3H16A

Crystal structure of a bacteria tir domain, pdtir from paracoccus denitrificans
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
APPHDIFISHAWEDKADFVEALAHTLRAAGAEVWYDDFSLRPGDSLRRSIDKGLGSSRFGIVVLSTHFFKKEWPQKELDGLFQLESSGRSRILPIWHKVSKDEVASFSPTMADKLAFNTSTKSVDEIVADLMAIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TIR protein
publication title Molecular Mimicry in Innate Immunity: CRYSTAL STRUCTURE OF A BACTERIAL TIR DOMAIN.
pubmed doi rcsb
source organism Paracoccus denitrificans pd1222
molecule tags Signaling protein
total genus 41
structure length 136
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 3h16A00
1FYWA 4C6SA 4OM7A 5H3CA 3UB2A 1FYXA 3UB3A 4C6TA 4EO7A 1T3GA 1FYVA 4C6RA 4W8GA 3UB4A 5KU7A 3JRNA 4LZPA 4LQCA 2Y92A 2M1XA 4W8HA 3OZIA 4DOMA 2Z5VA 5FORA 4C7MA 4FZ5A 4LQDA 2JS7A 1O77A 3H16A 2J67A 4C6TB
chains in the Genus database with same CATH superfamily
1NAIA 3BKXA 4FDLA 4ZJUA 3T5TA 1IB6A 4RJ2A 2APJA 1U0GA 2WY2D 1PK7A 3RBXA 3R76A 1KI6B 5JBIA 1UDXA 1JIUA 4D6XA 2VYVD 3L4BC 3LS2A 3NEPX 3VYTB 4AMGA 1EM6A 1B6TA 4B7XA 4XYLA 4TXLA 4YRFA 1E1YA 3K9CA 4EF4A 4CQLB 2Y0BA 2O07A 3LX5A 3WSVA 3HN2A 1FCJA 4B6GA 1RBQA 1U7OA 3F5FA 2ZJ5A 3RNLA 3H04A 3RIGA 4G3XA 1CUHA 1PT5A 4UOEA 1HPLA 4RPJA 4ZYWA 5A3JA 1KYYA 4RZ2A 2IYTA 5D6NA 1LF5A 1QPGA 3NKVA 2WTEA 3ORFA 5YASA 1BDBA 2H08A 5FNVA 4DPKA 5FBHA 4KKXB 1CS0A 3O0TA 2I6SA 3BFXA 4U7HA 3RLIA 3LY5A 5IKPA 3GXOA 3FDJA 3W9UA 3UK6A 1Z18A 3WWZA 2CYAA 2I9PA 2MYTA 1P5HA 2CF6A 2QSUA 2R1UA 1VIDA 3MMPA 5TJ9A 5I9TA 4ZZ1A 5JDCA 2CGEA 2HRCA 1R5BA 4JEUA 4E4TA 4PLZA 3WP1B 2ZRBA 2C2HA 3MK31 1IN8A 1N2BA 2ZJYA 4JQSA 5BRAA 4J1TA 4WL0A 3VHLB 4G4IA 3UF0A 3N2GA 1FMFA 3UT5B 3W3ZB 4BBPA 5EPUA 5D3ZA 2P6PA 1XRRA 1N77A 2Z8XA 3RABA 5T5QA 4Z49A 3RV3A 3ZEIA 2I2XB 1N9GA 1TT5B 1W96A 2OAP1 4LOHA 3ZHCA 3ZOZA 5KWEA 5ARDA 2ZRAA 3IAEA 1XPOA 3CYFA 4ZTBA 5JZ9A 4RQBA 3FSGA 3UYKA 2K2QB 1NP3A 4C4XA 1GNLA 3ANTA 1NLMA 1DHTA 5ELLA 1YF3A 4LRQA 3EG9B 1WLYA 4FYIA 1Y1PA 1C7IA 4HNQA 3MZ0A 1F06A 3L7KA 2IH2A 2DH5A 1R4MB 2NZXA 3PQ3A 3FF1A 4PS1A 2X9NA 2V0GA 2VYQA 4QFCA 2DQYA 5ALDA 5AVQA 4RADA 5F5XA 3ZGXA 3IMGA 4I19A 4REOA 3F9RA 2Y1FA 2WJAA 1VL0A 3AVPA 1VYHA 3IQGX 2JAQA 2WV9A 1KK0A 4A8PA 3B9QA 3DDUA 1A7KA 1PZXA 3UMGA 4QHYA 3A1NA 1WP4A 2A9KA 4BQOA 4YMVA 1HEUA 3D8BA 4FGUA 1KIMA 5ECDA 3DAGA 3F49S 3OICA 4ETNA 4AB1A 3WB2A 3QA9A 2Q7DA 4TT3A 5K7SA 2GYYA 4L6IA 1ABEA 1S96A 1RLTA 2OZPA 3HNPA 3TLGA 4A5OA 5ITSA 2B7CA 4INJA 4LRXA 2BIFA 5FTNA 2O1XA 4AW9A 2DY0A 5JMWA 3OT1B 1UPFA 3E9NA 2RK3A 2W2LA 2QROA 2GTPA 3KWJA 2OA0A 2A9FA 5BXQC 5JVDF 3BMOA 4GMHA 4BVBA 2ZIXB 3SSMA 3VPCA 2BUBA 4MI1A 2VT7A 4REMA 1JHZA 3AB8A 1JEQB 1T9DA 4OJQA 5A62A 1FZTA 3PD1A 5ESWA 4BNYA 1SBHA 4EY8A 2PZ8A 1BDHA 3O03A 4LHSA 4XIIA 4AMVA 4UVDA 5UKDA 3ESCA 3IXQA 4JX9A 2FEKA 3X2EA 1GQSA 3LHIA 3DVRX 4GP9A 4ZARA 2QMOA 1N25A 5EJ2A 2PKEA 3N7UA 2DXIA 4TYYA 5EXPA 1BD3A 2IE0A 2P27A 4A3SA 4F56A 1YK1A 4J16C 4DGSA 2B61A 4E11A 2ORYA 4DLLA 1GSOA 4WUVA 3I58A 3KYCB 2UV8A 1ZR2A 4F46A 1HUQA 2CDCA 2X0JA 5JS2A 5KIAA 2C2GA 1V8OA 3GCGA 1ONBA 2NXJA 4Q15A 3KE8A 3OJCA 5IF9A 4IXMA 2Z6UA 5A9SA 1JKJA 2ZRQA 3EA0A 4QYXA 4M8NE 4ND2A 4QD3A 4R6XA 4W6ZA 3ZZ1A 4MEAA 1GTZA 3BQNB 3P2YA 1SUEA 3IOMA 4GVXA 4DBLC 3OBBA 1NVVR 1EFVB 3LLVA 4JC5A 1G6HA 4F6LA 4HTFB 5KX5F 2F8MA 4DV3B 1GG9A 3P19A 3V46A 4PZ9A 1QUEA 3KE9A 1H1DA 5FBLB 5FEMA 3WLNA 1DIBA 2FX3A 3FDXA 3GPCA 2PXCA 1ZGGA 1E5LA 4Q9JA 5DLQC 3V4SA 5JXGA 4DCUA 2GWRA 2BOVA 3IOCA 3ON5A 4LXYA 4NFYA 1UXIA 3MIIA 1HORA 2H2GA 3H2HA 3I3SR 2V9CA 4FN5A 4P4LA 2O54A 3FOBA 3RFCA 3EXHC 1GQQA 2I1LA 2OHVA 2PNFA 3G89A 4FFWA 4HN9A 2OB1A 5F7JA 4DMHA 3D0QA 4MB0A 1AXGA 1YB6A 4I55A 3WZMA 4WLVA 1KSHA 2G9QA 1WAMA 5A2GA 3JYPA 1W87A 3MT9A 4G85A 3PA6A 4PC6A 1N2JA 3UY4A 4V0NA 4JLWA 1DKNA 2FK7A 4QUJA 2PWPA 2L2QA 1GG5A 1HK7A 1W1UA 2CUZA 5BURA 3EDOA 4CIWA 1VRVA 3G0IA 4HDKB 2K7FA 1DKOA 1YHZA 3BL6A 5JVDB 1N0IA 1T6NA 3CLUC 2Z09A 3EWSA 3UJ6A 5DDIP 3WL5A 3HFRA 2ES4A 5AXAA 2F3SA 1GAWA 1P60A 2WF5A 1V11A 3IE2A 4IVNA 3ZKWB 4N5MA 4DE5A 1RQPA 1EDOA 1DWOA 3GZJA 3HKEB 4FGSA 4LZOA 3FR7A 3RROA 3TBKA 5CA0A 3VSCA 3K0CA 5AI4A 2HUPA 1SUDA 3AHDA 3C6YA 3EEIA 4WCVA 2B4AA 3B3GA 2DQSA 3LX6A 4I8DA 4W63A 5B57C 4I5DA 1SQFA 4ALMA 2P2SA 5IDQA 1XEXA 2Q28A 3C5EA 4R16A 4ESEA 4YDQA 5ANRB 2B37A 2IYAA 1LXCA 4CMAA 3VR5A 3Q3GE 1Q0UA 3TJRA 5JFTA 2HT1A 4NU5A 4OG2A 4MPDA 3O8NA 4REQA 2R6JA 3A4MA 4LY9A 4BFSA 4WFJA 1UC8A 1ISPA 1JU3A 1N2OA 2R5WA 3F2VA 4B4UA 4UREA 2QT9A 1BX3A 3AHIA 2Q0XA 1YB5A 2IYXA 3WHLA 3GEPA 1ESZA 2B4TO 3BGIA 5EKUA 2XCSB 1CSEE 1DTWB 3PDIB 4NAVA 4X20B 2ISQA 3CF4A 4BGVA 3QV2A 4PG5A 1H3FA 3TAXA 3DS8A 4EFLA 1NXXA 1TYAE 4JVOA 4E3ZA 3LBIA 5KX5B 1KFEB 4TWZA 2PH7A 1G3QA 3PXDA 4RK5A 1QZZA 2FQXA 1OI2A 3HNOA 4B40A 1E2DA 3RS2A 4EHFA 5ES4B 1SBQA 5CBKA 2QENA 2IDJA 1G9XA 2C4HA 3P0HA 1T25A 3P27A 1E3MA 3DL7A 2PJRA 1OTHA 3UGQA 3GFVA 3TOSA 4ZT3A 2Q4OA 8ATCA 1EWQA 5IF3A 1VCNA 3GWGA 3A10A 3HDVA 2GPBA 3TQCA 4ZVNA 5CBPA 1QPZA 2Z6QA 2GZHA 4HS9A 4WK6A 5HF8A 3ZU4A 4OYYA 2QRHA 3PC8C 4G0MA 4OUKX 2ID8A 4D9HA 3WJ2A 3T3NA 5KEIA 1M66A 4KE8A 4TUYA 1UJBA 5K6RA 3WGJA 2WU1A 1UKCA 1QHIA 1SCBA 