2AR7A

Crystal structure of human adenylate kinase 4, ak4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
KLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylate kinase 4
publication title Crystal structure of human adenylate kinase 4, AK4
rcsb
source organism Homo sapiens
total genus 72
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ar7A00
1DAGA 5TARA 1XEXA 2GBLC 5BN5A 2F9MA 3CRQA 3GD7A 4CZ2A 5G3YA 3GLGA 2FZLA 2W2XA 4F7WA 1P2VA 3KFXA 3W5IA 4Q4JB 2UKDA 1JR6A 3GMTA 4RCYA 3OESA 4NYJR 1KY3A 2QZ4A 4KFRA 5KTYA 2IF0A 1NN1A 2RHMA 4EQ6B 3AVXA 3BWDD 4M1WA 2REOA 221PA 5DYGA 3U7HB 3LQQA 3PUYA 4BZXA 1EESA 3FGNA 1GDDA 1WRBA 2DWOA 2B21A 3M0EA 3CF2A 2QSZA 3DOFA 1WB9A 1PLLA 3CR8A 2BDTA 4NHOA 4Q7LA 3K8YA 4D4KA 1JECA 5CJPA 121PA 2DR3A 2QE7A 5HPYB 4UQOA 1Q3TA 3TIFA 3AVPA 4JL5A 4TQUS 3C16C 2QTFA 3M4YA 4DCVA 4Q4AB 2NZJA 4LPSA 1A2KC 2ASEA 3KKQA 3SR0A 5J4YA 4R2IA 2OT3B 5J4VA 4BFTA 2YNMA 2QAGB 5EP4A 1Z06A 1OJLA 1XXHA 5JJLA 4BQSA 1LF5A 1N25A 4Q1EA 4DT1A 3P1JA 4LYHA 1BYUA 4A82A 4Q1CA 3WP0A 1C1YA 4TLEA 2IF2A 2W0SA 3UATA 4DB2A 4GSYA 1U8YA 4YDHB 1NIPA 3BFVA 2YV5A 2GJAA 2GNOA 3NDPA 4DEXA 1Q22A 3CM0A 4P4UA 4ZDIA 1E0AA 5ELXA 2GKSA 5HKKA 2HF8A 4BFWA 3W90A 2IYVA 2VF7A 2GCNA 3BK7A 3ETLA 2HXYA 1QHNA 1YZKA 2F1IA 2VHCA 4YMWA 1LW7A 1KK0A 1HUQA 2A2ZA 2WKQA 3S1AA 2EYQA 2RGNC 3OE7D 1XJCA 3AKYA 4JBYA 2IYLD 3DDCA 2ZYUX 2IEYA 4GOJA 2XEXA 4WOPA 4XSHA 2BJVA 2LKDA 1CJVC 4TQAA 2XJ4A 3QXXA 4NE2A 1VMAA 2ZRDA 2CCJA 2ODBA 4Q4HA 3U2QA 1SKYE 1DO2A 5KNBA 1R5BA 3AF0A 4BE7B 2LWIA 1HH4A 1LNZA 2BHRA 1KKMA 1NBME 2ZJOA 3G5UA 4Q1AA 2ZI6A 1Z0AA 3VKHA 3IEVA 1DELA 3T1QA 4JZKA 4HB0A 4PFSA 4CEHA 3MJRA 3ZS8A 1QVRA 3KKPA 3LFUA 3NEYA 3BOSA 1SVOA 1JPNA 1FZQA 3PIRA 3U6KA 1W1WA 1E9CA 1XTQA 2QE7D 2X19A 3NH9A 1Z2AA 3C14C 4RD0A 3SYLA 4EPXA 4EPYA 3KQHA 2PLFA 4KSCA 4TMKA 2HJVA 2EFDB 1F60A 4PHFA 4HLQB 1R8SA 4PANA 3UMRA 3T1OA 1KMHB 3QKRB 4HAUA 2YINC 3A1TA 1EFUA 1T8TA 1CXZA 2EFHB 2VRWA 4BWYA 3AV0B 3EIEA 3G0HA 3BB4A 4LHWA 5GADl 1DAFA 2V9PA 5HR5A 3SJCA 2WWFA 2IS2A 2QP4A 4JVNA 3W6NA 3K0FA 4LK2A 4MRNA 2REXB 4W5JA 4M21A 4RD1A 1QDEA 2WJIA 3JVUA 2FDCA 4MGIR 3CUEF 3VAAA 5L3SB 2AXPA 3DMNA 1EK0A 1VG9B 5FOXA 4X8OA 4IDQA 1QHSA 1FL9A 5HKKD 4HAZA 2VP9A 1N6KA 1ANKA 5KDDA 4OI4A 1IY0A 1Z0DA 1W4AA 3UWKA 2FEOA 2FWRA 1A2BA 1F3OA 2O8CB 2Q21A 4R7ZA 1CS4C 3NC0C 1G3UA 1W5TA 3QKTA 3K9NA 1U99A 3UG6A 2A7QA 3GJ3A 3IKJA 4IW3B 4HI0E 1NNEA 2B92A 2HJGA 2IYRA 2QA5A 4GMXA 3CX8A 3LDAA 1SULA 4GT1A 4DLWA 4EPRA 2V3CC 2X2FA 5FTMA 4G5SA 4OQMA 4Q5IA 2QAJA 1UJ2A 3MGCA 5FUXA 2GXQA 4HAWA 4O2RA 2QORA 4OHYA 1OXTA 1TADA 3L8YA 1VPLA 1S1CA 2IWHA 5LD2B 1Y3AA 1B0UA 1KOFA 3JZMA 5LB2A 5CYOA 2ZJAA 3TAHA 4CEJA 2ZIAA 1PVOA 2GJ8A 5JMTA 4UJ3A 1K6MA 3NWJA 5KO2A 1GWNA 1P60A 1LF0A 3GLFE 1AS3A 2OAP1 3N2IA 1OLOA 2IWRA 2E87A 3FMFA 3THWB 2WAYA 1KAOA 4NYJQ 4O2LA 4PTLA 1ZC3A 2XTZA 5AJYA 4AKGA 4DDTA 4RD6A 3TR0A 3ECCA 3DHWC 5AJVB 1E94E 1T0HB 2A5DA 3P32A 2QN6A 2O8EA 1W36C 2CL7X 4RCZA 4HSEA 2Q0HA 1KIMA 1UKZA 1T9HA 1U81A 2OZEA 2WWHA 3I72A 1X86B 2I1QA 5J47A 1XTKA 1Z22A 2JJ2A 1R0WA 1SHKA 5HTKA 1LVGA 1TU3A 2R65A 2W83A 1YR6A 1ZNZA 1Z6XA 3TKLA 2QNRA 5KPDA 1DADA 1RRFA 2NG1A 4MKGA 4NYMR 2YWFA 3PUXA 2O8DB 2QRZA 5F3WB 1E4VA 3IQWA 2ZREA 2QM7A 2B6HA 2RCNA 3M6AA 3PCRB 3N5CA 2RAPA 2W6JA 1XFAA 3EG5A 3D31A 5JEEA 2J0VA 2XZPA 3PITA 5FR1A 2QT1A 1XCGB 2ZI3A 2XZOA 2PEZA 3DL0A 1T3SA 1ZJ6A 1XDBA 1NP6A 3OIWA 4TZ6A 2ZI5A 1BMFA 1YRAA 4NBSA 1UBFA 4TZ0A 3W8NA 2AKYA 1HTWA 2OBLA 4B33A 4JLJA 2VHQA 2CBZA 1CIPA 1DPFA 4TSFA 2P6RA 5FPKA 4L5BA 2C8VA 1EGAA 3VU9B 2DFNA 2GVZC 1T5IA 1E2DA 1NIJA 1Z6YA 3QF7A 1XCMA 2Z5FA 5C4MA 4A2PA 2ZS7A 4MGYR 4BLOA 2ZUCA 3HPQA 1GKIA 4JSYA 1JALA 5DNYB 3R9WA 3T5GA 4KCGA 2QMUA 5CITA 1QF9A 1HY3A 1IY1A 1M1YE 1S4QA 4EJSA 4DLUA 4LHXA 4PHGA 1DOAA 2V1XA 3LH5A 2JLZA 3UANA 4CIDA 4C0AC 1BS1A 3QPWA 2HYIC 2RGEA 3EZ6A 1UAAA 4LHZA 5CM8B 1XZQA 1KDRA 2CHQA 2ONJA 5D3MA 3TGPA 2SHKA 1AJEA 1TL7C 3VR2A 1E3MA 1D9XA 1ZNWA 2Q3HA 2QGNA 5AUQA 2J9RA 4B3FX 1E2HA 1IM2A 2N46A 2ATVA 3I62A 3HU2A 4DRZA 1G8PA 2JJ2D 2Z43A 4PPNA 3UXMA 3LXRA 4B2LA 3CWQA 1ZCBA 1FMLA 2AK2A 1W7AA 4TMXA 4PSKA 1Z2CA 4JT4A 3SC3A 1BKDR 1OF1A 2F1JA 4H1UA 3TW4A 3GLHA 3U4QB 1KI4A 4Q01A 1ZAKA 1Q21A 1YZQA 4RD2A 2PX0A 3ND9A 2W6JD 1YZLA 5FI1B 1P72A 2AFHE 3L0OA 1II8B 2QI9C 4MUBA 1JBKA 5C1BA 3I8XA 1MOZA 4JVLA 3K9HA 4HZIA 1F2TB 4PC3A 5HZKA 4EIWA 1BMFD 4Z8XA 4MRRA 1GKYA 4V0OA 4C30A 2EU8A 1IJEA 1EXMA 2DY1A 4LOAA 4IEEA 4TSFD 2WJJA 2V8OA 2OV2A 3RS0A 4DDVA 3U44A 3HR8A 3LD9A 3ZD6A 1XTRA 5D3QA 5EXTA 4PO8A 4TMTA 2WICA 4I99A 3B13B 4HDCA 1F2UB 1CJTC 5J4HA 2IHYA 4URWR 1E6CA 4NCKA 4G0NA 3NVAA 1GITA 2C2HA 3AUYA 4TYNA 4LJ9A 3U3RA 2DFLA 2XGJA 2H16A 4KO8A 2R6GA 5SZJA 3IO3A 2CJWB 3D7MA 2ZRIA 4GNKA 1VECA 1XNJA 3A4MA 4ZPXA 4BLPA 1JB1A 5EJEA 2XNDA 1QHHA 2GCOB 1E9RA 1O3YA 5C18A 4D0GA 4DSUA 2V6IA 4GBMA 5DYIA 3B9PA 2RGXA 1R7RA 4Q4LA 2ORIA 3E2IA 3TMKA 3U3JA 1E9DA 1E2NA 3MSXA 4KFSA 2AWOA 2CVFA 1W0KA 3X1DA 1M6NA 1XD2A 5IRCD 3UK6A 5G41A 3TK1A 2C9OA 1D5CA 1IOZA 4JSTA 2FFQA 2ZS8A 2GVDC 1ONBA 4WW0A 3THYA 1OXUA 4K8OA 1DEKA 2XOKA 1G3RA 1OH5A 3CO5A 