2AR7A

Crystal structure of human adenylate kinase 4, ak4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
KLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase 4
publication title Crystal structure of human adenylate kinase 4, AK4
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ar7A00
4D2IA 4TL8A 4NHOA 4US1R 4C0BA 2P6NA 2F43A 3GLGB 2ZRBA 3IIMA 1E3MA 3OESA 4OHVA 1KMHB 4MH0R 2QGZA 4KVAA 4I4LA 4BE7B 4LRWA 4WBSA 4FD2A 4ACAA 4Q9IA 1TTTA 3EIEA 3NBYC 2YNMA 3I3SR 4DCNA 1E2FA 3DVLA 2GEDA 4UNSA 2VPPA 4NCNA 1E9BA 1M34E 1Z6AA 1W47A 3AKEA 1L8QA 2KB0A 3HP1A 1YR9A 1G9XA 3LLMA 2OCBA 4A9AA 2EFEB 2H5EA 4B33A 2IK8A 1M6NA 1YZQA 3QBVA 2ZSEA 4M1KA 5HTKA 2YVUA 1EFHA 1COWA 3U7EB 1UKEA 4YXWA 1D2MA 4PPQA 1KI6B 1US8A 3HU2A 2R65A 2IYWA 1TQ6A 4KLZA 2ZJ8A 3M6AA 1EFCA 1O3YA 1P2TA 3CF2A 2B6HA 4PAOA 4QJ4A 3U2QA 3EWAA 4QG7A 4D4KA 1AGPA 4ERNA 3ZQJA 1ANKA 2HV8A 4GNKA 3UATA 5EJEA 3PUYA 2QBYA 1E1QA 5LB2A 1E2EA 3E5HA 4LSGA 1D8TA 1O87A 3B8HA 4BFVA 4DT1A 4L16A 3CH4B 2RKOA 3CPEA 3LQRA 4ZDIA 4XWOA 1Q44A 2B8WA 2C99A 4EFLA 1WP9A 3DM9B 1E2NA 5TARA 4LX0A 2F7SA 1VIAA 4V0OA 1KO1A 4MKFA 1NVVR 1OHHD 3QVUA 4D82A 1Q57A 4XH9B 4JLAA 2ZJ2A 3PQCA 4TLAA 2QENA 5FUYA 3U3RA 3GLGA 4HLUA 1JNYA 2FX3A 1XXHB 4XIGS 5JJKA 2AKYA 4M1TA 4OHYA 3GPLA 1HTWA 1KMHA 4M0LA 2ZRPA 4NTZA 1BMFA 2LKDA 1FTSA 2GZDA 2KWIA 4ZO4A 1KI7A 3DMDA 4Q03A 3A1TA 3W5JA 1KNXA 2J7PA 3PUZA 1FTNA 4I1UA 4M9QA 3I62A 4PHHA 1MH1A 2QEQA 4E07A 5FPSA 5JWRA 3I8SA 4MYHA 3FMOB 5FOSA 2DY1A 5IDVA 3X1ZA 2PLFA 3SBEA 3DOFA 4MRPA 4JLKA 5TMPA 4BEJA 3T5GA 3K70D 4BQSA 3CW2A 4UJ3A 1N6NA 2IHBA 3IEVA 2EU8A 1WDTA 2VP9A 3IBYA 4PPGA 4XVRA 3BOSA 3TBKA 5FH9A 1GKUB 1KI6A 4D81A 4P4TA 3BORA 2A5YB 1I4TD 4ITRC 1S8FA 1IXZA 6Q21A 1R5NA 4LJ8A 1VPLA 4N0EA 4TT3A 1KYIA 2BJWA 3KUDA 2W6IA 1SKYB 4JVNA 1GVNB 4B2PA 1T8TA 3B5JA 2ZI3A 5EE3A 3L43A 2PT7A 4JS0A 2P5TB 1HURA 4DLXA 2ZR9A 3T12A 5HZKA 1ZNXA 1EX7A 2A5JA 2VSOA 3SR0A 3NDPA 3MFYA 3FB4A 1K5DA 3CR7A 5BYKA 1P6XA 4IEEA 1A1VA 2H57A 2V8OA 5CM8B 3VR4A 1QG2A 1YU9A 3AKDA 1JBKA 1ZC3A 4A6PA 4A4DA 2FA9A 3HPQA 2IS4A 2P0EA 3WYAA 3CBQA 4NYJQ 1ZD9A 3ASYA 4CRWB 4NYIR 3MUFA 3C16C 1XXHA 3GLFA 2XXAB 4IJMA 1ZRHA 5E4FA 3ZDQA 1Z0JA 3C5HA 5F9HA 1GL9B 1Q3HA 3B85A 2TMKA 3K70C 4ILEA 4NE2A 3B1ZA 3EZ9A 4JVMA 3LA6A 4IDOA 5C4GB 4B71A 3NDBB 1QHNA 2JLQA 2OM2A 3OFND 1W0JD 4DSTA 221PA 4PO1A 4LHWA 4IDQA 2QTHA 2GXUA 3IBGA 5DI9A 3LRPA 4TSFD 3T34A 3PUXA 4US2R 3QKUA 1L2TA 4DCVA 5AUNB 2V6JA 1TF5A 3M0EA 2VO1A 4POAA 4US0R 2J9RA 2OCYC 3LBHA 4X8OA 4GOKA 2AKAB 4TZ6A 1JALA 3KZ1E 5KYKA 2WJGA 3ASZA 2ORWA 2RGAA 2Z4SA 2ZE6A 3ICEA 1VCNA 1G5RA 3EPHA 3PITA 4Y0AA 2NOAA 3A1WA 2FWRA 3KL4A 3OIYA 4IXNA 4NCHA 1UDWA 1E79D 4QNMA 1I2DA 1TQDA 3BK7A 2X77A 521PA 1Z6YA 3B1XA 2QM7A 3CX6A 3HU1A 1E9CA 1MO3A 4IDNA 1CKEA 5H8WA 3GEHA 2CLCX 1JI0A 3EXAA 4PQRA 3ADBA 2JEOA 4JMPA 2XNDA 3GMTA 2ZITA 2G1JA 1KSFX 1E2MA 3FFBA 2B7BA 2WWWA 3IO5A 1AN0A 2Z5FA 3DOEA 2B8TA 1KMQA 2XTMA 1XEFA 1FMLA 2JJ8A 1Z6XA 4M1YA 4E09A 4CEHB 2XXAA 1MRSA 4OQFA 3KQKA 1XCMA 1P61B 3DMNA 1PLJA 2RGBA 1M7BA 1OHHA 4GP7A 1Y63A 4S2EA 4PC7A 4XVQA 4DWJA 2O8DB 3U3KA 1JEEA 3WRYC 3D6TB 4EAQA 1E2JA 3I5YA 3H1TA 4BZQA 1WB9A 3RANA 3AM1A 2Y8EA 4NZYA 1X3SA 4ZCIA 1HE1C 2UKDA 3CPJB 1U98A 5CLLA 3W34A 5CITA 1BKDR 4C0SA 3NXSA 1JR3E 3GJ0A 4RJLA 1OFTA 5FTJA 1NN0A 1WA5A 1OH6A 4UJ5A 4HAZA 1U0JA 2V1UA 4M21A 3FMIA 2BJVA 1NN1A 4AY2A 4V0ME 2OE2A 4KVGA 4DC9A 5A4JA 3RSOA 1M74A 1G18A 1H8ED 2NZ8A 1XCGB 2C96A 3KXLA 2MSDB 2QPAA 2XX3A 4FN5A 4LBYA 2NO7A 1OFUX 2YOFA 4HB0A 5HPYB 1JECA 2QP4A 4HAYA 5DYGA 5CIQA 2QMEA 1L7VC 2WTUA 2O0JA 3AF3A 4C2TA 1FZQA 3C15C 1HT1E 4URYR 2EVWX 4LZZA 3E1SA 1LS6A 3B82A 1QHHA 1ZNZA 2UZ3A 2JLYA 1OKKD 3A4NA 3WMEA 4R2HA 1A4RA 1BOFA 4NU0A 4KCGA 5M04A 1W36D 1UADA 1GRQA 2ZSBA 4A2WA 1ZM2A 1D2NA 3U7GA 4OI0A 4RD0A 2ONJA 2QSZA 2RAPA 5DE3A 1E2LA 3LXRA 1A2BA 3WRXC 3LNCA 1TU3A 4FINA 4HAWA 3ZGXA 3B78A 2GZAA 3THXB 2QPOA 3I1FA 1WBBA 1N5KA 1U0LA 3VQTA 4C4PA 3VAAA 1DAKA 1G3IA 3W9YA 2JLRA 1CIPA 1P2UA 4KSBA 1LTQA 4IVRA 4FCWA 5CJPA 3W8RA 4DVGA 3CRMA 3D3QA 3AEZA 4CEHA 1JJVA 3AVXA 2QRNA 2BMJA 1ETUA 1Z6GA 4MYTA 2JAQA 1QVRA 5C4MA 3HJNA 5SZJA 3EC1A 4XWKA 4OBEA 3GJXC 4QGGA 3SFZA 1RPZA 1FUKA 2O8DA 3I4LA 1XJCA 5L3SB 2RH5A 3EIHA 1P60A 2FSFA 2HXSA 4PO8A 2N1BA 5G3YA 2RGNA 1KKLA 4BLSA 2QSYA 3LFUA 1HY3A 2OESA 2ZI4A 4DEYA 5DI3B 5BXQC 2QA5A 3CF0A 2VL7A 2AFHE 5DN6A 4C0QC 1M1YE 2CL0X 3RRYA 3K0SA 1XFAA 1L4YA 1ZD8A 4G5GA 3SYNA 1FQKA 1ZU5A 3AP1A 3AVVA 1W0JA 4Q1DA 1NL3A 2ZXUA 4IFEA 1AJEA 4TSFA 1IOZA 1KGDA 2H7VA 2PCJA 3CNLA 2WIAA 3U3OA 1Z0DA 5KSZA 5JRZA 1XDBA 1XEWX 1Q0UA 1G3UA 3GJ3A 3UMSA 2VF7A 3A4MA 3IDQA 4MRSA 4TLDA 4EPVA 4XTRA 1LB1B 2BKUA 3QKTA 1XEXB 2HJVA 4UKDA 5BN4A 1Z28A 3QE0A 5TB5A 4NKRA 5J4YA 2OAQ1 4KSCA 3CLVA 1ZUNB 1GITA 1KDRA 4Q1CA 4WW0A 3THXA 3M1IA 4MKIA 2W0MA 1DAHA 1L4UA 1N3BA 4Q4HB 1W36B 1FMJA 1E79A 4BWYA 4LY6A 3Q7PA 3QXHA 4NCJA 1ELOA 3ECCA 4PC6A 4MGZR 1RYFA 2CHGA 3U3MA 4OHZA 2BVNA 2CE7A 5FL3A 5FPYA 4JL5A 4Q47A 1ONBA 2PMDA 5KSYA 1R4AA 2A5DA 1OYWA 1E94E 5EUQB 4TMZA 1DADA 5F3WB 3DKPA 4AKGA 3ETLA 3KFXA 4B75A 4FXPA 2ZR7A 5L3SA 