3H16A

Crystal structure of a bacteria tir domain, pdtir from paracoccus denitrificans
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
APPHDIFISHAWEDKADFVEALAHTLRAAGAEVWYDDFSLRPGDSLRRSIDKGLGSSRFGIVVLSTHFFKKEWPQKELDGLFQLESSGRSRILPIWHKVSKDEVASFSPTMADKLAFNTSTKSVDEIVADLMAIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords TIR protein
publication title Molecular Mimicry in Innate Immunity: CRYSTAL STRUCTURE OF A BACTERIAL TIR DOMAIN.
pubmed doi rcsb
source organism Paracoccus denitrificans pd1222
total genus 41
structure length 136
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 3h16A00
1T3GA 4LZPA 3UB4A 3UB2A 4LQDA 2JS7A 1FYVA 4C6SA 4FZ5A 4C6TB 2M1XA 3UB3A 3JRNA 5FORA 4OM7A 4C7MA 4LQCA 5KU7A 3H16A 4W8GA 1FYWA 2J67A 1O77A 4DOMA 2Z5VA 4C6RA 4C6TA 3OZIA 1FYXA 2Y92A 4W8HA 4EO7A 5H3CA
chains in the Genus database with same CATH superfamily
1FRQA 2WA1A 3TBKA 4RLSA 2WDPA 1QO0A 3LUCA 3KQOA 4LOJA 2P9QA 3H7AA 1U6IA 1FLDA 5D51S 4DCVA 4M88A 2XQVA 2HA2A 3IAHA 2PE5A 1IQPA 1H5QA 1TADA 1OZGA 2NO6A 4O4IA 2HA5A 5HCNA 5AIBA 3AF3A 4B0PA 5EXDA 2SKDA 5FWAA 5IBPA 3GEMA 4HPJB 4L0CA 4CRWB 2P78A 4QU5A 1ZK0A 2BD0A 2VHQA 5ALYA 1DARA 4RC9A 1SBTA 3MNFA 3UVEA 3V97A 3IVGA 4HGRA 1A4IA 1J0EA 1ZJYA 2IIPA 1Z75A 1EX9A 5EJ8A 3ENKA 1FLAA 1DWQA 1QYRA 1CB0A 3DGFC 1GLVA 3N0TA 2I2XB 2XUKA 1ZD9A 2VK4A 3MBKA 4KWTA 5CEJA 4RTOA 1SG0A 3VGJA 3OJWA 3AI1A 3P4XA 2X4DA 3UOGA 1AGXA 4NBLA 5JNTA 5KTPA 4YMHA 1QGOA 3OU2A 2HWKA 2HSJA 1MVLA 1UFKA 2V7EA 2BBSA 4G1VA 4ARUA 4P54A 3DA8A 1VHDA 2QRKA 3LDUA 2ODEA 4UC0A 3T3DA 4BE9A 1X0XA 4YCAA 1U8YA 1T8TA 4TTPA 4RWEA 3P4UA 3T3HA 4MGIR 3U4MA 3MWDB 5T8KA 4NCNA 3ND6A 2G1KA 1ENYA 4KN6A 4N5LA 5K8JB 3EFBA 3X1WA 2BGUA 1FNSA 1W4AA 3LCVB 2ZYWX 3W5JA 3MWJA 1ECCA 2J7KA 2ZRJA 1Z6QA 3D4BA 4ZHQF 4BTVA 2OUKA 4I6GA 1A2QA 2NVWA 2H1FA 5CNJA 4HTAA 1U7HA 3DMYA 5F98A 1G66A 4ZOQI 2X40A 4GL4A 4FGSA 3QFCA 3QFSA 1LBEA 2FCRA 3ER6A 3F9RA 1GN8A 3KBBA 3NRCA 3UKJA 3G2OA 1K8RA 1DELA 1ORWA 3T7CA 1Z15A 2I4MA 2BCEA 2A7XA 3UK0A 3WBFA 5GTDA 2IXEA 1IZYA 4CR6A 3DEHA 1E6MA 4I1VA 3QX9A 1GN9A 1YRLA 3MAJA 1UC4B 4Y9TA 3HJTA 1E0AA 3TLJA 3WYDA 3LQFA 1LZKA 3EPPA 4BV2A 3QVMA 4K6GA 2ORYA 5IWCA 1QIEA 4AQDA 2XWPA 1BGWA 4YIKA 4E7PA 1QGDA 4JJKA 5GONA 2RIPA 3Q2IA 2B7BA 3R8XA 3W2HA 1PT7A 1QYVA 3A58B 3PFBA 3R4VA 4GOMD 4NMWA 5G0UA 3QUBA 3SBEA 1CFZA 4BBPA 9LDTA 2PKWA 1NMEA 1TUBB 1O95C 1D6NA 4HFJA 1JA1A 1UKVY 1SM4A 1VB5A 5CH3A 1NVWQ 2FETA 3B1JA 5C8XA 2LR0A 1H6CA 4K87A 5DE3A 1PNQA 4PTLA 2BFFB 3BREA 4ZC8A 4ROSA 1KZ1A 4G89A 4QHSA 2DH5A 2Y4NA 4BFLA 2C3PA 2J9FA 4TL6A 4YMSA 2UUOA 2QTLA 3LUBA 2ATIA 3A4LA 1FZQA 2ZREA 3TDNA 3K9WA 1XK6A 4L8VA 2VAVA 4F72A 1N8KA 4PX3A 2P9ZA 4KSCA 5C35A 2QX7A 2JCYA 1YJCA 3NIDB 4GF5A 1SBNE 5DV9A 2RHHA 3EISA 1Q16A 5AQ1A 1RC1A 5KEIA 1PGQA 5L53A 3K6SB 1X80B 3DONA 1YACA 2CJWB 1ILWA 3GNQA 3OOYA 4CEIB 4MTCA 2YS6A 3DE3X 3V32A 1SUDA 5CTJA 1U2DA 4G1MB 3HBFA 1FFSA 1S2MA 2G82A 3PWTA 4Z9XA 3NRBA 4JJEA 3UC9A 2HXSA 4ZANA 5IC6A 1MOSA 3REFA 1FFXB 2Q9AA 4K2AA 1JKJA 2GKSA 3CNQS 3U4IA 1E5LA 4A1FA 3BHMA 2HJRA 2JFNA 4RJLA 2FP4A 4YQZA 4YT4A 5A0VA 2CNLA 4RVOA 5FFMA 3NTLA 4UVIA 4CKZA 3LSTA 4Q00A 1MH1A 4UUMA 4UHBA 1WUKS 5KTTA 2X5KO 1MOPA 2IHZA 2W2KB 1GPMA 1JQEA 1KEEB 2V7QD 1MC8A 2YIDA 3NAZA 2CHUA 2VCHA 4XA8A 4C7MA 2P5UA 5LQJA 5A03A 1Q50A 2JIZA 3NGMA 5JO9A 3GRZA 1J90A 1SVMA 3HY4A 1J5PA 4NCJA 5KX5B 5ICSA 3AONB 3ZY5A 4LVOA 3RWBA 2ZSJA 5JTUA 1R4MB 3LP8A 4WH0A 3ZCUA 5HYVA 3CZ4A 2GK4A 4G1UC 2IXTA 3H0KA 2D2IA 4ZCQA 3UO8B 5BQ5A 5HJEA 3I1JA 4MQUA 4N54A 3DXYA 3WNZA 2CKDA 3HJHA 4GZ5A 5BMOA 1OU0A 4IS2A 4MVCA 2J3KA 5L7YA 2AR9A 2PS0A 4XR9A 3WGQA 1MENA 5F12A 3ED1A 3BFXA 4LCBA 4BEWA 3UA4A 5A5VA 3AT1A 1F8GA 2OSVA 4LVCA 5FR1A 