3H16A

Crystal structure of a bacteria tir domain, pdtir from paracoccus denitrificans
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
b'APPHDIFISHAWEDKADFVEALAHTLRAAGAEVWYDDFSLRPGDSLRRSIDKGLGSSRFGIVVLSTHFFKKEWPQKELDGLFQLESSGRSRILPIWHKVSKDEVASFSPTMADKLAFNTSTKSVDEIVADLMAIIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TIR protein
publication title Molecular Mimicry in Innate Immunity: CRYSTAL STRUCTURE OF A BACTERIAL TIR DOMAIN.
pubmed doi rcsb
source organism Paracoccus denitrificans pd1222
molecule tags Signaling protein
total genus 41
structure length 136
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 3h16A00
4W8HA 2Z5VA 4LQCA 3OZIA 2M1XA 1FYXA 2JS7A 1FYWA 4DOMA 4OM7A 5KU7A 4C6TA 3UB4A 4LZPA 3H16A 1FYVA 4C6SA 3UB3A 4C6TB 4C7MA 1O77A 4LQDA 4EO7A 3UB2A 4FZ5A 5H3CA 3JRNA 5FORA 4C6RA 1T3GA 2J67A 2Y92A 4W8GA
chains in the Genus database with same CATH superfamily
1XZAA 4MW1A 4QTXA 4KQXA 1TA9A 3C6QA 4BC0A 2F8LA 4D43A 5AUOB 5B55A 3HWWA 5SYAA 1MR3F 2V1XA 3O7WA 3NHRA 4HN9A 4QL3A 4TRJA 5CA1A 2HW8A 4KB5A 3GVXA 1I7NA 1BRTA 4QRHA 4ZU1X 1V16A 2CUZA 3B52X 3BXHA 3QM1A 5J5AA 3VR2D 1ZGJA 1MLDA 3G2LA 3I6QA 3MBOA 4C01A 4JENA 2I2AA 3R9IA 2RHGB 3TRJA 3SAJA 1HE5A 3TFQA 2GJ4A 3P97A 1I9GA 4GUAA 2HA2A 2G9VA 3TIIA 2YICA 3LNCA 4J76A 4CL0A 2O2JA 2OCDA 2E3JA 2FLVA 4DC1A 1TVEA 1FW6A 4Y9UA 3UMRA 2IYUA 3A1NA 3P5BA 5CMLA 1W8IA 3ZDXB 2H0AA 1Q0SA 4PZ9A 4YMWA 3ZHXA 4AJ1A 4X94A 5L7TA 2ZI3A 4IXWA 2HRRA 4RMJA 4YAOA 4NABA 2PSHA 3KOOA 4KIUA 1FDTA 5CBKA 2EKBA 1X39A 4AYTA 3JPWA 1GAJA 4Q9JA 3K0SA 1UDBA 3BCUA 4ZPXA 1EB8A 1ZN2A 4RJTA 3C5VA 2RMKA 3KP1A 1EQAA 2VHUA 2FZ4A 4HQNA 1JIIA 5DBIA 1A8UA 3GR6A 2B6NA 3R5KA 4Y9DA 1H5UA 3KM0A 3MMPA 4GOMD 4BVJA 4HRXA 1NBWB 2ZI6A 2FSIA 4L5CA 1J70A 4N0EA 2IV3A 2R3SA 3FOBA 2JI6A 5DTRA 4R0MA 3Q0IA 4HX2A 3ZU5A 2GEDA 3V4LA 3PENA 2QTZA 3BRCA 1T8YA 1FYEA 4EKYA 4UU1A 4CT4B 3N74A 1DT5A 2FXVA 4Z0PA 3UXHA 4G0UA 2FJ0A 3H4MA 3ZCVA 3ZWNA 1G16A 1A2QA 2CBXA 5IPFA 5JNVA 4B2YA 1FOEB 2O4UX 4S1VA 2M6SA 1EVEA 1JFTA 2AQIA 4JLJA 1JB1A 3VOSA 3CE6A 2QRMA 4B3CA 6AT1A 3T7CA 2CV0A 1LWNA 1NVVR 2B25A 3GBSA 3V4SA 1KHTA 3NP9A 5B4TA 3PUXA 4EOGA 2IP4A 3G2HA 1Y3HA 3TEJA 4AJKA 1SHKA 4ZI3A 2EZ8A 1K7FB 1HORA 2D4HA 1G63A 2CYCA 2VDQB 4NULA 5JSKA 1RRCA 4YJKA 3GNSA 5ALUA 3RHTA 4XOUA 1NVVQ 3EUAA 4I1RA 2ID7A 2BCEA 4OHOA 3ISJA 4TL7A 1PKXA 1C3VA 1PZEA 1RABA 2XCQA 3HLYA 3SLGA 2ZUSA 2WG0A 1U5BA 3DEHA 1FA9A 3KYJB 1MNQA 4KVFA 2P2LA 1PYOA 4PGMA 3SC6A 4BEWA 3RFXA 3EF3A 4M89A 2OOKA 3DV9A 3PDIA 4TT8A 4CF5A 3TINA 3P9IA 2H5JA 3AOEC 1XDBA 1I3MA 1DOHA 3A1EA 1Q50A 1QIMA 2H7YA 3RO7A 2J4CA 3MMSA 1R74A 2BCGY 4HAZA 1NIPA 2GAAA 1NJ8A 4V1CB 1QFMA 2N46A 2QTGA 2OMEA 1N6RA 2PT5A 4B71A 4PLVA 5FBZA 2FV8A 4IIYA 1WCV1 2DLDA 3VXKA 2Y77A 2FUCA 1C29B 1RMQA 2BM0A 2JVKA 1LF0A 5CX1A 5FTKA 1CS0B 4NNPA 4NYJQ 4KSCA 2QN3A 5JMPA 4RZSA 3WLOA 4DCNA 3KZCA 1ULTA 5EZ6B 2O2GA 3I92A 2H5LA 2WABA 3E8XA 3UMSA 4JYAB 2FPIA 1E3MA 2P1ZA 2Z30A 3TIXB 4DWWA 4NEQA 1POWA 2G0TA 4LEIA 1KEEA 1HGXA 4H7KA 4X3CA 1JLMA 2J46A 5JYEA 5HZMA 5LMUB 1AKTA 1XRPA 4B3JA 4Z7JA 1S1CA 2ZCUA 1OHHD 3FDJA 3OX1A 3PI6A 3V33A 1PV4A 2WV9A 4PS0A 4GBGA 3KV1A 1UZAA 1BEZA 4ZODA 3OSUA 3KZVA 3ZE7A 4EHBA 2BH2A 2BKXA 3A7DA 2NP7A 2X3UA 1A9QA 2JJQA 4O4IA 1OGIA 1Q0LA 1T1RA 2JBAB 4MUGA 4AWXA 1CJVC 4HT3B 1I0IA 1NV9A 3FPKA 5EFOA 3EG9A 3IPLA 1GZHB 3F98A 1CY4A 1N3BA 1PFQA 4HDSB 4Q7EA 4G1MB 5CURA 4LI0A 1XDWA 3AHCA 5I01A 1WBJB 2EX0A 3VNRA 2ZRAA 4GOOD 3RYFA 3G88A 2FSFA 5DMHA 3BSSA 1DPFA 2XYQA 1G8AA 4JU9A 4UCWA 5JZSA 1KTIA 1GVNB 2AWOA 1BWSA 4HRAA 3VBEA 3OIUA 5KHOC 3STTA 2Z1NA 3E0XA 4Y7CA 4MGIR 2E4ZA 3T5AA 1MZVA 2VRNA 1AM4D 5G1OA 1E5LA 1T2FA 2DF8A 3SKVA 4MHSA 4QLAA 4X65B 3ZLJA 4QPPA 3OP4A 4LJAA 1JEJA 1U7WA 5I5EA 3B7PA 3N3AC 4M9XA 5I9NA 4J9UE 4G09A 3VO2A 2IX3A 3RHSA 2C77A 3TTTA 1NM5A 3DR5A 4EI8A 2ZZMA 3CW8X 4MVXA 1M34E 4RKFA 5ELXA 3TL6A 4BQRA 3SF0A 4HUTA 1SB8A 1TF2A 2EVWX 2OC4A 4AKTA 5A1JA 2FR1A 1J2TA 1TW2A 4UBLA 1M67A 5CTJA 5AD1A 4QUHA 1D9XA 1GLGA 1JE0A 2IY7A 1T1IA 3BD6A 2EWWA 3DNPA 3GJQA 4Z9XA 1RWVA 4DOMA 1XCMA 3VVCA 3VVMA 5EKTA 3EZ9A 1MHPA 3CVYA 3F7TA 4PCAA 2YY5A 2GZ3A 2D1TA 2Q0QA 2ZWVA 3L8CA 2C4WA 1N8TA 4HNGA 2ZB4A 4DXDA 5AW8A 1QHHB 4RSRA 6REQB 4QHSA 4EHLA 5IVHA 1W48A 3FUXA 3MQ2A 4CG1A 1VG9B 2IOFK 1RYDA 1U1EA 3ZHSA 1SUWA 2JI7A 3B9QA 4FBGA 4IDHA 2C9DA 4OI4A 1RKXA 1UAYA 1W59A 5HDBB 3GJ7A 1QS0A 1V1RB 4HB3A 2L69A 1T0PA 5EJIA 1J24A 1RVDA 3GEEA 4C78A 5I7HA 2H06A 5IJAA 4KREA 5EE3A 4ATNA 3TNLA 1FYWA 2OGUA 2C98A 2X0JA 3PLNA 5B12A 2QT9A 4S1TA 2SBTA 5JAUA 1MEOA 2IYTA 1RJ9A 2WHPA 3HWRA 4JBGA 4LQLA 4QUKA 2HK7A 1WW8A 1FVHA 1M1XB 1SRQA 1UJNA 2JFQA 3EEFA 4Z3KA 3KZNA 2XZOA 1CUSA 3F1KA 3MJRA 2ZLBA 2Q46A 1P0FA 5LU8A 3M5CA 1G17A 4NK5A 1QR6A 1R50A 1W19A 5HMLA 4IIBA 1NF2A 4MW7A 4G5YA 3T34A 2F90A 4B9AA 4ITVA 2CWDA 2GRJA 3PWSA 3H2BA 1A2KC 4GAEA 4ONEA 4Z0HO 1KQPA 4Z4GA 1U5CA 2ICAA 4M3NA 2D0DA 4W8GA 4IGKA 3I6MA 4YYEA 4E5DA 1EBBA 1ZXXA 3B5JA 5KVQA 1GO2A 1NE7A 5TQ0A 1JEOA 4H7EA 2C92A 1ORTA 2YIMA 3O8QB 2QAGC 4I5EA 4X97A 2A0UA 2BM9A 3LHSA 4MTCA 1P1KA 3BIOA 3HYNA 4KXQA 3R9KA 1ODJA 4CLXA 1CE8A 4BFSA 3P9XA 2PGOA 1RBZA 