1XMSA 5AJWA 4IKEA 3L43A 5JHHB 4MDFA 2F9LA 1DO0A 1QHIA 1UBEA 1ESNA 2ZUDA 3WYFA 4JVMA 2RGGA 3CNLA 1SXJA 1X8LA 2PX3A 2WJGA 5FBWB 4A8JA 1OB5A 3CONA 5CK4A 2CHGA 3U3KA 1GOTA 521PA 3A36A 3L0IB 1N5JA 4NP6A 4DLTA 3LVQE 2R6DA 4AURA 2CEAA 2ZR9A 4O0MA 3FOZA 1U8ZA 1AQUA 2D2EA 1CR4A 2ODWA 1KSHA 4FMCF 4NYMQ 2FJUA 1KDTA 3QVUA 3B1XA 4JT2A 2DBYA 3B7GA 3B1ZA 3GLIE 3U7FB 1W0JD 4A6XA 2D4HA 1NSTA 3ZVLA 2J0UA 4LJYA 2AD1A 5H70A 4R2HA 4D6PA 1SVMA 3CB4A 2FNAA 4ITRC 5FBVB 1OFTA 4BLRA 4P4SA 1P3JA 2NIPA 1SVLA 3CRVA 5E3HA 1RJ9B 3WBKA 4CT4B 1JJ7A 2J1LA 1SKYB 5FH9A 4DIEA 2QP3A 3NDBB 4XSGA 1KO8A 1W44A 3I8SA 2DCUA 4OK3A 3HU1A 5EE5B 4D0NA 4EKDA 2R44A 2QPOA 2F6RA 3OHMA 1G64A 2OXRA 1XU4A 2V54A 3GEEA 3PQCA 2XNDD 4YMUA 5FOWA 5JJKA 4PZYA 2YC2C 4I1SA 2IK8A 2VEDA 5CLQA 2V6JA 3ZZTA 1XMIA 4JBXA 1Q57A 1TF7A 4IHQA 4Z51A 1N6OA 4P4TA 3GJXC 3HJNA 1G7SA 1X1SA 2BEJA 1G4AE 3QVVA 1DTSA 3KKOA 4TWZA 4LBZA 2R62A 2QBYA 2FGKA 1MO6A 2FV8A 1NMZA 2RGAA 4C0BA 1W0KD 1FNNA 3QOFA 4QM7A 2PL3A 1E0SA 3QF4B 4FIDA 4M1TA 4TL6A 2KBFA 2ZE5A 3KKMA 2H17A 5EE3A 2RGDA 4B32A 4BFUA 4F38A 5BW8A 1DE0A 1KO4A 2AFIE 1U8AA 3OAAD 2XOKD 4EJSC 1US8B 1VDZA 3BORA 4HLCA 5G53C 1FMJA 4XWKA 2FFAA 1W2HA 2WVJA 5C2JB 4AI6A 4V0MA 3RS2A 2GEVA 1G3MA 2A78A 3ZGXA 4OQXA 3O8BA 2VYFA 5AUNB 1PLKA 1SXJD 3OF5A 5B58C 3UPUA 2OUKA 2ZROA 4YDSA 4EQ6A 1JQJC 1P7CA 1E9BA 3N70A 3PR1A 1P6XA 2AXNA 4JLMA 4F93B 4F92B 2QRNA 4PPQA 3W6OA 3LWNA 2ZPTX 4PHHA 4RVCA 3WNCA 4IVPA 5KNDA 1RFLA 3H0KA 2FGJA 4OJKA 1T3LA 3FMOB 1E0JA 3V4RA 3FMIA 2JIZA 1E2JA 3WNDA 1N3BA 2F3TA 4URYR 2XNSA 4Q4AA 5H8WA 1MO3A 1XB2A 3NC1C 1G1MA 2FMXA 2HT6A 5JJIA 1G9XA 3KL4A 2ZSEA 4Z54A 1BOFA 3F3YA 1E9AA 5EQTA 1JR3E 3F5FA 2QAGA 4GP7A 1BH2A 5P21A 4QGAA 4CW7A 2OCBA 2WV9A 3EA0A 3BAFA 4PPGA 4JLDA 3VKWA 3WNBA 3SHFA 4CEIB 2GESA 1E9FA 2FPMA 3KB1A 4ZIRB 4XWAA 2QMEA 3L2OB 3TE6A 4Z1MA 4ERNA 1N0WA 2RH5A 2YOGA 2PBRA 2BBOA 3D8BA 1M7GA 1TF5A 4NYIR 1E0KA 2IX3A 3A8TA 2BC9A 5FPYA 3LLMA 2BMJA 1GL7A 4H9GA 2FPLA 3LW7A 5CLLA 5FPHA 4CT5A 2JA1A 5HZHA 3E5HA 2B7BA 3THXB 5F9HA 1XRJA 4KBGA 3GLFB 2D2FA 4NCJA 5JECA 3C5HA 5KSZA 4V0KA 5FTNA 4ZDJA 3W3ZB 2IUUA 4KU4A 3CNNA 5E7MA 2CE7A 1DAMA 1VHLA 3IBGA 4A36A 3HYRA 1CEEA 3HU3A 2XB4A 3EZFA 4ZDKA 1ZNXA 1BO6A 4DLSA 3B5JA 1G3IA 3SN6A 4KVGA 5KHOC 4UJ5A 1X1RA 3R9XA 4Y0AA 3SS8A 3NBYC 1FX0B 2WJYA 4BUJA 5C46F 3RRYA 1E32A 4DSNA 3KXLA 4GI7A 2C9YA 3QIAA 4GL2A 3K70C 1KI6A 3AKEA 1AK2A 3SJAA 4DLVA 2NOAA 3B1VA 4Q02A 2GJKA 3B9QA 5CIQA 4US1R 5FI0B 2DFKB 4IXMA 1NY5A 2NO7A 5KOYA 4HAXA 1HQYE 3C15C 2DWPA 2JIZD 3I92A 1W47A 4PQFA 2I4IA 1PUIA 3TR5A 3CZPA 2PZEA 1AS2A 4Q19A 3AVTA 4HDOB 4WZ6A 4E09A 4M2LA 1G7TA 1KSFX 1JAHA 1KMHA 3QKRA 2B8WA 2GJ9A 2G6BA 4PO9A 4HEJA 3C5CA 1OYYA 1Q1QA 1NKSA 3O8CA 1CJMA 4BGDA 1OXXK 3A6PC 3F8TA 5G3ZA 3WRYC 2GAAA 4I81A 1SXJC 3DMDA 4JJKA 4A8JC 2ORWA 4C0SA 2CHVA 5FTJA 5IK2D 4FCTA 2GWHA 3QEJA 2G83A 2WKPA 4Z1MD 4LHVA 3EPKA 5L3SA 3U5ZB 1HEIA 1G291 2J5XA 2C5LA 4K81B 2GXAA 2KWIA 1R2QA 1W49A 1KI9A 1WCV1 4WXRA 1S0UA 4PAQA 1G4UR 2AKAB 1P9RA 2Z6VA 1XTJA 3RVBA 1E1QA 4TYPA 3RS5A 2VSXA 2RGCA 1RC8A 5IHPA 3T06B 3BB3A 4LWZA 2IXFA 2O8CA 3I3SR 3VFDA 3THOA 1P4SA 4LRWA 2ZR7A 4JKYA 3VR3A 4V0LA 3OIVA 4FINA 1Z08A 821PA 1OH7A 4P32A 1QRAA 4A0RA 3RDPA 1N6IA 4RD4A 1HE8B 3RHFA 2PMDA 4YONB 4Q7MB 3T34A 1GUAA 4A1FA 4C7OB 2IS4A 1G6OA 1VYUA 2H8KA 1FNMA 1DVRA 1R8QA 1I2DA 3CIOA 4JL8A 2J7KA 1XCPA 1P62B 3V4FA 2V1UA 3B85A 1NVWQ 3CLVA 1N5KA 4Q9IA 1U0HC 3CZQA 4OQNA 2YOFA 4LZZA 5KSPA 4OHXA 4YC7A 3PEWA 1GAJA 4WZBE 3KJEA 2CL0X 1NLFA 1D9ZA 1EX7A 4Q9KA 5FTKA 3SOPA 1N6NA 3X1WA 4B2IA 1IBRA 5KDOA 1KO5A 4AKHA 3QKSB 3AVWA 1KKLA 3TAUA 1Z0FA 2C03A 2WOJA 4DJTA 5LPNA 3L0PA 4FMBB 5A4JA 3OIUA 4TLBA 1IJFA 3FB4A 3P4XA 1SKQA 4TMVA 3FPAA 2ZI4A 5AJXA 1SHZA 1IN5A 3AF1A 2W0MA 2W00A 2ZVPX 4Q9HA 3VR1A 3THWA 1TTTA 1NL3A 1G18A 4B43A 2FX3A 1LV7A 3TSWA 1T5LA 1X6VA 4IOMA 3U60B 4Q66C 4XTCS 5FOSA 5KUTA 2C9CA 4S2EA 3Q5DA 2OFWA 4DWJA 5FUWA 2OFOA 4FMCB 1QHXA 3LBIA 1XP8A 2IL1A 4URXR 1W36D 2BKUA 3RS7A 3IBYA 4RZXA 4HYYA 1IY2A 1K8RA 2IXGA 4DCNA 2DHRA 2ZETA 5BXQC 1IN4A 2GXUA 3CW2A 4RFVA 3LBHA 4M9SA 3EIHA 4N0EA 1ZD8A 4IDNA 4N0DA 1Q3HA 3PJRA 1E1QD 5L3RA 2YWHA 1UKEA 3SQXA 5AUOB 2MMCA 2O8DA 5EZ5A 2IYSA 2BV3A 1E2LA 2JJ1A 4UKDA 5HE9A 3CF0A 1YRBA 3SU8A 3DM5A 4URZR 1MRNA 4V0NA 4BFZA 5AUPB 4YQFA 2CDNA 1KTVA 4ARZB 2A5FA 2QAGC 1R5OA 3LAWA 2YWGA 1NVVR 4LJ8A 4JS0A 2BM0A 3TUIC 2ZJ8A 1VIYA 4V03A 3VX4A 1TF2A 3H84A 4A6PA 4FWTA 4OHWA 2BMDA 3OZXA 1S2MA 1M7BA 5KDLA 2PJRA 2LKCA 2VSFA 3RANA 3VR5A 1E4YA 2QUZA 4BRWA 1XPUA 1D2NA 4E22A 1AN0A 1FFHA 1CLUA 2RGBA 3A1UA 3BFKA 2ZYWX 4D4MA 2ZUBA 1GFIA 3VU9A 1GTVA 1F6BA 3AUXA 5HCIA 3T5DA 3RS3A 1I4DD 1AGPA 1XEXB 3WHKA 2F55A 1XTSA 4BPBA 2O0KA 3CH5A 3DM9B 2EYUA 1M8PA 2O8BB 4IDPA 1T0JB 4KLNA 1IN8A 3SZRA 2HUPA 4GZMA 2WTUA 1ETUA 1B23P 1RYHA 3B82A 1KI2A 3D6TB 4IOLA 4PSAA 2N1BA 2A5JA 4R9UC 3RYTC 3H4MA 1T6NA 1Q44A 2KB0A 3SBEA 2F43B 4AG5A 4AKIA 2QPAA 1CF4A 1NLYA 1C4OA 1G5TA 1S9DA 2O0JA 2VPPA 3EWAA 4G1UC 5E7JA 2ZYTX 5BYJA 4Q18A 3EAQA 2OSBA 2QTHA 2BMFA 2JLSA 2WIAA 3H1TA 4MKIA 2P6NA 5CDFE 3GLIB 1HT2E 3AKDA 4JVSB 1KO7A 2GEUA 