3N39C 3SFZA 3HU2A 3OKPA 4YPFA 5GTDA 3DOEA 3A3OA 4YJ3A 1FS4A 4JBWA 2QLJA 1H8HD 1M0WA 4NK5A 1FTSA 4LC9A 4E31A 3A1SA 1AMUA 4B87A 1C8KA 1DOAA 1DVRA 3LGXA 4GRIA 4Y9DA 4PFJA 4C4OA 4X6UA 3K6RA 4MNTA 5DYIA 5KYUB 5LWHA 1SUIA 1KOLA 3C3WA 4FEGA 5A71A 2R751 4Q4DA 3ROXA 2DFTA 3NHJA 4KLCA 4RIFA 2FGJA 1VLLA 5G1OA 2X4DA 3LHKA 1W2GA 1YQDA 2HHLA 4JBGA 3SS9X 4BV9A 5CDYA 1HLGA 3LQYA 5AJHA 1E6KA 1ZJWA 5DHTA 4X95A 5EA2A 2QORA 3E18A 1AH2A 3ILYA 3ENWA 4DZRA 2V5AA 2NUPB 3DV0A 4UBOA 3VV3A 2DJIA 1I13A 3DYIA 3QP9A 5LQDA 1KC1A 1XLVA 1FLNA 3H9BA 3PYMA 2PT5A 2WAMA 1A2BA 2CVFA 4QGSA 4NLLA 3WWPA 5FUQA 5JNRA 1GFIA 1K7FB 3LKZA 2TRSB 4RLQA 3GY0A 5TVKA 4PN3A 3JALB 5SY6A 5ED4A 1YZVA 2AW5A 3RJTA 2V3CC 5HS6A 3I30X 2Z3ZA 1MHTA 3KR2A 1EJ0A 4IVPA 4MUAA 4BX2A 3CN9A 1EB9A 3A4IA 3MMZA 3PEUA 4PZEA 3PPXA 1EDEA 3PICA 4W82A 5EHQA 4ZEXA 5HR5A 1YQUA 5AIBA 1M5RA 2OD9A 1PYDA 5B4VA 2R5FA 2VDOB 2DR0A 1CIPA 1KFKB 3DTVD 1H1LA 1Y9JA 2V7TA 3OP4A 3NOQA 4O5OA 4Z3DA 3VH4A 1L7OA 4UJ3A 4RZHA 1E3LA 1OQAA 2EBWA 1JH9A 1E6CA 4D4KA 1RAIA 1LPMA 2C04A 4JL5A 3N05A 3BDVA 1R0LA 3GAZA 3IVGA 4ID3A 4OY3A 4UKDA 4YP5A 4AZTA 1K8ZB 1T0PA 3REOA 4YJ2F 1M1ZA 5KOJA 4E7OA 1FFSA 1LTQA 1XHFA 7REQB 3PQ6A 1IBMB 5AD1A 5AHOA 5HQJA 2J6BA 4J3NA 3HACA 4A23A 1EGHA 3VPAA 3K9BA 3PNSA 5IBRA 1R27A 1GPNA 1XWIA 3AWIA 1NRXA 3C1TA 3ROPA 3WBKA 4YGYA 3IR7A 4LTNA 2UDPA 4C7XA 4PICA 2NAFA 3K5PA 2ESRA 2Q8PA 1SXJA 1DCFA 1NU6A 5LSAA 2OVBA 5HKKA 4LZZA 1RC1A 2X9VA 3U3XA 4GGPA 1Z6PA 4MUHA 4Q1BA 1ACMA 5HK8A 4IEEA 3AR6A 4GOND 5A04A 3CC8A 1CDEA 1W0KA 2M98A 1U8AA 4ND8A 4C0LA 4KW7A 3QLVA 1LLQA 4MR7B 3B3FA 2NO7A 3ZE2B 3IE1A 3DBRA 1PLJA 2B82A 3JAWA 2V5UA 3G0OA 2X77A 3IJEB 1ZSVA 4NV1A 3UICA 2GQ0A 2VSOA 4XWWA 3EW7A 4JU8A 2WM2A 5EWMA 4DLXA 5JNUA 3LUCA 4U4AA 4W8HA 2CMKA 1Y42X 4EATA 2WWRA 4C7MA 1SKBA 1S2LA 5DI3B 4KQGA 5JAHA 1SG9A 2VYVA 3MJEA 2BFEB 4FGLA 4MWBA 3HYCA 4YT4A 1OB5A 1PSDA 3HY4A 1TF7A 3DFFA 4YWHA 1QIGA 4EHHA 4FB4A 4W5OA 1XTUA 2GEBA 4MP6A 2ZUTA 3RJ9A 3L43A 1U1CA 1T1IA 1M1YB 5H82A 1CWUA 2C3UA 3BJIC 3GG9A 4MVJM 3GG2A 3A11A 5ALMA 3ZUPA 4KREA 1Y8CA 4OM7A 3U3DA 1TFRA 4Z1MD 1HFEL 1AKRA 2Q3DA 3H5TA 4HB3A 1XDZA 3C3CA 3KBBA 3GLHB 4GHWA 4KVZA 5LIPA 3H05A 3Q8LA 2VDJA 4JJAA 4X41A 5CVTA 5EESA 1THTA 5LPNA 5F7OA 2A0WA 3IT3A 1UMCA 3OVMA 2VDKB 3N8IA 1KARA 4CV2A 4ZJZA 3ZDCA 3L77A 4YJ2B 1HDIA 1UWVA 1XZEA 2P1RA 3QA3E 2RG1A 3LLSA 2W6ID 1O94C 3F1KA 3A4VA 5F1YA 3PKIA 1UF9A 1SU4A 3WRYA 3OEHA 4QYTA 5C81A 5FTLA 3PFWO 3RTAA 1EFAA 2NT3A 3N7AA 4MLDA 1LLFA 1GKKA 3STYA 3EEOA 2PL1A 2YYAA 1AMNA 3QELA 4AJKA 5C2JB 1XKTA 2C59A 5HZMA 3DHEA 1VIMA 1OMOA 2BE9A 2XUPA 4PE5B 3OU6A 4LN1A 4OATA 4RC9A 1JU9A 1L2TA 3G9TA 1QYWA 1KH3A 5IJWA 4M1KA 1KGSA 1A8HA 2Z8YM 4U2GA 1DEXA 2ZPUA 2AMVA 2X7XA 4JJ7A 3QSGA 1XSEA 4OREX 1PCXA 1N2CB 1T43A 1YE8A 2XPCA 3DWIA 4Q19A 4RWZA 2GA9A 4XDZA 3W1WA 1G7CA 3DWGA 5HMMA 4BVKA 1SGWA 4CT4B 3P2JA 5BV0A 2PR7A 1Z06A 4HX5A 1Y6FA 1V1MA 1X7ZA 1JSZA 3IKJA 1FRNA 2BEWB 2IU3A 1JN0A 2XDWA 2RBEA 2MSDB 4IQ8A 4PLVA 2X13A 1U9CA 4AJLA 5E7MA 3N86A 3CF0A 3BXFA 1E2PA 3RUHA 4HNAB 3BREA 4EPYA 3I5AA 5D5QA 2JIQA 2KI5A 4G5XA 1FW6A 1YZLA 3BRWD 2YMQA 4HXEB 4YAKA 1FVOA 4R0NA 2OUIA 1XPRA 1RI4A 2ODPA 2JGIA 1D2RA 1E61A 1UMBA 2Z08A 2ZGVA 1M2EA 3DV2A 4LCBA 3RS4A 4BBJA 3DE4X 2AZDA 1QDEA 2X19A 1QU2A 4X8LA 1U28A 3LY9A 1V16A 4FBMA 2BTQB 1H2YA 2HSGA 1GNRA 4KV9A 5AI0A 4ZQHA 5B1IA 2CL6X 3VYRB 3W1EA 4YIHA 1LDBA 5IWAB 2YZ7A 1YDEA 4QUGA 1NR5A 3LT2A 4RA9A 1U2ZA 2ZUSA 3D8HA 2PZEA 3MWJA 4OQXA 4Q66C 1PJRA 4GBGA 1Q0LA 3EXAA 1L5SA 2NTEA 4HF7A 2JATA 1Y3FE 4URWR 4F5EA 3HTXA 2YYYA 5K20A 3ENNA 4HDAA 4UQPA 5EIBD 3WGYA 2IHVA 2B4RO 4HWSA 4LF6B 3CISA 5TGDA 1W73A 2G7MC 3QPBA 3HCEA 2YBDA 4OHVA 3QENA 1ELOA 2P3LA 1PVVA 2VA8A 3FJYA 5CRIA 5BQ5A 3PXGA 1U3WA 3DE3X 2ZQ5A 1KYZA 1IXYA 1KAEA 4C1NA 5LQSA 3RUAA 3W6OA 3X2FA 4DSTA 1A04A 2WIJA 2WIBA 1R88A 4DBVO 5EZQA 4DA4A 3AKYA 4A27A 2W2NA 4XWTA 2FWIA 2FRDC 4IHKA 3E7XA 1HMYA 4EUSA 4F12A 2NNWB 3A4YA 4CIDA 1TU0A 3GCWA 3DF9A 2W4IA 4RQTA 3TGLA 2WSSA 4XUDA 3WC4A 1OW3B 1TO6A 2C7RA 5CM9C 1IMJA 4PW0A 3SIWA 4X71A 2V9ZA 3S68A 4TYWA 4KHPB 2YFQA 4GPIB 4RPCA 3VR5H 3G5MA 1NOIA 2IHUA 2EWMA 3OP1A 2I8CA 1CRQA 4IKOA 1U5AA 2JI7A 1XZIA 4JS0A 2WM8A 5H9WA 5KNCA 1QH0A 3CTMA 2QM7A 3QVGB 4KXFB 4NJOA 4XGRA 5EPOA 5J40A 4DIFA 1GCUA 2FPOA 3BFJA 3RYFB 1XOIA 1IVSA 3E9DA 4KRGA 4AM8A 5F64A 5DX1A 4AQDA 4N6NA 1SPBS 2GX6A 1QGED 1E58A 1U3UA 4AECA 4RVGA 1MX5A 2H0AA 1WUKS 1JAZA 1U98A 2JIBA 4J0IA 1W29A 4OSOA 3ZVMA 3NTUA 1VYTA 1UQRA 4HHEA 4KGZA 2RAUA 2AI2A 3VKHA 1NULA 4GUDA 2H8GA 2VTBA 2VHZA 1PT8A 2CHVA 4WK4B 1VL1A 1K5PA 1II8A 4PANA 4BGUA 2WJGA 3HB0A 3ZS8A 1BE1A 4HEQA 1MRZA 4N47A 1U2PA 1QS0B 3ZV7A 3EISA 2XTZA 3NHAA 4MCAA 4ZOBA 2Y4NA 1HEYA 1HYHA 1NLUA 3V7FA 4ZYVA 2EX4A 2WWGA 1OBHA 1AKMA 1XYVA 1AX9A 1IG0A 1OX6A 3L0PA 4TMZA 2FEOA 1R3DA 1QRAA 1O2DA 3QKRB 1FLAA 3RODA 4GDFA 3CT4A 4JIMA 4OHKA 1SULA 3VNRA 1PGOA 4MGIR 3QY0A 3S2IA 2W42A 4B46A 2ZB3A 4QEDA 5IX8A 1W9MA 3VJKA 1CCWA 3PG5A 4ZVLA 4I3HA 5IULC 1UUFA 5LXTA 2XGJA 3OFJA 4QLAA 3U5TA 3LQFA 1MEOA 1YZGA 1NE2A 2QRLA 3GPDG 3MCZA 5CHEA 3UAGA 1R3UA 1GUBA 4ECAA 1DIHA 1XHLA 2Y0EA 5LLSA 4TLBA 2C5FA 4AX8A 1G8PA 3I6ZA 