2Y1GA 3PSHA 1GGKA 1OXXK 4P32A 2VJDA 2CC2A 3WLIA 5CD9A 4FXOA 2IXDA 5I9SA 3T7TA 4DXHA 4ITVA 4BNYA 1YQWA 3GVXA 3UAZA 3MGBA 3ZH9B 4Y2PA 4C4PA 5JRJA 3E23A 1NMSA 3GCZA 4XI9A 2Q1TA 5BR8B 3P2IA 4QDUA 2PA3A 3F0TA 1R8XA 1USGA 3UUWA 2WJ4A 1MO3A 2RB4A 3HYLA 4ZT4A 2GFHA 4ZHQB 3EPHA 4N18A 4PNEA 1W7AA 2NUAA 1YOVA 2JEYA 4DHWA 1XDUA 3NHPA 4DR6B 3GDOA 3DB2A 3NBKA 3DEZA 4M1WA 1DIGA 1G64A 4GLLA 1UBUS 3H5LA 4HSEA 4RH1A 3WKBA 3ZNQA 3IE1A 1AGRA 1X1EA 2PGLA 2ZE8A 3B1VA 1G63A 3SF8A 3NTRA 1OLXA 2Q7OE 3HJUA 3OE1A 3WLOA 3L43A 2P35A 4DLAA 3I01A 2Q6IA 4W5HA 5KO2A 1B74A 3REQA 1RBMA 1JA0A 1XCJA 2P9BA 3GRRA 3LQRA 1VXRA 3MF4A 1TF2A 3Q87B 4R3UC 1JQDA 4V0RA 1A9PA 3SXJA 3FZQA 4ZGGA 5J4LA 2JC3A 1DT3A 2QD5A 3AVTA 1D2RA 1Z4PX 2WU0A 4GOKA 1B14A 1HQCA 1P31A 2QRQA 3FPCA 1D8TA 1NN5A 5ADHA 2JL1A 4FFBB 4Q9NA 4FDUA 5JSYA 5EPOA 2GB4A 3FRJA 4CQMB 1IJFA 2B30A 4BB5A 4DAEA 1M6VB 3NQ41 5AOVA 2CXNA 2HIMA 1IK6A 3O2QB 5B30A 4PZZA 3RUIA 1C0EA 2HPVA 3MERA 3IQZA 4KVGA 3QV2A 3CZMA 1MU0A 1N8TA 1ODFA 3EG5A 3KU4A 4WK4B 2ENWA 3AKDA 4LMBA 4Y2SA 3STVA 1QZ3A 5AKHA 1TYBE 2Z2XA 3RVMA 1XLTA 5JSZB 1CIVA 5FPQA 5H3CA 4IWXA 1LI4A 3KWMA 3OAAA 3R5JA 4ZVKA 2WJYA 5IF3A 4B6RA 2NZJA 1ECJA 3L82B 4R01A 3CLSD 3C6BA 2Q3FA 1D8AA 2SCUB 1GL6A 3EIXA 3O2NA 4YWHA 1H9CA 3CF4A 1B6SA 2C9CA 1KZHA 3SM9A 9LDBA 2MOKA 3PFCA 4JNKA 5JJBA 1ZRMA 2YN2A 4V39A 5EKDA 1DAKA 1J0BA 1SPBS 1IH8A 2B37A 1GCIA 4L85A 1U2GA 4NQZA 2UXCB 3TZLA 5GGXA 1JYSA 1LBTA 3JAWA 2RK4A 3OM9A 4UHHA 4IV0A 4IF4A 1NRIA 2CNOA 5FUVA 2BTQA 4ZO4A 4BQFA 4R0NA 3ZE0B 2ZIGA 1CJSA 5KDOA 1O3YA 5K3BA 3QNUA 3PDIA 1NN1A 1ULUA 4M1ZA 1OLSA 2WUWE 1TKAA 1N6KA 1JLLA 3CTPA 3MBIA 4Z8YA 4DIBA 5KYNA 4BX9A 2VJKA 1HOXA 2ERXA 5KOYA 1V37A 4AIIA 3C3BA 5CAEA 3EMKA 2CMDA 3NHSA 4IVRA 4MVJD 4UAVA 4JEHA 2H63A 3KO8A 1GA1A 1ZG3A 4X93A 1UAYA 1AQNA 2QDKA 4G4SP 5BVHA 3P0JA 1V1RA 5KQGA 1JLRA 2XJ9A 3V7UA 4YR7A 4BWFB 4CW7A 1AXRA 3PTLA 5K4AA 3RAEC 4KBFA 4R2XA 5EMLA 4P3PA 3K71B 1VSBA 4JLBA 4K26A 4EDFA 1DWPA 1V4VA 2EAUA 2P2YA 2PD4A 1XLWA 2DWUA 4DLUA 4L73A 2CEAA 1XIVA 1ZFNA 3S2UA 3FHTA 1G4AE 3ANYB 4KIWA 4OPMA 1FNCA 3IJ5A 3NUZA 2XZLA 4PX5A 3GFQA 3MN1A 3L7JA 2GN4A 5FFFA 3R1IA 3L0BA 5DPMA 4DCSA 5DN6A 3O8OA 4QASA 1RI5A 4ODIA 5KKAA 3SGLA 2WWFA 4KPFC 1CJUC 1LH0A 1FVXA 5AP9A 4BX3A 4UAGA 3AOEA 3CH7A 3DV0B 3PENA 4R1UA 2HBZA 4QJ3A 5A71A 3AKYA 2XB6A 3KHKA 1OX6A 3RUCA 3HU1A 3T7AA 5GIOE 3QI2A 3C3DA 3DS8A 4XDHA 3T61A 3ZGOA 4XQ9A 3O8BA 3Q9UA 3TL2A 3GN1A 3RRNA 1HFKA 3A8TA 3NHZA 2IVFA 3LBNA 1WSAA 3NASA 4I81A 4NVRA 1W5EA 1PT9A 1DCTA 1AKMA 4DCGA 3HBLA 4CF7A 3CR7A 2CWWA 1JAHA 3Q7QA 4TVOA 2W2VA 4DC0A 1ISIA 1TUGA 3LUGA 4IQ8A 4S1TA 2RGUA 1KMHA 4CVNA 4DLBA 2ACWA 1EFPA 2BEVA 4PSKA 3JQFC 1IM2A 4J29A 5F5LA 2FLKA 4L4XA 4PHTA 3EXHA 2PWAA 1U0OC 1FU4A 2VHTA 1NI3A 4DIDA 1SIWA 1MVOA 2AYZA 4OJTA 3BQNB 4Q1VA 3U6KA 4WINA 4GICA 3UFXB 4RTQA 4MJXA 2ECOA 1G8JA 2PMWB 3WL3A 4DB2A 4UFPA 1HEYA 2AZTA 2XUHA 1RAFA 3OEED 4Q3KA 2XE7A 2XWQA 3VJMA 1IUOA 2G9QA 1I0IA 1T26A 3CG0A 1HUQA 1RS0A 3BMCB 4AY3A 1ECBA 2OQ2A 1QP7A 4HNAA 1YRHA 1NRWA 1BXRB 1UFVA 1WW8A 2GEBA 1AVTA 2AQHA 4MMZB 5TMPA 1KWKA 1QUEA 2O52A 1D4FA 2FK7A 3AZQA 1LDMA 5LQRA 1KPIA 3Q12A 4LQDA 1FDIA 4Q3LA 4NMXB 4CTMA 2WV9A 4DWWA 3N3AC 5DM1A 3GAFA 4HQ6A 4AJ4A 4E5SA 3FKJA 2B8TA 4BNJA 1BH2A 3K94A 5TJHA 3TECE 3FTFA 2FPIB 4RA6A 1XZCA 5L3QB 1VIVA 1CQJA 4GKVA 1XA0A 3KYBA 5ALUA 1OXUA 1C29B 1E69A 4BL5A 1CNEA 4C4TA 1XRSB 1N0HA 2P67A 1Y42X 1PQUA 3DEKA 2J4CA 3LO5A 2L17A 5IW8A 2GEJA 3PUVA 3PHJA 4QFDA 5AW3A 4BJ5A 1XHEA 2O7QA 2DFDA 1Q7TA 4UKDA 1WKBA 1YU6A 3NHAA 5L6LB 1IYZA 2CNBA 3H05A 2AYYA 4KR3A 1MAVA 1KI2A 2HY7A 2PZJA 3F7TA 5EE0A 4LEIA 5CLIA 3PUYA 1LNQA 1NF9A 1QFJA 5DNWA 4EJSA 2M1XA 1OWNA 5J4KA 3I8OA 4TL8A 1C2TA 1J9EA 5AJTA 