1DEXA 1FFDA 1W5EA 3GT0A 1IAVA 3O9ZA 1CHNA 4IIDA 5JPIA 3SZGA 2CXSA 4KYIB 1DQYA 2HSJA 5AIAA 1B15A 1RTTA 2BFWA 3AT1A 2ZJ5A 1L5NA 1WMDA 3AX6A 4JA0A 4E11A 4X3PA 3LUCA 4PLCA 2GK6A 2HIHA 2G0NA 2I67A 5IH3A 4CIDA 2E5WA 2HADA 5FL7A 3AM1A 5J2UF 2VAPA 5FH9A 3HTXA 1OQAA 1W25A 4FZJA 4QU0A 5DNVA 3IELA 2JFXA 4F4JA 1TJ4A 4NE9A 5FV7A 3EC1A 5AJHA 4Y30A 4TT3A 5DNWA 1I24A 4OJQA 3THSA 1KQNA 4TV8A 3JD0A 3B2EA 5CBPB 4TGLA 3WMFA 1PJQA 4X8HA 3AUXA 3GLIE 2PRSA 3IIIA 4TYMA 3HVHA 3TXAA 2YMQA 3CVUA 1IZ9A 4ZQHA 2CXUA 2R8OA 1TQ2A 1VCHA 5DTJA 2VQ3A 3MW8A 5CD1A 3E82A 1KAEA 2YY7A 1TLLA 1RU3A 1XZLA 2QMOA 3FWPA 1JEEA 1NKTA 4RIGA 1ZZEA 2PXAA 1FMTA 2Q3EA 1BU8A 3GZJA 4N9WA 1NVXQ 1R6XA 2ECFA 4X6YA 3GOQA 3EMBA 3ETDA 4E12A 3WRWA 3TYXA 3K70D 4JOCA 3CEPB 3RQSA 2R1TA 1R12A 1G9TA 1Y9AA 2C3OA 1SOAA 2VSFA 3FUWA 1DKLA 1G5IA 2PZAA 4MVYA 4Z99A 3QFTA 3LWNA 4P7KA 2BP7B 4LXIA 3ASVA 1ORWA 2BM8A 3LT5A 4P80A 5A2QA 3UQYS 4P3NA 3K6KA 1Y7IA 1FXWA 2JHFA 3F46A 5A4FS 2BJWA 3RTAA 3M89A 3HY4A 4WSOA 1T8TA 1KKLA 3Q98A 5I9SA 2QNBA 4RSHA 4EJ2A 3WGJA 5IU6A 5L4NA 3KQPA 2QKYA 1IHDA 2HWWA 2F8TA 3W90A 4PZAA 4E07A 1DKPA 4ZAZA 2EZUA 1HFWA 5K51A 1JSXA 3MHTA 2ONZA 1KZ7B 1O1YA 4TYWA 4K3VA 4IOLA 2CFRA 5DIFA 2WUGA 2O3QA 2KI5A 4IDGA 4I9HA 1VL8A 1F1BA 1PG0A 4YUZA 4IINA 4GOKA 5A6VA 3V4ZA 1XCJA 1GTVA 1TYDE 4B3BA 2R4TA 4EARA 3CM0A 4LHXA 2VT3A 2Z5FA 2C5SA 4NDAA 3FWZA 2Y9PB 4G1FA 1TU4A 1L5KA 4QFDA 4BBJA 2ZAGA 4HQFA 3I0MA 1NNLA 4H6PA 4XUGB 3LZ6A 3EVBA 3IAM6 4O1MA 1TVKA 1MO5A 3ZXSA 2C31A 2NYRA 4ZEMA 1AQIA 1NV8A 4IQ0A 1OXSC 4POAA 3RTBA 1HQYE 4G07A 1N2SA 4MYSA 4IXMA 1U94A 4N01A 3TL2A 3LXXA 2W2MA 4IICA 3GLGA 3T1VA 4G0QA 3KRTA 4GD3Q 5JEEA 4XFDA 1I4EB 3D0OA 4HN2A 1ORDA 3A1FA 1KJYA 3BDIA 4JP2A 1HDGO 4MV0A 5LXTA 3W8RA 3KKPA 1CZLA 5KC8A 3QXSA 2QAGB 1I3KA 2V3CC 4J2HA 3SX0A 5HJ5A 1WTCA 2GZRA 3UT6A 3ADDA 3I1YA 4XVCA 2G6TA 4DL9A 1M2VA 4BVGA 4GI7A 3VNAA 2AFIB 1L3BA 1FF9A 4EFLA 1SVOA 3LUAA 1BOOA 4NCBA 7ABPA 1RPTA 5LN1A 1HE1C 4IOJA 4OAOA 2DC1A 4MS1A 3V4PB 2VNAA 1DWUA 4KAXA 5LIPA 3DEIA 4AN1A 4F5ZA 4ZVSA 2VJQA 5TRTA 4MV5A 3STXA 3MIIA 4G84A 4JD5A 5EMLA 2ZI4A 3AHHA 1H8HD 2P3LA 3KZKA 3OAAD 1WX1A 2FWIA 3OZ7A 4D4JA 1NQVA 4O2AB 1NMXA 1U9IA 2E0IA 3D7RA 3GAAA 4P98A 5FWNA 3UUWA 4D4LA 3GGOA 1ZH6A 2I1QA 3LG2A 4P3KA 4Y2TA 3L7CA 4LVNA 2VQDA 5B7NA 3FNRA 4BZQA 2Z58A 4M54A 2VCYA 3RTDA 4D9GA 2R5NA 621PA 4IG4A 1O0CA 1IFXA 1FLAA 4WX2B 2OHHA 1QC5A 2W00A 3DKRA 4E32A 3RYCA 4FD2A 3DHYA 3A58B 4CETA 4CG3A 5B57C 2VNJA 5AQ1A 2QSYA 4OYRA 5FRDA 3BMOB 4PLWA 2VUUA 3HKEB 5FBWB 2W8ZA 3I23A 4ECEA 2R11A 2X1MA 4X1OA 4ZAWA 3UJPA 3U4CA 3B1XA 8ABPA 1QHGA 2WAAA 3GHHA 2C4HA 1CVIA 5FOXA 2GTPA 4TYQA 5REQA 2ZWAA 5I5GA 1T8SA 4MVJH 1DCKA 2CLFB 2HD4A 3GL9A 3P0HA 4YHHB 2R6R1 1UFOA 3AIMA 1G6OA 4DBLE 2I71A 5CVDA 3TSWA 4N3GA 4KK4A 2O14A 2M2IA 2Z5LA 1S2DA 3ENWA 3TW4A 3VC3A 4LFAB 2PTHA 3LXUX 5EQJB 2BGIA 4X8MA 2ENUA 4OQFA 2Q62A 3E03A 3I39X 1CJUC 1ZEJA 2AA3A 3HHPA 3IPAA 1P2DA 1XLWA 3X43A 2FPPB 3CZCA 4P0QB 2JJ8A 2J0EA 4NLLA 1U1GA 1RIIA 3T6KA 2V96A 1KK0A 1OREA 4L07A 2GKSA 1L9XA 2OORC 3O94A 4WLVA 3ONDA 4NFHA 4OGLA 4UDNA 1E8MA 4BRSA 1DBIA 5H83A 4UZFA 4YT4A 4JUIA 1NAIA 4K6KA 1H8ED 5AK5A 4ZEWA 5A9SA 1OTXA 2ZWIA 4OP2A 2OHOA 1SVMA 4IL5A 3UAWA 1GUFA 3R6TA 2Z3WA 1B0PA 1UBNA 1E3WB 1YZYA 3EPLA 4OQNA 2IVFA 3J80A 1W96A 1GA4A 2Q28A 1MT0A 3T12A 5JJIA 1PP4A 2N1MA 4G86A 1A96A 1FY2A 4UAVA 1LDYA 1SZJG 1ZIXA 2QE6A 2QL6A 3FTDA 2GPNA 2VQ6A 4I55B 2RDMA 4J0FA 5FAKA 5K8LA 1V5EA 4YRFA 2OB1A 2WRZA 3K0CA 4N5LA 4X71A 3ZEIA 4A82A 4XRGA 4H3SA 3WMRA 4II3A 3VTAA 1Z12A 1IEQA 3OFVA 1YULA 2DT5A 2J3IA 5F1YA 3TCNA 3TUIC 3TGLA 2PX2A 3F90A 3HP7A 3TDNA 3WE7A 1GRVA 2P67A 4FVTA 1XC7A 1KI2A 3ES9A 4DTCA 3ZDZB 1LVHA 4CEJA 1V3VA 1ITZA 3G0GA 4X45A 5KSZA 1D6JA 4UOQA 2D59A 3HFRA 1SC3A 2I99A 3BRQA 3RU7A 3DYIA 3IUQA 4MPPA 5C7OO 1YA4A 4L95C 1V3UA 4JELA 2XNJA 3U39A 1BMQA 2HF2A 2YZ7A 4GQIA 1MOZA 2X5NA 3MEQA 1K9VF 2VWHA 4N7RA 2OC9A 2DEUA 1BDHA 1YVUA 2EJUA 3AHIA 3U44A 3LKVA 3N2GB 2D5CA 4M76B 4UE2A 4YRZA 2A7QA 3AXTA 4G8BA 4DAOA 3QUTA 1LSUA 5LXTB 2Q8PA 1AUXA 4PLYA 1P4JA 1X7GA 1QMGA 2XDWA 1OVGA 4LZWA 2BHTA 3LO5A 4LZPA 4PBRA 5DLQC 3WGLA 5E38A 3WK6A 3ITEA 3Q3IA 1Y3FE 2YJTD 1SU7A 1QANA 4JS0A 3TQTA 1JAZA 1DT3A 4WT7A 3QELB 4G25A 2CZCA 1ENZA 1YOBA 1W4LA 2Y66A 4HEQA 2I78A 4KXFB 4RA9A 1Z5GA 5HM8A 1XTIA 2Z4TA 3GBPA 2P3QA 3L7BA 2ZIXA 1TUBA 3OE5A 3AU9A 4NATA 3HCEA 2FN3A 3LA8A 2JLXA 3FDZB 1XFDA 1KPGA 4ODIA 1MOPA 1GPBA 2IYZA 2K4MA 3KAPA 1L4MA 3PQEA 2A5JA 1JYFA 1JSCA 3KT0A 3LCUA 4D41A 2ZUCA 4DQ0A 5JT1A 2JLYA 2VEOA 3E22A 3F5SA 2WMDA 4UD2A 1UBJS 2EBHX 3LYAA 4RK6A 1DHRA 4Q21A 3T3OA 3KBBA 3MUFA 1NN5A 1EFVB 1J06A 4UAGA 2ZUEA 1KGSA 1YCHA 3KK0A 1M6YA 1EAYA 3IEPA 4JP8A 4K1XA 4IPTA 2HDNB 5JXWA 1J2UA 2WWHA 1RD4A 1CEEA 4YJFA 2AMLA 5CT4A 3ZY5A 4LGVA 1KYVA 3D8NA 4QU8A 1KZ6A 2VJMB 3GLQA 2W2QA 3QVSA 4QARA 4B3GA 4S0XA 1SAYA 3HKDB 1XD9A 2BMFA 1J0EA 4WN9A 3HCAA 3T3IA 4R8SA 3VTZA 4BL5A 1N4AA 4YT2A 1B73A 1GFZA 3C6YA 5BNFA 3RK1A 4D2IA 4S2EA 3G1TA 4NI5A 4WRRA 5T6BA 1LSOA 2WJHA 2J5RA 3KE8A 5HIIA 4B2IA 2Z8XA 1U2EA 1AQNA 3DOEA 2W8BB 4R8KA 4TL9A 5ALKA 3ZHRA 2XBMA 2NTEA 4PYOA 2PVCA 3MGKA 4YRNA 3DE0X 1VL6A 2GTIA 