2ZM5A 4C2UA 4URVR 3PR1A 4L8GA 1XTKA 2A2ZA 2QT1A 2WWXA 1KK1A 4TQ9A 1KI4A 1E0JA 3T5DA 4BGDA 2HXYA 5ELXA 3BH0A 3QXCA 1NSFA 2J3EA 5FFMA 1XB2A 2JA1A 3A58B 3PV0A 5FTKA 4RCZA 4V0LA 2QROA 1QZXA 1F2UB 5LDDC 4EPWA 2XB2A 2WV9A 5CK4A 1T6NA 4L5BA 2IXEA 3T15A 2BM1A 4HAXA 3FHTA 1CRPA 1II8B 3BE4A 1EESA 4IXMA 4Z8XA 5J4HA 4YMSA 1S1MA 5CM9C 1VYVA 2WOJA 3QENA 1KI3A 4HLQB 4JBXA 1AKYA 2HDNB 3A6PC 1GKYA 2E9SA 3AVYA 2ZYTX 4KFSA 3RDPA 1OIVA 4LJ4A 1OH5A 4QBHA 1AS2A 2WJVA 4MKHA 3UPUA 2GCNA 3EZFA 4RVCA 3TUIC 3N2EA 3WYFA 1OV4A 4NL4H 1LFDB 2QAJA 3J81k 1ZYUA 2N46A 1XEXA 1EG7A 4BZPA 1GAJA 3CZPA 1NVWQ 1S3SA 1N5JA 5EE0A 3BB1A 4Q1FA 2JATA 2AXNA 1JR3A 3TSOA 5SZHB 3UKDA 3SN6A 3W6PA 3TSZA 2WM9B 4Q4HA 1OB2A 2OLJA 4Q02A 3ZQ6A 2FV8A 4V0MA 2WAYA 2QPTA 3F3YA 3UANA 3CKLA 1W7AA 2I1QA 1X8JA 1E98A 2FSHA 1E99A 2GKSA 4LBWA 4UNNA 1S9DA 3TIFA 1GTVA 2OUKA 3KKPA 3KKOA 4OKSA 3V4RA 1R5OA 1VMAA 3VU9B 2FN4A 2JIZA 3SYLA 1UBGA 1ZIOA 2XOKD 1YR6A 4OL0A 3TR0A 1KDOA 4LYAA 1JAIA 1G64A 1H65A 1R8SA 1ZC4A 2JGNA 4C0KA 2CVHA 1IJFA 1XMIA 3GFPA 3QF4B 2PZEA 3ZVRA 1C9KA 4CEJB 2W2XA 1YZUA 3QEJA 1AM4D 1F2UA 1TF2A 1KJWA 1RJ9A 3OAAD 2IC5A 4ARZA 3WBJA 4OQMA 4B73A 2R6GA 2RCNA 3VKGA 1II8A 2ODBA 3KJEA 2FNAA 3AP3A 4LYHA 3BERA 2DFLA 5KUTA 2A7QA 3KKQA 1NJFA 1JJ7A 1W2HA 1G3MA 3TAUA 2IWHA 3MSXA 1WCV1 4G5OA 5E7MA 3HYRA 1C1YA 2IXGA 2X2EA 3ZVMA 5FTMA 1U9IC 1LF0A 2CLDX 2BOVA 4FI3C 3MWLA 3RS4A 3HR7A 4L15A 2QP9X 3I73A 3P1JA 3MWJA 2ORIA 1X6VA 5UKDA 3SJZA 4AG6A 1Z3IX 2BCGY 3QPVA 4I81A 3RVBA 4IKEA 5KU1A 2L0XA 2W2VA 4C0JA 1CS4C 4RCYA 4FMDF 3ZS8A 3BD9A 1FW6A 4M22A 3VFDA 4IVPA 4PX9A 2F6RA 3W3ZB 2AN9A 2GBLC 2OEPA 2P6RA 1W46A 4GDFA 4ABYA 1EFTA 1RKBA 4GMDA 4U02A 3IILA 2ZE8A 4JBWA 1ZUHA 3Q9LA 4URWR 4BLRA 3AGPA 4TYYA 5K8UA 4D0GA 3ZH9B 3TMKA 5JEDA 4B74A 1G8PA 1ZNYA 4YLGA 5LBIA 3VU9A 2BEJA 1DVRA 1UDXA 2RGGA 4WXPA 3LLUA 1B23P 1X8LA 2EFGA 3EPKA 3LW7A 4LGMA 1FP7A 3QKSB 1OB5A 2C78A 1U2RA 3AF4A 1QDEA 1KO8A 1W4RA 3C41J 1OE0A 1YZLA 2NO1A 4F4JA 3QF4A 1OXXK 3THWB 4CEJA 2WWFA 2ZRAA 3UWOA 1S2MA 3FWYA 2IYRA 3Q7QA 4F7WA 4BFYA 4HDCA 4A82A 2LCFA 1CJUC 3UWKA 4AKIA 3AF0A 3KJGA 1G6HA 2FFHA 1NG1A 5J40A 3DL0A 2PL3A 4Q4LA 3PVSA 4DDVA 4IDPA 1IXRC 2C95A 3OEEA 3L0PA 2CBZA 2PMKA 4OHXA 3Q3JB 1VKJA 1N0WA 4R7ZA 4GSYA 1E2GA 4C0LA 1XRJA 3TJZA 2YJTD 1I4DD 4E22A 1E1RA 5KTYA 1FOEB 2GESA 4HAVA 4TLEA 4Z54A 3AKCA 3NVAA 4HUQB 1Z0IA 5JCPA 5EP2A 1EWQA 3T06B 1U90A 2REOA 3SQWA 3L0IB 3TE6A 4UQOA 4QM6A 4M2LA 3A8TA 2AK2A 3GLHE 3T1VA 4CEIB 1P9NA 4E5UA 4GP6A 1K6MA 2OFWA 3LXXA 1OXSC 2DWPA 3BJIC 2P6UA 1J90A 3K1JA 3WHKA 1G8FA 3NBXX 1U9IA 1ZAKA 4JT4A 1IBRA 4OK3A 4QRHA 4D4MA 2WWYA 1X1SA 4YDHB 3HPRA 1B0UA 5HKKD 1TQ2A 3LAWA 4I1OA 1G7TA 4KYIB 3MAAC 4Q4AA 1GKIA 5JFGA 2N42A 4LJ6A 3SOPA 1JXOA 4LV6A 4CIDA 1U8ZA 3QKSA 2IA5A 2G0TA 3P4XA 4Q1EA 3SDZA 2OO7A 3LDAA 3Q5EA 3ADDA 4ZKEA 1T91A 2I1VB 2CMKA 1NVVQ 1P7CA 1G20E 2R6FA 3THWA 3QXXA 4DKXA 3DEFA 1TU4A 3R20A 2VP4A 2GVDC 4E03A 3B9PA 1QG4A 3BFVA 3MGCA 2QT0A 3U6KA 3PUWA 5DH9A 2OBNA 1WXQA 3H2YA 2FPKA 1MABB 3BH6A 1II0A 1Q12A 2VEDA 1MO6A 3I92A 2ZI9A 1Z22A 3D7MA 1DELA 4LHYA 1EFRD 4A0FA 4WZAE 3OAAA 4G3XA 4EPRA 3HR8A 3KQLA 1KK3A 3KX2A 3QF7A 4DUGA 2XTNA 3QG5A 4LK2A 4QKQA 3U6BA 2OFOA 4FIDA 4QJ3A 3I32A 1ZUIA 2IHYA 1ZM9A 421PA 1E0AA 3KQNA 1TADA 4M4SA 1D6JA 5EZ5A 1BYIA 2ZYWX 2FJUA 3CH5A 3HWSA 4MGKR 1AQUA 2O0HA 3EASA 2ZUBA 4HUQA 2HF8A 1PV4A 3H4MA 1IY2A 2IYQA 3VMFA 3TUZC 1QHXA 5EP3A 4MYCA 3SQXA 5J4LA 1KI8A 3SJAA 3GLFB 4EDHA 1DO0A 2ZYUX 4CEIA 1OW3B 4HI0E 4BLPA 1Q21A 1Z08A 3WNDA 2J1LA 1N5IA 1OXUA 3G0HA 5DNYB 1D9ZA 2GEVA 2J87A 1XJ0A 4P33A 2VP6A 3VR5A 2YOGA 2ZEJA 2JJ2D 3LX8A 1MKYA 3DZDA 2RHMA 2ZS9A 3RC8A 2PBRA 5JJLA 4OYHA 3RS2A 1BIFA 1XMSA 1OIXA 3MMPA 3QJYA 1GFIA 2GJ8A 4HB3A 4Q1BA 1IY0A 2GJ9A 2ZRDA 3Q8XB 5L3QB 3IKJA 4BLQA 2WVJA 3WNCA 2KBFA 1W0KA 2ZREA 4BFTA 5E7IA 1IJEA 2GK6A 1XPOA 4A2PA 3CZQA 3BB4A 1KOFA 4CVNA 2J45A 4NYIQ 4ASUD 2OG2A 3K0AA 1W48A 1EGAA 3GLHB 5JLJA 2FPMA 1KAOA 2H1LA 2Z0MA 3K0CC 3RRZA 5BWMA 4GOXA 1R0XA 3VKHA 1ZM3A 2VH5R 5FI1B 5CYPA 4M1MA 1MABA 3R9IA 2GF9A 5F2EA 4JIMA 8OHMA 2R44A 2IXFA 3GEIA 2WMOB 3AKYA 1E0KA 3X1WA 4ESHA 1SXJD 3PEUA 3FTQA 2F3TA 2WJHA 5KO2A 1N6HA 4JLMA 4Q7MB 4YONB 3T61A 1V43A 1DOAA 4C3ZA 3EZ7A 1IQPA 2Q21A 1IN6A 1G7RA 2VBCA 5JSZB 3O8CA 5EXSA 4OQXA 3BAFA 5C2JB 5AR1A 3VR6A 3C4JA 3B60A 3N70A 4O2LA 4C7OB 2G83A 1M8PA 1JXMA 2E1RA 3LX5A 1FPMA 2JCSA 1D9XA 4IOJA 2IYUA 5FI0B 3K9NA 1OSNA 4YDSA 5A0FA 3TW8B 1HEIA 2WKQA 4M9ZA 3V9PA 3A1UA 121PA 4HATA 2ERYA 2GHIA 1Q22A 4ZPXA 4NBSA 1YZTA 4YQFA 3VR3A 1CF4A 2PJZA 3O8BA 2JDID 1M7HA 4K8OA 4JYCA 4NDZA 3B2EA 5B64A 2FU5C 4CZ2A 4IHQA 1JQLB 1N6LA 3L8ZA 5GADl 1IN4A 2G88A 3GD7A 2FSGA 1ZINA 4DEXA 1QBKC 3I8XA 1DG3A 4IOMA 4AKEA 5FUXA 5DSZA 4BFZA 5L3QA 1NMZA 2HF9A 4X8HA 2BBOA 2DHRA 1V5WA 1YE8A 2W83A 1E0SA 2V4ZA 1SXJC 2IS2A 4XD7D 2OXRA 2J5XA 1VG8A 1AK2A 2DYKA 2O8FB 3F5FA 3K70B 5GJVC 5CB8A 1P72A 3GLHA 3K9LA 5KNBA 1XD8A 4TMKA 1S0UA 2ODWA 4LPKA 1QHHB 2C03A 2Z83A 1Z6TA 3UIEA 4Q9JA 3L82B 2ZU0C 4DXAA 2GETA 1DAGA 4Q9LA 2X8AA 1T8UA 1VCMA 4D6PA 2I4IA 4NYJR 1J2JA 3LD9A 1NMYA 3IQXA 4ZCMA 4RY2A 