2AR7A

Crystal structure of human adenylate kinase 4, ak4
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
221
structure length
221
Chain Sequence
KLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human adenylate kinase 4, AK4
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenylate kinase 4
total genus 72
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ar7A00
1P2TA 5JZVA 2IS1A 4ZPXA 1NJFA 3GJ0A 3KKMA 2VLIA 3VR3A 4I99A 1FQKA 2YV5A 1H8EA 3RANA 5HE8A 2AKYA 3U44A 1XCGB 1TF5A 1NSTA 2YWEA 1UFQA 2A5GA 4QHSA 4F91B 1CJMA 1E2HA 1MOZA 2XAUA 4PANA 4A2QA 2CCKA 2VF8A 4AYTA 3AVUA 1G3MA 1XMVA 3TSZA 3LWNA 1UBFA 5F9HA 4UXJA 3U2QA 2H18A 1E0SA 1KSHA 4B3CA 1OSNA 2X2FA 3ZZ0A 2HYIC 4MITA 4W9MC 3F3YA 4Q9HA 1S1MA 2JASA 3EZ9A 3L0SA 4CZ2A 1XEXB 4EDHA 5JHGB 1ODFA 2FF7A 4NMMA 2W0SA 3J81k 2CHGA 5CITA 2OEPA 3LW8A 2OAQ1 2A5DA 3QUSA 1SVSA 1Z0KA 3SC3A 1SKQA 2DWOA 1KI8A 2CLSA 2ZI4A 3TQCA 4B34A 2ORIA 5TVKA 3AB3A 4UJ3A 3FKSD 4B44A 1XRJA 4ARZA 1K6MA 5SZIA 2EFGA 2AXPA 3HU2A 1KZ7B 2LKDA 4NKRA 1XD8A 4ZCLA 1H8ED 4PHGA 5EE0A 4II7A 3U7GA 4PZYA 1NL3A 1Q21A 2D74A 3EZ2A 1J70A 2JLRA 3OZXA 4URWR 4DDTA 2D3WA 4WOPA 4Q48A 3FDIA 2G83A 1XB2A 5JWOA 3QE0A 5CLQA 1NRJB 2P65A 1G17A 4C0LA 2ZS9A 3ZD6A 1EFRD 1G20E 2XSZA 2C96A 4RD6A 3HPRA 2AR7A 1ZJ6A 3WRXC 3TLXA 2O8FB 1ZCBA 1W4AA 1UKEA 3LD9A 4XTCS 3K0AA 4DXAA 3IEUA 1KO5A 4HB3A 3NTUA 2G9NA 3KB2A 4R2IA 2BMFA 3LA6A 1I4LD 1LFDB 2ONJA 3A1SA 4G3XA 4PHTA 1G291 5CDFE 1HA3A 4B32A 1UDWA 1E2LA 4C0HA 1GKUB 1R8SA 3LXXA 4MRRA 1G1MA 2D2FA 2WIBA 3VU9A 3K0CA 1FL9A 4PQYA 4O3MA 1AKYA 1DAMA 2N42A 1UF9A 5SZKB 2FFBA 1JPJA 4XSGA 1R5OA 2EVWX 1Q3TA 3O47A 1T91A 1E32A 4HUQA 3GJ6A 4Q7JB 1MRNA 3A1UA 4DB2A 1GWNA 4TZ0A 2HLDA 3OEEA 3IQXA 4JJKA 3QKSA 3NVAA 3T12A 4DLXA 1XTJA 4QG7A 4XIGS 4URXR 1EFRA 2C9CA 2XSZD 4YLGA 2RGXA 3H0KA 2J87A 4G5RA 3CX6A 2OHFA 3NDBB 3D31A 4PC3A 3I92A 3K9HA 1RVDA 3LXRA 1QG4A 3ZIAD 3EWSA 4EQ6A 1S2MA 3O8CA 1GIAA 2VHCA 3QVVA 1Z47A 3AGPA 1ZM4A 4KVGA 4BLQA 2QAGA 3QKSB 3GFOA 3QKTA 4KBGA 4DUGD 3SYKA 3ZYCA 4A8JB 2QNRA 2YOGA 2EFEB 4RZ2A 3KUCA 4U02A 4JL5A 4PQFA 1GOTA 1N5JA 2J7KA 5CJ2A 1WB9A 1AS0A 1ZVQA 4D80A 1JEEA 2ASEA 4JZKA 3QKUA 1VIAA 3MGCA 4IFEA 3KQKA 4QNMA 3QXSA 2ODBA 1ZU4A 4JBWA 1JALA 3CF0A 4M0LA 2WWXA 1S4QA 4OHZA 3GJ7A 5DYGA 3U60B 1XPRA 2O8DA 4ON9A 2RHDA 4KITB 4HLDA 8OHMA 4ACAA 5LDDC 2J46A 4MQBA 1DAEA 1L8QA 3IQWA 3ZGXA 1XPOA 2UZIR 3RWOA 4YXWD 3TUZC 3GEIA 4LRWA 1W4RA 5FPSA 3BERA 4V0LA 5LB2A 2GEDA 3HPQA 1XXHB 4D4MA 1T3SA 3LBHA 5LB4A 1N6NA 5KSZA 2ZANA 2ZETA 1TU4A 3GLIA 4LY6A 3SQXA 3LQQA 4FCTA 3ASZA 3VU9B 3NHBA 2VL7A 2C98A 4PC1A 4JVSB 4I1UA 3RRYA 4LHXA 3LRPA 3OEED 1XJCA 1XJ0A 4OK3A 2JDID 4URVR 2O8EB 2DFTA 4TMKA 5D3MA 2OXRA 2QAGC 3A1VA 1YHNA 2FV8A 2VBCA 3CX8A 3O8DA 2BCGY 5JJLA 4PO1A 3A58B 3B82A 4S2EA 3EA0A 4GP6A 1OHHA 1A7JA 2NGRA 3WRYC 1SVIA 4WZAE 4DIDA 4F92B 3HYTA 4QBFA 3OAAD 3R8FA 3RLFA 3ZLJA 3JZAA 1RW4A 4XTRA 2AFHE 3T5GA 4KLNA 3CWQA 3I73A 3ZS8A 4DDUA 3ETLA 1DE0A 4L5BA 1GSIA 3IIMA 4OQFA 4QNRA 4AG6A 2NMVA 4Q1CA 2RHMA 2MSEB 2WJIA 1DS6A 2VSFA 1QZXA 3CRRA 2JJ8A 2ZYUX 4MYCA 1NF3A 1E9CA 3K1JA 1M2OB 2JJ1D 3AUXA 1WRBA 1AQYA 3UPUA 1HUQA 2NTYC 1W46A 2YC4C 2OBLA 2C95A 2FSFA 3DPUA 2WJJA 2I1VB 2WMNB 3KX2A 3TAUA 1O3YA 5FOVA 3MG9A 4JLKA 1NMYA 1KSFX 1IN7A 2FPLA 1SXJB 4AD8A 3ZQ6A 4M22A 4O2LA 4QGHA 4HI0E 4C2UA 4F4JA 1M7HA 1FTNA 4QGAA 4KFUA 1KJZA 1SHKA 4B73A 1QHSA 1H65A 3IIJA 4EJSC 5GJCA 1E94E 1VYUA 2FSIA 2H17A 2RGNA 4LX0A 5FL3A 3E5HA 3NG1A 3P4YA 4IRUB 1DELA 5JI2E 1KAGA 2Z6VA 2ZUCA 3SBDA 4GZLA 2ZS8A 5JWRA 1KGDA 3UKDA 1KK3A 2ZRKA 3VR6A 3SJBA 2GXSA 1Q20A 1NN3A 2R6AA 3T1OA 4TWZA 2DYKA 1II8B 3IIKA 4RKFA 1FP6A 4NONA 3ONWA 1FFHA 2A78A 4IDPA 4JLBA 1CJTC 4U5XA 2W58A 4LJ7A 1GKYA 2CCJA 1D8TA 2IYWA 2H8KA 1RYFA 1ZCAA 3K70D 3PVSA 4EAQA 2AK3A 4HAZA 3CO5A 2DR3A 4RKEA 2OAP1 4A6XA 4C2TA 2V8OA 4DLVA 2BJVA 2C03A 4HDCA 4YMTA 5BQ5A 4PC6A 1TF2A 5AK0A 4BEJA 1EXMA 2HT6A 3P26A 1XD9A 5FPKA 4XWAA 1II9A 1SQ5A 5EE9A 3KXKA 4OI4A 4EUNA 4PR0A 2MSCB 2QY9A 2FNAA 3D6TB 3U3KA 2J0UA 5KSYA 1FX0A 1KDRA 3GLIE 3IPXA 2WWYA 3C5HA 3SE0A 3K70C 4QGGA 3N2EA 4ARZB 3KTAB 2H5EA 4JBYA 5GJVC 5TXGA 4RZ3A 2VTKA 1KJWA 4Z8XA 4A8JC 4LYHA 1X1SA 3C16C 2PCLA 1XEFA 3H84A 1TTTA 1I2MA 3DKPA 3T1TA 3FE2A 1R2QA 4YC7A 3B85A 4XJXA 2E87A 2EW1A 2YJTD 3ZVNA 3QXHA 4DZZA 3IBYA 2JLZA 1PV4A 4QJ4A 2CL6X 5FPTA 1BOFA 3R7WB 4Y0AA 3RRNA 5LD2C 4B3FX 2BKEA 2ZRHA 5GJWC 3V4RA 4OQXA 1BKDR 1SXJC 1FNMA 4NCIA 1QHIA 5HCIA 3L0PA 4XVQA 1LV7A 1VPLA 2JIZA 3GFPA 3I8XA 1E1RA 3R9WA 4LHVA 1B0UA 4NZYA 3EWAA 3N2IA 5KTYA 3CRMA 4Q03A 4F4IA 1VCIA 2KB0A 2PX0A 3KJGA 3M4YA 3MWKA 3T61A 4JL8A 1T3LA 1QVRA 3C15C 1Q57A 5FR2A 1UM8A 2GJSA 5CYOA 3I4LA 2GNOA 3X2SA 5BN3A 5KDOA 3ZD7A 1S8FA 4M9QA 4EKDA 2DCUA 2K5UA 2W2TA 2HXSA 4UKDA 1D2NA 5IF9A 1KIMA 1G7RA 1G3UA 5FTMA 2DFKB 1M8PA 2ZAMA 3SN6A 5L3QB 4LOAA 2DWQA 1BMFA 3VNUA 4OBEA 1RRPA 2WPDA 3GLGA 3B1VA 5FUWA 3WHLA 2CK3D 5BWMA 3SI7A 4Q02A 1JNYA 5G3ZA 6Q21A 3BAFA 3BH0A 2Q3HA 1UEIA 1Q1ZA 3VAAA 3QKRA 4AKEA 5EXSA 1Z28A 1OJLA 2C8VA 5TMPA 1YZQA 1C4OA 2H16A 4K46A 3QG1A 1F6BA 5HZHA 4WAUA 2XGJA 5FTKA 1NIJA 2IYVA 