3FYSA 3O2SB 3WZMA 4HEHA 4C5AA 4F7DA 2UZAA 3EBLA 4WGFA 1T6XA 1TPYA 9LDTA 4DYDA 5IYZB 2Q9UA 3CA8A 1JECA 5CH8A 2DHCA 3RJTA 3WNZA 2UYYA 4ESHA 5L3QB 1B8NA 2R4UA 2NV2B 2B4RO 2QPLA 4NV3A 4OQMA 3GFOA 4IR7A 1YZVA 1Z3CA 2JHCA 2WJAA 5DEIA 1JVBA 2F9FA 2NZUG 1DBRA 2PLNA 2YHBA 3EVGA 5ALMA 3TLXA 2XEDA 3Q40A 4U39A 3R76A 2JD0A 3A4IA 4MWSA 2HMAA 1JVSA 4J3JA 4JEUA 3EMDA 4EB8A 4BFVA 3BBLA 2QN9A 5IEJA 2YV3A 3ISTA 4JLPA 4ZVQA 3H1BA 1C7FA 5AJWA 3OOHA 1R4MB 2Q6LA 4RLHA 4RMNA 1YB4A 2BE7A 2DAPA 1O7JA 1ZD1A 2JLCA 5FFFA 1LWOA 1O03A 3B8HA 4NOKA 3KPWA 2CFCA 5DGCA 2J31A 4DVGA 5I9LA 1P81A 2W2KA 4K9QA 4AKGA 2QZPA 3D2BA 5BMVF 4CDNA 4MH0R 4DA6A 5JI2E 4Y6PA 2NACA 1YF3A 2BGKA 1M83A 3QBEA 4Z2YA 1O0BA 3IPYA 1H66A 3UO8B 5DI3B 2WKPA 1V5IA 1KY4A 1YR7A 3GRZA 4BVLA 1JJAA 1A9XA 3R20A 5EEHA 4QFCA 1MJGM 4ARUA 5KWVA 4R3UC 3TTXA 1Y8QA 4IUCS 3KHSA 3R0JA 3I5MA 2BFAA 4ALJA 2JZNA 3LBIA 3THYA 4TYPA 3HKBA 4RA6B 1T34A 4UMEA 4J94A 5AP9A 3AIKA 3D3EA 3JX9A 3Q7PA 1KFCB 3DEYX 4JNCA 4TS4A 5FKJA 5EVJA 2JBWA 1L7BA 4GX5A 4BTVA 1GL3A 4ZDKA 5HBRA 1A7KA 2B83A 3SMVA 1FZTA 1V26A 3F9IA 2H4YA 1TT5A 3EUFA 3OLWA 5CA1B 3A31A 4MCIA 1IY8A 2H7XA 2G9QA 4ARZA 5ITWA 4XVHA 1FUKA 4ZREA 3IEVA 2Y05A 1YFJA 1V16B 2FPKA 2RJ3A 2YVLA 1UUFA 4E6PA 5DGIA 4IMJB 1ZG3A 2JKYA 2WHXA 1Y1KE 2YRWA 4RHTA 3LECA 2VT6A 3SVLA 5EKXA 3ZGXA 4EMBA 3OCWA 2VDKB 2QPOA 4ZANA 2AUMA 3FJ1A 5HP4A 3HCCA 5EJEA 3UWMA 4ROSA 1GYQA 1I33A 2BZSA 4JBYA 3U4DA 3PXXA 2YFKA 2HHHB 1XPJA 1AA9A 1E99A 4FLFA 4TQUS 1T2CA 3R6DA 1WZIA 3EY4A 4QODA 1C7ZA 4MYTA 3LBYA 3IQXA 3DHVA 4LCEA 4XM0A 5AI9A 4P22A 4D6YA 1QRTA 3N8KA 3DDZX 4ENTA 2G1PA 3TLBA 1RDFA 4A0GA 2HCTA 3NHJA 4LOHA 3ZWVA 4EFMA 4YAKA 1QHSA 5C1DA 1LRJA 1D0SA 3BAZA 5T4BA 3LGXA 3DLIA 4HO1X 4EHFA 2DKNA 2VSQA 4G41A 1ZK4A 2FPGA 1Q15A 2ISCA 4P86A 4AJ2A 3RRXA 5BOSA 2Q3BA 1N34B 4DLLA 2FZLA 3V00A 3LLCA 3AWDA 1A50B 3DDUA 1QONA 3P9KA 3ZTWA 4Q4CA 5AW1A 5TEVA 3NHWA 4MQEB 1RAIA 2MSCB 3A6PC 3UTDA 1NM5C 1C3LA 2YJNA 3FR7A 3KQWA 5B7QA 3EWIA 1C7EA 3FI0A 3M4ZA 1N1GA 1S4MA 5T7BA 5CTAA 2IYVA 5CNJA 5BWOA 3IPCA 4N9QA 1B43A 1YFLA 5GOTA 1D09A 4TLLB 1TAQA 1EWVA 1AKUA 4OLFA 5KTRA 1IDOA 3R0XA 4UW9A 1T9GS 3IAFA 3TRDA 3ORFA 1EHCA 4FNMA 4HADA 2CB9A 4C20A 2B9EA 4DLUA 4P54A 5DOZA 4TWBA 3VSAA 2H52A 1M1UA 2N1BA 1B0UA 2BFDB 3C16C 4R1OA 3TPCA 3AUFA 2QVZX 4N8EA 2Z9DA 1GKLA 3KOUA 4QOHA 2O2ZA 3HCOA 4R5HA 4R8VA 5KWEA 3A37A 3GDGA 3GRRA 3WGTA 2XUHA 2IHKA 1JWBB 2FQ1A 3B1WA 2C7OA 1U0OC 4INZA 5ELLA 3PHBE 3I1FA 5EJGA 5JDCA 2GZAA 2Y4OA 1RXVA 4CV1A 1ODSA 5AHXA 1J42A 2DKFA 1L1EA 1KDOA 3OX2A 2OV1A 5EN4A 4D92A 1RHRA 3EZGA 3NBQA 5IANA 5CCXA 1U5BB 2WF9A 2FEMA 3E7WA 1W87A 1MCZA 3KOXA 4R9SA 5JBQA 1SKUA 3PDIB 2JJ2D 4DQLA 1Z4MA 3EH2A 2OQIA 3WKCA 5FOWA 4QXOA 3DJFA 2QRUA 4LS3A 1F2TA 3E3NA 5AHWA 5BQPA 4ACAA 1I2MA 5K01A 1SVIA 4A73A 2A9VA 1KI3A 1QYDA 4N6GA 1K0FA 3WLLA 4R16A 1DEKA 3D0KA 2QUJA 1KP9A 1TZMA 1TZBA 2IYQA 2ODAA 1IRXA 1YO6A 4KTTE 4UQPA 4URXR 3IBCA 3C7KA 4A2CA 3DKKA 1XWFA 3C5EA 4OK5A 1KZHA 1T8PA 4DMMA 2FPIB 5JS1A 4JBHA 5HDQA 3A1TA 3RAJA 1YOVB 4B6OA 7MHTA 2OXTA 3HABA 3ZJYA 1TLTA 2PUHA 1EX9A 2D3TA 4J0CA 5DULA 1TEVA 3KKOA 3E3AA 4K6CA 4BLOA 1T5IA 3M2TA 2QNRA 1EDDA 1GADO 2VDPB 3L0SA 2EQ5A 3WLJA 3OQOA 2D8MA 2I6GA 2RK4A 4BHTA 4D4IA 3OM9A 4JLOA 3RBXA 4O4IB 1BQEA 2NAFA 4HRVA 5JQGB 4MIKA 1KA9H 2IWRA 3OU7A 3QVXA 5AJUA 1GZSA 4M9QA 3EG9B 4B09A 2XPCA 1RSZA 1Z2AA 4JSTA 4MRSA 3QUAA 3SYNA 1BE1A 3OZXA 4TTQA 4TVOA 4F71A 2C2BA 4MITA 4NG5A 3RYFB 2BFNA 4TXHA 3GROA 2PFSA 3KR0A 3SDSA 4AZ0A 4DM3A 2Q2OA 1K27A 2Z3ZA 4DQUA 3D8TA 4OQ4A 5KOYA 3T1HB 4WZBA 2WJJA 1NG1A 3AI1A 3PDJA 1RI2A 3JQCA 2AK2A 2KPOA 3ND8A 4MIYA 1JWLA 1A4IA 4PG6A 1RJWA 1RLIA 5TGDA 4YFYA 3W5IA 5JQWA 2ZYDA 1F0KA 3AL3A 3KBOA 4OD0A 2H16A 3OMXA 1TTHA 2J67A 4FD3A 4WZAE 1DOZA 3C14C 3PHLA 1FYDA 4C4ZA 2XYVA 2EBUA 4EGAA 1DXOA 1XTTA 4QNRA 1JHYA 3LC7O 2ZJ8A 2YWCA 1NPDA 4PYQA 3HR8A 1TQ6A 1FSSA 1Y8CA 1BW9A 2XVYA 1T3TA 3PHHA 1QHYA 1SY7A 2XRFA 4G01B 1VGQA 4RD4A 4H7IA 5BN4A 1JDJA 3F2IA 4UHKA 1QGUA 3X1JA 2H2DA 5D3KA 1LW7A 1UIRA 5K9ZA 4PC3A 4WI1A 2QROA 4XX0A 3T3HA 1W73A 1WZCA 2XNHA 3OZVA 4JI2B 4WKPA 3FOAA 2QQFA 3G0BA 4JR1A 4BNXA 2BFFA 2VI5A 4US1R 3S0JA 4P83A 3IA2A 1QZXA 2EQBA 4IHAA 4PF1A 1KH3A 1H9AA 4R0NA 4X6UA 3S7TA 3SP1A 5EGSA 4TMKA 5DGDA 2P5SA 3TKLA 1BHSA 1OIXA 3SVZA 1DRJA 4B8ZA 3I8OA 1TC1A 2DWOA 2WDPA 3D8SA 4EY6A 3IE1A 4BPBA 1M10A 4IV0A 2XADA 1QS0B 2H51A 3BXFA 1N25A 2AFVA 2Q27A 2QD3A 2I2WA 3DTTA 3QBJA 3OUZA 2CFSA 2CMGA 3FYTA 1GTJ1 4DNFA 1VL5A 5DCWA 3R7FA 4FEAA 1H2XA 4KE6A 2WHPB 1RJ9B 1YBFA 4KGXA 1CX9B 4YUXA 2BN4A 3LQQA 3JQDA 3NTUA 2OAP1 3OG9A 3A1UA 1Z6AA 1RVV1 5TPZD 2VTDA 3E5MA 2WG2A 2FQWA 5DX1A 5ALXA 1CJCA 1XMJA 5FBLB 1IWPB 3GRFA 4LRQA 4W5WA 3G7NA 1JLKA 3KZ1E 1Z7GA 2MJLA 1CTQA 1WPQA 3OIYA 4YCJA 3IL2A 3QE4A 1IHYA 2C84A 2XIJA 4Z7QB 2EKDA 2D2IA 3DEFA 3E7PA 3GG2A 1NURA 3F6CA 5HKAA 1GHTA 1YASA 3EWAA 5BN5A 1X74A 5TQ0B 2V65A 1YL7A 2JAPA 5KPJA 4XCQA 2ANBA 1WSAA 1WXIA 5AQEA 4C7XA 4FFLA 2JGLA 5AM3A 2H2FA 4WECA 5BSEA 3DO6A 1GA1A 3RK0A 1CE8B 3SEAA 1PEKE 2WB4A 4FC7A 1OROA 5JS7A 1QVAA 4ARCA 5KX5A 2VZLA 1KY5A 2BJHA 2EJVA 3MWYW 1QJCA 5LP6F 3WKAA 2I33A 2LKDA 3EDCA 5DK4A 2IFTA 