSYA 4X65B 4JCCA 4UEQA 2ZUDA 3WXBA 4Y6SA 4E15A 3HJBA 1U2DA 3GQBB 4DT1B 1CY8A 5TEVA 3FKSA 3R41A 1KZ9A 3TLAA 4GLJA 4DWVA 1MBZA 1Q12A 1YR1A 2HOQA 3AOEC 2NP7A 3U7IA 4B2IA 2R5WA 4CETA 3PR3A 1QF7A 3SQXA 1RKQA 5BSHA 3H2JA 3HM2A 1EWYA 1K3FA 1FFBA 5K3SA 2I71A 2C78A 3L02A 1MTZA 4I4NA 3ZKWA 3F2VA 1CY2A 1V3QE 3VSBA 3BH6A 3SS9X 3AVQA 1U7WA 3FPGA 4RD6A 1T5LA 3ICQB 1TD1A 1NG1A 2B30A 2B2NA 4OHUA 5FRDA 4J6EA 4JT2A 4YALA 4YJGB 4ZP1A 3TS1A 3IFSA 3PQ7A 4U5QA 3VVLA 1ZICA 2X4IA 4XVQA 4HLQB 3FF1A 4R9VA 4EHAA 4HK4A 1ORTA 3KLMX 1SCJA 3TW0A 5E2AA 4YRSA 1EFHA 4E08A 5JEDA 5K0FA 1W5EA 2GJAA 4FBMA 4TSKA 5DIZA 3RTEA 4EI7A 1QUEA 1U99A 2C2KA 4ZVUA 3MQ2A 4M54A 1BFKA 3DDZX 3TO5A 4B4WA 3TSOA 3QMPA 1NVGA 3W6NA 2IH2A 2A0KA 1TMYA 2RGDA 3QVGB 4H0NA 1VYVA 3P9XA 4RNDB 2AR9A 2VDOB 3BSYA 3G8BA 3JWIA 4GR9A 3AKCA 1RD4A 2V7BA 2CD9A 3HJNA 1J97A 3VO1A 1EU1A 2ZTUA 1B8UA 5BYBA 5H4GA 4G56A 1A2BA 1FP7A 2DTEA 4OB8A 4GS5A 3LC7O 2XKJE 3HMQA 5DZSA 2HXSA 3ROTA 2VTBA 3O2JA 3L1IA 4C06A 4OB7A 5KNBA 2JJQA 3HGQA 2QG9A 1CUFA 5TT1A 4LOIA 3LOPA 4TSFA 3WGNA 4AMYA 1TK2A 3A6EA 1PKXA 3HBNA 3LNCA 4G8BA 1T2DA 4ENVA 3S8EA 3U7HB 2UUCB 1OI3A 2YJ5A 4BMYA 3LT1A 4HDMB 3UFXA 2B0CA 2VNKA 4YT4A 4BUJA 5H68A 2FNAA 4TKZA 1LQUA 4J90A 1CY0A 4WV3A 3AXSA 3U17A 2J9ZB 3MTAA 1K06A 1HBJA 2Z9CA 1QQTA 1JIIA 2E5WA 3HBAA 2FCAA 4Q9LA 5BWMA 3PPVA 4G36A 1RPTA 2L2QA 4G4JA 3G8CA 1R16A 4Q3EA 1VLLA 1TW3A 1MAWA 1M2EA 1DT3A 2P2GA 4WNIA 4XCQA 5I8ZA 4D3FA 1JH9A 4WJZA 2YJGA 1VJCA 1E6WA 1FK8A 2ZSBA 3THOA 3O4JA 3HYCA 4AN1A 3ZW8A 10MHA 3WLPA 3TL3A 4NZZA 4RY8A 3W90A 4LWPA 1G0OA 1JECA 2RHOA 4ZI7B 5K03A 4OAOA 4EUSA 5JAPA 2QVGA 1N5DA 4GXQA 3H9JA 4QBGB 3K0FA 3N1UA 3NDPA 