3EW9A 1A2KC 1Q1QA 2ZSAA 4KODA 4EPVA 1G3IA 1YZTA 5J40A 5K8UA 1O87A 4JBXA 2QP3A 3DDCA 1GKIA 4WVFA 3SOPA 3PV0A 5JCZA 2GCOA 4JMPA 4TMVA 2PLRA 2WWWA 3B6EA 4FMDF 5DHAA 2KE5A 1Z0DA 1CIPA 4WBSA 3W6PA 1Z08A 1KI2A 5F9FA 3R9XA 3CH4B 3BB4A 4KHZA 1OXSC 3L43A 4URZR 4LYFA 1ESNA 3THWB 5KNBA 4TLDA 3LVRE 2HDNB 4B75A 2IEZA 4BFTA 1JBKA 4OQNA 3Q7QA 4D82A 2NG1A 1X8JA 4LGMA 4LJ5A 2J45A 2KJQA 2VEDA 2X2EA 1VHLA 3BFVA 1WCV1 3MUFA 4Q19A 2CBZA 3QPWA 4ZKEA 5E7IA 5CLLA 4D0LB 4X8LA 1M34E 1KAOA 3VX3A 3ADDA 1HT1E 1PZNA 1X8LA 4PPQA 1SVMA 1UBCA 3H86A 1KHTA 4ESHA 2QGNA 1IN8A 2FU5C 3D7MA 3RS5A 4Z54A 5EXTA 4DSNA 4DDWA 3MRSA 2F43A 3DVLA 2G88A 2PJZA 4QRHA 4C0KA 5A4JA 2WWFA 1P9WA 1E2IA 2GXUA 3GJ3A 4G01B 4HATA 3CPHA 2FPMA 2BM0A 4DRZA 3TQFA 2OE2A 1NI3A 4EPXA 4DSOA 4YMVA 2Q9AA 3CZPA 4PAMA 2TMKA 5KUTA 4Q1DA 3E70C 1CR0A 3DZ8A 1BO6A 4FXPA 5JS8A 2OUKA 1P73A 5CYPA 5K8IA 1IXRC 4TT3A 3O8RA 4Q4LA 1XMSA 5FH9A 2QBYB 1CXZA 1G8FA 1OFUX 1XTKA 1IJEA 1KK2A 5JECA 1WF3A 1E69A 2NO0A 2XNSA 4DUGA 2A5JA 2WM9B 2CDNA 1E0JA 3ADKA 3KKNA 2Z4RA 1RKBA 2CMKA 4JSYA 3CBQA 5KO2A 2RGAA 3ZJYA 3IDQA 2IC5A 5FR1A 2JEOA 3B78A 3K53A 1EWQA 4HZIA 3WBKA 1G4AE 4Q9KA 2YZ2A 3Q8XB 4LK2A 3EAQA 5A0FA 1JAHA 1COWA 2KSQA 3C41J 3MWJA 1RPZA 2WPDD 1NVWQ 3EC1A 2GXAA 1DAIA 1VG0B 4JIMA 2QN6A 2ZR7A 2IYSA 4TLAA 2L0XA 4V03A 2W2XA 4S35A 3R9IA 3EC2A 4B71A 3RABA 4NU0A 3NXSA 1XU4A 2PT5A 3BORA 1N2CE 5HR5A 1WDTA 3EPJA 1XP8A 4TQUS 3LAWA 3OE7D 3NWJA 4HAUA 2QQEA 2NO9A 3U7HB 3BBPA 4B3GA 1DAHA 3F8TA 3T06B 1V5WA 4IFBA 4O25A 4LBVA 4PAQA 4BFUA 2H92A 2FGKA 2R8RA 3OFND 3REFA 4PTLA 3T1QA 1Q12A 4LHYA 4J0QA 2VP6A 2V1XA 5FOUA 3NKVA 1JR6A 4ZIRB 1IONA 3SHFA 1KI6B 2WKRA 2ZE6A 3PCRB 3LFUA 1N6KA 4MH0R 2J0UB 1E6CA 1N0UA 2YHSA 4P31A 4BZPA 2IYZA 5D3MB 1NBMD 2GJ9A 4C7OB 4O2RA 1AN0A 3PXGA 1C9KA 3GQBA 4WXPA 2BEJA 1HURA 3VQTA 3PG5A 1OIWA 4DCVA 3E1SA 3RNLA 3BK7A 1RRCA 1E9SA 2B92A 2ODEA 2HJVA 1IJFA 4CEJA 4B3DA 5AJWA 2IYYA 1HEIA 2XTMA 1YZLA 3BIFA 3GLHB 4PPFA 4OK5A 1XPUA 1TEVA 4PFSA 1U90A 1Z0AA 3F0TA 2J0VA 4BLPA 3IBGA 1NVVR 4EFNA 3CNOA 5FBLB 4TMZA 3GJ8A 1JJ7A 1VYTA 1EX7A 1MT0A 3I8SA 4M4SA 1QHXA 2JJ2A 2GAAA 1XMIA 2ODNA 1S9HA 2GBLC 1MO5A 2CLDX 2OILA 4LJ9A 4X8HA 4FD2A 4IXNA 3GJXC 1J7KA 2C78A 4N1AA 2C99A 3SR0A 2IS2A 1G8YA 2GETA 4B43A 2W83A 3FKQA 2XB4A 1G6HA 2GRJA 4PQRA 2WSMA 5SZJA 1IY0A 1L4YA 1U2RA 3U3OA 5HPYB 5H8WA 4WXRA 1N25A 2WOOA 5CM9C 1AZSC 4A8JA 2B6HA 1TNDA 3C8UA 2IEYA 1SXJE 1M1YE 1ELOA 4FI3C 1J8MF 1DVRA 3CNNA 4DJTA 2JLUA 4AKIA 2IUSA 4OHWA 1XTQA 1JXMA 1IN5A 4D81A 4NPHA 4TLEA 1OXTA 4MGZR 1TU3A 5G53C 4AWXA 3HP1A 2IK8A 1OE0A 1U8AA 4G5QA 2G0NA 4G5GA 2FX3A 1E79D 4ZDJA 1FOEB 2HV8A 3UWKA 2AXNA 2ZPTX 4OQMA 3SFZA 2DB3A 4M21A 3KDSE 2VSOA 1MH1A 2GTPA 2P6UA 4I4LA 1COWD 3U7FB 4TZ6A 3KKQA 3U44B 4Q4AB 4M1TA 1XTRA 3NH6A 4UXIA 1QF9A 5BYJA 3H1TA 2WMOB 3GLIB 2C5LA 3UG7A 2BVNA 1SGWA 3QOFA 3QENA 3REGA 2ZS7A 2QL6A 3CF6R 5LD2B 5JSZA 1KTVA 2XEXA 4CEHA 3U61B 2OFOA 5LPNA 4TT3D 1R0WA 4B3XA 3EASA 2QBYA 1BYIA 1R4AA 5FUYA 3G0HA 4W5WA 3HR7A 1E2NA 2PL3A 4MGKR 5CIQA 2P5SA 4LBWA 2NPIA 1P62B 2W00A 3B8HA 4JLVA 1F48A 1ZIOA 2FSGA 1YJ5A 1IM2A 3NBYC 4UNPA 2BIFA 2ZSDA 4L4UA 5EUQB 1KMHB 5J4VA 1KYIA 4KU4A 4DHEA 3CZQA 1S3GA 2LWIA 2RAPA 3DEFA 4QM7A 1G8HA 1JR3D 4ZDWA 1RRFA 1YZUA 2XJ9A 3ZS9A 3KUDA 3N70A 1QHNA 4D26A 3ZQJA 1YZGA 2BBTA 3SU8A 1G18A 1DEKA 3LLMA 4LUCA 4CF7A 5DNYB 3AUYA 2FEOA 4D4JA 1W36D 2WV9A 3P20A 4A6PA 1XFAA 1D6JA 2LKCA 2O8BB 5TARA 3VTKA 1XCPA 1HE1C 1LTQA 1P61B 1TPZA 421PA 2PZFA 1YZNA 2QTHA 4HB2A 4NCHA 3AVXA 4MDFA 3CB4A 2ANBA 1E9AA 5KPDA 3ZH9B 1ZBDA 2CE2X 2XXAB 2WOJA 1YE8A 2ZE8A 4IOJA 2QROA 4Q5IA 5GVSA 1AQUA 1F2UB 5L3SA 3UXMA 2WTUA 1CTQA 5FI1B 2JIZD 4XWKA 5B57C 1TUEA 5KOYA 1ZNZA 1HQYE 4CEHB 1T9HA 2Z83A 1W36C 4QJ3A 2WIAA 3EPKA 5AUPB 3U6BA 1R0YA 2J1LA 1OB2A 4D0NA 5EZ6B 1S9DA 2ZR9A 2G1JA 5KU1A 1AKEA 4TQ9A 4Q1AA 1N6PA 5TB5A 3LQRA 4CEJB 2EYQA 3QI2A 1GVNB 4RD1A 1EFHA 1ONBA 4MDEA 2ZU0C 4G5OA 3AVVA 4BFYA 1XEWX 4HLQB 4BUJA 3PUXA 4V0ME 2GBLA 1ZC4A 1R0ZA 1ESMA 1ZIPA 4I81A 4IDQA 2QA5A 1NLFA 2GZDA 2DPXA 5G41A 1XJQA 5EQTA 3V9PA 4D2IA 2D62A 3HDTA 1VYVA 2J9RA 4Q00A 4RVCA 4H1VA 2D4HA 3CLVA 4M1YA 1OW3B 1IOZA 4TYWA 1SVLA 4Q9LA 4B6EA 1OKKD 2N46A 2AWNA 2OLKA 2F9MA 3EZ7A 1U98A 4YXWA 1SKYE 2I3BA 3QNUA 4DBLC 1N6IA 1ZM2A 1KSJA 1KI7A 1UDXA 4MRVA 2QM7A 4AURA 2R62A 2CVFA 2PT7A 1KI9A 1NJGA 4CT4B 1G9XA 2NO1A 1RYHA 3ICEA 3PJRA 3R7WA 4GSYA 2JA1A 2QP4A 3RS7A 4C9BA 5HKKA 2QTFA 2C04A 2ZI6A 4MYTA 4YMUA 1PUJA 3AM1A 3LX8A 4MKGA 4QXAA 3RS2A 1G3QA 4IOMA 1X3SA 1CRQA 4F4CA 2V54A 3L8YA 4GOXA 2OO7A 5GADl 3ZIAA 4HUTA 1PVOA 3DZDA 1CLUA 4B2LA 5GVRA 3I61A 3PUZA 1KI1A 3MWLA 1N5KA 2I1QA 3ZVLA 1IN4A 4M1OA 5FOSA 3Q85A 1T0JB 1JI0A 4NHOA 5FOTA 4QHYA 2QE7A 2V4ZA 1Y63A 1U8ZA 2X1VA 1CR4A 2HJGA 2XZPA 4RY2A 5DIFA 4A2PA 1KKMA 1ZNYA 2ZEJA 1VG1A 3Q7PA 2FZLA 3B1YA 1QDEA 2FH5B 4DT1A 2F6RA 4IEIA 2WWGA 4URYR 5FBQB 3MMPA 1YKSA 2YWHA 5JS7A 2B7BA 5E4FA 2OCBA 2REBA 1IY1A 4BRWA 1Z29A 4C0QC 1DAKA 3S1AA 4KI0A 2ZQ5A 2I4IA 4LHZA 3TR5A 4QGFA 3BD9A 5EE5B 1R6BX 1P9NA 1DAGA 1EFUA 1NMXA 1LVGA 1F2TA 3KJHA 1KNQA 1KY3A 1Q1BA 3OHMA 4O0MA 3AF3A 2PEYA 4CEIA 