3AO0B 4KX5A 1L7XA 1A8IA 3NIWA 1PL0A 2H17A 3R0IA 4OVKA 3A0RB 4B6FA 4YTEA 4TS1A 4B74A 3TZKA 4MDFA 1DIOB 4MROA 1K75A 1XCOA 2D0OB 3U4HA 1EE2A 4ID9A 5BWCA 4TV8B 5LCXA 3ROTA 5AM2A 4KLAA 3T3DA 1XHLA 1U9IC 1KO7A 2WWTA 1T9KA 1G66A 1GIAA 3MB8A 3FHLA 3FOCA 3HDYA 4UULA 1UPTA 1QO0A 4NL4H 1ZA1A 5EEGA 2XXAA 5KSYA 1NSFA 1E3TA 1WDKA 3KJQA 3TNJA 3B6MA 1HE2A 2L17A 5JS8A 3SQOA 4GLLA 4B32A 3W4JA 1M9NA 4XIGS 4AY2A 1D2AA 2Z6VA 5AVJA 3W6PA 4HWOA 2AI1A 3LHFA 2UYGA 2JZCA 3GT3A 4PYRA 3MJSA 5EZ5A 5KOHA 1PJ8A 2O5EA 4PQYA 5DHSA 2R1TB 1Q0UA 4UD6A 1K92A 1TEHA 4ABYA 4EX7A 3VKHA 1XZCA 3L0ZA 4HQOA 2DPLA 3O4FA 4Z53A 2HREA 3ET4A 4BV9A 4XRRA 4JXKA 4WVLA 5HEKA 3REGA 1X8LA 3RJ5A 4BU1A 2C3MA 5J4HA 5F3WB 3UQZA 2AIRA 4BLPA 2BMAA 3A6KA 1ZCZA 4KYUA 1NMSA 2J6BA 5H81A 4BEVA 3O8CA 2QAJA 4XOIA 4F1WA 4NKRA 5CDSA 1T9HA 5DSXA 2SKEA 3MTEA 1TF5A 5CU7A 3PFWO 1J97A 4HTAA 3VDMA 5TGZA 3VFDA 4WY2A 3V9AA 2WP0A 3OH8A 1E1LA 2XJ9A 5BW5A 1QHNA 2B69A 4FOSA 2XUJA 3LPCA 3JD2A 1NF8A 1GR1A 4EFKA 2GAJA 3MHPA 4XTRA 1X9HA 4AKSA 2NZYA 4AG6A 1MV8A 5JZVA 1J0AA 3HSKA 1GZ4A 2GGSA 3UJBA 3VMFA 3K20A 4IEEA 5GV7A 4D46A 3ZUPA 3ONVA 4RD3A 2DUUA 2QGZA 3VPHA 2J9XB 2X77A 1FL9A 1KTVA 2D4AA 2DQYA 1ONPA 1QIHA 2Z3VA 2H54A 4HPWA 5BORA 2XI4A 1AC5A 1TVKB 1VP3A 3IT2A 1ZMTA 1I8TA 4G1VA 4K6OA 4XGNA 3FMOB 1KAGA 2CE7A 3K0CC 2GUWA 4U7HA 4MOWA 2FCRA 2VHVA 3A32A 3TMKA 2OCKA 3GLGB 4NARA 4YDRA 3A3NA 1Z83A 4HAWA 1Z07A 3GQVA 3MWGA 4I0WB 2ZWPA 3VAYA 2X40A 4IVRA 1BDMA 3DTVA 3RT9A 3WXBA 1W9HA 4MV8A 4ZCMA 1T25A 4FLEA 2PRJA 5F35A 2F4VB 4P3XA 2C94A 3UOGA 2YS6A 3ANTA 2QLLA 2AF4C 4OUDA 1ZUNB 4V0QA 1X8JA 2HAEA 1M2VB 1M34A 2RCNA 1YIOA 4NFLA 5BSGA 2B1RA 1ZUHA 2GEJA 2C99A 3VZCA 3WBJA 1K5PA 2CVHA 3FTPA 2VPYA 2WU1A 4I4TF 1P4HA 4L3VA 1GNPA 4AURA 5FUBA 4H0NA 4MS1B 4IJUA 4R9UC 2ZUFA 1MZPA 4KVZA 4E4TA 5KTNA 5C18A 1KS2A 3R9XA 3EVDA 4CF7A 2A94A 2Y1DA 2ZQYA 3RVPA 1PN3A 3SZUA 1I7QB 1XWIA 1EXVA 4DMFA 3V4RA 2FZKA 1XMOB 3TRKA 1VJ5A 1GZ3A 3L7OA 1Q83A 1LLUA 5IARA 5K45A 3HCDA 3UV7A 4XSHA 1ABFA 1L4LA 3M4JA 1BJKA 2B0CA 3LH5A 1X2EA 5H59A 3R5HA 1U90A 2GD6A 3PNSA 2WJWA 3STWA 4O2BF 1C0LA 2X7XA 5T4HA 1EFKA 4M46A 1PEYA 1ZMRA 3K0BA 4TM8A 5GGYA 1DTSA 3WMGA 4ALLA 4FN5A 2OAGA 4HX5A 3W77A 2JCGA 1QC5B 1O08A 3OE7D 3VDQA 3RYCB 3PLAE 4M0UA 4PYKA 4KHPB 1B6SA 3DVSX 3NYQA 4D7AA 2B36A 4C3VA 4XIFA 4DWVA 1DZ3A 1LV7A 1VL1A 4FS8A 2BISA 1LJLA 3IIEA 1UPBA 4HWTA 4RWZA 4C07A 5JFGA 5TMBA 2BMDA 5JXGA 4IGIA 1FBTA 2B21A 1LXCA 1FMCA 4YY3B 1NP6A 3PCRB 5H4HA 3I2KA 1WMAA 1EVJA 4OFXA 5JALA 2X1LA 5REQB 1XMSA 4H31A 3I9V1 3T52A 2OQ2A 4LXUA 3TZQA 1GSIA 3HXTA 1TL7C 3L84A 2ID9A 2ASEA 1W36C 4UZEA 1ZPDA 1LEHA 3P2OA 3PPXA 2GPYA 3LVFO 3W04A 1R9GA 4CJXA 2J3EA 2JJ1A 2C4NA 1LV8A 2WIKA 4JT4A 4NMWA 1PEAA 4ZGBA 3O75A 5IS2A 1EK5A 5EIAA 4TOIA 2MIIA 2PBZA 4GEGA 3CZQA 3LKBA 1EGVB 3AF4A 1P2SA 3DM5A 1MB2A 1N7JA 1DKUA 4WDRA 1DBWA 1RXSA 1E2MA 3M4XA 2F1RA 4MKRA 3OLCX 2GRUA 3LY5A 3PC3A 4OFWA 3WB0A 1F14A 4TMXA 3LUHA 5A9SB 2ZJOA 3TI9A 5JSQA 4MYUA 2YXLA 4OA8A 5KNBA 1ES9A 1SUPA 3C3XA 2GJKA 1F12A 2V4MA 3GPLA 2VF8A 1HMYA 4UHBA 4B33A 1RWMA 4A8PA 2VXCA 2RGGA 3RIHA 3RS9A 1XHFA 4A26A 2JLWA 3Q8XB 4NH4A 1BZYA 1G8JA 1ZJ4A 3AV0B 3L4EA 3TH5A 2R86A 1Q84A 4RD6A 1TNDA 4WMLA 5IF3A 4AI6A 3V4OA 2C4TA 1I7DA 2XAUA 2DERA 1TKCA 5CT8A 5DN6A 1GLNA 3P5SA 4AW9A 1ZOLA 3RQIA 4L0DA 5I7FA 1JS1X 1PR5A 1ZK0A 5AW0A 1Z82A 1TE2A 1XF9A 3CWZA 5BSVA 5GVSA 2ZJ6A 4AJLA 1XTJA 3UJDA 4XIJA 4A2QA 4TZ6A 2CZGA 4JUAA 5JAHA 1ZGZA 4MYRA 4AY5A 4LVUA 3CLTC 4WNAA 4ARAA 1QKJA 1FP2A 4RF3A 4BDTA 1N2EA 1PD0A 3KEGA 5BMVA 1UQRA 3KQSA 4LJRA 2YJ5A 3WLAA 4GX2A 2F3QA 1B16A 3HUUA 3UB2A 2QXYA 5DHAA 5JNSA 4AYWA 1W4BA 1EBUA 3TJRA 4I5DA 3C70A 1ZMXA 3AZPA 3RJ9A 4OU5A 3KFVA 5AK6A 4RV9A 3U44B 1TJNA 1CNEA 5J5CA 2O8NA 3R6GA 2JHPA 3EAFA 5TC4A 4BC1A 1NRJB 3R24A 3BILA 4QAQA 4JQZA 1WKCA 3FBGA 3QEKA 5JYCA 1J7KA 1YRBA 3IESA 2NVOA 4OXXA 1DBPA 4H1WA 1QH8A 4DHWA 1T5SA 4HYQA 1RKUA 1G41A 4MHOA 4QPJC 5JZOA 1QZ3A 1MIHA 3PUZA 4ALIA 4E5PA 1GGKA 2G8NA 1XZKA 1UC8A 1RYMA 2RAUA 3GG9A 4L8WB 4RA9B 5D5QA 3GFSA 5CGZA 2VPXA 5KYUA 5IFKA 1NF9A 1PJ4A 1RZVA 1TUBB 2ZIXB 1JA1A 2G77B 2ZYHA 3JU3A 3LDFA 5TQ2B 3PKJA 4CF4A 4GSYA 3T7SA 1UAAA 4FE7A 3AVTA 1FK8A 2FWRA 4L4RA 3IVGA 1K6JA 3LP8A 5DH9A 2CLCX 4PRYA 4QOFA 4Y2VA 1R15A 3TOVA 3LJKA 1X86B 4JASB 1HX7A 5BV0A 5HZKA 1CIVA 1E2LA 2ZBGA 3E22B 4JDPA 5I7RA 1H2FA 1JKMA 1XBTA 1SD5A 2AVDA 3BGDA 4TRRA 4KACA 4EPYA 3Q9SA 4B6QA 1R18A 1N8KA 3OPNA 4LC9A 3G23A 5ETJA 3FOZA 2H08A 2D7DA 2ZI9A 4F56A 1ESEA 3WHKA 5LQRA 1H9BA 3FLMA 1QYIA 1W36B 2ZSAA 1XAIA 3AY7A 3DKIA 4YJFB 4BV8A 4TTIA 4C0JA 2QI9F 2VAXA 1ESMA 4E15A 3SOZA 1M8PA 1XVLA 1YHZA 2O7RA 4P5PA 4UTXA 3S81A 2C8LA 2Y6UA 1BKYA 4Q15A 4EHNA 5C5CA 3MAAC 1DAKA 3UJ6A 4F21A 2XT6A 3I0NA 3TVTA 4BO1A 5A0TA 1M0WA 1M72A 4IS3A 4WN9B 3OD1A 1DCMA 3VI4B 4OYHA 1WPGA 2RHBA 3EIFA 1IZ7A 1NMYA 1P6UA 3DONA 1DAFA 3JTMA 3CW2A 1P7YA 2F8MA 1QG4A 2FPRA 2G4CA 3FVWA 1LX7A 3OZCA 4GWLA 3A36A 4RK7A 1X7DA 5G4LA 3SX4A 1AV7A 4CM7A 2QX7A 3MLBA 1V11B 4MQLA 4IG9A 3VJMA 2JAWA 4BGEA 1KJJA 3UWDA 1UJ4A 4RDHA 3I45A 1ZDMA 2ZCJA 1QGZA 2DHEA 4KXLA 1N8NA 1TIKA 2LCIA 4RWEA 2HHLA 2ZULA 2VG8A 1F6WA 4QO7A 2X0IA 4FMDF 4O59O 