3T1TA 1CX9B 1A96A 2YV3A 3IP3A 4QOGA 3G0IA 1NYTA 4J0CA 4WL0A 5KX5A 1TRHA 2ANBA 5DRTA 3RSFA 1BS9A 1YR3A 4DN6A 5DWQA 4DSTA 4CTKA 5J58A 3OKCA 3L1UA 3TX2A 1VCNA 3BDIA 1P9RA 3ZUPA 3T4EA 1DTWA 1GPBA 4GYYA 1F5SA 2Q5CA 4P31A 1HDOA 1SNYA 3NGMA 3PVZA 4M1ZA 4XUEA 4YFVA 4F92B 4IIYA 2CUNA 1IN6A 3SIRA 4BNKA 4B6GA 2H11A 4YHHB 5JJLA 1TK9A 1Q44A 4HUQB 4DV2B 1ORHA 2QRVB 4OM8A 1PQPA 3NAGA 4W9MC 4GVLA 4OYLA 3KSAC 1RIIA 3OD1A 1PNQA 3DWGA 4XIYA 4X44A 5HMLA 2ONYA 2AWOA 3KQPA 3W7BA 4HAXA 5KHAA 4BVBA 5JH7F 1USIA 4KR3A 1L8QA 5FNVB 5HGJA 2EOAA 4JJ4A 3LD9A 2AOXA 3CO0S 4MTCA 3WNVA 5HRAA 1GQQA 5TT0A 1LBQA 2XB8A 1DPFA 3EXHC 1GAWA 2JGRA 3IUNA 3K5IA 4U9UA 1DHRA 3KVVA 2KLBA 2VP2A 2X9VA 2GUWA 3CTPA 1L5FA 3DL0A 3KT6A 1LNQA 3I2YX 4UHKA 1HT2E 1DX6A 2QE7D 4QQKA 3TNDA 1GIAA 3SHWA 3RS9A 1WMSA 3L1JA 2Z8YA 1J0EA 2BFEA 4NCNA 4P32A 3AVUA 2Q3CA 2IEDA 2I8CA 2WA1A 1HYGA 3DAPA 5IFKA 1NRXA 2QD3A 3NGXA 1UM9A 3TYXA 1YJAA 2FMUA 1YA6A 3RSOA 2I1LA 1U4NA 2WKRA 4II3A 4W8OA 4V39A 4JDUA 1CE8B 5F12A 2BP7B 4C21A 1NVFA 3QEMB 2IZ5A 2BHTA 2C5EA 3KU1A 4UPDA 1ZY2A 2IU3A 1X8JA 4QJ5A 4PPGA 1JEJA 1ZRNA 3BXOA 3D43A 4KQIA 1G3RA 3A6LA 4IVQA 4PYMA 5FJIA 3SZ3A 5DNYB 1Q3HA 3MELA 1W35A 2PGNA 4CTNA 2DUNA 1Z68A 2X23A 2Y6VA 2P0YA 2Z8ZA 3DDWA 5A6SB 4CUJA 2IPOA 4JOBA 4IXTA 5KCMA 5U1PA 2DR2A 3BD9A 4J7UA 1V16B 1ZI6A 4OYHA 4ZQHA 4OJTA 2FA9A 3P1JA 4OLFA 5REQB 1KXZA 1Z15A 1QC5A 5KU7A 3AHCA 3V8NA 3ZIDA 3PA8A 5KBYA 1SUPA 2LR0A 2HFKA 2REOA 3IR5A 4WESA 5FHQA 2QS9A 5DLYA 2MSKA 2P6UA 4W63A 1NYRA 1V25A 5TPWA 3DO5A 5AD1A 5B2EA 3ISJA 4Y0AA 2MINA 3HB5X 2B4YA 1OU0A 1TF5A 1MN6A 4A2QA 5FUMA 3H1TA 2EF0A 2UYYA 1KTIA 2I8AA 2VZLA 1MJNA 1O94A 4MH0R 1I36A 4WN9B 4QSHA 