3L1IA 3E8SA 5IJ0B 2OWEA 2PL1A 2R1VB 1SRRA 1XZGA 2W42A 2A9OA 1T6YA 4UAJA 5IH3A 2A94A 4C7JA 4MKIA 4EPRA 5KB3A 5JYCA 1V16A 2WU8A 4E5KA 3JRXA 4Z0HO 4YLYA 2CXTA 2P65A 3UHAA 1P5FA 1M0EA 3W5CA 2GZ3A 4Y98A 1FLVA 4PPGA 1GRRA 3U7RA 4B3BA 3JQ9C 4IEEA 1OI7A 2PXXA 3W7BA 4FI3C 1DX4A 1POWA 4GX5A 3TXAA 4D82A 2GFQA 2WIJA 5BMVA 1XZIA 1Z2AA 2BH9A 1LK0A 3WO1A 4DAOA 4DQUA 1T6NA 3THXA 2HV8A 2YWCA 2FOXA 2P2NA 1P62B 2HSGA 3TNJA 4LY0A 3B8HA 1WO8A 1YCHA 4J6EA 4H6PA 4ALIA 3B89A 2WB2A 3U3ZA 4UM9D 3ZX5A 3CRZA 2LIVA 2N3ZA 2NM0A 5CA1F 1IHDA 2Q5LA 1SXJB 4H1TA 3RQSA 4A0QA 3FI9A 4HUQB 4ZVSA 4UBKA 1KI6A 1SMKA 2G17A 2JZOA 2AN9A 2YX1A 3IX7A 1H3EA 3GJRA 4BJ3A 1KOJA 4YV7A 4P5DA 3SSNA 4DSOA 2HMVA 2LKDA 1UBHS 4R5HA 3DZDA 4HXFB 3TGWA 1K4KA 3D1LA 4MQMA 3GR6A 2BFMA 4A0FA 2XYRA 3Q1LA 1RAAA 2ZR0A 4KWCA 2C4VA 2PV7A 2RKOA 4CKXA 4KQWA 4IIXA 1V6SA 2HQBA 4IXDA 3ANXA 1ICEA 5B2EA 1E66A 2CD9A 3ND7A 1FS4A 4E2XA 5LYYA 2YHAA 1GUZA 4CMCA 4ZV7A 4Q02A 3IHLA 3UJBA 4BPRA 3T7DA 2W8ZA 1P0FA 3I9MA 4M1OA 3DBIA 4OI4A 3V7NA 1Z17A 3DNFA 4GT1A 1SXQA 4E94A 5IZCA 3RIHA 3TH5A 2C3YA 3ZGVA 3TQHA 2ZXFA 2XH8A 3BBPA 3FPSA 3NPMA 2H59A 1GGJA 1T0HB 1A9QA 1CUWA 4F1WA 2FDRA 2OOSA 2WIKA 3A6LA 2QU8A 2H2DA 1L1QA 2XA1A 5L51A 4LSGA 3ZVLA 4QTYA 3LCCA 4P98A 4ND3A 3CUEF 4CKCB 2GAFA 4G63A 1W36B 1JLSA 5JFTA 1VJRA 4CCAA 4IH1A 1ZHHA 3P2EA 2Q1YA 1WOYA 2O8FA 2YDXA 5FL7A 4DYHA 4CEJB 1BHJA 1AUPA 4FCTA 2I99A 2PSFA 2LPMA 2A3NA 4CF5A 5IJ9B 1M34E 1YVDA 3OZAA 4NPHA 4LV6A 2OHHA 2ZJ2A 3PUZA 5ERYA 1VKZA 3RVQA 3UMBA 2QV0A 3VOTA 2B6NA 1QVAA 5E6RB 2JAXA 5C3UA 3WWYA 2QSZA 3ZV3A 2BMDA 5ALPA 2OZVA 1MC5A 1Z0JA 4IIGA 1QH8B 4WRRA 1UBLS 1YQQA 5HFNA 4OSOA 1HQDA 5LDHA 5E2AA 1XKQA 3ACCA 3ASYA 4A0GA 3TTTA 3E9EA 4MQLA 2OD9A 4M0EA 3HP1A 2OCIA 4RUKA 3G7NA 4I1RA 3QYJA 1X74A 1K6JA 1QE0A 4E3ZA 1RWWA 2GCIA 1M2NA 1PEDA 1YBHA 5SZKB 421PA 1ORIA 3D6FA 3GVPA 5DW3A 4BQQA 3CF2A 1FX0A 3LT4A 1E4VA 3L05A 5AW2A 2ZVQX 1J2TA 4V0SA 2O1XA 2H11A 2OGUA 2VDVE 1RMYA 3GEBA 3I05A 4M53A 4TWAA 1M2VB 2RSLA 5AKLA 5JATA 2HREA 2PGDA 3RIGA 1P6XA 2OHXA 1A8UA 3GQBB 2PWYA 1HI9A 3WMWA 3C6ZA 1DOAA 1MB0A 3JVVA 3OZCA 4FR2A 4ZAGA 5K3DA 1WV1A 1M6YA 3DLAA 2ZXUA 2NP7A 1V7ZA 3KOZA 3H9UA 4P83A 1QMPA 3KSDO 3KEGA 4Q3BA 3WXMA 5C46F 2VFAA 4X62B 4IRMA 1AZSC 1WPRA 1HG0A 2G6TA 4QRHA 1U0TA 4X1KB 4DDTA 3ZE8A 1TI7A 1ZOLA 2B4TO 2FSVA 3EVDA 5FPTA 1JAZA 3A3YA 1LLQA 1TVKB 2V7UA 1L1EA 1LK7A 2PNJA 3ZE9A 3FPJA 4NDZA 4U7TB 4Q4HA 3TW0A 5HRUA 1IWPB 3RUAA 1Q1QA 4TT3A 1OKKA 4XYEA 2BMAA 2FRVA 2O4CA 3WZ2A 5HZHA 2WU4A 3AIKA 1F12A 2GHQA 1NRXA 3VRHA 1JHRA 1W29A 1MIOB 3AY0A 2RD2A 1IY9A 1FMCA 3GXOA 2J46A 1EWQA 2QD2A 2NTNA 2OV1A 3N59A 1P9NA 4ZVTA 1YD7A 2A9QA 4NCIA 5KI6A 5CA1B 1DEHA 1MNAA 1WVGA 1M0WA 1T4BA 2YJZA 3VVBA 3A0RB 3W77A 3SKXA 1Z6XA 3GAMA 5JCXA 1VE5A 3P0EA 4ZYVA 1L4MA 2IYXA 1P18A 4L16A 1ZL0A 5CK4A 3KU1A 4I4LA 5HX7A 3K2QA 1JU4A 3AX6A 4UMVA 3O91A 3OLWA 1G98A 3GP5A 3EF1A 4GE0A 4M7OA 5A9TA 2PK3A 5KMGA 2PUCA 3D9QX 1U2SA 4G5FA 3H5NA 3RO7A 4J4TA 2QORA 3E1KA 2RC5A 1ZQ9A 1H8HA 3MWYW 1NQOA 2EGHA 3DOHA 4PFJA 5EZ6B 3JR3A 1IEQA 1BJKA 4ESEA 3DPUA 3ORFA 5DTJA 3LNTA 3T3GA 1NW3A 3HB1A 5MN4A 3KBOA 4RS4A 3TLBA 4ZQHA 1UPCA 4ZDWA 1OYOA 3RWOA 3FKSA 3HYRA 3AW9A 4QOGA 4YUAA 4AJPA 1LBHA 1YO6A 3QWHA 3RC8A 3AV0B 3HB5X 3PEUA 4LGMA 1LPSA 1NVDA 4I5GA 4MVXA 4DC1A 5L7TA 2QRVA 3M6IA 4YRZA 4GP9A 5IEJA 2IEDA 3K53A 1FVOA 3QF7A 2GH1A 1WAMA 4S05A 3IQXA 4ZVLA 5AKEA 1RLMA 4FJ2A 4RM2A 4XAQA 3RVOA 3PD0A 1CR6A 4QHTA 2BEUB 4LVNA 2IOYA 3PQDA 5JSQA 4R2HA 2IEIA 3VNUA 4LJRA 1MG0A 1GTL1 1GPKA 3E3AA 2A4MA 4NP6A 1WJGA 2GZ1A 4HYTA 5DCLA 2F64A 4OEHA 5KHAA 3RS2A 1XTBA 4EW3A 3NBUA 1VIYA 3SYLA 3LDFA 2OM2A 3EJ6A 2PTGA 4FNMA 4BFSA 4N4AA 3CW9A 1N5DA 1P9RA 1YQUA 1Y1QA 2HLDD 1RJFA 4L9WA 4ZVPA 