1KDOA 3EZ2A 2P3SA 1ZYUA 2TMKA 3HWSA 4B47A 3GFOA 3GJ4A 4M22A 1E2QA 4F4CA 1S96A 3B1WA 3IIKA 3ICEA 2JJ1D 1ZVQA 1Q12A 1NG1A 3SFZA 1Z07A 3QJYA 3BBPA 4L4UA 4JKIA 4TT3A 5J5CA 4QBIA 1L4YA 2FEMA 4NONA 3AF3A 2EWWA 2NO6A 2OM2A 1II8A 4KHZA 2A3RA 2Y8EA 4LYAA 3CH4B 3BIFA 2VHJA 2AX4A 1CBUA 1XD9A 2KBEA 5GJVC 1F2TA 3IQXA 1ZD1A 4HDQB 3BH6A 4K46A 5EZ6B 1A82A 2IT1A 4TN1A 1ZIPA 1KZGB 2VP0A 1G17A 4P3YA 4KYIB 3PENA 5TY0A 4MRVA 4JLBA 5F9FA 4M1SA 2YVUA 4BLTA 2QSYA 1Z0KA 2GF9A 3K09A 2ZSBA 1Z3IX 4QJ3A 1YVDA 2PH1A 4JYBA 1CULC 2IYWA 2ZYVX 5HE8A 4KFTA 4QBHA 3QUSA 2JJ8A 3MWKA 5M04A 1GVNB 2WPDA 4ZKDA 3LXXA 3RAPR 3RSLA 5DH9A 5CM9C 3BRWD 1N5LA 5JCZA 2WWIA 1NJGA 4EFLA 1HE1C 1W4CA 5GJCA 3R8FA 1FOEB 1GRRA 1I4TD 1KNQA 1UBCA 2CJWA 4BASA 1TX4B 2CMKA 4XTRA 3KXIA 4U00A 1GNQA 4DLXA 1U98A 4QG7A 4MKFA 1XX6A 2ZSFA 4BEBA 2W2TA 4DLYA 5EE0A 1LS1A 1ZBDA 4Q1DA 2IYXA 3QI2A 1P2UA 1WMSA 4KLZA 2PCLA 2A9KA 2XJ9A 1RRCA 4IFEA 1Z28A 4L16A 5B57C 4KSBA 4LC0A 2EW1A 3KB2A 3SYKA 5LD2C 2OO7A 1DARA 2OILA 1AGRA 3D3QA 1KNXA 3UWOA 1LTQA 2XAUA 4HUQB 3KX2A 5JSZB 3ADCA 4UNNA 2D7CA 3RSOA 4N3NA 1XEFA 4QFMA 1JJVA 2CLCX 2OESA 2QTVB 4TT3D 4A4DA 1U94A 4BLSA 1E2KA 4AYTA 4Q1FA 5E95A 4AYWA 5J4LA 5JFGA 5TDHA 1AKEA 3QKUA 1T4GA 2VHTA 1AIPA 1IHUA 1Z0IA 2WWYA 1ESMA 3SDZA 5K8TA 2FSFA 5K8IA 2FFHA 4QBGB 2VP5A 4TL7A 4OK6A 4B3XA 3IUYA 3NXSA 2AR7A 2WSSA 4X8MA 3U3MA 4WVFA 4RJLA 5UKDA 3GJ8A 2ZRGA 3AVOA 3KJHA 4HZUB 4HB3A 4LJAA 4LYFA 1A1VA 2B8TA 4KV9A 1KGDA 1TQ6A 1Q1EA 3TVDA 1ZC4A 3IEUA 3BXZA 1RIFA 1P2TA 5J40A 1M7HA 3UMFA 1NSFA 2WPDD 4D81A 4W7SA 3UKDA 3W5JA 2XXAB 1CR2A 2QQ0A 2IYTA 1NVVQ 1UEIA 2RMKA 1RJ9A 1A5TA 1JNYA 2ERXA 1G21E 2AHOA 3QQ5A 4MKHA 3EW9A 5GJBA 4C0HA 3T1VA 4ZI3A 2PJZA 3IDQA 2FSGA 3LNCA 2JLYA 4JLOA 1YZUA 2BVNA 3B8HA 1NBMA 2MSCB 4FWIB 2WBLC 1R10A 1XMVA 4DEYA 3GJ6A 3QBTA 4MQBA 3WMGA 4EFNA 1XWIA 1E2GA 1KSGA 5AWFC 4DCTA 2OLKA 1OXSC 4Q21A 4GFDA 5GVSA 2JLXA 3K0SA 4BECA 1UADA 1SZPA 2ZRFA 1NRJB 4HATA 2C98A 3QBVA 2HYDA 1II0A 4KFUA 4ZDWA 2QROA 2L0XA 3LW8A 3QF4A 1J99A 3BERA 4X8HA 1T91A 2V7QA 3W34A 3QY0A 1YZGA 3EWSA 4G5GA 1U9IA 1US8A 4D2IA 2IYQA 4OJQA 4TYQA 1TQ2A 4B6FA 4C2TA 3FFBA 2JLUA 5EP3A 4BZQA 4E07A 1OV4A 2IYUA 2HV8A 2AL7A 4Q9LA 4LX0A 4D25A 2BKEA 1QVAA 1EFCA 1J8MF 2WSSD 3ZVMA 3Q9LA 4DUGA 2H5EA 2VHUA 5JHGB 1XMJA 2YOHA 4OI0A 1EFHA 2VA8A 5DISB 5DI3B 2GK7A 5EXPA 3U7GA 3H2YA 1IXZA 3K0AB 4Y0VA 2H57A 2GXSA 1GNPA 1E79A 1TQDA 1WA5A 4AKEA 3MJHA 4G5QA 2HLDA 4QHTA 4RFSB 1E96A 3EZ9A 3GLGE 4FW9A 3V00A 3L82B 4OQLA 1GZSA 1MV5A 1CR1A 4QGGA 4OI2A 3A58B 4JYCA 2QU8A 2WJVA 1GKUB 5L3QB 1TAGA 3AP3A 3L0SA 3MMPA 3MAAC 5DGXA 3UIEA 1NBMD 3C4JA 1UM8A 4U02A 1AZSC 4KI0A 2IUSA 4PAMA 4MGZR 4B3BA 2C77A 1WBDA 1OIVA 4CEIA 1OW3B 1D2MA 2D06A 5FPTA 3TNFA 3Q8XB 3KQUA 3ADDA 1ZM9A 1AS0A 2AK3A 3T61A 4AY2A 1HQCA 2ZRPA 3REFA 4C0KA 2ZAMA 5TXGA 4N1AA 2CL6X 4US0R 5DI9A 5FBRB 4BLQA 3K09C 2QY9A 3CBQA 1SQ5A 2NTYC 1YE8A 4Q03A 4QL3A 3SEAA 1I2MA 3T12A 5KSYA 3MWLA 4B3DA 3AF2A 1P5ZB 3THXA 3GLFA 2PMKA 1Z8FA 2F7SA 3RLFA 1MT0A 5F98A 1MH1A 2P65A 2V7QD 3NHAA 2CCKA 4PXAA 4QJ4A 3A4LA 1IQPA 1GM5A 2WKRA 5FBQB 1XXHE 3A1WA 3B60A 3OFNA 4QOSA 1FP7A 4UNQA 4EDHA 1FQKA 1E98A 4L15A 4IVQA 1VG8A 2FSIA 1DBSA 1WBBA 1KI7A 2O0HA 4YMVA 3WYGA 2Q9BA 2NO1A 2OCAA 1PZNA 2NGRA 4BRUA 3EC1A 2UZ3A 1FUKA 2FFBA 1NI3A 2GJSA 2C99A 4DUGD 4PPFA 1G41A 2E1RA 4AG6A 1GP2A 4QHSA 3GLHB 1ZM4A 1NG9A 5EXSA 2BCJQ 2QMHA 4D82A 4QHYA 4MDEA 3PFIA 1RW4A 3GJ7A 3MRSA 4LSGA 1HA3A 3K70D 3VNVA 3PEUA 4JLAA 5J4KA 3REGA 3PEYA 2QM8A 2BBWA 4P33A 2IBMA 2HLDD 2D3WA 2ZTSA 5IF9A 4RZ3A 1KK1A 2OCPA 2WIBA 2GETA 4PHTA 2ANCA 1NMXA 1LS6A 4LBYA 3KZ1E 4X8LA 1Z6GA 3TW8B 2XB2A 4QRHA 4B2PA 2WWGA 4BEJA 4L9WA 5CIWA 4MA4A 3DVLA 1R4AA 2IYZA 1AZTA 1M34E 1KDPA 3LRPA 4Q4JA 4A2QA 1G8GA 3W6PA 4ZO4A 4W5HA 1Z83A 2ZI7A 1COWA 4WA7A 2GDJA 3K9LA 1J90A 3EPJA 1VTKA 1WQ1R 2QENA 4I4LA 5FR2A 3SNHA 5A5GA 1UF9A 3ZQJA 2IXEA 4EPVA 2BIFA 3LO5A 4XD7A 2EVWX 3T35A 2OCYC 3MG9A 4HAVA 3VHXA 4M8NE 1W4BA 4IOKA 3FHCB 3MUFA 2WJHA 4ACAA 2OEPA 4LJ6A 4TYYA 4ESHA 2WZQA 2RB4A 3SBDA 2VP2A 3U7EB 1UPTA 4AWXA 3ZD7A 3RS4A 4H1VA 2ZAOA 2JEOA 3FTQA 3OFND 3Q7QA 3VHLB 1YR9A 3ONWA 3GEIA 3IHLA 3EARA 2HDNB 3CRMA 4M9QA 4ABYA 4C7OA 2QPTA 4GMDA 1DS6A 1TNDA 1RE0A 2JLRA 2Q9CA 2QT0A 1Z6TA 4G01B 3EPLA 1TUIA 4MGKR 5JS7A 3IHWA 4DIDA 2OLJA 3TUJC 2ZRAA 1P61B 3I5YA 1RVDA 1S8FA 1ZMXA 4O3MA 2OXCA 3DOEA 1KK2A 4IFBA 4B6EA 3THYB 4PO1A 2FF7A 4Z8YA 3FVQA 3QKSA 2G1KA 5BQ5A 4BFSA 2ECKA 4RY2A 4A15A 3SE0A 3LX5A 3R7WB 2Q3MA 3LBNA 3QPVA 5FOVA 1EX6A 5FL7A 1L8QA 2F1HA 1U9IC 3MWYW 2DB3A 1OH8A 4DLZA 3TQFA 1ZRHA 4DXAA 1P75A 2RKOA 1QG2A 1LB1B 3BC1A 5EUQB 3GP8A 1WDTA 2V55B 2ZRHA 1R0XA 3I5XA 5DHFA 1COWD 4PC6A 2ZE7A 5DN6A 4LV8B 1IXRC 2FSHA 3HP1A 4ILEA 3VR6A 3BE4A 3KTAB 3NG1A 5JZVA 2WHXA 2ZRKA 3QEOA 2J0UB 4M0LA 1ZU4A 3BS4A 2GA8A 4MYHA 2XITA 2IHBA 4XVUA 3G82C 1G6HA 2YZ2A 4XD7D 1DAHA 2YC4C 1J7KA 3O8RA 1U0LA 1J8YF 2Q9AA 2E9SA 2GZDA 4RKEA 2JLQA 5JCPA 3E1SA 3PEVA 1E9SA 4EAQA 5BN4A 1GNRA 4GRAA 2V4ZA 2R8RA 2ZS9A 3QNUA 2AN9A 1ZINA 4ARZA 1ZUIA 1UFQA 4JLVA 1QHYA 1MABB 3A1SA 5CK5A 3X1YA 4IDOA 2ZRBA 5JI3E 4DB4A 2QBYB 3RABA 