2AR7A

Crystal structure of human adenylate kinase 4, ak4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
b'KLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase 4
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of human adenylate kinase 4, AK4
rcsb
total genus 72
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ar7A00
4EFLA 3CNLA 4DLYA 1DVRA 1YR6A 2ORIA 1P75A 4B32A 3GLGE 4B48A 3REGA 1PUIA 2WIBA 2X8AA 4M8NE 2NO0A 2JASA 4DRZA 4TYPA 1TPZA 4K46A 5TARA 2RHDA 3EZ2A 1N6NA 4O25A 1Z08A 3GLFB 4C2UA 1U2RA 2O8EB 5B64A 4LJ5A 4BUJA 1UAAA 4GI7A 4NCKA 1DAGA 1AK2A 2ATXA 3IKJA 3M6AA 1QDEA 2N46A 3BB4A 4C0BA 3GJ5A 1BOFA 4KYUA 1OT3A 4B43A 1RJ9B 1ONBA 1KO8A 2WMNB 4JZKA 2A2ZA 4JVLA 2I1VB 4OI4A 1N3BA 1E3MA 4XD7D 4QBHA 1T8UA 4FMCF 4LRWA 1P7CA 5JHHB 1CF4A 2W58A 2EFEB 3B1YA 4R2IA 4H1UA 3GEIA 2W6JD 4TTRA 1GRQA 4BRWA 1NJGA 1CULC 2IX3A 2YINC 3AKYA 4ZDWA 1CJMA 3T34A 1OYWA 4E07A 2C98A 4LHYA 4Q4AA 1COWA 4A0HA 3N2EA 3AVUA 2PH1A 5KDDA 1DAFA 3Q7PA 2H16A 3K9GA 3SQXA 2IUSA 4J0QA 1GSIA 2ONKA 3BAFA 5E7JA 4A0RA 2QGNA 2IYUA 2IL1A 4TLEA 2PEZA 1XX6A 5DYIA 5B57C 5DIFA 3TQFA 1NN0A 1QVRA 2CLSA 2F7SA 2XEXA 3K9HA 4KYIB 4DJTA 2GRJA 3R9WA 3CF6R 3B60A 3I8SA 2RGAA 5A5GA 3V4RA 4XIGS 2RGXA 1P61B 3FE2A 1XPRA 4TZ6A 2WWHA 3FMPB 2XXAA 4LYFA 1OIWA 2ZE7A 2YHSA 2B8TA 3KUCA 4I1SA 3BERA 4R71A 3CWZA 4FINA 2QE7D 4PPNA 5J4HA 3W3ZB 2J0UA 3THWB 1XMSA 1U99A 4M9SA 1KI8A 1I4LD 1YRAA 2OFXA 1OXSC 4RVCA 3KQUA 1AKYA 4NP6A 2R6FA 1T0JB 3VNUA 2OV2A 3K9NA 2ERYA 1XMJA 1IY0A 2GESA 3TAHA 3L2OB 1IN4A 2E87A 4GMXA 4OI2A 4KFUA 5EJEA 3EPLA 2BC9A 2GDJA 2D4HA 4GMDA 1XTQA 3MCAA 2R62A 2CL6X 1GKYA 3WXMA 5A4JA 2HJGA 4MQBA 4ZI3A 2AK3A 3RS2A 1HUQA 4GSYA 4W5WA 1N6RA 1R5NA 4F38A 1G41A 1DELA 3SC3A 4NCNA 1E2HA 1GL6A 2V55B 3MAAC 1U8AA 4GOKA 3SI7A 2JJ1D 5FOTA 4ACBA 3X1WA 4B6FA 3B82A 2VHUA 4PPQA 5L3QB 2P67A 2FMXA 1UF9A 2MSDB 4MKHA 3F8TA 1HE1C 2ZRHA 1WA5A 1DEKA 1SVIA 2WICA 2CLCX 1SVKA 4JVMA 2XGJA 5KNDA 4DZZA 5GJCA 4Q21A 2NZJA 2PT5A 4EUNA 1N6PA 3OAAA 2QA5A 5AUPB 1A7JA 1VCIA 4LBZA 3C41J 2GEVA 1JPJA 4B75A 3ZGXA 4DDVA 2Z43A 1NMYA 1AQUA 3U7FB 4GZMA 4W5HA 4G01B 3NC0C 4LJ7A 1CRQA 4OK6A 4M4SA 1E9BA 1FPMA 1B23P 5CB8A 4P31A 2D2EA 1OV4A 5FFMA 4AY2A 2VO1A 4MYUA 1KSFX 3FKSD 1OFHA 3KTAA 4PC6A 2HT1A 3KFXA 3I8XA 4A2QA 2ZXUA 1HE8B 4EFMA 3SEAA 1XEFA 2JA1A 1D9ZA 1ZU5A 2C9YA 2Q21A 2CDNA 2W0SA 2W6IA 5K8TA 3Q3JB 3MWJA 4BZPA 1M7HA 5FPKA 4KHZA 3ADCA 5AK0A 2PL3A 1W36B 2O0JA 4X8HA 1AA9A 1XMIA 3U4QA 2ZJ8A 4A6PA 2P5TB 4IKEA 3AB3A 1E96A 8OHMA 4QL3A 1RRGA 1UJ2A 1GG2A 4P33A 4ACAA 4FI3C 4PO9A 5C4MA 1CJVC 3ZH9B 2QBYA 1MKYA 1Z3IX 3R7WB 2WWIA 3I5YA 5AJVB 4E5UA 5JEDA 1T3SA 1F3OA 5FBRB 5JBQA 4HB2A 3C8UA 3CZPA 1E2MA 5FTNA 3WYGA 3MWLA 3DPUA 1OXUA 2GJSA 4TQUS 4F4JA 1S1MA 3LLMA 1J99A 1E1QD 1OF1A 3QG1A 4B74A 3K09C 2GTPA 1Z22A 1Z63A 1F2TA 2AN9A 4IDNA 4KBGA 4S35A 4A9AA 1OXTA 3W6OA 1CJKC 3CRW1 1WDTA 2JDIA 1GRRA 4URWR 1DE0A 4HI0E 5FOXA 3LY5A 3V4FA 1A4RA 3D7MA 6Q21A 3RC8A 2QZ4A 3NTUA 4Q48A 1RPZA 4Y0AA 2QRZA 2DBYA 5HZKA 1U98A 5KOYA 2YZ2A 4KSCA 4ASUD 3PUVA 4N0DA 1MABB 3LW7A 1GL7A 5FTMA 4B2LA 4DUGA 5HKKA 3EX7C 1W47A 3VKHA 5LD2B 5DNYB 3IEUA 1A2KC 4LPKA 1U94A 1SGWA 4CEJB 1ZJ6A 1RJ9A 3BE4A 3SFVA 3SJAA 1Z0JA 2QROA 1T9HA 5FOVA 3KB2A 2C77A 4OI1A 2VSOA 1KMHB 4PHGA 5D3MB 4GBMA 4PPFA 1WQ1R 4XH9B 4RZ3A 2V3CC 3KKQA 4QG7A 4M2LA 5D3MA 4YXWA 4JBYA 4CT5A 3G0HA 4KXFB 3W3AA 3SN6A 4M1WA 5HE8A 1G7CA 3RSOA 1JQJC 5EE3A 4DSNA 3EPJA 2D7CA 2HYDA 4JS0A 1FZQA 5FBQB 4XWOA 2GBLC 3QPUA 4UXJA 4MUBA 4TYQA 1VHTA 2IYQA 4HZUB 1NL3A 4LHXA 4M0LA 4KSBA 1EXMA 2ZI7A 4P4SA 5FOUA 3B7GA 4TL9A 1WB9A 2O8DA 3K0FA 3VR6A 2NG1A 4D25A 2X2EA 2G83A 2Q3MA 4WZAE 5HCNA 1JB1A 4OBEA 4U7DA 1E2JA 4LI0A 4LV8B 5KPJA 3LLUA 3QUSA 2XOKD 2W0MA 1OJLA 3O8CA 1W0JD 5BYKA 2FV8A 3X1YA 2XITA 2PZFA 4HSEA 4EPWA 1W1WA 2WOOA 2UZ3A 2NPIA 4JT2A 1II8B 1N2CE 5KNBA 3L43A 3E2IA 1U81A 2QP9X 3KFVA 4MGZR 3AVXA 2QTHA 1YJ5A 2QN6A 3OIYA 4IDHA 3ZS9A 2FG5A 4Q4LA 4ZKDA 1NVUQ 2WJYA 2XJ4A 1ESMA 3J81k 3A1VA 3KL4A 5EE9A 1FL9A 3IHLA 2P5SA 3PEUA 3CRQA 4G5GA 1J8YF 4TWZA 1KOFA 1U0JA 2PX3A 1QHGA 1TF2A 1XZPA 4URZR 1Z06A 4MRSA 4NDZA 2YWFA 3CIOA 3CKLA 1UDXA 4M9QA 1P9NA 1SZPA 2WKRA 3N70A 1XB2A 5J47A 2FNAA 2UZIR 3RS3A 1SVSA 5FOSA 2RKOA 4CEJA 3CB4A 2IYLD 3BOSA 1YZQA 1CBUA 2B7CA 3U3MA 2ONJA 4I1OA 4WZBE 2JLSA 4ZCMA 2VLIA 4V02A 1O3YA 2CMKA 1RC8A 4UXIA 2DFNA 4HAXA 3SU8A 1US8B 4NHOA 3QXJA 2QI9C 2OBMA 1MO5A 2ZU6A 3VR1A 1IJFA 4PHHA 1OKKD 2GKSA 4TL6A 2QE7A 1HA3A 2GEUA 5DN6A 1XEWX 3P1JA 3W8RA 3L0IB 2WAXA 3THOA 2IYZA 3RC3A 5H68A 1WMSA 1T8TA 4M1TA 1WXQA 5TXGA 1CLUA 1C4OA 3U2QA 5GJWC 2HEIA 5EUMA 3M1IA 1W2HA 3GFOA 1L4YA 3VTKA 4HB4A 3MWKA 4P0TA 3FGNA 4C0KA 1VYTA 1H8HD 5JSZA 1QHIA 1OH8A 4PQYA 1NN1A 1QHHA 2P0EA 4CZ2A 1G5TA 3A4MA 2FFBA 1PUJA 3HR7A 4MKGA 2QPAA 1S2MA 3BFXA 3H84A 2FSIA 2R65A 1OPXA 1ZIOA 3P4YA 3C15C 1ZM7A 2ATVA 2XX3A 4B3BA 1KDRA 1MRNA 2CEAA 4NU0A 3ADBA 4QHYA 1GKIA 1XD2B 4KV9A 2MMGA 1KNQA 2WWWA 4ABYA 1E1RA 3WNDA 2ORWA 2CL0X 3W90A 4AD8A 2PZGA 4P32A 3CWQA 4QGGA 5DLQC 4KAXA 1G5PA 4BGDA 4EJSC 4EKDA 2JJ2A 2ORVA 1PLKA 1UEJA 1VCMA 3CM0A 3SYLA 1P9WA 