2AR7A

Crystal structure of human adenylate kinase 4, ak4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
KLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human adenylate kinase 4, AK4
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenylate kinase 4
total genus 72
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ar7A00
5F9FA 1SVWA 4KJZA 4DLXA 3I5YA 1SVOA 4V0ME 2QG6A 1KI6A 4HAUA 2R6GA 3DOFA 1T8UA 2GAAA 3CH4B 4Q21A 1KSFX 1E69A 1F6BA 3KQHA 2CK3A 2GDJA 4HEJA 4B3XA 5FPKA 2G77B 1G8PA 5KNDA 1CR4A 4OK3A 1N0VC 4MRNA 2A7QA 4TMZA 5CLLA 1BYUA 4TT3A 5EXTA 5JHHB 3IPYA 4Q19A 1OH7A 1R2QA 1E2FA 2W00A 3A1UA 2Q21A 1OXVA 1SQ5A 2FFBA 1ZP6A 3ZVNA 1SVIA 2V9PA 4DB4A 2QP4A 3ADKA 4BFUA 1TQDA 3KQNA 2IYSA 4FCTA 4R98A 1R7RA 1GILA 3IKJA 2ZRJA 4EIWA 3BGWA 4ACAA 2DWQA 3RAPR 3SHWA 2QBYB 3EX7C 3RANA 4Z54A 4B75A 3A1TA 1LNZA 5E7MA 4HB3A 3AM1A 2FPLA 1GITA 1TUEA 1OH8A 1NNEA 1G8GA 4BGDA 4YXWA 1Z47A 1DPFA 1BMFD 4I1OA 2KB0A 1HT1E 3ZGXA 3K09C 2V3CC 4YMSA 1ELOA 1T91A 5GVRA 3MRSA 3TK1A 5FUYA 3NEJA 1MRNA 5KDDA 1D2NA 1NL3A 2W83A 3Q5EA 1W5TA 1KO5A 4H1VA 5JSZA 5KNBA 1QHSA 4P4SA 5AJYA 4ZDWA 1NG1A 5H8WA 1A5TA 2ZTSA 3G82C 3RS4A 3TH5A 1T8TA 4JL8A 2QL6A 3JZMA 2VLIA 1NN0A 2C9OA 1E9SA 3N5CA 5FUVA 2PH1A 3CNNA 4N3NA 1TF5A 3RRNA 1N6HA 2VO1A 3GJ3A 2WZQA 6Q21A 4PR0A 5FR2A 2F1IA 4DLZA 4WZ6A 4M2LA 2F43A 1QHGA 2QMEA 3QKUA 4HLQB 4IW3B 3P26A 2Z4RA 1E9CA 1OXSC 1ZM4A 3H0KA 4KYIB 1N6PA 2XTMA 2J7PA 4LY6A 1JECA 1G3IA 2XB4A 3QEOA 3AV0B 2HT6A 2JLQA 1DBSA 4JLNA 1XMVA 5G53C 3G5UA 1FTNA 5CK4A 5C18A 1H8HD 2VP2A 2Q3HA 4FW9A 2JA1A 4Q4AA 3T06B 2GHIA 2KJQA 4GBMA 4OQXA 3W6OA 2VSXA 1G5PA 4PXAA 3OEHA 2BMFA 2FG5A 1HUQA 3I5XA 5JWOA 5DN6A 1P60A 3NWJA 1G3RA 3HR8A 4PC6A 3F5FA 3L82B 1G21E 3WMFA 4RZUA 1CJMA 5P21A 1L4YA 4HLDA 4Q1AA 2V55B 3K9LA 3K0CC 3CF2A 4HUQA 2WOJA 5SZHB 3U60B 2FFQA 4B2IA 3FYHA 1RPZA 1CP2A 3GEEA 3EIQA 3LDAA 4TN1A 5CM9C 3VQTA 1IXZA 5A5GA 4Q9JA 3O8CA 1HE1C 2QZ4A 3BXZA 4LDJA 4EPTA 1N6OA 2BMEA 4Q7MB 3IO3A 5EXXA 4RSGA 2P65A 3EWAA 1RW4A 1KI9A 4G3XA 5CDFA 1II8A 3IQWA 4Q7JB 3QNUA 4M1YA 3GLGA 2HDNB 2GEUA 2ZE5A 4DIEA 2CLDX 621PA 1HA3A 1VCMA 1ZM7A 1FW6A 4EQ6A 2EFDB 4I81A 4I1SA 1JR3A 3F8TA 2ZI3A 3QVUA 4O0MA 3PUYA 1N5IA 2YYZA 3OAAA 4OK5A 4NZYA 4ZDIA 2QTVB 4NYMR 1F5NA 821PA 2I4IA 4HATA 2WJIA 2A5FA 1EWRA 3FWYA 5FPYA 3CRQA 2OBNA 2G83A 2OLJA 1XXHE 4EPRA 1SKYB 3DM5A 1SZPA 4LC1A 4G5SA 2JIZA 2VTKA 1NVVQ 2BEJA 4A8JA 1E2EA 3U5ZB 2IYYA 2QMOA 1YZQA 5C4MA 2HXSA 1W49A 3GJ6A 4XWKA 1Z07A 5L3VA 3W3AA 3AP1A 5D3QA 3LA6A 2WWWA 3THYA 2OCYC 2J45A 4DSOA 1OIXA 1P73A 1W4RA 3KJGA 3CO5A 4D4LA 5M04A 2CL6X 2B8TA 4PC3A 4TQUS 1UM8A 1CJUC 1HYQA 2IYQA 2ZITA 3QVVA 2FMXA 4OHVA 3UG7A 3MSXA 4TL8A 1Q57A 3CLVA 4PPFA 3RHFA 1E6CA 1TADA 4ILEA 1UKEA 2IEZA 2RHMA 1Z0KA 3C8UA 3NDPA 4OI2A 2JJ1A 3WBKA 4W9MC 1NIPA 1SXJA 1X1RA 4Q9IA 4BZQA 4POAA 4DLTA 1MO3A 2GKSA 2ZRKA 3EPJA 3TQCA 4XSGA 3EZFA 5CM8B 2QSYA 3B6EA 4HAZA 3VMFA 3U7EB 1E98A 3ZJYA 2OG2A 1FTSA 5JWRA 2ODWA 1W36B 1N5KA 2OAP1 4H9GA 1FX0B 4OHWA 1HY3A 1QHHB 2AWOA 3ASYA 4MYTA 2HXYA 2ZI9A 4PFSA 4QHSA 3MJRA 4BLRA 1FOEB 2IS4A 4LZZA 2BEKA 3AGQA 4NKRA 3SFZA 3EIEA 3R7WB 5DYIA 3WHLA 4KSBA 1E2IA 2ODNA 5EE9A 1GFIA 2CCJA 2RGEA 4HB4A 721PA 1FUKA 4Z8XA 3SR0A 3DHWC 2XNDD 3DVLA 3EASA 3EC2A 2HUPA 3AF2A 3MWJA 4TMTA 1IN6A 1YZNA 3B1XA 2DCUA 2CCKA 2QP9X 1E99A 2JLSA 1FMLA 1NLZA 1YHNA 3KKPA 4Z51A 5DI3A 3W5JA 4A0FA 3PV0A 5G41A 3V4FA 5CK5A 3TR0A 1TQ2A 5EUQB 3FMFA 2XZLA 4A36A 3OIUA 3QBVA 1RIFA 4AYXA 4DJTA 2ZANA 4ITRC 2GWHA 3SBDA 2PX0A 1G41A 3SQXA 1FFHA 1VG1A 2GETA 4UNRA 1W0JA 2F3RA 1R10A 2GXSA 3CNLA 3JVVA 5SZKB 2OFOA 4HLUC 1XF9A 4DZZA 2YHSA 5CB8A 1C1YA 3FTQA 2ZXUA 5EXPA 3KB2A 2RGAA 3VU9A 4P3YA 4OI4A 4G5OA 4OQLA 1E2KA 2IYXA 2O8FA 3FGNA 5AUQA 5KNCA 1ZU4A 1M2OB 4M1SA 4WW0A 1QG4A 2J7PD 1KI6B 2GBLC 1MO5A 3C4JA 1ZM9A 2XSZA 2ZSDA 1Q1BA 4LPKA 1KMHA 4JZKA 4URVR 4BLPA 1XCPA 1G4AE 5K8UA 2CLCX 2ZSBA 4OKSA 5DNYB 4LBYA 2GZDA 4C0HA 1OYWA 3TQFA 3PCRB 1KI7A 2PT5A 2GCPA 1M6NA 4BFTA 3FFAA 1R6BX 2D2FA 4ARZB 4ASUD 2R8RA 1IN7A 3B1WA 1XD9A 1NVVR 3T1VA 1TU3A 4YC7A 3AVPA 4B48A 1MKYA 4R7ZA 4IJMA 3K8YA 1EESA 2R6AA 4FMCB 4LCBA 4LYFA 5FBVB 5TDHA 2BIFA 2YWEA 3L0SA 4U00A 1E3MA 5DI9A 1DELA 1UBGA 2J3EA 2PMDA 3CM0A 4UNQA 2IXFA 1A1VA 3HPRA 2ZJBA 1GIAA 5FR1A 1Q21A 2MSEB 4JT4A 2PZEA 3KJIA 3PUZA 4TWZA 1P9WA 1NI3A 1EXMA 1RVDA 3QF4A 4EPWA 1W44A 3CIOA 1HT2E 1IXRC 4JVSB 2XNSA 3C41J 5TMPA 4NU0A 1W4BA 3WNBA 3TNFA 3RS7A 1XWIA 2FSFA 1E4VA 2FPKA 4KFUA 2QRZA 1NMYA 2XX3A 2GRJA 1I4DD 4BLOA 3D6TB 3KXIA 2BV3A 1QF9A 4BQSA 2OSBA 4I4LA 2QE7A 1Z5ZA 2YZ2A 2IYTA 3GCGA 1IJEA 3IDQA 2WBLC 1VG9B 4YMTA 1XTRA 2GEVA 2GXUA 4XVQA 3C5CA 3EW9A 5BN5A 3UMRA 2E9SA 2IC5A 5ELXA 1Y63A 1GG2A 2RGDA 1SXJE 3LRPA 2OXCA 2XSZD 1LFDB 1S2MA 1WA5A 2GJAA 3AKEA 4C0JA 3A36A 3NBYC 2PEYA 2W6ID 3RSOA 4A8JC 5FOUA 5IHPA 1CR0A 1KHTA 1N0WA 4IRUB 4PTLA 5CLQA 3B13B 2ZRNA 4XTCS 4TYYA 3A58B 4H1UA 2DFLA 2GTPA 1GOTA 3BD9A 1WXQA 1E4YA 2OBLA 4LGMA 4HB0A 3NHAA 2OUKA 1XEXB 4LV6A 5HR5A 1N6LA 4Q4JA 3KQLA 3EA5A 3AVVA 1W47A 3VR5A 2GNOA 2YOGA 3GLIA 1ZU5A 4UNSA 4V0OA 4DLSA 3IHLA 2ZAMA 4NBSA 3RC3A 