2BJWA 3TW4A 1E9BA 5K8LA 3HU3A 2VPPA 2GEUA 3H4MA 3NBFA 3IO3A 1W0KA 1ZUNB 1TQ2A 1U0JA 4FMBB 4TL7A 1W5TA 3MFYA 1NVUQ 3OEHD 2ZI9A 1N0WA 2PBRA 5IHPA 4TSFD 2DFNA 4TYPA 3K70B 5DISB 2GK7A 3K09C 3BWDD 4GPTA 2ZJ5A 4ACBA 1Q1EA 2LCFA 1QHYA 221PA 4ERNA 1YRAA 2QPTA 3G82C 1Z6AA 3R20A 4ZO4A 1KO4A 2XZOA 1CULC 2H1LA 2D7DA 2O8CB 2AK2A 4X8OA 5EP2A 2QAJA 4UXHA 3K0FA 1NBMA 4JYBA 1T5IA 1XWIA 4P0TA 4DCUA 2N1BA 5JBQA 1E2QA 3K9NA 1N6OA 3KKOA 5E7MA 4FMDB 3Q3JB 2CL0X 2QMHA 5DI9A 1J8YF 1W5SA 4IEEA 1SKYB 2WSSA 3AQ4A 1VMAA 3UG6A 2GCOB 3PQCA 4BE7B 4D4LA 4LC0A 4CGZA 5KSOA 2E1RA 4YDHB 4OJQA 821PA 3QEOA 2ZI3A 3U6KA 5FTNA 4IJMA 2SHKA 3BJIC 2VHUA 2QORA 2IA5A 5TDHA 4B3BA 4Q66C 4A1FA 4LYAA 1G8PA 1IHUA 1CP2A 2NQ2C 1Z6YA 1UBGA 1RC8A 3DO6A 2G3YA 1DO2A 1R5NA 2PEZA 5DLQC 4LCBA 4OHYA 5GJBA 2VP9A 3QXCA 1SULA 4LPKA 4A0FA 1ZD9A 3ND8A 5B58C 1WE2A 1GNPA 4KVAA 3NEJA 2PZEA 2GJKA 3FPAA 3KQNA 2VH5R 4EJSB 2VP0A 2DHRA 1UPTA 3QPVA 1YR8A 4KFRA 2OG2A 1NN1A 4DCSA 2IXFA 4M9XA 3KZ1E 4CVNA 3EPHA 4KJZA 2F3RA 4ZI3A 3WHKA 2F43B 3WP1B 2ERXA 3P1JA 1PLKA 1TEXA 5DN6D 1FPMA 2DFLA 2F3TA 4HSEA 1MO4A 1JECA 2BWJA 4LDJA 3LW7A 4RD4A 2AWOA 4L15A 1XMJA 2NZ8A 4BEBA 1R8QA 1DG3A 2P2LA 2BBSA 2QQ0A 1CJKC 1GL9B 1Z2AA 1GL7A 1Z6XA 2ZE5A 3SJZA 1K8RA 3ICQB 4ZCIA 2IW3A 4DDVA 2IYLD 1P2VA 1XEXA 1A82A 4HB4A 4D6PA 4BFZA 3W5IA 1XEWY 4FINA 4Z1MD 3AF4A 3NDPA 4R2HA 1WXQA 4M9ZA 4NYIQ 4XD7D 3TBKA 2B7CA 4TL8A 4GMXA 4F93B 4EPYA 1EWRA 2J5XA 5KNCA 2XZLA 1YQTA 4Q4JB 1JB1A 3GLFE 1GRNA 1XZQA 1ZNWA 2RGCA 3H2YA 3WYAA 2P0EA 3GLGB 4KXFB 3BS4A 1AM4D 2O5VA 4KBFA 3EIHA 4Q4JA 1JEDA 4RCZA 2F1IA 2A5FA 2CK3A 1UADA 2CHVA 3BFKA 4HAXA 4M1WA 3OF5A 5F2EA 4CT5A 2OLJA 1W2GA 2C77A 4PO9A 1E2FA 1HE8B 1ZC3A 2MMCA 1DOAA 2ZRBA 2FG5A 2FOLA 4YQFA 3LDAA 4TTQA 5IRCD 2PMKA 1Z6TA 4TTPA 4AYXA 2ZRAA 1C1YA 2UZ3A 4CRWB 5L3VA 4N0DA 2BHRA 2PZGA 3THXA 3DKVA 4QFMA 1HY3A 1OFHA 1HV8A 2CJWA 3NH9A 3L82B 3T1VA 3V4FA 4OJKA 4EJSA 4A4DA 3FHCB 5F3WB 3UIEA 2Q0HA 2FPKA 4QBGB 1Q0UA 5EXXA 3K0EA 2RGBA 1S3SA 3W3ZB 1ZUIA 2KI5A 4YONB 2XNDD 2BMJA 3ECCA 3A4MA 1P4SA 3CWZA 4LJ4A 4IVQA 4PZZA 5H68A 2IUUA 2JLYA 2BMDA 1OYWA 3FTQA 2CHQA 1U9IC 1ZINA 4Y0VA 1OH7A 3CM0A 1B23P 4Q9IA 5EZ5A 4C0SA 3C7KA 5FBWB 1S0UA 2GK6A 4UJ5A 2ZRMA 1AGRA 2A7QA 5EE1A 5FPHA 3T35A 2YVUA 4JLMA 2W6IA 1G16A 4OI2A 4AY2A 1XTSA 1KJYA 4GI7A 2ZSBA 1G41A 4P4SB 2MMGA 3NHAA 5A5GA 3GJ5A 2IXEA 2QPAA 4R9UC 2QT1A 2W0MA 4PSVA 1MO3A 4AKHA 1ZAKA 5JSZB 4M2LA 2PX3A 3SBEA 2JLVA 2W6JA 3EXAA 1NG1A 2QSZA 3BH7A 2GILA 2OBNA 2ZITA 1T8TA 3A4LA 1XXHA 1JAIA 5LBIA 2C2HA 1GM5A 5JHHB 3A6PC 4M53A 2OT3B 3KQLA 1JXOA 2WSSD 3D3QA 1SVOA 4FCWA 5J4LA 3EX7C 3QXXA 5AJXA 5HKKD 4BFVA 1OXVA 2ZRFA 4NYMR 2J0QA 2ZRDA 4HB0A 4D25A 1E2MA 4KO8A 1KNXA 2Q3FA 4QL3A 4GBMA 1F60A 1UKZA 2ZJZA 5EXPA 2HT1A 2XNDA 4R98A 3AP2A 4OKSA 2GVZC 4IOKA 1AJEA 1VKJA 2FGJA 3ZZTA 1W47A 4IDOA 4HZUA 1BMFD 3UANA 1Z8FA 5BYKA 3U5ZB 2XOKA 4H1UA 4PHFA 5CK5A 4XVUA 2JGNA 3SHWA 3RSLA 3FVQA 2OV2A 4JSTA 1E98A 4Q1FA 4TL6A 1BYUA 4C0BA 1FMLA 3WNDA 1T4GA 3W6NA 5HCNA 4WW0A 1ZUHA 1J90A 1KI4A 2ATVA 3QXJA 1Z83A 3RS0A 4US2R 3PR1A 1VDZA 1N5LA 2WJGA 2XX3A 3SEAA 3W8NA 3RS4A 5J47A 2RGDA 5JWHA 1GNRA 2RCNA 4BASA 3K0SA 3B13B 2F1HA 4PC2A 5FUVA 5FOXA 3GFTA 5J4YA 4ZDIA 2BDTA 3B9QA 1WMSA 1KI3A 4A9AA 2ZJAA 4XSHA 1MABB 1WP9A 3QBTA 1EFTA 2AD1A 2QZ4A 1MRSA 2QTVB 3WYFA 3K0AB 1TAGA 1TMKA 2QAGB 1KK0A 1AGPA 2F1RA 3B7GA 3PUVA 721PA 2NO6A 1GL6A 2YNMA 1AA9A 3EZFA 1AK2A 3FB4A 4Z1MA 1GAJA 1QBKC 2PJRA 1Z63A 5C1BA 1AS2A 1MV5A 2YC2C 3WP0A 4QBIA 5BXQC 2B21A 1OF1A 1RIFA 5CK4A 1E9RA 1YR6A 2V1UA 2JLWA 4TYYA 3PENA 1XTIA 5EP3A 3CIOA 2O8DB 1YR9A 4B2PA 5C2JB 2PCJA 1E9FA 1OXXK 2F7SA 1XNJA 4IOLA 3LV8A 3U4QA 3QBVA 5KHOC 1TADA 2IYXA 4UNSA 3OAAA 3FOZA 2EFCB 4TN1A 1G8GA 2AN9A 3U4QB 4LZZA 2ZRGA 2EFHB 1G7TA 1G4UR 4HAWA 3THOA 4TSFA 3THXB 2JLXA 2R44A 5IT5A 2IYTA 1TQDA 2O0KA 3QKRB 4FWIB 4GL2A 1LF0A 2VO1A 5E3HA 1UBEA 1CF4A 5HE9A 1IY2A 4XVRA 1OT3A 2IL1A 2ZM5A 1TL7C 1OV4A 1TF7A 1FP7A 1KDOA 2IUTA 4LC1A 5FUXA 5KYKA 2G1KA 2IF2A 2H7VA 3AVTA 2REXB 1XXHE 1VCMA 1CEEA 4Q01A 2ODWA 2XTNA 3CF2A 4BFXA 4LBZA 3AH8A 3DMDA 3W34A 3B9PA 4KFTA 3U7EB 2O0HA 4NYIR 2F1JA 3BH6A 2CCGA 4DLZA 2IS6A 3OFNA 3DM9B 1M6NA 1R5BA 3HU1A 4MKHA 5DH9A 3AVYA 4PC7A 2WKQA 3PIRA 4UNNA 1A4RA 3GLFB 3B2EA 5JCPA 2VSXA 4JYCA 1H8HA 1L4UA 1ZM7A 3AF1A 3I72A 4MUBA 4ZCMA 2Z5FA 4GP7A 1QHGA 4H9GA 2IYRA 1TQ6A 1V43A 3TAHA 1WBBA 3FMPB 4HAVA 2VHJA 4V0KA 4R7ZA 4BZQA 2GF9A 2QPOA 3IPYA 4POAA 4U00A 3MJHA 1GP2A 2QMEA 4KCGA 1A5TA 5AJVB 4K8OA 4LV8B 4BLRA 4B48A 5JRZA 1NVVQ 1Z22A 5FOWA 1E4YA 2FFAA 1W0KD 4G5SA 5E7JA 4DSTA 4NP6A 4ABYA 4URUR 2IT1A 2OCAA 1NP6A 3LBIA 3KFXA 3RRZA 1VECA 2MSDB 5M04A 2Q9CA 621PA 1ZP6A 2OM2A 4B47A 3IEVA 5DGXA 2ERYA 1OFTA 3V00A 2GXQA 3I32A 3EA5A 4MUAA 2Z0MA 4AG5A 3NBZC 2V7QD 1E1QD 1EGAA 2IWRA 4DLWA 4GOKA 1H8HD 3CNLA 1YU9A 2E9SA 2BKUA 4IDHA 4E22A 4HEJA 2DBYA 5JEEA 1GG2A 3CW2A 2V7QA 1BIFA 3B1WA 4BECA 5JJIA 2ZUBA 5CIWA 1XD2A 5AUQA 2JLSA 3TMKA 1QVAA 3C14C 2OBMA 2RB4A 1N6HA 4EFLA 1ZNXA 1NG9A 1XBTA 4FMCB 3RC3A 4AC9A 1Q44A 3GEHA 3PEYA 2W2VA 3MCAA 1I2DA 2FJUA 4TYQA 4UQOA 3MLEA 2FE4A 3WNCA 4EFMA 5AR1A 