2J46A 5AWFC 4HDOB 1N25A 3TSZA 3CRRA 4V0NA 4LJ8A 3OEED 4LV6A 1Q21A 4NYJR 3KQHA 2F43A 4ZO4A 1Q3TA 2FFAA 3OZXA 3IPXA 3RABA 4A92A 4TTQA 1JJVA 1KDPA 1KSGA 3KTAB 2P3SA 4W5JA 5EP1A 1KZ7B 2RAPA 1OFUX 4WZ6A 1A2BA 2IYWA 3SHFA 4FD2A 1OB2A 3B85A 1GNQA 1A82A 4GOJA 1LF5A 1E0KA 4I81A 2J0VA 2O5VA 2ZJZA 1S8FA 4C30A 4Q01A 2GCOA 2ZI4A 2ZRAA 1D6JA 2A78A 3KXKA 3S1AB 3SBDA 5KSPA 2Q3HA 2WKQA 3U6BA 2OZEA 2OM2A 2OUKA 4CVNA 3PENA 2C96A 2RGEA 121PA 3UIEA 4JL8A 3MFYA 2K5UA 3ONWA 2JLQA 4QBFA 2CNWD 3U3JA 1GL9B 3KKPA 1UKZA 2RGDA 4DCTA 4B3DA 4HDQB 4IOJA 4O2LA 3DM9B 1FQJA 1HEIA 4P4UA 3M0EA 2BIFA 4M9XA 2FSGA 3E70C 2GXUA 3VR2A 3RVBA 4CF7A 3TLXA 3ZVMA 3O8RA 1NP6A 4BLOA 2BKEA 2GZAA 1COWD 4TMZA 3TNFA 1KK3A 5J40A 3NDPA 521PA 4FWTA 1D9XA 4UXHA 4BQSA 3Q5DA 3EZFA 1XMVA 4XOIA 1K5DA 1R0YA 2H8KA 4EFNA 1KDTA 4NONA 2FA9A 4UNSA 4B3GA 4ZDIA 5LPNA 1ZM3A 1BMFA 1NLFA 1II8A 1NMXA 421PA 3FMOB 4RJLA 1XTJA 2VF8A 2GAAA 4I1VA 3SZRA 3K70C 1S9DA 2RH5A 3SS8A 2QPOA 1W4AA 2PBRA 4DLUA 3AVYA 3PJRA 1E2GA 3ADKA 3I92A 1RW4A 2WJHA 3KJEA 3AUYA 1VG0B 4OHXA 2WHXA 3HPQA 4R98A 1NN5A 4B35A 4RD4A 2F6RA 1V43A 4B34A 3PR1A 3X2SA 1F48A 1GVNB 1U0LA 2PJRA 2X77A 3UWOA 1NN3A 4B3XA 4CYMA 4TN1A 4AG6A 4ASUA 3W5IA 1NVWQ 3VR3A 1X1SA 2H5EA 2KSQA 3AVWA 5KSOA 3IO5A 2EVWX 3B78A 2Q9CA 5IT5A 1E9RA 1U8ZA 4V0KA 4Z54A 1GM5A 1D2NA 2WWGA 2PCLA 4Q47A 3RRMA 3BFKA 2QQEA 4C0SA 3RRZA 2H7VA 1N5KA 3WY9A 3EIHA 1ANKA 3EPHA 1OSNA 5A0FA 1ZBDA 1ZYUA 3WMFA 1UKEA 3LQRA 4Q9JA 2FWRA 3GLGA 1NVVR 1CR0A 3LWNA 1TQ4A 3WYFA 4ZIRB 4EPRA 2G77B 3NIBA 5FTKA 4PZLA 2QEQA 1CU1A 1OIXA 4ZIRA 5G40A 1OXVA 3BJIC 2J87A 1R5BA 5JHGB 3A37A 3KB1A 1Z6XA 2IS6A 1SXJC 4Q1FA 3QF7A 1SXJA 2ZRKA 4L16A 4Q03A 2R6CA 1AZSC 2F1RA 2AD1A 2VPPA 1OFTA 1XDBA 1NY6A 1M1YE 1QF9A 3OFND 1IBRA 1JECA 3U61B 1W2GA 1XZQA 2ZR7A 4Q19A 2VA8A 5CIQA 4A82A 1DPFA 2PX0A 2ZJAA 4FMDF 4HAUA 3ZVLA 2OXCA 4IVQA 1UBFA 3AF4A 3KJIA 2FOLA 5FTJA 5HR5A 4FMDB 4QBGB 2F9MA 4RFSA 1XD2A 3IGFA 4IFEA 4NYMR 5KHOC 2JLRA 5ANRB 3MGCA 2XNDD 4US0R 3UXMA 5EE1A 5CITA 3R8FA 4Q4HB 1FX0B 4GNKA 4AIIA 2IEZA 1EFCA 4HB0A 3U7GA 1X8LA 4H9GA 1I2MA 1TX4B 3EWAA 4FWIB 4QNRA 2KE5A 1V5WA 3D8BA 4Y0VA 1Q0UA 1Z07A 4JIMA 1RYHA 3H2YA 1WRBA 1ZUNB 1LS6A 1LB1B 4MGYR 3QXSA 1P62B 5AJZA 3CLVA 4Q9KA 2KB0A 4B76A 1N5JA 3IUYA 4PC3A 2BBSA 2C5LA 1J70A 3L8ZA 4RZUA 4MRRA 5P21A 2BM0A 3FB4A 3C5HA 3Q72A 4BFYA 1VG1A 3PUWA 4C3ZA 3UK6A 3THXA 1TQ6A 3A1TA 2QU8A 1B0UA 1QRAA 1ZD9A 2J7PD 3PCRB 2YOHA 1SKYE 1NBMA 2IEYA 4Q1EA 2OG2A 2VSFA 2ZI5A 1EWRA 5CIWA 1E79A 4TZ0A 4KO8A 4OKSA 2OCAA 3ZZUA 2GNOA 2HDNB 1IM2A 3ASZA 4HDCA 4LPSA 4A2WA 1S1CA 2VHTA 3W6NA 1W44A 3R9XA 4PX9A 4Z1MA 1FUUA 1KAGA 1D5CA 2DY1A 2VHCA 4TMXA 4NYIQ 4GOXA 1QZXA 3HDTA 4CDGA 1XCMA 3ZDQA 3TRFA 2JLZA 4RD3A 3RNLA 3OE7D 5EQTA 3PUXA 3P26A 2QNRA 3THWA 2ZROA 3T1VA 1LS1A 1CIPA 1X8JA 2BMEA 1HQYE 2DFKB 2JLYA 2QORA 1EGAA 2J41A 3WNBA 4B73A 4Z8XA 1TAGA 1LTQA 2ZI9A 3IIMA 1XCGB 4EIWA 4L4UA 2LKDA 1UADA 4V0LA 4XSGA 4Q9LA 4QJ3A 2HYIC 5IK2D 1G1MA 2OEPA 3ICQB 2G0TA 4C0JA 2XSZA 5KDLA 4ON9A 5JZVA 1NJFA 2J9RA 1TUEA 3JZMA 1JEDA 2FEMA 2ZRNA 3RHFA 4EDHA 2QY9A 2EYUA 1P2UA 4OJKA 1ZNYA 4Q9IA 4JLOA 4QBIA 1N6KA 1CKEA 621PA 4D81A 3PV0A 1LY1A 1R8QA 3PEYA 1G8HA 3K1JA 1G3MA 1KJYA 2ZRPA 2FPKA 3C5CA 4NKRA 2YWHA 2HT6A 2SHKA 4D4LA 4QRHA 1Z6AA 1AS2A 4Q4JB 4DEXA 3WNCA 3DVLA 2OCYC 3E1SA 3GJ6A 3QBTA 4F91B 1ZC3A 2WJVA 1CR4A 2IUTA 4B47A 4WIAA 2CCKA 3QSYA 3SJBA 2I4IA 4GFDA 1YKSA 4DT1A 4DDUA 5JJLA 1ZNZA 1G8GA 4KODA 3A1SA 1G3UA 3THYA 2WOJA 2QM8A 2VF7A 3DZ8A 4LYJA 3U3KA 1JQLB 2H18A 1ZCBA 1G3IA 2ZE6A 3MLEA 1IHUA 1XF9A 2VEDA 1AN0A 2KI5A 1LV7A 4EAQA 4F92B 3QPWA 2QRNA 3DEFA 3DMNA 4LBWA 4WAUA 221PA 3R8CA 4MGIR 3VX3A 4YONB 3VKWA 4AYTA 1TL7C 2J7KA 2QAGA 4WXPA 2QGZA 3SJCA 2I3BA 2J59A 4Z8YA 4NYJQ 3WHLA 1YR8A 1ZMXA 3Q85A 2JATA 4DWJA 3U4QB 4B3CA 4BRUA 5FUVA 4UKDA 1DBSA 4D4MA 1E0JA 2WTUA 3LVRE 2N1BA 3H4MA 1SXJB 2R6DA 3LBIA 1KO5A 3ZJYA 1SHKA 3LBHA 1WCV1 1MV5A 2Y8EA 3TMKA 5HZHA 1E98A 3K70B 2BHRA 5BWMA 2PLFA 4PXAA 3FKSA 1JAIA 3B9QA 4FXPA 1R2QA 2D7DA 4V03A 5DHFA 1PLJA 1E2KA 1RFLA 2VP2A 4D2IA 1T3HA 3C14C 1RE0A 4PSVA 3B1ZA 2ZVPX 5TMPA 4C7OA 3R9IA 4N1AA 4PSKA 4NYMQ 4WBSA 4A2PA 1N5IA 1YRBA 3BORA 1OYYA 1SKQA 3QF4B 3DKVA 4Q4HA 1KYIA 4D80A 4L15A 4GRAA 2BDTA 1ZM9A 1G5RA 5KNCA 3X1DA 3SYKA 2AFIE 4TLBA 1ZC4A 1KI6A 3AUXA 1ZCAA 4TTPA 1ZM4A 4MYTA 1NLZA 1SVLA 2G1JA 1CTQA 3ETLA 3DM5A 4G5SA 4HAWA 3RWMB 3KX2A 4XD7A 3GEEA 2GXQA 2ZR0A 3QXCA 4DCSA 1ZNWA 4ZCLA 2KJQA 1Q1BA 4F93B 1P2SA 4JVNA 4OHWA 1QBKC 4BFVA 4LY6A 3DDCA 3I61A 4ZKEA 2QP3A 1IJEA 4ITRC 4ARZB 1BS1A 3RYTC 1KMHA 3K0AA 4LUCA 4X8OA 5FBVB 1RRCA 4D4JA 3G5UA 3K0AB 4BLTA 1DAKA 1J7KA 2ZSBA 1E0SA 1G4AE 1G8PA 1XD9A 4MITA 5AUOB 4A4DA 2EU8A 1W36D 4HAVA 2XTZA 1DAMA 2E9SA 2EQBA 2X1VA 4JSTA 1KIMA 2RMKA 3NBYC 2YWEA 1QG4A 1E2IA 1TMKA 2ZYVX 1AKEA 1E32A 3BH7A 4MRNA 4UJ3A 4JSYA 4EPTA 3RLFA 3OF5A 4TL7A 1A5TA 1G3QA 4KLNA 1GP2A 2BMJA 3DO6A 4DUGD 4DC9A 3Q5EA 3HWSA 2UKDA 3PEWA 1CRPA 2IHYA 3CUEF 4AKGA 4TYWA 3FVQA 5JMTA 4JYBA 2QM7A 2IXGA 1UFQA 2G9NA 2IBMA 1NG9A 4KCGA 2JLWA 3PIRA 1CJUC 2C78A 4JLJA 4UNNA 3B1WA 4PO1A 4GDFA 2CLDX 2DPXA 1XRJA 