3X1XA 1Q0UA 2X9QA 1MO2A 2C99A 4FNAA 4RY0A 5CHEA 4INPA 4DA0A 5JSHA 2W93A 3CH4B 3P0FA 4FK8A 3JQ7A 5EYPA 1KFBB 1UKCA 3DEJA 1BVHA 4H3SA 5DSZA 3ZXYA 3TG2A 4I1PA 2YXPX 3O4GA 5K8CA 4AF8A 3F90A 2PYZA 1Q84A 4HQFA 2DHRA 3K8YA 4CZ2A 1WNFA 1D0VA 1I3LA 4CFZA 2JATA 4LYDA 1A69A 2MR5A 1N6IA 4JB2A 1XKXA 1BXKA 2KX7A 1Y5MA 2JCGA 4JFRA 5K3FB 3U7QA 2XNJA 2Q6KA 3FWNA 4DMCA 4JXXA 1H1TA 2ZTSA 2FB9A 4CTJA 2D5AA 4COOA 2OQVA 2VJLA 2CXHA 3L8HA 1U28C 4QE3A 5E7QA 2VPQA 5L6MB 5CVVA 2QTVA 2C31A 4AYXA 4HQ0A 2GRAA 2VYFA 1CZLA 1K4YA 1FUYB 1WE2A 1WVIA 1A27A 5FLYA 3KPJA 2EATA 1PJQA 2FG5A 4Z1OA 1ZN8A 4ILKA 2PKQO 3AJRA 2FSSA 2DKFA 4LQ4A 2G0NA 3KYDA 3A9UA 3QU4A 2JAOA 2EIHA 4RZUA 4KHPB 4XEUA 4FDVA 3QY9A 4C7KA 5C5IA 1LI7A 3FPLA 5HKKA 2NXNA 4L4UA 1N8NA 1U7WA 3PIDA 2JGNA 5G0TA 3MJDA 2A4KA 2I4RA 5FH9A 4DLWA 4EYOA 5HZMA 3GCDA 3MGAA 4XQEA 3W2EA 3N6VA 3ORRA 1NUTA 1Z7YA 3DTVA 2D2XA 2OSBA 4KIUA 4AJIA 4DV0B 1XXHB 1PGOA 4KXUA 3EZNA 2C95A 3A11A 3GPBA 2EQBA 3OOSA 3Q3IA 4HCJA 1JHQA 4ZI7F 5LN1A 2UUBB 3HFJA 4P4SB 1LPBB 4WAUA 3W5DA 1ZIPA 4O4LF 1RP7A 2WINI 1FVFA 1C2YA 1KVSA 1NM5A 2YJ5A 1PJ4A 3UAXA 3ZN2A 5KNDA 3PITA 1JEEA 3EB9A 3TMAA 1G60A 1V95A 1D2HA 1B7GO 4OAPA 1Y37A 9GPBA 1RWQA 3O1JC 3H1BA 4ND2A 1VMEA 4BMZA 4PQRA 5BWLA 1M72A 1BEZA 1TFUA 1VE1A 2W5UA 3WDKA 5B7QA 1W87A 5J2TA 2V5VA 1HTTA 2BWJA 4JB8A 4MI9A 3P0RA 4REQB 1G3UA 4P7FA 3B6EA 1Z4IA 4M36A 4CIVA 3N7AA 2EU8A 4YACA 2REQB 4EYSA 4CQLB 1S3FA 1XPJA 4JLKA 5KYYA 4O6VA 2VATA 1NUAA 3OA0A 4JJZA 4N12A 1IG3A 2PAFA 2YY6A 2HO4A 2BCGY 1E20A 2P91A 3EAQA 4HB4A 1IEWA 4Q03A 2Z9DA 1M5UA 1KDZA 4EP1A 2IEAA 4NENA 2WB4A 1FU8A 5AXBA 3LIPA 1WB9A 1J23A 5FTKA 3H6GA 1VPTA 2MT9A 3NS7A 4F6RB 3LX8A 2MSWA 2D2EA 1AKVA 1TZMA 2CYAA 2ZIFA 4RV4A 4ALNA 1UQUA 3RBZA 1DZ3A 2B5OA 5TJ9A 2OR3A 1RRCA 3S2IA 1NBHA 4WKPA 3EMBA 3I2GA 4D74A 4WJLA 4UU8A 2WU1A 3WMRA 2IC5A 4ZQEA 1HDXA 5EWMA 2PYIA 3QVJA 4R40A 2ECFA 3DOUA 1TW2A 1UODA 4PLVA 4TV8A 3ZDDA 1PZGA 3G2NA 3FNGA 1ORTA 1PWHA 4MYSA 2Q2VA 2VZ0A 3B5EA 2ONJA 3V4VB 3WB1A 5JECA 3ECSA 3LK6A 4AB1A 2B9VA 2C4TA 4GWLA 4OOFA 1XU9A 4M0UA 5LD2C 1YRWA 3LXXA 3A9VA 1JHUA 4UTZA 3P4YA 4X3CA 5F4ZA 1LK5A 1FYVA 2ID8A 1PQ4A 3NXSA 1GRNA 2KHZA 1W85A 3B2EA 4QBFA 3ND5A 1GGEA 1Z4LA 1U80A 2C2MA 5M5BA 2E2WA 4Z4IA 3JATB 3NNDA 3QM1A 3AK4A 2QXTA 3ZI7A 3K0CA 1SXGA 5CT9A 1IN8A 4IDEA 1UAAA 5COQA 3B8EA 4PYLA 5EEGA 1B0ZA 4UCFA 3T0FA 3AETA 3LFUA 4CM8A 2C2HA 4F5DA 1TZ2A 1JWBB 2RGBA 1HZZA 3OTIA 4JMLA 8ADHA 1SZDA 5IHXA 3UT5B 1KIMA 3GNTA 2GA8A 2ZRMA 4OYRA 5AM4A 2X14A 3OE7A 2CV2A 4IXTA 4AJLA 4PIVA 1TF7A 3BCUA 4OHZA 2ZBGA 3B1XA 5H9WA 2QYSA 1AK2A 3IAFA 4ZP1A 4TXLA 3EFOA 1YZYA 5ALVA 1UBSB 4QSMA 2JA1A 3GEIA 4H17A 3TJMA 3QBJA 4AK9A 3ONFA 1T3LA 1WXQA 1IUKA 2I87A 1P44A 3ZHVA 3RANA 1VSUA 1HG1A 2W98A 4FE4A 4FOSA 1ILEA 4CYMA 5GMOA 2W2PA 4YCCA 3T1OA 3LH5A 3HY3A 5ECGC 5F33A 4OI1A 1K86A 1ZXBA 4GX2A 4EI9A 3HFGA 1CLUA 4YP5A 2QVLA 3PXGA 3ZKWB 4ZQCB 4HVCA 5CCEA 4J0KA 1ZONA 4FCCA 5CTAA 1NVEA 4E22A 3JQBA 4Y2RA 5B7NA 1YHYA 3DKKA 3EA0A 1SULA 2FSHA 1LTKA 3IIKA 3N8HA 3NH6A 1EB8A 1GZSA 4WUTA 1OAOA 4JEIA 2WBLC 4JP1A 4FX2A 5HFJA 4CKEA 3L1VA 1LW7A 4F7DA 4RH3A 1VL1A 3FFAA 1DKPA 3F47A 3V8VA 3ZUPA 3UAWA 1XKLA 3MJEA 1HT1E 4XYMA 3P32A 1R0ZA 2G76A 5JY1A 3VHXA 3T7RA 1NWHA 1Q1ZA 2FJUA 2PRSA 3AUAA 4MZDA 1A4UA 3RC2A 2HHAA 4TTJA 1AS3A 2AXNA 3D7SA 3MINB 3OKCA 4FFPA 5HMLA 4O4LB 3RREA 4QLAA 1A8IA 3M6WA 1L7EA 5CFQA 4LJ8A 1EBUA 3JALB 5DK6A 1EPUA 3LUPA 1ULSA 4UTNA 4BMXA 1RWKA 4RHYA 1TFRA 4KHZA 1JMVA 3GJTA 4R1PA 4URYR 4NCAA 5EQDA 1Q2XA 1PGPA 3V1YA 2H4ZA 4XPIB 3T9CA 3EHEA 5H8WA 3AMVA 3G2JA 1FF9A 4MDEA 3VM6A 1T34A 2GK7A 1NW9B 1VLMA 3EGXA 3KQPA 3K7EA 3FOEC 5A62A 1PGJA 3TNFA 3RIYA 3C6YA 2UVPB 3NVKI 4O02B 4ZPXA 4Y7CA 1P2DA 2EX0A 2Q49A 