1M2GA 3D4PA 3FD8A 5G0VA 1U9YA 2PLWA 3D8UA 3K1TA 3OX4A 4PGFA 1GT6A 5D7NA 1NF3A 4DC1A 3IIMA 1E79A 3SHVA 1A9YA 5ALGA 3PRKE 4BKRA 1JIIA 4B3JA 1CEYA 1JPJA 3N76A 4AU1A 3FYUB 1YO6A 4FYWA 2CF5A 4PN7A 4DPMA 1Z5PA 5ECYA 5FIUA 4JZYA 2ZIWB 2XB4A 2XB8A 4X61A 8ABPA 3GLFB 1CZUA 2JFQA 1SQ5A 3MGCA 1Z75A 4X66B 4Y9RA 1UOQA 1SC6A 4D3DA 4ES6A 4X65B 4E94A 1YL6A 2BEVA 3OZGA 1OLUB 1IM2A 5DTIA 3L07A 3DHWC 4R2XA 3WTCA 3UB3A 1Z6AA 1ONPA 1EZ4A 3JVUA 3ZCRA 5B12A 3SYMA 1Y1QA 1ENZA 5JV5A 3HXLA 2XA2A 1P2BA 1S4QA 3H8WA 2JFHA 2Y2VA 2ZI9A 1YZHA 3I0ZA 1ZWLA 2PDAA 4LOAA 4L16A 4EJ6A 1WD5A 5M04A 3I5YA 5CEJA 4EYOA 3RC1A 3V3KA 2B92A 3KYDA 1N8TA 3UENA 5NLLA 4BFWA 1R37A 4PPYA 5K1ZA 5HUHA 3ZK7A 4IJ5A 2Q2VA 1IZ7A 4OD0A 1JZQA 2DG2A 5HF9A 3RT9A 1JDZA 5LMZA 3QYJA 2REQB 4KN8A 1GQ2A 5LMUB 1MLDA 3NPAA 2MYPA 1KNXA 4BJ5A 3OSUA 5BV1A 4FSHA 3IIIA 2NWQA 4RD4A 3U37A 2QLNA 1BW9B 5G41A 1GL9B 1W2HA 1M2OB 2NPIA 3A9WA 1N8KA 3K2QA 4B6RA 2AIRA 4GYKA 2LKDA 3BXOA 2G6TA 1L4EA 1DC8A 3GDWA 4ITVA 5DSXA 4ZC8A 3UHJA 3F6SA 4UOQA 4WZAB 4H7HA 1XLTC 5LJLA 4TMTA 2WSMA 7MHTA 4HQKA 1BJKA 1X0XA 4MLCA 4OIMA 3RVBA 4A2PA 5IHXA 1NI5A 1B0ZA 3W4KA 3KJFA 1WUHS 2J08A 2ODBA 5CITA 1ZQ1A 4GPBA 4KN9S 3GLIE 3THXB 1A5BB 2G0TA 4KVAA 3TLKA 1JEDA 2WT8A 4C0AC 2FPWA 3R0XA 1EA7A 3N8HA 3TFWA 1DEHA 4WZ6A 2CKDA 2WJ4A 2WSBA 2EQ5A 2HMWA 2GFHA 4BCCA 3BF8A 2L0XA 3IELA 2PLNA 4BY9E 4LGCA 4ZMBA 3HADA 4AJ4A 3RSZA 1P6XA 4H2DA 3UN1A 1T8RA 1X74A 4DWOA 4PYRA 4WCDA 3WGKA 1RCTE 2LDBA 1B23P 1SVOA 1QFJA 2O2HA 5COAA 4Q4LA 1K89A 1P7PA 1JWLA 3LQKA 2CWWA 1XK7A 1C4XA 4ZAGA 1QIDA 2AJTA 3ICEA 1G21E 2WMNB 2YZKA 2ZG6A 4AZSA 2G06A 1YR8A 3QU4A 4KXYA 3KETA 1M2FA 2EBUA 3RFUA 1QXSA 1UH5A 1FQWA 1YB2A 3U4MA 5T6MA 1BMDA 1JB1A 1FVFA 1Z4JA 3OIGA 4K05A 5TT0A 1K4KA 3IESA 3WRVA 4HDRB 3MG9A 2Y27A 4KQKA 5F1PA 3HYSA 4S1PA 2IPNA 1QG0A 4OKNA 3DOOA 4WNAA 2NIPA 4BDSA 3MGKA 4AUMA 5HMLA 3DTVA 1JVSA 1NUUA 3K5HA 3ZU5A 1P44A 4D82A 1DWUA 1KFBB 2QJFA 4C5CA 2J5QA 4D26A 2ECPA 4BNGA 4BRWA 7MDHA 3KT0A 2XNCA 3O94A 4KWIA 4NU0A 3FOWA 2FMKA 1WY7A 2YWGA 3EMVA 2HFJA 5JARA 1E9BA 4ZEOA 3SK0A 1WU7A 1LC0A 3V1MA 3ENVA 2K6GA 1UOEA 1EYZA 1WQ4A 2KB0A 4R2LA 2CDRA 1Y6RA 2GCPA 1G6OA 1K5DA 4CTKA 3K6JA 4MKHA 4YI3A 4DDHA 2PRJA 2B20A 5TV2A 4CYMA 3S81A 2O3TA 5HXAA 1RWPA 1LF0A 1AA9A 3WNDA 4ZAXA 3A1EA 1NLYA 2C9CA 3OCJA 4K1XA 4FLEA 4LJSA 4W1RA 2QRZA 1IEQA 1WR8A 1GIAA 2JK0A 2YXBA 4PU0A 3WLRA 5JHHB 5L7TA 3M34A 3FUCA 1YBVA 2A59A 2WKRA 3FCXA 3D7MA 3KJHA 5ALRA 2QY9A 2OM6A 3BZWA 3EHDA 4RCZA 4Y6SA 2CE2X 1XZAA 4LVOA 4IEIA 4RLSA 2Y6UA 3IHLA 3EPKA 2MU1A 3M5WA 1GVHA 1RMTA 3M6FA 3HQ4O 5KVQA 1OX5A 3OD1A 4AUNA 4LJ6A 1YSCA 3ZNNA 1MW9X 1ZC4A 4FZ5A 2BVNA 3GUZA 3IODA 1L8OA 1LLDA 1RKUA 1PFUA 2PSHA 5HBGA 5ITZA 4IJQA 4Q37A 5TPZD 2XBLA 2QV7A 3RFTA 1L4GA 1XU4A 1VKOA 2AD5A 3FF4A 4MIOA 5ALTA 2P68A 3U3ZA 2R7LA 3UBTA 1GA1A 5KSZA 1NJ8A 2NNLD 3DWEX 1Z73A 4BNDB 1SC3A 4KITB 2J3LA 3IL2A 3G5TA 2EHJA 3I4FA 4DUGA 1QFZA 3GA5A 1TMOA 1FY2A 4L78A 5EVCA 4DDVA 2CDBA 1J06A 2RDMA 2AYYA 4IIUA 2ZE6A 2P4EA 1JKMA 4MKRA 4XJXA 1F6BA 3DAHA 3GCZA 4CV3A 4D9MA 4K86A 4BXOA 1JFTA 2PS0A 4CF3A 1YNSA 2FN9A 4Q21A 4IJMA 1R0ZA 3HR8A 2HLNA 4U7PB 2R00C 4Z1MA 4IGAA 1YZKA 2FCAA 3LPAA 1TEXA 4Q47A 2NU9B 3JYNA 1EUQA 4Q02A 4BEVA 4CRWB 1ZSYA 3MWFA 3PVZA 3STVA 4BKOA 5GIOE 3NNSA 5ALYA 2NUTA 2LV8A 4XPZA 3O21A 4TMVA 1UJ6A 1BA3A 3KQOA 1YZFA 3VNBA 2V4UA 1FP2A 2CW5A 3KJNA 2WZCA 3JD2A 4QASA 4UZFA 1CUIA 2R48A 2WVAA 1IJKA 1IJFA 1M0SA 1OASA 2J7KA 2YV5A 3IH5A 4QUEA 8OHMA 4A8HA 1DBRA 2HQRA 4MQUA 2XSZD 2XD4A 1ZHHA 2YNMC 2NZWA 3VX3A 3CLSD 1WUYA 1PWYE 2VHYA 4WZBA 4ZYYA 1E1CA 1FP7A 1ODKA 1YOVB 3FVVA 4AXBA 4DJTA 3K4QA 5KNDD 2HJGA 5A1TA 1A72A 2YOHA 2XQIA 4YRLA 3KNZA 3T4PA 1M3SA 1W0JD 3NALA 2H1VA 4FQ8A 1JB9A 3TAUA 1WTAA 3C5CA 3EAFA 5F77A 1I3CA 1T6ZA 5AHWA 3BMCB 1KVTA 2LNDA 4MW2A 3TPFA 4P9NA 3U9TA 3R3HA 1RT9A 2HLDA 1B41A 1TM2A 4R69A 4YA6A 4J91A 1U3FA 1ZNQO 4M1ZA 5B53A 5K0BA 4UPDA 4D0GA 5I4CA 1RWQA 1XMXA 5K8LA 5LOVB 3OQNA 4P0PB 1DIOB 4G56A 4XD7D 1VZ3A 5AXBA 1IBKB 4WCFA 1NE7A 2YHUA 4F3NA 2O2YA 2Q5FA 4GX1A 2GK6A 1Y5LA 2GPNA 1WOMA 1KJIA 5EJ9A 2ANCA 2FZKA 1QFSA 4AMYA 1F9AA 1VM6A 2FXVA 2GM4A 2C20A 1T91A 2WPDD 4TKVB 3GRCA 3T6KA 1NW3A 1K8QA 3KJQA 4X84A 3UUGA 1NATA 1RKXA 2Q5EA 1C9NA 1UJ5A 2Z1NA 1CB0A 3DOFA 2F3QA 5LYJB 2P41A 2DKNA 2H9YA 5BR8B 2JD1A 2PQ0A 1X8KA 3ONVA 4PC1A 1XQYA 2GM5A 5LP1A 5SZJA 1KAMA 1HEIA 4EYKA 1HF3A 2YQ4A 4M7PA 3E82A 4DNFA 1Q1QA 1FLVA 1X8LA 4I4TA 1ZD3A 3THYB 3MWDB 1QG6A 1TADA 4D9GA 3C98A 2SCUA 4TSRA 2Y99A 1D9XA 4KJZA 4JI6B 2QWXA 4TKLA 2WYHA 3JD3A 3KLBA 3R7WA 2HQ1A 1KEKA 3KEOA 3I2YX 1W581 3IA2A 3QE0A 1BX1A 1HE3A 4BB6A 5JSYA 1PQYA 5KMGB 3OM0A 4W7SA 5ALSA 3I09A 1GAEO 3E7WA 2OQRA 3OZRA 2D62A 3VPXA 1IQUA 4X1OA 1Z7WA 3AI2A 3GAFA 3ANLA 1Q50A 4UE6A 2H06A 5E1BA 1Y4SA 5EJ6A 5KVAA 1CUSA 3GR6A 4P08A 4DG8A 5FAKA 1A4UA 3RHFA 4I5GA 1UK6A 1OAAA 2FW7A 4DR1B 2P62A 5EJIA 2AN4A 1QO9A 4WE3A 1ADBA 2VNJA 4LG1A 1PTJA 2R68A 2Q5CA 3ZZTA 1U8EA 2JASA 5JQWA 4MW1A 4Q3OA 3X1XA 2VL7A 1ODLA 3G7UA 1K6MA 4ARZA 4NENA 4I1OA 4MGHA 5ALNA 1AHPA 5JECA 1QO0D 3EVEA 1G3UA 2OCLA 4U9HS 5E1DA 3USES 1D7AA 3SMVA 1I2CA 2BC9A 3DEJA 2VN8A 3JARA 3QBJA 1P5FA 1RXWA 