1EWRA 2CK3A 3NBZC 4L8GA 1U0JA 3T1TA 1IN6A 3GQBA 5EP1A 2YYZA 1CU1A 4J0QA 3IIMA 2FE4A 1G7CA 2ZE6A 3LQRA 1NN0A 4LI0A 4QGHA 4CGZA 1S9HA 4KJZA 1S3GA 3OEEA 1HV8A 2MMGA 3O47A 2REBA 4NDZA 4B74A 1RZ3A 5GVRA 4EPTA 2LCFA 4YXWA 2O8BA 1OFIA 1W48A 2FZ4A 1N5IA 4UXHA 4BFVA 2O52A 4TYWA 5FL7D 2PZGA 1P73A 1F48A 4B75A 5JRZA 1RKBA 3MCAA 4KYUA 1OFUX 2VH5R 3AEZA 2VQSA 3ZJYA 1JEDA 2EFGA 1UDWA 3TVTA 3TQCA 2QGZA 4JBWA 2CNWA 2R6FA 3Q5EA 3VKGA 1HYQA 2F43A 2JATA 5DN6D 2GZAA 4DSOA 2J45A 2OBMA 1JI0A 3AVVA 2GK6A 3K1JA 3AF4A 4IJMA 3ZZUA 1H8EA 4QGFA 1DAIA 5DIFA 4TLDA 4CDGA 4A92A 3GLIA 2D7DA 4B3GA 3PUZA 2DYKA 3AH8A 3FKSA 4OQFA 2ZU6A 1YZTA 4DCUA 4Q47A 5SZIA 2EFEB 4KAXA 6Q21A 4IDHA 4C0JA 1OFHA 4PC7A 5FUYA 2IS1A 2C95A 2NMVA 3EC2A 2NO9A 2ZANA 2H18A 2ZRNA 5DLQC 4TTRA 1S3SA 1GL9B 2NPFA 3GJ5A 3U6BA 4DDWA 1MR3F 2CLSA 4R71A 1V43A 3QXHA 4F4JA 2OHFA 2BOVA 1ZM2A 5JBQA 1E9EA 3ZIAA 2FOLA 4IVRA 1FP6A 1UKVY 4UNPA 1OYWA 2CK3D 3CRRA 3E70C 4NZYA 1JQLB 3PV0A 3WMFA 621PA 2IC5A 4IXNA 3CKLA 3I73A 2VP6A 3FFAA 4D26A 1CJKC 1CKEA 3CWZA 2Q3FA 3KUCA 4NCNA 1YR7A 2XSZA 4XWOA 1DG3A 5ANRB 4PR0A 5JWOA 3OEED 3GLHE 2FU5C 1UEJA 3KKNA 4LDJA 1ZU5A 1PV4A 3KQNA 4MRSA 4YXWD 2G1JA 1E2FA 2J59A 3C8UA 4NCHA 3AM1A 3B6EA 3K0CA 2AWNA 1G5PA 2XTNA 2Z83A 3EIQA 3MFYA 3ZYCA 4QKQA 2NZ8A 4QXAA 3P20A 4KITB 2CNWD 4DCSA 4UXIA 2ZRJA 5IT5A 4I1VA 4MH0R 2WWXA 4S35A 1SVWA 2QQEA 1KI6B 5H1YA 1OB2A 1KO1A 2R6CA 4NYIQ 2O8FB 3KJGA 2WAXA 1H8ED 2FN4A 2ANBA 1E2MA 3OIYA 2ZJ5A 2GRJA 1PUJA 2RHDA 3DZDA 2ODNA 4MYTA 3KJIA 3W3AA 4XVQA 1SVKA 4FCVA 3FKSD 3IO5A 3U3OA 3JZAA 3P26A 2JLWA 3GLGB 4ZCIA 2IEZA 4RZ2A 3GEHA 4BFXA 2D74A 4HUQA 1VYVA 1NKTA 5JSZA 2PT5A 5FTLA 1FW6A 3WHLA 4D0LB 1JR3A 3RWOA 2ZU0C 1NLZA 1GILA 2G0TA 2P5TB 4W5WA 5JI2E 2ZE8A 5EXXA 5B2ZA 3K0EA 1W36B 1W2GA 1FUUA 1YZNA 3WBJA 3FHOA 4HB2A 2F1RA 3ZIAD 4B3CA 4LHYA 2HEIA 2GEDA 4NCIA 4M1KA 1EG7A 421PA 4LPKA 4JLKA 2VSOA 5IDVA 4C3ZA 5F2EA 1XEWX 3IGFA 4LC1A 2BMEA 3ZDQA 4LY6A 5FPSA 1A4RA 2KI5A 4HZUA 4XH9B 2ODEA 3P4YA 3AB3A 1HT1E 1Z0JA 2XSZD 3AVUA 3SHWA 3ZH9B 4MUAA 3KQKA 4FN5A 3C7KA 2B7CA 2HXSA 1AQYA 3OEHA 4AYXA 2G0NA 4ZV4A 4PX9A 1ELOA 2ZQ5A 1MO5A 1ZD9A 5FOTA 4TMZA 3VMFA 3IPYA 1XXHB 4FMDF 3GPLA 3IILA 4DT1B 3U4QA 4GP6A 3WXMA 2XXAA 1EWQA 1C9KA 3K9GA 1Q0UA 5KNCA 2Z4SA 1VIAA 1TEVA 4C0QC 3PUVA 3T15A 4QNRA 1OHHA 1CTQA 2KSQA 3WY9A 3RC8A 5KSOA 1GG2A 2F3RA 4PC2A 2A5YB 1ZCAA 5A0FA 1SXJE 2WOOA 1XBTA 1KHTA 2BM1A 1OT3A 4M1OA 1W4RA 4UXJA 1G5RA 3PG5A 4NL4H 3MWJA 1YR8A 4E03A 2G3YA 4IRUB 1E2PA 2FA9A 3CX7A 1M2OB 3DO6A 1XJQA 5CYPA 1FPMA 2PCJA 2BEKA 4NMMA 4Q7KA 3S1AB 2H1LA 1JAIA 5K8UA 3QG5A 4F91B 1L7VC 4XOIA 3FE2A 3SJBA 4ON9A 3EA5A 1H65A 1F2UA 4NH0A 4Q4HB 1IONA 2DWQA 1VCMA 2PEYA 4M53A 4FD2A 3BH7A 4B44A 5JRJA 1JR3D 1PJRA 3CNOA 5TB5A 3A1VA 3VR4A 1LFDB 2VF8A 3KQLA 4DBLC 2DFTA 3SFVA 4OKSA 1N0VC 1AA9A 1D8TA 4Q9JA 4CEHB 2VP4A 1VHTA 3EPHA 1N2CE 5KPJA 1N0UA 5LBIA 4OI1A 2NPIA 2GILA 3VNUA 1MKYA 3NKVA 2GCOA 2GHIA 721PA 2ATXA 4U7DA 3AP2A 4DLRA 3LA6A 4RZUA 4KVAA 1VG1A 1X8KA 4C2UA 1GRNA 4LCBA 2ZI9A 5DE3A 5DI3A 1ZM3A 2ZRMA 3SI7A 3VX3A 4PQYA 4EFMA 3SQWA 1WF3A 3K0AA 4P31A 3LV8A 3OEHD 5E7IA 2J3EA 4ASUA 1YJ5A 3MLEA 4XVRA 2VLIA 3B78A 3EX7C 3EXAA 3KXKA 4RFSA 4WBSA 2G9NA 5E4FA 1G16A 4ZCMA 1XJ0A 1D2EA 1U2RA 4TMWA 1JEEA 3K0FB 4V0ME 2X8AA 5B64A 3AQ4A 1OHHD 3TSOA 4G3XA 5L3QA 3TUZC 1KAGA 4OHZA 3NHBA 5KU1A 2EQBA 3TSZA 4RKFA 2C96A 1MO4A 2X2EA 4ZKEA 3Q7PA 4URVR 1X8JA 2ONKA 2R6AA 1HURA 4YMSA 3ICQB 2WSMA 4Q00A 3RRZA 1ZUHA 4DDUA 1PLJA 1OE0A 1Q20A 2QMOA 3AVQA 2GAOA 1V5WA 1KMQA 3BFXA 2NQ2C 4JIMA 2BCGY 5L8VA 5TV2A 1OH6A 5DO9A 2ZJBA 3K0CC 3F0TA 3I61A 1GL6A 2Q6TA 2UVQA 3W8RA 4XJXA 3PVSA 1KJWA 1SGWA 3CR7A 2FG5A 3FMPB 4LBWA 1XEWY 4PQRA 4HB4A 1OIWA 3I32A 2VTKA 4LUCA 3M1IA 3CPJB 2XTMA 3DZ8A 1P2SA 4B35A 4OK5A 2OG2A 3DEFA 2J7PA 1H8HA 4CYMA 4XIGS 1Q1ZA 1ZIOA 2IW3A 4BZPA 4CRWB 4DC9A 4U5XA 1N6LA 1R0YA 2WMNB 2K5UA 3TBKA 4UNRA 4QC2A 1VYTA 2ZVQX 4CEJB 2R2AA 3KUDA 3ZS9A 3EZ7A 1FTSA 3I1FA 1KYIA 3QXSA 1NN5A 4DZZA 2A5GA 1G8FA 3AP1A 4ASUD 4JMPA 2JGNA 1II9A 1RRGA 4HLUA 1KK3A 4E5UA 4D4LA 1VKJA 3A4NA 2J0SA 4TLCA 2OAQ1 4II7A 2GZHA 3X1XA 5JEDA 3QG1A 1Z29A 5CB8A 3RRNA 3DKVA 1NMYA 2R9VA 5EE1A 1FQJA 2O8EB 4TQ9A 1YQTA 2J46A 2ZR0A 1OSNA 2YHSA 3R8CA 2I1VB 3ZQ6A 3BB1A 4KODA 4WZAE 1NN3A 3NTUA 2ZRLA 3R20A 4M1MA 4A0FA 2J0QA 1KI1A 3R9IA 3CPHA 3HDTA 4NKRA 1W0JA 1FTNA 1P9WA 2D62A 1TPZA 3C41J 3NIBA 2PLRA 3N2EA 4GZLA 4M9ZA 1KY2A 3O8DA 1Z63A 2C78A 1EFTA 5TMPA 2GF0A 5TVKA 3HR7A 4PC1A 3KFVA 3AGPA 4JL6A 4QNMA 1CJUC 4PZLA 3QSYA 1MRSA 3CX6A 2W58A 5CJ2A 3AVYA 1OXVA 1RRPA 1P9NA 4F4IA 2W6IA 3SYNA 2KE5A 1VCNA 1OKKA 5B30A 1JXOA 4BFYA 1NJFA 2JDIA 1WXQA 4M4SA 4LJ7A 3QPUA 4TL9A 4AC9A 3LY5A 2OE2A 1L2TA 4LBVA 1F5NA 2OFXA 4KXFB 3GJ0A 5EUMA 1AKYA 4TTPA 3FDIA 2J7PD 1H8HD 2ZITA 2AD5A 2Z0MA 2JCSA 4YLGA 5DHAA 2QL6A 4C0LA 4ZIRA 5CDFA 1KSJA 1N6HA 2WM9B 2G88A 4NTZA 4UNSA 4CVNA 2JAQA 3Q85A 2GTPA 4POAA 5EP2A 4DKXA 2CLDX 2VL7A 4NU0A 1TQ4A 4LV6A 2IUTA 1D6JA 2BBTA 2P2LA 1YU9A 4ZI2A 3DPUA 3OAAA 1G7RA 1TMKA 4O25A 4EJSB 1EFRA 2GBLA 5BWMA 1KI3A 3FWYA 2IYYA 3R7WA 2ZJYA 3P27A 1S1MA 4QJ5A 1J70A 3IPXA 