2H85A 2Z3ZA 3JQAA 2R8ZA 3PQFA 4GMHA 1BOFA 4J0EA 1R00A 1R4NA 5DLQC 2I62A 3C4QA 1U1EA 1PV2A 4CODB 3F78A 4LY6A 4Y67A 4DMHA 1GTMA 1JEQB 4RFVA 2QW8A 4XTCS 2O2EA 4ZREA 4KDEA 1U7PA 2FUG1 1G291 3AC0A 3WB0A 3WI7A 5EZYB 1P29A 1DFGA 4XX0B 2O50A 3IMFA 2Q5JA 5ICMA 3FIJA 3JVUA 1MGOA 2A33A 3SEZA 3ZTWA 2JD0A 1Z74A 5JV5A 3HZZA 3VAZA 2D13A 3ROEA 1XB2A 4BO8A 4NBSA 3OIDA 3EVNA 3W78A 3U17A 1OX4B 1Y8RB 2LDXA 2VBGA 2ZT6A 1R66A 3F5SA 1PEYA 2AJ8A 3Q85A 4XSVA 4OMUA 1HT2E 4QFBA 4MK4A 4XARA 4WOBA 1PO7A 2VP3A 4BX2A 3TIFA 3BXXA 4F9TA 4N5IX 2DQZA 3QKWA 1XU7A 1IVSA 3UUGA 3H11B 4D9KA 4W9RA 1VLVA 1YE5A 3RGWS 3TOSA 3VU0A 3ROGA 1YDEA 1FP7A 4OMDA 3KX2A 4PC2A 2NYRA 4OUDB 3QHQA 1L6RA 4GOOD 3ZWYA 1BCRA 3JD2A 4C6SA 2BGKA 3ZX4A 1AO0A 2A5LA 3KALA 3FCAA 3ZNPA 4D8WA 4DPKA 1Y3IA 4G0NA 5FT9A 5IXJA 4DZZA 4RJIA 2PQ6A 2E5LB 3E3NA 3NKFA 2YYSA 1OA0A 1U1DA 2IUTA 3DL4A 4IXMA 2K7FA 3JQAD 1RYMA 1RKXA 1M73E 2X2OA 2IELA 5AW6A 5FBVB 3WLAA 3BGVA 4R6XA 1HDRA 3NDJA 2JDIA 3FYUB 5E4FA 4LMAA 2CVFA 5JNVA 1C5KA 3LL4A 4TYYA 5CB4A 2WIGA 4DIKA 2NADA 4Y2UA 2V98A 5DCUA 2HIHA 4IRUB 3HN6A 3LQ4A 3OKPA 4AMGA 1EP1B 3V4ZA 2MCFA 4JP5A 1C4KA 1KBOA 2PGIA 2YJ3A 5DBFA 3IEPA 1A5TA 3K05A 2FUG6 3G8YA 1P1IA 4L0DA 4MRPA 1R6DA 4QTXA 2AS0A 2VNSA 1V9LA 2Q1WA 5BNWA 4CQNA 4G5RA 1HRDA 1DRWA 4EFNA 1XVAA 2W11A 3C16C 3MCUA 2PUBA 3NORA 5EXTA 3RYIB 3IV7A 4WN9B 3OCWA 1OIXA 1C1XA 3C97A 2DUMA 3LSYA 2II6A 3KQNA 1SCDA 1QQ5A 1UBRS 4M55A 4C7XA 1U8FO 3IEVA 1V4NA 2PWBA 4D43A 3QVSA 2YOHA 4AD8A 4G81A 4WY2A 5BW4A 3VXKA 2Q3CA 4ZK2A 2GPWA 2QD1A 3D0RA 3MTBA 2BHSA 2QTHA 4G4JA 2WLSA 1K88A 2FUCA 4HNSA 5AHKA 4A0RA 4I55A 3C3CA 2B1IA 1BDJA 1DTSA 3ZIAA 2EG5A 2PT7A 4DDUA 2HHCA 3FYTA 3T54A 1NXVA 1JRLA 3X2SA 1FBNA 2XIJA 4HGZA 2YJ4A 5AFSA 1EFKA 1ZICA 3M89A 1E2HA 1I13A 3TVYA 1XZDA 3TPCA 5B37A 3F7MA 4YRLA 2IBSA 2CE2X 3IE0A 1XGKA 4YAFA 5DYWA 4E12A 3FTNA 1NG9A 3ICEA 1TK9A 4QDJA 3L1KA 2J0UB 2JLZA 3R6DA 2QBYA 4US2R 4TGLA 1UOOA 3CRNA 1Q1BA 4TUYF 1FTNA 2ETVA 4QXMA 1DEKA 3UWPA 4DNXA 4RTRA 4KPUB 3AO0B 3IP7A 3KZMA 4FXPA 1U7OA 1AF4A 4LZJA 5DU2A 2FFQA 3P2OA 4W8HA 3EBLA 3LVBA 2GEVA 2B4YA 1E1YA 2Q2OA 4NU8X 4B71A 4E03A 3N1UA 4KMMA 1BVRA 1S6YA 1RRKA 2TRSB 3UB4A 5JQGA 2C8VA 2XGSA 1NJ2A 2QN3A 3KD2A 3H5OA 1D1QA 2D8AA 1EZ4A 4FGKA 1TEXA 3BDAA 4DKXA 4B3FX 3Q8KA 2A86A 1SK8A 2QQ0A 2VR1A 4JP8A 5D2CA 4BASA 5JZBA 2P5SA 5C8YF 3LQQA 3MXTA 2C7VA 3IEMA 4P3OA 3VC2A 3P9NA 2X3UA 3K0FB 1BDIA 3TINA 2CN1A 2QD3A 3IIJA 3X2EA 3ZIAD 2R25B 4U7WA 4AXBA 3HXQA 4PBSA 4GDMA 2HAEA 3SHQA 3VTZA 1Z0AA 4EMUA 4LZWA 3WRWA 4CV2A 2IHBA 3RSCA 3R40A 4FHGA 5ENDA 4PG4A 4ANFA 1X9GA 4YBRA 3IPAA 1USIA 2IZ1A 5HCUA 1QS0A 2UUAB 1VJ5A 3UK7A 3A1TA 4M60A 2BISA 1HDGO 1NVKA 1UBEA 3S2GA 1OI2A 3N0XA 3MYYA 1YL7A 1GXSB 4AROA 5AXAA 2A1TS 2XITA 1OXTA 1BWPA 4TYNA 3HA7A 1HNXB 4LHZA 1MABB 1QJ4A 2QYOA 5ALWA 1COZA 4LWQA 3AQ4A 4AY2A 1IXZA 4QDTA 5CPFA 3WGLA 1WG8A 1MBZA 2RBGA 4O2BF 3PNQA 2ZZMA 1ZN2A 3JQQA 1CY8A 4KI7A 1IZ8A 1NNLA 1PYGA 2EGUA 2Q2QA 4W6QA 5DLPA 3I9NA 4ZOAA 4GLBA 3VH2A 2WG2A 4IUBS 5HXAA 4FKBA 1PDWA 3I52A 3TL3A 1DV1A 3D8BA 1GL9B 2XDWA 2GPNA 3L7AA 4AU1A 1GEEA 2O06A 3DFZA 4EW2A 1L7BA 4AJ1A 3BEOA 2IYRA 2QTCA 2OO5A 3EH2A 2OBMA 3UK1A 2ZTHA 3TLZA 3FI0A 2IYAA 3EQ9A 3E0QA 3JRWA 2ASEA 4YS6A 2YQ5A 2KS6A 4B47A 4KR7A 1R9JA 4MKRA 2HA6A 1DC5A 2IYOA 3W90A 1ORDA 3VPFA 2B92A 1LZLA 4KLAA 3PRJA 4EKDA 2JFFA 5IK2D 2DCMA 4ZZ0A 5C18A 4N3BA 2Q0SA 3QE3A 4A26A 4FD3A 1GV0A 4EHBA 2ATEA 2HXYA 2OHVA 1I7LA 4P3NA 2E4VA 4EJFA 2BT4A 3A6PC 3DD5A 1RI4A 4RANA 2O8NA 3KCQA 2Q5IA 3LD9A 2QN2A 2J3IA 4A36A 3INNA 3GA5A 2NSJA 4Q37A 1OVMA 4U2FA 4RVHA 5HHTA 4R81A 4XDGA 1TCVA 1VL6A 4WZBB 4DIOA 3G02A 2H1SA 2NO0A 3CGGA 3UAYA 1QP8A 1WSBA 1W2HA 2YFQA 1UC9A 2XLBA 2XCTB 1USWA 2B4QA 1ZQ1A 4QLOA 