2JFXA 3KWMA 3WDKA 1KEUA 1QGUB 1TQHA 3G88A 4MO2A 2DHQA 4QODA 3FYUC 3ZNQA 1MT0A 1PO7A 1IN1A 1FTNA 4Q6WA 5BN4B 3TEJA 4PGGA 2XUIA 2Z2ZA 1BQ3A 1ZOSA 2X9GA 4JOQA 3PENA 3FKJA 3GNSA 4ZHSA 2CZCA 1S1CA 5FL7A 3GZTB 3PHCA 1P62B 3B53X 3VOTA 3KB6A 4UNSA 2YIDA 2JAOA 1H5UA 3THOA 1OXSC 3AQIA 5ELMA 1H2WA 3RSCA 3CIFA 4LWPA 3UANA 3UAWA 4ERNA 4R0MA 5CVEA 2O8BB 3EPHA 4C0SA 5DM70 3ZIAD 3U4QB 4R2JA 5G53C 1YS2X 4O1IA 3BTSA 4GP6A 3F74A 1HQKA 4EM6A 3K0EA 4BRSA 4EB6A 5KVVA 1DS6A 3O31A 3V42A 4O4HA 1ORHA 4YYZA 1SG6A 3C74A 3I6IA 3L1UA 4Q3NA 3WYBA 2O23A 3HWWA 4KHZA 1X15A 3WNQA 4TN5A 1SM4A 2D2VA 5I9MA 1CY6A 4EB3A 2GBIA 1KBZA 2VZ0A 2FSVA 3LKBA 1Z4LA 5A3VA 1H5NA 2ORED 1TKBA 1TUBA 3MBOA 2WI8A 2ZSJA 5ESDA 3T12A 1G41A 2VDPB 3W2TA 4XPIB 4X63A 4CM7A 4YPVA 1GZUA 4P4NA 1YJAA 2B34A 2X8JB 3CONA 1EQUA 4K9LA 3RIMA 4ZMRA 1JEYA 2G77B 3EFBA 4HUQB 1C2YA 2XDYA 3C3BA 4RH1A 3DAOA 4K6MA 2NZ2A 4KAJA 3EBOA 3KL2A 4YAOA 2W6MA 3UATA 4Y2SA 1TRHA 2W2OA 3E1GA 3K1YA 3E22B 2PIAA 1Q1AA 2QL9A 1UKAA 3BSWA 3GX1A 4HDOB 5EWLB 5HYVA 5KDDA 1DJMA 2X3UA 1NVKA 3HH8A 3QX3A 1Z26A 3PNKA 3UJBA 4BVJA 9GPBA 2IBSA 4RHUA 3WWCA 3H6GA 2JKZA 1EIZA 3PSAA 1K2WA 1R6XA 3GH3A 2XCRB 2QUIA 3ETHA 1P6QA 1PVDA 2OLJA 4II7A 2ZXUA 3WK6A 4DV0B 2MSNA 2P2GA 2XH8A 3HKCB 3IJPA 3RBAA 2PH1A 3SC4A 1CUWA 1BH6A 2BZ0A 2DBYA 2O8FA 3HDHA 3WLKX 1PW7A 2O1SA 4AP9A 5J47A 3OJXA 3E9ZA 1PZNA 5AVJA 5JASA 4ILEA 1MA0A 5ECWA 3O93A 1AUPA 1VYUA 4HATA 5IUKC 1RFLA 2Y6VA 3VHXB 1TO1E 3B48A 2OHXA 3LF2A 2VPQA 4Y2PA 1KKLA 4K9KA 2COUA 4P3XA 4DTCA 2FFJA 4HDSA 5J5CA 3DBVO 1FK8A 3IEIA 5G40A 3EZFA 3NZEA 3L0ZA 3GRPA 5SZKB 2H17A 2PQ2A 4DJEC 2VXYA 1EVQA 1V5EA 2CLSA 2Z95A 3KRTA 1UXJA 3OOYA 4I5FA 4I8IA 3ZY3A 3R6DA 1Y6GA 5JS1A 4Y7DA 1QE0A 3NHSA 3PUWA 4A0GA 4N41A 2XMBA 4TRRA 1UMDA 1JKIA 1J8FA 5BWNA 2OAQ1 4FLFA 4PWYA 2HK8A 1E3IA 1DFGA 2OZVA 3OZDA 5L8VA 2PO5A 2JCSA 4CUKA 4EGCB 3OT4A 4PS0A 3FDZA 5GJWC 3T95A 2FPGB 2BL4A 4IH4A 3F7TA 3VNVA 8LDHA 3ER9A 1PS8A 5FHRA 1RI5A 2O8VA 5DGDA 4ZZ3A 4BLSA 4HLNA 1VI6A 1XRQA 3WMEA 4GX5A 2CBZA 5AR1A 2ZUCA 4JC0A 5FYDA 1RE0A 3WXBA 4G1FA 5AOAA 3TO5A 4DLTA 2ZIAA 2FPPA 4G0WA 4M60A 2Q6VA 13PKA 4C0HA 2CNNA 5LQUA 2VQEB 3JATA 3MSXA 3PC7A 3VU9A 2XUFA 1XALA 2AFHA 2ZAIA 3HVUA 2ZWAA 2PH3A 4LCEA 3UWMA 2AEJA 1NURA 1UKZA 1ZW1A 3QU5A 1E9EA 3GVPA 4GD3Q 4HB2A 4R2KA 5LDGA 3ROQA 3UMRA 2KS6A 1AMOA 3TPCA 3ROEA 1E1RD 4AZ0A 3PUVA 4FC6A 1KPHA 4DQXA 3K1AB 5A4DA 2IOQA 2QAGA 2E37A 2VQSA 1SCQA 2C2WA 4G1UC 4ERXA 3RHTA 2Y71A 2VXBA 4ZC1A 1PZHA 2G5GX 2C88A 3A6KA 4FSDA 2IDMA 3LZ6A 4H7EA 4TTAA 5CW1A 3R44A 1T4CA 2ZPAA 3G82C 5DXAA 1OWNA 3FFWA 1NQVA 3RU7A 2ZOSA 5I45A 1ZGJA 1FVXA 3QXGA 3FM9A 1T2NA 2NUAB 1PEAA 4KH0A 1PNTA 4OTZA 4MV0A 1XDDA 3H2BA 3CUVA 4BV3A 4Q3BA 1O6GA 3V1YA 2COKA 4U7WA 1NBAA 4YRAA 2OMEA 3E1SA 2QAIA 1T36B 5KYWA 1F20A 2GMWA 3K9GA 4HDCA 3HP4A 1CUJA 1Q0PA 3ZDRA 3KSDO 5BVHA 1X14A 4MVWA 4RAOA 2VQFB 3IVAA 1UAGA 4Y6PA 2E7ZA 3C7KA 4Y2YA 3QEAZ 1TM3E 4OLFA 1R2QA 1ZK1A 3ETEA 4YEDA 1L5HB 4N7BA 2V7VA 4FILA 5KS2A 3SIRA 1R1DA 2JVJA 2VXOA 1XFAA 1UL1X 3AM3A 3W05A 5I4BA 1QVRA 4DXDA 1IEXA 1EWKA 1ZUIA 1QB8A 1CJCA 4LE2A 2IOYA 3KFLA 2G8LA 2A57A 3M5DA 5LA6A 2CFCA 3MWLA 4PX5A 3CVUA 1ZCBA 4CMKA 2MHCA 4KFCA 3CRVA 1K6IA 2BEUB 3BFKA 4KX5A 4PYKA 1WCV1 3LVBA 3WYNA 1FEZA 2ZE5A 3AEQA 2JBHA 2M6RA 1LLCA 3PDUA 3VMFA 4QDKA 5B3LA 2A1UB 2EZ4A 1M6VA 1W85B 3AIIA 4LQDA 1JRLA 4U2DA 3R9XB 1KAOA 1P3DA 3O8DA 3OD5A 3KXPA 2JAUA 1DQZA 3CKMA 4PF1A 1Z4IA 3A3NA 3MOSA 1QR2A 1IBRA 4JB2A 3CW2A 4UEWA 2J3MA 2CLKB 1FNCA 4ZQGA 2IWRA 2N46A 3K94A 4KUEA 4PFSA 1YRAA 4EFKA 2Q2QA 2AZXA 4N82A 2CY0A 4M1SA 1L1RA 5FA5A 4A26A 2GBGA 3KKQA 1U9IC 4XX0B 4Y2JA 1LU9A 3SYKA 4P3NA 2VWHA 2Z9BA 2GBPA 4KJXA 3JQAB 1DCKA 2LUOA 1NA5A 4Z9BA 4QHTA 1L9XA 2XOKD 3O91A 1F8GA 4YMSA 2ZIFA 2FPIA 5I7VA 3H2GA 3CV3A 3L2OB 3M4JA 1GTMA 1JA9A 1I7PA 2N3ZA 1MO5A 1GSHA 4PRKA 4XGKA 1XTKA 4F84A 5IAGA 1S3FA 2EJWA 4BMYA 1NVMB 3I0MA 1SEVA 1IWBB 2QUZA 5GP1A 1HM5A 4BGDA 1HETA 3SF0A 5HKLA 5JTTA 3QTLA 1HR0B 1KDPA 4GZ3A 1ZRSA 2DECA 4WFIA 1LX6A 1ZP6A 2KJQA 2AOXA 4TXMA 3WNVA 2WM9B 3NGLA 2W0MA 5K3FB 1K8XB 3X1JA 2DTXA 4IF4A 3LXMA 3HJUA 5BSRA 4B4DA 3O4RA 5HKBA 3JQRA 3VC3A 2H11A 2WKQA 1M0TA 2EDAA 1NVWQ 1SKQA 4RZUA 1PL0A 4RHXA 1NXTA 4H7DA 4MS1B 2YHAA 3A2KA 3CNNA 4JMLA 4PTYA 4KBFA 1N4DA 2DU8A 2ZTSA 5A03A 1SWWA 1HURA 5JAUA 4JYCA 4B3GA 1YVDA 2E49A 2GN8A 3R8FA 3PNYA 2XWSA 2GPJA 1JEJA 4GXQA 5E8RA 1WW8A 1RPJA 3RRBA 4JUFA 2IA5A 4YJHB 1QGDA 2B2XA 3H0CA 4FYXA 1B0AA 2OP0A 5CCBA 1A2QA 1Q7GA 2WHYA 3V8QA 2WKWA 1N2ZA 1XZMA 2PSSA 1L4KA 2FW9A 3QPUA 4RELA 5DWDA 3VZCA 2A0XA 3DXFA 2RI0A 5CLFA 3L6UA 1SKMA 1CUUA 3ZWAA 3L7OA 2QE7D 4CTMA 5JCOA 1O9BA 2EW8A 3P4UA 3ZU6A 3QFTA 3DC7A 5ERYA 1FSZA 4E21A 2W6QA 3DZKA 2H1WA 4GR9A 3IVRA 3ODPA 5AW2A 1SUFA 4XZ3A 3ZE6A 3I04A 1OBFO 4NMMA 1KPGA 1NHGA 3RUEA 3WYGA 3GRZA 2ZAYA 1ZWKA 4BKPA 5BWLA 1DG1G 3I6MA 5K5EA 1NRJB 5EHXA 2W58A 3TZKA 5ALLA 3GLGE 2PRKA 2UXBB 1MKYA 3ZI0A 2B7BA 4GM1A 3RTEA 2NU7A 4JBNA 1A9QA 3S5JA 4ZOQI 4YP1A 1RXUA 4MQ6A 4DEXA 4U6NA 4Y2QA 1JBEA 1UC5B 2R7NA 2QAJA 4MARA 2FFHA 1OCEA 2PPVA 1GZDA 1KK2A 1ZL2A 3CZQA 3FZYA 4KGDA 3TOZA 2HPHA 3DE0X 3KDPA 3NUZA 1V48A 1P2DA 3NX4A 4ZVSA 