4C4PA 1GNQA 1ZMXA 3KTAA 3A4NA 3FHTA 4KFSA 4CYMA 4W5HA 5L3RA 3P27A 4BGDA 2X77A 3B5JA 1X8KA 2CNWA 2NPFA 3KXIA 2ZROA 3WYGA 2A9KA 2VHQA 2Z4SA 4Q18A 2Q9BA 4A0HA 4AK9A 1PLJA 4JVMA 4JLOA 1U9IA 2EWWA 4Q21A 3SZRA 2CL7X 3T15A 3GLGE 5JJKA 4TQAA 1KO7A 2O8FA 3EARA 3BOSA 3AKCA 3LNCA 4V0MA 2O0JA 4Z8YA 3TVTA 3ZDQA 1ZRHA 4RFVA 1JR3E 2FZ4A 1D5CA 3PUYA 3CX7A 1BH2A 2FEMA 1GZSA 3RC8A 3CUEF 4JKYA 2XXAA 3NBXX 4HAYA 3FFBA 3VFDA 3QJYA 4ZV4A 2WWIA 2FA9A 1GRRA 3TVDA 3FWYA 2A30A 4US1R 3LVQE 1WBDA 4ZIRA 2R2AA 3X1XA 4B35A 1OLOA 4WIAA 4TMXA 2BC9A 4PPNA 2ZSFA 1P60A 1P72A 1U94A 3RS3A 1LY1A 5FTLA 2GZAA 4UNRA 2AX4A 3C4JA 3QSYA 2QEQA 5FL7A 1X6VA 4DCTA 1P9RA 1ZD8A 2P67A 5J5CA 2VHTA 4B33A 1Z07A 1KK1A 2YKGA 4JLPA 1M7GA 4Q4HB 1NY6A 2QP9X 1OPXA 2QM8A 2RGGA 1W48A 3DOEA 1DO0A 1US8B 1RJ9B 4IHQA 1E0KA 1KSGA 2QE7D 2A3RA 3LBNA 2W6JD 1FUKA 1KMHA 1FNNA 4CDGA 3L0OA 3IILA 3QQ5A 4JT2A 4EPRA 3QF4A 1Y3AA 3W3AA 2FFHA 2WAXA 5JI3E 2ZRNA 1U81A 2QENA 3AVWA 4OK6A 4PZLA 1L2TA 3TGPA 1CS4C 1JQJC 3P32A 1EESA 1Z0JA 2EFDB 2AL7A 4EQ6B 4N0EA 2XOKD 4HDOB 1VCOA 2ZYWX 5P21A 5CB6A 2ZJBA 3CR8A 3U3MA 2QUZA 1OXUA 1OIXA 2GKSA 5FTJA 4TYNA 1AIPA 2P6NA 1OYYA 2RH5A 2X19A 4X8MA 3DL0A 3GPLA 3JVVA 3IO5A 3DOFA 1RZ3A 1SVWA 1SZPA 4MGIR 3OE7A 2WKPA 5IK2D 4QM6A 3AF0A 3VMFA 1P3JA 1OH6A 2HXYA 3BXZA 4Q4HA 5CDFA 3F5FA 4FIDA 1LW7A 1I4DD 4D0GA 3AV0B 4NCJA 4RFSB 1F5NA 2J41A 2C9OA 1EX6A 2Q6TA 1UKVY 5AWFC 4L9SA 2WJHA 3GJ4A 3MAAC 2O8EA 2QU8A 4KLZA 1XDBA 2ZYVX 2HLDD 3RRMA 3I5XA 2FN4A 4AI6A 2WZQA 2YWGA 3GMTA 3THWA 2NIPA 2OCPA 3VR1A 4B76A 3AVPA 1IXSB 4TMTA 3BGWA 1NKSA 4BLSA 3WNBA 3KXLA 1NLZA 3UMSA 4AYWA 1P75A 2VIIA 2P5TB 2QSYA 2FMXA 5H1YA 4BLTA 2ZRIA 2OFWA 3TKLA 3BRWD 2RKOA 4BFWA 2EYUA 2QMOA 4KSCA 4DC9A 2JJ1A 1SVKA 1FX0B 3Q72A 2O8CA 1T8UA 2JATA 3L8ZA 4LPSA 2GAOA 3U3JA 2JCSA 4XOIA 3TNFA 2J59A 1GILA 4M8NE 1LS1A 2JLQA 4QKQA 4MA4A 1MKYA 4GRAA 3RDPA 1QG2A 2Y8EA 2ZIAA 3VNVA 3VHLB 4LBYA 2CE7A 3KL4A 2OCYC 4NH0A 4Q9JA 4JLNA 4NL4H 4P4SA 3TIFA 4DT1B 2R6GA 1W4BA 5E95A 4R71A 5AUOB 1SXJA 2IBMA 1XX6A 2ZJ8A 3PUWA 1VG8A 3T34A 2J7PA 3L2OB 3W8RA 4RD0A 3RHFA 1T5LA 2HCJB 3DM5A 1FUUA 2GCNA 4Q4AA 3CKLA 3IKJA 4LJ6A 1E2JA 1GDDA 4LYJA 1HQCA 3X1DA 3LLUA 3P4XA 1GRQA 4DCNA 3AKDA 1EFCA 4QBHA 3CR7A 4DLYA 5L3SB 2R6FA 1NMZA 3AF2A 4AIIA 3WBJA 4RFSA 3OEHA 2GA8A 1G5PA 2QGZA 4JLAA 4M1KA 4M1MA 4A0RA 4ASUA 3WMGA 2BBOA 4G1UC 2BV3A 3OIVA 2GWHA 3MJRA 4V0NA 3UMRA 2F9LA 4DLSA 3A37A 1FZQA 1G6OA 3JZMA 5KSPA 2DY1A 3QIAA 5B30A 2FFQA 4US0R 1OB5A 4PAOA 1Z0FA 1Z6GA 4ITRC 2V6JA 3OIWA 4BZXA 3HYRA 2VP4A 2YOFA 3N5CA 2PH1A 2VF7A 5FL7D 3AP1A 4HUQB 3AVQA 3OIYA 2CLCX 4F38A 2HCBA 1II8A 4DEYA 1E2GA 4I1OA 1P5ZB 1R10A 4P4UA 5ANRB 1T0HB 2ZRCA 1NLYA 3MWYW 3B60A 2HEIA 2JJ2D 2RGEA 4NTZA 5JRJA 3JVUA 1OFIA 2FWRA 4KSBA 4P32A 2AHOA 2VP2A 3BB3A 3WMEA 3FGNA 1WA5A 3X1ZA 3QPUA 1M74A 1TUIA 1E4VA 4FW9A 4ASUD 2WHXA 4MKIA 1VG9B 1UEJA 1RFLA 2HF9A 1SHZA 1CU1A 1NKTA 1KZGB 2CNWD 3TK1A 1NNEA 4C30A 2ZRPA 1ZYUA 4LJAA 2XTZA 2QMUA 4Q1BA 3Q5DA 3TW8B 4IKEA 1II0A 4PSAA 1IN6A 1S96A 3K0FB 5CM8B 3KB1A 5J4HA 3FKSA 3Q5EA 3W6OA 2QI9C 3R8CA 3HR8A 1KMQA 2BOVA 1OH8A 4P4TA 4WA7A 4UNQA 3A1TA 4DKXA 1E1RD 2VA8A 5JEDA 2ZXUA 3BFXA 4K81B 4TLCA 3QG5A 4JL6A 4DEXA 1JPNA 3GLHE 4FCVA 2OFXA 2ZRLA 1E96A 3U3RA 4P3YA 1P6XA 4RSGA 4FMCF 4RD3A 2KBFA 5CJPA 2GJ8A 3QVUA 1CR1A 5C18A 1ZD1A 5H70A 1LS6A 3CRW1 4W5JA 3TE6A 3I62A 4E07A 2YWFA 3CH5A 3BE4A 1BS1A 1W7AA 4GNKA 5FPYA 1W0JD 4LSGA 3WMFA 4A15A 1G21E 2ZR0A 4L8GA 5TV2A 5EP1A 3PEWA 3RWMB 2XJ4A 4BFSA 5C4GB 2GHIA 5AJYA 1LNZA 5J4KA 1CJUC 4I1SA 4IVPA 3FFAA 3K8YA 2QT0A 1P7CA 3VKHA 5BW8A 4HLUC 3MSXA 5HTKA 3CPEA 2PLFA 3L0IB 2VRWA 3TH5A 4MKFA 1D9ZA 2Q3MA 4C3ZA 3M0EA 2ZU6A 1EK0A 2NOAA 1IXZA 2ZAOA 1OH5A 1HT2E 5DN6A 2G77B 2REOA 2W6ID 4ZDKA 4C0AC 3I5YA 4NE2A 1M7BA 1R0XA 1F2TB 3LX5A 1UJ2A 3RYTC 4DLTA 1TQ4A 3RSOA 1VCNA 3KJEA 3M6AA 2ZI5A 3VX4A 1YRBA 4A82A 2ZI7A 2IHYA 3NC1C 4LI0A 5L3QA 3M1IA 4LJ8A 4HDQB 1CBUA 3AKEA 3X1YA 1OKKA 5DYIA 1GFIA 3ND9A 2D7CA 3KJIA 3VKGA 1AZTA 1CKEA 5KNDA 4AKGA 2WVJA 5AJZA 1E2PA 4XD7A 2CVHA 3W5JA 2X8AA 3TUIC 3D8BA 3RVBA 1T6NA 1XD2B 1DG1G 1W44A 1YR7A 5DI3B 1NIPA 4Q1EA 1DTSA 4C7OA 1Z5ZA 1E2DA 2GZHA 3AVOA 1D2EA 1E3MA 1X86B 1NN0A 1IAQA 1Z06A 4GZMA 2CEAA 1ANKA 5DHFA 4BPBA 1D2MA 2ZVPX 4NDZA 3W90A 3FMOB 1Z2CA 3SQWA 1F3OA 3SYLA 4NCKA 5D3QA 2F55A 4N3NA 1I4TD 4P33A 3TR0A 2H57A 2QRZA 1NY5A 2ATXA 4PSKA 2IS4A 2Q21A 4GMDA 3FYHA 4LJYA 2ZRJA 3LY5A 1E9EA 1N3BA 5FFMA 1ZM9A 2V6IA 2R6DA 2YYZA 2GVDC 3FMIA 4B74A 1LB1B 4EPTA 4Q7KA 2QRNA 2KWIA 4RZXA 3VR5A 4XWOA 1CRPA 2AD5A 5KDDA 4HLCA 2KBEA 4Q7LA 4MRNA 2QG6A 3LO5A 2V55B 3CPJB 2GEVA 4KYIB 1Q22A 4TMWA 4QOSA 521PA 3RAPR 4JT4A 4A2WA 5AUNB 1ZW6A 1ZM3A 1WQ1R 2ZE7A 2IWHA 1PUIA 4HLUA 3Q9LA 1A1VA 1YZKA 3IHWA 3KKPA 4MYUA 2XITA 4TTRA 3KFVA 5CB8A 2B8WA 1DPFA 2FSHA 4V0OA 5G3YA 2GCPA 1IBRA 2IHBA 1LF5A 3SYNA 1Q3HA 4QHTA 3T5DA 1E99A 1US8A 4EIWA 1X1RA 4PPGA 3PEUA 121PA 4F7WA 2P6RA 4RZUA 4PHHA 3WY9A 3SNHA 2ZREA 2YOHA 1FTSA 3BB1A 4IW3B 3NEYA 2R65A 4DIEA 1HTWA 1KKLA 4YMWA 2AFIE 2VP5A 1VIYA 5DO9A 3EG5A 4CEIB 1E2EA 1QHHA 3B1ZA 2G0TA 3K09A 4GOJA 1DBSA 4B2IA 3DHWC 