2HK8A 1VIAA 1Z12A 2H1RA 1BWRA 2ZRAA 2ZYGA 4J7XA 4JIGA 2GLTA 3UTCA 2XGJA 2A30A 2ZB4A 5IDYA 4UJ5A 5JXHA 5HUQA 5COAA 4RADA 4YRBA 3E5MA 2H00A 4WX2B 4DXAA 2I4TA 5BN3A 4BZZA 1RDFA 4Y2QA 2QVCA 2PRKA 3EBOA 3JU3A 4RF2A 5EJFA 4UHFA 5L3RA 3VMFA 1NJGA 1WDMA 4YRAA 5JD6A 3CVYA 1EVZA 3S70A 4JYZA 2EJUA 3NAGA 4A3SA 4BLWA 2BELA 3ZLUA 1X7ZB 1O94C 3LBHA 3OP4A 2RGRA 3CBQA 4GR4A 1RQNA 4B8ZA 3G9ZA 3WGYA 5LSAA 1EE2A 5JCOA 4IINA 2R5FA 4KAXA 4LHYA 1NSFA 4LOKA 1XF1A 4YUVA 1I6WA 2FEXA 2RMKA 1ENZA 2XWSA 3W3AA 5E2IA 2V7GA 5CLFA 2ZRBA 1MCZA 2YIMA 1FP4A 1YA4A 3UV3A 1YK0A 4EI8A 1KI3A 1JFFA 1JG6A 3LCMA 4OB6A 1E1DA 1E1LA 2IYUA 1GSOA 1HWYA 1RLIA 2QZZA 3QPVA 4LNAA 1L5HA 5F76A 5C1PA 1HMPA 3TOZA 4GR5A 2YHIA 3BS4A 3TE7A 2O2ZA 2OLJA 1D3AA 2OGSA 4NDNE 3AR7A 4ZAFA 2AKAB 3CRW1 3IPXA 2BGIA 1KETA 1UP4A 4E2WA 1W25A 1JLMA 5JNLA 3DMTA 3RUPA 1Z7WA 4P38A 5CFZA 5LXTF 4MUBA 5T3UA 2AJBA 3T5MA 2DPHA 1N2EA 2A59A 2JHCA 2OY0A 3U4QB 3O4IA 5C8YB 4JLAA 5AD1A 2WSIA 1NPYA 1T4MA 4JKOA 3T3MB 4B17A 1KS9A 1T0UA 2C9MA 4FOOA 1BVUA 4FB4A 1K3FA 4CEHB 3HUEA 3BFKA 1PKXA 3VPGA 2MYUA 3AR2A 2UUPA 4PAMA 2JLSA 4C0XA 4I4CA 5BOSB 1KDRA 1CVLA 1RIIA 3U0BA 1A76A 5JLJA 1PHRA 1V2HE 2AA3A 3T7EA 1QKKA 4D96A 4E14A 4F06A 3V1KA 1KGDA 1ZZEA 2NO1A 1CF4A 4J8PA 5JBNA 4HATA 5J5VA 5K09A 1U9IA 1Y3FE 2QLMA 3EQZA 2NW6A 2RI6A 3M5CA 4OK3A 5FNVA 3ZDZB 4Y2TA 5DEOA 3W3AD 3Q9LA 2D1YA 3DYBA 4RYDA 4UPVA 1QGUB 4DLSA 2O8CB 3U3OA 3K5WA 1G9XA 3HB4X 4BU1A 2B8WA 4K9PA 2CLSA 1FTGA 3E5NA 3HKBB 4O2BB 5F77A 1QAOA 2F43A 1U2RA 4TROA 1VE9A 2I5PO 3WFJA 3EDRA 4ZKEA 3ICOA 3WLMA 2JLWA 2A67A 1PDOA 1J8VA 2HOQA 1LV7A 3P2YA 4UAUA 4MS3A 4FDMA 1KDTA 3LM8A 2IHUA 1E2GA 1KZYC 5CIQA 3QXJA 4S12A 1LW6E 4NICA 3ZK7A 2DERA 2HH9A 4YAUA 4G0XA 4TWJA 2QN1A 4LIPD 4GPZA 5AT1A 1T5SA 3EOBI 5IVHA 3KQYA 3GZJA 1ZD8A 2DG2A 1WEKA 3WADA 4I99A 2O2XA 1U0FA 1GA4A 3UUEA 2C9OA 1H05A 2IF2A 3FYHA 2FVXA 2I67A 1ZGHA 4QL3A 4Y6GB 1R8YA 2IA5A 1XYYA 1OH7A 4BZXA 4RIIA 1KKMA 2QHXA 1EVJA 1KP3A 2NYAA 3LRXA 5D7NA 3ZDCA 3QA9A 2OORA 3I3OA 1CIJA 1QHHA 1TRKA 1ZMOA 4N47A 4RMGA 4XVQA 4XJXA 5I7EA 5KAMA 4AMUA 4Q24A 1FRVA 1APBA 2P62A 2RGWA 3ZOZA 2VT7A 5AQEA 4ZCLA 3F71A 1F2UA 2V6JA 1M3SA 2R6HA 1ZM7A 2ZSFA 3QKTA 4J9UE 2ZM5A 3RDPA 2FN7A 3KVOA 4ZEXA 3NWJA 3GT3A 3HGTA 2NVBA 4YTEA 3PFGA 4NMHA 1W52X 2WZBA 4L4SA 4WLVA 1WDKA 3P9YA 2WTMA 1YR9A 3IP9A 4MDYA 3GDWA 4ZODA 4UQOA 4E6EA 3BEDA 4QWMA 3JWEA 3MOGA 2E4AA 3QELA 2Z98A 2OHOA 2B7LA 2BM1A 3BIOA 3FDZA 2REOA 2AN5A 4B6JA 3UATA 4L0MA 4BN4A 2JGFA 3M49A 5CT4A 4E5PA 1XTJA 3SNHA 1Q6ZA 4BNGA 1NASA 1E2NA 3E81A 2IP4A 1NVFA 1RBYA 2Z5FA 3VU1A 1EDEA 1DBPA 3I9V1 1ZD1A 2Z4RA 2I8AA 1R5NA 3HCNA 3QKRA 4INAA 2OZLA 4II2A 4QXPA 3MCWA 1EEHA 1ZJ6A 4JLWA 3NBXX 4IDOA 3IUBA 4F4IA 3KWJA 4GZLA 4MB0A 4F6LA 3KR2A 2E4XA 1U3TA 3DL0A 5FAKA 4LMPA 2CJXA 4O2RA 4WE3A 5KTYA 4LSWA 2HF9A 4DOMA 3AIMA 2H4YA 4FGZA 4HZUA 2WABA 1E6CA 2JZCA 1X7XA 1RAIA 1U5CA 1HETA 5AO9A 4GH5A 5F4BA 3PNSA 3KKZA 4H3VA 2K6GA 4IOLA 3NETA 4REOA 4BRUA 5TEVA 4OGKA 4Q47A 1WU8A 4C0SA 1RADA 1S7CA 5CYOA 3RC3A 1BDHA 3G5AA 3IE2A 5HVNA 1ISHA 1MAHA 4JVOA 3GLGB 5L40A 1L8XA 3N8GA 3C6XA 4OTZA 4LF7B 3MTGA 4ESOA 1DO0A 3RKRA 1XVIA 4ZC1A 1UAGA 4D6YA 3DYIA 2F3UA 1HNNA 3T34A 1Q3TA 2PKEA 5EJGA 3QWIA 3R7DA 3R3HA 1B8VA 2C58A 2X5XA 4X60A 4XWOA 8ABPA 2PUWA 3B78A 2WAMA 3WGJA 3HYSA 1ZHFA 1NJ8A 2XTJA 5DIZA 1ZM9A 4V02A 2NT3A 4UUPA 3E58A 1K06A 3VMMA 4ES6A 3WAJA 5IT4A 3RM3A 1LC3A 2WT8A 3JSXA 2WE8A 2GASA 4HR7A 5KREA 5C5DA 3FFWA 1DV2A 1SC1A 1X1TA 1PLKA 3E2PA 3KJZA 4OUKX 2EGGA 1P5ZB 3I9V6 2PX5A 2X0KA 1VPLA 3JAKB 4QHYA 1G5IA 4RD0A 1UJCA 3T5TA 5JD4A 1DIOB 4DA9A 4EPYA 3TB4A 4QGBA 1LBSA 4OGGA 8AT1A 1DADA 2VYCA 4HWTA 1L4BA 1UP7A 4WUVA 1IHPA 1YS2X 1P60A 2GJKA 4UMDA 4N5HX 1ZY2A 2A1TR 