1G3QA 1CR0A 2G77B 3B1YA 1QZXA 5D3MB 1NVXQ 1O87A 2ERYA 2YWEA 4GOXA 3DKPA 1J2JA 1E2IA 1E2EA 1Z5ZA 2FPKA 1T3HA 1T8UA 2J41A 8OHMA 3Q3JB 4WAUA 1SVIA 4HAYA 3BD9A 5FL3A 1KZ7B 4URUR 2ZSDA 3NBFA 5DSZA 1ZNYA 3ASZA 2A30A 4R98A 3I4LA 1QHGA 5H68A 5BYKA 5LDDC 2ZXUA 1DAEA 3KTAA 4D4JA 4WIAA 4M1YA 2ZSAA 4JLPA 1Q1BA 1FX0A 1RYFA 2O5VA 4ESVA 3TH5A 3BH0A 1R5NA 4QM6A 4RSGA 2OBNA 1WE2A 3ZVRA 4C9BA 4OYHA 4LV5B 3SJZA 5C4GB 2X77A 4FMDB 1ODFA 3MD0A 3BGWA 4MRPA 4HUTA 1VG0B 3NEJA 5GJWC 3X1ZA 1E79D 3QXJA 3HYTA 4L9SA 4FCWA 3WMEA 4PAOA 2W6ID 4IOJA 5JLJA 1KJYA 3PUWA 4V02A 2C04A 4DVGA 1GIAA 1N6PA 1OKKD 1GRQA 2PZFA 5JWRA 1W5SA 2JDID 4PZZA 1QBKC 5LB4A 1NVUQ 4P0TA 4Q7JB 2P0EA 2PT7A 4CF7A 2HT1A 3WYAA 1WP9A 2YKGA 3H86A 1MABA 5HCNA 2CCGA 2W2VA 1K5DA 5SZKB 4B71A 4YMTA 4LJ4A 3FYHA 4I1OA 3U44B 1NF3A 1QG4A 2H7VA 3TRFA 5EE9A 1XF9A 4LGMA 3AKCA 1E99A 1XPOA 3NBXX 2QG6A 1IXSB 4US2R 1E69A 4KBFA 2VO1A 1X3SA 3NH6A 3ASYA 3TLXA 2RGNA 1ZP6A 3RWMB 3LX8A 4FXPA 3WRXC 1EFRD 4DSTA 1GSIA 2ZRCA 1VCOA 1E1RA 2J87A 2N42A 1CP2A 4MITA 4OHVA 3RRMA 4B48A 4RD3A 2P5SA 5FFMA 3X2SA 5JS8A 2BBSA 2ORVA 1QHHB 1M74A 4IEIA 3GFPA 3AGQA 5JWHA 1DG1G 4JLNA 4OL0A 2X1VA 4B73A 1Y63A 2P67A 1VCIA 4MYUA 3RNLA 4DHEA 5BN3A 3GCGA 1OPXA 3L8ZA 2VIIA 2H92A 4AD8A 4GDFA 1ZM7A 1TEXA 2GCPA 1RPZA 1G20E 3K70B 2BJWA 1W46A 1ZW6A 1I4LD 2CVHA 1XD2B 2VBCA 4A2WA 5FOUA 2MSDB 3K53A 4FI3C 3RC3A 4EUNA 3ND8A 3BJIC 5K8LA 1TUEA 3ZVNA 4NPHA 4A0GA 1XTIA 4JJZA 4A0HA 1JPJA 1G19A 3CRW1 4HLUC 4I1UA 4M9XA 3A37A 4ZCLA 3CPEA 3QE0A 4TLAA 1AM4D 2QEQA 3ZLJA 1CRQA 2QP9X 4D80A 3QENA 2DPXA 4ACBA 5AR1A 5G40A 1IAQA 4HLDA 5FUVA 3PXGA 2ZJZA 1K5GA 4A9AA 5KYKA 1NY6A 1SXJB 5IK2A 1OIXA 4A8JB 5FBLB 1CRPA 1BYIA 2ZEJA 4AK9A 3B2EA 4LJ5A 1KJZA 2Z4RA 1XZPA 3J81k 4B34A 2I3BA 2HCJB 2WMOB 1U90A 4LYJA 4OBEA 4EPWA 3HPRA 1Z6AA 2XZLA 1R0ZA 2JLVA 1R6BX 1YHNA 1IN7A 1A7JA 3ADBA 3JVVA 2HCBA 2XX3A 1Z47A 2WWWA 1KI8A 1G8YA 3ADKA 2CE2X 4P4SB 4AIIA 1SVSA 5SZHB 5L3VA 2BWJA 4MYCA 1YKSA 1E1RD 1UDXA 3ZZ0A 1UKYA 4GPTA 4TTQA 4C4PA 1BIFA 3VTKA 2ZJ2A 2IS6A 3LVRE 4WXPA 2EFCB 3WP1B 1L4UA 3V9PA 2HF9A 1N6RA 1DAKA 3LLUA 1LY1A 3Q72A 4W9MC 5AK0A 3VQTA 1TU4A 4G5OA 2YJTD 4Q48A 2FH5B 2P6UA 3FHTA 4PSVA 2ZM5A 3KDSE 2IA5A 2NO0A 2EWVA 3U61B 3QXCA 1G8HA 1UBGA 1XD8A 4G5RA 4B76A 3CF6R 2MSEB 2CXXA 3EASA 5AJZA 4TL8A 3UG7A 1XPRA 2O8FA 2JASA 3TJZA 1ZUNB 4Q1BA 2UZIR 5CB6A 4GOKA 3IIJA 3GFTA 4QBFA 3FKQA 3UMSA 1JXMA 2KJQA 3W9YA 3OE7A
chains in the Genus database with same CATH superfamily
4EFDA 3AIOA 4P7GA 1JIUA 5F76A 1TQ8A 2PANA 2V7BA 3ZLVA 4II3A 5G3YA 4B79A 3U4DA 1O2DA 3PC3A 1P2VA 4B5LA 3W5IA 2AT1A 4BNMA 4C4XA 4DANA 4RGYA 4GYWA 4AKSA 4D8TA 2FX2A 1MC1A 3D1LA 3GMTA 4X7BA 1HNXB 4RCYA 4WVFA 2O14A 4RC9A 4DLBA 3S55A 2OBYA 4C4SA 2TS1A 3FPGA 2NU7A 4DV4B 4WEOA 1O7JA 2REOA 5E3IA 4HDMA 2OPHA 1VGVA 1L7DA 3LQQA 1K7EB 3CZ9A 1GDDA 3LPLA 5JARA 5LDHA 3VSEA 5G1PA 2QSZA 5J43A 1AUOA 4FYPA 3UT5A 1PLLA 3FRIA 4D4KA 1JECA 3LC7O 2B2NA 5CG1A 5IW8A 5HPYB 3OJEA 2X0RA 1BTOA 4UQOA 5D5PA 3ZCVA 4HQ6A 1P9LA 4I8IA 4CQLA 3IIEA 3C16C 2QTFA 1Z4MA 2VDLB 5CLIA 4RQTA 1SC9A 4PTZA 1LWNA 4FX2A 1Z26A 1YA8A 2ASEA 3ODGA 5J4YA 4L9AA 1LPNA 2XADA 5E1OA 4AJNA 2O3UA 3DXYA 5C51B 5LQJA 2IPOA 2YNMA 3EFOB 5AI5A 3GHHA 4ETMA 3WI7A 2M9MA 1OWPA 5JJLA 1KAHA 5F73A 3P1JA 3CJTA 1Y6ZA 4LWQA 1C1YA 4PU0A 4QUBA 4NMWA 2W0SA 2WUFA 4PZ9A 1X7YB 3L7BA 4YDHB 3ZE8A 4LRUA 1NIPA 4DNFA 2AMYA 1Q22A 1ML3A 4ZDIA 3UMGA 3DR5A 2CJFA 4RIIA 3FGOA 5A5FA 2PTGA 2FTKE 3GG9A 2OYCA 4OQQA 3F74A 2HF8A 1QH1A 4HPWA 5A3QA 3QPCA 4Q34A 1MXFA 1UQTA 1XLTC 5JPIA 4DDHA 2GCNA 1FP1D 3BK7A 3UOWA 2HWKA 4FQ8A 4EW3A 1QHNA 1ORHA 4WOKA 3ZDFA 3BKXA 1M2OA 4Y6LA 4QT4A 4YMWA 1FSPA 3IQZA 3OCZA 1QO0D 2COEA 4Q16A 1QO7A 3G8YA 5KTNA 3VZQA 3NVKI 3JYQA 3AKYA 4RF2A 5REQA 1DX6A 1N75A 4FLMA 1JKIA 1RLUA 5C7IO 3BQMB 4L7VA 3N0WA 4GOJA 5KYYA 5FAXA 3ZV3A 3ABRB 1O6FA 2BJVA 5BVGB 1CJVC 4TQAA 2XJ4A 3HDJA 5PGMA 1VMAA 5TNXA 4J7XA 3U2QA 3LTNC 4JI2B 3ZDYB 4MGEA 2I4RA 4XPZA 3AF0A 1GLGA 4BE7B 1HH4A 3NWBA 1UCFA 4Q7EA 1XMQB 1GKLA 3WLRA 4G1BA 3GJZA 3QA9A 3GC6A 3R0XA 4UTOA 2VJYA 5DYNA 3ZWXA 3O4VA 1X74A 5A6VA 2R87A 4WZAB 3PHIA 3ZTWA 1EVLA 4RV5A 1NM5A 3UW1A 2VK2A 3ADOA 3AK4A 3CUUA 3E2PA 4L7QA 1HYBA 1SR8A 1T36A 2ZAIA 3ZS8A 3H42B 2JAXA 5F64A 4NXNB 3BOSA 1SVOA 2ZCVA 3C2QA 3U6KA 1XHEA 1E9CA 1GZ4A 1XTQA 4YJHA 1KA9H 3NH9A 1U2SA 2FB9A 2YMLA 2P2NA 3C14C 1RXYA 1SKBA 1I0IA 2QAIA 5JAUA 3W3AH 2JCGA 1M5UA 2PLFA 4TMKA 3KQHA 3KZOA 2HJVA 4PHFA 3ZOKA 2BRUC 1R8SA 4DOMA 4QIHA 3GZJA 1JN0A 3T1OA 3D1VA 3QKRB 4TV8A 2WYOA 3ZC3A 3FCSB 2ZJ4A 3OMLA 1EAYA 5DNEA 3KSUA 1P4RA 3VC7A 3G0HA 5GADl 4WV3A 4P3PA 4FT2A 2J9GA 3C8DA 3ORHA 4YUWA 1M2VA 3V1YA 1JHOA 3CFYA 3KV1A 1SIUA 4NPCA 4WDRA 1LBEA 4MRNA 2REXB 1XDDA 3CJRA 3QVLA 1YDEA 3CIFA 1NBWB 2WJIA 4GG1A 4JGIA 2XWSA 4MGIR 4RD1A 3DV2A 3WB0A 4YPOA 3DMNA 5CP8A 1K7YA 1SEPA 5LZ5A 2QYHA 3IVAA 3IR6A 4ICIA 1NUPA 4X8OA 2FE1A 3SXPA 3USES 1FL9A 5J2TA 1IQRA 4IIJF 5HKKD 1EUDB 3HR4A 5MN6A 4XLLA 5T6BA 3UHPA 5K0ZA 4OI4A 3ZU3A 5IXSA 1TJYA 1Z0DA 5FD8A 1ISHA 1M83A 1FNCA 2OVBA 1IBLB 2O06A 3LKDA 3PC6A 4XQGA 3B2QA 3UHAA 1F3OA 2JFXA 4AJLA 1XRNA 