4QJ5A 1CJVC 5UKDA 2EQBA 3PEVA 3TRFA 1KO8A 1OHHD 3HWSA 4DWJA 1XCMA 5KPJA 4LHWA 4WZBE 3WXMA 1UKYA 5JFGA 1XZPA 3W9YA 1IQPA 2G6BA 3EPLA 2ZUDA 5EUMA 4U7DA 4WZ6A 4RCYA 2ANCA 5DI3A 4EPWA 4IVRA 5K8TA 4MGYR 2GDJA 1J2JA 3SJCA 5EP4A 3CRVA 1SXJD 5BN5A 4L9WA 2UVQA 1F2UA 3NC0C 4LWZA 3IGFA 1Z3IX 3OIUA 4M9SA 2IF0A 5IDVA 4RD2A 1G7SA 4HYYA 3UWOA 2IYQA 2P3SA 3X1WA 4OYHA 1JQLB 1OIVA 4KV9A 5G40A 1K5GA 2CXXA 4XH9B 3ZZUA 3KQHA 5TY0A 3VR4A 1GUAA 2ECKA 3AP3A 1VHTA 4DVGA 4A36A 2WBLC 5BN4A 1QRAA 4BRUA 3ZVMA 4ZI2A 2IYUA 1U0HC 1CR2A 1PJRA 1AS3A 4I1VA 3AKYA 2ZJ2A 4JKIA 3SJAA 5EJEA 2PMDA 3B1XA 2UKDA 1L7VC 3FHOA 1R7RA 1NSFA 2R6CA 2EWVA 5ELXA 2IX3A 1W36B 3ASYA 4C0JA 2FDCA 2D06A 1MABA 1G19A 2NO7A 2CJWB 3GEEA 1FW6A 1W1WA 3DMNA 2RGNC 3PFIA 3AGQA 1EG7A 2GF0A 2J7PD 2O8BA 3MD0A 3UATA 5C4MA 4YMSA 5C46F 2NZJA 4OHVA 2V3CC 1NBME 1E79A 2ZSEA 3VR2A 2VQSA 3THYB 2BBWA 1A2BA 1K5DA 1G64A 2JAQA 3EIEA 1GITA 2O52A 5FI0B 1VTKA 3GD7A 3I1FA 4NYJQ 4A92A 1MR3F 1W0JA 2OXCA 1KY2A 2B8TA 3C5CA 4CW7A 4ZKDA 1MO6A 1NVXQ 3VHXA 4IXMA 2HUPA 3UMFA 2OSBA 4GT1A 4ILEA 2HYDA 1PLLA 4GDFA 1W4CA 3IHLA 3QF4B 3TSWA 2WAYA 2XB2A 2J0SA 1DAFA 4RJLA 1FQJA 4E09A 1ZU5A 3EZ6A 4D4KA 3E2IA 5FBRB 2IXGA 4QC2A 2J3EA 1N6RA 2A2ZA 2WJYA 3G5UA 1KDTA 2ZYTX 1E0AA 4BQSA 2ZJOA 2Z43A 4LV6A 1G7CA 4OI1A 4A0GA 3OESA 1FMJA 4OHXA 4Q47A 2D2EA 4FWTA 5HZKA 4FN5A 1E2KA 5JLJA 1P2SA 1DADA 3CRQA 4TLBA 5KDLA 1N5IA 3GLFA 4KAXA 1W2HA 3ADCA 3EIQA 4MYHA 4PXAA 3K0CC 1XF9A 3A8TA 2JDIA 1KOFA 4IDNA 1DARA 1G5TA 2ORVA 1G5RA 1GTVA 2R9VA 1P2UA 3K9LA 3PITA 4DLUA 3UK6A 4G0NA 2C9YA 2OESA 4W7SA 2BEKA 3BC1A 1RJ9A 4YDSA 4JVLA 5FBVB 3GLHA 5DSZA 5DE3A 3ZVRA 4CIDA 2AKAB 4JLDA 2ZJYA 1Z0IA 1T3HA 4HZUB 3ADBA 5B2ZA 3AEZA 2WICA 1U0LA 1W49A 4LV5B 2BCJQ 2ZVQX 1RRGA 2YINC 1NN5A 4JVNA 4OQLA 4GFDA 4B6FA 1N6LA 1UAAA 2BMEA 5B64A 4DSUA 5EE3A 2EU8A 3FMFA 3HJNA 5IK2A 3GP8A 3TJZA 1E1QA 3O8BA 4DLRA 4PO8A 3QEJA 2BM1A 2VYFA 3IUYA 3CONA 4V02A 4NBSA 4M1SA 1KI6A 4MRSA 3K9GA 5F98A 3A1WA 5JMTA 2GJAA 2WWHA 3NIBA 1E9DA 2ZTSA 1KO1A 3SDZA 2DWPA 3THYA 4TL9A 1KDPA 4KYUA 1JJVA 1QHHB 4OL0A 4E03A 1J99A 1ETUA 3A36A 4E5UA 2ORWA 3LH5A 4NYMQ 3S1AB 4MRPA 2WJVA 1D9XA 4BLOA 2HF8A 3QF7A 3SS8A 3QY0A 3VKWA 5SZHB 4ESVA 4Q7MB 1YVDA 1U99A 1HYQA 2A5YB 4JJZA 4L16A 2RMKA 4PX9A 4NYJR 4OI0A 4Z51A 5L8VA 2ONKA 1RE0A 1S1CA 3TUJC 3TSOA 1JR3A 1N0VC 4JLJA 4JS0A 1U8YA 4DB4A 2V9PA 3SFVA 2GESA 1HH4A 1G3RA 2OZEA 3GCGA 4BWYA 3I3SR 3KQUA 1TX4B 4NCNA
chains in the Genus database with same CATH superfamily
1P2TA 5JZVA 4ZPXA 1ADCA 3GJ0A 3KKMA 3NOXA 4JWTA 1RM3A 4DQDA 5HXAA 4TVKA 1O6BA 3SICE 3T52A 1H8EA 1RHMA 4GR9A 1XCGB 4HDMA 2DFPA 4ZZIA 3EAFA 4DLAA 3KC2A 3ME5A 3M83A 1UFQA 5HRUA 4PANA 4A2QA 2BFFB 2CCKA 1KOLA 3WL6A 1WLSA 3L8FA 3AVUA 4NBTA 3T94A 4RAOA 4IZ6A 1UBFA 3K96A 3I53A 1A9ZA 4RL4A 3OLCX 4DSZA 3O90A 2P0AA 1RWWA 1ZIYA 1U2DA 2IPLA 3D3WA 3PLAE 3UH0A 3G7SA 1QH8A 3ACCA 3VYSB 5ARBA 2ZUEA 2QRMA 1ZNQO 3HI6A 1WZNA 2H65A 1S8NA 1ODFA 3T95A 2IZ1A 2ZYIA 4K26A 4NMMA 4YDRA 4BO4A 1TYZA 2W0SA 2PX2A 2XRFA 3DONA 1ESZA 2FRXA 5LLSA 2OAQ1 2A5DA 3UT6A 4KR2A 4RHCA 1Z0KA 1GYPA 1H0SA 4MUEA 4RTLA 1SKQA 3C8ZA 1KI8A 1CQXA 2CLSA 4OB7A 4PYKA 3TQCA 4B34A 2MYPA 2ORIA 5HWSA 4XWWA 3AB3A 4UTRA 2WB2A 1O94A 2I4OA 5DJ5A 1LSOA 3MZ0A 5EKTA 1YQGA 4R51A 5E6RB 5C1OA 1LJUA 4RZIA 4ARZA 1XTVA 4ZQGA 1Q19A 3G2MA 1GPJA 2J85A 1J9GA 2Q3JA 3FCEA 3FVVA 2NNWB 5KCMA 3CLSC 4PHGA 3EGDB 5CBPA 1ZH0A 1ESEA 1NL3A 3BHIA 3MN1A 3FJYA 1WOYA 2XZDA 1MJ5A 1VHDA 1LDEA 3PTLA 3UB2A 2JKVA 4WX2B 3FDIA 4ZPJA 3UV7A 2G83A 2A1TR 1XB2A 4R1SA 5JWOA 4L9AA 5HKLA 1Q7EA 1GLGA 3MT7A 1NRJB 4RXTA 5L6LB 2P65A 4MCJA 5A7GA 4B7ZA 2ZS9A 3D3EA 4R83A 1EFRD 1G20E 3DDOA 5EKDA 1I7NA 2VYND 2C96A 3PPVA 4XLLA 5FX2A 5F2NA 2RB5A 4ZI5A 4EKIA 2C2KA 3A9UA 4Q93A 4FFNA 3LD9A 2VDKB 3BM5A 1OJ7A 1UZNA 5AW9A 2G9NA 3KB2A 4RENA 4D8YA 2W42A 2O8DA 2BMFA 4CTNA 1GDTA 3D6UA 1LFDB 3R3SA 3W79A 5K5EA 4NAVA 5CDFE 3WWOA 1EWTA 1E2LA 1E3JA 1H42A 1R8SA 1KQPA 3FM9A 4MRRA 2PO7A 4N9WA 1XVAA 2D2FA 1DV1A 3RTBA 1RT9A 3K0CA 1OREA 4QASA 5EGNA 4DXDA 1N5MA 2RH9B 2N42A 4OSEA 1K27A 5DBFA 5SZKB 4DNQA 1R5OA 4JC4A 5KJCA 3VC3A 2I4TA 1GUYA 2EBWA 3P9ZA 2J3JA 3GJ6A 4Q7JB 4U2CA 1VE5A 1AG9A 3E3AA 3GRVA 4XSVA 5I7OA 4EENA 2HLNA 3QLUC 5FLXA 2XMQA 1WCIA 4ENSA 2QRPA 3QKSA 2BSQA 4TXJA 5IULC 3R6WA 2F9FA 4QG7A 4XIGS 1NHGA 1KZ9A 2I5PO 2CUKA 2XSZD 4YLGA 4G5RA 1H9CA 2C4TA 4CKBA 3OQ6A 4Z9FA 1C3VA 5KWEA 4LQLA 3TTVA 3I92A 1RS0A 3ZIAD 4ZZ3A 2QMYA 1SCUB 4LVCA 1H66A 5LQRA 4MOWA 4BLQA 4EMTA 4D0RA 3QKTA 5HQTA 4XQ0A 4DUGD 3WC4A 3SYKA 3ZYCA 4PE5B 5CVCA 2YOGA 3AZOA 2CXOA 5KTMA 4IY1A 4RZ2A 3KUCA 4JL5A 4OJYA 1N2BA 1KAQA 4PQFA 1X13A 1WB9A 2ASEA 4JZKA 4MHSA 3UAZA 4MUIA 4PNZA 3WLMA 1VRCA 4K5QA 4CMGA 3RYCA 2QUHA 3TOZA 3VAZA 5CDSA 1E92A 1DC6A 1JALA 1ZDMA 1Y5LA 1TVKB 2POQX 1YB4A 3U60B 4OHZA 3GJ7A 3HGMA 5DYGA 7YASA 4OIMA 1P5RA 1YAJA 3IP3A 2RHDA 4HLDA 1WKVA 4MQBA 1DAEA 4OO3A 3TIVA 2R7MA 3FVWA 3ZLUA 5AVSA 1L7AA 2WA2A 3C3DA 4H77A 3RIEA 3NETA 4C88A 4MNTA 5LB2A 3B5EA 3MTGA 1THTA 3NMUF 2H1HA 1DEXA 4NBKA 5AQ1A 3OOHA 5KSZA 1JDUA 1Q2UA 1QGAA 1DT3A 5HX7A 4AZ0A 3NHBA 3FYUB 1VIDA 2D0DA 