1IXZA 1J23A 1GAXA 3RKRA 2QI9F 5HGXA 3DO5A 1RJFA 1JHPA 3QW2A 1BGWA 3JRWA 3ROFA 4UEQA 2IX9A 5ICMA 1EX6A 3EDRA 4RA6B 1UK8A 2FWRA 2PA3A 3D7KA 2OPHA 3UWOA 3WLJA 1R9NA 2VLIA 2YDYA 3K5IA 1GR0A 2AEMA 2NZVG 1MAHA 1K6JA 1C30A 1U2EA 1VJDA 3ETJA 5ALOA 4AO6A 3AHFA 4JU9A 4ZDKA 5FX2A 1ODJA 1S2NA 1E3DA 1U1FA 4DQKA 1Q7CA 2O8EA 3IFSA 1DAEA 4LV6A 2LDXA 3V4PB 3TRKA 4PWZA 1PJ4A 2YC4C 4F2HA 5TSDA 1A9TA 1PVOA 3GNQA 2ZIUB 4TWBA 3O3MB 4MYDA 3B6EA 3ND6A 4TTPA 3UAVA 3HB9A 3CPJB 1TZKA 4GOXA 5DTQA 3WR5A 2LVBA 2GZSA 4J03A 3KKOA 4ND4A 2IX3A 1F0NA 4W5HA 5IJ9A 1X9IA 4NDAA 4HRAA 2NT4A 3BBPA 4IIBA 5J2UB 6NULA 1E9CA 4MAMA 1F2UA 1QVWA 2BKXA 2WOOA 4KL8S 4MWCA 4R9VA 1Y8QA 2J6HA 1LFAA 1WY5A 1BS2A 1KEPA 1KSJA 2WIFA 2CV0A 1ONOA 2AN3A 3W6ZA 4Q4JB 1DLIA 3R5XA 2YN2A 5M3BA 2YWCA 2C95A 2ZLBA 2H1IA 1DUVG 2AQ8A 2FOLA 3QV1A 2ZCUA 1I24A 1WPGA 5EQFA 3FTEA 2XCLA 2QIOA 2JCBA 3V4RA 2HGZA 4XJSA 1NKTA 1EX1A 3K7EA 5FT9A 2HM7A 2XZTA 4R41A 3L7YA 4BUCA 1G3RA 1NIPA 2P3SA 1U7WA 4IMJB 4JKOA 4P3YA 4EVSA 2JKVA 3FIUA 2PKQO 3JZDA 4L5AA 5K0NA 1E64A 3RSSA 3MTQA 3F7NA 4LWOA 4NOLA 3FHTA 2D2FA 5HJ5A 2XVZA 5H5JA 3TLCA 5C53B 2HBZA 1DAHA 3AFGA 1A71A 3P9PA 4OKIA 1VSBA 3NM6B 4ZEVA 1IHUA 3HBFA 5E0OA 1JG3A 2PVPA 3F9IA 3ZQ6A 2DUUA 3LE8A 4RD2A 5F1OA 2R1TA 3FAZA 4C7VA 5T4EA 3IHTA 3LBNA 1UC4B 3QEOA 2DSTA 3PHJA 5JTUA 4M1MA 1CV2A 4DY6A 1P19A 1QHGA 2UZ1A 4HAXA 4LY0A 1BHJA 3Q7PA 4YAEA 5DW3A 1EVZA 1Z39A 3LCMA 3SEQA 4AJ2A 1Z4PX 2VZEA 2N1BA 4IOMA 2O19A 5EFZA 1DQPA 1YE5A 5TQ2A 2GCOA 1VIAA 2Q99A 1WMBA 3LL4A 3NYQA 1W49A 4B4WA 3LECA 1OWOA 4K6KA 4Y0NA 3Q5GA 4OHBA 2XUOA 3DE2X 2C03A 3IT2A 4M37A 1H0HA 2GD1O 2A0KA 1B16A 2J67A 3CO0S 3UK2A 3B51X 4NVRA 4D9NA 5A9SB 1UM9B 1K0FA 3LK6A 4PX2A 2EFHB 4QBIA 1AB6A 3FPSA 4TMXA 3Q10A 1Y7IA 5F73A 3T3IA 1UZNA 1FDRA 1DC4A 5ALKA 1CZLA 3ZG6A 3I8XA 4R2MA 2BI8A 2MINA 3DD5A 3ZY6A 5KWVA 1RLJA 3V4ZA 4RZIA 4FB5A 3ZLBA 4P0TA 2QLBA 3DL4A 3TYXA 3UGTA 3BULA 4TLAA 1E4YA 4UTPA 2JGKA 4LKOA 4FK8A 2RHLA 3PZRA 2H1RA 5D51S 1DRVA 1Q3KA 1ZCFA 3N6RA 4ZTUB 4ND8B 3DZIA 1UQTA 3O3OB 2J3JA 3EIUA 4HQRA 3VZRA 2JFBA 3IVMA 2AR0A 3Q7IA 2G72A 3MS4A 3A6JA 3OE4A 4YPOA 5A0VA 1PD0A 2PV7A 2QJWA 2QUHA 4JLNA 1G19A 1FYFA 4B3CA 1FNBA 4OUDB 4U7FA 3W9BA 4BP8A 4DT1A 2Q50A 1ZMOA 2WUGA 4FMBB 4YMIA 1U3CA 1VG9B 2B8EA 2QTRA 4J76A 5CIQA 1TEHA 3OPYA 5FQNA 4UNRA 3ECSA 1GJRA 1RYFA 3ITKA 1DIRA 3BXEA 3EVTA 1CUBA 4YBRA 2FEXA 3MRVA 3T5GA 1RPZA 1P7WA 2B0JA 2VP6A 4EELA 1B26A 3F4LA 4M98A 3DDOA 1UP7A 3MXOA 1V11B 5LDHA 2AEFA 1E2JA 2P9YA 2V54A 4UTRA 2HNAA 1S4MA 4F4HA 3VR2D 2PN1A 2ZYRA 4KQ9A 3OTIA 5ALUA 5AMXA 4CLXA 2OO5C 2VSXA 3DHYA 5AKXA 5B3JA 3ZD9A 1RIIA 1ZIOA 1W47A 2BMEA 3NFYA 1XEXB 3NB0A 1JIKA 2HSWA 3PNVA 4KLNA 1W6RA 2IQ5A 4Q16A 3I9LA 1WZIA 3GROA 4RVHA 5KNDA 3QVXA 5L3VA 4OLBA 2AFIE 1WETA 4REQB 3GEIA 4D80A 1P9NA 3K31A 1XEWY 4J4TA 3TD2A 3HY6A 3L7CA 3H97A 3H86A 3LZCA 3OPNA 3SIPA 1GRQA 5KYVA 5HQ3B 4RVSA 4FS3A 1TVKA 3GJ8A 4CEHB 3DXZA 2JFVA 1W5AA 5KVSA 3ZWVA 1MQSA 1RRKA 4G81A 1BFUA 1YVEI 4F96A 2C4NA 4EYQA 3FOEC 3NBZC 3QU7A 1RYMA 2W98A 1K2VN 2XE8A 1PJSA 1ZD8A 2W71A 2XXBA 2ZT5A 1GPUA 4KQ1A 1E1RA 4OBEA 4TQUS 3S29A 5I8PA 3NVKI 1AOXA 1EFPB 2FCRA 4JUBA 3HHEA 1SCJA 2X5NA 2XYQA 4YRTA 5T3YA 1ZL0A 4LGMA 2XQVA 1A82A 1E60A 1R0YA 3ROZA 2R8ZA 5BQ3A 1O95A 1NYRA 3AF3A 1ACJA 1PD1A 3TW8B 4DYHA 4OQEA 2F9MA 1TU3A 2WQZA 1UBHS 3E15A 2XNDD 2YZGA 3FWPA 3NHKA 4NBSA 2NO6A 2YXLA 3OZ7A 4FFBA 3L7IA 1DO8A 3HMQA 5FOVA 2UKDA 3RG2A 5B1HA 4P82A 1M5UA 4B3FX 4Z7JA 2UVPA 1X6VA 3LQ1A 3KOXA 2J4CA 3BXGA 4DCTA 4ZO6A 4MVYA 4BZZA 4TUYB 1JQ3A 3QU9A 1NUTA 1IN7A 1E1LA 4KXWA 4H1UA 3VC2A 2GRAA 4HWOA 4YJ3B 2QSJA 3C4VA 4LK2A 3INYA 4F1JA 3SQOA 3FLAA 3NBFA 3Q88A 4J0EA 2JH3A 2BW0A 3CS3A 3M4ZA 5LZ5A 5CP8A 1RXIA 1KMHA 1GPLA 3PPWA 5D3MA 3U0BA 5EMLA 4P35A 1UCFA 2QOEA 3PKZA 4CM6A 5ALZA 2XNHA 4QUKA 1FFEA 2BFFA 1DRWA 2FFAA 2YW2A 1V1RA 1VJRA 3HA2A 2JLRA 4XCVA 4E09A 5J4KA 1O87A 3DXXA 4PCUA 2BFOA 3LW8A 4FD2A 2FWMX 3MAJA 4QXQA 3RC8A 1ZU5A 5I9SA 4GOJA 2G4VA 3EOBI 2DE0X 3EVFA 3MJFA 1JFFA 3CLHA 3GDOA 4RF3A 3LUHA 3DV0B 4BNLA 1ECFA 5BSGA 2W00A 4UM5A 2XRYA 2D59A 4BQPA 5KSOA 4LE0A 3KQNA 1DZ3A 2PCJA 4UHBA 1OTYA 4ZVUA 1NZFA 1QANA 1E7SA 3CR3C 4U9IS 4P38A 1CEEA 2ODNA 1ZM2A 2EWWA 2N75A 3BCUA 4FUTA 4HSEA 2GXSA 2IYLD 2Q0SA 2JGEA 3R24A 4MW0A 3LUBA 1E66A 1FQJA 2LKCA 1ZD1A 2H7CA 2PBFA 2PS3A 5E9JA 1VPEA 1KEEA 2HRZA 2NSHA 2JGFA 2QJTA 4NE2A 2OHFA 4IZHA 1ZA2A 2GD6A 2V7UA 1VPDA 5BNTA 1MV8A 2XEDA 5BNWA 1URPA 4O29A 3RRNA 1JG2A 1Z34A 4G86A 1OXXK 2XT9A 2V74B 4BO9A 2VK8A 5KNDH 4ALLA 1HLDA 3UWSA 1V2GA 4V1CA 3SQNA 1MEEA 3L6EA 3O6VA 1GCGA 4I46A 1NVXQ 2QTVA 4QRDA 3NTVA 3BA6A 3FMOB 4BWFB 5LC1A 4EEZA 3GLIB 2VPPA 2PMKA 2QD2A 5FH9A 4ZYUA 5IUNC 1EXMA 1RSZA 4JITA 5L6LB 5J3JA 4P58A 1TVEA 1XA4A 1KS2A 3K16A 3T3MB 2E6UX 1E9AA 3P94A 4XGNA 1B3RA 3ASUA 2ZTLA 3EODA 2O59A 3K8YA 5JDCC 3PXUA 4QGHA 2CMGA 1WHSB 5FORA 1CTQA 2GF2A 4RW0A 2VAXA 4BCDA 3MCWA 3FTFA 1Q1GA 3RDPA 4QXMA 1JP7A 4O0MA 3K70B 1K06A 2BSXA 3L8YA 3CLUD 4J1TC 1ZK2A 3EQZA 3T41A 3JWJA 3GFRA 1XTJA 3ZC3A 1KR2A 3I37X 1XRPA 4DM3A 1UKVY 2VC2B 1BZYA 1G21B 2O20A 2P3OA 3JAMA 4JLSA 3NBUA 1YI0A 4NYMR 4R05A 4H0FA 3TBHA 2VUSA 2G9UA 1PFYA 3D1LA 