2MSCB 2LWIA 3P4XA 2YC4C 5KPDA 4FD2A 4Q47A 2ZI4A 1KNQA 1FP7A 3SU8A 4PAOA 5CITA 3CRRA 1OFTA 2VP5A 3HWSA 3JZAA 2OFWA 3RC8A 1P5ZB 3A8TA 2QAGB 4B3DA 3J81k 4MA4A 1GL9B 4UJ5A 5BQ5A 3K0SA 2KBFA 121PA 1CTQA 3MJHA 4PHHA 1G1MA 1BH2A 4Y0AA 3CNOA 3SJAA 1E9EA 4P33A 3AF4A 4FMDB 3RSLA 3B1VA 5FOSA 1C4OA 5LB2A 2R62A 1JJ7A 2ASEA 2IYZA 2QPTA 3DKVA 1II9A 1P9NA 1S96A 2FPMA 2JJ1D 3B9QA 5DHAA 4DLYA 1SXJD 1XTSA 1Z3IX 5CIWA 3TBKA 2IYUA 1E2QA 1TUIA 2GCOA 2OO7A 1H8EA 1P7CA 2ZJ5A 1ZNWA 1J8MF 5E7IA 1E9RA 4O2LA 3W34A 3RS5A 4C0BA 2RGBA 5EZ6B 1TQ4A 2VPPA 4XWAA 2JJ2D 2N1BA 2ORIA 4QGFA 3W8NA 4DXAA 2HT1A 2CCGA 5DI3B 2FWRA 3T12A 2BMDA 2RCNA 2O5VA 1GSIA 3WP1B 4IDNA 3SN6A 3GJ5A 1KI4A 5EE5B 1WRBA 3OESA 1M7BA 1AZTA 5LPNA 3KFVA 4D82A 4PC7A 2GXAA 1T6NA 1P2TA 1PLKA 4LJ7A 1PUJA 1JBKA 1N25A 3ZDQA 2WPDA 5B2ZA 4LHZA 3WXMA 3SYNA 4YMUA 4EPXA 3H2YA 2QUZA 4PPNA 4F93B 1KMQA 2HEIA 4PHFA 2FH5B 4IOKA 3HYRA 4G5GA 3VR3A 1GUAA 1R0ZA 4U7DA 3IBYA 1OKKD 1XTKA 2RB4A 1E0KA 5KDLA 4KITB 5L3QA 3B7GA 3CW2A 1Q44A 3VNUA 2WIAA 3KTAA 1E9BA 2OILA 3IIJA 2F55A 2ZROA 5DO9A 5UKDA 2QENA 3B78A 3ONWA 3OAAD 2DYKA 2XNDA 3ZD6A 4WA7A 1XD2B 1AGRA 2QBYA 5GJCA 1E2MA 1Z6TA 3ZZ0A 1UBEA 2B21A 1P75A 4V0LA 1NRJB 3T61A 1JJVA 4DT1B 4XWOA 4FWIB 5JJIA 4EQ6B 2IBMA 4XD7A 3MGCA 4IKEA 3NDBB 1JQJC 3TAUA 5KSYA 2NIPA 4BE7B 4IEIA 5EE3A 3U4QA 4LV5B 4MKIA 4GL2A 4YDHB 1OXUA 5TXGA 2GCOB 2CHVA 2CHGA 4FMBB 1XPRA 1Z8FA 1WBBA 4QOSA 1Z06A 4IDOA 2DFNA 2VHCA 4Z1MD 1O87A 3L8ZA 3VKHA 3KXKA 3NG1A 1Z6XA 3SI7A 3AVYA 4M8NE 1OXXK 5B57C 2XXAB 1XTJA 2WWHA 4A92A 3U44A 1I2MA 3RS2A 1S1CA 1KK1A 1MR3F 4WXRA 5CJPA 2J0UB 1TPZA 2WWGA 4ZDJA 3THYB 3SYLA 2WHXA 4QBFA 2WSMA 4Q1BA 1S0UA 4Z8YA 1E2DA 3SJBA 2B7BA 2P5TB 3NVAA 1SHZA 1VIYA 2V8OA 1AKEA 4E09A 4BFWA 4PQRA 2GA8A 3T1OA 3FMOB 1F2UB 1G5TA 2G0NA 3LNCA 4RD1A 4CVNA 1Z0DA 3NBZC 2JIZD 4BPBA 1DO2A 1GWNA 2ONKA 2QAGA 1LV7A 5FFMA 3QXJA 1OE0A 4LHVA 1VDZA 1F2TA 4R2HA 3AF3A 4II7A 3X1ZA 4Q9LA 4AD8A 3SC3A 1E2LA 2FEMA 3GLIB 3HP1A 2F43B 1JR6A 3ND9A 1DEKA 4CF7A 3WRXC 2G1KA 1X8KA 2DY1A 1DTSA 2Q9CA 2WAXA 3QKRB 1T0HB 4UNNA 5AWFC 4YDSA 5JLJA 2WSSD 2ZR7A 2OM2A 4GMXA 3VFDA 2WTUA 1CULC 1P2VA 2FNAA 2R6FA 1JEEA 2W58A 3KQKA 4US0R 1LS6A 1ZIPA 1ZJ6A 2ZJAA 1S9HA 3WNDA 1GNRA 3VHLB 4UXJA 3SYKA 4AYWA 1G6HA 1OKKA 3R20A 3ICEA 3IEVA 2QT1A 4P32A 4URXR 4YLGA 1F60A 4E07A 1YVDA 2NOAA 1OFHA 3QG1A 3UATA 4KLNA 2CDNA 3LAWA 3I61A 4QC2A 4LHYA 4F38A 1Q0UA 2VP4A 2JGNA 5IK2D 2PLRA 5FTMA 1P62B 2P6UA 2GK7A 1XZPA 2W2XA 3AGPA 3GFOA 4YONB 3U3JA 2ZU0C 2RHDA 4JMPA 1XNJA 2B7CA 2QGZA 1KDPA 3LX5A 5E7JA 1Z0AA 2BM0A 1L4UA 3IUYA 4TLEA 2WKQA 4IOJA 5J5CA 3RWOA 1XCMA 3SEAA 3W8RA 3NBXX 1T3LA 3WRYC 4A9AA 3PITA 2QP3A 1B23P 1IM2A 2C9YA 4C2UA 2BMJA 2H16A 3KKMA 4PZYA 4Q4AB 2KBEA 5DLQC 2C2HA 4FXPA 2WVJA 4M9SA 2GJ8A 5JCZA 4NHOA 2EU8A 1NN5A 4L9SA 2QNRA 1VHLA 4DT1A 3LQRA 3X1DA 4DDTA 2IXGA 2BBWA 4JKIA 4JBXA 2J0VA 1IN8A 1RRGA 2KWIA 2ZQ5A 1AA9A 4NYJR 3LY5A 2C99A 4LYAA 2W6JA 1JB1A 4ZPXA 1NSFA 1JAHA 3EIHA 2Z83A 1AIPA 2VBCA 3U6KA 3AVOA 1JPJA 3K9HA 1VTKA 3GD7A 2JLWA 1W4AA 1AK2A 4LJ8A 4R2IA 2OT3B 5E95A 4DCUA 2OCBA 4U5XA 3B85A 1E2HA 3FFBA 4TYPA 5FBLB 2C9CA 3R9XA 3LQQA 4O3MA 1WB9A 3ZH9B 3ZZUA 3KL4A 2V54A 1IN4A 3TIFA 2JDID 4OHZA 3F0TA 1LF5A 2QSZA 3Q9LA 3VU9B 4C9BA 5GJBA 1OT3A 1G4UR 1SKYE 1SGWA 4LI0A 1U9IC 1M7GA 3QKSB 4DVGA 5FOVA 3RRZA 4TTQA 5LD2B 2GXQA 2XTNA 4XVRA 2CXXA 3WYGA 1UDXA 2W0SA 4Q9KA 1KTVA 2DR3A 1EG7A 4GFDA 2AXNA 2I1VB 3K9NA 8OHMA 1QVAA 4UNPA 3CX8A 4W5WA 4A2WA 1CLUA 4AKGA 3L2OB 1L8QA 1F2TB 3H84A 4M22A 5C46F 2JEOA 2HYIC 4GRAA 1ZRHA 1NMXA 2ZRHA 1W4CA 1FL9A 3GLHB 2DB3A 1KYIA 1U8ZA 1SVKA 1X8LA 4PSVA 5DHFA 5KSZA 1DVRA 4TSFA 2FZLA 4WXPA 1P9RA 3BBPA 1BIFA 3CRMA 3CZQA 2O8CA 4JLKA 5AJWA 5HCNA 1GL6A 3BK7A 2BJVA 3MLEA 2WOOA 3PUVA 2R6CA 3U3MA 4BZXA 3I32A 4NCJA 3LVRE 2ZETA 4KVAA 2ZRPA 2JLYA 3QUSA 2W6JD 3FPAA 4UXIA 3L43A 3K70C 1D5CA 3KJEA 4I1UA 1R5NA 3BB3A 1AGPA 3K0FA 4DEXA 1FUUA 4FIDA 1VMAA 4XD7D 2WPDD 3UIEA 4TZ6A 4JT2A 4OHYA 1WDTA 2OCAA 3RYTC 1CBUA 2FOLA 3OIVA 3AUXA 1BO6A 1XEWX 4Q00A 2AX4A 2YNMA 4PAQA 4V0KA 1P3JA 4WIAA 1D6JA 2NTYC 1XXHA 2AD5A 4QXAA 2VIIA 5DGXA 3ADCA 4Q02A 1DAGA 3RRMA 3V4RA 1IY1A 4HDOB 4TL9A 2ZPTX 3EWSA 1YE8A 2EWVA 3Q7PA 4RFVA 4ZCLA 5HE8A 2OBMA 3ASZA 5EP3A 2L0XA 2ATXA 3K0CA 1QHIA 1GKYA 1EFHA 1US8A 2Z4SA 3M6AA 3K70B 4G01B 3M1IA 3QKTA 2ZRMA 4JLPA 5FH9A 1XD2A 4NYIQ 5JRJA 2J9RA 2QY9A 4GT1A 3N2IA 3MWKA 4RD3A 3TKLA 4RD6A 1II8B 1R8QA 4ZIRB 3KTAB 4DIDA 2CVHA 2XJ4A 4ARZA 2V1XA 1TU4A 2DPXA 3SJCA 1KAOA 1DOAA 4MH0R 3VNVA 2IXEA 1D2EA 3HR7A 5BN3A 4EPYA 2CE7A 4LJAA 3W3ZB 4P4SB 3KX2A 2HF9A 4IOMA 4TYQA 2RGNC 4FINA 4RY2A 1JXOA 4IVQA 5FI1B 4C0KA 3GLGE 3KUDA 1M1YE 4QBIA 1OIVA 2YV5A 4DLVA 1VG8A 4L4UA 2HCJB 1YZTA 1NJGA 2ZSEA 2IA5A 1VPLA 4A4DA 2ZREA 1NBMA 3KB1A 4X8HA 4M1MA 4O25A 3LWNA 3C16C 3BJIC 4YQFA 2ZS9A 3A6PC 2AK2A 3PUWA 4MGZR 4LBWA 4CT5A 1KDTA 2EFEB 2YINC 3TSZA 4AKIA 3CWZA 1KKMA 4Q1FA 5BW8A 5H68A 4ERNA 4JS0A 2ZE6A 1Z08A 1FP6A 1JXMA 4OBEA 3CZPA 3U7GA 1OV4A 4F4CA 1G8YA 1G9XA 1FZQA 2GBLA 2ZSFA 3LBIA 1GKIA 3ADBA 5AUPB 2IL1A 3E70C 3HU3A 3ND8A 1E9AA 2J59A 4KFTA 1OB5A 1EGAA 