4H1VA 3LDAA 3QJYA 4E03A 3BC1A 1G9XA 4AYXA 1RRPA 4BE7B 3OEHD 2QT1A 3IQWA 4KVGA 1G291 3T35A 4JLKA 2A30A 3KKMA 2DWQA 1UBEA 2HLDA 1WBBA 1E2DA 2Q9AA 1IXSB 4PANA 1KI6B 2PT7A 4P4TA 1IN8A 2O8BB 2BEKA 2IXFA 1TEVA 4TMVA 4KVAA 4C0HA 3TSWA 4M21A 3TJZA 2PLRA 1GITA 2RCNA 4XWAA 2GZDA 5LD2C 1BIFA 1DADA 2PZEA 3Q9LA 5CDFE 3KQNA 2V7QD 1F2TB 1W4RA 2ZU0C 1RRFA 1FTNA 3K0CA 1EESA 1E2NA 2GAOA 4OQFA 4RD6A 3JVUA 4D26A 2BBTA 1W49A 3QIAA 1KK2A 2GETA 1P3JA 4HAZA 1G20E 4I4LA 3MRSA 3NHBA 3QBVA 2Z0MA 1Q1QA 2PJZA 1Y3AA 2Q9BA 2CBZA 4MA4A 5KPDA 4CEIB 2HV8A 2Z4SA 3QF4A 2B92A 2C03A 3K09A 4JL6A 3TW4A 5CJPA 5C46F 1KI7A 2WJIA 3VHXA 3AF1A 5CK5A 3UMFA 2KBEA 3QG5A 1HV8A 5GVSA 1E79D 4JKIA 2HJVA 2Q6TA 1TU4A 2EFDB 3LXXA 1PJRA 1OW3B 2C95A 1U90A 1Q22A 1YU9A 2XJ9A 1II9A 3I73A 2YOGA 4RFVA 1DO2A 3HU2A 2OBLA 3F0TA 3LX8A 4IOKA 4QHSA 3CH5A 1C9KA 1YZNA 1Z6GA 4DLRA 3QKSA 5GJVC 4DHEA 3K9LA 2R6AA 3EC2A 2JJ8A 2R44A 3K0CC 2C04A 3GJ7A 5F9FA 2ANBA 3OE7A 4JLDA 1NBME 2G1KA 2GJ8A 5L3SA 4C0LA 2WVJA 2VP4A 1CP2A 1PZNA 3UG6A 1EK0A 4DCNA 1U8YA 4RZXA 3KDSE 2H92A 4FCWA 1KZGB 2CVHA 1QHXA 4W9MC 2DCUA 4LOAA 3W6PA 3EZ6A 2GJ9A 2ZRBA 4E22A 4DB2A 1FQKA 2WWFA 1XEXA 2XSZD 4C0AC 4C2TA 2QTFA 3U7HB 3GJ3A 3AH8A 5JS7A 3TIFA 3GQBA 2ZI3A 2IK8A 2J3EA 1R8SA 3SHWA 1U9IA 5EZ6B 3Q7QA 1XTKA 3NH9A 1WF3A 3A36A 3F3YA 2DWOA 5EXPA 1HQCA 2CE2X 3BXZA 2VP0A 5FPYA 3ZYCA 3GD7A 1VG8A 1L2TA 4X8LA 3CZQA 1SVOA 3VU9A 1Q1EA 4NMMA 4PHFA 2GILA 4R7ZA 2CHVA 4HAYA 1K5GA 2FSHA 3K70D 1M74A 2BJWA 4NCHA 2ZSAA 3DKPA 1TF7A 1F6BA 5ELXA 2HCBA 4OQXA 4RCZA 3AKDA 2HCJB 2XZPA 3I62A 5JWHA 5FTLA 5DH9A 2YOFA 1W7AA 1EG7A 3NBFA 1FMLA 4PZZA 3FOZA 1YR9A 3R20A 4AC9A 3THXB 3GLHB 3H1TA 2RGNA 3NKVA 3TKLA 1R0XA 3QNUA 2JLVA 3GLHA 1W4BA 2OAQ1 3TUIC 2ZRIA 3H0KA 5DSZA 2DHRA 1JAHA 1XFAA 1VG9B 2JJ1A 1E2FA 1VHLA 3QXXA 2QENA 2ZPTX 3MG9A 3MMPA 4POAA 4FMBB 4C0QC 4IOLA 4TL8A 1KDOA 4WOPA 3MWYW 4NPHA 1GFIA 1NKSA 2ERXA 3EWSA 1KO4A 4OQMA 4IHQA 3NHAA 4LCBA 4G5QA 3D3QA 4AK9A 2AR7A 3P32A 1E9CA 2QSZA 3N5CA 2Z5FA 4M53A 4JMPA 2BM1A 2XAUA 1VTKA 1N0UA 1WE2A 1G18A 1L8QA 4EJSB 4BWYA 3EPKA 2ZQ5A 3VNVA 3IEVA 1GRNA 1ODFA 4Q18A 2C2HA 3VX4A 4LWZA 4G1UC 4IJMA 1EX6A 4IVRA 1TTTA 1EFRD 2GXAA 3U6KA 4BLPA 4AKIA 2CK3A 3QENA 1UKVY 4BFTA 2ZSDA 2EWVA 4YDSA 1KKLA 1P6XA 4TSFA 2ZITA 4AYWA 1AZTA 1NSFA 1M7BA 2O8EA 1JPNA 2F3TA 3QE0A 4HEJA 1G6HA 3CNNA 2WKPA 4PC2A 1ZVQA 2W2XA 3K0EA 3T61A 3TUZC 1QHSA 3B6EA 5SZJA 4ZI2A 1IN6A 5EXXA 1G17A 1EFHA 2ZYTX 2TMKA 2I1QA 1CR1A 2NO6A 1KAOA 4YMTA 1GDDA 5SZKB 3CO5A 5SZIA 5E7MA 2D62A 2NO1A 1DTSA 3C4JA 3EXAA 1OH7A 1VECA 3BB3A 4QKQA 5DGXA 2GBLA 5F9HA 4B2PA 2NQ2C 2XTNA 1JNYA 3BK7A 1IN5A 1G4UR 1KNXA 3WRYC 4EQ6B 4XVQA 2B7BA 3WBKA 2C99A 4PQFA 4IW3B 4DB4A 1EFTA 5IDVA 4IEIA 3BH0A 4M1OA 1DAEA 4YDHB 1R4AA 3BH6A 2IWRA 4DLZA 1FNNA 1QHNA 2OT3B 4FN5A 5CM9C 3PQCA 5KU1A 3ICEA 4FMCB 5E3HA 4PO8A 1XBTA 2O8BA 3PG5A 1FTSA 4WW0A 2IF2A 2J0UB 1AQYA 3BS4A 4D0LB 1NF3A 2AHOA 4AKEA 2YYZA 3B1XA 3EG5A 4MKIA 4RSGA 4AKHA 1NKTA 2A5JA 1PV4A 2WAYA 4IFBA 2REOA 1ZRHA 3GFPA 1OH6A 3OIWA 1XP8A 3GLIE 2V54A 1DG3A 1VIYA 2A5GA 1E6CA 2DR3A 2ZUBA 1T3LA 2EYQA 2WSMA 2IUUA 1C1YA 2A5DA 3JVVA 4F7WA 3K53A 1KSHA 5DN6D 5CK4A 1E94E 1ETUA 2CXXA 2O0KA 4JT4A 2OHFA 4KLZA 5E95A 1VCOA 5JWOA 1SXJE 4HLQB 4IRUB 1MO6A 4B6EA 5B2ZA 1Z0IA 2C8VA 4K81B 2VHQA 3TAUA 4Q02A 3FMFA 4JLBA 1KJZA 3ZD6A 3RRNA 4FCVA 4LK2A 4MYCA 1GNPA 3FPAA 3QVVA 2QT0A 4JLVA 1FUKA 1XJ0A 3BRWD 2CCJA 4MYHA 1S96A 4M1KA 3RAPR 2CJWB 5AUNB 1VKJA 1KI4A 5DI3A 2A7QA 2GEDA 4LBYA 3ZVRA 1IQPA 2GF0A 3L0OA 3GPLA 1BYUA 1MO3A 3VFDA 3WMGA 2A3RA 3L0PA 4BEJA 1E0AA 4LSGA 3GJ4A 4DIDA 1BYIA 3OIVA 4RD0A 4TT3D 5BXQC 1M2OB 3U44A 4WVFA 4URVR 2JCSA 3WP0A 1P2TA 5HKKD 3GMTA 1Z0DA 3I1FA 4DDTA 2FFHA 3U44B 2NGRA 3CF2A 1XXHA 3A8TA 4DLVA 5JCZA 2OLKA 1N5LA 2H1LA 4MH0R 1GNRA 2OO7A 3SBEA 1NMZA 4M22A 4KFSA 1U9IC 3FTQA 4G5OA 2AL7A 4BLQA 1Z0KA 2P2LA 3CPJB 1AGRA 3FYHA 2D06A 2FPMA 2N42A 4S2EA 4PC1A 1OLOA 2ZRMA 1G8YA 2NO7A 3N2IA 2ZRLA 3IQXA 5EP2A 1S3SA 3DL0A 1Z28A 3FHOA 2NMVA 2AWNA 4OI0A 2OLJA 4U5XA 1TU3A 3UMRA 3REFA 3GJ0A 5BN3A 2WBLC 3GJXC 4UJ5A 2ZI6A 4OHZA 1Z0AA 2O52A 1R0WA 1E9FA 2V6JA 4DCUA 2X19A 1II0A 2WJGA 3WBJA 2FE4A 1EX7A 5HTKA 4JLNA 5E4FA 2ZRCA 5JEEA 5AJXA 2BWJA 1E99A 2LCFA 2FFQA 1TQ2A 3MD0A 3GJ8A 2IW3A 2GA8A 4ESVA 4QM7A 1KI2A 2L0XA 1NIPA 1T6NA 4A36A 3TK1A 3VAAA 5B58C 2OFWA 4TYNA 1AJEA 1GZSA 1W0JA 2FH5B 2BOVA 4P4SB 4B33A 3A1UA 2BJVA 5JRJA 2JAQA 3W5JA 4Z1MD 2XZLA 2QG6A 2IF0A 2ODWA 4C4PA 4NH0A 3UWKA 3AVOA 3K8YA 4MRVA 4Q1CA 3LNCA 1KTVA 1KMQA 1CS4C 4LHVA 3IIKA 5FBWB 1X86B 2FSFA 2QL6A 2YC2C 3AV0B 4NTZA 4DSTA 4II7A 1TEXA 1W5SA 1L4UA 1MABA 3BBPA 4TQ9A 1JR3D 4Q7KA 3TGPA 1YZUA 3GLIB 1W36C 1E9DA 4DLTA 2CCGA 3NXSA 3NVAA 2IYTA 4QJ5A 4A8JA 4AWXA 5FOWA 3KZ1E 3GCGA 1UBCA 1W0KA 5AJWA 2ODBA 2QTVB 3UG7A 5KYKA 4JJZA 1IY2A 4BECA 4CEHB 1JBKA 5C2JB 3EIQA 4ZV4A 1ZP6A 1AS3A 5JI2E 2AD5A 3LBNA 4CRWB 4XWKA 5L8VA 2B21A 3HYRA 2IHBA 4UQOA 1KI9A 2WIAA 1AGPA 3BGWA 4PZYA 2DFLA 4V0ME 4XJXA 3BIFA 3WP1B 2ZAOA 2YVUA 3FHTA 3AGPA 1W46A 1S3GA 5FL7D 2W00A 4PPGA 5B30A 2GWHA 2WPDA 2MMCA 2IT1A 4YLGA 2RHMA 1UM8A 2QPTA 4UNRA 