5ARBA 5K0GA 2HK6A 4HD8A 1VFPA 2VTKA 3LUBA 4YONB 2OGWA 2CGEA 3O38A 3UMCA 2FMIA 3PUKA 4Z4IA 2Q1SA 1ZGAA 1GV1A 2B4KA 4TQ9A 4ZDWA 2H1IA 1K5DA 1VKOA 1AG9A 3DXXA 3KR9A 4KDRA 4DLZA 2R751 3MCUA 1RS0A 1OTYA 1FDOA 2NZWA 4UVGA 5LSAA 3HM9A 1TUEA 4HPJB 5ECYA 1FRVA 2Y76A 2JFFA 3AEUA 1P5ZB 3GJRA 4L5BA 2GNAA 1VCMA 3MTGA 4BO9A 5E4TA 4O4JF 2X1VA 3ZHZA 1NW7A 1DC6A 3QXHA 4OSOA 1SUFA 3ITDA 5BY2A 1CIJA 1W6UA 4ZEXA 2NN3C 5JDCC 3O83A 5AUPB 3ROPA 2CXTA 5EMKA 4DSZA 4US2R 1E4OA 4IVPA 1P4SA 1DG1G 1NRWA 4MSUA 4DKXA 4DRZA 4F0JA 2R8RA 3IV9A 2FHPA 4ZMSA 1A9XB 2O3SA 2YJ6A 3LLUA 4NBUA 3OFND 4P7JA 5FBRB 5FAXA 4UNRA 4MB0A 2A3NA 4OXQA 1VPTA 1JR2A 1V5WA 2O52A 1Y8QB 3AGPA 3N2IA 2EATA 3AERA 2ZIGA 4W63A 5BQFA 1E61A 3ETJA 4F86A 6Q21A 3EVAA 3ZHQA 3THYB 4UZSA 1U0SY 2UVDA 2ZTUA 3HKBB 3N8HA 5B3JA 3ZWXA 1YAJA 3Q15C 5JV5A 3QPAA 4BNNA 1MX1A 1QH1A 3PI7A 5C7LO 1CIPA 2FN9A 5KKAA 4EZEA 1YS2X 3TQSA 4QBTA 1OPRA 1AKRA 2EJWA 4K9SA 4E31A 2KSQA 3CUUA 2NUPA 5HF6A 3FNQA 1I6MA 3IODA 4ARZB 3F8WA 3OZUA 2XUQA 3IVAA 2P9FA 3NCTA 4II7A 3M6MD 3SXJA 4JJGA 2VYFA 3ORSA 1SQFA 2OILA 1GTL1 3D0QA 5L7YA 1FJGB 3PFBA 4KNWA 3Q2IA 3DEZA 5KOIA 1T8WA 1XDDA 1CYDA 1N6KA 2VN8A 4HC4A 4HDOB 5EMJA 1EGQA 4W6QA 3OTOB 3SSAA 1OYWA 2WSLA 2Q5CA 4JGGA 3J7AC 4JB2A 4G0WA 1NXQA 2DQZA 1IXKA 1PGPA 3QBDA 2IL1A 2FSGA 3PHCA 3Q3VA 4HI0E 1B00A 1NVFA 3PQFA 1J07A 1EVYA 3PQ6A 3T9DA 5I7SA 2V0CA 5G2OA 1AU9A 2O0JA 5AVRA 2YWDA 3W8NA 2GBPA 4KMRA 3RAPR 3F2VA 4Q3NA 3RUIA 3VR5A 1ZM4A 3ZGOA 1ZIOA 3M6XA 4GGOA 3RV4A 3STYA 3ZJ4A 4C76A 4CGYA 3IUSA 1WQ3A 3K96A 4RANA 5I48A 2WTEA 2QV7A 4ZCRA 2FPGB 5JS2A 2Z8YA 1XCPA 4QASA 2PSFA 3EJ6A 5BOSB 5IUJC 4NQZA 1CUBA 1DUSA 2XMPA 4HLCA 2WIBA 4AROA 5ITSA 1GDTA 3GEDA 5GZ3A 4R2IA 1QYRA 1UK6A 4Q3EA 5AESA 3KT3A 3KYBA 4ZT6A 1HA3A 3DS8A 2DJ5A 1XRQA 5M2QA 2R6GA 3GXBA 3IAS1 4Q1BA 4TKUA 4P92A 3T95A 4IIJA 3L93A 4PEVA 2E89A 4BEJA 4J1SA 5IXJA 2WTAA 3NHKA 4G2NA 4ESOA 2WWRA 3MJCA 4FR0A 5ARDA 3OFJA 2EFDB 5GY7A 4OI1A 3RD5A 1U7PA 1XQ1A 1XYYA 3P9NA 1N8SA 3ABOB 2ZR0A 1VKRA 2BFMA 1ELOA 2PSEA 1BCSA 5HK9A 4IYJA 1AURA 4EHHA 2H1VA 4UMDA 3S1SA 3D6VA 1YRWA 4D8YA 3HSYA 2ZB7A 4I9GA 1RFGE 4F1KA 2HA5A 4F2DA 3B9RA 1OBCA 4DNXA 1EWQA 3UBMA 1Y89A 2GHRA 1LPMA 3GA0A 1VHJA 4CR7A 4XPZA 2W98A 2Q3MA 4EHDA 1SC9A 1IHPA 4JODA 1J39A 1V7PC 4OX9Y 1U04A 3BXZA 4CM5A 1IJFA 4LZAA 5FQOA 3TW6A 2DJIA 2WHEA 3MA0A 1L7RA 4HMOA 3IEMA 2PZBA 1IWOA 1CERA 3DE5X 4HVLA 2JH9A 3T38A 2CLMB 5KZMB 1V9CA 1Q57A 3EZ2A 1ZHFA 2P68A 2QVXX 3G2OA 4FONA 4CODB 1HETA 1OFTA 1IBRA 5B2ZA 1N5OX 4TVKA 5AVXA 4LIPD 1DEOA 1J9EA 2F17A 4REMA 4HYTA 3EODA 4ACBA 5JCOA 1DIRA 2G1AA 1K6XA 3T61A 1GTSA 3ZDCA 2P2ZA 4QOGA 4EYOA 1QFSA 4ZARA 2ZB8A 2PHZA 3AQIA 2R60A 3BTSA 3DDOA 3QTBA 4LXHA 4YP9A 4JI8B 2WD7A 4ENVA 4NC9A 4Y6QA 4K86A 2IODA 3RRMA 3HB4X 4TMTA 4LY3A 2O4CA 4JC5A 4TXLA 5AVOA 1VA4A 1TGYA 1RADA 4N5HX 3X2FA 3B9PA 1LA2A 1DWOA 5IVIA 1QF7A 2F3RA 5KAMA 3OZBA 1KQGA 4BN5A 2CMHA 2WYHA 4RKYA 1NI3A 3LYHA 2BRUA 4FFBA 5J43A 1LPBB 5LP6A 3K9HA 5M34A 2LDXA 3JWPA 5FI5A 4R3WA 3TUJC 3U37A 4AS3A 1Z34A 4KQKA 4U0JA 4XIYA 1WETA 1YB6A 1ECCA 2PY6A 2HM7A 4MO9A 5J2UB 2OENG 3ZXXA 5THXA 2BFCA 3S5UA 3WGVA 4LMRA 3I37X 1VYHA 4JUCA 4E2WA 4AQYB 1QRAA 2XUIA 3JARA 2WYWA 2E1PA 4UTOA 3PR3A 4ZQFA 3U7QA 1JIKA 3M9LA 4P3YA 1C4KA 1CV2A 3FGOA 1F0NA 1SXJB 3IGFA 3T9FA 5HX7A 2ZB2A 1C0EA 2GASA 3GAMA 1W1UA 2OHVA 1R4AA 1T4BA 1YH3A 4PSUA 4D8VA 4IDOA 1NPYA 3PUYA 1DINA 3Q7IA 4NEGA 3L02A 4WZBB 2ZRGA 4E5VA 3IEKA 1J8MF 2C2XA 4AD8A 3GNQA 5JNTA 1ZW1A 3JQAD 1IBMB 4GKJB 2ZANA 3Q3JB 5TX7A 2RGBA 2WWFA 3AEQA 3PRJA 2IRWA 3TN7A 2AT1A 1SBZA 3H1FA 1FQKA 2HA3A 2O7QA 5BNZA 1AGYA 1PJRA 1K1EA 2CDAA 3FVTA 4A8TA 4ZYTA 1NT2A 1CP3A 1Z5NA 3RBVA 5C32A 5CB4F 5G0WA 3T5BA 3MLEA 2NU7A 1CY1A 2B6HA 2BTOA 2Y1FA 1BW9B 3DOCA 1FC0A 3M82A 2C78A 5EKDA 4PNPA 3RYHA 5C8XA 1DDIA 3X1XA 3QYFA 4FFMA 2CVFA 4RPJA 5BN4B 1NBMD 1QGUB 1H4QA 5JYBA 2YOHA 1NW8A 3MUOA 1JLRA 2V7BA 3AW9A 3LPDA 1KETA 1DUVG 1KH2A 3O90A 2W2NA 2AHRA 2QMHA 4NENA 1X3LA 5ALQA 3FGNA 4G5RA 4C4TA 4L16A 2V9PA 1RHJA 1AXGA 3NANA 3PUHA 1X0XA 1K7XB 2BFFB 3VOTA 3ZD8A 4B4UA 2R62A 2PMCA 2O9JA 3NJRA 5IZCC 5JY1A 4MZXA 3R7DA 2VHWA 2RHWA 3WK4A 4B6PA 3KC2A 1QWOA 5C52B 5AI4A 1D2GA 1SXJD 1KL7A 3TLGA 4DY4A 1Z7BA 2IHJA 4LGMA 4NWIA 2HZBA 2IU6A 2KQUA 2AYYA 4KQ1A 4C6SA 1BS2A 2R47A 1K4YA 3HDQA 1CULC 4DC9A 2ZYTX 2V7WA 1GQFA 1T3ZA 2FYTA 3HYTA 4ZT2A 4AXBA 4M0FA 4DEVA 5SZIA 3WMWA 3GEIA 4DJDC 4G5GA 3QIVA 3PJRA 3VPFA 1K8XB 4PYLA 5EE5B 1YGPA 1ZQ1A 3A6DA 5H80A 1N0IA 4LQCA 3RFVA 2ZSKA 1YL5A 4CMEA 4JJ4A 5KJFA 1MKYA 1XTZA 3NAGA 3MMZA 3BMQA 2VBIA 4UEOA 5CDUA 2WAYA 1Z6PA 4EMSA 3OTWA 5KYKA 4K8RB 1SO8A 3PK0A 4LJ5A 4QDXA 3RGGA 4W9MC 2UUBB 4F9GA 2ZIVB 3V8QA 4RQTA 4RIFA 5HKKA 4RY9A 4HK4A 3JVUA 1UC9A 1XVTA 5C1IA 3WWPA 4DARA 4KK3A 1Q0QA 4X7RA 2GTHA 1SG6A 4G8CA 1JEYA 5A4IS 3IUEA 3OZAA 4GPZA 4XLLA 5SY6A 2A88A 5ADWA 1R9NA 1EK1A 3B13B 1X3SA 2KLHA 2V7QA 3SHWA 4HVTA 4DUYB 4H6VA 5DNCA 5A7GA 2PJZA 2JIDA 4XIIA 3KSBC 4EGCB 1W75A 3M5PA 4UDYX 1QYWA 5A4DA 5FB3A 4A23A 2RJOA 2B1IA 5MN6A 2XDQA 4J7XA 1S1MA 3HXKA 4CM4A 5LR6A 4TVSA 2D1FA 5K7SA 1DJOA 1KNXA 2ZSJA 1NW5A 3GFFA 5AHRA 1MHTA 1E1MA 3A9SA 2I3DA 4HATA 1JXMA 5T67A 