2V3CC 1N25A 1AS3A 4X8LA 4DBLC 5JSZA 1T9HA 2V1XA 1K8RA 4FMBB 1ZIPA 5EP4A 3AVOA 2Z43A 1KDTA 1Z0KA 2QU8A 1EFRA 1ZVQA 1TAGA 1E2DA 1SVSA 2G0NA 4MQBA 3DHWC 4P31A 4C7OA 1Z07A 3R8FA 1RRCA 1NY5A 2R2AA 2ZVQX 5J47A 5KPDA 3R9XA 4NH0A 1CRQA 4HLCA 4KAXA 4QHYA 4A0RA 4URXR 2OSBA 5AWFC 1MV5A 4CW7A 1CEEA 2WKRA 4RKEA 3EA0A 4IEIA 2VQSA 3MJHA 1OJLA 5DISB 1KJZA 1KKMA 3MLEA 4JJZA 2ZUDA 1PJRA 2WIBA 4PQYA 2H18A 1W5TA 3H0KA 4XTCS 1R0ZA 3I72A 1OLOA 3FFAA 4TN1A 4QNRA 3N5CA 2CK3D 4KFUA 1WQ1R 4URUR 2W6JD 2DFKB 1MRNA 2QTVB 1GIAA 4HSEA 1VHLA 3UK6A 1H8HD 4IRUB 1E9FA 4LJ7A 2ZJBA 2NO6A 2JLWA 1CR2A 2QE7D 4R71A 2QORA 5JZVA 4JKYA 3SZRA 1P3JA 2JJ2A 3VR2A 2YV5A 4UXIA 1T5IA 3VHXA 2AL7A 4Q00A 3SEAA 1LF5A 2EW1A 4Q19A 3V00A 3PFIA 3SHWA 2GVZC 3UG6A 5HE8A 2WWHA 3REGA 621PA 4Z51A 4LJ9A 3WXMA 1E2HA 2O8FA 4RD6A 3CR8A 4UXJA 2ECKA 2KSQA 4ZCLA 1QVAA 4Z1MD 3IIKA 2BHRA 4JLOA 5FUVA 2PJRA 4JKIA 4AIIA 2IYTA 4B3GA 1C4OA 3TQCA 2O8CB 4TQUS 4QL3A 2FDCA 1G21E 1SVMA 1R6BX 4DSOA 4JLNA 2J0VA 3IHLA 5JS8A 1G1MA 4PAMA 3T1OA 4ASUA 4GRAA 4B3BA 5L3VA 4EJSC 4YMTA 4KLNA 4NYMR 1FX0B 2H17A 4NCIA 4Y0VA 1SULA 3KB2A 4CT4B 5G3ZA 2ZANA 3L2OB 3W6NA 1VIYA 1XD2B 4J0QA 3Q85A 3P27A 2AXPA 1FUUA 2REXB 1SHKA 2YOHA 2CXXA 2RGEA 1NI3A 2BKEA 4WZBE 1NSTA 2XITA 3X1DA 1CJKC 1FQJA 2FEOA 1QHYA 3K8YA 1NLYA 1P75A 1NN3A 2VTKA 4RZUA 5J4VA 1J7KA 1PLLA 2W2TA 2F1IA 1D2EA 2WWGA 1Z47A 3SJCA 3WHLA 5IT5A 3NC0C 3RS0A 2ANCA 4LJAA 3R8CA 4IW3B 3EX7C 3R9WA 3FYHA 4N0DA 3O8RA 2VHUA 3QOFA 4D4JA 3WBKA 2J59A 4C0HA 2GWHA 3CO5A 1IN8A 2C9YA 3DPUA 3ZIAD 2QG6A 1W4AA 3MWKA 3CRVA 3T1QA 4IFBA 4Q7KA 3WMGA 2WJYA 2CHQA 4GMXA 2GNOA 2YWEA 3K9GA 1ZCBA 5IK2D 3BIFA 4WIAA 2EFDB 1KI2A 2ZQ5A 2QAGC 3AB3A 3QUSA 4F4IA 5GJBA 3H84A 1DAEA 3OFNA 4LBZA 1UBEA 1KO7A 2ZYVX 3IO3A 3D31A 1S9HA 5HCNA 4AYXA 2P67A 2QP3A 2GZHA 1CR4A 1Z0AA 3B13B 2FE4A 1NF3A 2ASEA 3K0FB 1OXVA 3BRWD 1AA9A 5B2ZA 3UXMA 5JI3E 3AVWA 1LV7A 4Q01A 2FG5A 2RB4A 4OQLA 4TTRA 3WP1B 1YRAA 1Q3TA 2F9MA 3RABA 2ORVA 4EFNA 2FGKA 2O8CA 4L4UA 2Q9BA 4JJKA 1TUIA 3WY9A 3TUJC 3BFXA 1SVOA 1XTQA 3Q5DA 3L8YA 1R10A 4R98A 2XSZD 1G4AE 1FX0A 2GILA 2H16A 5FBRB 4KITB 2IYZA 3EG5A 3ZJYA 1NJGA 1T5LA 4URZR 1G6OA 1XD2A 3ADCA 1PVOA 1HQYE 4KV9A 3U3JA 1E9DA 4U7DA 2VRWA 4QM7A 3TSWA 1EK0A 1GL7A 5HE9A 3PUVA 4WVFA 1N6OA 4NP6A 4Z8YA 4O25A 2AHOA 2NQ2C 2WZQA 4D80A 2NO9A 2AD5A 4DLTA 1R2QA 1NBMD 1PZNA 1N6KA 3PEVA 3UG7A 4KO8A 5FOVA 2IYYA 4B48A 3HDTA 3R7WB 1E9EA 1XTSA 3P20A 1WE2A 2HJGA 3TR5A 2C5LA 4QFMA 4HUTA 1LW7A 1G19A 2VSFA 3FOZA 4GI7A 3ZVLA 2R6CA 1T3SA 4DCUA 1KSHA 1YR7A 1RJ9B 2ZU6A 2FFQA 2KE5A 5H1YA 4ARZB 4EKDA 4HYYA 4DLWA 3EIQA 3QSYA 1G8HA 4QBGB 1WF3A 1F6BA 3QG1A 3VNUA 4M8NE 2LKCA 4G5SA 2HT1A 2FPLA 3THYB 3ZLJA 2ZVPX 3KKNA 2W6JA 4Q18A 4XOIA 1KK2A 1H8HA 1CJTC 2ERXA 3K0FA 3AV0B 2ZJYA 5JMTA 3U44B 1GP2A 3QEOA 5H70A 2CCGA 3K09C 5EQTA 2D2EA 1RW4A 4FWIB 4C9BA 3VKWA 1G16A 1FP6A 4WA7A 1H8EA 2ZROA 4QHTA 1D5CA 1XMVA 4QBIA 1VCIA 1GNRA 5LPNA 4D26A 2ZETA 2J0UB 3B1WA 4RD2A 1GRRA 5L8VA 2YHSA 4NMMA 1MR3F 3PIRA 1YQTA 2QQEA 4Z1MA 5KSPA 4DLZA 2QAGA 1OKKA 3SI7A 1NRJB 1N6RA 3QVVA 4A92A 2VHQA 5EE5B 4JVLA 4B3DA 4H9GA 1OF1A 2BMEA 4RZ2A 4KODA 2WKPA 4R2IA 4P4UA 1YKSA 1ZJ6A 2CNWD 2OHFA 1Z06A 5FBWB 4CT5A 3EWSA 3RAPR 1NLFA 3DKVA 1E2QA 3LW8A 2C9OA 2P2LA 3G5UA 3UMFA 2WHXA 3QPUA 5AJWA 4KFRA 3R7WA 2PCLA 3FHOA 4M53A 4KXFB 1RVDA 4W9MC 1CJMA 1BH2A 5DGXA 2OAP1 2P3SA 1Z8FA 2GDJA 2PX3A 2NPIA 1N0VC 2PZFA 4UNRA 2D06A 1W49A 2GCPA 4GZMA 4GT1A 1DG1G 4CDGA 2VIIA 4DLYA 4QOSA 5FUWA 2R6AA 3KTAB 4WOPA 1CR1A 3W5IA 1COWD 3FGNA 4PR0A 4BASA 1T3LA 4A8JC 3PENA 2DBYA 3EW9A 3TVTA 2ZJAA 2WSMA 3NHAA 4TTPA 4QGAA 4BPBA 1Y3AA 4GPTA 4HZUA 5AJYA 4D4LA 4PZZA 3THYA 2V54A 3SU8A 1HUQA 2VF8A 5EE1A 2HT6A 3SYKA 3U44A 2IW3A 3CWZA 2OCPA 3LWNA 2QI9C 5B58C 2VHTA 4O2RA 5FR1A 1ZBDA 3NEYA 3DO6A 3AUXA 4TTQA 2PT5A 1Q1EA 1LY1A 1W2GA 2ZJ5A 1VTKA 1U8YA 2IYSA 1CULC 1OYYA 2J0UA 2MSCB 4LPSA 4YC7A 3EA5A 1E2KA 2ZR0A 3CB4A 5GJCA 1ZU4A 4ZI2A 5G53C 3SNHA 1XNJA 1W1WA 2GTPA 2ZUCA 1QHSA 4B3XA 1JPJA 2GAAA 4U00A 3KXKA 1GL6A 4DLRA 2ONKA 4B2LA 4FMCF 2F55A 1TL7C 5JS7A 3B1YA 4B43A 2IUTA 2RHDA 4PPFA 1RRFA 3KXIA 4EPTA 2O8BB 2A78A 3NC1C 1RYHA 1IN5A 2VP0A 2WOOA 1BMFD 2QL6A 3MWYW 4G0NA 5H68A 5BQ5A 3K09A 3BH7A 2IX3A 2XSZA 3GP8A 3DDCA 4FWTA 5BN3A 3HYTA 2YWFA 2EQBA 3EPJA 2ZIAA 3I61A 3AQ4A 4GFDA 2J7PD 3RLFA 3GLIE 1K5GA 1YHNA 3CUEF 4Q4AB 3TW4A 1SVWA 4KYUA 4ZIRB 3EC2A 3VX3A 3CONA 4R9UC 3ICQB 5LD2C 4B35A 1KDPA 1R0YA 2QN6A 5FOWA 2V9PA 2CL7X 3P32A 2NTYC 4JLBA 3FDIA 3A36A 4B76A 1XJQA 2IBMA 1E9SA 1KZ7B 2VHCA 3KTAA 4Q48A 5E95A 1VG9B 3W8NA 1BYUA 1KNQA 1KY3A 4ZKDA 5DHFA 2QTFA 2ZRLA 2FZ4A 3DZ8A 4HZIA 4XJXA 5CIWA 2AR7A 2VP2A 4JL6A 4GOJA 4HDQB 4FMDB 4JT2A 2A30A 3GJ5A 1VYUA 4FMCB 1GRNA 1GOTA 3KKMA 2QRZA 4ZV4A 3AGQA 4TT3D 1W5SA 2FF7A 3WNBA 4OQNA 2SHKA 721PA 3ND8A 2ZI5A 4C0AC 1Q20A 2YC4C 5D3QA 2GAOA 1U99A 1EFUA 3CWQA 1DPFA 2RGCA 5K8IA 3MCAA 2WMNB 3AUYA 3A4LA 1E2PA 4KBGA 4LBVA 1EXMA 3CX7A 3ZD7A 4B32A 1GM5A 2CVFA 4HAUA 4EFMA 1KZGB 1UKVY 1IONA 2OCAA 2ZSDA 3ZVNA 1NMXA 1KTVA 1WRBA 2C2HA 821PA 1TUEA 1E32A 1E4YA 2ZS8A 1II9A 3OZXA 3RS3A 4TQAA 5JHGB 