4C0AC 2FFAA 2FFHA 3NBFA 2YC2C 4K81B 4IVPA 3PXGA 4G1UC 1KAGA 2ZSAA 1ZYUA 3I73A 1YR9A 5DIFA 2HV8A 5JWHA 4S35A 2BHRA 3U3RA 2C8VA 2FGKA 5C2JB 2ODEA 2GVZC 2KI5A 3I3SR 4BUJA 5KTYA 2IX3A 3E2IA 1XTQA 1Z29A 2G0TA 5GVSA 3UWKA 3THWA 3HJNA 3GFPA 1UKYA 1Q3TA 2REOA 3C14C 2CNWA 4GOKA 2XZOA 4QG7A 3FDIA 2B92A 3VTKA 4DCNA 3KZ1E 4ACBA 3NHBA 5BWMA 1OSNA 4B74A 4RD0A 5DN6D 3QXSA 2FDCA 4PZLA 3BOSA 4QGAA 3AH8A 4MKGA 1XB2A 1B0UA 5J4VA 2ZRBA 1G7RA 4AG6A 2BDTA 3A1SA 1KSGA 1CF4A 3BFKA 1IAQA 2NO1A 4XJXA 3T34A 4JL6A 4XIGS 2C78A 2CLSA 1XEXA 4LJ9A 2P6NA 3CPJB 3VHXA 1WBDA 4Q18A 4RVCA 3P32A 5K8LA 1U0JA 3W9YA 4NCHA 1NMZA 3L0OA 3CF0A 3PQCA 3D31A 1FQKA 2FJUA 4QGHA 5KOYA 3QSYA 4MDFA 4Q9HA 3TMKA 1M74A 2UZIR 3B1YA 4BFZA 2QAJA 4KODA 5JFGA 2H8KA 5J47A 1XCGB 5FUXA 1TTTA 2H18A 5F3WB 5CIQA 2JCSA 4CEHA 4TSFD 2G9NA 2NPFA 3N2EA 5H1YA 3T35A 5BYKA 1YZKA 1GP2A 1QZXA 2X2FA 1I4TD 4IEEA 4O2RA 1PZNA 4MQBA 4QNRA 4BLTA 1S9DA 1G5RA 2PBRA 3QXHA 2NO9A 4CEIA 4E22A 1JI0A 1US8B 1HTWA 4Q4HA 5CYPA 1D2MA 4CEJA 1LS1A 5IF9A 5J4KA 3AVUA 2P5SA 4V0NA 4XSHA 1DAKA 1U90A 3LO5A 3EPLA 4A0GA 1ZIOA 1N6IA 2Q0HA 3X1XA 5J40A 3GLHA 1N5LA 1TL7C 2ZVPX 3MWYW 1TQ6A 4XVUA 3QF4B 1OH5A 4B2PA 4OQFA 2CEAA 1ESMA 5B58C 3ZS9A 5F98A 3DDCA 5KU1A 4EKDA 3AVXA 1QHYA 1RRFA 2ZYWX 1NN3A 2O0JA 3REFA 4JL5A 1F48A 2AKAB 2FSGA 3UG6A 4YMVA 4TLBA 4MDEA 1VYTA 4PAMA 1Z2CA 1MT0A 3LXRA 5CJ2A 1KI3A 2QM7A 4DSTA 2ZUBA 4D0GA 3ZLJA 2ZRCA 2Y8EA 4X8LA 1NBMD 1H8ED 4FMCF 4AC9A 1H65A 4HLCA 4FWTA 1OXTA 4HSEA 3K53A 1ZC4A 2UZ3A 5EE1A 4DSNA 4JJZA 1A4RA 3PR1A 4B73A 1MABA 2E87A 4RFSB 4A2PA 2PL3A 4HDCA 1EFTA 1KIMA 5FL7A 1W1WA 2LKDA 5JSZB 2WMOB 2DWOA 2OCPA 2QQEA 4UKDA 1T3HA 3SZRA 4GNKA 3A1WA 4C3ZA 2AHOA 1E96A 1JR3E 2JAQA 4BFVA 3IPXA 1ZAKA 4RKEA 5EQTA 2XTZA 3TRFA 2A2ZA 1Q1QA 4KO8A 3E5HA 3I4LA 2ZUDA 2W2TA 1SHKA 4TLDA 3T15A 4NE2A 2A3RA 2Q3MA 2J87A 5KHOC 4OI1A 4TLAA 2D3WA 4RZXA 1A2KC 2J7KA 1R0XA 5DISB 4XH9B 4L9WA 2ZYVX 4C7OB 2HJVA 4TZ0A 4GZLA 1Z0JA 3WYFA 1G3QA 2BWJA 5AK0A 1X1SA 4CEJB 4B6EA 1UFQA 4GSYA 3KQUA 3LW8A 2VEDA 3ZVMA 1ESNA 2LKCA 3ZD7A 4B34A 5TB5A 1RRPA 1E9DA 3CUEF 3ETLA 2ZU6A 2ZAOA 1IQPA 3ZIAD 1UKVY 1RZ3A 4CDGA 2DBYA 4NMMA 2GZHA 2PLFA 3I62A 2BBOA 3CRVA 2QI9C 4PPQA 2YKGA 1NG9A 4M9XA 3K09A 2QRNA 2QEQA 4DLRA 2NG1A 1QRAA 1OF1A 1Z0FA 3TVTA 4CEHB 2HCBA 1MV5A 1GNQA 1XPUA 1K5DA 5FOWA 1GVNB 2BC9A 4JSTA 2V6JA 3V9PA 4CZ2A 1ZINA 1G7CA 1MOZA 1JR3D 1DO0A 1P72A 1T4GA 3U7HB 221PA 2BOVA 3H86A 3QKRA 1NLFA 1XX6A 2EFHB 2XZPA 1SXJB 4PQYA 2BKUA 4UXHA 5JBQA 3HPQA 4M0LA 5FL7D 4BWYA 3V00A 4OJKA 4EDHA 5FPTA 4ZCIA 5F2EA 1Z6GA 3TSWA 4Q01A 2C03A 2Z6VA 4BRUA 1E79D 2PZFA 3KKQA 4KU4A 5AJXA 2YOFA 1IY2A 2VHJA 3ZYCA 4GI7A 2DWPA 1JQLB 2CE2X 4D80A 5GJWC 4LRWA 2ONJA 4CYMA 5AUOB 2CNWD 2QORA 5JS7A 4QNMA 3DKPA 2FE4A 4AG5A 4RZ2A 2QTFA 4AKHA 1BKDR 4EJSB 1ZVQA 4B3GA 3AVQA 1UAAA 1FNMA 1E1QA 5EE0A 4Z1MA 3ECCA 3I92A 2QU8A 3L0PA 3O8DA 4JLAA 3FKSD 2O0KA 2QTHA 3PIRA 1O3YA 3R9WA 1NJFA 3DL0A 1AQUA 4M9ZA 2X1VA 1KZGB 3OHMA 1COWA 4GOXA 5FPSA 2REXB 1V43A 1DADA 2Q3FA 4FI3C 3CONA 4YXWD 3EZ2A 2IHBA 1QVRA 4JBWA 4X8MA 2J1LA 3LLMA 4GPTA 3W5IA 4ZKDA 2O8CB 4NYIR 1ZUHA 2NZJA 2H5EA 5FOXA 4EFMA 4QJ5A 5CB6A 1DE0A 4TYNA 1YZLA 1I4LD 3AUYA 2W2VA 1J7KA 1TMKA 5FL3A 5CDFE 3KDSE 2A30A 1XMSA 1J90A 2V4ZA 1OB2A 4BRWA 2I3BA 3GJXC 3U2QA 1E94E 2D7DA 1MRSA 4TTPA 4M4SA 3TW4A 1XJ0A 4JKYA 3AF0A 4D0NA 3NXSA 2PX3A 2GEDA 2F9LA 3QOFA 2UVQA 4EAQA 1Q20A 4RJLA 2JLUA 2BCGY 2YJTD 4HUQB 3UANA 3U7FB 4NONA 5A0FA 2HYDA 5HCIA 4PC1A 4N1AA 4C30A 2IW3A 2VSFA 5GJVC 3BC1A 3WBJA 5KSOA 3FHOA 1G7TA 4D26A 5JJKA 1F2UA 3BIFA 1XRJA 2FV8A 2WWFA 3GQBA 1OH6A 3K1JA 4ZO4A 3T5DA 1VHTA 1NSTA 1BOFA 4EFNA 3GFTA 2J41A 1XU4A 4LK2A 1YR6A 1PVOA 2QT0A 3MD0A 4ZIRA 2OV2A 2RMKA 3FMPB 1COWD 3LBHA 1HQYE 3AP2A 1KO7A 1DG3A 4NP6A 1S3GA 1OLOA 2FF7A 3SHFA 1EFUA 4DKXA 5L3RA 1AS0A 1L7VC 1DAMA 3OE7D 3QXCA 2VF7A 2R2AA 4BASA 4BEJA 3MUFA 4RZ3A 3Q8XB 4HB2A 2A5YB 2EYUA 2WWXA 2JJ2A 3PEUA 4M53A 5EP4A 3THXB 3BB4A 2ZJZA 1CR2A 2P67A 3K0AB 2F9MA 4DDUA 1KO8A 4AYTA 3HU1A 3RRYA 4IDQA 2ZJYA 1F3OA 5AJZA 1Y3AA 3Q72A 3SOPA 2RH5A 4MRVA 3FHTA 3BB1A 3LFUA 3IEUA 2O0HA 1W2GA 3IIKA 2QMHA 3DO6A 3LX8A 4L8GA 1KK2A 4PANA 1G6OA 4PC2A 3GEHA 1CEEA 4LPSA 1XZQA 4QM7A 2VP6A 1E79A 2YWHA 3IILA 3R7WA 4OYHA 4P31A 5E4FA 2ZRAA 2YOHA 4LJ4A 2H1LA 4DUGA 1QHHA 3UXMA 2BCJQ 4PHTA 4B3FX 3MCAA 1Q12A 2IEYA 2ZIAA 2XEXA 3VX4A 1G8FA 1OPXA 1KOFA 2CL0X 2AK3A 2YVUA 5L3SB 4GOJA 3AF1A 1T5LA 5BYJA 3KFXA 3ZZTA 4URYR 2REBA 4PSAA 2P3SA 3R8CA 1II0A 2IYRA 2O8FB 1YJ5A 1EK0A 3K0EA 3DZ8A 4BFYA 4TMWA 1A82A 1EFRA 5HKKA 3A37A 2IF0A 5FBWB 2AL7A 3KUCA 4KI0A 3U4QB 3T5GA 1DAEA 1LF0A 2WJJA 1E2NA 4QJ4A 4D25A 4LBZA 1KI8A 5K8TA 1NP6A 1FMJA 1XBTA 3AKCA 3TR5A 4BFXA 2AFIE 1XMJA 1OHHD 3EAQA 4PQFA 1TNDA 3SE0A 4RD4A 2IWRA 3WY9A 3RABA 1CJTC 4A6PA 3EPHA 5K8IA 2ORVA 2CJWB 4TMKA 1Z83A 4LWZA 2ZS8A 4LX0A 1ZW6A 1NVXQ 2IHYA 1WF3A 1VKJA 3I72A 4NYMQ 4PO9A 4B76A 3SJZA 1GNPA 4DHEA 1Q22A 1OJLA 2ZRFA 1NVUQ 1KKLA 1RE0A 2ZVQX 5FTLA 1IXSB 4LHXA 4TLCA 4ZI3A 1RC8A 3EZ6A 3K0FB 3RWMB 5HKKD 1Z63A 2DFTA 5L8VA 2R9VA 5HPYB 4LBVA 3O8RA 1YR7A 4B3BA 1XEFA 2OESA 1V5WA 4DLUA 