3UB3A 2R87A 2OHJA 4FHEA 2Z6AA 2QRKA 5B3LA 3DZCA 1MOSA 3WMXA 4UBNA 4O2BA 1LTHR 4MQFA 4UHFA 4RZXA 5M04A 3CVWA 3DKVA 4PXAA 1HR0B 1MIOA 2YV4A 3JWIA 4WHMA 2XODA 4NBSA 2ZJ7A 4ZQBA 4FQ5A 5HK8A 2Y27A 4IIVA 3IVXA 1PGJA 3PC8A 3FW1A 3DWEX 3RS5A 4DANA 4NZPA 1RQPA 1OBVA 4C2BA 3BX1A 3PRHA 4ZOCA 1QRSA 4AG5A 3Q6NA 3G9TA 4CCWA 3FSJX 2IEIA 4CKZA 4RCZA 1FXSA 1WW2A 1NU6A 4M1EA 3Q7EA 5FTLA 5JWOA 1EFHA 4XWOA 3DUFA 1SVNA 3KZMA 4ZVTA 4FHFA 4UREA 1TQ8A 3B38A 3BZUA 5T64A 1O6CA 1ZJ5A 1H2EA 1V4NA 1ZU5A 2ZB3A 5E3JA 4CUKA 3W5BA 1ZJYA 3N7TA 2JGAA 1GPMA 1NBHA 4MRRA 3DAYA 5YASA 3DLTA 3D7KA 3OZDA 2QRPA 1THTA 1XLTA 4BP1A 1VPEA 1RC1A 4Q5IA 4X41A 421PA 4BZZA 5EXSA 3BB1A 2JLBA 5CFZA 1ZRNA 3B70A 1SZCA 2DFLA 3AJDA 5LP1A 1BE0A 1Y9DA 2P6OA 1Q11A 4H08A 1PJ2A 3FWYA 4QICA 3ECSA 2QV0A 5HFAA 3RREA 1G21A 5DRTA 4F2GA 4XWWA 1I32A 4H4CA 3S2FA 2J6CA 3D64A 3AZOA 3ESCA 2HDOA 3OKFA 4LN1A 5BV7A 3FTFA 4W5JA 5BVHA 4GPBA 3VPSA 2VSOA 4MX8A 5HUJA 2LV8A 3N2YA 5DBFA 4M9ZA 4XDGA 3IUNA 3Q72A 1R00A 4G63A 3RUDA 3UW3A 1BHQ1 1EINA 3QX8A 3GGCA 3TQFA 1HQKA 2GDJA 5T8KA 1E5XA 2CMDA 4EY7A 1U7OA 1U7XA 1G8HA 1FMJA 3C41J 3IBTA 2KJQA 2QWXA 3GZNA 4R6WA 5I4CA 4UHJA 3T54A 5DNAA 1XD8A 4I46A 4M87A 2WSBA 3DTVB 3CPJB 1NXPA 2WJ6A 4EG1A 2WE7A 1QB7A 7MDHA 1FFXA 3HYRA 2I0FA 3ILSA 3EVCA 3F1LA 3OWHA 3AVOA 2WPDD 4OUDB 4NPHA 6CHYA 3ONEA 4MVJM 4M53A 1ZU4A 3W6UA 5IM4F 3EEYA 4ZEVA 4IF4A 3BG5A 1M34B 2DBZA 1QPGA 2DFVA 3H6KA 3CZ5A 4NONA 2R7AA 3HLKA 4ND8A 4D9KA 4Z4CA 4G8JA 1EVZA 5MGNA 1DB3A 1WL8A 4YCBA 5U4XA 1F20A 1HC7A 3DTYA 1EGAA 4AJNA 1OH6A 2AG0A 4CQMA 3WV5A 2A9OA 4R5MA 5FBVB 2FGKA 4GO1A 5KHLB 3GLTA 3QUCA 4HKTA 2PA0A 1MENA 2W22A 3DAPA 4MKHA 3SC3A 3UMBA 4FKBA 5FF9A 1PW7A 3D6AA 3W2HA 2P1DA 3CPHA 4HNSA 1JLSA 2JCYA 5CFOA 1SB9A 2VXYA 4WPGA 2WJVA 2RHLA 3GK3A 2J48A 2WJIA 4GMFA 4YLEA 4HRYA 4RCYA 1O94D 5KNDD 1L7PA 4ZMBA 3ZE6A 3LZDA 1J09A 1GAQA 1K88A 2R97A 3DNFA 2I4IA 3FZEA 1BVRA 4GXTA 1BFUA 3R3VA 1COWD 4EF5A 5CG1A 4UM7A 1RM4A 4CM9A 2LWIA 1RBQA 1SR8A 2AOTA 4TSFD 1CKEA 1QVWA 3WIVA 1FFHA 4KKVA 3N2KA 2B2NA 3PUJA 3C1TA 1SKQA 2KMLA 1E94E 3CTPA 3L06A 4N03A 3KSMA 3JQ6A 2EW2A 4R2XA 2B7BA 2CHEA 4X60A 3D3WA 4EG7A 3A25A 3TEMA 1EJ6A 3HV2A 4S1OA 5ICEA 3RW9A 1YZLA 3A9VA 3FIUA 2I9KA 3UVEA 3TE6A 4CN9A 2GCOA 3BIWA 3NVMB 3PFFA 1PR2A 4M22A 3TSYA 4B1FA 5E7JA 2QUHA 3R3HA 2O6HA 5IJXA 3ME5A 2C9YA 2GESA 2QJWA 1C7RA 5IVPA 1YQGA 2XCLA 1YBHA 5D01A 5ALPA 4Y0NA 5EXPA 1W0KA 1RE0A 4UNIA 5AICA 1IU9A 1YD7A 4KLRA 1A77A 4PG5A 4RGVA 2FUG6 1U2GA 2W6ZA 1M33A 1KZ4A 3JYLA 4MQ6A 4RPLA 3RU2A 3ZH9B 5B6IA 1VSBA 1IATA 1XTKA 4IIHA 2A1UB 4A6EA 5HRCA 2PGLA 1F9AA 2A57A 1CZNA 1E1CA 2VJPA 1AUQA 3D59A 4PCUA 4Z4HA 2FOIA 3KOMA 1SCBA 1YZGA 2XOKD 4RO0A 4R01A 4D3FA 1WP4A 1Y6RA 3C3AA 2QM7A 1T6YA 2OCGA 1G5RA 3ZY3A 1RWKA 1GPH1 2XRZA 2D1RA 4Y2PA 2HCRA 3I9LA 4WQMA 4ZWNA 1NC3A 2H8KA 4KO8A 1VM6A 4PHFA 3B7WA 5HIKA 5C8VA 1R64A 4ZYVA 5EQFA 2OCIA 4KRGA 4A10A 3WAGA 3KXPA 1A04A 3X3HA 2QD5A 3L7IA 2XUOA 4HDNA 5IC5A 4HWRA 5K0SA 4PONA 1RZRA 3VMMA 1WBBA 3UMFA 1TIBA 2R48A 4HG2A 4O4JA 4F6CA 1DJMA 2DFNA 1DXHA 1X14A 1I2ZA 1TZ2A 2P2GA 4PRZA 2XCTB 4JL8A 3E9CA 1SU6A 1ZGCA 3ZU6A 6LDHA 1URPA 2I29A 2JJ1D 3IUBA 4KR2A 4B7UA 4LF4B 4Q7MB 4P93A 5KYWA 2PT6A 4WNAB 5J2UA 1OJ7A 3U7GA 2R1ZA 3FPCA 3MCZA 2D2XA 5BMVB 3OQPA 1E2UA 3ORYA 3EARA 5EHQA 4YAIA 2WEKA 1K7CA 1YSCA 4ZI2A 1RQXA 2EF1A 1FJ2A 3OHSX 4JT2A 3PNMA 5TJHA 4KRFA 5EESA 1Z6YA 1GGFA 3UY4A 5AJZA 1JHPA 3T1OA 4D0RA 3I2IA 1FRNA 3BJMA 3I5AA 3PG5A 4RZ3A 3RVDA 2C59A 3WTBA 5JAIA 4DBLC 2HF9A 1V95A 5SY9A 2JAXA 1DRUA 3KV3O 3OUTA 3GFRA 5BNWA 5KJCA 1SU8A 4B81A 5T4FA 1NLUA 5B3JC 3DWFA 2CHUA 4RZQA 3VC7A 4MW0A 1YI8A 3I2FA 4V2UA 3FOWA 4IM7A 2NXCA 2CWWA 1QH8B 1GGVA 2XZTA 3LHKA 1R0BA 4HCJA 1YDWA 4JLAA 2QP4A 4MK4A 4EPTA 2QM3A 3A4MA 4KFTA 1H1DA 3KUCA 2ZVJA 3AFHA 3CR3C 4JNKA 3QOFA 2ZDGA 2I7TA 4MO2A 4F1JA 2PFKA 4BJ3A 5G4KA 1F4PA 2GPAA 4X9XA 1E1QA 4PTLA 1ONSA 2DVMA 4UCXA 5DN6D 5DYGA 3B82A 3QSGA 1GL6A 4CMAA 3W8FA 3WL7A 4AX8A 3DB1A 4BO4A 3PNPA 1DJNA 3R5SA 3NWBA 5JECA 4DCVA 5CT9A 5AVWA 2FLWA 4ZVNA 1H65A 3K1YA 2CJXA 4FT4A 4LPKA 5FPSA 1H1LA 4WWHA 4XX1A 5BUSA 2XE6A 5IJ9B 4RTPA 1QE3A 2Q8NA 3ORHA 3BMXA 1PI3A 1ABEA 1XMXA 4Z1MD 2XQJA 2B20A 4GKVA 3WQSB 3S2EA 4RTOA 3K9CA 2JFOA 5AXBA 3IP1A 2DTDA 4PRKA 4ENRA 3DXYA 1X1TA 5AFSA 2I4NA 4PLPA 5H70A 3QOYA 1IULA 4AMBA 2R6AA 5K3SA 1NU8A 5E4FA 1SWWA 3HMKA 4ND1A 2FMHA 3IJ5A 1JT2A 3HBLA 3FHJA 3H13A 4IHJF 4TM7A 1U9YA 3H99A 1GA6A 3UATA 3GGSA 3L6CA 4XEUA 1XZGA 1JA0A 2C0QA 2JBHA 1QRRA 2OD2A 3L9XA 3KETA 3IQDB 2YYYA 2BEUA 4MEAA 5AW4A 1AKEA 4KBYA 4OYYA 3ELWA 2QS9A 2X5JO 4EJSA 2YY6A 4EPXA 4F8YA 2GI4A 3LYUA 5DXAA 1GUZA 1TCVA 3JAWA 3SC2B 1NVKA 1R7RA 3UA3A 4YUWA 2JGIA 3ESAA 3OU2A 3DDWA 4W7SA 4BB9A 1E8DA 1NNEA 1XPOA 4MW2A 4PSCA 3IXQA 3ZHBA 1NA5A 3COYA 4B6JA 4NOLA 3CHYA 1F8XA 3WB2A 3AEUB 4B40A 4NS4A 2B8EA 3CRRA 2OCPA 4LK2A 3COZA 1D4ZA 2PRZA 3T15A 1B8PA 3T4EA 3CU5A 1A7UA 1KIMA 1OKKA 1UFVA 4H1TA 1E96A 1XZQA 5K3FA 3RARA 1Y82A 4X00A 4L9AA 4RM3A 4IIXA 5JD6A 4F4HA 4YAFA 1PGQA 3B8EA 3RVNA 3CKYA 2EFJA 4ND4A 1O9GA 1VXRA 4MVWA 2CDCA 4C88A 4ER3A 4JHXA 4G1UC 5AW6A 2XB2A 4U2BA 2IYAA 1OX5A 2P6MA 3ENVA 3IMFA 1BXRB 