4GBMA 1Z2CA 4O0MA 2EFCB 1IN7A 4Q7LA 2MMGA 3FMFA 2O8BA 4PZLA 5JEEA 2W58A 1CXZA 3X2SA 5DIFA 4I99A 5LB4A 2B92A 1QF9A 4OJQA 2GJAA 2H8KA 3VTKA 4LV5B 1NY6A 1U8AA 4TMTA 4BLOA 1HA3A 2D62A 1YJ5A 2IYVA 5AJXA 2XZLA 1RRGA 3CPHA 2AD1A 2ODNA 4YMVA 2VSXA 3FKSD 4ZIRA 2XJ9A 2UZIR 3K0EA 3X1YA 4Q66C 5JRJA 1SKYE 2CNWA 3RS7A 2REBA 3WP0A 2C04A 3CF6R 1P62B 2BV3A 1VG0B 2AX4A 3U7FB 2GBLA 1XBTA 2IUUA 4UNPA 3K0AB 2XOKA 2R6DA 2XZOA 1YZKA 5HCIA 1G5TA 3GCGA 4PHTA 3MJRA 3NHBA 2H92A 3CNNA 1RC8A 1F5NA 2MMCA 3IHWA 4B34A 3SC3A 1WBDA 4MDEA 4DCSA 1S1CA 3P26A 2NIPA 3QKRA 4EUNA 2NGRA 5AJVB 2QMHA 3I5XA 3HU3A 1AZSC 2HLDD 3GLIB 1ZNWA 1W4CA 1TEXA 2R8RA 3MRSA 2ZSAA 5FOTA 4AURA 2VLIA 2ODEA 4QXAA 1F2TB 1KSJA 3TNFA 2BBWA 2J41A 5KDDA 1NVUQ 1JQJC 1YR8A 2WBLC 1DE0A 5CDFE 3U60B 4H1UA 2XNDD 1G8YA 3SJBA 3UMRA 2DFNA 1X1RA 1DO2A 2ZE5A 1KI9A 4TYQA 2CJWA 1SVLA 3IUYA 1MT0A 1AGRA 2O52A 3SFVA 1CTQA 3ADKA 2ZRIA 5CK5A 3VR1A 3B7GA 2D3WA 2VA8A 5TVKA 3RYTC 1G8GA 3CIOA 2ZRJA 2O5VA 3TRFA 2CDNA 2JLZA 4OK5A 2CL6X 2QM8A 5ANRB 4ZDJA 2VHJA 3KFVA 2JASA 1R0WA 3BS4A 4AG5A 2IEYA 1R5BA 4GL2A 2NG1A 3ZZTA 2RMKA 4ESVA 1VECA 2EFHB 4OI4A 4LHVA 2QMUA 4A0HA 5F9FA 3BWDD 1SXJE 1W4BA 2NZJA 3GJ4A 3S1AB 5F98A 3NH6A 5EXTA 3GQBA 2X2FA 5JI2E 4IOKA 1HE8B 2YWGA 3C8UA 3GFTA 4PC1A 4FCVA 4DLVA 1PLKA 1UEIA 3A1VA 3B6EA 4QC2A 2Q3MA 2HCJB 1FFHA 3EARA 4BEBA 2JLVA 1UAAA 2CEAA 1JB1A 2Q3FA 3FE2A 4W7SA 4D0NA 1E9RA 1WMSA 5EUMA 2OBMA 1NKSA 4A1FA 5CLQA 4DDUA 5KNCA 1R8QA 2FSIA 2DPXA 2ZI6A 1U94A 4I1VA 5KNDA 4RD3A 4B47A 3NG1A 4HEJA 1SQ5A 3K53A 2ZTSA 1VYTA 4TWZA 4RSGA 4WXRA 4RFSB 5FOUA 4MITA 1DAFA 3O47A 4OK6A 4MGIR 5KHOC 2YZ2A 2QUZA 4AYWA 3GLIA 1G7SA 2GCOB 4M9SA 3RNLA 1Q1ZA 1ESNA 4JBYA 1J70A 1F2TA 2FZLA 2IYXA 2FGJA 4Q1AA 5AUOB 2J0QA 4JLPA 1P2SA 3U61B 2FH5B 4PANA 3AVUA 3OIVA 3BB3A 5K8LA 1DBSA 1LVGA 1P2VA 4NONA 2RGXA 4UXHA 3JZMA 4OJKA 2IF2A 1KJYA 4PSAA 1GZSA 1N5LA 4MKGA 1XD9A 1JPNA 2ZJZA 1KIMA 1Z2AA 2EYUA 4L9SA 1TX4B 1UKZA 3QXJA 2V6IA 2Z4RA 3ZS9A 5BW8A 5K8TA 2ZRMA 1M2OB 2CE2X 3NBFA 4MRRA 4RKFA 4CYMA 4XWAA 5FTNA 4B3FX 4IVQA 3FKQA 5TDHA 1RRPA 2OV2A 4RZ3A 1UJ2A 2AK3A 2OT3B 4JYBA 4CF7A 2ZS7A 1CBUA 4LDJA 4P3YA 3AH8A 1J8MF 1IHUA 3NIBA 3NEJA 3WYGA 1HQCA 4TZ0A 1KK0A 4MRVA 1G5PA 4B2IA 3S1AA 1KSGA 2ATVA 5EXPA 2EWVA 2I3BA 2P5SA 2KBEA 4HDOB 5DN6D 4JLJA 5HKKA 5BYJA 2PH1A 4ZI3A 1FNNA 2OZEA 1TQ4A 3FKSA 4JSTA 4DB4A 1N6PA 4BRWA 2G1KA 3C5CA 1XPUA 1GNQA 4H1VA 1IY1A 3H86A 3K9HA 4TL6A 4LHZA 3B9QA 5JWOA 2FFAA 2XGJA 1GUAA 4MUAA 2DWOA 3JVUA 2G3YA 4PTLA 3REFA 4DIDA 2OXCA 3SS8A 1T0HB 2X1VA 2EYQA 1ZCAA 2MSEB 2V55B 4RFSA 5IF9A 4F92B 5DYIA 2BBSA 1AIPA 4G01B 2ZE7A 3PXGA 1CR0A 4S35A 4Q5IA 2GCOA 1GG2A 2YKGA 1KY2A 3EPLA 3TGPA 3NBZC 2G77B 4Q21A 1SXJB 5KDOA 2A3RA 3LY5A 3ZD6A 2W0SA 3LV8A 4DLSA 1A82A 5DO9A 2VP5A 5CB6A 4F93B 4AWXA 1IAQA 3Q72A 3ZZ0A 3K0CA 4U5XA 2HLDA 4M9XA 5J4KA 2QY9A 3OHMA 3D8BA 1VG1A 3QQ5A 1KO4A 5JJIA 3B1VA 4RD1A 3M4YA 1NKTA 2J46A 2RGNC 4MUBA 2BDTA 2D2FA 2ZRCA 1G7CA 1DEKA 1SVKA 1ZW6A 1Z83A 4F91B 1XTIA 2F3RA 2IS1A 2F9LA 1LNZA 2AWNA 5SZKB 4NPHA 4YMWA 4Q4JB 1TNDA 2NO0A 4TL9A 1IM2A 4HB4A 1F60A 1NVXQ 1S3GA 2YYZA 3AF1A 5GJWC 3BXZA 2YWHA 3OIUA 4NYMQ 2FFBA 3C14C 4WAUA 2BMDA 2OBLA 2B7CA 4N3NA 1S96A 2HEIA 1A7JA 2OILA 2Q3HA 4OI2A 2YINC 4PHFA 4QJ5A 5CDFA 5FTLA 2GXAA 3OE7D 5JBQA 1XU4A 5P21A 2WICA 2AFIE 1XPRA 1OT3A 4IOLA 3BBPA 5FPKA 2GF0A 3GJ8A 2D74A 1UBCA 4F4CA 1YVDA 3C7KA 5L3RA 4FCTA 1HYQA 4LC0A 1XTRA 4QGHA 2FOLA 4ACBA 3LBIA 4TL7A 1MOZA 2LWIA 4C30A 2C98A 1NNEA 1F3OA 2QZ4A 1F48A 4W5JA 5DHAA 1ODFA 1E96A 2NPFA 2WPDD 4AYTA 1JR6A 1SXJA 1JR3D 3KJIA 1Z0FA 1HV8A 1NIJA 3GJ6A 2IT1A 1T3HA 2ZRNA 2O8EB 4AKHA 3TQFA 2KI5A 4W5WA 3P4YA 1GDDA 3DM5A 3BC1A 4G5RA 2ZAMA 4V0KA 1JEDA 3ONWA 3QBTA 2HYDA 3E2IA 2A9KA 4ON9A 4DSNA 3T35A 3GFOA 5EXXA 2GEUA 1GNPA 4HLDA 5GVRA 5DLQC 4OI1A 2GJSA 2F1HA 1VDZA 2IF0A 5FBVB 2ANBA 3LQQA 3ND9A 4BECA 3OEHD 2R62A 4DZZA 5HZHA 4XSGA 2PX0A 3RRMA 3AVTA 1G41A 4QBFA 3TAHA 1AS0A 4EJSB 2JIZD 1PUJA 4Q7JB 5C46F 1S4QA 4Q4JA 2XAUA 5B57C 5KPJA 2DWQA 4GZLA 3BGWA 4Q9KA 1N2CE 4BRUA 4DHEA 3PCRB 4PHGA 1E9AA 2HYIC 3FMPB 3NKVA 4PQFA 1FNMA 4A2QA 2ZPTX 3RSLA 1EWRA 2JDIA 1X8KA 2ZI7A 1GILA 2WSSD 4LYJA 2F1JA 5FOXA 3IEUA 2IEZA 5FBQB 4G1UC 1DAIA 4RD4A 1VHTA 3NTUA 2XJ4A 2OFXA 4K81B 4LV8B 1ZMXA 5AK0A 4LWZA 1PUIA 5SZIA 3X1XA 5IRCD 4A15A 1G3RA 1G291 5HR5A 4LUCA 5CYOA 5B30A 5FR2A 2R9VA 4RFVA 5C18A 3QPWA 5TV2A 1XWIA 4PZYA 5D3MB 4AC9A 2C9CA 1A2KC 1BS1A 4LOAA 1VCOA 4DCTA 4XD7A 4YMUA 1NBME 2ATXA 3ZYCA 2D7CA 1T4GA 1MO5A 3NWJA 5FBLB 1W36C 3IPXA 1I4LD 4TYNA 2CLSA 4X8MA 5E7JA 4UNQA 2QAGB 3OIWA 2CCKA 3A1SA 3VHLB 5C1BA 2V7QD 1CJVC 2XEXA 3F0TA 1NIPA 3KQHA 2O8EA 5FL7D 2YC2C 1CP2A 2IYLD 1U0HC 3U5ZB 4FW9A 3SHFA 3FPAA 3BFKA 4MRNA 1YZNA 5CJ2A 5KSOA 3L0OA 2NMVA 1W44A 2P65A 4OHWA 2ZJOA 2XB4A 3KJHA 3RWMB 1DAMA 2QQ0A 4PFSA 4ZDKA 1KO5A 1UPTA 4LJ5A 4MA4A 4EJSA 4EPXA 1G17A 2GXSA 1GSIA 3U7HB 3QY0A 3KB1A 4LYFA 1OFHA 1UF9A 4KHZA 3FVQA 3IIJA 4Q9HA 4QGFA 3U4QB 4KFTA 3LO5A 5AUPB 1IXSB 4D0LB 3F8TA 4II7A 5EE9A 1NN5A 1HT2E 4EIWA 2CK3A 4HZUB 4M1SA 1KAGA 1OFIA 5TXGA 1U81A 3CNOA 2GK7A 1KHTA 2BBTA 3QXSA 