4WVFA 4D8UA 5HKAA 4TZ0A 3P0EA 2GEFA 3OEYA 3SIXA 1C0EA 1M10A 1U4SA 1Y9AA 3O4HA 3A6GA 4FP9A 4MB6A 2FLKA 5DN6D 1NVBA 3TDNA 1JQBA 1SOAA 2AUMA 2QTVB 3MLAA 3GQBB 4RGVA 2P2DA 4KAFA 4BX0A 3JRXA 4H4DA 4I1RA 3CZRA 4LVNA 3L8CA 3CUYA 3Q5DA 2G28A 2A5GA 3AJ8A 4JOCA 4ETMA 5HM6A 2ZRIA 1U6KA 2H4YA 3E3OA 4J3FA 4C4PA 1R6AA 3RC2A 5C51B 1XDGA 3JAWB 4LHYA 3TQIA 3K0FB 5C5CA 2RK4A 5EWMB 1SVIA 2G1UA 3KQLA 2W48A 2X3YA 3HA5A 4PM4A 3KT8A 2PZAA 2BGKA 2QE7A 3EIEA 3O5AA 4S35A 3RH0A 2MSWA 4O08A 2CJWA 4BU1A 2JDIA 2EW1A 1QQ6A 3D3KA 4LOJA 3E6AA 5AT1A 2BMVA 3NWJA 3NBMA 3EGDB 4GBJA 3TM4A 3VR4A 1U8XX 1ULTA 1RW4A 5T4HA 2J7PA 2ZATA 4I0WB 3WWDA 4CTOA 3BMNB 3D7SA 3JWIA 5AOVA 2BELA 3D8SA 3M2TA 4XCQA 3RE1A 3RTCA 4ZMSA 2FQ1A 3LIIA 2YUTA 3EQ6A 1GLVA 2FDXA 2JFZA 3DAFA 3PEFA 3NG1A 1N6LA 2OTCA 4KIWA 4X1KA 4E15A 1IDOA 2FHSA 3QEMA 2PL5A 4RH0A 3QOFA 3PD7A 2VSFA 3H65A 3UW3A 4X1YB 3VR6A 1NLZA 3G23A 4S24A 1WSAA 2K5UA 4ESHA 2GZ1A 2DWOA 1HQDA 5L3RA 1TUGA 1C7QA 1QK4A 1ZAKA 1JPVA 2OFFA 3ZTYA 3DMDA 1NBME 1PV2A 4QOIA 1WNFA 1FU8A 1H4VB 3H17A 3HABA 3HRKA 1SOMA 3NWBA 3PEEA 4BRUA 5FYQA 5CFZA 1GO2A 5MFPA 1OAOA 1Z6QA 2MT9A 3ZH2A 2GM9A 1AKEA 1R9GA 4G25A 3SXJA 4QT4A 5KB3A 1XVAA 5CAEA 2AOTA 4M49A 1MW8X 2E1PA 3SQLA 4WIAA 2GDZA 1CZKA 1ZRMA 2VQ6A 1P1HA 3ET4A 3QELB 5IYZB 5K0TA 4ZI7F 2EKLA 1CJSA 2CVOA 3R74A 1RZRD 1P0CA 2GARA 3GIWA 2Y93A 2YZ2A 2XE6A 3CVJA 3MUNA 3P2EA 7AT1A 1GGJA 1ORRA 3GT0A 1H23A 1RMYA 5HP4A 4IVQA 3WMFA 2X0DA 4L4XA 2H2HA 1K7SN 8ADHA 4ZI2A 3UWPA 2ENWA 4AUEA 1DBIA 4UDOA 3GMDA 3VZBA 2YBEA 4MTLA 4R31A 1KJWA 2Z58A 3IT0A 3ED1A 3NJ8A 3PF8A 2IYVA 1AQYA 2BJHA 1M6HA 2WAAA 1TE2A 2J30A 3DKVA 3Q5EA 4MS4B 4L8FA 1CC1S 1MFPA 2QRJA 4RDCA 4A6EA 5KCZA 5HCUA 4DADA 1E3QA 5LLDA 2R0QC 3AVWA 4ZZ2A 3E9YA 2WFMA 3FPKA 1LNQA 2GJ4A 3CUTA 3UO8B 1MJ5A 4ZOEA 2XY4A 1UPAA 4FYMA 3B5IA 3ZBUA 2O3SA 1GRNA 3IULA 4P7FA 4Q3AA 4E14A 3DE1X 2QYSA 2AR9A 3CX3A 2WNIA 1UMBB 4OHRA 1N5LA 2QN6A 1KZYC 2NACA 3FHJA 3BIJA 3UH1A 3VU1A 1JEOA 2A35A 3GZNB 3JQEA 3KU1A 1V16B 5BSMA 4RTJA 4KXXA 1T1EA 3N9IA 3ZWBA 4I81A 2Y66A 1JQKA 1HYBA 4FYYA 1R5OA 2FEWB 3A6DA 4RA9B 5H70A 2IH4A 1NV9A 2VBFA 2ZUWA 1P3Y1 1B6RA 4NFHA 4QQRA 3A3PA 3VBEA 2GS9A 3G8BA 4FHCA 3Q8WA 2G0AA 3OM1A 4IHJF 5ESRA 5CH3A 2A6PA 3PR1A 5L3QB 2GBLA 2CLOB 1XZDA 2I99A 1CUAA 2WKSA 2ZYTX 1P8AA 3BK1A 1I10A 3ET5A 3P2KA 5IBCA 4EG3A 1U8FO 3W4JA 5H9VA 4IDFA 4J4BA 2EEZA 2E21A 2FMHA 3BTOA 3IUMA 2BMWA 1NDQA 3JQCA 3K0CC 1HC7A 2PA0A 3OWOA 3OZAA 1X2BA 4OXIA 3TJMA 3ZWQA 1F3OA 4EP1A 3P32A 4HNVA 3F1LA 3UKJA 5FTJA 3UUFA 2BGUA 3R4VA 1P1IA 3KZVA 4JB3A 1JDNA 1OLXA 1XA0A 2MJLA 2P6UA 4B47A 1Z4OA 3DCYA 2WZBA 3PRJA 4N18A 1R12A 2B2NA 2EKQA 4IS2A 4CFZA 4DM4A 3QUBA 1T9GS 4OH7A 3RREA 5L7WA 4XIJA 2DHRA 3M1YA 3NR2A 2BKEA 3DM5A 4ZI7B 2FSHA 1DUSA 3VI3B 1C0PA 4CIYA 3SJUA 1RLIA 2JBAA 3F96A 4PLTA 5JWHA 3EASA 1GXSB 4IIFA 4FDVA 3HN7A 5BOSB 821PA 4ZGWA 3ZQJA 1EG2A 2HSJA 2XMDA 3LWDA 4IIEA 2QRVA 1EMDA 3O83A 1X3LA 4C89A 2Y1OA 3BWYA 3ODGA 3ZV3A 4JI8B 2NV6A 3RM3A 2ZIGA 4DDWA 1OFUA 3A3KA 5G02A 1JHXA 2GKGA 5K51A 4FDUA 2GM3A 3IPLA 3W5SA 4NECA 4HNTA 4YUZA 1UP4A 1QX4A 3N5CA 1EG7A 3KFXA 3JVDA 3NEJA 4UHEA 4C4AA 5CDUA 3DFUA 3Q8MA 1YA6A 1J2RA 5BO5A 3PQ2A 3KQMA 4DIUA 5JWRA 3H11B 4YECA 4HAOA 3L02A 2BFDB 2X4IA 3OZSA 1K8RA 2BJVA 3D6HA 1LZLA 4KE7A 3ZGVA 4YBZA 2B83A 4LE1A 4LRYA 1CE8B 3ZQUA 5FB3A 2VTBB 1II8B 5C7IO 3KJEA 2JZCA 1V9SA 2P5SA 5B36A 4PHGA 4YRJA 2O3UA 1BEUB 3PQ4A 3C3PA 5EOVA 3W06A 2HDWA 3CUWA 4A15A 5IWCA 5JANA 1RM5A 4NZYA 4QQ8A 5BQXA 3WLEA 1ZJZA 3TIFA 1IJBA 1HYEA 4EKEA 3WQBA 1II9A 4JA2A 3AR4A 4PBTA 2HB6A 4OBXA 3V1KA 3ZK9A 1EINA 2C3OA 2QD1A 2YJZA 1OV6A 4L4SA 1AZLA 3D6AA 4LC1A 1RAGA 5JSQA 3HCPA 1SOVA 1VYVA 4UNQA 5LXTB 1W19A 2GUGA 4IRXA 4P1ZA 3V6LA 1O94D 2XKAA 4IBOA 4OK3A 1COWA 2ZBFA 3DXYA 2W2MA 3QNUA 4R2WA 4YJDA 2D1RA 1JJBA 4R1PA 4BTVA 4ZDWA 3DBLB 1ARZA 1U3DA 4UHCA 3HWX1 3QX9A 5H4HA 2F55A 1N6RA 5FA8A 3SZLA 3V4VB 2DVMA 4OYLA 5DK4A 1APBA 2OCDA 3TLJA 4YAIA 2JC3A 3S7ZA 3OM9A 4QPDA 3LH5A 4NAUA 4XSVA 1N2XA 1ZINA 2VZLA 4ZVKA 4G1CA 4JODA 4IZOA 1K8YB 1SB8A 1VHDA 4MVJA 3TQSA 3GJ6A 3L9XA 4J0JA 5JIBA 1FDTA 1CXZA 3HE3A 3M7IA 3C1AA 4QULA 4YRIA 4UHKA 1QVZA 3EJWA 1TTQB 1CS4C 1Y4ZA 3R5KA 1I2BA 3P5SA 4XYBA 1D6JA 1TK2A 3EC2A 2OPBA 2WTAA 4CKBA 1TAGA 2V9PA 3I9FA 4PLGA 2PAAA 1QQ5A 3QMWA 1RNLA 2GEVA 3ZJVA 4TTJA 5TE9A 4DSOA 1MZVA 1TC2A 4DV7B 2IP4A 4MPJA 4NSNA 3C1UA 4AZ3B 4D4IA 4RGQA 2FFBA 1YJ8A 2X14A 2NPOA 4A9AA 4YP7A 5KTYA 2J3HA 1PJZA 5DYWA 3KKMA 5ICFA 3OQVA 5HFNA 5F2OA 1PKXA 1ZNZA 1LBEA 2YXNA 4TM8A 3GDGA 1T3GA 2XNDA 5DOZA 5J9FA 4M6WB 3W6UA 3NANA 1UBTS 4FMCB 1MGPA 1KQOA 3HBLA 4HPJB 5E3HA 1GTSA 4XOUA 1R6UA 1P4SA 4ILKA 3UJ7A 3DYVA 2W11A 4CQMD 2D5AA 3SQXA 4MYHA 1KZGB 4H7FA 2YWEA 1CYEA 2JHAA 1WPXA 4IDDA 4EPRA 2HBYA 1JQJC 4R01A 4TTRA 1KU6A 1WXIA 1O77A 2EF1A 2HA0A 3TI7A 4OP3A 2FZGA 3LFTA 4ACAA 4F85A 3TTTA 3TTXA 2JD0A 5IS2A 4WQMA 4Q4HA 4RK4A 3BMQA 1IDN1 1T4BA 2W6JA 2OORC 2L69A 1HQYE 5BYAA 1SXJC 3MM4A 1A5AB 4WBSA 2F9LA 2LBPA 3M6LA 3W7VA 2Q9CA 4BC1A 4FOOA 2I2BA 5KJCA 3KELA 2FDCA 4I9GA 2BZSA 5JU6A 1O0SA 1GAQA 5DBGA 4AYXA 1JLMA 5IAEA 1JHDA 2CVZA 1N4AA 3A0RB 4D9EA 5JDIA 4US0R 2A0UA 4RKRA 5JRDS 1T9ZA 