3FR8A 2C98A 2XKBA 4JVSB 7REQB 3RRYA 1C30A 3LRPA 4OU5A 5C81A 4R54A 1RCTE 3SIRA 4J1TA 3C3XA 4LXQA 1GAEO 2DFTA 3M6MD 4K9NA 4EUEA 3T9EA 3A1VA 3CX8A 3AC0A 3GAFA 5LA6A 1GT91 2K4MA 4Y9UA 3B82A 1ENOA 3NYWA 5BUSA 1PGOA 1JSRA 1ZK2A 3CUTA 5G02A 4EW6A 3EXHC 3ZU4A 1V8DA 2A0WA 1R37A 2YJ6A 3IVMA 5BOSA 3DZGA 1ZICA 4ILKA 4XUGB 1ZY2A 5EIHA 4WZAE 4DIDA 3RKRA 2B98A 4UEJA 4G2NA 2P1ZA 3HYTA 1HRDA 3TLEA 5JSYA 5F7OA 3T4UA 5K05A 3ZLJA 3JZAA 4XTRA 5ITZB 1WULS 2VXOA 3I73A 5CB4B 1KGSA 2DG2A 3KU4A 4CM8B 3QLUA 3DW3X 4QNRA 4UQPA 4L8YA 4JUFA 2RHMA 2Y1FA 3OTGA 3GFSA 1OTYA 4Z3OA 1QZXA 5BSKA 2ZYUX 2QIPA 2ZB3A 1NF3A 4QZVA 4GECA 3LPMA 4AQDA 3ON5A 4L6CA 3A26A 5DRTA 1RXWA 3DE4X 3AUXA 2H2FA 1AQYA 1UBHS 3ZTWA 2J4FA 2BZGA 1U2SA 1X14A 1IPEA 2IZ7A 1QVVA 3P9YA 4O4JF 1W75A 5LNK6 2C95A 4KE9A 2JLBA 2FW1A 1E2BA 4YCJA 3KFLA 1TZBA 2I1VB 1UKAA 2WJJA 3LT5A 4GVPA 1R4MA 4HTFA 1O3YA 3NTXA 3MG9A 4PO3X 3WMRA 4L73A 4FGZA 2ZWMA 4WBNF 1ZGHA 4RGYA 4FFMA 4AD8A 3C7AA 3BTVA 3K8ZA 4O2LA 1WOMA 1OYOA 2CNOA 3KWLA 4AZVA 2P8JA 4ANFA 4B46A 4C2UA 3H42B 4QGAA 4KFUA 1SHKA 1AK1A 1EAMA 3AY7A 5GJCA 5K6RA 1DC4A 4YCBA 1OA0A 1ISJA 1DMSA 3P4YA 1I4OA 2HN9A 1DELA 4PS0A 4QU0A 3T1HB 3RB8A 2HBRA 2VJMA 3PNQA 3VR6A 5JWRA 2CLFB 3PFGA 5HIMA 1NJSA 2R6AA 3BBLA 4KX3A 3IIKA 3WZLA 2WJ6A 3KOWA 3CS3A 1O0BA 2JGRA 1FDWA 3AIOA 1WZ2A 1FFHA 2V5AA 3FA2A 5AKKA 1CJTC 4F6CA 2BH2A 4JCOA 3DZIA 1NW3A 3VBCA 1E5XA 2IYWA 3KT3A 3ZBQA 3DOCA 4CLDA 4ONEA 4ZVPA 4A2CA 3ELBA 4NV1A 1WM1A 4ZCPA 2AK3A 4LWQA 1E7MA 3CO5A 3SAJA 2OAP1 3EEQA 4KAJA 3X1MA 5A5FA 3UOAB 2BFFA 1USKA 1TKAA 5IAJA 1L0BA 2ABWA 3FPBA 1G1AA 1VFNA 7GPBA 1KEKA 4C87A 5YASA 1U0GA 2QW1A 1EXMA 4PTZA 5K7SA 3TI7A 3P26A 3EFOB 3V7YA 2ZQZA 2H5LA 4QDKA 4XWAA 5LCXA 4YRNA 3NANA 3D8HA 4S1NA 5EE9A 1G98A 4OI4A 2H07A 4PR0A 5BRNA 3OFJA 1DDIA 1KP2A 2XDYA 2YY7A 3A0UA 4RIEA 4D9GA 2QY9A 5CNJA 2XCQA 1RWVA 1UXKA 1TGYA 3WRYA 4UU8A 1QH9A 2B83A 1YQQA 2QIOA 3RVLA 5B7NA 1FX0A 1KDRA 3GLIE 2GVNA 4BLVA 3K70C 1MH9A 1RYYA 4G0YA 5LMCA 1DZIA 3N2EA 2WYVA 1RKXA 3EMDA 3L7KA 3KTAB 2H5EA 4F2HA 3ETGA 4PGGA 1ATIA 2CLLB 4KR6A 1YJXA 3R0QA 5EVCA 1YULA 1CYDA 1KJWA 3R44A 3PNSA 1X1SA 3N1UA 4XIYA 1U1GA 3I9OA 1M3SA 4FONA 4EY5A 5C4IA 3FZYA 4JY7A 5GIOE 5LMUB 2I4LA 3P0IA 4K87A 4YC7A 1MB0A 1Y1TA 2HDHA 1O0CA 4X3OA 2EW1A 2O3SA 2PXCA 2YJTD 1M2NA 2ZJ0A 3GUUA 3OX4A 2J6CA 5G4LA 4N0PA 2BEUA 1G55A 2JLZA 1PV4A 3C3YA 4G1EB 2P7IA 2CL6X 1RADA 3I9NA 4KXWA 3HU5A 3TB6A 2WYWA 2F4VB 1FY2A 3H1BA 5DKFA 1HNWB 2BZ1A 2WINI 2BKEA 1SKUA 1ZI9A 3CA8A 1JNXX 3GRFA 5BQ3A 1TM3E 5ULLA 2Z9CA 4F6LA 2XGSA 2JD0A 3YASA 1I7DA 3HDHA 3GPIA 1DOHA 2YNMD 2OZVA 5J2UA 1H2WA 4B3MB 2QZPA 5J1SB 2DHEA 1ECPA 3I8XA 5A1JA 2V7TA 3OU6A 1E1RA 5I7AA 4CLOA 2F8LA 1RLOA 4N3CA 1ZD4A 3UXHA 4FYMA 5A71A 1VCIA 4ED9A 3IR5A 3KJGA 2E1PA 4E1AA 4ZVSA 2EGHA 3RG2A 2CYBA 2Z3WA 3LS2A 3QPCA 3L0CA 4K6CA 1Q57A 2OWDA 1RQNA 4EHAA 1GQRA 2H54A 5IBQA 5BN3A 5H80A 2CVQA 4BV8A 5MDHA 4PX3A 4EKDA 2R751 4WCDA 1U4SA 2O1WA 4UKDA 1D2NA 1MPXA 2NYVA 4WN9A 1WABA 4D9BA 1G7RA 1C41A 2P1DA 5J2UF 2AVNA 2PX8A 3DVRX 1QK4A 1M8PA 2VCHA 4ZMBA 2JFWA 2BGLA 2ZAMA 4JJAA 3SN6A 4O4HA 5L3QB 1M5UA 1DBQA 3MCUA 4UZSA 2IVFA 3SI7A 4XR4A 4CCSA 3JQAD 5G3ZA 4BVKA 2YS7A 1AB6A 2A5LA 3G9UA 5G0SA 1YACA 1QLHA 5EXSA 2ZW9A 1C4OA 4CE6A 3STHA 2E7ZA 4WAUA 3C0KA 2XGJA 5K3FB 2W6OA 4KODA 3VU3A 4EPVA 1MEJA 2QD5A 4L0CA 2Z2YA 3HKBA 4MP3A 2RCYA 4CM4B 3WTCA 4QGSA 1H2RS 3B6KA 4JBXA 4V3BA 4UHDA 4G4SO 1R9JA 3OX1A 5G1NA 1GKIA 4KR0A 4DIKA 4XDGA 3L8DA 3GI1A 4HX5A 1M2KA 2Z8YA 3RUPA 4YAKA 1O95C 4W5RA 2P6OA 2WWWA 4B4UA 3B6EA 4HMOA 2W4IA 4FMDF 1MLDA 4LOHA 1FYEA 5DT2A 1XJ5A 3I83A 4RKYA 2PJDA 4TMYA 4LMRA 1CIPA 4WBSA 5EWLA 1Z08A 3FJOA 3W6PA 4J43A 5DNEA 1QNFA 3R9XA 2O5EA 5JIBA 1B6TA 3B6JA 3L43A 4URZR 2PSHA 5ALPA 4WEOA 3ITDA 3THWB 1K8ZB 4TLDA 3HZOA 3TECE 3FB1A 1PGPA 4QEZA 3U09A 2BZSA 2NG1A 1X8JA 3D7KA 4RSMA 4AZTA 5FYQA 2YR0A 4MZXA 3UYKA 1UQUA 4GPBA 1GPMA 3A06A 3HCAA 3QPWA 4M38A 3HADA 2ZJ3A 4MQLA 4B9EA 1TCVA 4D0LB 1M34E 3VX3A 3EIFA 1I0IA 2JLAA 4MQEA 5KIAA 4DR1B 3MGBA 2QN8A 5ALJA 3LC1O 3H86A 1V4NA 2NTVA 1CVRA 2BRUA 1CP3A 1JYSA 5EXTA 2VDWB 4LXYA 3T0FA 4DSNA 4DDWA 2F43A 1ZD2P 3DVLA 5C35A 5AXCA 1XROA 1NDUA 3ESBA 3NZEA 1E2IA 1N78A 2GXUA 3GJ3A 1OLUA 4BGUA 5BPHA 4HATA 5JOQA 3HRKA 5JARA 2FPMA 4DQLA 1NOJA 1G21B 1RFGE 3N6XA 4MW9A 3Q0TA 3UW1A 4B40A 3ZV7A 1T10A 1NI3A 2ZUSA 3IT2A 4M0FA 5CFOA 3IMEA 2Q9AA 2AG6A 1M6WA 5IDXA 1RXVA 4FXPA 4MJ3A 5JS8A 2NSLA 3E05A 5FEMA 5C31A 4D3FA 1AF7A 4ZVKA 1OGIA 3GRKA 3O8RA 4XAQA 5JAMA 4BKMA 5FH9A 1E1LA 3R41A 1JQ5A 2PMBA 3Q88A 5TGZA 1OFUX 4ZU3A 4LGVA 4JX9A 1BMDA 1WF3A 1STOA 1Q0ZA 2NO0A 2PT9A 2ZBVA 3L06A 3ESRA 3WIOA 4KDCA 5FFFA 4D96A 1RKBA 1HT3A 3I1JA 2WHRA 1IWOA 1N8SA 4KXXA 2PL5A 4HNRA 4QU8A 4BZWA 4BKUA 3F3KA 4OLFA 4B8WA 5HKBA 1RAEA 3UQYS 3WWEA 3IDQA 1AHPA 1XJWA 5E4YA 1J0XO 1WSWA 3DHEA 3TJMA 3C45A 3NB0A 5HIAA 2J3DA 3KOXA 1GXSA 1MJHA 4NJEA 4V0RA 3WBKA 5LQJA 4CEJA 1G4AE 1H4QA 2IOHA 3HMQA 2OGWA 3BRSA 1VI2A 2YZ2A 1WDKA 4I2NA 4LK2A 2C0PA 5FB3A 2KSQA 1COWA 3MWJA 5JISA 3BD8A 2C2WA 3ZU3A 5ED0A 3RRXA 5KTPA 3QLTA 1KY4A 3CKKA 3GIDA 4EF4A 3PXAA 1REQA 4F6RB 4ZD6A 