5AR1A 1FX0A 3PJRA 3CPEA 1CR1A 2TMKA 2A5JA 3BFXA 1XP8A 2NPIA 3WMEA 5JS8A 2IUUA 1AQYA 4DCSA 3X1YA 2A5DA 4JLVA 2ZI5A 1NN1A 3TUJC 2F1JA 3VKWA 1OIWA 1ONBA 5TY0A 4Q1EA 1LTQA 3C15C 1JEDA 1FNNA 1G19A 4TL7A 4B71A 2VF8A 5TV2A 5ANRB 4ASUA 4C0SA 2HJGA 5KPJA 2PCJA 4W5HA 1PJRA 1TEXA 1ZD1A 2DFKB 4N0EA 4F4IA 4ABYA 1KJYA 2RGNA 4JLBA 4NTZA 4KXFB 1ETUA 2NO7A 4KCGA 4F4JA 4XTRA 4A1FA 4B35A 5A4JA 5FPHA 1YZGA 4UJ3A 2IYWA 4L16A 4M21A 4DCVA 4LJYA 4URZR 2G1JA 1W36D 2PMKA 2BM1A 4US1R 1OHHA 4FMDF 5CYOA 1G18A 2GVDC 1D8TA 2WKPA 3AP3A 2VSOA 3P20A 2JATA 4TMVA 1IHUA 1SVSA 1NKTA 1CRQA 4BLQA 2GESA 3QENA 4NL4H 2CJWA 4M1WA 1KJZA 1TEVA 1W46A 1CRPA 3U61B 1E1QD 3QY0A 4DBLC 2V7QA 4P4TA 2X8AA 4MUBA 4UQOA 4V03A 4AY2A 1D9XA 1UBFA 3SNHA 1AS2A 1R5OA 4JYCA 1RFLA 2IUSA 2ERYA 2ZYTX 3NH6A 3LLUA 4ZKEA 3DOEA 4D2IA 2O8EA 1U9IA 3BS4A 1ZMXA 4KHZA 4MYCA 2GILA 1HEIA 2ZJ8A 2C96A 5KSPA 3CH5A 1ZCAA 2IS1A 1CIPA 1KI1A 1G8HA 4BFSA 2NZ8A 4IFEA 5FTNA 2JLZA 2Z43A 1ZD8A 2D4HA 4GP7A 1NY6A 4A6XA 2BVNA 1W0KD 4HZUB 1UJ2A 4AKEA 1W36C 4G5QA 3TW8B 1T5IA 3BE4A 2J5XA 1GAJA 5AJVB 1UF9A 2NO0A 2XJ9A 4Q4HB 1W7AA 1ZM3A 2VHQA 4R71A 4IDPA 3QEJA 4HLUA 3NKVA 2D06A 3B82A 2XXAA 1XD8A 2ECKA 5FUWA 4DC9A 4FN5A 2JJ8A 4PX9A 4IXNA 1KI2A 4US2R 4Y0VA 3A1VA 1K5GA 1R8SA 1XDBA 3LD9A 3QG5A 1E0JA 1AM4D 3OFND 1PUIA 2EQBA 3CR7A 3AVTA 4K8OA 3OE7A 1N6NA 1X3SA 3THOA 2EFCB 3D8BA 3RDPA 3FMIA 4DLWA 3TLXA 3BWDD 4HDQB 4HZIA 3IQXA 4A15A 3GJ0A 2VA8A 2QQ0A 1FPMA 4RCYA 1JAIA 1JNYA 3ZIAA 4ZI2A 1RYHA 1Z22A 1LVGA 1UADA 2WMNB 3SFVA 3AKYA 2R65A 4NDZA 1QDEA 4Q4JB 1Z28A 3UPUA 1M8PA 4CRWB 2OFXA 1HQCA 5IT5A 1S3SA 1U98A 4XOIA 1SVMA 1M34E 1J99A 2JDIA 3CRW1 1T9HA 2XGJA 3TGPA 4D81A 4DB2A 4WAUA 2AWNA 4HYYA 1HH4A 2XAUA 3OZXA 1U8YA 1ZUIA 2MMCA 4Q4LA 3VR1A 4B6FA 1RJ9B 1GL7A 2QPAA 2FGJA 4K46A 1YU9A 3R9IA 4A82A 3U6BA 1RRCA 2GF9A 2KE5A 2QMUA 2V6IA 4OK6A 3N70A 2WJHA 3QPWA 2D74A 4V0MA 3THWB 2GJ9A 1GM5A 1W0KA 5L3QB 3BFVA 4OJQA 3B2EA 3QXXA 3K0AA 1ZD9A 4EFLA 3LXXA 4QGGA 4IVRA 3BRWD 4NCIA 2AKYA 3QF7A 1AZSC 4A8JB 1YRAA 3CPHA 2QPOA 5JHGB 4Q7LA 3DM9B 4C0LA 2IS2A 2IUTA 5SZJA 1LW7A 1R0WA 4MGYR 4Q48A 1GRQA 4M1KA 4ESVA 1GRRA 5LD2C 4QBHA 1S1MA 4U02A 2C5LA 3CWQA 4Q1CA 2LCFA 1ZC3A 3GLGB 1U8AA 5KUTA 4RKFA 1G16A 3W6NA 1AKYA 2N42A 3LW7A 4W7SA 1VECA 2X77A 3D3QA 4KYUA 1HURA 2FU5C 2ZS7A 2ZYUX 5G40A 4MUAA 3A4NA 2EW1A 3A4MA 5JI3E 1T0JB 3I1FA 4JBYA 4WZAE 4C2TA 1ZNYA 4NYJQ 4QKQA 3EPKA 1CKEA 4QFMA 2QAGC 1W48A 3DPUA 1XJQA 3QBTA 3FKSA 4QHYA 3EARA 1Z6AA 1JALA 4QRHA 2VHUA 3A4LA 5EZ5A 5G3ZA 5FTKA 3BAFA 4PPGA 2F7SA 2OEPA 3OFNA 3H4MA 4KFRA 2V1UA 3U44B 2ZRIA 3BERA 1DAIA 3QIAA 5JRZA 3RVBA 2O8BA 4P0TA 4EUNA 1G3MA 1ZCBA 3SQWA 5D3MA 3MG9A 4WVFA 2O52A 4Q1DA 3U3OA 3W6PA 2CHQA 3REGA 4PHGA 3WMGA 1GKUB 4JSYA 4MITA 1NKSA 4QJ3A 2Z5FA 3I8SA 2PCLA 1A2BA 3TJZA 4JIMA 3THXA 1SVLA 2Q9AA 3E1SA 1P4SA 2A78A 1S8FA 1E0SA 1VCNA 2Q6TA 1E32A 2WJGA 2I1QA 2F1HA 2OXRA 3I8XA 1E2GA 4E03A 3CX7A 2D2EA 4OQNA 3SS8A 4HAWA 4AIIA 2D62A 4OHXA 1N0UA 3Q7QA 4TQAA 1YQTA 4BECA 4D4MA 1E1RD 2QA5A 1U2RA 2P6RA 3SDZA 3GLHE 3OF5A 5EXSA 2NGRA 1J2JA 1G3UA 1YR8A 3GJ4A 3L0IB 2VQSA 3EXAA 2VP0A 3KKOA 1QG2A 4KSCA 4A2QA 1G7SA 1Z2AA 3OEED 4CW7A 1E2PA 4IXMA 1EX7A 4TMXA 3PEYA 3AQ4A 4MRPA 1G64A 3PEVA 5F9HA 4M9QA 2NQ2C 4AURA 2B8WA 2PJZA 2AN9A 3P1JA 1TAGA 1XFAA 4RFSA 4GZMA 4IHQA 4X8OA 3R8FA 5HTKA 4B33A 4URUR 1VYVA 3M0EA 1AS3A 1RJ9A 1D9ZA 1Q1EA 4QBGB 5IDVA 4CGZA 3VR6A 1KK3A 4JLOA 2C77A 5KDOA 4N0DA 3PG5A 2FSIA 2QGNA 4JJKA 2OAQ1 1NF3A 3QE0A 4TTRA 2O8DB 3KKNA 4L5BA 3WYAA 1J8YF 3B60A 4A0HA 3FVQA 2XOKA 5DE3A 5JZVA 1BMFA 4EPVA 1W2HA 1K6MA 2Z0MA 3ADDA 3EA0A 2AD1A 3T1TA 1TF7A 1KO4A 2B6HA 3FHCB 4D4KA 5EUMA 4IFBA 5SZIA 1X6VA 1EWQA 1QHNA 2IF2A 1FQJA 1WCV1 4C7OA 2QE7D 4HZUA 4F92B 2R44A 4KAXA 1G20E 3NH9A 2E1RA 1PV4A 4D6PA 5DH9A 1U81A 3ZQ6A 1YRBA 3NTUA 4AK9A 1P61B 1VCIA 3L8YA 1QBKC 2F3TA 4LV8B 2CMKA 1ZNXA 3Q85A 2ZR0A 4DUGD 1ANKA 2HF8A 3S1AA 2A9KA 2EFGA 2O8EB 4MKFA 2VYFA 1VYUA 1P2UA 3W90A 2QN6A 3B9PA 2CK3D 1JPNA 4BZPA 3TSOA 3UKDA 1CS4C 3EC1A 5HZHA 1HV8A 1X86B 3P27A 3GLFB 4A0RA 1A7JA 3PUXA 4LJ5A 1UKZA 1OW3B 3PENA 5EP2A 4JVMA 3B1ZA 4DEYA 2H57A 3CR8A 3P4YA 1DAFA 5JMTA 1IN5A 1TX4B 2GCNA 3H1TA 2EVWX 3RS0A 1W5SA 4I1VA 3B8HA 3HDTA 5JJLA 4R9UC 4G5RA 1KMHB 3TUIC 1E9FA 1ZBDA 4MYUA 3WP0A 1WQ1R 2MSDB 3NEYA 2J0UA 4NPHA 4MYHA 4LUCA 2C98A 1R4AA 3LV8A 4LYJA 1BS1A 1UEJA 4Q66C 2IWHA 4KV9A 2P2LA 4BEBA 5FOTA 1N2CE 4FCWA 5TARA 5DSZA 4PSKA 2ZRDA 1Z0IA 1U94A 2WV9A 4DDWA 4PZZA 3FKQA 1KJWA 3HYTA 1CJKC 3QQ5A 4M1TA 3UK6A 3EZ9A 1UBCA 1EX6A 2QM8A 1KK0A 4Q5IA 1G17A 3IGFA 1KO1A 3IO5A 3RNLA 3GLIE 3QKSA 4ZV4A 3ICQB 2SHKA 3PVSA 2C04A 2NO6A 1KY2A 1ZUNB 1SKQA 2F1RA 4Q7KA 2QROA 2G3YA 4JLDA 2ERXA 2RGGA 4NH0A 1ODFA 4MGKR 3EZ7A 3ZQJA 4MKHA 4QHTA 2O8BB 3VKGA 3ZVLA 1NLYA 2O8DA 1N3BA 5D3MB 4WZBE 1OFUX 2GJSA 1KGDA 1VCOA 2ZJOA 3UMSA 4MGIR 1K8RA 4B3CA 3NC1C 4LHWA 1VIAA 3VX3A 3S1AB 2ZM5A 5BXQC 2KSQA 3K9GA 4IOLA 2PZGA 1MH1A 2WAYA 4AWXA 4B2LA 3KXLA 3F3YA 3O47A 2ZI7A 1I2DA 2OE2A 4HI0E 3U3KA 1LB1B 3DMNA 1NBME 1MO4A 4E5UA 4TL6A 1HE8B 3PEWA 2CBZA 5J4HA 5GADl 2HLDA 3DMDA 1P6XA 2J46A 1NY5A 2VRWA 2OHFA 