3ZIAA 4JLAA 3SJZA 1XD8A 1R0ZA 1FOEB 2NOAA 3AVVA 1NI3A 2W2VA 2BCGY 3TR5A 1RVDA 4PTLA 3TQCA 1KO7A 1UBGA 3QKSB 4WXRA 4RZ2A 5BN4A 2CK3D 3AF3A 5FUWA 1ZU4A 2JLXA 3AVQA 2ZUDA 3X1XA 5F2EA 3I32A 2O8CB 2EWWA 3WYAA 3SFZA 2P6RA 1G8FA 1E69A 2ASEA 5L3RA 1S4QA 1IN7A 4NCIA 1P2VA 2E1RA 3ZQJA 3LV8A 1E2EA 4Q4JA 2GHIA 2CHGA 4GT1A 3T06B 3UANA 1MRSA 3B2EA 3TUJC 5L3QA 3EA0A 2NZ8A 3DOEA 5E7IA 3JZAA 1H8EA 3B9PA 1M34E 3T5DA 2FGJA 3VR4A 1F2UA 1KHTA 1KY3A 2D3WA 1KSJA 4IDPA 3MJHA 1E9AA 3EZ9A 3P4XA 4JJKA 3PITA 5KDOA 2F55A 5DI3B 3EZ7A 5K8UA 3TR0A 1ZW6A 4Q7LA 2BBOA 4Q66C 3VQTA 3CRMA 3GEHA 3CX6A 4M1MA 2O0HA 2MSCB 1TUIA 1GIAA 2QQ0A 2Z4RA 1UKYA 1Z83A 2J1LA 3NH6A 4OYHA 4EQ6A 3IIJA 3RANA 2GCPA 4B71A 4ZDKA 5K8LA 3Q8XB 4A8JB 3T1OA 2FU5C 2IXEA 5CLLA 2A9KA 2AKAB 4ESHA 5TVKA 4AI6A 3CPEA 3I3SR 3GP8A 2VRWA 1OHHD 1EFUA 3QPVA 4ZDJA 1OIVA 4HUTA 4R2HA 5H1YA 3THYB 4A0GA 3DZDA 4IEEA 1ZAKA 5J4YA 1T5IA 1F5NA 4ERNA 4NBSA 2IYRA 4EPYA 1G6OA 3SQWA 1GTVA 5KSZA 2VHJA 2CNWA 2ZRFA 3BB1A 2EW1A 1YZLA 1MR3F 2R6GA 4PR0A 3NBZC 2V8OA 4HLDA 4U00A 3EW9A 4HUQA 4LC1A 4HB3A 4HATA 5BQ5A 1Z0FA 3L0SA 4L9SA 1NBMD 5CB6A 5J4KA 3P20A 3QY0A 2OBNA 1N6LA 2ODNA 5KO2A 3HJNA 3ZZ0A 5LDDC 2GVZC 3AP1A 4G5RA 3SDZA 5JLJA 4C9BA 1R10A 5DHAA 2VP9A 5KUTA 4JLMA 4LGMA 2XTMA 1DOAA 2JIZD 4BPBA 2XXAB 5LB4A 1ESNA 1MT0A 1QHYA 5JFGA 2FZLA 1X1RA 1H8HA 3F5FA 3CPHA 3RRYA 4PC7A 2QMEA 4D0GA 4I1UA 4QM6A 1I4DD 4MDFA 2OESA 4LHZA 3H86A 1XJCA 3B8HA 2FGKA 3LO5A 2AXNA 4KFRA 2V1UA 2IYYA 2YWGA 1Z6TA 4QGHA 4MUAA 1XNJA 2WSSD 4Z51A 3QKRA 5L3VA 4V0OA 2ZRDA 2PCJA 2YNMA 1XTRA 1T0HB 2VYFA 5FL3A 3VKGA 5DYGA 1R6BX 4URUR 2GZHA 1E1RD 3U7EB 3OFNA 1XPUA 1SULA 2QP4A 4JYCA 1JR6A 5F98A 1GWNA 5TDHA 4Q7JB 5JECA 3TW8B 5AJYA 2F1HA 2OCBA 2H57A 2X2FA 1CJTC 2ZYWX 4QOSA 4UNPA 3C7KA 4LJYA 2KWIA 4IDQA 1JR3E 5DO9A 3VR5A 1YVDA 2GCOB 3ZVNA 2O8FA 4HUQB 4LX0A 4D0NA 3ZIAD 2YC4C 2F1JA 2NIPA 2HXYA 4EJSA 1FFHA 1SQ5A 4MGKR 1RIFA 1KKMA 3LQQA 5GADl 2LKCA 2GCNA 2ZJ5A 4JLPA 3SNHA 4BFUA 2HUPA 3ZZTA 2G0NA 3FWYA 3KUDA 4GZLA 1KY2A 1P60A 1J90A 1Z8FA 2ZVQX 3HU1A 3IDQA 1SVWA 2C9CA 1YQTA 3A4LA 3CF0A 5GVRA 4DKXA 4KI0A 1XEWY 2A5YB 4I99A 1IOZA 1MH1A 4JBWA 2QAGC 1FMJA 3T1QA 3EC1A 2CHQA 3PFIA 4TT3A 2XOKA 4QHTA 5CM8B 4BASA 1A1VA 3FHCB 4KU4A 1KK0A 3C16C 1TNDA 2J7PA 2G6BA 3AP2A 1ZINA 4RFSB 4URYR 1G19A 3QQ5A 1IAQA 4G0NA 4PQRA 2ZANA 2P6UA 1XTSA 4LYAA 1Q12A 4DCVA 1SHZA 2AFHE 3IBYA 4EPXA 3TVDA 3EAQA 1ZUIA 4K8OA 3HU3A 3CBQA 2BEJA 1F2UB 2ZSEA 1NNEA 1JALA 1AIPA 4WA7A 1L7VC 5TV2A 4DIEA 1PVOA 2VSXA 2ZJ2A 4L9WA 3T12A 3LW8A 2R8RA 4DVGA 1W5TA 3QXHA 1JR3A 4O2RA 3ZD7A 4QGFA 4BFXA 3SE0A 1BMFD 4CEHA 1ZD1A 2VQSA 5G41A 1JXMA 4IVPA 4DXAA 3UKDA 2PMDA 1AS0A 1XU4A 4HLUA 4PAQA 2DWPA 4YMVA 5FPSA 3M4YA 1LVGA 4BLRA 2ZAMA 2PEYA 4XVRA 1W48A 2OSBA 3S1AA 4A1FA 2IYSA 4LJ4A 4YMWA 1P4SA 1YZKA 3CW2A 4G3XA 5EXSA 4CW7A 1VMAA 3GLHE 5KTYA 1DO0A 3OHMA 1N0WA 4LBVA 4M1SA 3HYTA 3WRXC 2IS1A 2JEOA 2LWIA 4MRPA 3AKEA 4CIDA 3NC1C 2W6JA 1JJ7A 5J4LA 3VHLB 4LYHA 1N6IA 1G7TA 4D82A 5FUYA 3EIEA 1N6HA 2QUZA 4JKYA 4PFSA 5JWRA 1EWQA 4TMKA 5G3ZA 1ZIPA 5CJ2A 1KK1A 5FL7A 1KI3A 5CYOA 1KI1A 1E9EA 2V9PA 3UATA 3TE6A 1QG2A 2WPDD 3FMIA 3RS4A 2D74A 4C7OB 4TMWA 4OK3A 4Q7MB 2W83A 3A6PC 5C4GB 4ZCIA 821PA 2GXSA 5DISB 5AR1A 4LDJA 3U5ZB 2NPFA 4OL0A 2JLUA 1XTIA 2ZSFA 3IILA 2AX4A 2FDCA 1NY5A 3KXIA 2QAGB 4URXR 1HH4A 3AF0A 4PAOA 5IK2A 1R7RA 2JDID 4ILEA 1FNMA 3KQKA 3LH5A 2AKYA 5DE3A 1IXZA 1GUAA 2GK7A 2ZR9A 1Z29A 4GP6A 4RKFA 1NG1A 5FBLB 1XXHE 2IC5A 1IONA 4LJ6A 5EUQB 1Y63A 3A58B 3HR8A 2G88A 4XTRA 1PLLA 1HY3A 3R7WA 2IS4A 3V9PA 3ZLJA 3OEEA 1G3RA 2IA5A 3X1ZA 1RYFA 2QMOA 1VCNA 5GJBA 4OQLA 2O8DB 4DBLC 4AG5A 5CLQA 5AUQA 1NSTA 4U02A 2UVQA 4IOMA 4TLAA 4R9UC 2ZIAA 2HLDD 3I72A 4ARZA 1FW6A 4DLWA 2CL7X 2BKUA 4OHYA 1VYVA 1Z2CA 1HT2E 4OQNA 3CR8A 3DOFA 3QI2A 2ZUCA 3FDIA 1NVXQ 1ZUHA 1E9SA 3EA5A 4TLCA 1E4YA 1FX0A 1T4GA 1ZD8A 1DS6A 4LJ9A 1UDWA 1OHHA 2BMDA 1TF5A 3T1TA 4EPVA 2F1IA 3EARA 2GF9A 2CJWA 2FEOA 2YJTD 2IYVA 1KGDA 4IDOA 2GVDC 1J2JA 3QVUA 2VIIA 2W2TA 1P72A 2ZTSA 2F9LA 1NRJB 1E2QA 1SKYB 3PUYA 1TADA 4O0MA 3RSLA 4CGZA 2J5XA 2ZETA 2J45A 2ZS7A 3TVTA 4OK5A 2XNDA 4Q00A 1XPOA 5FH9A 1VYUA 5HE9A 2ZRGA 1FP7A 3OIUA 2RGNC 1U0HC 5FR2A 1G21E 2YV5A 1P5ZB 3CR7A 4Q9HA 4JBXA 3ZQ6A 2GJAA 4DSOA 1YZTA 3AQ4A 3KKOA 3SOPA 5EXTA 4V0MA 4YQFA 1NVVQ 4DEYA 1I2DA 2BBWA 2O8CA 1M7GA 4NCJA 3ADDA 5K8IA 4RD2A 3ZS8A 3W9YA 3IPYA 1Q57A 2OXRA 5DI9A 3K0FB 5CYPA 3GLIA 3LFUA 2WM9B 3CX7A 4HZUA 2AWOA 4RD1A 2VTKA 4D4KA 1YHNA 3ASYA 2W6ID 1UEIA 4HZIA 4QC2A 2BCJQ 3HPRA 2OAP1 3T15A 4A15A 721PA 2WSSA 1X8KA 2MSEB 2YKGA 4QGAA 2B6HA 1DAHA 4KJZA 1R5OA 2GJKA 2ECKA 4TQAA 3GLFE 1Z6YA 5BN5A 1E2LA 1T91A 2ANCA 3T5GA 4DLSA 5KSYA 2JIZA 3L8YA 5EE5B 4M1YA 1J8MF 2KBFA 2Z6VA 4DT1B 2HF9A 4BLSA 3QEJA 1Q20A 3LVQE 1XXHB 3RWOA 3P27A 3AKCA 3AP3A 2EFCB 4AURA 1YR7A 3L82B 4O3MA 3TH5A 2RGGA 5TY0A 3QKRB 1DARA 2EFGA 3MUFA 4B3FX 1WBDA 1Q3HA 5J5CA 2OE2A 1MOZA 2VP5A 1OH5A 3NDBB 3EASA 2Z83A 1M6NA 5LBIA 3D31A 2F43B 4KBFA 4US2R 1SXJD 3E5HA 4DDWA 1ELOA 5JS8A 1KJWA 5IRCD 3PVSA 1OB5A 3FFAA 1E2PA 4L5BA 5LB2A 2WV9A 3LXRA 3NEYA 3AEZA 3SYNA 2AXPA 1X6VA 