2BZ1A 1QF9A 2QGNA 1W4BA 3QLVC 1WL8A 4K5QA 4Q7KA 5CB8A 2BY4A 4E33A 1GKUB 5TMBA 1BH2A 1WMDA 3I2GA 1NJFA 1P1JA 1DX9A 1MAVA 3FGNA 5LYYA 4HLDA 5H80A 5J59A 5J4VA 2PGXA 1IHYA 4M4SA 3CR7A 5ER9A 1O4WA 4C6TB 3ASVA 3C43A 4EZBA 3NC4A 5E9QA 4YJGB 4L2IB 3GB9A 4RY0A 5C1IA 5A3QA 3IEMA 1LH0A 2B78A 5KYKA 5LJIA 1A9XA 5TEVA 3T5DA 2VEOA 2R8XA 3KVVA 4CM8A 1FP4A 3QWHA 2E85A 3H83A 1XCOA 5AW6A 1SBCA 3PUIA 4KQIA 4KE6A 3OAAD 1VXRA 1FQOA 2CXSA 2OE2A 3KSMA 2AQIA 3R3WA 3QPVA 1Q0RA 2P0EA 1E2FA 2ZTHA 3D3QA 1EBBA 1L5KA 5I5EA 2QP9X 2PXAA 4S04A 3CF2A 1Z45A 4Z5XA 5EKDA 4M99A 2E9SA 4NL4H 4WNAB 2G5PA 1BN7A 4LZJA 4HXYA 1OAKA 3FRHA 2QKYA 4CF6A 1EK2A 4Z99A 1KEWA 2CLIB 3Q40A 1MBZA 2V7QA 3HB4X 4K03A 3WSTA 5AKIA 1D6MA 4D0SA 5WRFA 3UJHA 5JISA 4LJLA 5E1MA 3RV4A 4BNIA 1Y9EA 2ZYSA 3A25A 2SKDA 3K1ZA 2WILA 2VNHA 3NNDA 4TTVA 1E9SA 2NYAA 2Q41A 3TXAA 3MWEA 2G0NA 2P75A 2L42A 3SDZA 4MWZA 4ZICA 2O2CA 4ZYXA 2IYEA 1GARA 1YRLA 1P0IA 1TCCA 2CEKA 5BT9A 3WRYC 2BMFA 1OT3A 1I0LA 1L4YA 2POQX 2I3GA 5DH9A 4C07A 2O8DB 3PTLA 3TUZC 1MO4A 1MPXA 3ZGNA 5I8ZA 3Q4GA 2RH5A 1G5HA 2JLXA 1XTSA 4BE4A 5M34A 3KEMA 2C4MA 4HFMA 1TCAA 1Z0FA 4S05A 3AMVA 5CURA 2GFQA 1KEVA 2ZI5A 2BHTA 2H92A 4LMPA 1DP4A 2GWHA 5SV2A 3BRCA 4KR2A 4RDHA 4ZU6X 3ZBPA 1M34E 1Y48E 2BM0A 3JCZA 121PA 4HB0A 4ND3A 5JG7A 2D5CA 4OQMA 4B34A 1QJ4A 2QR3A 4HVTA 4LHXA 4M21A 4WOJA 4BLRA 4JK3A 2QMZA 2C3MA 3F6CA 3BD7A 3PP8A 2FWBA 5KOHA 4Z3OA 1JKFA 3D6MA 2FSSA 3AIOA 2KQUA 5EWJB 3P52A 4AKSA 2KX7A 4PTZA 2H1SA 2PV0A 5G0TA 3V80A 3SC6A 3SOZA 3O8RA 1BNCA 4BPBA 5T8KC 2H2DA 1XHEA 4OGKA 4BN5A 3TMYA 4DIKA 5B55A 4NK4A 2W83A 3O74A 3SXUA 2OWEA 3TXXA 3OQMA 2W6ZA 3I5UA 3SN6A 1QTNA 2O7RA 4D3ZA 2EV9A 2AJDA 4Y2VA 4NMXB 4U1RA 1EP2B 3OE7A 4FCTA 5DLPA 2WJZB 3QXSA 3W9SA 3PIIA 4HT3B 4D56A 3FCCA 2AQHA 1YFLA 5CT8A 2I4TA 4F97A 2RHMA 3UAOA 1OVMA 2AKYA 4PLHA 3WZ2A 3QG5A 1H0SA 4JXKA 3GP5A 3DL2A 1TUEA 2YV3A 3DLHA 2UXDB 4JT2A 4L9WA 4RFVA 3KT6A 4BE7B 4M2LA 3BC1A 5KYGA 1U28C 2J48A 2OXCA 1R6TA 2QQEA 3RRMA 1W52X 3I6YA 2CT8A 4XW2A 1N3IA 2XQJA 1YB7A 4BL5A 5BN3A 5KNBA 4YIKA 5ISMA 3D1JA 1RC8A 3ZXIA 3KQVA 4W5NA 1ID8A 2NUTB 5K2MA 2RGWA 2A9JA 4MRVA 4HAVA 4P5PA 3U60B 2ZS9A 3G5AA 2FN3A 3OUZA 4GP7A 4WK0B 4F0JA 3IILA 4L9AA 2P8SA 1JEEA 4UUPA 4NH4A 1KH2A 4CLEA 2GPAA 5I9LA 1MABA 4XJVA 2GVNA 2VJMA 4LX8A 5DRTA 4H0NA 1XNQB 4KUHA 1HL7A 1X3SA 4JZKA 5CPBA 2BH2A 3WGTA 4OU4A 2CSXA 5EJMA 1ZH8A 4LHVA 3QPCA 4EAQA 1JGTA 5BUQA 5CD1A 4UAUA 3ENZA 3LDAA 3O84A 5GJBA 2D2IA 1UR5A 3D0KA 3SXPA 4DVGA 2JI8A 2VOJA 4HGZA 3ESDA 4TRMA 1CK4A 4FKBA 2CWDA 3S0JA 2VNKA 3KUXA 2O0KA 3WA7A 3PC6A 4RIHA 1TYDE 3TEMA 5AVXA 1TW2A 3I9KA 1HNNA 4P3KA 3T3PB 1ETHA 3L18A 1XZLA 3MYRA 3PHBE 4ZRMA 1NF9A 1DGQA 4DBZA 1LDMA 1GYQA 1WCYA 3HZOA 2ZSKA 1SURA 4F1KA 1EFLA 3PB3A 1I9CA 4MV1A 3KQTA 4C08A 3EEYA 5B3KA 4Z7NB 621PA 2JJ2D 4O4IF 2FW8A 1T1GA 2J32A 2RKWA 2F8LA 5KTTA 3HSYA 2WIDA 4BWVA 3AP3A 1NWHA 4HWTA 1I7SB 2F62A 4KXNA 4YAJA 1KI6A 3RU9A 1YQEA 1E2BA 4URXR 2I7CA 3LLMA 1N92A 4BNNA 5K45A 5B6PA 1V2HE 4W9RA 2IS6A 2HCRA 2WJVA 2IOFA 2D74A 5EEHA 2IXAA 4FZ3A 4CQLA 3E2PA 5FWNA 3U7EB 4I4TB 4YT5A 3EQ2A 4XVCA 1R8YA 4G1BA 1IU9A 1IUNA 1RACA 2D5BA 2OL4A 2SCUB 3T99A 4DL9A 3V2GA 3WAJA 4NJEB 2IEGA 3EDQA 3E5NA 5ECGC 2FR0A 4I50A 4YI5A 2ZREA 2OXEA 3OJWA 1FIUA 1DJNA 2HQSA 4ARVA 3ZLVA 4RXUA 4KNVA 1AUXA 1QH9A 4KSBA 4ZDJA 3B1ZA 1KBQA 4DMUB 1E9FA 2HV8A 1DI0A 3NXKA 3Q12A 1NJSA 1E2IA 1RKBA 2PLFA 4C7JA 2QP3A 1ZXXA 2FPSA 4FOSA 4B7AA 3NOVA 1KZ7B 3FSEA 4M7WA 2ID4A 3C3AA 3AFOA 2BI4A 3QMPA 1EK5A 3PUXA 4M36A 4E51A 3UT5A 4UCQA 2AVNA 4K2AA 4LVCA 5HJ2A 1RLUA 1B8NA 2FPLA 3VOSA 5FLXA 4YT8A 4JI0B 2NYRA 4R1OA 4HNUA 4TMFA 3PWZA 4CMEC 1ZVKA 3HYTA 1TT5A 1P1BA 1RM4A 2CNDA 2ZSAA 3INNA 4X44A 2HDHA 4F8EA 2B98A 5TJHA 3B6ZA 3AJ9A 1ACLA 1C4WA 3EC7A 4OO3A 4XAQA 5IP5A 2DFKB 2OHGA 3BFVA 4BGEA 1HWYA 4BEBA 2XV1A 4PGAA 2IV2X 1GZ7A 1B6GA 1G8YA 1TO2E 4QQNA 4V24A 5HIMA 2FAXA 1KVSA 1ANKA 2I76A 3EG9A 3IO3A 4FEAA 5FLEX 3OX3A 5CD9A 1LEHA 1R4MA 5IMBA 4UOZA 2P77A 4GZ6A 4LZNA 3QHAA 4TL6A 2IZ0A 5EIHA 4FT2A 3HUUA 2ZSIA 1P73A 4C2TA 3P9XA 4RZQA 4YV2A 4XUCA 1SXGA 3EOZA 1DRUA 1GTG1 4NEGA 1H85A 5JWOA 2QVXX 4AJ9A 3RKSA 1U9JA 2RB5A 1TYEB 5SZIA 1RYYA 3CKYA 3C7AA 4O4IB 2PX0A 1ESMA 1QMPA 2PKCA 2VATA 3C3DA 3Q2IA 2BWJA 4N5NA 1R7RA 5E7JA 5AP9A 3GVCA 3BG5A 5IJAA 2FE1A 2G1AA 2ROQA 4O4HB 1Z36A 2W2VA 3BGWA 2HBRA 2WU8A 2QN3A 4O1HA 3U62A 4EHNA 4FEYA 2JEYA 3HDQA 4KWCA 4YRKA 2XYHA 1LQ2A 4JJ6A 2XWQA 3ML1A 4XFKA 5BQPA 1VRWA 3OT1A 4OHYA 3AL3A 1TUBB 3HBMA 1WZNA 3KV3O 5F2EA 3HDGA 4GI2A 3UOAB 2Q5OA 2LIPA 1JIXA 4RDXA 3W5CA 2ZIXA 4DIDA 4FI3C 1JEYB 1EFHA 2IEDA 2HSEA 3PKJA 3LVFO 4JWTA 1IWOA 1JEQA 1L8LA 1QRDA 2ZBDA 3GEHA 1IQ0A 3BIFA 1UFOA 4IUDS 4JBIA 4R8SA 5KQRA 2FPKA 2WJ3A 3CZCA 4BAUA 3KZNA 4ENPA 4UEKA 2GESA 4V0KA 4WLFA 2PVSA 3CCBA 4X00A 3BBLA 3L3BA 2IYSA 3UQZA 3EXG2 1KGDA 2EARA 4NOJA 1LDNA 2QA5A 1YRWA 5SICE 2Q5IA 4LZAA 1VB5A 2PTHA 3ESZA 5GOTA 2YNMD 3AKEA 4Y2HA 4MDFA 3KYCA 3ZU3A 2RHBA 1G6KA 1YZYA 4HEHA 4N0PA 4CF5A 4D7AA 3CRNA 2RFLA 4JNCA 3N8KA 4AZWA 2Q49A 3NXSA 1YE3A 4JJ4A 1Z5VA 1DRJA 2HOQA 3PXBA 4GICA 1ENYA 3IAFA 3W8RA 1U2GC 4KTTE 4MR9A 3WGQA 3LAWA 2XUZA 4W1QA 1Z56C 3HYLA 