1KY3A 3X1WA 4LOAA 3OIWA 5AUNB 1IONA 5E3HA 1R0YA 2YWGA 1WMSA 1DARA 1E2JA 2W6IA 4JYBA 2AFHE 2RGXA 3SBEA 5DYGA 4PO8A 3K70D 2FA9A 4DCTA 4RCZA 2WJVA 2ZR9A 3QPUA 4ON9A 2VHTA 2A5GA 4DDVA 1P2SA 2UKDA 3JVUA 5BN4A 5IRCD 2IS6A 1G291 2ZRGA 2IK8A 4TT3D 2OLKA 1C9KA 4G0NA 2X2EA 2F6RA 1DS6A 4EJSA 1IJFA 4ZCMA 3RS3A 1XEWY 5J4YA 1ZM2A 3G0HA 4D0LB 1DG1G 2ODBA 4GDFA 5TVKA 1XXHB 2WJYA 2GF0A 4QL3A 3RLFA 1GTVA 4ZDKA 1LY1A 3TUZC 4D4JA 1EFRD 2VP9A 4GP6A 3GP8A 2H17A 3AKDA 1T3SA 4LC0A 5FBQB 3GLFA 5C4GB 3D7MA 4JVNA 1KDRA 1UDWA 2WKRA 4OQMA 3NIBA 4OL0A 3WNCA 4DSUA 1IOZA 1RKBA 2WICA 3HU2A 1UPTA 3ZS8A 1IY0A 2JLVA 2AR7A 3UWOA 1GDDA 521PA 1U0LA 4HAXA 4YMWA 5B30A 3OEEA 1N6KA 1ZNZA 2IYLD 3GMTA 4RD2A 2WSSA 2FEOA 2JLRA 2JLXA 2MMGA 2VH5R 2WIBA 2PJRA 1CXZA 3DEFA 2RAPA 4OI0A 3CX6A 3T1QA 2FSHA 3GJ7A 4QM6A 2FN4A 3TVDA 1YZUA 4DWJA 5JCPA 1XTIA 3C7KA 2V7QD 4HAVA 1XJCA 3MWLA 4DRZA 5L3SA 4F7WA 1TF2A 2XOKD 3VAAA 3VR4A 4JLMA 4ESHA 2AXPA 3QI2A 1GRNA 4S2EA 5JEEA 4AI6A 2CVFA 2FX3A 5B64A 3GPLA 1L2TA 3AB3A 421PA 2FZ4A 2XITA 3CB4A 1KZ7B 3ZVRA 3IBGA 3DZDA 2ZUCA 4CIDA 1U99A 5FTJA 1KSHA 2X19A 2IT1A 5JEDA 3LH5A 3Q3JB 2RGCA 5C1BA 4C0QC 1MABB 4LJ6A 2BJWA 1H8HA 3TE6A 5EJEA 1S4QA 4MRSA 4IDHA 2C95A 2IYVA 3BH0A 4V02A 2ZI6A 4FCVA 2GK6A 1E0AA 1WP9A 3OEHD 5FI0B 2WWYA 3IHWA 3FE2A 1J70A 2Q9BA 3O8BA 2PEZA 1XPOA 1R5BA 2ZE7A 3QPVA 4JVLA 2P0EA 5LB4A 4MRRA 1KDOA 4KBGA 2ZJ2A 3PFIA 5IK2A 1BYIA 3Q5DA 2ORWA 5KYKA 2RKOA 3UMFA 2G6BA 3IIMA 4HUTA 3WHKA 3GJ8A 3GLFE 3AVWA 1MO6A 2ATVA 1KNXA 2W0MA 1QHXA 1CJVC 3QJYA 5JI2E 3CBQA 2GAOA 1Q3HA 4WOPA 1AN0A 2H92A 3EG5A 3LBNA 4BLSA 3CF6R 4CEIB 2D7CA 2ZRLA 3MMPA 5FBRB 4F91B 4B44A 3GEIA 4P4UA 1SULA 1YKSA 1DAHA 2N46A 3MAAC 2BBSA 3BORA 3BH7A 4URWR 1E1RA 3LVQE 1UEIA 5HE9A 3X2SA 2EWWA 3C5HA 1CU1A 5LDDC 1OYYA 4Q03A 4KLZA 4LSGA 1OFIA 1PLLA 5LBIA 1WE2A 4KFSA 5HZKA 3FOZA 2J0SA 1N5JA 4M1OA 4TYWA 4PO1A 1NVWQ 4B32A 4CT4B 1N6RA 1Q1ZA 1AJEA 2BBTA 2ZE8A 2EYQA 1VG0B 4KBFA 4TQ9A 4JLJA 4B43A 3B5JA 4WBSA 2K5UA 5G3YA 2YWFA 4B47A 2R6DA 2CL7X 2H7VA 4I99A 1SXJC 4LYHA 4C4PA 3CKLA 2G88A 4J0QA 1X8JA 2DHRA 5JECA 4KVGA 3M4YA 2JASA 1RYFA 1GZSA 3AEZA 3BH6A 1XMIA 3KJHA 3NC0C 5EP1A 2VL7A 2OZEA 4L15A 2GZAA 1U0HC 3FB4A 2ZEJA 4HAYA 2ANBA 1W0JD 3OIYA 4GMDA 1IBRA 1Z6YA 5H70A 2ANCA 4W5JA 2J0QA 1EFCA 5J4LA 3VR2A 3MFYA 1KSJA 2NMVA 2WM9B 2GJKA 2BKEA 3TAHA 2HLDD 2WWIA 1M7HA 2PT7A 1NIJA 1PLJA 4EJSC 2XB2A 4NCKA 5KO2A 4NCNA
chains in the Genus database with same CATH superfamily
2OD7A 2OUIA 4KJZA 5AW2A 1KYYA 2FPGB 2UUPA 1M5TA 1R6UA 3O1LA 5C35A 2DERA 2QG6A 1KI6A 4HAUA 3GT7A 1UJCA 5WRFA 3SIXA 4ZFNA 3RSCA 5BMOA 1SOUA 5A6VA 4FU0A 2GK3A 3E4CA 4YN3A 4IV5A 3FTEA 4FZVA 5A5VA 4ZTZB 3KZNA 1N0VC 1SUBA 5C4IA 5CLLA 2Z2IA 5ICMA 1UPBA 1XZBA 4MVJP 1EU1A 2Y1KA 5F51A 4D5GA 3TZQA 4MV5A 4NC9A 2Q21A 4LVCA 3E8XA 3HKCA 3JVIA 3GO4A 1T6YA 3FKJA 1IIBA 5GV8A 1RQ2A 3EXG1 3Q2IA 1RWQA 4IGFA 4MSUA 3EOZA 4QUAA 3AEKB 1OBFO 2WE8A 3DCIA 4FCTA 3VYUB 3WYDA 3SDBA 5J2TB 1GILA 2QYSA 4TTIA 5MGNA 3BGWA 3EY9A 3NTRA 2QBYB 5F64A 5KKAA 1TM4E 1HGXA 3EX7C 1GCUA 3HWX1 2FZKA 2UYCA 2DT8A 1LNZA 1C4KA 1ML3A 3A1TA 2GTIA 3NUGA 3AM1A 3F2IA 1ND6A 2CN1A 3DE5X 1BXRA 3W3AD 4HVLA 1VPVA 2F67A 5LZ4A 2BKLA 4HQLA 4BGDA 2GPNA 1OCEA 1M0SA 1CB0A 4I1OA 2KB0A 2V3CC 3OTIA 4FMPA 1P29A 5GVRA 4XD2A 4C7KA 1QGDA 3IPRA 3SX2A 4JUAA 5JQWA 5AK3A 3DL4A 2W83A 3DDUA 4PNPA 4H1VA 3MYRA 4PZAA 1PGPA 2WLSA 2X8LA 3N07A 3UEOA 4YRQA 5JSZA 3H7AA 1X94A 3T7IA 4ZDWA 1I51A 1NG1A 1X80B 1A5TA 3T52A 3G82C 4EG7A 4UPEA 5E6UA 3IKLA 3I04A 2C5AA 5F77A 4HO1X 1P5FA 5AKLA 3LQYA 5DYWA 4PLTA 3FFTA 3T1HB 2I4NA 4XGIA 3COZA 2OL4A 3GT3A 2NSHA 2VO1A 3L7IA 2WZQA 5FR2A 3UH1A 2R6JA 3IPCA 1QQBA 5LQAA 3I2FA 4X9XA 3CCCA 5CAEB 2W2KA 2QMEA 4D3FA 4B46A 3HCBA 1RQXA 1Z38A 4RVSA 2XNCA 2Q3JA 3P9RA 1N6PA 2XTMA 2J7PA 2YY5A 3U80A 2BELA 1JECA 3MOGA 3HDVA 2Z57A 3C0KA 2WF9A 1AN9A 5FFFA 5HMLA 3E22B 3W4IA 5FBHA 3LDGA 3CGGA 4W6QA 2NT4A 4P1ZA 2O14A 5G53C 5T3YA 3F97A 3VR5D 3BHIA 2VP2A 5B3AA 1FW8A 1J00A 1N2JA 2Q3HA 2REQA 1SCKA 2JA1A 4FW9A 1S8AA 2GHIA 2KJQA 4UBKA 4RKQA 1Z33A 2V7GA 4GBMA 2MCFA 2MSNA 3BUSA 1K88A 3ZDRA 2GSWA 3FCYA 4ZODA 5F1PA 1G5PA 1UXGA 3KM0A 2BMFA 4NS4A 3STUA 1D3AA 3GDFA 1PN3A 4LSMA 4INPA 4CMEA 3WLHA 4I9FA 3NWJA 3V32A 5EHGA 3VZPA 2QY6A 1E8NA 3L82B 3WMFA 4X1IB 3THRA 1TK3A 5P21A 4AUKA 2HDHA 4Q1AA 2AOXA 2V55B 2WI8A 4QOFA 5LXTF 3RAFC 1ZG3A 3CF2A 2R7AA 5SZHB 3H5AA 2FFQA 5BMVB 4IIEA 5KWSA 1SRQA 3FYHA 5EQJB 4AKTA 1A9YA 1D6MA 4OHOA 3IV6A 3K1AA 1P5JA 4LN1A 3K16A 2VCYA 4PR3A 4ZWNA 3V9AA 1X1AA 3MJCA 3PSHA 4AJ1A 3KKEA 4K28A 4R68A 3T54A 2W4MA 4HUJA 2XD4A 4MIOA 3P52A 1I7SB 1RW4A 2W4QA 2Y4NA 3DT6A 1KI9A 3BCRA 1QC5A 3VNSA 2FWNA 1II8A 3V42A 4KO3S 4Z4QA 4Q7JB 5JFOA 3QNUA 3L40A 3GLGA 2W6NA 2YX1A 1ISRA 5HF8A 2D1SA 3UJDA 5C1OA 4P98A 2BHLA 1AUXA 3BK2A 4MCAA 4NV3A 1EFDN 4YALA 3F8TA 3GC6A 5LKRA 2G17A 3KRTA 4GS5A 1I10A 2HA5A 3BVPA 4IQ4A 1QP4A 1ONPA 1TMOA 1TTPB 1N5IA 1N92A 2HO5A 2YYZA 3D6AA 3H0CA 4OK5A 5M3BA 2QTVB 3WB2A 3RSQA 1H6DA 3FSRA 4U63A 2A9FA 2I4IA 3VKUA 4KQMA 3LPDA 1Z2NX 3PPVA 5CCDA 3TRHA 5M2QA 4BL5A 1G60A 3CUUA 3KQQA 4C4OA 2X5XA 