4MRVA 5AI4A 3SXUA 2PJRA 2VTBA 2QZ4A 1C9MA 3OTHA 3ZWCA 1CVIA 3HDJA 1PCXA 2VJAA 1CY0A 1NXXA 4QYXA 4XFKA 3GYGA 4MQEA 3F6YA 5J5CA 4B80A 4HLQB 1XWWA 3I53A 1PGNA 4OVKA 3PHGA 1AA6A 2FDCA 2Y0CA 3N53A 4PGAA 1H4VB 1WV0A 4RMHA 4YLGA 1BCSB 1UPFA 1NDHA 1V2GA 1Z07A 2HUNA 2VK1A 3KUXA 4M46A 3VX3A 4BX0A 2YCLA 4XYBA 3ZOKA 3WRXA 1Y0BA 3QP9A 4RBNA 2FZCA 4HH1A 4LJ4A 5D01A 3TSOA 2ZI7A 1IBLB 2E5FA 5EE3A 3TVTA 1KVUA 5LFAA 2XYGA 1T6XA 3N8KA 3PFHA 2O9JA 4B82A 4EW6A 4J03A 1AUOA 1EJ0A 1VMAA 1I01A 2GBFA 2OV6A 2V9CA 3P5BA 5AOAA 5EWLB 5LBTA 1I5RA 3D31A 3O3OB 1UFRA 3TQIA 1TYAE 1GNSA 1SHJA 3G2MA 1GG5A 3AF4A 1ZSVA 2XTAA 1XT6A 4NX2A 3BKWA 3WNBA 5MN5A 1O08A 4MS1B 1LKZA 4W1SA 3RS4A 1OT5A 3EDOA 2C7GA 4QNRA 4AP5A 1QO9A 4AN1A 1DG3A 3TF5A 1R74A 1B15A 1C8KA 1U0HC 2KJQA 2XXBA 1KDVA 3U13A 3D3WA 4Q4LA 4FDAA 1IAVA 4YJ3F 3L04A 3C2QA 5CJPA 2QX9A 3IUSA 4ZYWA 2GJ9A 3UUFA 4L2IA 1H2FA 2XOKA 1N77A 1MXFA 3QPWA 4RTPA 1T43A 3A27A 1J49A 3B1YA 3Q7PA 3GIDA 2VF4X 4CLOB 3K1JA 3WIVA 1MHTA 1KO1A 1SQFA 1ORRA 2G63A 4Y9DA 3CVOA 1W4LA 4LXYA 1SA0B 2NZ8A 5E6UB 1RWPA 5TS3A 4F7WA 5K3EA 4RU1A 2XUQA 2XB2A 4FNOA 1VP9A 3PFFA 5JNWA 4AZTA 1ZH0A 5LMCA 1AHNA 5EHIA 2OP0A 2P4HX 5CB6A 3DHVA 4AICA 2X2EA 3SFVA 4EYQA 1UK7A 5DSXA 3DZHA 1TVCA 3QE4A 2QN9A 3KEFA 4PYMA 1E7MA 4QREA 3SDZA 4G67A 2XGOA 2Y1EA 5DZSA 4LE1A 4RCYA 1SOVA 2GJ8A 1EAMA 1A72A 4QAJA 2MWMA 5HTKA 1QH1B 1LRJA 5GINE 4MYDA 3TLKA 1TQ8A 1NVVR 2CDNA 4PRZA 4EFLA 5AVZA 3EDMA 1WD5A 3BMNB 3M9LA 1NJSA 3IAM1 3M6LA 1W94A 4ETMA 1EXDA 2F1RA 5EAIA 1K7YA 4KXXA 7REQA 3GJSA 3ZDAA 1T29A 2J7PA 2V03A 2R5NA 2QL7A 3GF4A 2JFXA 2ONZA 2ZJ8A 4MVJH 4JB0A 3RT9A 5AYVA 2OK7A 2GVNA 4MO2A 4IGAA 2CXSA 1P3JA 4ZTBA 1F8XA 5ALQA 4P5EA 4RTMA 5KKNB 3U80A 5B3LA 1JH9A 2JGRA 4S2UA 4MAAA 5ALDA 1CSEE 2O6HA 4BO6A 1HV8A 2C2WA 4ZVOA 4DC9A 3A6HA 4FOLA 4C4SA 4J91A 1DDGA 2Y1FA 1U63A 4Y1RB 1WU7A 4RK5A 3SX2A 5MGBA 1TECE 3MIIA 1L5VA 3QBVA 4OJMX 2JIPA 1S9DA 4P6VF 1T5OA 5GP1A 3UMRA 1QF6A 1M2JA 1E9SA 1KJWA 1VFPA 5JUWA 4N01A 4EVIA 3O26A 3QVVA 2YIJA 4Z0PA 2IVZA 3ZDXB 1WTAA 1CETA 2JEZA 1PJCA 1GZHB 2ZU6A 1JPJA 3Q11A 1Z56C 3N7TA 1V11A 3OOJA 3DKPA 1JJAA 1DRUA 1KU0A 2BTOA 2JGDB 3JS5A 3ZV7A 1IN1A 3CNHA 5ALIA 5FOVA 3O93A 2I6XA 2HHLA 2WAOA 4HZIA 1DFHA 3EIEA 4INZA 3HCOA 4LXGA 4CM9A 5C8VA 2JCSA 4FFRA 2XNDA 2P2LA 3HPQA 4IO0A 4LI3X 4QIHA 1JLKA 3EZLA 3RLFA 2MSKA 5F7ZA 2J9YB 4WDRA 1VLJA 4TTAA 3SSMA 1W76A 4NFLA 4M89A 3EFHA 1RXCA 4MCHA 4OCZA 2J0VA 4QYIA 4WCVA 1AURA 5K99A 4RPGA 2QDXA 1UEJA 3EVZA 4PCAA 4QO7A 5ALMA 2OKGA 4Z0TA 3T9FA 4CKBB 4P2GA 2AJTA 1VCHA 3ASZA 3FBWA 2VRCA 1XQYA 3P9CA 1R6BX 1TQ2A 4K9OA 4G0MA 3DZCA 1XE3A 3OZFA 4B7ZA 3U3XA 2DY1A 1Z6ZA 4X1YB 4FLFA 3F3KA 4F4CA 3IAM6 3R0VA 4RDCA 2ZB7A 5LZ2A 2I71A 4XWAA 4EJ6A 1K7EB 4R8VA 2C7BA 3CLUC 3AL0C 1KNXA 3EXG1 4FEGA 4JAVC 4R2LA 3SS8A 3QOWA 4JI2B 2PX3A 4O8CA 4YRDA 4Z6KA 4PWYA 4KLZA 3L0OA 1OC2A 5HKBA 5CVCA 3ZW7A 2OESA 4QVKA 1ABFA 3IPCA 1ZC3A 4RPKA 4QICA 1IM8A 1ZH8A 1TUIA 2Z56A 4GYKA 2QNRA 4GI1A 5D3QA 3SJAA 3UJ9A 1PR2A 2O0JA 4CBVA 3GLFB 1E18A 2WUFA 3I42A 2AKYA 5TX7A 1YFLA 3MB5A 4ZCRA 4MEAA 3ZYCA 3K6RA 2OYCA 2BIFA 2ZE5A 2FW9A 1YR3A 5DNUA 3H97A 3OQVA 4J3NA 2BFCB 5BUSA 1GQQA 5JD5A 2QVGA 2ZYDA 3E7XA 4JUCA 4DG5A 3NFYA 2DPLA 4HYYA 1Y8AA 1T5TA 4IDCA 4Y9UA 5AI8A 5DOZA 3BSWA 1ZIXA 1CUFA 3TOVA 4I5DA 3EZ9A 2IWRA 2PMKA 4YJ3B 5IM4A 2XUPA 4YGYA 4EJ2A 1PAUA 2ZI9A 3QPCA 2VAWA 3OY2A 1OJLA 4BQIA 1G8FA 4DR3B 3N2YA 2XNHA 4HGQA 2AGVA 2IU3A 4IEFB 1RD4A 4L8LA 3CZCA 3DG9A 3BA1A 3LLSA 1VKRA 1Z88A 2JIRA 2V55B 4EY6A 1EX7A 1O54A 1SCKA 3EXIB 3IR6A 3NAMA 5ADVA 3FOFC 1FQKA 5CG1A 2OHJA 3ZPXA 1C14A 3O0TA 5TEWA 3H8JA 3X1MA 4QZVA 1IG0A 1F20A 1WHTB 2VZEA 4JR2A 2X1LA 2K2WA 2X5OA 2UYHA 4ZEVA 8ATCA 1TAHA 3W2TA 5BSHA 2BFAA 4C1NA 2V54A 