3Q2OA 2C29D 2WJPA 3GGJA 4M0LA 4P58A 2XKBA 3VI3B 2K5UA 4X3OA 3F6PA 3RC7A 4FDLA 3O47A 4HDMA 4TLBA 1HNNA 1XELA 3GQBA 3O2JA 3AERB 4BXOA 2VHYA 1AKQA 4AL4A 1DOAA 1BTOA 2PZMA 3JWGA 4QLBA 3PRYA 5JCOC 4HGRA 4CEHA 2O8BA 1D0VA 3Q11A 1KAMA 1R5NA 1BXZA 1GFWA 1QH1B 2YBDA 3KLBA 3EIWA 3NBAA 4EENA 3U49A 3FMVA 5C3UA 4JI3B 4JVMA 3PDCA 4TRMA 1F3OA 2HCFA 2X8LA 4WZ6A 1KGDA 4KXUA 1H42A 5AXAA 4WXRA 1M6EX 1PRYA 1NQXA 5DCUA 3GRKA 1JZSA 3WZ2A 2XT0A 5EIXA 4Z4FA 5GJWC 1UMBA 4JYCA 1MH1A 5FNZA 3PLRA 1Z2EA 2VHQA 2BRUC 1KO4A 3A04A 5LP6C 5HW0A 3ZD6A 5FXMA 2IS2A 3ZY2A 4S1NA 4IDCA 3C43A 4HUQA 2FOLA 4YFVA 3WBKA 1PJTA 1BH6A 1WO8A 5CLIA 3WGOA 1YZTA 1T5DX 1UXOA 2B35A 1JJBA 1ZGBA 8ADHA 1T9CA 1JTVA 3GIDA 4MMXB 3E9QA 1UC4B 1XTRA 2B92A 1I14A 3CIFA 3DAFA 1XE3A 3P4XA 4NAUA 4YQYA 1QAQA 2H2IA 2NSDA 3GU3A 5DISB 5FP0A 3TBFA 3VH3A 3M2PA 4YCAA 4DQKA 1RYYA 1JXOA 2R7MA 4DM7A 1EB9A 4ZKEA 1FU4A 3T1NA 2R5FA 3BGOS 4LRXA 2LVBA 4UDOA 3EPRA 4MMZB 1BFDA 3TSZA 5DTQA 5FBQB 4BMPB 1YA6A 1E2EA 5J63A 4C08A 5EJ8A 1X13A 3RNLA 2GVZC 5BSMA 4MYDA 4TPKA 1NYRA 5FBKA 2C9BA 4DV0B 1B74A 5GV8A 4TZ0A 4B3SB 1NAHA 3MD9A 2G07A 4NZOA 2W6CX 1GR0A 1W93A 2LR0A 4I3GA 1DUIA 5CB4A 1JR3A 5E9JA 5KUTA 3HEBA 2AI3A 4TKUB 1ACLA 5IRCD 5JH7F 3FUUA 4IIJB 4LKRA 4Y98A 4RLQA 1WCYA 2HLPA 1KARA 1OFUX 1P61B 1JIJA 1T5HX 1Z5WA 2CLEB 2H63A 3T7RA 1UMKA 3JYPA 1FYFA 3NBYC 5CDHA 2GHIA 4ZTBA 2P2NA 3FFWA 4HGZA 4CHTA 2EZTA 4HBZA 5IDXA 2WFLA 2BF7A 2UXBB 2HRZA 1USUA 5JE8A 4JJFA 1BCSB 4R1SA 3G5TA 1Y33E 1XRMA 2I6UA 1XZDA 3G5AA 1G8GA 4PSKA 2QF7A 3I9V6 4ZRMA 3NKVA 4F5YA 3ZHOA 2GAIA 3NYIA 3PWKA 4FXOA 4LJKA 4Q7KA 1WP9A 3UOAB 2A9QA 2CNLA 3ZE8A 1IBSA 1NL3A 1NW6A 1AGRA 1U80A 4K6HA 4UBIA 3U0BA 3VYWA 4BOYA 4E94A 4EKGA 2HJVA 1A9ZA 2WZBA 1YQTA 1QDEA 1U3WA 3QKSA 4ZT7A 3FWHA 3H11A 5ANRB 4ZZ2A 5KTSA 2ZU0C 1VRCA 4YC7A 3RSLA 5BYKA 4FGLA 2W42A 5J4YA 5KBYA 2GO7A 2HRDA 3BOSA 4FMBB 4DLBA 1WLYA 1RKBA 5DM60 1S96A 2FB9A 1J4AA 2E48A 3RVJA 1B2RA 4MR9A 1W47A 1GDHA 2GN1A 3H65A 4KE9A 2LTAA 5CB8A 3UK6A 3LBNA 1NQWA 2B34A 1QQ7A 3EA0A 5ESWA 1UP7A 3EIHA 4N0MA 5BR8B 4ZO7A 2XKAA 4CMEC 1ZCBA 1YIDA 3AR3A 3TZLA 1D07A 1E9FA 2XTMA 1A5SB 10MHA 1D4FA 3ER9A 2YJ3A 1QGAA 3V6MA 3ZWOA 2WD7B 4PNEA 4LYFA 3FPSA 4MUBA 3ZWYA 1RQGA 1DNPA 2Z4SA 4WXYB 5DK6A 3LUDA 4TVBA 4WA7A 5DM2A 5I7VA 1KR2A 3UMVA 2O5CA 2V7EA 2C2ZA 4KQMA 3N9IA 4KWIA 4ZCPA 4CNBA 2A0WA 3B6IA 3C1UA 3C6ZA 3N53A 1GZDA 4BUCA 1LPPA 2DU8A 3SXUA 4YRSA 2G67A 1YHNA 4FFBB 4FYWA 5LP6B 1PR0A 2GO1A 2VTVA 2WZDA 4Q9DA 4X44A 4TYNA 2OO3A 2XB4A 3ZBTA 4D3XA 2H85A 3HB0A 1BSVA 3QY0A 4CL3A 1V1MA 1E9SA 2BT4A 1XOIA 1Z2DA 2BFCB 1MW8X 1OB5A 4MWCA 4X1YA 5CX4A 1FRQA 1IN1A 3JARB 2HCJB 9ABPA 1OWPA 3EGOA 1IY1A 1VHWA 5DE3A 3U7QB 2YVUA 5U4QA 2LBPA 1FTWA 4XYGA 4BO6A 3HR7A 3SE0A 3U19A 2OOSA 3QQ5A 1WS6A 3QWFA 4CU2A 3HA7A 4L7VA 4ML3A 4PYIA 5C4IA 1DC3A 4UOEA 1IMOA 1MVLA 2ZXFA 4CVNA 4TXMA 3OF5A 3X2EA 4CTMA 3GB9A 3TTSA 4W5TA 4D5EA 1SWVA 1ULAA 2B4QA 1K89A 2NO6A 2MOKA 4LCJA 4HQRA 1JWAB 1IXYA 3AEQB 3A1DA 4AULA 1RPAA 1P2TA 1CJTC 4MJLA 4Y2JA 1GPLA 1L5QA 4XYLA 4XASA 1OLXB 3JW8A 4ANFA 3EA4A 3M33A 3PC8C 2X9GA 5F7ZA 1E6EA 4UHDA 4GPAA 3MUEA 2NU7B 1VBNA 4TQGA 4BFCA 3RYHB 1L4YA 1M2NA 2J9RA 3B9BA 1PF7E 3V4VB 3ZKAA 4YCSA 1KEPA 1SBYA 3OPQA 2X2FA 5IT4A 1MRZA 3IDQA 1PVDA 2H6EA 4IP0A 4MUMA 2H1FA 2H4HA 1OOEA 1VL2A 4ENPA 3TTVA 1OW3B 4J75A 3SMQA 1W0JD 3H5VA 4NENB 5HS6A 5JISA 2Y1OA 4BGUA 1GQRA 4YRIA 4L5AA 3OOJA 2FI1A 5CAEB 1HNWB 4DA0A 3MWFA 1BWQA 1EFTA 4G85A 3KUKA 4BQNA 3WYAA 4D02A 5HOEA 1XLTC 3AVQA 1NXSA 2WUWE 4TMVA 4A2WA 4GMDA 1PWEA 4FKMA 1GLVA 2AFIE 1XNHA 3R5FA 5C4MA 5B58C 1E3IA 2DLCX 2ZYAA 4MIOA 3PUWA 3IP5A 4MR8A 3TLGB 4H18A 4LYDA 4XI9A 4ZYLA 3G1WA 1H5NA 3FYHA 3OJ0A 3UCFA 1L4GA 1JQKA 5J2TF 3EVNA 3RSCA 2JFUA 4K05A 2K2QB 2VPWA 4MLDA 4OQZA 1I9CA 4TN1A 1KPIA 1OAOA 2P11A 1V4VA 4J2TA 1M7BA 3MCTA 5IM5A 3V2HA 4DA7A 4EF4A 5JEDA 5H1YA 4QBKA 4LRTB 3GJTA 5T8KC 3CJRA 4G37A 4AWAA 1ZGHA 3BMQB 3DSRA 3NTXA 3QVLA 3KXDA 4H1HA 3KTOA 1IUNA 2R1VA 2Z4RA 4Q9KA 3P4YA 1C9YA 3USES 2I80A 2EJBA 1C9MA 4RK0A 5EFZA 3IIKA 1K86A 3JXEA 1U3FA 4GICA 2VJDA 4JSYA 4QBIA 4CEIA 5A0VA 2JLQA 5ABPA 5ED0A 5AM5A 2V55B 1E1NA 4JR2A 3ULKA 4LUCA 5ICMA 2VP2A 4UMVA 3ZW9A 2FEPA 2QXUA 1JEYB 1HE4A 2CNNA 3W3AH 1U98A 3VPBA 1FSFA 1DC8A 2Y99A 1IRIA 1GN9A 2OY0A 3H5AA 3L8EA 4GIBA 5K0CA 4D96A 3RADC 1RPZA 1Y5NA 4LZZA 1JG1A 4C4OA 1XZFA 2PZLA 5EP4A 3JD4A 5HZHA 2P75A 4WERA 4EI2A 2H57A 2DTEA 3BB4A 2R6CA 2QZJA 2PDAA 2G63A 5CA0F 3GT7A 2SNIE 3LW8A 1J1IA 2GEBA 1TQDA 1KC3A 3EHEA 3UPTA 3I28A 1LDGA 2HT6A 2WJ3A 2XDQB 1DCTA 3RT7A 4CM4B 5F9HA 1ACJA 4Z9YA 2Y4NA 3EXG1 4LQDA 3E18A 2YVAA 3EIOA 4MARA 4GVLA 3P8ZA 4C1BA 3T7JA 3MINA 4HFNA 2BHNA 3KSZO 5TF4A 4ROTA 1HT2E 2FE4A 3KL4A 2B1QA 3G89A 2ZFUA 3GWZA 4H17A 4I66A 3O1IC 4O2BB 3BWCA 4MQFB 4R0VA 3UWSA 4AJHA 1L9KA 1MPXA 1SHTX 2G82A 2XNDA 1KSGA 1KU0A 3RANA 3OMLA 3L4SO 1EX6A 3NBXX 2LKCA 4PLTA 5EIBC 3WIUA 4I08A 1IB0A 4RHCA 2H9YA 4EQ6A 3E48A 2P91A 3P2EA 5IBQA 2BFEA 3UT5A 4RZ2A 1A5ZA 3ADOA 4OQQA 2DPXA 4WCDA 2PGAA 2G80A 3BC1A 3EZXA 3UJ3X 4C7OA 3WHIA 4D6XA 2H0QA 2WJZB 2PG3A 4NF2A 1P74A 1GAXA 3DBIA 5AVQA 1GU7A 1F48A 4YT5A 1EQ2A 2IUYA 2QVCA 4WCFA 3ED1A 2WFMA 