3BGDA 3H9CA 3VYTB 2QV7A 1GQQA 2EX4A 4RHFA 4QTTB 4ZALA 3ZY5A 5B6PA 1E7WA 2R4QA 1AGNA 3HS3A 1ZMOA 1YQ9A 2IYYA 4XWKA 1Z07A 3IV7A 3OHSX 1M75A 3CE6A 1Y7IA 5JCJA 2WHEA 2NX2A 4MKXA 3AHIA 3P5SA 1EZZA 3M9LA 1J23A 5D3QA 2IV7A 2OCKA 1S2IA 3G59A 2OCYC 3ZHBA 5CP8A 4D4LA 3CO5A 4BNNA 1AV6A 4GYYA 4UVIA 3VJKA 1CJUC 4DE5A 4IYRA 1Q74A 2ZITA 6ABPA 2FMXA 4MQ5A 3OJXA 3GV0A 1Q57A 2C5SA 3LYUA 1R9JA 2PXCA 2Q1SA 3KSUA 3LYHA 1TADA 3TEFA 3QNWA 1G20B 5BW4A 3BXFA 2RHMA 3ONDA 3L7BA 2V7UA 4O1MA 4OI2A 3UB2A 2JJ1A 2HF2A 1NIPA 3AYZB 4BN4A 4NV1A 4ESEA 4PYJA 1GTZA 3C5WP 3LDFA 1E8DA 4X65B 4Q37A 5DP2A 4XSGA 2R48A 3EZFA 2YWJA 2V98A 4RHUA 4HAZA 5CM8B 4AX8A 2GNPA 4TPKA 3HKBA 3U1VA 3FZYA 2ODWA 3QLVA 5KSWB 3VPGA 1W36B 4KL8S 2QUAA 1H6AA 4QRDA 5BOSA 4OHWA 1CY4A 1E3WA 1QHHB 3VU8A 3PE4A 1PEAA 2GB4A 1UDBA 2HXYA 2P6OA 2WTXA 3MJRA 5ALTA 4EEXA 1FOEB 4YJHA 3AGQA 1UK6A 3R7WB 4LQLA 3O75A 1E2IA 4KSBA 1RXWA 4BIIA 4HB4A 2VPIA 3AL3A 3I34X 4JJ6A 1LWOA 1BN6A 4HN9A 2SNIE 3EC2A 3AF2A 4TMTA 4J6EA 1GCAA 2DCUA 4Q7QA 1Q7BA 2JLSA 3I83A 3WO1A 3O8CA 1UINA 4YNBA 3KKPA 5FHQA 4F3YA 6REQB 1XVAA 2C2OA 5LBUA 1X7GA 5TMBA 3W5JA 5G41A 3V4FA 3QV2A 1EVLA 3AJRA 4RK1A 4DA6A 3H6HA 1N75A 5LL6P 1HZZA 4RUKA 3GMSA 4FK8A 3CVJA 1BVUA 1TJ5A 4A36A 1F0YA 1RIFA 1VMDA 3WL7A 2N0SA 1FU7A 1VLMA 3NS7A 1Z7WA 3O4JA 3R7SA 4FD3A 4U7GA 1LQUA 3SXPA 1BZYA 1G0OA 2WT8A 1NI4B 4AN4A 1FFHA 3BICA 3DQQA 4HWTA 4PRKA 1JFSA 1VG1A 2GETA 4UNRA 5JAUA 3WBFA 5GIPE 1R10A 1ZR4A 3T95A 4U2FA 5CB8A 2OFOA 4O2AB 3FTQA 5I8ZA 1JG3A 2W2LA 2WV7A 3LT1A 1DWUA 4K6CA 3DAFA 3VU9A 5KTKA 1NUTA 4OI4A 1E2KA 2P68A 1KEKA 2QX6A 1KPGA 1UJMA 3FGNA 3EBPA 5KNCA 2O1XA 2CXOA 4LMAA 4UM7A 3FMGA 4WW0A 2W2KB 1QG4A 2W6PA 3C6KA 3ZE9A 1VMEA 2J7PD 2GBLC 1NXQA 2HHAA 3W5CA 4KUHA 4LXYA 1ZM9A 2P4UA 2JGEA 3CWCA 3NWOA 1MC1A 1Q1BA 1FVXA 4D97A 3N8GA 1Z4MA 2WSIA 5EG5A 1Q7EA 4URVR 1U6IA 2B4YA 1W29A 2XOXA 3BD7A 3OZDA 3W1WA 4O4IA 3E1GA 2EHDA 4E2YA 4ZO9A 4ZVVA 3TQFA 2PT5A 3OFVA 3HJHA 4M7OA 2I7DA 5AW0A 4OHRA 1UMBA 3K0KA 4BFTA 1O95C 2D2FA 3WLMA 4DQLA 1IN7A 3H2GA 3G3EA 3G8AA 4F2DA 1YNSA 2X1HA 1TU3A 1B0ZA 4B48A 1GGVA 3PZBA 5B1HA 2XE7A 2HOQA 2W8BB 3NVKI 1QOZA 1YO6A 3F6YA 1KERA 1H0HA 4LYFA 1FRZA 1HLFA 5FBVB 2TRSB 2EATA 2D1FA 5ES3A 3L05A 3QLVC 2BIFA 2YWEA 4LVUA 4U00A 3IAAA 5KWEA 3ABZA 2PMDA 2X0DA 1EX9A 1F4VA 3UPDA 2IXFA 1A1VA 4QQFA 3QHAA 1E59A 1Y9JA 4Q9AA 3AR4A 4XRGA 2C31A 2YWBA 4OFXA 4G4IA 1IBLB 4CQLB 4GM4A 1ZRMA 4TWZA 2OGSA 3PA8A 3PDIB 1U3GA 4CMBA 3KKKA 4B4OA 1EXMA 3K8QA 2O57A 3QF4A 2I3GA 1W44A 3BDVA 1WAMA 4LK3A 3G2LA 3S2GA 4EPWA 5J2UB 2OR3A 2XNSA 3C41J 1DCTA 2HA6A 5CXUA 1XT6A 2BM9A 3W1EA 4MUHA 3DCYA 4YGYA 1GAQA 1SCJA 1U65A 2W11A 4ZT7A 3LK6A 1S7GA 2JPDA 3NI2A 3TXYA 1Y6RA 1CUHA 2ODPA 1GAXA 2XX3A 2GRJA 4BLOA 4RL4A 4RF3A 4CG1A 4LRQA 2H1HA 4DV0B 5LUBA 1NBWB 2JD2A 1AQ6A 1O89A 4P38A 3PFBA 2QE7A 3KOYA 1PK8A 2XI4A 4CMEC 2IYTA 3GCGA 3LZCA 4EKIA 3IDQA 2ODQA 1NLUA 1I0ZA 1P0MA 1XTRA 2GEVA 3I2KA 1WSAA 3L07A 2ZKLA 4FFDA 4IS3A 4EI9A 2BEVB 3E7PA 3H8WA 1O58A 1E3QA 3EXEB 1ZA1A 1SXJE 2EV9A 2H4YA 3K5PA 3M82A 4GGMX 5LZ9A 1N34B 4OLHA 2OXCA 1CUVA 4MV8A 1LFDB 1S2MA 1WA5A 2FZWA 1H5NA 3DTTA 3NBYC 4PX3A 2W6ID 3L92A 3CZ9A 4JBIA 3WLNA 3ZDXB 1CR0A 2RH9B 3MRVA 1KHTA 4A8JC 3UK0A 5D5PA 4PTLA 5TMEA 3BBLA 1V7QA 3KTDA 1T2DA 1ECJA 3FTNA 3WGLA 4HLNA 4LY3A 1EVIA 1N2OA 5HJ2A 1WLYA 2DFLA 4TYYA 2NTEA 5GOTA 3S70A 4H6VA 2G9UA 3NHAA 3IJEB 4P34A 1XEXB 4LV6A 5DHPA 5J5AA 1NQVA 1V9SA 2I2CA 2GNOA 3KSAC 2M1XA 2BH9A 4UNSA 3ETJA 2VTDA 4RIIA 4B09A 3IHLA 3IP6A 4MPJA 4TZKA 4C78A 4YP0A 2MSCB 2QX9A 2IE8A 4RVFA 4LFCB 2L82A 4DAEA 2YC4C 1PSDA 3GGDA 2WYVA 5JMPA 1XMOB 4L2IA 2E48A 1LDNA 1QQTA 1KNQA 2ZI4A 3HNOA 4PAOA 4PYKA 4BC0A 4RVDA 1GCGA 3CRRA 3HWSA 4WZZA 2X9VA 4RO0A 1P5ZB 1R9NA 5E6RB 3WI7A 3ST7A 3IURA 5BSRA 3G8BA 1B73A 3IPAA 3NQ41 4IIBA 5D85A 2OMKA 5C7LO 4M0MA 4UJ5A 4ZO7A 5EWJB 3WLTA 2IVFA 1YBHA 1J07A 2AR0A 1NUPA 3MJHA 4ZJYA 1EDDA 3NUZA 4JX8A 1G1MA 3CNOA 3SKYA 1RNLA 4MVJD 3U4AA 5HSGA 4XGQA 2ZDQA 4D96A 5L7WA 1LCIA 5FYQA 1V6CA 2C4HA 4OFBA 5BSGA 1XQVA 4YRBA 1II9A 1DV2A 1P9NA 1S96A 3B9QA 2ZYAA 3FPGA 5DHAA 4IQ8A 1XTSA 4CCYA 1Z3IX 4PZ9A 5AHXA 2YJ6A 3O8QB 1KJNA 2IYUA 4RSMA 3TBKA 1TUIA 1QKKA 2GCOA 2OO7A 1CE8B 3JPYA 1H8EA 1LJLA 3DEKA 9LDTA 1P7CA 1CDZA 3DLPX 1J8MF 1YR3A 3HDQA 2CNLA 2HPVA 2H2FA 2P35A 4OMCA 2C83A 4WNYA 3UMCA 1TQ4A 4XWAA 2FP4A 3GH3A 2JJ2D 4IUBS 2EFJA 5KKCA 5DK6A 3N1UA 8MHTA 3K2IA 3BE8A 1PT8A 4GM0A 3NRJA 1K6JA 5AESA 3GPBA 5ARCA 10MHA 3ZWBA 4FN4A 5B3JA 1Y4AE 2FWRA 1FDUA 4NBUA 4TKZA 5F5LA 3T12A 2RCNA 5IMBA 3ZWQA 3TW0A 1GSIA 1OILA 1IUOA 2MSWA 3KVYA 2O6HA 5EPUA 1RLMA 3OMLA 4W1RA 1XAGA 1Z62A 1I3MA 2BUBA 1DLJA 2RG7A 3NT2A 5DTJA 3V7UA 5IAGA 2CNNA 4BNMA 2VJYA 1NF2A 1QK3A 2XVZA 4P3KA 4A6DA 4DXHA 3KETA 1TM5E 4PC7A 2WRZA 4X6YA 4A7PA 3BMXA 1N25A 3COJA 4M1ZA 3GX1A 4E1AA 1WY5A 1OAAA 4RLHA 3SYNA 4EPXA 1KMQA 1PKEA 2HEIA 4FLFA 2FH5B 4IOKA 1FDTA 3VR3A 2J0EA 5E2IA 1MEEA 1WDMA 4UD6A 3O38A 3B7GA 3DNFA 1L4LA 4UBOA 4NMLA 2WIAA 5DYTA 4E7PA 1F0PA 2X40A 2C3YA 1XXLA 2HC9A 2VK2A 1AB5A 1IDN1 2ZROA 2AJBA 3CSSA 1U9CA 3D7KA 3KPWA 5DO9A 5UKDA 4EHLA 3F3KA 2PVPA 2BLLA 