3KYBA 2ZYRA 4Q15A 2V3WA 4BNZA 4OTZA 4U2EA 4DCOA 3ZTTA 1W5TA 1SXGA 1VPDA 1U99A 4WLFA 3OQMA 2UYQA 3B48A 3O0TA 4FBGA 4FSHA 4G25A 4REMA 1O97C 3WVNA 4IW3B 4LKRA 4R8LA 1QCCA 4Q37A 4MJ7A 2OPBA 4OATA 3LDAA 4E11A 1SULA 3GEDA 1FVHA 4D6XA 4EPRA 1ZH6A 5K05A 1HG0A 5B55A 5FTMA 1F4VA 3NHFA 5FI3A 2PPVA 1UJ2A 2QR2A 3EGEA 4URHA 3M4ZA 5FUXA 4LEIA 4RX1A 2GF2A 3O21A 2J3MA 1Z2NX 3N07A 1RZVA 4O2RA 2CXTA 4A10A 3KCQA 3L8YA 2WFAA 3GMDA 4R0MA 1BD3A 1S1CA 4MW6A 5LD2B 1ZJJA 3H2IA 4ZT2A 5HQTA 2OECA 1U9CA 4UFPA 1UMDB 1KOFA 1QB8A 3LUCA 5HRCA 1EUCB 2ACKA 3JZMA 4EGSA 1KXJA 3TAHA 4DR3B 1EP3B 1MVNA 1HRKA 4J2TA 2F17A 5CD1A 3VZDA 3RLIA 4FUQA 4UJ3A 4O4IA 5KO2A 1GWNA 5C5IA 1P60A 1V45E 4D3SA 1FXSA 4I9HA 4LXXA 4C78A 5LKAA 5CAEB 1U1EA 3RC2A 3THWB 1KAOA 2MYUA 2I99A 4PTLA 3PBKA 4A91A 4AKGA 3A1FA 3FLBA 1NUSA 2XIQA 2MINA 2ZSIA 3KVNA 3V32A 2Z2JA 3VPGA 1H3FA 2VT6A 3UAWA 1Q50A 3IESA 3I1JA 1C4KA 1VL5A 3KZMA 4PYKA 10MHA 1WZUA 2G7ZA 2H65A 3KQQA 5J5VA 3GZNA 3I2JA 3P9RA 2O8EA 1FJXA 1NWCA 4JI4B 5DTQA 1B7GO 1KEWA 1PP4A 1U2DA 1UKZA 2Q0HA 4RWEA 1T9HA 2OZEA 5FHQA 3RQSA 2HK9A 1E2BA 2UZ0A 1X86B 1C1DA 5I8ZA 5TMBA 5K3AA 5J47A 3N53A 3DVSX 2W83A 1OXBB 3EVZA 1Z9BA 4XM0A 3WIDA 5KZMB 1Z6XA 4OH1A 2LP4Y 4ZMRA 3NASA 2CN1A 4JGBA 1NW3A 1Q16A 2QNRA 4JHLA 4JUAA 5CFLA 2LIPA 1DADA 2NG1A 5KQMA 2Z04A 1G9TA 3QJ5A 4RY0A 1DIGA 4IGEA 5AKEA 1K88A 4K9QA 3DLIA 2IXBA 2FY8A 3R5TA 5LJLA 4JASB 1AMNA 3QX3A 2DKFA 3Q4GA 2W4QA 3PCRB 1A72A 1R4NA 3IP5A 2RAPA 3G23A 2W6JA 1PQYA 3TCKA 1D6NA 1MXHA 5JEEA 1DJOA 3M6WA 2XZPA 5K9ZA 2GUGA 3A9UA 5EIEA 2G07A 1XWWA 1XCGB 1MEJA 2OORA 2Y9PB 1GJRA 3PD1A 1OGJA 1T3SA 3BSFA 4YACA 1VKNA 2XZOA 1HR0B 3PKJA 4MUYA 3UK1A 2MSLA 1NP6A 1LNQA 3RUEA 3UQZA 1FYXA 1O4VA 1BMFA 2R5FA 2ZI5A 3WLEA 1DLIA 1JP7A 1UBFA 1YRAA 1Z7EA 3DE6X 2AB0A 3LLSA 4J0GA 1JV2B 4QXMA 3WGKA 5JJBA 2CBZA 1CIPA 4G1FA 3FKJA 3I2FA 1UBHS 1PEYA 2YS6A 4J90A 2C8VA 2X9QA 4FT4A 1YR1A 5EZYA 1MJFA 1X94A 2GVZC 3I28A 3UMYA 2OMKA 4Y6PA 3IV7A 1NIJA 1Z6YA 2A1UB 1A77A 3VJKA 1I80A 3PXEA 1WP4A 3JQEA 1MO2A 1NW7A 2GFHA 4Q6BA 4MGYR 2ZUCA 3HPQA 1QRDA 3T7RA 1GKIA 4KPFC 1JALA 3SPXA 4D99A 5IKEA 4E5NA 2GEKA 5CFQA 1EFVA 2JHAA 2YMPA 2YJ6A 3EGDB 3QKIA 2GCEA 3VGPA 1DOAA 3WRXA 2QE6A 1W93A 1UINA 2CLEB 3AI3A 4DQKA 2JAUA 5HJ7A 1A8QA 3EZ6A 3ZI7A 1KDRA 2CHQA 5BOVA 3HYLA 1JBQA 1V9SA 1C8KA 1R74A 1OJ7A 4QO8A 4EUKA 3VR2A 1N34B 1ZNWA 3TECE 1UJMA 4O2AB 1N8KA 1RWMA 1SIOA 2J9RA 3QIVA 1VCHA 5E7QA 4DARA 1E2HA 1T9GS 2ZB7A 1IM2A 3L7MA 2VFAA 1K86A 3BWCA 3OE4A 1Z2OX 5HQ3B 3C43A 4DRZA 1G8PA 2JJ2D 4ZAWA 1GPMA 1YSCA 1KL7A 4M98A 2H7XA 4Y1RA 3PNSA 3LT5A 4ZXFA 3T94A 4B09A 4ZCTA 4GECA 1LLUA 3ES9A 4KQKA 1Z6ZA 4LZNA 3OO0A 2VDRB 2J0EA 1AKMA 1QK4A 1BKDR 1YC2A 1U7WA 2H00A 1XKQA 3S2UA 3WGGA 2B9VA 3E9CA 4Z7OB 4MQEB 4HF7A 4G0WA 5EHNA 4GO1A 4RD2A 2C7BA 4F84A 3UMCA 3BJEA 1GTMA 1P72A 2XHEA 3H97A 4HNSA 2I5PO 2QI9C 3IDSA 1WD5A 4AWAA 5HKOA 4EG4A 4MUBA 3VU8A 5C1BA 2XNKA 3TSYA 4F1WA 4UE3S 1P4HA 2E4XA 3UJNA 2IYAA 5HOQA 5IAGA 2PMBA 4EIWA 5JAHA 1QH9A 2PA0A 2IRWA 1RJDA 4TWJA 1IJEA 3EIFA 1TTPB 2DY1A 1UMBA 3MELA 4LOAA 4D45A 2WJJA 1VL8A 4QU0A 1JE0A 1B8NA 2WQ7A 4JP1A 4MAAA 5HFJA 3HR8A 1GFSA 1Y4ZA 3OJWA 3PXBA 1XTRA 1KAEA 2PUVA 1Z5PA 3JQQA 5D3QA 5EXTA 3I01A 3PWTA 3CNHA 2XA2A 3C85A 4I99A 1ZOIA 4HDCA 5DBEX 4K9RA 5CFRA 4LXUA 5JDCA 3SHOA 1BDIA 2IHYA 5IJZA 3KHSA 1ATZA 3OTWA 2HBRA 2VT7A 5G4KB 1CQIB 3CPSA 3LPCA 3V4OA 1TIPA 3EG9A 1G2IA 1QRRA 2C2HA 2EWMA 2FQWA 1QPBA 2DFLA 3FAZA 3IVRA 4X93A 1BMTA 5AO9A 2Z8YM 5JCOA 1YDMA 2FUEA 4D3DA 4IGIA 4HWSA 2K7ZA 2Q2NA 2JVIA 3JQFC 5DKFA 5IBCA 1NJ2A 5K0JA 4B7UA 1N7IA 3MQ4A 4GKVA 1GTZA 2ZRIA 3A4MA 3ETNA 4ZPXA 3IAM1 1WDMA 3FFWA 4RY9A 4ZZ1A 1U7ZA 4JOCA 3ROZA 1YONA 3HP7A 4N41A 1O3YA 2YR0A 4RHCA 4XX0A 5C18A 2XD4A 3MIZA 3TB6A 3U49A 1SBYA 5KINB 2V9CA 4ZC1A 3TLJA 1NNUA 3E8SA 3B9PA 4LJSA 2TRSB 4BIMA 1GQOA 2FMHA 2Y2UA 1UIMA 4UHJA 1N4AA 3TMKA 2E21A 3D0QA 3RSGA 3ISVA 3D6AA 1WKCA 2PVSA 4WKBA 4MYRA 2QLBA 2CVFA 1W0KA 1ZK1A 4JJ6A 4QDOA 3KPJA 4D3YA 1GNSA 4OB7A 2E4WA 5A0TA 2EP8A 3TK1A 4JOSA 3S28A 2IOFA 4U7GA 2CYBA 1EEHA 1VBFA 3KG2A 1DEKA 2XOKA 1C2TA 1G3RA 3BF8A 3CO5A 3OJOA 5AHRA 3VU1A 1OH5A 1KMNA 3VH3A 1EVQA 3EYAA 5JHHB 3E0XA 3EDCA 3TI9A 2PSJA 1SELA 4HADA 1QP8A 4WXHA 2VK4A 1P4GA 4Z2YA 1UBEA 3B1JA 3A04A 4ENPA 5BMVF 3PLRA 1B3BA 3CNLA 1C30A 4A8JA 1K6JA 1T4CB 2NU6A 1Y1RA 3CONA 4Y6SA 2CHGA 5DK6A 3U3KA 5LM3A 4I0WB 1GYPA 2R6DA 2CEAA 4KDRA 2Y0EA 1AQUA 1LA2A 2V98A 2WILA 3P96A 3I2IA 4H16A 4DJ5X 1KZYC 2ZUSA 5CDUA 3L01A 2AH5A 3ESAA 3JW8A 4NYMQ 1WHSA 2FJUA 2VZLA 1KVRA 3QVUA 5FNZA 3D3WA 4KQ9A 3B1ZA 4LISA 3MJCA 3O2SB 1L4LA 4F3YA 3PKIA 3HVUA 4MUMA 4XCVA 2AD1A 5H70A 1IUKA 2I6UA 4D6PA 2NPOA 3A9TA 3CB4A 2FNAA 5ILOA 3JD1A 4RSHA 2B4RO 1OFTA 3LO8A 1KERA 2I4TA 3Q7SA 4L5AA 2VCHA 1IHPA 5HJ2A 3CRVA 1QR2A 3K70C 2VNJA 5E3HA 3WBKA 3GWZA 2IH2A 4Q05A 4EVQA 3BTUA 5CA0A 3ANNA 3OQBA 3FPJA 4XSGA 4MINA 4C43A 5I01A 5EE5B 2P2ZA 3HU1A 4EKDA 4D0NA 5AW3A 5AW8A 4NLLA 3OHMA 1T10A 5B12A 3PI6A 2V54A 2AOTB 1L4BA 2HQOA 2P5YA 3GT3A 3ICOA 3PQCA 4KYVA 3OFVA 4RIEA 4Z9FA 4GUAA 2YC2C 4BRZA 4F45A 2PQ2A 4I46A 3WB9A 4MV4A 2IK8A 2VEDA 3L1UA 