3GJ4A 1EZ4A 4J0QA 4ZFNA 3DF9A 3H2ZA 3OVMA 2UU9B 1TJ5A 2QI9C 1U9JA 2V7QD 2VRBA 2COUA 4QOJA 3Q0TA 5LYJA 2V5VA 5HQTA 2HSWA 1ZCJA 5ICCA 1M7GA 1Z0JA 4P08A 4M83A 4A9AA 1USGA 1PT9A 8LDHA 3Q85A 1YR1A 5B7PA 2FK7A 3AUSA 5ICSA 4BO0A 5A7HA 4JKIA 4M38A 5EIWA 1JPVA 1QUFA 1VTKA 4O3FA 5AOVA 8AT1A 1V9LA 1U2GC 2XUPA 1DSSG 3WV4A 2C4UA 2INGX 3IDZA 3Q8LA 4YEDA 3WGYA 2OFOA 2OK8A 2MSKA 4RFVA 4JL6A 4F3RA 2VRCA 4QGSA 5HNKA 2YW9A 4Q1FA 2ZRKA 3KKQA 1WQ1R 2ATVA 2QYSA 1G21B 2DKOA 1US8A 3FE2A 3JQ8A 1M6NA 1XROA 3GMSA 4KLNA 4YMIA 2OM6A 1NJ2A 1XMIA 2ZSIA 3S2GA 4YMGA 5BVHB 2NO4A 4FT2A 2JLUA 3T3EA 4XFJA 1E2HA 3C3DA 4TKMA 2QBYA 1THZA 4N54A 2HPHA 3I01A 3KZOA 4IZIA 5LUBA 2FFHA 3W8EA 1ZVVA 1TTTA 1AF7A 3VSBA 1XRRA 1Z17A 5H0IA 5JSYA 1DFHA 1KVUA 1YVDA 4PG8A 5C0OE 4UCFA 1X7HA 1ZKDA 3GZNB 3GRVA 1ABBA 1S2NA 4HH3C 4P2BA 1L7EA 2NT4A 3MVEA 3DYBA 3QUBA 3KEQA 1R0YA 4BVKA 1WJGA 2Z9BA 5KDLA 3OCVA 4C2AA 4QDKA 1GZVA 2DWUA 2GMWA 3KR2A 5CT6A 4C1NA 1FFXB 4MS3A 3DOHA 1NMQA 2NYAA 4JI4B 5LD2C 1UINA 1G8SA 2C83A 2XKKA 1ISFA 5THKA 5F7XA 3ZPXA 3OZGA 4HAOA 1UBUS 3DVLA 1I3CA 1N6PA 3H9GA 5IMBA 2IS6A 1A7JA 4BFLA 1ZVKA 3FXAA 5JHHB 1XXLA 4U9IS 4BO3A 5ERXA 1VE9A 5IASA 2OB2A 1CB7A 1UEXC 4Q47A 3NOVA 5EUBA 1XYVA 1S5PA 1KSFX 2I54A 3NATA 2HH9A 2XYHA 4QXRA 3EEBA 4MI3A 2J41A 2VYND 1B6GA 1I5RA 1ADCA 1B6TA 1QH9A 2Y2UA 1E2KA 3VZQA 1OI3A 5LZ4A 2A58A 1CRWG 4NPAA 4E5NA 2VSXA 1F38A 1Y98A 3DOIA 3PDHA 3QENA 4HLQB 5FA8A 4OLJA 5L53A 4S05A 4HB0A 4ARVA 1X15A 3V32A 2V54A 2C82A 4TWZA 4UM8B 3MTDA 2FFBA 2WWGA 1SUDA 4IUBS 1G4UR 4RHUA 1PUJA 4TL6A 1LCIA 3RSZA 4Y6GB 1G19A 3IX7A 1L7DA 3A3YA 3ENZA 3KKLA 4N7JA 5JCJD 4IUYA 1WHSA 5DXJA 2GPSA 1LRKA 3RS4A 3A0UA 2HPVA 2JDID 4FZ3A 3PJEA 1TXGA 3CEMA 5AI5A 3N7UA 3N2KB 3ZVNA 3OEYA 2CCKA 1QPZA 2IUEA 5P8WA 4CUZA 3W5HA 5KEIA 5JJBA 1OE0A 4B6RA 5FWXB 3VJLA 4O29A 2VA8A 3D3WB 5IHXA 1XR3A 4JQYA 5IAEA 2WJGA 4DXAA 4DS3A 2QUIA 3PXUA 1W1WA 1P9LA 1NP3A 2O8FA 4G0NA 3AUKA 5A0FA 4B45A 2HV8A 4A1OA 1ZHHA 3D4OA 4ZJZA 1C0KA 2R6DA 3WAKA 4D9CA 5IULC 2GCOB 2YOFA 3GZ4A 2G0AA 4YJHA 1OFUA 3GEBA 1KHHA 1VSUA 3OKAA 3TLAA 3W5VA 4D3SA 5HS4A 2ZSHA 3FCYA 4M6WA 4A8JA 5JFOA 1OT5A 2DHDA 5IAJA 4QGFA 2ETVA 2IW3A 2F67A 2WU3A 2WU8A 2ZJ2A 3AESA 3O84A 1KMNA 4HVAA 5ARCA 3STHA 3ROMA 1N9KA 1ODFA 1XK7A 2ZIWB 2ZJ0A 4FOTA 2PGJA 4ILKA 1ADJA 4BMXA 1E1CB 3DAOA 2ODBA 4YJ2F 3UHAA 4CZ2A 4FZ5A 5DM70 1HQCA 3D2CA 1AK2A 1BGXT 3D7MA 4CFSA 4RTMA 4D1YA 1YFKA 1CUGA 4ZV9A 4FMDB 4AMZA 4CF3A 3DO5A 2BGJA 5BT8A 1JYEA 1MB0A 2HWUA 1U7DA 3FNIA 1H69A 2QPTA 3QF7A 4BLTA 1N5RA 4RPHA 1FFEA 3PL5A 3FHTA 4QPNA 3NZEA 2P2DA 4I9UA 3C3KA 5ALOA 3PE3A 2GHTA 3HA3A 3HBMA 3DT9A 4PIVA 3GPDG 4HDNB 5K2MA 2J07A 3ROXA 4AG3A 3TSCA 1L6RA 4JI6B 1VB5A 3BQMB 5C3MA 2HDHA 2DX7A 4IOMA 3QHPA 1XQXA 1Q92A 4O4JB 3VM6A 4O4HA 3WK8A 1DQZA 1Y3IA 5LD2B 1M0EA 4CI9A 2DR3A 5JLJA 3K16A 4ZI7F 1PT5A 3D4LA 1Z29A 3AKCA 1A4UA 3HUTA 3AV3A 3EDRA 3WLKX 5KYWB 5FCDA 2E37A 2X2OA 3EIUA 2C9MA 3H8SA 1VJ0A 4DFDA 4AMGA 1PS0A 1YR3A 1H2AS 4O8CA 4YCMA 4ZMRA 3W3AD 2AQHA 3ANXA 3HZRA 1XL0A 2Q5FA 3IQWA 1VJCA 3F96A 5BP7A 1TPZA 2W4QA 1JAHA 2B1JA 3BRSA 4EO9A 4O33A 5AKZA 2BONA 1K8ZB 4F85A 5BR1A 3I5XA 3B48A 1QCZA 5ESRA 4UEWA 3TFWA 5AKKA 1FYVA 4IFTA 2OO5A 1VI2A 2YWBA 3KDPA 3V3TA 5FV4A 3N5KA 3KYDA 1ORRA 3VR3A 3INNA 2NZ8A 2XR1A 2PUAA 3T7KA 3G2QA 5JCPA 1E79D 1VE6A 2AJDA 2VNHA 4H7FA 3D3NA 3DEJA 4MWOA 3U7RA 1J20A 1WDWB 2PGNA 4FYMA 4QGAA 2E4WA 3KAKA 4AM8A 1D04A 4YRCA 3CKKA 5IDWA 2SCUA 4NU6A 5D1HA 2WKRA 5DBOA 4M0PA 5DYIA 3UWPA 3HP4A 2O3UA 3H1PA 2GXSA 3K9BA 5KQGA 4NVRA 3DBRA 4R1QA 4GC5A 4AAYA 2FWJA 3HL0A 5G4KB 5B1HA 1E0KA 5DNUA 3WK5A 2MYUA 3B1FA 3T4XA 1H1TA 3U80A 4AZTA 4EW2A 5IUKC 4BRWA 2WT9A 1U8ZA 4KVGA 4PPGA 3ZZUA 1T4DA 1S01A 4JU8A 4XB1A 3EMKA 5ALVA 2FVYA 2A59A 2BY4A 2NO5A 2P8SA 2YXBA 4B6GA 4EM6A 1CXZA 5K2OA 3UCXA 5ES4B 4Y0VA 2HQRA 4MI6A 3HCWA 1G0NA 4B3IA 2J7PA 1ARZA 2VTEA 3L05A 4MTLA 3HH8A 1H1LB 3DMHA 3GH3A 4FNAA 4EELA 5KTMA 3UMYA 2KWIA 5D85A 2O7VA 5KB3A 4BB5A 3O8BA 5KVSA 3LFTA 1UQUA 4YGXB 5HQJA 2WOJA 1ISHA 4PHHA 2ZTSA 3URKA 4GKKB 1YC2A 2BLLA 4KZKA 1N75A 1XDGA 4CF6A 1BEEA 1ICEA 2DRIA 3EXFA 3PHIA 2VPIA 3OJEA 3WGNA 3G0HA 3K0FA 1TF7A 1KJWA 1TK2A 4AKEA 1ZSYA 3LFUA 2YZKA 5KWSA 1TLFA 4FB5A 3JQRA 3C7AA 1TCBA 5KYYA 1HL7A 2R6JA 3HY3A 4A16A 1JQLB 3LC0A 4YJDA 2RHHA 2ZM5A 1P3DA 3DGFC 4GZMA 3G8CA 2W37A 1QVZA 4WK6A 2BEUB 1UCFA 1RQLA 2GZ1A 1GPWB 3ILYA 2HK8A 4QXPA 1JI0A 5IKMA 3SXPA 3X1MA 5DJ5A 4FYIA 3L1VA 2HA6A 4JJKA 4FM9A 4RQAA 2VJAA 5DCYA 2WVHA 3MAJA 4BWGA 3PGVA 1UXGA 2WHQA 1NHWA 4RS3A 5D3QA 4MAMA 3NJ4A 3JAWB 4AY6A 3NHPA 3AVVA 4DMLA 4JVOA 1IY9A 1JDZA 4IZOA 2ONJA 4BMOB 1IZZA 4GYJA 2Z9CA 4YV0A 4BASA 2WM2A 4EIWA 1WB9A 5A62A 4L5YA 1ZMOA 1L5VA 2LCFA 2JRLA 2PEZA 2V8BA 3N07A 4FEEA 4C05A 1KQFA 2BELA 3F3KA 1VLQA 1CU1A 3E70C 2AMYA 3AI7A 2R00A 2FVXA 2HIAA 3QW4B 4GEKA 3GOHA 3CRW1 3F7OA 2H3EA 5B37A 1RM5A 2I76A 4FGWA 3G8DA 3K2BA 1C0PA 1HRKA 1L0BA 1P73A 2I6XA 2QN2A 2W48A 3O1JC 4PLZA 1JSRA 3D6TB 4OAPA 2BUBA 3F73A 1PSZA 2HEIA 2FK8A 4BN4A 4Q00A 2CL6X 3PRKE 5JMTA 1FP4B 3CW9A 3H7IA 3HK2A 2TSYB 4FFSA 3UPUA 2YZMA 2RH4A 3VR2A 2IUSA 4JZKA 4X61A 1O8BA 2GF0A 5A9TA 1SBNE 1TCUA 3K0EA 5A03A 1BVUA