2GA8A 4P0TA 2JLSA 5J5CA 1XX6A 4WZ6A 2BIFA 3KQUA 2QE7A 3A37A 1TF7A 1P5ZB 3IPYA 1A5TA 2G6BA 2JJ1D 5JECA 1AKEA 1J99A 2WAXA 5JHHB 2ZAOA 5DI3A 4EPYA 3OEED 5TY0A 2BCJQ 4JZKA 5D3MA 4TLCA 1QHIA 4BFUA 4A36A 2QGNA 3VNVA 2D7DA 1E4VA 4DJTA 4LHXA 4DLUA 3OE7A 2XZPA 4LI0A 4JSYA 3TK1A 1SHZA 1RE0A 1E1RD 2IL1A 3RRNA 4EQ6B 4K46A 2GJKA 2CCJA 3LH5A 3AF2A 1OXTA 1NLZA 3AP2A 2ZRKA 1QHGA 3KUCA 4RZXA 1XZQA 4MYUA 1NP6A 1SZPA 1AQYA 2BMFA 4TMWA 3PG5A 4JLDA 4F38A 4AK9A 3PEWA 4P32A 1RFLA 1T0JB 1SGWA 4IDHA 2PZGA 1E6CA 3W3AA 2VYFA 1TEVA 1Z29A 1R7RA 4V0NA 1ZM7A 4B44A 3JZAA 3QI2A 2FEMA 4DDTA 1Z63A 3MG9A 2HUPA 4HB2A 2IWRA 4XSHA 2WPDA 4PO9A 3ZZUA 2C8VA 1UFQA 1ZD1A 1M7GA 2Q6TA 3THOA 3CRQA 3V4FA 2K5UA 3N2IA 4G5QA 4TYWA 3L0SA 2CHVA 3FHCB 4LCBA 4DB2A 2DR3A 2Q9AA 3GJ7A 3IGFA 3LVQE 1YRBA 2BC9A 4M1OA 1P9RA 1XCPA 5FPTA 4B3CA 5JCZA 1E2IA 2QMOA 3IQWA 3G82C 3OEHA 4YXWD 3U4QA 4DSUA 2BEKA 3RS5A 4AD8A 1N0UA 1RIFA 1ZP6A 2JLXA 4KJZA 3PEYA 4MDFA 4TMVA 3ZIAA 4JL8A 5G41A 5BN5A 1OIWA 3TKLA 4PPNA 3CRW1 3QIAA 5KOYA 5IK2A 3GLGE 3LBNA 1DS6A 1Z5ZA 2B21A 3QNUA 1E1QD 4LJYA 1P4SA 2HCBA 3CM0A 4P4SB 3T1TA 4M1WA 1G4UR 1XTJA 4DIEA 1N6IA 2WSSA 4CGZA 4AI6A 1DTSA 1UM8A 5EZ6B 4DUGD 4KI0A 4BUJA 2RGDA 4JVSB 4MGYR 2PEZA 2BM0A 1NG9A 2KJQA 4EQ6A 1XP8A 2GRJA 1JAHA 4L9WA 4A8JB 2WWIA 4PSVA 3SE0A 1I2MA 5E3HA 2E87A 2ZRGA 3LVRE 3W6OA 3RHFA 1HH4A 3TLXA 2WJIA 2PEYA 3GEEA 1RZ3A 2F1RA 2ZRFA 3CRRA 1Q1BA 3OF5A 1MO4A 2A5GA 1XMJA 4KU4A 3WMFA 4JLVA 4A0GA 5IHPA 2V7QA 1OH7A 3AVQA 2D4HA 2F43B 1XZPA 2Q9CA 4ZDWA 1QRAA 4I1SA 1ESMA 2W00A 4V03A 3RC3A 3O8DA 2O0KA 5FL7A 5G40A 3EAQA 1FL9A 4W5HA 5GVSA 4BLTA 2IS6A 2PLRA 2IUSA 2OLKA 1NBMA 3NH9A 3AVPA 3TVDA 4BFXA 2GXQA 2ZSFA 4LC1A 2DCUA 4DRZA 4PSKA 4TLBA 2ZRHA 1UEJA 1W0KD 3E70C 4D25A 3TH5A 1X86B 1G3QA 5KDLA 1Q1QA 4DDWA 2UVQA 3MD0A 3EZ6A 2A5FA 1BO6A 5EP1A 1GWNA 2WJJA 5AJZA 5FPHA 3EZ2A 4QHSA 1J8YF 1UKYA 4PC2A 4BZXA 2W6ID 2DB3A 4NCKA 2JLUA 3QKRB 2J0SA 3SBDA 1TPZA 2C77A 2Z6VA 1XXHE 4PXAA 3GLFE 1US8B 1E69A 4PC3A 5LD2B 4P4SA 2XTZA 2DFTA 5JWHA 1EX6A 1SKQA 1XEWY 2X19A 1SVIA 4HLUC 1KI1A 2J7KA 2BWJA 3W90A 4XVUA 2FMXA 2AWOA 4PAQA 1CLUA 2Q0HA 1TMKA 4N1AA 5A5GA 1AZTA 4BFWA 3PJRA 2EWWA 1CU1A 4TYPA 1OPXA 2QBYB 2JJ1A 3CX8A 2CJWB 4A8JA 1OH8A 1YZGA 3KDSE 4DT1B 4O3MA 4V02A 4A6XA 3VX4A 1XF9A 4BFSA 2QNRA 4TMXA 1P73A 3RWOA 2XNSA 4KBFA 1ZM4A 1UBFA 1P9WA 5AUQA 2G9NA 4B6EA 3JVVA 4B6FA 1LS1A 1DARA
chains in the Genus database with same CATH superfamily
4NFLA 4MEBA 4K9OA 3I37X 4D2IA 2BSXA 4MR9A 4TL8A 1VRWA 1IPEA 2HMTA 1N5RA 2H0QA 4DIUA 3VR3D 3V8QA 1Y98A 3HA2A 4L3VA 4OHVA 4Y2VA 1KMHB 4MH0R 1XCJA 5EJMA 4BKUA 4KVAA 1QV6A 4MMZB 4I4IA 2ZIXB 3O8LA 1EFKA 4LY3A 3FAKA 3CLKA 1NBWB 1W5FA 2W6NA 4TTVA 2Z3ZA 2XA2A 4FD2A 1CUIA 2YR0A 2DPGA 1TTTA 1JHRA 3EIEA 4TLMB 4CDNA 2ZUSA 3VUFA 3I3SR 4K9RA 4UNSA 1WIWA 2G6TA 3GPIA 1BRTA 4MV5A 1FSGA 1E9BA 1M34E 1Z6AA 1GRVA 1Q14A 1L7PA 1W47A 2PMCA 3AZOA 3HP1A 4ZALA 3LLMA 5G0SA 2FQQA 2OCBA 4D9FA 4WUTA 1MPTA 1DP4A 2EFEB 3DQPA 5DV9A 4YB8A 5AOVA 4B33A 4KQKA 2NV6A 8MHTA 3MAGA 3DLTA 1M6NA 2PK3A 5C3MA 3I52A 2F8LA 3QFCA 5KSWB 5E1OA 3OKPA 2F64A 1EFHA 5C80A 4QEZA 4PPQA 4B3HA 2WC1A 1GO2A 1KI6B 3HU2A 1U31A 3LGAA 3HDJA 2R65A 3H3FA 4KYVA 4NH4A 5TY0A 2IYWA 2PUFA 2EZ4A 2EEPA 3P0JA 5LVAA 1YMQA 1DINA 2EF0A 4WMLA 4BVKA 3H3XA 3AHCA 5C8DA 5KOJA 3ESQA 2HK9A 4F84A 3CF2A 4JODA 3EWAA 1QGOA 3NHMA 2PKWA 5A3VA 2ZG6A 1IHYA 1M0SA 4GNKA 4BGEA 1SCJA 1GR0A 5EJEA 4BJ5A 3I4CA 1RPTA 3RLIA 1G59A 4LSGA 4AMGA 1D8TA 1O87A 4YYEA 4AN4A 1VLZA 1W52X 1B6RA 1I3KA 2WTBA 3ZY4A 5F7ZA 3CPEA 1YL6A 3LQRA 4PGHA 3TTVA 1O97D 4BB5A 1H2WA 2VYQA 4NMLA 3ROMA 3OKFA 1CUFA 1P45A 2ADOA 2C99A 5KAPA 4EFLA 4MB0A 5TARA 1JN0A 3PYXA 3KHKA 4JEUA 1ESDA 3JQ8A 4MKFA 3GFVA 2XODA 1NVVR 3O74A 4ND5A 5HFJA 1X9GA 5DM70 5LMNB 3AR9A 3FVRA 3H5LA 2GSDA 3KTFA 4XH9B 4PVCA 4JLAA 1A2OA 3PQCA 5C51B 2LPMA 2W5UA 3AW8A 4NESA 2I03A 1RS0A 4FYHA 4PNHA 4TLAA 2QENA 5FUYA 3BX1A 2EARA 3IXLA 1JNYA 1K8ZB 2YWDA 3L0YA 3PUHA 5H02A 3UHPA 5JJKA 4IJKA 1H0HA 4M1TA 3O73A 3JYOA 5HW0A 4M0LA 1KMHA 2EHJA 1TUGA 4UU1A 4LA4A 3CLRC 3E9EA 1JHXA 2ZIXA 3BDVA 3FZYA 1FTSA 1U3GA 2IZOA 3JTMA 1OYOA 3PNVA 1O94C 3GBVA 5FNVF 4CMCA 5KKCA 3PFKA 5FLKA 3AI7A 3QOYA 3KVNA 4LECA 2I5PO 2DH6A 3A1TA 3D8NA 4ZC8A 2J7PA 4JVOA 3TXYA 5JS6A 3LY7A 4DHWA 4OHOA 4IH4A 1UJNA 2C4NA 4PHHA 3L7NA 4JGGA 1Y3BE 2C5BA 4E07A 5JWRA 4IUBS 4R68A 3ZQ4A 2OPHA 1GNLA 4MYHA 4Y6LA 3L4BC 3O26A 4J16A 3BZBA 4RZQA 5FOSA 2Q3LA 1IXKA 3SBEA 3VH3A 2NVWA 4JH0A 4BEJA 1RDFA 1U9ZA 3T5GA 1ZN9A 2HBYA 1SEVA 3OJEA 1WDTA 3PU6A 5HMMA 4PPGA 1A4IA 4L75A 1GDHA 2RC6A 4O2AB 1KI6A 2ZWIA 4UZFA 4D81A 1FMFA 2UUAB 2C7PA 2VUIB 1R4MB 4IEFB 5AJTA 2NU6B 3L7BA 3T41A 4LJ8A 2X0JA 3AERB 2CNOA 2BJWA 3ZE0B 3KUDA 5BOSB 3AEUB 2B1JA 1RXSA 1OBFO 4JVNA 5F23A 1GVNB 2EDCA 3KC2A 4B6QA 1ZCJA 3KKZA 3B5JA 3K73O 5ES3A 4KQFA 1PEKE 2YVLA 4MVJD 3ZWCA 4FFVA 1HURA 4C7XA 1VM6A 3T4PA 1IHPA 5LQJA 2C0QA 1ZNXA 2XB9A 4HS9A 4J3JA 2I0FA 1WW2A 3NDPA 1PGPA 2GR9A 4N5IX 1WLSA 3ZI4A 5LQAA 1NF9A 4I9FA 3S1SA 5BYKA 4KWEA 3RKUA 4QFCA 2H57A 2DTEA 4AJ9A 3RF7A 2P68A 3VR4A 4RTLA 1NP7A 1YU9A 3AKDA 