5CT8A 4IIUA 1H2BA 2BFOA 4JBXA 1TF7A 3B3FA 4Z51A 1N6OA 3K0HA 4H7KA 1FXWF 2AJTA 4P4TA 1OAOC 4QJBA 2BEJA 2PRYA 4LTDA 4R83A 3AR6A 1DTSA 3EXIA 4UATA 4LBZA 5EUBA 3ZIDA 2FGKA 1MO6A 2X3UA 4DXHA 2QBYA 5K3DA 2RGAA 3DBHB 2RD2A 1QX4A 3PQ6A 3GF4A 1ZVMA 3RYHA 2PL3A 3DOCA 3QF4B 1OWMA 5F51A 5AIBA 3WBBA 4TL6A 2KBFA 1WPQA 1KQNA 2PNJA 3M3HA 3WQRA 4B32A 3K6SA 3ZVRA 4B7CA 4JN6B 4HGOA 3ZCUA 1T2VA 4EJSC 2XH8A 1IHDA 1PT9A 3FNHA 1E8DA 2WE8A 1FMJA 4W1SA 3JVDA 1S02A 2WVJA 4QUKA 7YASA 2JH3A 1FRVA 4P7KA 4V0MA 3RS2A 4S24A 2GEVA 1J2EA 3DC7A 2A78A 1O0BA 4XGIA 1T4DA 2QV7A 3N7AA 3W1VA 1WTAA 2BZ1A 1SXJD 4WA8A 3OF5A 3T5MA 5K0LA 2JIBA 2OUKA 1C0LA 2ODAA 3REQB 1VIDA 3ROPA 1B0AA 2QVGA 1WVIA 4PWZA 1LTKA 2IPLA 1UXKA 4PBSA 3MTIA 3R76A 2JD0A 2IHNA 4JLMA 3QA3E 2UYCA 5JSUA 3DMTC 4F93B 5KYXA 2QRNA 2Q3EA 2ZPTX 2I3DA 4YAUA 5JATA 5CNJA 4FFMA 2CVQA 5KNDA 3KYJB 1H9CA 4OJKA 4Z4EA 5E38A 5C8VA 2HRRA 4BQIA 3A3YA 2QNBA 4YJ2B 5C31A 3BXHA 4GI5A 4PRLA 3I83A 3FMIA 2ORED 4QYSA 1JR4A 3V4RA 5IH7A 2F3TA 3FW1A 1XB2A 1R27A 2ZTLA 4IS2A 3WBFA 2HT6A 1NT4A 2P2DA 2ZSEA 1BOFA 1ZIYA 1KYVA 3EFOA 3ZY5A 3P9KA 3HLYA 2QG4A 4GP7A 4JXXA 4JEMA 3SZ3A 1L6RA 4CW7A 2OCBA 2WV9A 3NKLA 4MKRA 4PPGA 3Q7EA 4QPJC 3VKWA 4CEIB 1K8YB 3U3ZA 1L5OA 3H11B 2WR8A 5H3HA 1E9FA 1SQGA 3KB1A 1X7YA 4ZK2A 4XWAA 1GDTA 3L2OB 3G2QA 1EDOA 2DPGA 3I9JA 4WT7A 4YQYA 1BEUB 2FZGA 3DAGA 1TF5A 1X1CA 2HHHB 3NRJA 5LLSA 1JLRA 4RW0A 3MYYA 3G5TA 3LLMA 2BMJA 3A3PA 1Y5MA 3HB0A 4MPPA 4G8CA 5CNIA 2FK7A 5I45A 1I24A 1MTZA 2Y1EA 4PN7A 3E5HA 3EY9A 2DT8A 1Y7PA 4QBGB 1K2VN 5DLPA 4BB6A 1W5EA 1SCUB 2J09A 4DA8A 3GLFB 4NCJA 5JECA 2HD4A 4QX6A 2KQUA 1A3CA 2IHTA 4RIHA 4D46A 2OL4A 3V1KA 1C9EA 2GHRA 3CNNA 3SDSA 3GQVA 1P0FA 4KO2S 3UWDA 4AULA 2OV1A 1J33A 3IBGA 2GPBA 3NANA 4GWGA 4BZZA 4A36A 1OC4A 1CZRA 3E15A 2XB4A 3OT5A 5BWNA 5BVGA 3EZFA 3KK0A 4MV9A 3UGTA 3MGKA 5A71A 4DLSA 1PZGA 4P2GA 1B42A 1KHHA 3VOTA 4YJ3B 3LC0A 2VS1A 5KHOC 4XQ0A 5K09A 1Z0UA 1X1RA 4Y0AA 2DHEA 2E3JA 3SS8A 2RIRA 3AOGA 3NBYC 2CLFB 4WZAA 4DRXA 2JCBA 1ODIA 5CDHA 1VLZA 5DLEA 5GWXA 5C46F 1IC6A 2PO5A 4KXUA 4KWEA 4IJKA 1XCLA 2R8XA 5FEUA 5LOVB 2RARA 2VJMB 3C98A 3KB6A 1P1CA 2QZPA 2PZ8A 2QTLA 4OP2A 3SKVA 3SYMA 1UBJS 4US1R 1IB6A 2O2JA 3RYFB 2DFKB 3JSXA 5KOYA 2YWDA 2NO5A 1B0ZA 3BDVA 3LZDA 4LOKA 4BKOA 2I4IA 5ALIA 2PZEA 3DAPA 4WZ6A 4E09A 4G1CA 1KSFX 2GEBA 1GTG1 1JAHA 2PNFA 3BCUA 3QKRA 8GPBA 3U5TA 2RGYA 1EUYA 2G6BA 4IX1A 4XWWA 3SKXA 1NJ1A 2Y0CA 2YWJA 1PWYE 1PX2A 1Q1QA 3AIMA 3D7RA 2W6MA 4RZSA 2GH1A 1IIRA 2FX5A 1XRQA 2X4IA 1M2FA 4JUFA 2Q07A 5G3ZA 2VJLA 2ZSHA 3F7OA 2P8JA 3HZOA 1PGPA 3L7DA 1V96A 3DMDA 4HMQA 4I81A 4I3HA 3X0DA 5FTJA 5THQA 2DTDA 4UM5A 1WABA 2BHTA 3RHZA 4KV7A 3PCTA 5JVDF 4JC5A 2BI4A 4NCXA 4YCCA 1WKVA 1G291 4UE6A 2C5LA 3KQOA 1EH5A 3OJFA 4O4JB 3ENKA 2XIJA 2J5RA 2KWIA 1EUDA 3PDCA 3KR1A 1R2QA 1WCV1 1BN6A 2XVXA 2VWPA 2WFZA 3GEGA 3L7JA 3OKFA 4WXRA 3O1LA 3VHXB 1P9RA 1XTJA 3EJWA 3UXEA 1E1QA 1WOYA 3ESBA 1UFKA 1M1YB 2VSXA 3RRXA 3PC4A 4IR7A 3KAJA 1C14A 3PHHA 3S5JA 3T06B 1V4BA 1Z33A 4YLYA 3KAKA 4WOJA 3B38A 3GYBA 4GXTA 3I3SR 2JGFA 4JD5A 4JKYA 2BGMA 1PYGA 821PA 4E12A 3VPHA 4A0RA 3RDPA 2HPAA 2PMDA 3PSHA 4QECA 1GUAA 3T34A 1RRKA 2YJ3A 1G6OA 5KTMA 1ZMBA 3ZHRA 1GQ2A 1VYUA 1EGMB 2JAHA 1NVBA 5EUCA 4Y1GA 4BTVA 5M7EA 1DVRA 1RT9A 2F64A 2F3SA 2J7KA 1J00A 1XCPA 4I4NA 3G88A 3B85A 3FXAA 2JIDA 4NOMA 2V7XA 5FXMA 1SCDA 1U0HC 3CZQA 1YU6A 4OQNA 4X20B 3J7TA 2OHOA 4YJFA 3CWCA 1Y42X 2AJBA 4OHXA 5KSPA 4BKPA 1D0IA 2WW8A 2CL0X 3EQ6A 1JA1A 3H5RA 4B85A 5BMOA 8LDHA 1ZSYA 3IH5A 1IBRA 2XR1A 1OFGA 4D92A 3IDFA 2JLAA 3J80A 1UMDA 4PPYA 3FCEA 3QKSB 4OHOA 3K1AB 2O7VA 1SOVA 1EUCA 1U1GA 3TAUA 3UGJA 4DV2B 3PUHA 3KYDA 4LE0A 3FGZA 5E2AA 3ZGVA 4IH9A 2R7MA 4DN6A 3GLTA 1LXCA 3L4BA 2X5NA 3P4XA 1SKQA 4FX5A 1A8IA 5HXAA 2AFHB 1SHZA 4WKGA 1KYWA 4ZXPA 4BVFA 5CAEA 2W00A 2ZVPX 1JB9A 3DSRA 1OZAA 3M6IA 3OBIA 3THWA 1S8NA 5IPFA 4RSRA 1LV7A 2C2ZA 2CSXA 3LQFA 4IOMA 3U60B 1MGPA 1UPAA 2CVPA 5IM4A 3KZVA 1B6RA 1ULZA 2OFWA 4MW7A 1PWHA 1VLHA 5FUWA 4NABA 3GJRA 2P9QA 3LT0A 3ANXA 3SKYA 1RHJA 2V45A 3BPSA 4URXR 3HCOA 2BKUA 2H8GA 4GX0A 3FTPA 3FBGA 2GBFA 3DEAA 1KPGA 3RAGA 2A9PA 2ZETA 5BXQC 1IN4A 6PFKA 3D5EA 1RPTA 3PE3A 4RFVA 5ALSA 1PL6A 4N0DA 1FDVA 3PJRA 3IYLW 4L74A 4QQKA 4RL6A 3OE5A 3DEKA 3KLBA 2PRSA 1XTVA 1UBLS 2FR8A 5BN4B 2I2FA 5K01A 4FEYA 2GJ4A 3CF0A 5JYDA 4UU7A 3S3TA 4V0NA 3VBCA 1CVIA 5AUPB 4F2GA 4NS1A 1W4LA 3PDWA 4B4DA 2A5FA 2QAGC 5T5QA 3LAWA 2FP4B 3RG2A 4JS0A 1F5SA 3VZRA 3PWZA 4NOJA 1L3BA 3VX4A 1XMXA 3H9QA 4DLLA 3K32A 4OHWA 5TGDA 1TVKA 1M7BA 3LSTA 3ML1A 1I3OA 5HYVA 1PS0A 2VSFA 3L1HA 5F9MA 1HZJA 3T7KA 3KQTA 1V11B 1TECE 3NWPA 2PWAA 1W5AA 3UAYA 2OB1A 3MFQA 1D2NA 3UXYA 3DE7X 1BROA 1XPUA 4K88A 2ZUBA 1GFIA 1DBRA 3AHEA 1GTVA 4DCPA 1JLLB 3JZDA 2XBMA 4UM8B 4EKNB 4ER3A 3VDNB 4BNUA 1VJ1A 5DASA 4M7OA 3WHKA 1XCJA 1GG5A 1IBKB 2O0KA 3A6DA 3W7BA 5A5EA 5HUJA 1FVXA 3Q6IA 1M8PA 4KRFA 2O8BB 2QDXA 2CL5A 2R8ZA 3QPDA 4ZVMA 3RYIB 2OBFA 3SZRA 2WTUA 4DLNA 5MFPA 3H3FA 1OVMA 1Q0HA 2Y9MB 4H31A 5DLDA 5FF9A 3RSQA 1QVWA 2JI7A 4OUKX 1KYTA 4PSAA 1KI2A 1K68A 1W76A 4IOLA 2OXTA 3RYTC 3H4MA 5A4KA 4OMDA 