2XNKA 4WTOA 3SVZA 1E1CB 3A05A 2G9QA 3EMKA 3KSMA 4LRYA 2L0XA 4TLAA 5CFRA 2RBGA 1A9TA 3OE1A 3EC2A 4PSDA 5SY4A 3NKFA 1XU4A 3G6KA 2HMAA 2BHNA 2MYUA 1N2CE 3PQ5A 1K0FA 3TYXA 4BVGA 3K3PA 5HR5A 2JPDA 2ZZNA 3LQ2A 4N5NA 3ZZNA 1SIUA 4JP1A 4HAUA 3QX9A 3GB9A 1PNQA 1WXEA 1DAHA 1V5WA 2BGWA 3FLAA 4NOKA 2C1XA 1PVOA 4BFUA 1I0ZA 3B6ZA 4EDFA 1Z5OA 1BN7A 4X45A 3UK1A 2PD4A 2WHYA 5I8WA 2VPTA 4P86A 4NE7A 2BONA 3FUWA 4HV4A 4TN5A 4ZIRB 1IONA 1VE3A 4ML3A 2WKRA 3SHFA 1DL5A 2ZE6A 1UOPA 3I34X 2XMBA 3LHDA 2IOYA 3PCRB 3ZDXB 3SG0A 1N77A 2J0UB 1A9XB 2IYZA 3LLSA 4DPKA 2I22A 4MUMA 1WXDA 2GJ9A 1ISMA 3N2ZB 4DMGA 1AN0A 2PL9A 4EYKA 2ZXEA 1FUIA 4BMYA 3OT1A 4KK4A 1GNVA 3ONVA 1I6LA 1U3DA 3LK7A 2QDXA 3IAAA 4UUPA 1BXGA 4WXPA 5EIBD 3GVIA 3PG5A 3VQTA 4DCVA 1KQNA 4DIMA 1TKCA 1E9SA 4W1PA 3OX2A 1L7PA 4QSHA 2HJVA 3E8MA 1JU9A 3Q0EA 4J4BA 2XTMA 3HA7A 2GB4A 3GBPA 4X61A 1TRHA 1YZLA 3G59A 4PPFA 1O54A 1BMQA 3RT7A 1XPUA 4PFSA 3QWFA 3OMXA 1Z0AA 2XLBA 3F0TA 5HA5A 1DC8A 3TR6A 1XWFA 3VC1A 4DIOA 1G5QA 3P9CA 1TFUA 1YONA 3GQBB 2VBGA 3QE2A 4MB2A 3U1TA 1V39A 3ZDRA 5KYXB 4N7MA 3DVAB 1MT0A 4OU4A 2JJ2A 2WJZB 2HRZA 1XMIA 2XUQA 4DWVA 1R16A 5JROA 2OILA 3V8NA 1MO5A 2PMCA 3ZDDA 1Y3IA 2J9GA 4FD2A 3ANLA 4HUJA 4XRGA 2O2HA 5FOQA 4LFBB 3ZHSA 4AKHA 3LCVB 2OECA 1WUIS 2GETA 4TKVA 2W83A 1MAUA 4IGFA 5IP5A 1JDBC 5A6SA 3P9XA 3HS3A 4DR3B 2E3JA 3PQFA 3KD3A 2PLWA 4K2AA 3PGVA 3FCSB 5KINB 2HHHB 3ZY3A 1UBNA 1O1YA 5KHLB 2JAUA 2WPNA 1ELOA 1THZA 2PUHA 4FI3C 1TB4A 4KQ1A 4PZPA 3Q8KA 3CNNA 1OLXA 2XTAA 3TG8A 4JGIA 4YYEA 5IM4A 2BM9A 2G06A 2WNIA 4F0JA 2A35A 2JLUA 3OFSA 4RK6A 1FVHA 4G4GA 1JG7A 1JXMA 4QVKA 2PGXA 5BWLA 4BVAA 3FNRA 4NPHA 1OXTA 4TLEA 1HFWA 4AWXA 3RADC 2RK6A 4KH0A 3BGDA 2PH7A 2XMRA 4O4HB 4DJFC 1FOEB 2Y1EA 4P53A 2B4YA 4C22A 1WZCA 2GBPA 2ORED 5DM4A 2DB3A 1TI7A 4QO7A 1BFUA 2QL9A 1A8UA 3ZJUA 4XX0A 1MH1A 1WHTB 1D2HA 4YQEA 3NONA 1GZ5A 3ICCA 3VR6H 1XSEA 4K9PA 4AN1A 1F51E 1JIVA 2PTGA 4TZ6A 1ADGA 5C53B 1JZTA 4ZOLF 5G4KA 2C9BA 4UXIA 1EVLA 3HY3A 1CS0A 2WMOB 1I2CA 4BMSA 1ENZA 1V5FA 2XOXA 3HB9A 3JU3A 4BJHB 3ZPXA 3D8TA 4OMDA 4R1UA 3QENA 4D8XA 2W6QA 3L0ZA 2ZS7A 5LD2B 1NZJA 3CF6R 1CY6A 4NQRA 1MFZA 1ZOLA 3GMIA 2OFOA 4OD0A 1DXHA 1Y0BA 4BAUA 3U61B 2R68A 3PT9A 1NW7A 4BO3A 4E7OA 3ABQB 3C3CA 2UDPA 4B3XA 3KE8A 3EASA 1JQ3A 4I8DA 3DBLA 3KT8A 1V71A 5ECDA 2FFJA 5BQPA 4W5WA 1QHFA 2YWCA 3E4DA 4UAJA 5HUJA 3E23A 2BGJA 2P5SA 4CKZA 2O54A 2OBYA 4ZOLA 1T15A 3FNHA 4JLVA 6ABPA 1F48A 1QFZA 1ZIOA 4ZTBA 1YJ5A 4X95A 3K5HA 1IM2A 3W04A 3NM4A 1RIIA 3G1UA 3HDVA 4UNPA 3O4GA 3UJBA 1HLFA 3WBBA 4L4UA 3PWTA 3HLYA 1Z7BA 4KGXA 4CQLA 4JJGA 5J4VA 1S3GA 2GYUA 4PGMA 2RAPA 3UF0A 4BMXA 2WUWE 3DEFA 3LHKA 5F1OA 1G59A 4ZOLB 3WIBA 5LZ8A 4AJHA 2BTOA 4ENPA 4OHOA 3VVLA 3ZKWB 3ZS9A 3PKJA 4I5DA 5C0OE 3AWIA 4MI3A 2X14A 3KUDA 1PZHA 3GDGA 5JCOA 1ZOOA 4FNMA 4P83A 2BBTA 2ZWAA 5KCZA 1MDBA 1G18A 1OV6A 2G0AA 2VI5A 2XVYA 2YRFA 2YY5A 1J97A 3LLMA 4WZBB 5KTRA 3D4PA 3AUYA 1L5NA 2EATA 1AQIA 5EKSA 4D4JA 4EJMA 1UXIA 1W36D 1H93A 1IXYA 3TTTA 2O8BB 5FNZA 3UCEA 2H9YA 1TZCA 4FOSA 2AG0A 1K8XB 3BCUA 1LDMA 5IDWA 1TPZA 1NV8A 2Z95A 4U6QA 5A5VA 4HB2A 2Q27A 4NCHA 3EPRA 3LGAA 3KD2A 3FOFC 3JSXA 3O38A 1VZ3A 4MDFA 2WU1A 1Y4UA 3T7KA 3AR4A 3CB4A 3Q10A 2C00A 1XPJA 4J16A 4OQEA 1FP4B 3ZH9B 3WWZA 3RE1A 2ZE8A 3OF2A 5C8DA 2QW0X 5MFZA 2C7GA 2WTUA 1CTQA 2JIZD 4HYEA 5HGJA 5AVOA 1JSLA 2I0FA 1NR5A 3QU9A 3OQ1A 3T7EA 1XDGA 2RHOA 5KOYA 1ZNZA 1DCKA 1W36C 1TCUA 3W1WA 4EVSA 3GUCA 3M49A 3U6BA 3KXDA 4D0NA 3EEIA 1S9DA 4CLRA 2D5CA 3EDRA 1Q7GA 3IR7A 3HUFA 4TQ9A 4HKTA 3HB1A 1Z37A 3ITEA 4IEFB 1GVNB 2OB2A 4RD1A 3RROA 4MDEA 2IZ5A 4EHLA 1XEWX 3VTAA 4BUJA 1KAEA 1N7GA 4N7RA 2YJ3A 5G2OA 1T6YA 1NF2A 1ZIPA 3IVGA 1B0ZA 1IUPA 2VRBA 5BXYA 1UJNA 2GZDA 1WHSB 4PFJA 1ZXXA 5G41A 3AI3A 5EQTA 3V9PA 3VR4D 3KE9A 2D62A 4EFKA 2NUAB 4QIHA 3WGUA 2J9RA 2ZWPA 1XZCA 1PNRA 4MS4A 4RVCA 4K9QA 3P2EA 4H1VA 3AWDA 2D4HA 5HRAA 3IDAA 1MOQA 1OWMA 4YV1A 1FMCA 5CNKA 1U63A 4ARIA 3F6BX 3BTSA 3K1AA 3B3QA 5EKUA 2Z6UA 1SVLA 4Q9LA 3BWYA 4B6EA 1AY0A 2AWNA 3QGMA 3EZ7A 4E15A 3WIVA 1A69A 2I3BA 3QNUA 2VHZA 1FJHA 4FR0A 4RQBA 4Z3DA 5TSDA 3LKVA 2P4HX 3N3AC 4BNDB 1Y9DA 1UK9A 1TIPA 3M6UA 3CC8A 4MZDA 1OYVA 1WTCA 3UUEA 5DM0A 4WADA 4MRVA 3HJUA 1EK2A 2FCRA 3ZCUA 1JHZA 3AM4A 3KAQA 2N1MA 1NJGA 4PWYA 3LUKA 2NO1A 8ABPA 1FRVA 2OO3A 2X4IA 2QX9A 3ICEA 1H2FA 4PBRA 3R7WA 3ST7A 2YBDA 1ZGGA 4XGNA 1TUBA 2V45A 4DIUA 2R8PA 2QP4A 1NW5A 4DCPA 2GKOA 5FD8A 1CPYA 3L8HA 5B2FA 5HKKA 3IRVA 2C04A 2M6RA 3N8GA 4MYTA 3EISA 4GC5A 5CDYA 1HYEA 4ISBA 3M4NA 4W9RA 5ESWA 4A6EA 1FCJA 5JJCA 2W6MA 1IQRA 2CHUA 4FGUA 1QH0A 4R8VA 2RDMA 1AUXA 1AH2A 5I9TA 3I12A 3P9SA 2DEUA 4XJTA 4B2LA 4IZHA 2A4MA 3QLJA 3PUZA 1PNOA 4YPFA 3P0HA 3MWLA 4RVNA 3JQGB 4ALKA 4BWFB 2VYNA 5CBKA 3KQSA 3LO8A 2E5LB 1O9BA 4E2ZA 4R40A 1JI0A 4NHOA 4QHYA 1GTJ1 1VA4A 1KE1A 1QGUB 1FA9A 4MPJA 1FLNA 4JBHA 3IJRA 4LWOA 3D59A 4QU5A 2Z6AA 3MRXA 5DIFA 4CMIA 1M66A 1B8OA 1AKTA 1L5QA 3Q7PA 1AC5A 2VT3A 4Q12A 4ZXFA 1CUEA 3CZ5A 3B1YA 1QDEA 1M1YB 4FSDA 1MB9A 1NVDA 3S2SA 3V7NA 2EBFX 2H3EA 3F4BA 2NYUA 2ZDHA 5EJMA 1ECCA 5FBQB 1L4LA 2YWHA 2PAFA 2R6JA 4ZQFA 4EAQA 4MS1B 