3LL7A 3RRJA 3OECA 3FF1A 4K0KB 3HPQA 1ECJA 3AETB 2W90A 5DNVA 2WD7A 1QIGA 4RH0A 5LLSA 4G0WA 1ZRHA 3K9WA 1HDCA 5E4FA 1QPZA 2QGFA 1Z0JA 3PQDA 4PRZA 4E6PA 2I2CA 2W11A 1Q3HA 2YWXA 3B85A 5AKLA 2QKYA 4JASB 2WRZA 3FCXA 2WE8A 5CW1A 3B1ZA 3F97A 1XYYA 4IDOA 3WGZA 3NDBB 1E3DA 5CT4A 5IFLA 1VE9A 1QHNA 1QQ5A 1VJ5A 2H2FA 3RUFA 1RI4A 3DFUA 5JXWA 4P82A 3OFND 1UUFA 1W0JD 3UHJA 3JS5A 4DSTA 5DM1A 3JWIA 5IDQA 1XZFA 4COKA 4LHWA 2PWZA 4ZQGA 2QN8A 4BATA 3SQMA 4H0CA 4TSFD 1AH2A 3T34A 1VDMA 2J31A 4NBNA 1ICIA 4F21A 4US2R 3AF6A 4R3NA 2WG2A 3S68A 2V6JA 4QXQA 3COYA 1XALA 2CDCA 2Y27A 3VGPA 3T3PB 2ODAA 3ZIDA 3ZWQA 5LP6F 3KR0A 1E7SA 4PGAA 4US0R 3BIXA 4FSHA 2J9RA 2VAXA 2OCYC 2QJOA 3HRHA 4P3KA 4O2AA 3SR3A 3HM9A 5KKNB 2NU6A 2FB9A 3F6BX 3JV7A 2RGAA 3RBXA 2X6QA 5KJFA 3AERA 3PRKE 4ZCQA 3EPHA 3LDFA 4ODIA 5BOSA 5LKRA 1RRKA 2QYSA 2HHAA 2XWBF 2YHAA 3BGVA 2NOAA 4IXDA 1DIRA 3A1WA 5AXBA 3N2LA 4NCHA 1KXZA 2MYUA 1TJ3A 4GR4A 3JXEA 5K6RA 1HNNA 1E79D 4QNMA 1FNCA 4OSPA 3BK7A 1ZMOA 1IUOA 1Z6YA 5FNVA 2CB0A 4B0PA 5G0UA 1TM7E 3H8VA 3PX7A 3SVTA 4G8BA 4AJ4A 5G02A 3U81A 1E9CA 1U4OA 4S1OA 5FFNA 1WV1A 3IDSA 1JI0A 1P29A 2IHKA 1HRDA 5J58A 4JMPA 1OZ0A 2BFCB 2XNDA 2B78A 3R3XA 3VSAA 2G1JA 4LW8A 2E21A 3TQSA 1EVLA 1FE8A 2FKNA 3FFBA 1NDUA 1A8QA 5E6UB 3IP9A 2PUJA 4OH1A 1KMQA 5IASA 2JJ8A 4M1YA 1UXGA 2H48A 4CL0A 1E3WA 1C3XA 4HTAA 4JC4A 1MRSA 1JKFA 3B1FA 4BNTA 1KJQA 4K7JA 2WTEA 1PLJA 1JWLA 3QA3E 3TLCA 5EJAA 1ZCZA 1OHHA 3NTVA 3O2NA 4GP7A 4DWJA 3JRNA 1USIA 3HJAA 1A9QA 3O1JC 3S7ZA 3ENZA 2VDLB 3D6TB 2FRVA 1JIXA 2C2KA 3M1LA 1EAMA 1JKJB 1J0EA 3B51X 3VTFA 4NZYA 3FSJX 3IMFA 4ZCIA 1L5MA 4MV3A 1Q6YA 1W2WB 1QS0B 3W34A 2PWBA 3V2UA 3FTDA 1QKJA 4MW5A 5FTJA 2C9MA 3P94A 4EYGA 2VT7A 3UVEA 3DC7A 2I62A 1Y4DE 1MTZA 2DX7A 3HN7A 2ZYRA 3D3KA 5JNWA 5BV2P 2PJUA 1XVVA 3D6MA 2ARKA 4RM2A 1H69A 4V0ME 2OE2A 5DK6A 3VJRA 4RK7A 3RIMA 1G18A 4Q1AA 2NZ8A 4FN5A 4LBYA 1GPDG 1TM2A 1WSWA 3F4BA 3IE1A 1BGVA 1E18A 1OFUX 4G0PA 4KE9A 5HPYB 5JXGA 4MPTA 1CUBA 4RL6A 1DMRA 1IY8A 2ZSUA 5CIQA 1T13A 1G2PA 2O0JA 3I6ZA 5I7SA 3LF2A 5JU6A 4C2TA 2FUG6 3Q0IA 4LZZA 1NBAA 1LS6A 1XDWA 3B82A 4DADA 5FV7A 3U19A 2ODQA 2JLYA 3WMEA 2ZAYA 4BBAA 4HXFB 4R2HA 1AB5A 2OHOA 4L5JA 4KCGA 4JCCA 5M04A 1UADA 4MVJI 4D42A 3D8TA 1TOAA 2BF7A 4L0CA 1CR6A 3KLNA 4WXHA 1QIJA 4A2WA 4YCDA 1WZEA 1BROA 1E2LA 4EYQA 1A2BA 4HWTA 3CT4A 3ZR4B 4MJ7A 3B78A 3AX6A 2QPOA 3I1FA 3OFJA 1U0LA 1WPQA 2FX2A 1R74A 2BFCA 2H29A 5LA6F 5DSTA 1G3IA 3BJEA 5DT9A 3TZ6A 3N8NA 2JLRA 1GZUA 5LR6A 2ZJ0A 4XX0B 4A1OA 3O2SB 5E6UA 3DYVA 3PGVA 2R1TB 3AEZA 3D3QA 5EZYB 3KAQA 4Z9BA 2ZUWA 2R4QA 4RWZA 2GYVA 3NOVA 4ZXPA 2JKZA 1B0ZA 4RYLA 5T3UA 4FOPA 2D2XA 1A9PA 4HPWA 2IKSA 3T5MA 4CHGA 3EC1A 4AZ3B 4XWKA 3GRUA 3HDYA 4OBEA 3T0FA 2WINI 4BC0A 1WMBA 4YHHB 3M8KA 2E6UX 2X40A 3SFZA 4ILKA 5HS4A 3PKZA 3KOMA 4PWZA 3VU3A 2DUUA 4DIOA 3LKVA 1P60A 3BEDA 4CM9A 3ORRA 2LCIA 1GAEO 1QS0A 3BIOA 1NYQA 4PICA 2I34A 2XUDA 4ZT3A 1GPYA 3LFUA 5G3YA 4AJLA 1VLMA 4BLSA 1D09A 1ZJWA 4MW0A 3JZDA 2ZSHA 5FUBA 2AZMA 5DI3B 1U7PA 2R97A 2G5CA 2VL7A 2O0LA 3G02A 3S2IA 1M1YE 4N9WA 4N8DA 3MB5A 4ONEA 3RUIA 3RGWS 3AP1A 4IIDA 4FHFA 1XTZA 4AMYA 1JE0A 1NL3A 4A3SA 1NF8A 1RAIA 5EUBA 2D2IA 3HEBA 2VKQA 3LHIA 4MNTA 1DWQA 2I87A 1X2BA 4BNLA 5F2KA 6YASA 5LA6B 3DZHA 1RHQA 1YE3A 5ITVA 3EPRA 1LBHA 3NDJA 2WIAA 4KK3A 1Z0DA 5FI3A 4BO5A 5BNTA 5JRZA 1XDBA 5BSVA 3R77A 5EKUA 1QVVA 1ZGHA 3VVLA 3IDQA 4MRSA 2B2NA 4RQTA 4TLDA 1Z7GA 4XTRA 2O4UX 1UQTA 4MPRA 1BDHA 2D54A 4X6YA 1S2LA 1XKLA 4XW2A 4R0NA 5LZ2A 4INAA 1Z28A 3G7NA 4RANA 2OAQ1 3QVMA 1RFGE 1MQAA 4UHEA 1QJ4A 2PRYA 4M7WA 4PLWA 3EBLA 2GGSA 3PNPA 3IQZA 1L4UA 2G06A 1O9GA 1N3BA 2H5JA 2ISSD 4GLOA 1FMJA 1QK3A 1XRLA 2GRAA 4Q4HB 5TE9A 3WA7A 4P7JA 3VZQA 4LY6A 4NCJA 3MBKA 2KM1A 1FSFA 2R1TA 2ZFUA 4PC6A 1XWWA 4ZO8A 5D87A 4LMBA 3U3MA 4OHZA 5CYFA 5FL3A 3NJ4A 5ICSA 5HRAA 2PMDA 1VRCA 1R4AA 4L4ZA 4AZ3A 5C5CA 2H0AA 2FDRA 4K6MA 4TMZA 1DADA 3VC3A 4WA8A 4IP0A 1W9HA 3DBHB 3IQFA 3D3NA 3ROQA 3TZHA 4C2UA 2BGKA 1L4EA 4URVR 2A2ZA 1KK1A 3FPLA 1KI4A 2JIPA 3HJHA 4AQ7A 5ELXA 1AMUA 3A6LA 5FFMA 1XB2A 3EQ9A 3LRTA 3N6XA 4V0LA 2P9QA 3QPCA 1F2UB 4RHYA 1AUPA 1J5EB 1ONPA 2BFAA 2WV9A 1GAQA 1ONSA 5CK4A 4Y2HA 4D74A 3T15A 1SUDA 3X44A 5E9WA 3KEOA 4CI0B 4IXMA 1QQTA 3BXXA 4QWWA 5JSKA 4HQKA 5F51A 3CC8A 1VYVA 4MSUA 2E5WA 2WUWE 3AFOA 1M2GA 3O8OB 3QENA 4HLQB 3S0JA 1IM5A 4FZVA 1SQGA 4MUNA 5LA6A 1GPAA 5IM4A 4CLDA 1OIVA 4WLOA 3X1MA 5JDIC 4QBHA 2I4OA 1NR1A 2OPBA 3RC9A 4PONA 2WJVA 1JUDA 3EPPA 4Z49A 5AK3A 4MKHA 5IXSA 2VNAA 4FDMA 4P4NA 2O54A 4FW8A 5GZ6A 1QFSA 4RVCA 4LVOA 1KFJB 3N2EA 5IULC 4NL4H 1QAQA 3V4PB 1AKMA 5AXDA 2I1WA 4ZVKA 4F5EA 2XA9A 4HGYA 3W8EA 1LC0A 1U3VA 1S3SA 2QTTA 2PSEA 5H4GA 3V3KA 1N5JA 4J0KA 4Z0PA 4XM2A 5EE0A 4CTKA 2WDZA 1QCDA 4KRXA 1JR3A 5JZOA 1JVSA 4KC0A 3UKDA 3M9XA 4QWMA 4KO4S 4DQLA 1Y7TA 2ZCVA 2GAIA 4M89A 4R5MA 3FETA 4Q4HA 2X3UA 2XNCA 1OB2A 2OWEA 1U28A 2PMBA 4FZ3A 5DTIA 3WQHA 2IHJA 4B84A 2YFHA 2VPTA 3CKLA 1CZLA 4M1EA 1W7AA 4DMGA 2J48A 3I04M 1ZW1A 3HM2A 3JVIA 5K6TA 3L46A 1R1DA 1GGNA 1E99A 2FSHA 3I04A 2HBRA 2ZTLA 4BIIA 1QBGA 3BTVA 5DIZA 3ZK7A 1VA5A 1T9GR 4INOA 