1Q44A 2PUEA 3AY3A 4MO2A 1YULA 3UUEA 1YVPA 2J4FA 3WKCA 2ZIEA 4RHEA 4BMZA 3NKFA 4QVGA 3QFHA 2IITA 2GBGA 2G25A 4Q3NA 1Y48E 8ADHA 1NLYA 1Z7WA 3EWAA 2ARKA 2VPPA 4MYDA 4RZIA 2HZ7A 4RTOA 1OI7A 2EX0A 3H4TA 3H1BA 4EF6A 3UAGA 4O2AA 5BYJA 3A6EA 1PQPA 5LWQA 2BMFA 2HNBA 1UJ5A 2V6GA 4XD2A 3F4LA 1ULHA 2FSVC 2KX7A 5BO5A 5HQ3A 5JQGF 3GLIB 1VRCA 4Y18A 2GB4A 3VGJA 3AKDA 1R6XA 5J58A 3AQIA 5HQJA 3A70A 2GEUA 4ES6A 4XJSA 3AYXB 3UWSA 3WJ1A 1E58A 3Q40A 1CDZA 4EHAA 1NQTA 2QRVB 5JCJA 3DL7A 3M1YA 1JQKA 1LI4A 4XGRA 3DOJA 1E2QA 4DIOA 3SK0A 4BHTA 5IMSA 5DVZA 2BZ0A 1KEZA 1S96A 4PLCA 4QOFA 4M36A 2JJ1D 1VPTA 3SZOA 1WZIA 3W4KA 1YNSA 4IZ6A 4MQEA 1NG1A 1UIRA 4OHKA 4X1KB 3CCBA 2DU8A 3FYTA 3QJYA 4ZA2A 4JKIA 1WTCA 3LA8A 4JQOA 2FEMA 4QBIA 2BE9A 3DKIA 2OM2A 2FKNA 3HO8A 1PL7A 2OC9A 4MW5A 2OXFA 3JALB 3FZGA 4D8YA 3E4DA 3JQ9C 2AX4A 3TZLA 1XD9A 1YAHA 3VNBA 4R1TA 3WGHA 3WGQA 4AZ0B 1RS0A 5GJVC 4DAEA 3Q6MA 1N1DA 2PIDA 4UUQA 1HFEL 1F9AA 5ISMA 1T6ZA 1O0SA 2IT1A 3VR5D 2A6PA 4TN1A 1ZIPA 4NMLA 2OOSA 2E0IA 1R9NA 3PENA 1EX1A 4QQNA 1J9EA 4M1SA 1TEHA 4TXLA 1XF1A 2YVUA 2QSYA 1U8FO 1Z0KA 3S8EA 3ZDZB 2CNOA 3TQOA 5M34A 1ZH0A 4B46A 3FYDA 4Z3DA 4KE6A 4E6PA 3I5AA 3EISA 4WJLA 3RUAA 2A0KA 5ETJA 1PWZA 1VJRA 3Q7TA 2EJVA 2R751 3TGWA 4I66A 5G02A 3WL8A 5DTMA 4E3ZA 1CQIA 5CM9C 4XEUA 4K0KB 4RJTA 1FOEB 4CF4A 1I4TD 5A5DA 4F3CA 1EVYA 4UUMA 3AW8A 1VI5A 2CMKA 3NBKA 1LU9A 1ODLA 4KJXA 3MYRA 3KLMX 4CLHA 1GNQA 3IT1A 2I87A 3O2QB 3WAJA 4QG7A 3OECA 4NFLA 4DM7A 4BEBA 1YBMA 3OT4A 1QK3A 3HN6A 3QHPA 2R8BA 3K0KA 2YY7A 2AXEA 3K2QA 3PFGA 1WMSA 3QI2A 2PCLA 1GPKA 1N7JA 2A9KA 1NNI1 2A94A 2E55A 4JDPA 4YO8A 4PNPA 1RRCA 2NXNA 4LC0A 4M7RA 1DIOB 1JJFA 1ORDA 1PEAA 2EW1A 2OO7A 3NATA 3MS4A 2BAGA 4G4SO 1SK8A 2OILA 3M3DA 1VA4A 3H8VA 4A3SA 1NW6A 2J33A 2W2QA 1ORRA 4MLPA 1GO2A 1F8UA 4G09A 1DQRA 2DHDA 1LTQA 3EZXA 3Q0IA 4HXYA 3UPDA 4MWCA 4XASA 4WK2B 5EJIA 4DQXA 5JSZB 3ADCA 4UNNA 1Y3BE 2D7CA 2WMYA 4J91A 5FIUA 3QLEA 4KXVA 3ZQ4A 2XKAA 4QFMA 5F1OA 2CLCX 5GONB 1B8VA 3Q9NA 1JEQA 4TKZA 1Y6RA 3Q3CA 1WVGA 1X2BA 3RHSA 5J4LA 5JFGA 3K15A 5DGDA 2DQSA 2VHTA 4KIGA 5KYGA 2J4CA 1IHUA 1RHMA 3ACDA 2BHSA 4I6GA 2FSFA 5C3UA 1IEXA 3K72B 2IUFA 2VP5A 1QCZA 1XYGA 4BX9A 4LZPA 3TXXA 4YS6A 5KOIA 3NXSA 2AR7A 4XQCA 2O19A 4ZN6A 2KMLA 3THRA 3U7HB 3GA0A 4DLAA 3GJ8A 4YPFA 2V7PA 2ZRGA 4KQCA 1DINA 4R7GA 4C4YA 2B5VA 2WQ6A 3FCOA 3FPLA 1H0HA 1TQ6A 3CZ4A 4X7RA 4R8VA 4FHDA 3AFHA 4HOYA 1RIFA 1P2TA 2OGWA 1BX1A 1UC8A 1V8ZA 1GA6A 3JYOA 1KFEB 3UMFA 3E4CA 4C3OB 2QTCA 3B3QA 2Y93A 3Q3HA 4IX9A 4W7SA 4D81A 4V38A 3S8MA 2XXAB 1NFFA 2P9HA 2QQ0A 3C3DA 4N7RA 5AICA 4H7EA 2IU6A 2Z5GA 5IASA 1UEIA 2RMKA 2GLUA 3WA7A 1DKQA 4MKHA 1A5TA 3FN4A 4MVJD 4KI7A 4O33A 5D84A 3T8YA 1ZPDA 3H2GA 4GPEA 4ND8B 1PV2A 2LDBA 3L8HA 5T67A 1PKEA 2PJZA 1BRMA 1A9RA 3OZEA 1NBMA 4J8PA 2XMGA 1XMVA 2AOTA 4ZJUA 4DEYA 4TXNA 3GJQA 4UHFA 3WL3A 4E5MA 4NE9A 5WRFA 4FGUA 2OV4A 2GQ0A 1E2GA 4G2TA 2DPLA 4ZEOA 3MUNA 5F1YA 2QX8A 1FFDA 5EINA 1OXSC 1C1HA 2VJBA 3KO8A 3BD7A 3O3CA 4J0CA 4Q21A 4Z99A 2QDKA 4H3VA 1T34A 1UADA 2QLFA 4PG8A 2WB4A 3DTYA 5EWLB 1D1QA 4A23A 5HDBB 1K8XB 3DBHA 4EI9A 1II0A 1OTXA 4ZDWA 5EKXA 2WF8A 4IIEA 2L0XA 1XI2A 3QF4A 3UC5A 1J99A 2W22A 1LDEA 2I2BA 3QY0A 2UVPB 3DB1A 1GADO 5TMEA 2C1EA 3KV3O 4R7TA 4ZOLB 1XP5A 3H0EA 2CLKB 1RYEA 1WO8A 2OHIA 4G5GA 4ZHQB 1U9IA 5BV2P 3DR3A 4OJQA 4TYQA 3KM0A 3L0ZA 2W6NA 4N4AA 4PGHA 3PLNA 5FADA 1J5PA 2R86A 5BQOA 4FOSA 1Y8RB 4YLEA 1XNGA 1OV4A 3TB4A 4YX9A 3EVTA 2HV8A 3IUSA 3TTYA 2HJ9A 3CXUA 2L82A 4LX0A 5GV8A 1FSSA 4RTQA 2DF8A 3ENNA 3QOXA 3Q9LA 4YP1A 2XKBA 2P4HX 3REQA 2VHUA 3PPWA 1XMJA 2YOHA 4E08A 1U2PA 2FKAA 4X1IB 3AUUA 2ECFA 3WK5A 5CB4F 3ZGLA 4FM9A 4BFLA 4MV3A 3O2NA 4Y0VA 1U3FA 3R3JA 3USZA 3V2HA 1SQFA 2ID9A 2IELA 3CURA 3K5WA 5I4BA 2JCVA 5LL6P 4YJ2A 3SDBA 4D02A 4G8DA 4G5QA 2HLDA 4QHTA 2W6CX 4OQDA 3GLGE 1KJQA 3PNQA 4FW9A 4INOA 4LY0A 3KHKA 3WQSB 3QK7A 3FTDA 3QJGA 1JHPA 4OI2A 2XF8A 1RMQA 3QWHA 1G0OA 1GKUB 3FMVA 3SXUB 4EY3A 1YF3A 5LN1A 3A9CA 3DDZX 3B5EA 1MC8A 3UIEA 2JFQA 3GHYA 1G59A 3JQRA 3HY4A 1H1LB 1K0FA 4CNQA 2D2IA 2G09A 1CQJB 4U02A 1AZSC 2BH9A 3QLVC 5BRNA 1V16B 4DBLE 4D96A 5AVOA 4P22A 4CEIA 1EWVA 1AKVA 3H11A 3MJTA 3QUCA 1D2MA 1NVEA 1T2AA 5ALMA 2ALJA 3MIIA 3Q8XB 3VBEA 4IICA 5HJ5A 1ZM9A 1AS0A 2AK3A 2QTNA 2TMYA 3E3NA 2GTHA 4D3XA 2GNPA 1I51A 2FXIA 2P69A 1EHCA 3UJ3X 4XGNA 1MBZA 5TXGA 2YZMA 5FBRB 2WT8A 1DCTA 3BMQB 3KU4A 4Q03A 3LWBA 1I2MA 1PN3A 5KSYA 1P5ZB 1NW4A 4GEGA 3GLFA 1R6UA 3PB3A 2V7QD 4ARUA 4YRBA 4MWGA 3AHJA 2XVMA 1HZZA 3D8RA 4QJ4A 1GM5A 1VMEA 1YE3A 5D87A 4ZAZA 1XXHE 2V5AA 4J3JA 4UNQA 4EDHA 1T1JA 2WIJA 1DP4A 3OE1A 3OC6A 3RC7A 1CK4A 2R6JA 3I9NA 4DGSA 5BORA 1VG8A 3NZEA 2RDMA 3PQEA 1DBSA 2FEPA 5NLLA 3M6VA 2CNLA 3CR3C 4EG3A 2A1TS 4HNRA 4J0KA 4YJ3A 3N0VA 4BO4A 1CHDA 3EZNA 2FFBA 3HLKA 4HDSB 1EE2A 4JV5B 3VSCA 4TZ0A 3HRIA 3GU3A 3ZEIA 3IKTA 2WNSA 1G41A 4CV1A 3R6WA 1JIKA 1GP2A 2BM9A 2XUQA 2P62A 1Q7CA 2QMHA 4D82A 2YFQA 3MAJA 1QWOA 2I6XA 3UKJA 5LOVA 5LQNA 2VJMA 2WWTA 3GJ7A 4LSGA 1HA3A 3K70D 2FN7A 3RYFA 1E5LA 3RI3A 2AOUB 2QM8A 2DULA 4OGFA 2HR1A 3L79A 1JX6A 4RQBA 3HJRA 5JW6A 4YMHA 4PVDA 1X42A