5IWAB 4AO8A 3IAS6 4P7KA 1HDOA 2OGSA 1ZSVA 4GPD1 3ZCSA 4CM3A 5AW0A 3BEOA 2Q28A 2XF8A 1KMIY 2Q5EA 4OAQA 4EY3A 3LP5A 3EY9A 2FK8A 3F96A 3FOBA 1SCQA 3G9XA 4UUOA 2OFFA 4QGFA 2E6KA 3TFQA 4BY9E 4GKBA 4Y2PA 1NI4B 2DQYA 3MXTA 1LVGA 1BE6A 1F2TA 1KYTA 1A5AB 5DBGA 2EC5A 5TS2A 3GCDA 5F73A 1IZYA 4J4HA 4QRIA 4W82A 4CEIA 2Z2JA 1XMOB 3O31A 5K8LA 1E9BA 3HU3A 1L7MA 2OP0A 2GEUA 4P81A 4PWZA 1L8XA 2DPLA 3CGWA 3S4YA 1W0KA 2R6ZA 4KR3A 1ZUNB 1PSZA 1VPWA 3FZEA 4FMBB 2QZ9A 3HJHA 4L5YA 1W5TA 3KK0A 3MFYA 1H23A 4CL3A 2GBFA 2PL1A 3N2GB 1PSDA 4A03A 5IHPA 3BWMA 3ABRB 5AMXA 1EYZA 1KPHA 2D1TA 3DZFA 1PKXA 3M70A 4TYPA 4CCYB 5KTSA 1YI1A 4JK3A 4ACBA 4GPTA 3WKBA 2FSSA 3GUVA 4P4NA 1MZVA 3ACBA 3SC2B 1RJWA 1QHYA 2O7RA 4FGWA 4PG4A 5E6SA 1Z6AA 2PZLA 3C3AA 3K8OE 2QD3A 1KO4A 1ACLA 5B3JA 2DH6A 2H1LA 2HU5A 4A0QA 4EQZA 2O14A 1HMPA 4KG7A 1CHNA 3H9UA 4KXNA 3QIVA 3AKZA 4P0TA 1T5IA 3HHEA 4OH1A 4MWOA 2WIFA 2MYTA 1C7QA 2N1BA 1I30A 3KPUA 4XUDA 3C6BA 4KOEC 3ZI4A 5HKOA 1M8JA 4FMDB 4UVIA 2QYTA 4WI1A 2C4NA 3ZLTA 4WJZA 1E7SA 1UP7A 2Y93A 1EAYA 1W5SA 4OJTA 2ZBQA 4LE1A 1SKYB 2WSSA 3QWBA 4QGBA 1VMAA 3BDVA 2GCOB 3ZEAA 3EGIA 3KP1A 3RC1A 4BE7B 3G5MA 4R1TA 3ZD9A 4D4LA 3ONDA 4UHHA 1UMCA 4OJQA 4F3YA 2BH9A 3OTWA 5LIPA 4CTMA 2NO4A 4R5HA 3PYLA 2IA5A 4TLMB 4RJTA 4A1FA 5FP0A 3WGJA 3R9XB 1C50A 1G8PA 1XRMA 2DCMA 2GEBA 3BIOA 3AT1A 3VPGA 3RC7A 2Q3DA 1RC8A 3A10A 1JUDA 1CUBA 3HL4A 4YH1A 4D0SA 4LCBA 5GJBA 2VP9A 2OY0A 1SULA 4GM4A 4I1YA 1DQYA 3ZCVA 2Z09A 4BNTA 1U28A 1NVTA 2I3DA 4G0WA 1EJBA 2TMYA 2P2YA 2VP0A 2DHRA 3AO0B 2BKVA 1AKQA 1UPTA 2V7VA 4EJSB 4WVLA 2DBVO 1RQ7A 2OG2A 2CB9A 2ISSD 4UREA 1ADJA 2PKWA 1QV6A 2IXFA 3ILVA 3RJZA 4DCSA 3EUWA 2F3RA 4Y1GA 2BGRA 3VGPA 4ENTA 1QGZA 2F43B 3WP1B 3GJQA 2DHCA 2GWRA 1PF7E 1PLKA 1BH6A 1WJGA 1D7OA 1ICEA 2W8BB 3GCZA 1N5OX 2BWJA 2RHCA 2GDZA 2Z58A 4GRIA 5E0KB 4N48A 5LL6P 1NUPA 3L04A 1OBVA 1VBMA 2WKWA 3M6FA 3E9DA 4QOHA 1XMJA 1IZ9A 3EGVA 1REQB 4QOIA 9LDTA 5K09A 1R8QA 1BXRB 1DG3A 1G20A 2JRCA 2R8EA 3CRNA 4RY9A 2BBSA 3S99A 1IM8A 4K88A 5SICE 1W9MA 3S81A 1UIMA 3ETNA 3DE3X 5D3ZA 1Z6XA 5DF1A 5J63A 4P5DA 2NU8B 1M1XB 3ICQB 2WZCA 2Q5JA 1Q0TA 2IW3A 2J30A 2G80A 4FDVA 3NIGB 5LN1A 1HBJA 1Z68A 4D6PA 1IDOA 4FJ2A 4MGEA 4P38A 3VNQA 3W5HA 3WJ7A 4DGQA 5KU7A 2H0AA 4XD7D 2G7MC 3RUIA 3U4MA 1EGHA 4CCYA 1CUIA 1TPYA 1Y5MA 1SUIA 2IEIA 1AUPA 1E1MA 4YO7A 1LV8A 3QFSA 1YIAA 1GRNA 1DT5A 1TQHA 1XZQA 2GS9A 2OK8A 1IOLA 3N6RA 3R8XA 3WYAA 2BFMA 3EIHA 3SCZA 4L7VA 4NABA 4U2KA 3UJ9A 1UADA 4MQFA 5KOIA 1N4AA 5F2EA 2Z56A 5CHEA 4KPGA 3ELUA 1TVMA 1X87A 2QRLA 3OZEA 4LX8A 1L8LA 4AY6A 4YQFA 4MV6A 4TTQA 1N92A 1M76A 2PMKA 3DE0X 3M34A 3O2NA 4AYXA 2YZGA 4DBVO 2ZRAA 3PTAA 3KLBA 3HWX1 1BEEA 3BMNA 3RODA 5CA0A 3TZBA 4CRWB 1UJBA 4BQIA 3KALA 1SBIA 2B6NA 3FWZA 1DAPA 2O2DA 2DVMA 1GG8A 3DKVA 4D3DA 5AQEA 2I4MA 1JPUA 4O3FA 4ZAFA 1HY3A 3Q7IA 4BBPA 1E8NA 9ABPA 1SO8A 3I30X 3NH9A 5T8KA 4R8KA 3T1VA 2HK7A 5EXXA 2JFQA 2EARA 3KDAA 4EUFA 1S3SA 3NBUA 4RHYA 1C0KA 4C43A 2NU7B 2EERA 1J5PA 2IW1A 1BDMA 4EUSA 2VTEA 3F73A 2BMJA 1VI5A 1IDN1 4S24A 4CMIB 3VPBA 4IVQA 2GYYA 2IDJA 2AMFA 2QM3A 4FZ5A 4DAEA 2JLYA 3MWEB 2FRVA 2BELA 3MLAA 4OMCA 1DP4A 1U9IC 4RH3A 1MC1A 3DDUA 2I9PA 1PX0A 1NYTA 3C7KA 4ZYYA 2GPJA 3GCXA 2SICE 5KAPA 2NU7A 3MOSA 2B0CA 2W2LA 5FPHA 1E62A 1L1FA 1AKUA 1P0IA 1Z7YA 2NLOA 2W6IA 3LLVA 1UFOA 4J91A 1P0MA 5CURA 3MQ4A 4OATA 4OI2A 3KZXA 5DIZA 1XTSA 2VQFB 1KJYA 1PR9A 1A98A 3PGJA 1E5LA 2WV7A 3VPCA 3OA2A 1UEXC 4P4SB 1O5IA 3M89A 3OG9A 3O5AA 3NHAA 1ZK0A 3G2NA 3L18A 4E1BA 4E5KA 2X7HA 4R9UC 3U40A 4FOPA 4ARSA 2KM1A 1MEEA 2P5YA 1BW9B 2W0MA 3QW2A 1MO3A 5JSZB 1E63A 4V0SA 5AI0A 1GVHA 1Z33A 5KOHA 1UXHA 4C05A 3GLSA 4A8TA 4X00A 3BH7A 4Q05A 1N36B 4TGLA 3GOQA 2K2WA 4LCEA 3GWGA 1QPZA 1FP4A 2YWRA 2CBXA 2DTEA 4RIGA 3HB4X 3ZHYA 1ZQ9A 3M1AA 1Y6FA 4PNEA 1PK9A 3PGLA 3QPAA 1UQRA 4FCWA 3UC5A 5MF6A 3RAFC 1Q0SA 5AJXA 1H1TA 5GZ3A 3F90A 3RIYA 2VUHB 5DTJA 1QQBA 3QVOA 2LVBA 3H8WA 4G86A 4N5LA 1RQLA 5KYUA 2VQEB 5DHPA 4ZOEA 2Q4EA 1F60A 4JXKA 3F9RA 3H2ZA 5DLEA 4DDKA 1QB7A 3ELYA 4RMIA 1H2HA 1DUSA 1TKBA 3AP2A 5IMBA 3BEDA 3C8MA 3NRJA 3VU0A 1Z56C 3KO8A 3QKWA 5FFNA 4BFCA 3N8IA 5BV0A 4FBLA 1AMNA 4GD3Q 1DSSG 2JIQA 4BCCA 1IY8A 1NXSA 4EK9A 4UW9A 3KQOA 4XVUA 3GRYA 4NFYA 1Y7TA 4WXMA 3KHSA 3KAJA 4Z5XA 5K3CA 2V97A 1FP1D 4FUTA 5EMNA 1P31A 1J25A 3RVQA 3NHYA 2GAJA 3FTCA 2H4JA 2JBAB 1DIGA 1U80A 2VHWA 3N58A 3P9NA 3N7TA 2P27A 4US2R 3INNA 3PR1A 1VDZA 3SEAA 1U8CB 1I3MA 4LF5B 1NQXA 2RCNA 3U4AA 4PC2A 2D00A 2F1HA 3IJPA 3IPCA 1IU9A 2G8NA 1CB7A 3GFTA 4M49A 3GX1A 5DT9A 5IJAA 4Q82A 4Z49A 4GX2A 5GOTA 5J4YA 1WMSA 4DA4A 2C9ZA 4J1SA 2Z4TA 3T9CA 1TLLA 4XPIB 1QP0A 3LHSA 2YVLA 5F76A 3QBTA 4LWPA 2IITA 2QZ4A 1MRSA 3EGCA 2G25A 3K0AB 3GNLA 3LUAA 1TAGA 2YV3A 2A0YA 3PFNA 5K51A 4RA9A 4RTJA 4G9EA 2F1RA 3EHEA 3B7GA 4OXKA 4A7PA 1C3OA 3KDPA 3PNYA 3P7MA 721PA 2AJ8A 2YNMA 4Z1MA 3KOYA 5BNZA 3QMPA 6ADHA 1AQLA 4E5SA 2PJRA 1Z63A 4PFQA 5D3KA 1QYVA 2XCUA 2I2AA 2YC2C 5EUCA 1FSGA 1I14A 4KVFA 1T8SA 4EYGA 3JASA 3OWXA 3SQLA 1T9AA 4GVXA 4C06A 5KOJA 1V5GA 5IG2A 1DC7A 1ZJJA 5JD6A 2V1UA 1FXSA 4I14A 1DEOA 5KNDD 3FYUA 5EP3A 4J76A 1VXRA 2R1TA