4F72A 2EW8A 4OKSA 3V4RA 2QTLA 5IPFA 3WIUA 3EIUA 5KTSA 2FN4A 1Z73A 5L7YA 1FNDA 2CDRA 2JIZA 3DBHA 1NJ2A 1VBNA 3V33A 1YR6A 4OL0A 1LA2A 2HQSA 3DZGA 1DCTA 1KDOA 3GR6A 4K0RA 1JAIA 1U8EA 4LYAA 3BRQA 3G9ZA 4WKCA 4GKJB 3P9YA 4BLUA 3GFRA 3IV9A 4Y2XA 2YZMA 2GJ4A 4UE6A 4U2EA 1XMIA 1O6GA 3JZIA 4AMBA 4CEJB 2EQ5A 3AG6A 4H27A 3S2SA 1F2UA 5A9TA 1TF2A 1JT2A 3GL9A 3PFCA 2JLBA 3HVJA 1RJ9A 2XUPA 4PHCA 1QPBA 2IC5A 10MHA 4FGSA 4ZI7B 2AC4A 3NO4A 3CX3A 4Q6WA 4YT4A 3N6RA 4FI3F 1G42A 1TVMA 2RCNA 3QWBA 4LVNA 1J5XA 3B70A 2C2MA 2FNAA 2Y1DA 3AP3A 4KG7A 5MF6A 3LZ6A 2CYAA 2A7QA 5FTWA 5LU9A 2VYNA 4FGKA 3IAFA 4HO1X 3EF1A 1JJ7A 3O8OA 5L9AA 1J06A 3PLNA 3MSXA 3SR4A 4A8JC 1WCV1 4G5OA 3VI4B 4DLLA 2EP8A 4R0MA 1JAXA 2AYZA 5FTMA 2CLDX 3AFGA 4JUIA 1M1UA 4BNJA 3RADC 1TK2A 3VSEA 3G0DA 2DSTA 2QP9X 1D8AA 3GJSA 3MWJA 4FWBA 1X6VA 1G5IA 1MCZA 1Z3IX 1UK7A 3FB1A 2BCGY 2X5JO 4GLFA 4M87A 4FP9A 4NAHA 4DNFA 2P4EA 5KU1A 4IKEA 1CS4C 3UJ3X 2JFGA 4XWGA 4RCYA 3AY0A 3ZS8A 2WTAA 2PLWA 4KH1A 5IBPA 3VFDA 5FAKA 3H3JA 3RS8A 1ADCA 4BMOB 4PX9A 1JX6A 1A9SA 4LAFA 2OEPA 3SHQA 1KH1A 2W9XA 4PEVA 1YRQA 5H4HA 4GXTA 1HKUA 1KS2A 4J0CA 4LEIA 3TWOA 2BP7B 5IW8A 4P34A 4BS9A 3HKBB 5AW0A 2M6KA 3COVA 4MUMA 4C4YA 1KU0A 1P0CA 2JKYA 2XT0A 1T8RA 4M8KA 3TBHA 4YLGA 1FB5A 5LBIA 3TXXA 4N4AA 4W9RA 4WXPA 3LLUA 2YRXA 1HYEA 5GY7A 3RHZA 1OVMA 4RBNA 1YZYA 3FPFA 1O2DA 1ZO8A 1OB5A 3AF4A 4YP7A 1SCBA 1KO8A 2G72A 5AIAA 2VS1A 3ZU2A 3G0IA 2VP3A 1YZLA 2NO1A 3GROA 1OXXK 4CEJA 3OWXA 2HJHA 2ZRAA 1VBMA 1PVVA 3FWYA 4QQ8A 3FLMA 2Z4TA 3OETA 4JU9A 4MCJA 1DT3A 4C04A 4F7WA 2ECPA 2CVZA 4O8ZA 1L5SA 4A82A 2XBMA 3UWKA 1NVEA 3AF0A 3W7AA 1G6HA 1LLQA 2FFHA 1ISJA 1I5EA 3CR3C 2I6QA 3BE8A 3Q7IA 3RYIB 2R6R1 5T41A 4QPJC 3AY7A 3DL0A 4YEDA 5CFRA 4Q4LA 5I51A 2VDPB 3GIDA 3GVIA 3G8AA 3VR6D 4R5HA 2XVYA 1O4VA 3PQ3A 4X65B 5CUQA 3FJ1A 3NCTA 4HAIA 4D4GA 1X7WB 1AKTA 1HKHA 2PGLA 4EB8A 2QT9A 5EA2A 1A98A 2HH9A 5T5QA 4GSYA 1XRJA 3ZHSA 4C29A 2FF5A 2PWAA 2YJTD 4DLAA 5H5JA 4E22A 4LXUA 1WVMA 3TN7A 3AKCA 3W4JA 2B8NA 1YB6A 3PCXA 4HUQB 2QZSA 1XLUA 5JZMA 4E94A 3U1BA 3E35A 4KL8S 2P1RA 2C61A 3T06B 2G07A 2G28A 3NMUF 4HOYA 3L0IB 3OJFA 2XYVA 1VKHA 3ITEA 2XF8A 3T1VA 1UDBA 2C7VA 5KVVA 1P9NA 5GP1A 4UE3S 2VTEA 4GP6A 1JG7A 4C01A 1YJ8A 1OXSC 1ES9A 2DWPA 3COZA 2CXSA 1HM5A 1TEHA 1J90A 3D4BA 2XZDA 4GEKA 5TPZD 1QH1A 2JFVA 4JLWA 1U9IA 2KLBA 1ZAKA 2Z9DA 2EIXA 3HLKA 4H3HB 5JPDA 4JT4A 4Y2RA 3OZ7A 4D7AA 1IBRA 4D4MA 3HKBA 2FMHA 1X1SA 1ZY2A 2XECA 3BIJA 3HPRA 1OBHA 1X7ZB 2HA4A 2VYVD 5DHPA 4EMUA 4ZMBA 5HKKD 1G7TA 4KYIB 5E9JA 2W2LA 4EYEA 3MAAC 1AGNA 3KLBA 5AKYA 3H97A 5HJ2A 5I4CA 2VDMB 4CIDA 3GRFA 3CKMA 1T5TA 3SSOA 1RTKA 1U8ZA 4W9NA 5KNBD 4WWHA 2MDTA 2IA5A 2AIRA 4DR7B 4NABA 3EVGA 4XGRA 4Z4CA 4XGIA 5MN5A 1T91A 1FFCA 2I1VB 2QUHA 2CMKA 1V48A 2R6FA 2YWCA 1QB8A 3AC0A 2HQOA 3HTXA 2X5OA 3UO8B 4KYTA 4BNWA 4HDMB 1C4WA 1I2BA 4QAQA 3UQZA 4E03A 3B9PA 1VZ3A 3RVNA 3TEMA 4O4LF 2B1RA 1AXEA 2W22A 5DWQA 2DFDA 4IWXA 1O0BA 4HUJA 3KDPA 2GN6A 2E4WA 4RXTA 3EVNA 1A9XB 4XFKA 4ZEOA 1QU2A 4U6QA 2FPKA 2VEDA 3RYIA 4FB4A 4NU8X 1E62A 3HCBA 3PFNA 4G0QA 3D7LA 3FCAA 5ILQA 2W43A 4E51A 3JSXA 4YV7A 3TZBA 1DELA 3WQSB 4EF5A 3WYCA 4DQ0A 1R6VA 3OSZA 3E3MA 3ANMA 4GMHA 4RPHA 3HSYA 3R5HA 4WZAE 1KDYA 4BO1A 3HR8A 5JQGF 3KQLA 5EKXA 4QKQA 2FMKA 1X7WA 4TWJA 5IKEA 4UE2A 2D5LA 4Y7DA 5M34A 3W0LB 3I32A 4UTVA 3PXEA 421PA 3NS7A 1QCCA 1RKQA 3OZBA 3EVTA 5CB4F 4HQ0A 5B4VA 2FJUA 2G9QA 3HWSA 3GDWA 4NJOA 5JATA 2Y0EA 1Y7IA 1XHEA 2ZUBA 4HUQA 5IT4A 1PV4A 3ADOA 3ESXA 3H4MA 2H11A 2VCEA 2HNKA 3OOSA 3VMFA 2OMEA 4OYYA 3SQXA 1RRMA 2PUVA 4GMGA 3T9EA 4NQRA 1Q0TA 5DCWA 1JXAA 3KETA 5KQPA 1MOPA 1A8SA 4HI0E 4FT4A 2E5LB 3B3FA 1I9CA 3BCRA 3L7KA 1Z08A 1Z2DA 1LJUA 1DJQA 4YPOA 4FOSA 1E60A 1SOVA 2IW1A 2YWJA 5ELMA 3WLAA 1D4OA 5DNYB 3ZHBA 5T4EA 2GLUA 1PZGA 4Z7QB 4OSEA 4DS3A 2XDAA 2YOGA 1AKNA 2OZPA 3RVQA 3FOEC 2ZEJA 2IEGA 3VR2D 3PD0A 4FVTA 4BN5A 3HJUA 3DOIA 1T29A 2O7VA 3ZHQA 3CVOA 1X7ZA 3OCYA 5JJLA 2PX8A 3MWDB 1BIFA 1JR4A 1W9MA 2I67A 3MMPA 3I23A 1RT9A 3LPLA 1GFIA 2GJ8A 2A6PA 1YB1A 4RU1A 4ZAYA 2IKQA 3CLTD 2FPPB 4Z9XA 1Z18A 2BTQB 4ZT7A 4C7VA 5L3QB 1ICEA 3WNCA 1HLPA 1Q77A 2KBFA 2Q4BA 4M99A 4IRXA 2GWRA 2P11A 1WJGA 2C5EA 4KFCA 2DT5A 2IDKA 2BF4A 1KOFA 4CVNA 5BNIA 2J45A 3FA2A 3WTBA 4MHTA 1FYWA 2OO3A 5JLJA 3RRZA 5HIIA 4MR8A 2DBRA 3C1OA 2P91A 1A9XA 3VKHA 1ZM3A 2VH5R 3KPWA 5FI1B 3RSFA 5ITWA 3VNVA 4R1LA 1YF3A 4MX8A 2COEA 5F2EA 4JIMA 4MRMA 1NMSA 2CXUA 2IXFA 8OHMA 1QOQB 1U8UA 2YJNA 2PFGA 3DE0X 3PDIB 1SXJD 3PEUA 3W8DA 3ZTWA 1ESZA 4MPPA 1XZHA 4FEGA 5A4KA 5AW4A 2I76A 4Q7MB 2PRIA 1H6CA 2YL2A 5A5EA 4Y2QA 1XNGA 1Q0LA 1OXKB 1DOAA 1FMTA 1VKOA 2WUVA 3DB2A 3HCFA 3MA0A 4FFOA 4B4KA 4DMCA 5DW3A 4WXYB 2DLCX 3CTPA 1JHYA 3AJ8A 1NVDA 3P2MA 4FOTA 3O8CA 5EKTA 3FNGA 3J7TA 2FR0A 1QU3A 3RQIA 3DTVB 2ET6A 3L6UA 2HM7A 2YASA 1J2TA 3HJCA 3B60A 1G66A 4LN1A 4MQFB 4X7BA 1M2WA 3GUVA 4O2LA 4BQFA 5D86A 1JXMA 3V8NA 2FSSA 2JCSA 3RV4A 4TTJA 2XYQA 3AR3A 3DOJA 2C4MA 4QODA 1EYZA 2E1PA 2X5KO 1ZCFA 3K9NA 1OSNA 3EHDA 2B94A 3WR5A 3E8MA 3TW8B 3RARA 1HEIA 5THXA 2WKQA 4TGLA 3AIMA 2AE1A 1M10A 3HHEA 2YFQA 2YHUA 4U7TB 