1ZKMA 2RH4A 3KJFA 4FEEA 3OAAD 2CMHA 4HN4B 3ZDEA 4TWAA 5JCOA 3RFUA 4OAOA 4W9RA 2XCSB 1XD2B 4DMGA 3Q8LA 1E7QA 2YWRA 1AGRA 3LUCA 2J6IA 3GAMA 1E2MA 2Q2VA 3AY0A 3OCWA 2Q46A 1SUIA 3OTHA 4NJEB 5DCWA 3U39A 1NRJB 3T61A 1JJVA 3PZRA 5FBKA 5BNIA 6ADHA 2X7HA 5JJIA 2YJGA 3VYWA 1QS0B 1IUKA 1TKRA 3U7JA 2B8EA 3GAAA 5IABA 3KZCA 5FA6A 1QKIA 5EE3A 3R24A 4EEZA 2XV1A 3GLUA 2ZIUB 5TXGA 2B4RO 2JZCA 2NT3A 4N6NA 1DKNA 2AX3A 5LA6F 1U7UA 1Z2PX 2BFCA 2MYNA 4QOSA 4ZQGA 1WBBA 2IOQA 1UFKA 2TMDA 3UAZA 3K73O 1RWXA 3FOWA 3TNDA 2HWKA 4Q93A 3FGZA 3HTXA 1HLPA 3G6WA 1ES9A 2R97A 4MAAA 3FZNA 4R7GA 4Q0MA 4M8IA 5LBTA 1VPTA 3AERB 3IHKA 1S1CA 1MR3F 5AM0A 2J0UB 4HJXA 1I6WA 1EP2B 4C3OB 3PP8A 3FTFA 4D4GA 2XYVA 2WWGA 2FSVC 4ZDJA 3GRAA 4BB6A 2QJRA 5KJ6A 1JRLA 2J3IA 2OCGA 2I34A 3QMWA 1S0UA 4Z8YA 1GZ7A 3QIVA 2QZPA 4GBGA 2PU7A 5DTQA 3SJBA 1MXFA 2NSYA 4MS3B 3CF4G 1JTFA 3RK0A 4BFWA 1Y6GA 2BSQA 2YW2A 3T1OA 3FMOB 4RD1A 1VJ1A 2HQOA 3FHLA 3D3WA 4JP8A 1Z0DA 2O2ZA 4BPBA 1DO2A 1FP4A 3LP5A 1M1NB 4UM5A 2QI9F 4MEBA 1CY8A 5LC1A 1BDBA 3OZUA 1O97D 4I3HA 2JGIA 3OMWA 1L8OA 1UC8A 1ZH8A 4R2HA 4EYQA 4DMFA 4AD8A 1GLGA 4F3CA 5A3VA 1WIWA 4EGFA 1K3FA 4QT0A 2F9FA 1YZ3A 3EH1A 1DEKA 1U2TA 2HO4A 2IP2A 3MTAA 3T9DA 4A10A 3TG2A 2OYRA 1DTSA 1F9EA 4UNNA 1C2TA 5AWFC 3TYXA 3ZNNA 2EW8A 3TDNA 4JYMA 1MV8A 3ONVA 4GMXA 4N8EA 5JXJA 5M34A 3H1AA 1GQ2A 3KLNA 1JEEA 4Y1GA 3KQKA 4KFCA 4F8JA 3IEVA 4Z4CA 3ICEA 5KWJA 1H0KA 1TMYA 3ZWMA 2CXQA 1EE2A 4U6NA 4KRFA 2FVXA 1X9HA 2A0XA 4FYVA 5F7XA 3CX4A 1YVDA 4AMZA 1ZHOA 3CCBA 2NOAA 1OFHA 2RAUA 4PZ0A 3FCOA 1QKJA 3FLMA 1FRVA 3IT0A 3LAWA 2DLDA 3V1YA 4XOUA 5J59A 3O3CA 3LU1A 1Q0UA 4I6EA 2VF4X 2JGNA 3THSA 2P6UA 2VUTA 3AGPA 4YONB 4ZVPA 3U3JA 4DCNA 5EJ7A 1QTIA 1PSZA 1WXXA 3HUFA 3M34A 2I7XA 4JMPA 1BFUA 1M6YA 1R50A 1XNJA 2IDJA 3N2YA 4JJEA 3IXQA 2ZTVA 4R8SA 4K9KA 1HOTA 1K3UB 1BXRB 3E3OA 4EBBA 1BMDA 1Z0AA 1MU0A 1L4UA 3IUYA 3WK5A 2PUDA 2NVBA 4P84A 2DFDA 2UYYA 3SWWA 5IVPA 3SEAA 4NOMA 4JELA 3NBXX 1A1SA 1T3LA 3RROA 1ADCA 1D1PA 4N18A 1LC0A 4A9AA 1T1RA 2AN5A 1B23P 1CQIB 3OT1B 3GUHA 3UAXA 4YRKA 1ZEJA 3IOCA 4JYZA 4PZYA 4MMXB 4YRMA 1PX2A 2KBEA 5IXYA 2DY0A 1X7DA 4HDMB 2J9GA 3WGMA 2C2HA 1RE1A 1AB6A 1Z4KA 5A5FA 1DCKA 3O31A 3ZQ4A 4LOLA 4C03A 5FTWA 1JL3A 4FI3F 3K5IA 2QNRA 1VHLA 1LQ2A 2L18A 4EG3A 3KYCB 3X1DA 4LZAA 2XMDA 1YA8A 4DJAA 3G2MA 1SG0A 3PNSA 3H1FA 4ILKA 1IN8A 4KWCA 3AW8A 4RPJA 5DMXA 1NM5C 3KWLA 2GM3A 3LY5A 5ALLA 5JROA 2W6JA 4J7XA 1JB1A 4NHEA 5HBGA 3JV7A 3ZTTA 3WJ7A 4WY5A 4MQLA 1NSFA 3GIDA 4N3GA 5COBA 4RTKA 3X1MA 3NAMA 3O82A 4B6OA 3AVOA 5IHXA 4YUZA 4X61A 3K9HA 1VTKA 2WM8A 3ABSB 1M2EA 3K0BA 4CG0A 5AW6A 5CHEA 4EABA 4CF5A 3VR0A 4O59O 2WKWA 3GUCA 1JA0A 1JEOA 3B85A 3L77A 1E2HA 2CJXA 3OJWA 1N4AA 2AI1A 3TTUA 1SCIA 5JAHA 4O3MA 2P9BA 2JFVA 2Q5JA 1GG5A 3AB8A 4MV3A 2GT1A 3KL4A 4MI9A 1V8BA 2V54A 1IN4A 2NZXA 5FHRA 4GOMD 2WU1A 2I6QA 2UAGA 2JFZA 4WL0A 2QSZA 3E2MA 1PEKE 3HKEA 3H5OA 3MLBA 3TNYA 1OGIA 2YJ4A 3CLTD 3QKSB 3DG9A 1MFZA 1XE3A 2XY4A 5FOVA 1H93A 1P2GA 1CZKA 2GXQA 2XTNA 4MQ4A 4DV3B 1ZVMA 5TPWB 1PEDA 3L8FA 1DRKA 3GQVA 4AP6A 2IHZA 2G0AA 3B7PA 1W1IA 3D8SA 1EG7A 4GFDA 4Q3AA 4TV8F 4ES6A 2EIXA 3H8SA 3RH0A 1DSSG 4GZ6A 1QVAA 4UNPA 4E46A 2QVYX 3EQ6A 3GVHA 4A2WA 4B6PA 4BQRA 3L2OB 3H84A 1NW4A 2YFYA 3DHEA 3OCJA 4GRAA 1MTOA 2JVJA 5IASA 1IEQA 4EJ2A 3GLHB 2BFNA 2FW1A 4GXNA 2V0GA 4C06A 2V6FA 3C6XA 3DBHB 1I4OA 5ADUS 2EZUA 1OZFA 3EEQA 3A1DA 2CNDA 2GZ1A 1UK7A 3CRMA 4JLKA 3L1JA 1U1DA 3V8BA 3ETDA 1ABFA 3OA0A 3ZYZA 5G2OA 3U3MA 4MINA 3BEDA 3N2ZB 1KP2A 4EA9A 1ENYA 1YB6A 5DMHA 4E3WA 5FIUA 4R41A 3CW9A 3L43A 1MJ5A 3B70A 3OZIA 4I8DA 1IWBB 4E5KA 4EMUA 1ILEA 3K70C 3VZQA 4J94A 1U2DA 3RIEA 1AGPA 4DEXA 2BGLA 1FUUA 4FIDA 3NKLA 1VMAA 5DBOA 3UIEA 1TO1E 1EM8B 3Q0EA 4OHYA 2JKZA 4UQLA 4O4HB 2OA0A 1CBUA 4TXNA 4UQPA 5ES4B 3NO4A 4BRSA 4IH9A 4AT1A 2BPOA 1NFQA 3ZUPA 1HXHA 4V0KA 4P82A 4L4RA 1L1QA 4KDCA 4WIAA 5LQJA 2JLXA 3S4YA 4MB6A 3QU4A 4P7KA 3MB5A 4Q02A 3DDWA 1PU2A 4GEKA 1SOMA 5LMUB 1BSVA 2Q4TA 3MPUA 2XMGA 1MD9A 4XQ9A 4ETNA 4F2HA 1CS0B 2EWVA 2PG3A 3Q7PA 3MMXA 1C3VA 2L2QA 3BXGA 3D3EA 5HE8A 2OBMA 3FYUB 4IDAA 1IUPA 3HGTA 5K6AC 3BSYA 3QNMA 5IJ9A 3LZDA 4XX0B 1QHIA 4QFDA 3K71B 4WY2A 4MMZB 4OBXA 1PJBA 4KE7A 3PHJA 3A2KA 4LKOA 4MXDA 4XFKA 1HKHA 4NYIQ 5FJJA 3C7AA 3N2IA 4DEVA 2VDLB 5ITWA 2IIBA 4X94A 2X9GA 2FEPA 4E30A 1BXGA 1RCUA 1SQ0A 3L9WA 4KIWA 4WHMA 2BY4A 3HXLA 3KTAB 1EX1A 1QQ6A 2A5LA 2Z2KA 4II2A 2BFEA 2LR0A 5FLEX 5IS2A 3TLJA 1KAOA 2JGLA 3CINA 3HE3A 5L7TA 3ZV4A 4DANA 5FNVF 4MJXA 4ZYWA 3QVSA 1TCCA 1TO6A 5U4XA 4FYJA 4TZTA 3S28A 4EPYA 1N3IA 4EMTA 1I7NA 1DUSA 4LJAA 2Q8PA 2Z2JA 3KX2A 4WD3A 3BULA 1XJWA 2MHCA 3KYDB 3ZV3A 4IIYA 1O6GA 1C7FA 5FI1B 4IVQA 4C0KA 3GLGE 4YXFA 2ZCVA 2BGMA 2HI0A 4I5FA 4EYEA 1M1YE 4RAQA 4UDYX 1J8QA 1OIVA 3N3BC 3T7CA 1VG8A 5E2AA 3JSXA 4L4UA 5D1HA 4PGAA 1P0CA 4MICA 1SEPA 3SE7A 1XL1A 4OA5A 4ARIA 2ZSEA 2IA5A 5EIEA 3UMYA 4DGSA 2WJ6A 2CUNA 3W8DA 4BATA 2DHDA 5DZSA 1U02A 2BFCB 1E2BA 5AHWA 3LWNA 2I2WA 3EH2A 3BJIC 2Y4OA 2H1RA 2ZS9A 4Y9UA 1Y7TA 4X7BA 3P9KA 1JFRA 4MGZR 4CT5A 4XPZA 3FJ1A 2EFEB 3BIWA 5BWCA 5KC9A 1C3JA 3JATA 1LBQA 3ZHVA 