3MJRA 1KO1A 1RKBA 4QFMA 1D2MA 1XWIA 4BEBA 3DMDA 1S9HA 2RB4A 1HTWA 2CE7A 1BH2A 1G64A 2ZRJA 5C1BA 1G7RA 5L3SB 1P73A 2ODEA 1UPTA 4BFSA 4TYYA 3W34A 1SVMA 4HLCA 2HXSA 5EZ5A 4PAMA 4BZQA 1HURA 2B8WA 4FIDA 1LW7A 1VPLA 2EFHB 2H17A 2IYXA 2JJ2D 1G16A 3BD9A 5G53C 5BW8A 4Q1BA 5JCPA 4NYIR 5FI1B 2J0QA 1GILA 1T5LA 2ZE8A 2OCPA 3QEOA 5FR1A 2FPLA 2GK6A 4QJ4A 4QXAA 3KJHA 1BO6A 2FX3A 3LD9A 3ND8A 5CDFA 4DLXA 5JSZB 2BV3A 5G3YA 3U60B 4YXWD 3B5JA 1O87A 3I5XA 4M9ZA 4N0EA 2AK2A 5M04A 1OE0A 4FCTA 1GOTA 2V7QA 3U3RA 3QOFA 2DYKA 4US1R 1Z47A 4P3YA 3W8NA 1CR2A 2XB4A 2V1XA 1WP9A 4XVUA 4LJAA 4CEIA 5D3QA 1ZM2A 4PSAA 5H8WA 3KKNA 1YZGA 1XEXB 1IY1A 2ZJBA 3NBXX 3LX5A 3RDPA 1Z2AA 3RS7A 2REBA 4JVSB 1M8PA 5FPHA 1BKDR 3NWJA 5FUXA 3V00A 4B2IA 1S0UA 5HPYB 1US8A 4RY2A 1XCPA 4N3NA 2PMKA 5HCIA 5JI3E 3AVTA 2R2AA 2ZM5A 1GKUB 2Q3FA 2OFOA 4FW9A 2NO9A 2ZJOA 2RGBA 2QSYA 4HYYA 4RCYA 5EE0A 2WWYA 3BFVA 3D6TB 3DHWC 3MSXA 3NEJA 3VU9B 2QMUA 5EP3A 5H70A 5UKDA 5J4VA 2P6NA 1K6MA 1IXRC 3PXGA 1OXXK 2QMHA 2BMFA 1CEEA 3AF2A 1VDZA 3AGQA 3CNOA 2O8FB 1DAIA 2ZREA 4A6XA 4F4CA 1Z5ZA 3A4NA 5IF9A 2BVNA 2REXB 2FN4A 5FI0B 4MDEA 1LNZA 4UNQA 5FPTA 3UMSA 4YMSA 2NTYC 1QVAA 1OFIA 1QHHB 2RGCA 3IBGA 1W0KD 3VMFA 1AM4D 4NE2A 4LZZA 1FP6A 2FZ4A 3IHWA 1F60A 1JI0A 2DFTA 3O47A 3U3OA 4A8JC 4YMUA 4GL2A 2IS2A 4GP7A 3KXLA 3GFTA 2C9OA 5EP4A 3A1WA 1W4CA 1VIAA 2ZS8A 3B13B 3I4LA 4JL5A 5SZHB 2QAJA 4Q1DA 3WMEA 4W7SA 2VBCA 4IXNA 4CT4B 2G3YA 5JJKA 2ZEJA 2XB2A 3UPUA 1D2EA 2ZJYA 4L8GA 4RKEA 1ZNXA 2V6IA 4KITB 2QBYB 4DSUA 4BFWA 3RS5A 4OHVA 4YC7A 1HYQA 1OKKA 4IXMA 4MKFA 1Q1ZA 1N0VC 3PEVA 3QKUA 3LRPA 2V4ZA 2J0SA 2Q0HA 3KJGA 1P9RA 3OEHA 3TSOA 3GLGB 1Q44A 2ZE5A 2FF7A 4LV5B 1TQDA 1K8RA 2CVFA 1G7SA 2ZS9A 3ECCA 4Q5IA 3GLFA 1E1QA 2WWXA 1GAJA 4XSHA 2OILA 2VP6A 3RS0A 1RZ3A 1YE8A 4E09A 3NG1A 5F3WB 3AM1A 3CH4B 2WZQA 1CXZA 2DB3A 1JEEA 3QKTA 3OESA 2JGNA 3B1VA 4F4IA 1I4TD 2VH5R 4HLUC 3BWDD 4LHWA 1H65A 4OJQA 1N6OA 3HP1A 1EFRA 3CX8A 3PUZA 2IWHA 2WJJA 4QNMA 5BYJA 2F3RA 3G82C 2A5FA 3FFBA 1DG1G 1NIJA 4PHTA 3LAWA 3K0SA 4TSFD 4ZPXA 5TB5A 3IO3A 3ND9A 2XNSA 2WMOB 3O8DA 3SR0A 5IHPA 4Q4AB 1LF0A 3CONA 4BZXA 1H8ED 4NZYA 3FKQA 1X3SA 4TLDA 4B44A 1NLYA 3O8BA 5JRZA 4GPTA 5JJIA 2HF8A 3LA6A 4TMTA 3KQLA 2D2FA 4KFTA 3WHKA 4A0FA 1JXOA 4NL4H 2XZOA 4Q1AA 2ZYUX 2VL7A 3AVPA 4XTCS 3OAAD 5C18A 1E4VA 1D8TA 1XJQA 2R9VA 1MO4A 1LFDB 2FJUA 2P65A 3TBKA 3CRVA 4LC0A 1HT1E 4BFZA 4X8MA 4D6PA
chains in the Genus database with same CATH superfamily
4BKQA 1EFDN 3KSRA 5U9CA 1YR6A 3IUNA 3A14A 4M8NE 2YVLA 2BH9A 2NO0A 5CCXA 3GEMA 2JASA 3PWKA 5H16A 3G79A 2IX9A 1TPZA 4TYPA 5A05A 5TARA 1V95A 3SC2B 1FMTA 2RHDA 4XARA 1FTQA 3C39A 3P45A 3V6LA 3UFBA 4JKOA 1A9XB 5KOHB 2NW6A 3KT0A 5B64A 1ZXBA 1TTPB 3SM9A 3KYDB 2JGFA 1ZKDA 2HWYA 2DWUA 1R6XA 5DYNA 3W5DA 2YY5A 2C4NA 1BN6A 3QM1A 3H19A 4NNPA 2ZIZA 3TZBA 3QH4A 1FMFA 2Q99A 4OKNA 2QUIA 4YAOA 4F3NA 4CG1A 1CJCA 4Y6QA 3RBZA 1IB0A 4KYUA 4MYRA 1X1DA 1ONBA 4WJZA 1TJPB 1TM5E 2IZOA 4JDUA 4RZHA 3MLBA 4JZKA 2A2ZA 1AXEA 1IWOA 2I1VB 4E2FA 2H48A 3UC9A 1N9ZA 4PE5B 1NWHA 4P7JA 3K4QA 1PZMA 4QBHA 3K30A 2A8YA 1EM6A 1AZWA 1W8IA 4UEKA 2B4AA 5KIAA 1WBBA 2JS7A 4ZWNA 2FVXA 4H1UA 1BWQA 1CF9A 2W6JD 3V48A 2JG3A 1VKHA 4L51A 2DQKA 1MXHA 4YAGA 1Q6YA 4XM2A 2AOUB 5H0IA 5A4MS 4ALLA 1W52X 2QG4A 2IX3A 1E5VA 2CZGA 4BZZA 1Y5IA 3R75A 3OKPA 1J9GA 2MYTA 1OYWA 3UHOA 5DZSA 1JTFA 3UM9A 1PTJA 2C98A 4EATA 3IJPA 3SF8B 2K7ZA 3AVUA 1PX0A 1QGDA 1TOAA 3LQ2A 4REQA 1IMJA 1T6ZA 5F7XA 8MHTA 3C7CB 3K9GA 5DX8A 4S1NA 3QZUA 1TCVA 4ZTBA 1JZTA 2AMFA 2JHCA 5DVZA 1I7QB 4BCBA 2N75A 3LUBA 3C3EA 3VPDA 4EHNA 2IYUA 3LQFA 2FWBA 6AT1A 3OZCA 5LQMA 1XX6A 5JCJA 2PXAA 4YRTA 5DYIA 5B57C 3C3JA 5TGTA 2WVGA 1DBIA 3NV7A 3BK2A 1QVRA 1VQ1A 3TQFA 2PWYA 3HL0A 1Q95A 4FGSA 3KXDA 5J5AA 1VM6A 4GXTA 3CF6R 2XRYA 3R9WA 1GZ4A 1DT3A 3FCYA 3IP6A 3EF3A 2RGXA 2WFLB 4M6WA 1G8AA 2WWHA 4DY4A 5EWLA 1U5BB 1RI4A 3GHHA 1OROA 3D5QA 1J56A 5IJ0B 5ILQA 5IH7A 4JXXA 2VNHA 1MC4A 5DYWA 3BERA 4R71A 5EJ6A 5J63A 3U3XA 2ODAA 2R6HA 1TFUA 4IVNA 4ZK2A 1SK8A 2JKYA 3W3ZB 2J0UA 1BWRA 3WGQA 5J4HA 2R48A 4M9SA 1F9AA 2QD3A 3UFXB 1YRAA 4BB5A 4RVCA 4H3VA 1AKYA 3GPIA 3RI3A 1T0JB 4MWZA 1W5BA 1YIAA 4U9IS 1T5HX 2UDPA 2VCEA 4HNAA 1XMJA 1IY0A 2A9JA 4OLFA 4UUMA 3NONA 3L2OB 4FFPA 3KCNA 3KR1A 4OI2A 3QPDA 1H66A 1JIKA 2XYHA 1MV8A 2Y92A 1Y8CA 3FWNA 2R62A 2CL6X 5A4JA 1O96B 3ST7A 2HJGA 3AFOA 3E3MA 2AK3A 4H4EA 5KYVA 1X7GA 4GSYA 2G72A 4W5WA 1HF3A 1XL0A 1QRUA 1L7XA 2GYWA 3IOBA 4QTTB 1JKJB 1DELA 1W5FA 1EX1A 4N49A 4K9LA 2V97A 5B3AA 1E2HA 3NMUF 1AY0A 1G0NA 1XWFA 3SDSA 2ETVA 2F00A 4XCQA 5TEVA 1U8AA 3OUTA 4PYJA 2POCA 4Y9RA 4MK4A 4S05A 5KQLA 3II6X 2R7NA 3I6YA 4FHCA 5A71A 3QX3A 2JGLA 3B82A 1DDOA 2H31A 3PXCX 2VHUA 4I5GA 1PJZA 1JU9A 2P67A 4OSEA 2MSDB 2VNSA 4RA6B 3W7BA 2PQ6A 3F8TA 1HE1C 3W2GA 2WICA 4EB6B 1WU8A 4QDZA 1YAJA 4U2KA 3GA7A 5B4UA 4AJ4A 4JVMA 4EHIA 4CR8A 3QWHA 4DZZA 3DDSA 4Q21A 3EPRA 4ZCRA 2VDRB 4CN8A 2NZJA 1V41E 1QU3A 4KNYA 1N6PA 3OAAA 2X14A 3H8VA 2VF2A 2DEUA 3HH8A 4IMPA 3NDJA 2QA5A 5AUPB 1L8LA 4UZSA 3AZPA 4RVGA 4MDYA 3G0CA 4X61A 1CHDA 3C41J 4UFPA 2GEVA 3JAMA 5AK6A 2EP5A 