4PZPA 4BPBA 1ONOA 2F55A 1MA0A 3AC0A 1Z2PX 3JVDA 5GADl 2A88A 3B6ZA 4X97A 1V95A 1SXPA 3CUVA 1O0CA 2O23A 3T7DA 3W05A 1XJWA 1NW8A 2JH8A 4O0LA 4GEGA 5DTIA 4D41A 3SZMA 4JLKA 2XOXA 4P86A 2QYSA 2P9GA 1XRMA 1E9EA 1E32A 2NLOA 1ZCBA 2X7HA 3KM0A 1CR6A 3I2GA 1KZ1A 1KIFA 3KJZA 1UINA 1A7AA 2HK9A 5AKHA 5JD6A 2QN6A 4JUFA 2ZIUB 4HNRA 3OCVA 3A9VA 3P9IA 1YVEI 2FN8A 2V3WA 5BSUA 4ER5A 1U5AA 1S9DA 1XF1A 3ED5A 1NBMA 3LDAA 2UZ4A 4NZMA 1PK8A 4LNAA 5CITA 3HQ4O 5HRCA 2BE9A 4FYHA 2UU9B 5CR9A 3RC3A 4F3YA 2HT1A 2R4QA 1QDLB 2GEKA 5K6RA 1NQVA 1QS0B 4KO3S 3HCFA 2FMKA 2GPTA 3U9SA 3BMCB 1UL1X 4G9EA 1OFIA 1T5BA 5T8KC 2QZZA 3EISA 3FAZA 2PO5A 2VAWA 4J4BA 1GPYA 5K20A 4YJ3A 4QWWA 5IKXA 1YZ3A 1F7UA 4HVCA 4RCZA 1E2KA 5BW6B 3OZWA 1MW9X 4M7PA 1NAHA 3RVMA 1PNRA 1KRWA 1WVMA 5JSYA 1GZ7A 3L1HA 4XGRA 1UPUA 1YI8A 1VIAA 2FKAA 2KJQA 3EVAA 3M70A 3MN1A 4MI3A 3RVOA 3OJXA 5DYTA 1FSSA 4UTXA 2V97A 4BO4A 4Y2RA 2XA2A 2XPCA 4YUAA 1DIBA 2JBHA 2J3DA 3FOWA 1GU1A 1JKIA 2HWXA 3LRXA 3P94A 3IQXA 4JBWA 4G67A 5BQXA 1H2FA 4QUGA 4DV4B 5EC8A 3X1DA 3QWAA 1PFVA 1ADCA 1NI3A 1T9GR 1UANA 3QHQA 2DRIA 2AZDA 3CSDA 3VV2A 3IMGA 3PT5A 4UMEA 1NKSA 3GT4A 3VSDA 4CF6A 1WR8A 4DLTA 4U7WA 4OFXA 2P4UA 2H07A 2CBZA 3D8UA 1GZ6A 3DAOA 3EHEA 5CFPA 5FTJA 3WJAA 4QJIA 4Q37A 3BGWA 2NUBA 1H3FA 1FDWA 2JHPA 4E5YA 5EHXA 5IN4A 5K8IA 2OECA 4WOCA 2Z4RA 3ME5A 4GNRA 4GDFA 1AO0A 1JDVA 1Y80A 2CCKA 3AKDA 4N6NA 3FKSD 3I1JA 4OQXA 3G5LA 3DQZA 1VBNA 2I29A 5IP5A 5KTYA 1U5CA 2J6IA 1ONNA 3G0OA 3JALA 4PZUA 5IS2A 4JB2A 2SICE 3H9GA 5IVHA 2GF0A 1GADO 4BEBA 5BVHA 5E4JA 3ZVMA 1A8SA 1F0KA 1XZFA 3FCUB 4UM7A 1W87A 2ZYSA 2AA3A 3AI7A 1G8YA 2HJRA 4G0UA 1QP4A 3FG9A 4D4LA 1O9BA 3GUVA 1IB6