4RF5A 1SURA 5H68A 1H6CA 3UJCA 5CB4F 1CJSA 3R76A 1VKNA 4KQXA 3A28A 2IPOA 2XKAA 4F4CA 1A98A 1G8YA 2IU6A 1LV8A 2ZSFA 3MJSA 4M55A 3GRPA 3TGLA 3ADBA 2QTLA 1J0BA 1EEXB 2IYPA 2PX6A 2C9MA 2J59A 2R5FA 1JH8A 2VC2B 4G36A 4I7EA 4IFTA 4KFTA 1MBZA 2XD9A 4G41A 3VR6H 4C0AC 5GZ3A 3NBFA 3M8KA 4GI3A 4K81B 1NX9A 1VLJA 4D57A 3BE6A 5BV8A 1RWOA 2GEJA 2IODA 3FSGD 2JCBA 2RC5A 2IGTA 4CIXA 3DT8A 1AE1A 1UH5A 1KAGA 2ZSAA 1ZYUA 3I73A 5ALUA 3PHHA 5EJFA 1TEZA 2HV8A 2XE8A 5JWHA 1ZMBA 1ZW1A 2R1VA 4PCUA 4GX1A 2VQ3A 1GU1A 3HACA 3PVCA 2EAUA 5JAIA 2P9ZA 3FPKA 2G0TA 4WESB 4Z0NA 2Q5CA 4UTVA 2O2DA 1SM4A 1H2YA 2H1CA 3FDFA 4KV7A 2F17A 3C14C 1Q3TA 5BOVA 4BKPA 4NZ9A 2XZOA 4QU5A 4OATA 1I9CA 5SYAA 4FDUA 4IM7A 3NHBA 5BWMA 1JLKA 2FMHA 5DCUA 3GUYA 1SXGA 5DN6D 1AO3A 3BJZA 2R4UA 1WB4A 4L5YA 2V59A 3H2SA 1BA3A 4P3NA 4QUKA 1EUQA 1RRVA 2FLVA 3AH8A 1XB2A 4MCIA 1PL6A 4MKGA 4TV9B 5J4VA 1E6WA 2WE7A 2DUWA 2ZRBA 3LDHA 3PRYA 4HNTA 3ANTA 5E9AA 2YW9A 4JIGA 2ZVJA 3ZI0A 3H4VA 1YH3A 3FRHA 4O8ZA 3WV4A 3O4HA 3T34A 5A62A 4DRYA 1HNXB 2C78A 1ZI9A 4KXYA 4QUBA 1K7FB 3OX2A 2FI1A 2HMVA 2P9EA 3GRVA 4U9HS 3VHXA 1Z7GA 4ANFA 2W9XA 3H11B 5K0LA 3O4VA 5JYCA 2X9LA 5K8LA 1AZWA 4G6ZA 2HL6A 2EJBA 3ZBTA 2YBDA 2C4UA 3ICPA 5AI8A 4DJFC 3A6EA 1OLSB 5K3BA 1JQDA 4GR5A 3SXUB 3UICA 1QLWA 2UZIR 3GDWA 3N05A 2Q50A 4AM8A 1QAQA 2H7XA 2WQ6A 2H8KA 5AJUA 5J47A 4RDCA 3U7RA 4KQJA 1RYZA 3NDJA 4DG5A 3BD6A 4FFRA 2CLMB 1TVEA 1I94B 2JCSA 4IL5A 3FWPA 1WTCA 5HXAA 1F1JA 2XF2A 1V16A 4INJA 2C0CA 2X8JA 1U2GA 3NALA 4FHCA 3TFQA 4O2RA 1PZNA 4MQBA 2ATEA 2Q3BA 5I9MA 1CVIA 1DG9A 2Q6LA 3V3KA 2C2BA 4E22A 4QO8A 5I9IA 3ODGA 2JLCA 4CMJA 5CYPA 1SHTX 3AFIA 4AJEA 4CEJA 2FMKA 1JHDA 1T36B 3G9TA 3PKZA 1S4MA 2ZATA 4IHJB 4XSHA 1DAKA 5IF9A 5EWLB 4H7HA 1U11A 1N6IA 2Q0HA 4E3ZA 3RJZA 3GN1A 1N5LA 1JVNA 3JQQA 4CQMB 2ZBVA 4TUYB 1C3OA 4BOYA 1VE5A 2QHXA 1JJAA 2ZTLA 5TEVA 5J1SB 3DTVD 1N0HA 2CDRA 4EKDA 3I58A 5IM5A 1I36A 1RRFA 4RF4A 3T9EA 1SC6A 2O0JA 4JL5A 4J3FA 4MHTA 4YMVA 3OCVA 1TM3E 1JXQA 1C8LA 4K1LA 5B3LA 5KWIA 1VYTA 5IKXA 2OOKA 3SZOA 4P35A 1TLFA 5JG7A 3SNKA 1NDHA 4U3JB 2WUFA 3CSDA 3SS9X 2YIMA 5CJ2A 3LKBA 1U1GA 2ZUBA 3QX8A 3KZKA 1UM9A 3V5NA 4ND5A 1NBMD 1SZCA 2XNJA 1T2EA 1H65A 1YL6A 1FU8A 4HLCA 2FWMX 5BSUA 4UC0A 4BN5A 1L4GA 1UXJA 1P7PA 3K53A 2QRPA 4LE2A 4RC9A 3DLTA 2J3JA 2UZ3A 1A4RA 3PR1A 5IAJA 2E87A 4A2PA 5CW1A 3OQBA 5LMCA 1DIAA 2OGZA 2X58A 5DM1A 1KIMA 1EFTA 5FL7A 1W1WA 3UC9A 3PNBA 4AY6A 1ULAA 2QQEA 1PI3A 1J06A 2JAWA 3N39C 1L8AA 1NVAA 2NTJA 3L1IA 3G1WA 3Q7EA 1F51E 4PNZA 5KVCA 2AHOA 1RAIA 4GH5A 4Y2TA 4B9EA 1TC2A 4BUCA 2FN3A 2OC9A 1R6AA 3IPXA 4RKEA 3UT0A 2XTZA 3CMCO 1P17A 2CUKA 1Y1TA 1QF7A 2A2ZA 3U0VA 3DD5A 1IULA 2ZUDA 2GN6A 2W2TA 1KAEA 3L7NA 5GIOE 3BTSA 1W4ZA 1UC4B 2Q3MA 3GFGA 3SVTA 4RZXA 3IS3A 2I4TA 4JGGA 1KQGA 1T5HX 2FCAA 3IB6A 1UOQA 3OPXA 3SF8B 5C7YA 1CUDA 2UZAA 4WKCA 4EI8A 2ZYVX 1VHWA 3EAGA 3JQPA 3WYFA 3B20A 3ONNA 4UZEA 4HMQA 1FJ2A 5FWAA 1E4OA 2HSJA 2VEDA 3BWEA 3LW8A 1GHTA 2N75A 1EXDA 1VBNA 2D6FA 1SEVA 3BGIA 4BQIA 1M6HA 4NOKA 4V3BA 3ZD7A 1LXCA 3U7QB 5TB5A 1E9DA 2Y1OA 3CUEF 3ETLA 4GLLA 1Z26A 1LJ8A 3OM8A 1T9KA 4Z9XA 3AB7A 4W82A 1B41A 4L4SA 2CHEA 1RTKA 1K92A 2GZHA 4MIEA 1B3BA 3ET4A 4NESA 2VHVA 4R40A 5SICE 4ZO6A 4W8OA 2F8TA 3V1KA 2Q3EA 1RI2A 4ENSA 4XSVA 2ADFA 4DLRA 3FNIA 1RKXA 2EBHX 1F8FA 1MJHA 3H5LA 1OF1A 1Z0FA 3UQYS 4HGQA 4DG8A 2L19A 3PB3A 2VDWA 3WC4A 1K5DA 3PQ2A 4ZOLF 3DLAA 4ZVMA 2H9AA 2BC9A 3I09A 3CN7A 4LYDA 4NBLA 1H2BA 5LP6C 3F7NA 2NU8A 1V47A 2AZTA 2SCUA 4B7ZA 3I9KA 1JR3D 3ZWWA 1P72A 3QU9A 1T4GA 4IMPA 3H86A 4UM9D 2ZZMA 1XX6A 3U4HA 3I2HA 5KOHA 4EG8A 4O02B 5LYJA 4BWYA 5HDBB 4IUDS 1RJWA 1N1MA 4XYGA 1C4WA 3V00A 3TFOA 3DO8A 5F2EA 1ZK0A 1U04A 1XA0A 3TSWA 5JDCA 2Z6VA 5KKNB 4BRUA 1NVKA 3ESQA 3OTQA 4X20A 3KKQA 3T3NA 5AJXA 1MX3A 1M2NA 2QJFA 2XDYA 2XGGA 4HWPA 4BIMA 3RYCB 3W5BA 1AKMA 2WF5A 4N5HX 8ATCA 5C53B 2XHZA 5THKA 4D80A 3U1TA 1QO7A 4LYYA 5GJWC 4LY9A 1JT2A 1ZMTA 2HCRA 3LWZA 1W581 4AQDA 1GRVA 1RHQA 3AV3A 5E1DA 3AR8A 5I7AA 4KAAA 4EG0A 3IXMA 2DQYA 3MTEA 4AKHA 1KFCB 4RZ2A 3JARA 4UHDA 1PDVA 3BMCA 1YOBA 5DWDA 3AVQA 3EDMA 3K1ZA 3LY9A 1UAAA 1OZHA 1FNMA 4JC0A 3ZV6A 3G13A 3I92A 3ZNPA 2VYNA 2QTHA 1NJFA 3IC5A 4DMKA 3M4XA 3AU8A 1D7AA 4I19A 1HFEL 4V0RA 1YACA 1QFJA 3IUBA 5SYMA 5FWXB 2AC2A 4PGFA 4MV7A 4X84A 1WEHA 1G21B 2AZ4A 2BEWB 2ZM6B 2WK1A 5KEIA 1DADA 3HJCA 3RSHA 3UM9A 4U3JA 4YXWD 2IHBA 2ON6A 1QVRA 3D6JA 3QTBA 3GFSA 4JBWA 2J1LA 3C3WA 2GZ2A 4GPTA 4UVHA 3TZKA 2M6SA 2NZJA 1TAQA 4JEMA 1QZTA 2WSBA 1DE0A 3DEHA 5FPPA 2W2VA 4JB2A 1TMKA 3HMQA 1LPNA 2LPMA 4NF2A 1J90A 2POCA 1OB2A 4KH0A 2I3BA 2C00A 5IVIA 1S2DA 1YR1A 4QNNA 1MRSA 3L4KA 3JQ6A 1MQ8B 2P7HA 2FY8A 1SA0A 2ZAYA 4M4SA 3TW4A 3TW6A 5AHKA 4EVSA 3AF0A 3K30A 2MYTA 3ZTWA 4Y2RA 5AW9A 1BWQA 3J81A 1P81A 3GWZA 1EHIA 3LX6A 2EARA 2IIQA 3L1HA 3RS8A 4EAQA 4CCWA 1CNMA 4RJLA 1YT5A 4DIKA 2PUTA 2Q5IA 5ALOA 5JS1A 3IALA 4UHHA 4H3HB 4LJSA 4QSHA 1ZCZA 3X2EA 2JAHA 3P9IA 4RPLA 2Q5HA 1YMVA 2R00C 2X8JB 4N1AA 4PC1A 4WZAB 4R1UA 2IW3A 2VSFA 3BC1A 4Z7QB 4D26A 1TKBA 1QVVA 3OM0A 3P97A 1T10A 1VLZA 4Z7JA 4PLYA 2JS7A 4Q34A 1R27A 5GGXA 1GV0A 3GQBA 3LC0A