3ORSA 3B53X 2Z43A 4J2TA 1AQUA 4KO3S 4N5HX 4U9UA 3QELA 3LUDA 3T7DA 3NC0C 4LHEA 1FYEA 4ND6A 1I2AA 4CQLA 1UJ4A 1OV4A 5JDIC 2VO1A 3HEBA 3K92A 5FORA 2CFSA 3FKSD 2R1VB 2R5NA 2UUPA 2Q5JA 1HLDA 3BMNA 3EK2A 1MX1A 3U4IA 4H60A 4X41A 4X6XA 4AG3A 3I8XA 4FKZA 4QO7A 4A2QA 2WUGA 4HQ6A 4EG6A 3Q6MA 2P2DA 4LHSA 1EFAA 5LLDA 3GW8A 3E81A 2IPLA 3L9XA 3ZXUB 1KETA 1U04A 2W6IA 5K8TA 2WVAA 2OAEA 4ODIA 3Q3JB 3VI3B 3MWJA 1TAQA 1Q0ZA 3QWAA 1M7HA 4RS4A 2OHGA 1UPBA 1NX6A 3ADCA 1V37A 2PL3A 2X8LA 3LHKA 1W36B 3NGMA 4LXXA 1E7YA 3AR3A 5B55A 5MN4A 3KKKA 1VHJA 4IDEA 4CMCA 4DA0A 4PTZA 1ZCFA 2FN3A 2OGUA 5CU7A 5DCUA 1USWA 2A57A 1YE5A 2BLNA 3C8DA 5DBOA 4N9QA 4ACAA 4DLNA 2VUUA 1PGPA 3EN0A 3FCXA 1ZVVA 1MZPA 3NBKA 3R5TA 3TI9A 5I7VA 1JVNA 1VL2A 1Z3IX 3ZLUA 3I5YA 4L95C 5JEDA 2BDUA 2B1GA 3OD1A 2XMDA 1E2MA 2FUEA 5FTNA 4KR2A 1LKZA 4L5CA 2AZDA 3AF6A 1OXUA 4HXEB 4HMQA 3Q8WA 4TQUS 2PAAA 4W4TA 4ZARA 1LGYA 4QUBA 5TS2A 4B31A 5INTA 5FLXA 1XZCA 1CHNA 4TUYA 3DMTA 3AWDA 2A0FA 4QE3A 2R86A 1EZ4A 2GTPA 1Z22A 3MFQA 4IDNA 5MGBA 1NXQA 5HUHA 1HQDA 3GG9A 4UDXX 1EA7A 4W9RA 1SY7A 4XR4A 1WDTA 4MMZB 5HIJA 2JDIA 1WKVA 1P6UA 1SKBA 3EZLA 4RPKA 5DEIA 3RVKA 1C4XA 4B80A 4X3PA 4PLWA 1MFZA 1I6LA 1XN1A 2EC5A 2WJ4A 4UBIA 4YJGA 1RBMA 3DP7A 4D3DA 1RQGA 2FCAA 3EHDA 4Q48A 1I0ZA 4GI2A 3LDUA 4BDSA 5A5DA 2YTZA 1U98A 4EELA 1Y3CE 1WSBA 4MHTA 2WQZA 4EECA 1ISPA 3UBMA 2HU2A 1VC2A 1Z37A 2DJ5A 4EA9A 5DRYA 1VP9A 1Q1NA 1W47A 3GARA 3SCZA 5LD2B 2QW0X 1WKBA 3QMMA 5DNYB 3WMXA 4FEYA 1OAAA 1EFLA 1WCIB 3P96A 4LAFA 2GB4A 3M6FA 4F56A 4CEJB 3PHJA 1QYCA 3C5EA 1L4NA 3G9TA 2VS1A 1Z0JA 4B87A 3KFLA 5LA6B 1RYDA 5K8JB 2C77A 1C7IA 2AC2A 5CH3A 4L6IA 3I34X 3T9DA 1MPTA 3KZMA 4GBMA 4EDFA 2NU7A 3DMGA 2V3CC 2WM8A 4N82A 3V80A 4QQRA 1T15A 3S2IA 1KAMA 2RHLA 5AKLA 2ZZKA 1KTIA 4MW0A 2YIMA 5EZYA 1QLJA 1K3TA 4M0DA 1HX7A 3WE7A 3DMYA 3MZ0A 1V1MA 2QLLA 2NZ2A 3CE9A 5G1OA 3T3MB 4N5IX 3VZDA 3PFKA 1P44A 1NULA 5JANA 2E6UX 5K6TA 4JR2A 4YAFA 3D1LA 4NFSA 2W70A 4ZTZB 1XJWA 2Y6UA 3QPUA 4FFDA 4MUBA 5C0OE 2IYQA 4EHJA 1NL3A 3DQPA 5IC4A 4KSBA 1EXMA 1N3LA 4FE4A 4P4SA 2O8DA 4E3ZA 1L9KA 1HT0A 2G83A 3BD6A 1MB4A 5HCNA 1FDVA 3E4CA 5LZ4A 4LV8B 4XFDA 5KPJA 5IVPA 4MRAA 1PSDA 3CRZA 4AY3A 5C53B 3N0TA 1A9SA 1HFWA 1V4BA 1OGIA 2IKQA 5BYKA 2O6LA 4WKBA 2X4IA 2UZ3A 1II8B 1N2CE 2HHAA 5DRTA 1AB5A 1WF6A 2QP9X 4BJ5A 3AVXA 2EKZA 3QOWA 1TKRA 2QN6A 5HCUA 5I7UA 2FG5A 2ZIWB 4GPZA 2Q3BA 2WJYA 4W7HA 3D2AA 4G84A 4U1RA 5TLSA 5CVCA 1QMPA 1ESMA 5BO5A 4YAKA 5I9BA 1IVSA 1D5WA 1WD7A 3OTHA 4I36A 2G5PA 2MYPA 3IKVA 3PEUA 4TWZA 1J8YF 1OA1A 3OZFA 1KOFA 2NWQA 3AI2A 4X1OA 3UAGA 1JB9A 1NXWA 3GLKA 1QHGA 3IUMA 5BMVA 5KTMA 4URZR 2YDXA 3I9NA 8AT1A 2YWFA 3GDWA 3K5IA 1HFKA 4HBZA 1SZPA 1KIFA 4IF6A 2ZVDA 1JN0A 3LLSA 3R24A 1JHAA 5E7QA 3OZWA 1Y5MA 4K6GA 4PRLA 3SEFA 3MOIA 2YRXA 2ONYA 3PFNA 1OVGA 4P2BA 3VO1A 5SYAA 4F8EA 2RKOA 2WWTA 1XAIA 3DVAA 3CB4A 3KBOA 4UEWA 2Q5CA 1BGWA 1RABA 1RLMA 2JLSA 4IIFA 1LK7A 2VLIA 1YFZA 5DM70 5JPDA 2NXJA 4GS5A 2WTAA 3G13A 3EQ8A 3WQBA 2JIMA 4UXIA 2DFNA 5U4QA 3EJ6A 3GLRA 1IBCA 1LQ2A 3W9UA 3TM5A 4ZN6A 3RVMA 3SNKA 4YXFA 4MUNA 4ZQEA 1IQ0A 3G2PA 4JOBA 4ETWA 4MV8A 1EBFA 4MYDA 2PYZA 2M2IA 3P7MA 1JMVA 1M2KA 1TVKA 1ZEJA 2P0AA 2WZDA 1HA3A 3BBLA 3U13A 1H3EA 1D2GA 1M83A 2IYZA 3FNIA 1JRLA 3QLUC 4MR8B 4YN3A 4D9FA 1CZKA 1Y9EA 4B7CA 4LF9B 4JP5A 5AVUA 4BVBA 3GFOA 2KPOA 2QLJA 2FP4B 2XCRB 3RGWS 2EARA 3IAM1 3L07A 1RZUA 3H5VA 3FGNA 4QYIA 2R96A 3F96A 3OPYB 3FPHA 4UFOA 4C0KA 1L4KA 3PE3A 1QHIA 4QODA 3JPYA 1OH8A 1QPGA 2GPNA 1NN1A 1QHHA 5I01A 2X0RA 2PA0A 3DZFA 1G5TA 1F4PA 3A4MA 3KU4A 4G0XA 3G9QA 2W22A 2PQMA 2NZWA 3HR7A 4BLUA 1Z8HA 2QPAA 1N2IA 3BFXA 5AKKA 1Q7EA 1SUAA 3FVWA 3TTWA 1BVHA 3TLJA 1C8KA 2R65A 2X7HA 1OPXA 4GNRA 3P4YA 4HGOA 1KYZA 4RYDA 2BGGA 1RRMA 2C2MA 2IVFA 2ATVA 3W2FA 5JATA 1KDRA 1LPBB 1QOPB 2CEAA 1EVKA 4NU0A 2BKVA 4ISCA 1ENZA 4QHYA 4ZXFA 1N2SA 1ZIYA 1FU8A 3OZBA 1KNQA 4HLNA 2BE7A 4IYJA 4K9MA 3STWA 2VSQA 4TXLA 3T3EA 3EXEA 2P9YA 2CL0X 4AD8A 2F4VB 2PZGA 3MJDA 2IY7A 2LGJA 1TYEB 3O94A 5FA6A 5TMBA 2YR0A 1DL5A 4BGDA 3HN7A 3WIBA 4KK4A 3OZIA 4EJSC 3KL2A 4EKDA 2DKOA 4EA6A 1VL8A 3V4SA 5BQ3A 4FFSA 1T4BA 3CRRA 2OO3A 4ZVQA 4LJ8A 2PMCA 4C43A 5B5SA 1NJSA 2R1TA 4IICA 2GKGA 2F43A 2X3FA 3F5DA 3RABA 5JXGA 1JJVA 2GYYA 2IGTA 3BKXA 3I6MA 4TXNA 5JMPA 5KYWB 3ZJUA 4QFDA 1K3FA 1TAHA 3EHEA 3WGUA 1TW3A 4IH1A 2FLWA 3QE4A 4EL0A 4KRFA 1ADBA 1GNQA 1NW6A 3B7PA 4BYGA 1H2HA 2O5VA 2ZJZA 1S8FA 3L93A 3EF0A 4C30A 5DBGA 3S1AB 1D6JA 2IUEA 3SYMA 4XWGA 1KGSA 2HDOA 2WKQA 3W5AA 2OZEA 3PENA 4B9EA 4DRYA 4RULA 3LUJA 4G8DA 2CWDA 3MFYA 3MUEA 5D86A 4E7OA 4PYLA 3RBXA 1I3MA 1F14A 3JCZA 4MCAA 4UE3S 4G4IA 3E22B 1GL9B 2BLLA 2FSPA 2JIPA 1CEQA 3PGJA 4O2LA 5HMMA 1HEIA 3AHCA 2BIFA 4DQLA 2Q2OA 5BR4A 3ROPA 3E70C 3M89A 4Z0TA 1DXQA 5REQB 1RI3A 5C32A 4RTSA 5ALIA 1DX6A 2YHIA 2BGRA 4KLAA 1G9TA 1PQPA 4IINA 1U2DC 4BLOA 3Q8LA 2BKEA 1X80A 2BGLA 5H9WA 1SAYA 4R3WA 1KK3A 2IXAA 2Z57A 3KLMX 3LZ6A 5J40A 521PA 5THQA 1CVIA 3HJHA 2WZCA 1ZHHA 3B9RA 3GN2A 4L3WA 4FFLA 4UXHA 3REQB 4BAUA 4BQSA 2PH7A 5TT0A 4XOIA 1A0OA 4PICA 1WR8A 1UOQA 5IMBA 4AZ0A 2ATIA 3MWDB 5LPNA 5JMWA 1VFPA 