5AQ1A 1EFVA 1MU0A 3RJMA 2I3AA 4TS9A 2AJ8A 2WTBA 2VWQA 5B1SA 4AXXA 4DRXB 1EUYA 5ADUS 4LXQA 4QXOA 2QZZA 2VJYA 4U6SA 3EUAA 5CLIA 1MNAA 3ZDQA 3UXHA 3VC7A 2ZI3A 3SDSA 4IIJF 5T4BA 2P7IA 4BZXA 5BPFA 5T67A 3B9BA 1NQ5A 3NYWA 4BNMA 2O7VA 3EXFB 1WCWA 2XMPA 1NM5A 2JBWA 4K9NA 5FUYA 4MOWA 2N1MA 2DJ5A 3IIEA 4ZT4A 5LQRA 1VCHA 4R8LA 4ZU3A 1RQLA 1X1AA 3VYUB 4ER5A 3A1CA 2PRYA 1Z4QA 2EX0A 4V0OA 1UMDB 1KJQA 4GSKA 2I33A 2GRJA 2I62A 3NH6A 2ZE7A 3DZBA 3I01A 2QW1A 4B5KA 3ZUGA 1ORWA 3A14A 3EMDA 1C29B 3HCWA 3K2IA 4MW7A 4N39A 4WHMA 3WE7A 4ALNA 2R8EA 3C3MA 1WNTA 2EFYA 3AZQA 4HDKA 4Q9AA 4OCZA 2OENG 4L4ZA 3K6SB 4LJAA 4IPTA 5JVDA 3N0VA 1NG9A 3BIOA 5HK9A 3RVQA 1EUDB 2HDOA 1T0IA 2X41A 1LY1A 4JYMA 3ZEAA 4UUBA 2WE8A 2OILA 2TECE 5L3ZA 3ZKWA 3EDYA 3HKEA 5KYYA 1T0HB 2C98A 1Z47A 2FPPB 2PMDA 4TWRA 3DEHA 4N76A 2W6OA 1L7DA 2IYZA 3JATB 1RI1A 1SVKA 4UBNA 5F76A 3VU9B 2HK9A 1JT2A 2GJ8A 1YU6A 3LT4A 2WAYA 3OZVA 4OX9B 1P4GA 4JYAB 3CZAA 4IDHA 2ZKIA 2PGNA 5T57A 3VO1A 1ADCA 1AKTA 1MG0A 1L5YA 3BWXA 2FRDA 3D2CA 3UTCA 3AC0A 2PMBA 1VMDA 2W2QA 4NCBA 1N7GA 2VTVA 3L01A 3MVEA 2WWYA 5ITVA 3JX9A 2QZ4A 1MC4A 2ATCA 4ND6A 2O2GA 1E6LA 3V2HA 4DAEA 2CJFA 2P69A 4PZDA 4TL7A 1LCIA 4GO1A 3RFFA 1F60A 2FFQA 3I6BA 3QYFA 5CG2A 3UHOA 1XMOB 3LTEA 1NXSA 4X20A 1RYNA 5LR6A 2HADA 3TR5A 4F60A 1DU4A 3CEJA 3KR9A 1YCHA 1U1EA 1J9EA 2AFIB 3PUZA 4FHFA 4OQFA 2V8BA 4H7PA 2EGHA 3DD1A 5KX5A 1TGYA 3Q6IA 3OAAA 3W79A 5CTJA 1DFHA 4A0HA 2A33A 3VUEA 4MGZR 5DBEX 5CMLA 5A5FA 2E1RA 1XLWA 2ADFA 4QBFA 3R9WA 1CQWA 1L4BA 4IIJB 3O1IC 1A8SA 2ZM5A 4K9PA 4BUJA 4ZV4A 4U2CA 4XIFA 3L92A 3EGXB 5BVHB 4BFUA 2JEOA 4A6PA 2LR0A 1XD8A 1I6KA 4MROA 1AVTA 4Q1EA 3X1KA 2JVKA 3P8ZA 4MYRA 2H2FA 2KHZA 2O57A 4RL6A 1MNQA 1Y81A 3PNLA 4FQ5A 4IQGA 3ZW7A 4DCCA 5FBVB 4HR7A 3U9SA 4F92B 1ILEA 3KR0A 3PNMA 2QZSA 2PE5A 1JTEA 3ID6C 1ODTC 2A9QA 4ALKA 3L1VA 1V8FA 4L50A 1PDOA 2NXEA 2Z5LA 1S7CA 3DYBA 4S1NA 2ZJ3A 5LA6B 4D9BA 1NW9B 2HKIA 2QEQA 1MZPA 1C1YA 4B3HA 1FFYA 1N0HA 2Q9UA 3S1SA 2HTFA 2I8LA 2XA1A 4IV8A 3QBVA 5K0JA 3A6EA 3DC2A 2CK3D 3AEQB 3G9XA 2A30A 3D43A 4NKRA 1M1UA 3CZMA 4IXWA 1GYRA 2DC1A 4QAJA 3C6ZA 1TJ4A 5KYUA 4YUVA 2NSYA 1BDMA 1OHHA 3JPWA 4ND1A 3R0VA 2JIDA 4H31A 5AJUA 5AM5A 4M38A 5TVGA 4NBNA 1BXZA 1QJCA 3HLKA 1GZHB 4AS2A 5JJLA 5EE1A 1DQSA 3J7TA 1T10A 2W37A 4UNNA 2EIHA 2VCHA 1E8DA 1YAJA 2WYWA 2VPXA 1Q22A 4KKVA 3UQYS 3T5CA 1KDYA 4A7PA 1WVIA 4B2IA 1JHQA 3LC7O 4WCFC 1PKEA 2BT4A 3GK3A 1EE1A 2UYQA 1L1QA 5EUBA 2WAOA 3BA1A 4PIVA 3OX1A 3FN4A 1TF5A 2AG8A 3DO8A 4YRBA 1V8ZA 1X7YB 3NV7A 3IDSA 4IINA 3P9YA 1QHEA 2AA3A 2MTBA 3K6KA 4E6EA 4RH3A 1ZONA 3G68A 3H5NA 2XYGA 3JALA 2AG1A 2Q2OA 3CY6A 4M0PA 3L46A 4H15A 3FBGA 2QYHA 2FETA 4JQOA 5IBQA 3U26A 3VGPA 5T4FA 2ZB2A 4GE3A 1G98A 3RVNA 2Z5VA 3CIOA 1TQ6A 4ZODA 1HRKA 3OQOA 1I7DA 4R9RA 3LUPA 4GOLD 4IDBA 3M33A 2DBZA 1DINA 1L7BA 3X1WA 4EMUA 3NHYA 4DUPA 2GO1A 3FDIA 3K05A 3PQ7A 1II0A 3I23A 4GNRA 5FWAA 3WIBA 5J5AA 1U3GA 1Y1KE 2EP5A 2E4XA 5TY0A 1KAHA 4LJRA 5EIBC 1RWWA 2D06A 4PIPA 3MA0A 1UIMA 2HJWA 4QKQA 3PX7A 4FKZA 4QC2A 2GA8A 7REQA 4X91A 4ABYA 5E8JA 3U13A 3VPHA 2SICE 1XZPA 5JAMA 3TKLA 5B7NA 4QARA 1PTJC 3HGMA 1NQWA 2HA5A 1N1MA 1WQ1R 1IH8A 1W25A 1LK0A 1P3JA 1MB4A 3A32A 3LZDA 4N9WA 4KQ2A 3HM9A 4PLYA 4M8IA 3PRYA 5KSPA 4IX9A 2D7JA 6CHYA 1M7BA 1D2GA 1US8B 4JLMA 4QUDA 4XXHA 3ZHYA 4AURA 5LNK6 1XFDA 2G07A 4QRHA 3ZVLA 1E1QD 4QTXA 5A5GA 2CXPA 4PO8A 1Q6ZA 1ZI8A 3KVOA 3F5MA 1A2OA 1GN8A 1QKKA 1XG5A 2DBRA 2NW6A 1NY6A 2WZDA 3TOCA 2PS9A 3HUTA 3ZOKA 1SKAA 3H5WA 3UEOA 3ZXXA 3BAFA 2I7XA 3EPRA 4KC0A 3UJDA 4OHZA 4MR7A 4F3TA 2OM2A 1J5XA 4O6VA 3MN1A 2AHRA 2BMDA 1E1KA 2BUCA 3AHGA 3IIJA 3NCHA 3O95A 4H7IA 1UBFA 1D7OA 4KR0A 3U48A 3W6NA 10MHA 4QNRA 3GFGA 4CF4A 2DYKA 5IK2A 2JJ2A 2BRUA 5DB4A 2DLCX 2ONYA 4IS3A 3D7RA 1JL3A 1GFWA 3HJGA 1XAHA 3MYYA 1WMEA 2PXHA 2X22A 2DBVO 1PRYA 5DI3A 5K3SA 3R8CA 3HXPA 4L0DA 5DE3A 3QFFA 3ABQB 3DJYA 3EARA 1FSFA 3FMIA 4CG1A 2I2FA 3UMJA 2OGUA 2QK4A 3GEGA 1YVUA 3COVA 1M1YA 5TQ0A 5CDFE 3N5KA 2A3NA 2FSVC 1W30A 1OT5A 3B7GA 4TSKA 4BFVA 1HRDA 1GL6A 4R5HA 5FTKA 1UM8A 2A84A 1P91A 5JSFA 2XTNA 4QGAA 4EVRA 1Z17A 3TGPA 3GLHA 2WF7A 3GFSA 1KKUA 3Q7EA 5KC9A 1YTLA 3ST7A 5KVCA 1X7WA 1UJNA 4N5DA 1QHHB 1C8LA 2A4KA 1QTRA 3BICA 4ZK6A 4KYTA 5B6IA 2XRZA 3TIIA 3AUJB 5CT5A 1E77A 2F67A 1ICEA 4WW0A 3UMFA 4FMPA 4YJ2A 4P93A 4Y6QA 1FUIA 1GRVA 2ONZA 3LA8A 3LP5A 4TMWA 4QBTA 4X8MA 4EX6A 1VL6A 3HYNA 2VJNA 2R6ZA 1EM8B 1Z2CA 1ZN2A 3KLMX 1W5EA 1FFCA 2QS9A 2IPXA 1Z8NA 1FDOA 1I3LA 2LD4A 2ZBRA 5FRDA 3T0IA 4C6RA 1N33B 1I2ZA 1V95A 1G2PA 3DMNA 3HL0A 4G41A 4TZTA 4WXRA 2DULA 1BKSB 4CXMA 2GJKA 2IW3A 2VRCD 2D2EA 2ZWVA 4MB2A 4ZVMA 5AUNB 3NTQA 2XDQB 3WK7A 3MCAA 2BGRA 2JLWA 4OK5A 2VAWA 5TMDA 3R3JA 2GOYA 1C7JA 4URYR 5JMPA 1JG1A 1XJQA 2P40A 4HN2A 4A36A 1WXEA 3V32A 4IY1A 3GFOA 4L08A 1F8YA 3GW8A 1JDPA 1XR3A 5FPKA 1G9TA 3K32A 2QRUA 3EXIB 3R7NA 5C5DA 5M5BA 3TLAA 1FFHA 4ZQEA 1G4UR 4MUFA 3F0TA 4WINA 1J90A 3I73A 2BEWA 2FY8A 1KVRA 3LT1A 2R85A 3Q11A 1PL7A 1FOEB 1GPBA 2NPFA 1AGXA 4EUFA 3P7MA 1SCIA 4CTNA 4MQEA 4HNAA 3TG2A 5DASA 4H08A 4LJ5A 5D5HA 4DB4A 1L4UA 3K20A 1D4AA 4G07A 1IOZA 3KB2A 4LOKA 4QOSA 3T7AA 1BC5A 3NAGA 2C5SA 3TLXA 2NLOA <