1X7HA 4LF9B 1QC5A 1MG0A 3FWKA 1Q22A 4KOEC 1U0BB 1YZVA 2PJZA 3ABOB 3DW1X 3O8BA 2JDID 1FBNA 1F12A 3O4VA 4PLGA 1M7HA 1QPGA 4JYCA 4K8OA 3UHAA 2ORED 4DE5A 1ZR2A 3KVYA 1J0DA 1PR1A 3LCUA 1AUOA 3CLSC 3MWDA 5GADl 3BD8A 3IT0A 3PHGA 1XHFA 2FSGA 3BTSA 5T6MA 3K5PA 5JQGB 1UJ4A 1C2YA 1NXPA 3UFBA 1CJBA 5JLAA 3CU5A 5CB0A 5JQGA 4IOMA 2FPPA 1ECPA 2ILVA 3OEWA 2GK3A 5L3QA 2BTQA 4UEOA 1NMZA 3KXPA 5G0TA 4C2BA 1SBTA 2BBOA 4FX5A 1YMVA 2ZTVA 3KRTA 3HFGA 1E0SA 1H1DA 3DB1A 2DFVA 3R6WA 3PNBA 4M0EA 4R81A 1PV2A 2VF4X 4J0IA 4XD7D 4OMDA 1VG8A 1Y9DA 2SKCA 1GTL1 1O94A 2HA0A 3F5FA 4OEHA 2YHBA 1FXUA 3ZOKA 2WU1A 3ZDRA 1PJ8A 2ZP1A 3PC7A 4M3NA 1PK7A 3N2YA 1JIJA 2C03A 1QHHB 1MFPA 3OLXA 3GVHA 4JBIA 4MQUA 4KSYA 5I5GA 1YTUA 4EUEA 2QF7A 5I6DA 2ZU0C 3ISVA 4N5LA 2GETA 1DAGA 3PDIA 4PYKA 4NDNE 1VCMA 2F3UA 1OTHA 2I4IA 1MAAA 2IHTA 1WL8A 3H5WA 1FTGA 3L4BA 5AKIA 1RQ2A 5B1SA 5KCMA 4ECAA 4UDXX 4X95A 1NMYA 2HMSA 3ISJA 4MHOA 4J1QA 4UFPA 3SEQA 4O1MA 4BO3A 4MWBA 1AS3A 1RZVA 4RKWA 4CN9A 1YACA 1JHMA 1K8RA 1EXNA 1SD5A 5LN1A 1I01A 3A28A 4CR7A 4LMPA 2F8SA 1F1BA 1KDTA 3DTVA 3M4NA 1EFRA 1ZVQA 2AN5A 1E2DA 2HSZA 4PF1A 3EG9B 3DHWC 2ZYGA 4MQFA 3ZVKA 1ILWA 4E1VA 2C9BA 2JH3A 1I2CA 4MUFA 4NOLA 4N49A 3FUWA 3FJOA 3L06A 4NH0A 4C05A 3F96A 1LDYA 3BL5A 3TW8A 3D8RA 2BCEA 3P9NA 1PFGA 1CEEA 4CN8A 3E9CA 1HMYA 2ZULA 3IOMA 1IG0A 1R37A 3MJEA 4IEIA 4L08A 1GA1A 1I4EB 1BN6A 1YJAA 2ZUDA 4JJZA 4WH0A 4IJUA 1RBYA 1W5TA 5DYYA 4BJHB 4NEQA 3HK2A 2YN2A 3N5CA 1C7IA 3UNXA 3G8BA 4GF5A 4UHFA 2O2XA 4URUR 2Q6KA 4WFQA 3RIXA 1SBHA 3UK6A 3KEMA 4J1SA 3O8QB 2ZQZA 1E9FA 4LJ7A 2NO6A 3HVIA 2JLWA 4R84A 2AJCA 3H2GA 4H0FA 4AQYB 2J3IA 1EXDA 1R9NA 1SCNE 4G0UA 2QORA 2R6JA 4UXIA 5JBIA 3T1NA 1GTRA 2F9FA 2AL7A 4OM8A 3OH8A 3UUEA 4F8EA 1MT3A 3QFSA 3SHWA 3UG6A 1O6CA 1D1SA 2D3TA 4PSCA 4Z51A 1PCXA 1E2HA 4CDMA 4UXJA 2I29A 3ZEIA 1THGA 1XL0A 4J6EA 3KQOA 3DOOA 2LCQA 3KG2A 2ON6A 5K1ZA 3TIGA 3ZJTA 3SX0A 3OQBA 1XDSA 3OJLA 2O8CB 1Z25A 1X38A 4E2XA 1LBSA 1PQPA 2X7HA 4U5QA 1WPRA 1EX9A 1RKXA 3DDHA 3ZX4A 1G21E 4PYRA 2VJLA 3W3AD 3IHLA 1WMEA 3KWFA 4ASUA 4L6CA 1TE2A 3AM3A 2JFWA 2OK8A 1N2HA 2I8CA 3CLUC 2QJWA 1KPGA 3FOAA 4RTPA 1FX0B 4NCIA 4Y0VA 2I55A 3PUJA 4CT4B 1H9AA 3L2OB 3N7AA 3INTA 3W6NA 1V5FA 1CEQA 4I9UA 5CM2Z 3HO6A 3I0MA 3GFQA 3VDQA 3ZV4A 1QONA 1IVNA 3EG9A 4XFDA 1Q7TA 1H42A 2REXB 1NI4B 2M1ZA 4HZGA 4G84A 2G25A 3HR4A 4WZBE 4ZAGA 2XITA 1JLSA 2GT1A 3SFTA 1CJKC 2VT2A 4RJKA 4YRBA 1QHYA 2IBSA 4FGUA 1GN9A 2VTKA 1NN3A 4KLAA 4QDJA 1ECBA 5ECGC 3HXOA 5ALFA 2GPWA 3DOHA 5E8JA 1TTQB 5BMVB 1ZK3A 1RM3A 2WWGA 1SRQA 4N41A 1X13A 3OA0A 3WHLA 4A1FA 4CWAA 5IT5A 4C6RA 3SZ3A 3G2MA 5JMWA 3WAGA 3HNOA 4LJAA 4IW3B 4GKVA 3EX7C 3FYHA 3GEGA 2EF1A 5EY5B 3REQB 3QOFA 3O8RA 3UT6A 2QD3A 1F8UA 3TFWA 1SIOA 3DPUA 1W4AA 3CRVA 2KLHA 2IUFA 3NHYA 5AQEA 2VHZA 4LYDA 2AW3A 2WJYA 3EQZA 4GMXA 2DBVO 2ATCA 1KI2A 2RBEA 2F3PA 4HWGA 4WLUA 4F4IA 1NF2A 2A0KA 2JB9A 3C1UA 4GLJA 1KO7A 2AOTB 2VDWB 2HA2A 2D1SA 4AYXA 2P67A 2QP3A 4RSHA 4UTRA 3DD5A 4NV3A 4D4IA 4K3VA 4ZP1A 4NPCA 2IYPA 1HG0A 1LV7A 4ISCA 3HABA 1N2JA 1WMFA 2DHQA 2E2WA 4V0SA 3ZDCA 5B7NA 4YAKA 2PGJA 3MQ4A 4TTRA 5EVJA 2F9MA 2XUAA 2IU0A 1Y42X 2G4LA 3E82A 3HBFA 1Z36A 2Q9BA 4XCVA 2O8CA 4F46A 2ID4A 1TUIA 3KCNA 1IBSA 3RWBA 2LBPA 4OQDA 4CQLB 3KSAC 1R10A 2HJ9A 2XSZD 4R98A 1G4AE 1VMKA 2JI8A 1FX0A 2DHEA 4LQDA 1NFRA 2H85A 2C59A 3GLSA 3OOWA 2AC2A 2VEOA 4TKVB 4YV2A 3EG5A 2CWDA 1EDDA 2GFIA 1NJGA 3R0IA 4URZR 1G6OA 5L51A 3DO5A 4Y9DA 3EGXB 4QU5A 4GOND 1PVOA 1AB6A 1HQYE 1E9DA 3K8ZA 1IOLA 3KQPA 1RXVA 1EK0A 1EP9A 2RAVA 2WFMA 1NI4A 3EUAA 3B36A 3GAFA 2DQ4A 2R47A 3PUVA 4N7JA 4PLPA 4UCWA 4OO3A 2GB4A 2OFFA 2AHOA 1TM3E 5CXQA 4DR5B 1UK6A 1NVAA 2JPDA 2NO9A 4FJ2A 1YBAA 3WK7A 1KEEB 3U26A 1NBMD 1HQDA 4HLNA 1KZHA 3UC9A 1AA6A 1WETA 3R3JA 4A0QA 2FVXA 4L6IA 3L4JA 3OQ6A 4GIBA 5BMVA 1E9EA 4L57A 3P20A 3QVSA 3W5IA 3P2IA 4ZZ2A 2B83A 1VSBA 4RTMA 2H5IA 4IH1A 2C5LA 4QFMA 4EZIA 1JVBA 2QZ9A 3REQA 3FOZA 4QU8A 1PL7A 3ZVLA 1EFAA 4DCUA 3RVKA 3P19A 2ZU6A 2FFQA 1KQOA 3BF7A 5DLYA 5H1YA 1NWHA 2PM8A 4HYYA 4ARZB 3QSYA 2Z5VA 3HI6A 1SN7A 3T3GA 1KY5A 1XZEA 2H1VA 4IR7A 3NWPA 1POXA 4XD2A 2LKCA 4G5SA 3ZI7A 4EA9A 2AOTA 2VDWA 4UHCA 4TVSA 3ZLJA 3EQ6A 3QVWA 1BQEA 3A0RB 1UH5A 3K9FC 4FIZA 4G5XA 2DPHA 2XLBA 3WHPA 1CJTC 2ERXA 4LDZA 2ZJYA 1T4DA 3H2BA 1KEWA 3PGA1 5H70A 2CCGA 3K09C 2D2EA 4C9BA 4FWIB 3KD3A 5KWSA 4ENSA 3N86A 4DTCA 2KW5A 1LNQA 1H8EA 4J0DA 1XMVA 4ED9A 2AJBA 1VCIA 1GNRA 3COPA 5AW9A 2AUNA 2XV1A 3PDUA 3PLRA 2WKWA 4R3WA 1OY1A 5ESWA 3TD2A 3TZKA 4S1VA 5L8VA 2AZXA 5LYYA 1N92A 3GNLA 3TM5A 3NP7A 4ATNA 4H7IA 2NZYA 1QWOA 3ZD8A 2I4LA 2K7FA 3FBTA 2HA3A 1YAJA 4UEWA 4CQLA 1J23A 1HOXA 1JG6A 2NAFA 1D7OA 2O48X 3BXGA 3FFTA 4I66A 3SVZA 1C9DB 2ZKLA 3K72B 3QK7A 2QAGA 1LPAB 3ID6C 3SQLA 3UMBA 4DLZA 5CFNA 4GDFA 4M76B 1N6RA 4JN6B 3QVVA 3RT9A 4A92A 1UEXC 2VHQA 3D6NB 3AONB 2DMRA 4ND7A 4OP3A 4TKVA 5HSGA 4JVLA 2J4FA 4H9GA 3AQIA 2Z08A 3EGXA 4L51A 4OHUA 1Z26A 1MAHA 3A1CA 1R9JA 3O1HB 1FUEA 1PK8A 2CHFA 3GH3A 4I1IA 3V8MA 1ZVMA 2V5VA 2ZLBA 2CNWD 3NEAA 4FLMA 4TM8A 3TX2A 3O9MA 4CF6A 1IDOA 1Z06A 2CLEB 3OLQA 4ENVA 4ZRDA 5EHXA 3FTFA