3V6MA 1HE4A 2ACKA 1W94A 4MIOA 3FFWA 2I76A 4IIHA 3M4ZA 3U17A 3OU7A 1SUDA 3PS9A 2QPOA 1W4AA 5MDHA 2CMFA 1PR6A 4IIUA 4DLUA 4YCSA 1WVGA 3PXAA 1YU6A 2J9FB 3I92A 3PI6A 4ONEA 3SBEA 1RW4A 3KJEA 3EAGA 3AUYA 4OHXA 3HZHA 5JAQA 5J1SB 4WLFA 4PX2A 2OB2A 4WXMA 1MG0A 2WHXA 3TEFA 4QQNA 4R98A 1A69A 1NC3A 1V43A 1YI8A 3OQPA 4MGEA 1GVNB 4QUKA 1J1UA 3UWOA 4E30A 1RVV1 4GI5A 3T5AA 1H05A 5L4NA 5LZ9A 3ZYZA 5TSDA 3CVYA 1NVWQ 1JLLA 5I48A 2GO1A 2P1DA 2XE7A 2EVWX 3WFJA 1ZSNA 3M33A 2Q9CA 3DBLA 4N47A 1E9RA 4IMJB 4V0KA 5CNMA 1GM5A 1O0CA 4PPYA 5FUBA 2JJMA 2YH2A 5KVSA 4FKMA 3ZHZA 4UOEA 4ME6A 4RJJA 1ANKA 2BONA 2OP1A 3DBVO 1CLEA 4O33A 4DOMA 2UXBB 1G21A 1UK7A 4HFMA 4IDBA 4BP1A 3BWCA 5AJTA 3LQRA 4DUYB 2CJFA 1YB2A 1DV1A 4EA8A 2FJPA 2AQ8A 1YC5A 2QX6A 3AOGA 1NVVR 1B6TA 2FQ1A 5KHAA 1TQ4A 4ZIRB 3F3MA 4TN5A 1FLDA 1G5FA 3NIBA 3UB4A 2QB5A 1C4KA 4WACA 1ECPA 1PG2A 2QUAA 3EGWA 3ZCRA 1R5BA 4JUDX 3A37A 5K4AA 4PLPA 3Q7IA 5A2GA 1QANA 4B3RB 2IS6A 1SXJC 4R01A 1SXJA 4DIBA 4RMIA 4X93A 3HXOA 4IP0A 2BTEA 1AZSC 4FNMA 4A26A 2AFVA 3M6XA 3IB3A 1PKXA 3QU4A 4MPDA 2XNJA 1NXPA 3KWMA 1XDBA 4V2IA 1N1MA 3QE2A 1JECA 1X2EA 4TSKA 5T64A 4RK7A 4MS4B 2OV3A 4FMPA 4MAFA 3WWPA 5KNDD 3BWBA 1QOZA 2V0NA 2QTGA 5ALMA 4KNVA 4NF2A 4H17A 2PX0A 4QOHA 4HAUA 6NULA 2F48A 1UBFA 3AT1A 2Q3JA 1FY2A 2F9MA 3K2IA 3VGPA 4F5YA 1ECJA 3PNKA 1YUBA 4TXJA 3ZE0B 5AQ1A 2A59A 4OHRA 2O5RA 3MWEA 3ZHVA 2ST1A 5EE1A 2H0QA 4K8RB 4BHTA 1OZGA 3L7KA 2H4FA 3R8FA 4Q4HB 1FX0B 1RAFA 2IEZA 1HYEA 2B5OA 2UYHA 2COEA 1RIIA 2HO5A 3O8OA 3EWAA 4IILA 4QNRA 4UZFA 2PUWA 4BS9A 1V5WA 1CQIB 3ABQB 1Q2UA 1Z07A 3EPPA 3CZRA 3PXBA 4MAAA 4RZSA 1UOEA 3H2YA 4LJRA 1VSTA 3DKKA 4IMIB 4MS1A 1ZUNB 4XGIA 1Y8RA 3CWCA 3DE5X 5AJZA 4OMFG 1GAEO 3UCEA 2KB0A 2Q4BA 4KXMA 1WNTA 2C5LA 4RZUA 3L8ZA 4BFYA 1H93A 4D8TA 4E5VA 3C5HA 1DC5A 1VG1A 2COKA 2V74B 4C3ZA 3D4BA 4B6QA 5JSQA 1TQ6A 3A1TA 1B0UA 1QRAA 4H0FA 3THXA 2Q07A 3ZHUA 5DM4A 3N59A 3QSGA 1GNSA 2IEYA 1NBMA 2AC4A 4Q1EA 1E7RA 2D2XA 2JF0A 1UZNA 3RTAA 2JFVA 1EWRA 3DAYA 4XCXA 1YL5A 1GZ7A 3PQ8A 4YREA 4KO8A 3VDQA 4TZ0A 1NMQA 1RS0A 4AW9A 2RAFA 4OKSA 4WSOA 2IPAB 2WA2A 1QJCA 3ASZA 4W7IA 2ZWIA 5CX1A 5BUCA 1E3EA 5MGNA 3D3NA 3DLIA 5IW8A 3QVOA 1W44A 2AE1A 3CJRA 3QVLA 3FBGA 1KHHA 3GA5A 5LKAA 1XT6A 2RCYA 3L1KA 2AQHA 2GD1O 1GPYA 1IATA 3V8RA 4LMAA 4U2GA 2VHCA 4TMXA 4GOXA 1YACA 3HDTA 2O14A 4ZVKA 4H08A 2PXHA 5K51A 2JLZA 4MW6A 3DFMA 3A2MA 2BP7B 2GRAA 3HJRA 1CDEA 1ULSA 3THWA 3N0XA 3NM6B 5AKJA 1B2RA 3A9SA 4IUDS 1V5GA 2O5EA 3V4OA 3K9WA 3T3NA 3CNQS 2OV1A 4XYLA 4H35A 1TA4A 3K7EA 3KYJB 4MZXA 2ZATA 1MX3A 2ZI9A 3REOA 2W42A 2J33A 2O0MA 3D64A 3L0YA 4UMVA 1Q7RA 2PVCA 1M6EX 1KPIA 2OEPA 2Q5IA 4X3CA 2XSZA 2FTKE 4IDAA 4BEVA 3GH1A 4DM7A 3WSVA 3F6EX 1QIFA 5DCLA 1EXVA 3G2OA 3RHFA 3U5TA 2VRCA 1LX7A 4DV6B 1IEQA 4PR3A 5MN5A 5GONF 1U8CB 1CKEA 4IJWA 2UU9B 1X7HA 1FYVA 5KQGA 4YUVA 4D43A 3OU2A 4D81A 1LY1A 2ECFA 3BWYA 5FLKA 5IUJC 2GAFA 3P5BA 1IWBB 1ITZA 3PGA1 1KJYA 5G0WA 2FPKA 3F6SA 1GLVA 3N7TA 4I9UA 4NKRA 4J0IA 3HYSA 4KTTE 4BGVA 2AVDA 4OA8A 4RH0A 4JQYA 4AUNA 4DEXA 5CFZA 1BW9B 4MW2A 3JD3A 3E1SA 4F91B 3SX0A 1B74A 2CCKA 5ALUA 4DTIA 2Q5LA 3H8WA 3VPBA 1HDZA 3G68A 13PKA 5IBQA 2I2DA 3ZNPA 3MMXA 4DT1A 2EQAA 1WB4A 3K94A 4HVCA 3D3KA 2AA3A 3A1SA 3C7TA 5CVEA 1WAMA 1P81A 3H42B 3THYA 2QM8A 5GGYA 1KWGA 3DYIA 3GNSA 4LYJA 5IEBA 4D9CA 3U3KA 5CDYA 3V8BA 5L53A 1YL6A 4WJKB 2RFLA 2HRCA 3STHA 1V39A 4AIRA 4ZMSA 4LXYA 3UGKA 2FX5A 1OASA 3AR9A 3EXG2 1U02A 2BR5A 2YZMA 3DEFA 3QLVC 1E2BA 2CFTA 1Q0HA 2ZCJA 3DE7X 1ORVA 4WNAA 3EY4A 3M6MD 4ZT7A 1SQSA 1T5OA 4GYJA 3O83A 4WXPA 3W6UA 1YQQA 3DP9A 2JAXA 4RY8A 5FNVB 2J59A 3K72B 2AUNA 4KAFA 4RYLA 2XOXA 5F7ZA 4BMCA 2JATA 4ZP1A 4JI5B 3D59A 3OC6A 3HXLA 1YR3A 1CE8B 3CKMA 1BJKA 4QLOA 3KAQA 1HC7A 3RJZA 4BAGA 4D4MA 1TA9A 3NI2A 5J2TA 5JTTA 5DP1A 4BVKA 4RLFA 1GZ5A 5GOZA 1KEEB 2N1BA 4LOLA 4ECEA 4ZI7A 5JFTA 4BNDB 4DR2B 1FFAA 3UY4A 3UN1A 1FTWA 5D85A 4OOFA 3LBHA 2Y8EA 4B6OA 5IYZB 5DM1A 4NENB 1C1DB 1XZBA 2BHRA 3PL1A 2PLFA 1KEWA 3PWSA 5TQ2B 3DDOA 1GKKA 3RVOA 1QK4A 1V1RA 4CM9A 3OZAA 1OZHA 2FRVA 3L05A 4NY1A 1RFLA 2INGX 3D5TA 3BEDA 2VP2A 3UJCA 3QMPA 4D2IA 2HK8A 3PXEA 1GV1A 4ZVPA 2V0GA 3B89A 3ZWKA 1VOTA 4FZRA 1QB8A 2ZVPX 2P7HA 3L84A 1QPBA 5DNCA 1SBNE 3U16A 4NYMQ 5LJLA 3FPEA 3R74A 5B3JA 1O7JA 4YA6A 4HUJA 5HRUA 1E63A 1V25A 4Q4HA 1KYIA 1GPKA 2BDTA 2E18A 3FSEA 1GD1O 4O02B 5KNCA 1MO2A 4LQLA 3X1DA 3SYKA 2A4KA 3AR6A 3PYLA 2VN8A 4BNIA 3X43A 4A16A 1KI6A 2QN3A 3AUXA 4D5GA 2QLMA 4MYTA 1NLZA 4WRRA 2G1JA 1QG0A 4N76A 2XHZA 3ETLA 3DM5A 4K6OA 4XQCA 1YDFA 2GTHA 3KX2A 1VE3A 4XD7A 3U1VA 3X44A 5IZCA 3GEEA 2A14A 1LDNA 2GXQA 4AUKA 3E6AA 1TCCA 4LZWA 1MZVA 4RPLA 2KJQA 3RUCA 4F93B 1Z17A 4RFLA 2QX9A 1U80A 1SU8A 3D3JA 1R37A 1WVMA 3AXSA 5DTJA 3QBJA 1FYWA 1E3DA 1IM8A 1G42A 2LV8A 4LY6A 3Q1KA 1RQ2A 2CNDA 3G23A 4DHWA 5DCYA 5K8LA 3ZH2A 2W6OA 2YIJA 3I61A 4U0KA 4KDEA 3OKAA 5A2QA 1HT3A 4C0XA 5JSHA 3NRBA 3PYXA 3D2BA 1QM5A 1GZDA 4N0MA 2OYCA 3SGLA 2XGGA 4Y2YA 4ARZB 4B4OA 4EVIA 2OENG 3RYTC 1KBZA 3VRHA 1M2JA 4J0FA 1ZMBA 2L42A 3DBLB 3G9UA 5FBVB 4V1CA 4BO8A 4D4JA 1G6Q1 4C5AA 1SCUA 3K0AB 5HGXA 4KR6A 1NFRA 2CUTA 1P29A 3JVEA 1JVSA 2VFAA 5AUOB 1SD1A 4A4DA 2NQ8A 4HAVA 1W36D 4EKGA 4JSTA 2X1VA 1ZCJA 2TECE 1G21B 4AROA 4IL5A 2RMKA 3BAZA 3LA8A 5ARDA 4WI1A 1ZJJA 3AEYA 3LC7O 4G67A 4QEDA 5A06A 4R1QA 1E5QA 5T3UA 4G1MB 4LZNA 4RPJA 4A10A 3CKKA 5ALLA 1Z68A 4Q3EA 5E6UA 3RFFA 4KLNA 4F12A 1N5RA 5KYYA 3WDSA 1QH8A 1GP2A 3DO6A 3PEWA 3HWSA 3PDHA 1CRPA 1U4NA 5B7NA 3BPSA 1TXGA 2HRDA 4M7PA 4BCDA 2IXGA 1RYBA 2V6FA 2O8BB 4KCGA 2QY6A 3PIRA 1CJUC 1UJ5A 2Z8YM 3ET5A 2WRZA 4UNNA 5ALSA 2CLDX 2DPXA 2HIGA 4GGOA 5KTRA 2HA7A 1S4MA 3H6KA 4N5LA 1Y3DE 3G7NA 4AYXA 5AW7A 3AY6A 1YQUA 4GR4A 1JLSA 1UBEA 1QVVA 1USKA 2Q9AA 3NHYA 3O75A 1X2BA 4YQYA 4S1OA 4C6SA 3UPDA 3F9CA 4P4TA 1EE2A 1Y34E 2BEKA 4FZVA 4DMHA 1TEVA 4TMVA 2EIHA 2K6GA 1THGA 3QHPA 3HDYA 4M21A 1WULS 3A6HA 1VKRA 3MRVA 3ORHA 3VR5D 4O2AA 4XWAA 1IWPB 2YCLA 1O8CA 4HDMB 2QX4A 2W2LD 2Q6VA 2C7OA 1O6FA 4Z9BA 1O77A 2D3TA 2V7QD 1LV8A 1W4RA 1V96A 3C6KA 2RH8A 1RRFA 3D4IA 4KWIA 2WYOA 1Z4NA 3M34A 2WIFA 2WLSA 3EBPA 3HP7A 1KVTA 2HEGA 4J0JA 1EESA 4D26A 3ADOA 1W49A 4JLUA 5A3QA 4EEKA 3ELYA 1K0UA 1KK2A 7ADHA 2QLFA 1P3JA 4MQUA 3IUBA 4OOEA 1DJNA 3GEDA 1G20E 4I4LA 3MRSA 3FHLA 3QBVA 4YP7A 3VSDA 1GN9A 1CUBA 3ILHA 3U80A 1DKQA 2QM3A 2Q9BA 2W93A 3UCFA 2HV8A 4TS1A 5K8VA 4TRJA 2R6JA 1PJ4A 2B78A 3P8ZA 3DMTC 4R1LA 2E4AA 4AMBA 2IBSA 2WJIA 3VHXA 3LC2O 2VDNB 3BXEA 1BEUB 1JBEA 3DZGA 3OO0A 5GVSA 3GAAA 3GRYA 2W4IA 2HJVA 3IC5A 3KG2A 4Z86A 3FTEA 4WCFC 2HUNA 1LVUA 3L7JA 4N54A 2EFDB 5LMCA 5IVIA 4PFKA 4BRZA 1U90A 4NICA 5AKGA 5HOEA 3ANLA 1II9A 3I73A 2VPIA 4RFVA 3I6QA 5CIYA 3UJNA 5LQKA 3FOFC 3OETA 4WNCA 5GINE 3IEIA 4A91A 1C5KA 1FLVA 3FZEA 3ZNQA 4DHEA 1HEYA 2R6AA 3EC2A 3WLQA 3IT3A 3K0CC 4HWRA 2PUBA 4MQLA 3OCUA 3RTEA 3ZJTA 1J20A 3OT1B 1NBME 4CHGA 2PAFA 1AB6A 3A26A 4WY2A 4TVKA 1CP2A 4MP8A 3UG6A 4HR7A 1M0WA 2AEJA 2XV1A 3D43A 4RXUA 3RS9A 3WB1A 3C6ZA 4LRTB 3BMCA 1VLVA 2H92A 2I4MA 2SBTA 4FCWA 1KZGB 4ZOLF 5E9WA 3NQ41 2XMPA 5K2MA 1K8ZB 2HA3A 3EG9B 3GMSA 3JATB 4ESOA 4LOAA 1ZK2A 3KLNA 1YBVA 2ZRBA 5ALPA 4YPFA 1CUUA 3R2JA 3UW3A 4RVDA 1VBNA 3ZBTA 2XSZD 3BGSA 2DSTA 1XVIA 5LVAA 4XIJA 1QC5B 3FXAA 4L4XA 1UKCA 1XDWA 2IK8A 1R8SA 4D0RA 1U9IA 4D6YA 3Q7QA 3NH9A 3A6GA 3WYCA 1WF3A 3F3YA 4ER7A 1P9LA 3N2KA 4Q7EA 1QJ4A 4HTAA 5FPYA 5K6RA 3PQ6A 3FF4A 1UEXC 4F2DA 1DZIA 4FVTA 4KE6A 1ISIA 1Q1AA 1Q1EA 3HFSA 2R3SA 3FF1A 3CF4G 4DR4B 3ZU5A 1UDAA 1GPLA 1L3BA 3LT1A 4MR9B 4TUYB 5E2AA 1RU3A 3PRKE 5I7EA 2N9UA 1U2PA 1FFDA 3VO9A 4RCZA 1H3FA 3D1VA 2VQ3A 2BTQA 2XZPA 3JQFA 3I62A 2J5QA 3NT4A 4BTLA 2P4QA 2H9AA 1BNCA 1FQOA 3S8YA 1W7AA 3PQ2A 3VC7A 1G59A 5FPPA 2YMLA 2FVYA 3USES 1U5BA 4AC9A 2IEBA 1EE9A 3CG0A 3I1IA 1EQ2A 1R0XA 3QNUA 1AHNA 3GLHA 1GYPA 2FEPA 3TUIC 5DSZA 3HQ4O 2DHRA 2EGHA 3HZRA 1E2FA 1M6VA 4H77A 3QXXA 4DN6A 5A62A 2XUFA 1K0FA 4B4KA 4D4GA 4TL8A 2XMQA 4H6PA 3FCCA 5GZ3A 2FPRA 1KDOA 5LP1A 4RCVA 2GUWA 3BHMA 4EB8A 4B6PA 4E5NA 4L57A 4RW0A 3JVIA 4O4HB 3IBFA 5AESA 5HW0A 2EJWA 2EL7A 3HYNA 3WJ7A 4M53A 2IOYA 3P2YA 2O7VA 1XDSA 2XAUA 5CW1A 3K2BA 4QRDA 2G7MC 1W0CA 4ZOCA 2CV0A 3AJDA 2PX4A 3N8DA 4BWYA 4UAJA 3SVLA 2F3SA 3R9XB 4YRNA 2AG1A 1KQNA 3EEQA 2C2HA 3OJCA 4NAHA 5B58T 4A6EA 1QV6A 4LWZA 2XMSA 1QUEA 1Y81A 4FOPA 5EZYB 4D9EA 3IUSA 1YCDA 1EFRD 2ZAIA 4CLOA 3U6KA 4PF1A 2PUAA 4KMOA 3BQ9A 1GZUA 2LXNA 5KNBH 5DSTA 4YDSA 3G9ZA 1EDZA 2GN0A 5IBRA 4A3SA 1JS1X 4X97A 1OUMA 1LBIA 2IP1A 2PGNA 3CYFA 4QVKA 2BFFA 4AWBA 2HSEA 2O8EA 5CA1B 3RWBA 2AI1A 2EG9A 1JPNA 2PRZA 4GE0A 4YJHA 5FD8A 5KNBA 3O6VA 2OV4A 3LCJA 2VZ8A 4CIAA 3AESB 3MCUA 2JRCA 4N0PA 3K0EA 1X1BA 3AUJB 3T61A 3B6EA 4C4OA 3WK6A 3F5QA 4KREA 5SZJA 3OT1A 1Z5WA 2IZ6A 3MTEA 8ATCA 2P2NA 3O3MB 2BGJA 2HQOA 2IHJA 4H7PA 1G17A 2I1QA 2Q4DA 1CR1A 2NO6A 4QPZA 1BN7A 2J67A 3ECSA 3FYUB 3JQBA 3T95A 3T1YB 4MXDA 1DAOA 2FZVA 1SVUA 1NKVA 1DTSA 2NO1A 3DC2A 4LG1A 4NZPA 4HX9A 5AVSA 5CB4B 1T9GS 4H1TA 1DJOA 3EXAA 2FN9A 4NI5A 4U5QA 1LJUA 1VECA 1LPMA 1DLJA 1OH7A 5BMVB 1IK6A 1FTGA 3L5KA 4Y0NA 4QKQA 2C29D 4MLPA 4IQFA 3O4IA 3SR3A 4CE6A 2XTNA 5IT0A 2PUVA 3FGZA 2J3LA 2PZAA 2QJRA 3WRYC 5E0OA 3WBKA 1YMVA 3IXMA 5JLAA 2C99A 1D2HA 2JFQA 3B1KA 4PQFA 3S70A 3WGTA 2Z6AA 4IEIA 3PT9A 1HDXA 3BH0A 3KJQA 4H59A 1DAEA 1ZK0A 1R4AA 4M1OA 4OAQA 4RL6A 2WAAA 5CTAA 3IA7A 1E3IA 1ODTC 2A94A 1Z9BA 4RIGA 4EJFA 4MLZA 3B51X 4KIFA 1AD2A 4EYGA 5E3HA 3K71B 1CFJA 1GZ6A 2WJPA 3JQ9A 2JZOA 1COZA 2MWMA 5ITZA 2O8BA 5ELLA 4YV0A 1IAVA 2J0UB 1SOWA 1RXUA 2OCDA 3BS4A 1NV9A 1L5KA 4AKEA 1P2BA 2YYZA 4RSGA 1GT6A 4EAAA 4AKHA 3PTLA 4MJLA 2VZLA 2QRJA 2R60A 2VT6A 2NP6A 5DOZA 2YUIA 4MKZA 2ISQA 5BUZA 5L4SA 3NUGA 3Q4GA 2QTBA 4W9NA 4RHYA 3TZCA 1AT1A 3EW7A 1DEHA 3UMJA 1T3LA 3VZCA 1WSWA 1P4GA 3PXXA 4QD3A 2IUUA 1LPPA 4OUDB 4M0EA 4O8ZA 1WCWA 2H11A 1FRVA 1RWPA 2CC2A 1ETUA 2O3UA 1OAKA 4X24A 4B3IA 1KEVA 1Y6RA 1JKIA 2P75A 1SXJE 2VTVA 5AOBA 1MO6A 5B2ZA 4BBJA 2GUGA 4IJQA 1MB2A 4XRRA 4FX2A 4F3YA 3PFBA 1ZH2A 5G0TA 2BD0A 4MB6A 1XPJA 3VSBA 5K0BA 2WTBA 2NUTB 4OJYA 2IXBA 1YT5A 2C84A 2WG2A 2IHVA 3C3AA 3GFVA 1CUDA 1FUKA 2C7GA 1OOEA 1VBFA 3MS2A 4JLVA 4EVRA 1CY6A 3EQZA 1SIOA 2RK4A 3UKOA 4FE3A 5AUNB 1KI4A 3S2GA 1XZIA 2YIDA 2A7QA 2GEDA 4JOQA 4PGMA 5DI3A 2PZ8A 2GF0A