3UB2A 3CYFA 7MHTA 3RVDA 3H04A 3ZJ4A 2G1JA 3C7TA 1FFEA 1J20A 1TM2A 1XTRA 2ERCA 3COWA 4PPYA 3TMYA 4F84A 3V8EA 4E11A 2GRJA 1II8B 1TJ4A 1WWKA 4DNFA 4U39A 5JYDA 4MRMB 1E1NA 4XTRA 2PVCA 3DDWA 3IDAA 1TT5A 1RIFA 4RQUA 3VU9B 4ZYZA 1RZRD 4D4LA 3K4QA 4GR9A 4JXJA 1M2OB 3KT0A 2D06A 4YAOA 4E6PA 4EAQA 3JVEA 1UK8A 1K5GA 1BFDA 4R84A 3VOBA 4YJ2B 1DQNA 2DFNA 2QLBA 1KEZA 3QENA 4J90A 3GIWA 4NJEA 3PNVA 5GJVC 2VPIA 3WTCA 5DM0A 2BI7A 1C0IA 4OHPA 4W63A 4MMYB 4D3XA 3NHKA 1Z28A 2AXPA 2XY4A 5HSGA 1TO1E 5AK5A 4QYTA 3LHSA 5BO5A 2ISSD 2P3OA 5E4YA 1FXSA 1G41A 3I8XA 1MH9A 4HDKB 1XWFA 3DO8A 1YH3A 2LUOA 3L93A 1MQSA 2IPLA 4MVJP 4R98A 1YB6A 2IP1A 1KAEA 2O23A 4BFVA 1M1ZA 4C3UA 1A9ZA 4E51A 5C2JB 1TLLA 1JQLB 4RV5A 3VO1A 4WV3A 1MORA 4D25A 3AR6A 4PG8A 4PTZA 4RK4A 3HH8A 2IYNA 3PGJA 4JLJA 2RHCA 3JSAA 3WIOA 4K9KA 1X39A 4GMFA 4JR0A 1VG9B 3KOWA 4O4IB 1ZH4A 4MARA 1XI2A 2Q5CA 4BFUA 5LA6A 2XV1A 4C14A 1CE8A 3CFYA 5TXGA 4IJUA 4KLRA 3DMPA 1XAIA 1X8XA 2PRZA 1M8JA 1YUNA 3A1SA 4O1HA 4JOCA 1KH2A 2OC4A 1DKMA 3ELUA 5C4GB 2R48A 1ZOPA 4MQ6A 3HQ4O 3QQPA 4IKOA 4MV3A 1AG9A 3IQWA 3KWFA 1T9HA 3KTFA 1VJGA 1W2WB 3ABRB 3LFTA 3TWOA 1J33A 1G9SA 3RSGA 2DM6A 2BI8A 1PZHA 2F2TA 2FRDC 3OZDA 1S1MA 4IIJA 3WDMA 1I24A 1Y6ZA 6YASA 3WLEA 1H23A 3D0KA 5IKMA 3JQPA 1IIRA 3N70A 5CMLA 1BE0A 2CCKA 1JIKA 5IUNC 2REXB 3CF6R 3EASA 1B3BA 3GLKA 1Z0ZA 4B7AA 1M2EA 1R9NA 1YK1A 4FOTA 4J7UA 5FLXA 5CG2A 2HF7A 2QQFA 1EJ6A 3RVNA 1OWLA 3I30X 3U7GA 4FC6A 5E9AA 4PFKA 2BKXA 2W2XA 3FH0A 3KV3O 3QFHA 3VJKA 3LX6A 2ODNA 2OAEA 3CX4A 4B31A 2ZIAA 4PC3A 4AJKA 2WNHA 3PLRA 1ABBA 4XJSA 2HHHB 3VPAA 3R9KA 4LYEA 1CLEA 2PSSA 4GWKA 1LLUA 3BE4A 3L92A 3N9IA 3WHIA 2HRQA 4YUXA 2ZSDA 2F3SA 5I9NA 1O6CA 3AL3A 3ZHZA 5CH8A 4BDSA 3G88A 3G1UA 1ZAYA 2X19A 1AXEA 1T8WA 3LGAA 3PRYA 3A1DA 1RXIA 2AT1A 1Z82A 3DXZA 1QIIA 4XZ3A 1LPPA 3WYCA 1GFSA 2EWMA 2R7MA 4Q7EA 2RAUA 8GPBA 4S04A 1BW9A 4HPXB 3UT6A 1FFBA 3BX1A 4B3DA 621PA 2D7DA 3KL4A 4P7JA 1HDEA 2GRUA 4WXYB 3IKTA 1MFZA 1C8LA 2Z0MA 3A9WA 1E3LA 4NZYA 4DSAA 2CMGA 1PBTA 3CVUA 4K0KB 4DSUA 4EK9A 4WNCA 5D00A 2EEZA 1XN4A 4QPZA 3CURA 3UXEA 2LBPA 4NSNA 4RZ2A 2PXAA 2NAFA 1IN4A 1C7RA 2O6LA 4CG3A 3UH0A 4U2KA 4AMVA 4JI8B 2WVGA 2YJTD 1VP3A 4YK7A 2CXXA 4M83A 5ICFA 4B4VA 2ANCA 5H4GA 1NXOA 5FNZA 1DC8A 2R6JA 3PI7A 4MIEA 1PW7A 1GGVA 4EBBA 4JV5B 4G5XA 1EGAA 3D0OA 2AN3A 5I7OA 1I7QB 1EA7A 4KPYA 3QVWA 4MVJF 1F6DA 2B8EA 3FROA 1QB8A 3IBGA 3H3FA 4G1FA 4HL6A 4PYIA 4CLRA 2G40A 5JHHB 3SHFA 3ZCVA 4L6CA 2BF4A 2I1WA 4J07A 3PKJA 5LZ8A 1Q12A 4DIMA 2RG1A 3OFVA 2H7VA 4O0MA 5DB4A 3JQ9A 4IZ6A 4B6PA 3DMRA 2J9FB 1WVMA 1V8BA 3KHUA 4MR7A 2EJVA 3AI2A 1T9KA 2VDNB 2I3BA 1SG6A 1NFQA 2FHSA 3DJFA 3IODA 3MOSA 3OM8A 1EZZA 3BVPA 4HWOA 4M0PA 3S5JA 4LFAB 5KQPA 4HEA1 5AMXA 5IAAA 1E2BA 2N47A 1N2XA 4R8RA 1KI8A 2PH1A 4WXRA 4JBNA 5C0OE 1EUDA 3PEYA 3KDSE 4E70A 4WDQA 1JF8A 1TC2A 4AYTA 2V4MA 3TRDA 3HDQA 2NV2B 4R3NA 1G9TA 1DCKA 2HSWA 2YJGA 3ORQA 2W7TA 4RNCA 4N76A 3FR7A 1JILA 4W5JA 5JCPA 4BEJA 1L7VC 1RLJA 4K05A 2PKQP 4HDAA 3CUUA 4UE6A 4EG7A 6ABPA 1QP4A 5TT1A 3PHIA 2DKOA 4PC7A 3BRWD 1A4XA 1M1UA 2FP4B 3D3EA 4RW0A 4OHOA 3HVKA 4J0CA 2XIQA 5DWVA 3UMSA 4DJ5X 5E9QA 2R62A 3ND8A 1GU7A 1SCJA 4C2TA 4EUKA 3DM9B 1F9AA 2O0HA 3NBYC 3SHVA 3U26A 4XRRA 4MWZA 2HU2A 3TZQA 1CP3A 2ZU0C 3G5TA 1UPTA 5DBIA 2GHRA 2GTPA 3FJYA 1KFJB 4G1CA 5CVJA 5E9JA 3S8YA 1QOZA 4AQ7A 1JI3A 2GM5A 2PCJA 2GK6A 4LSMA 1TUEA 1YCFA 2NQ8A 1EEXB 3CXUA 4X94A 3RIMA 4EZEA 5ICEA 5LU8A 5DHFA 3W9UA 4CG2A 1RHMA 2RI1A 1NSTA 2OXCA 3E18A 4QULA 1N3IA 3ZU5A 4M3NA 2PHZA 1QGZA 4MLDA 1TA9A 4BXOB 3OT1B 1XL1A 1A97A 3A2KA 3E5RA 4C87A 4FSHA 3V9PA 2R751 1BVYF 3QOFA 3ACDA 2P7HA 3HEBA 2ILVA 4NK4A 4EPWA 3NT5A 3AY7A 4H7IA 4OJKA 2BZ1A 4QEKA 3G13A 1UBCA 1QAMA 1W59A 5IAJA 3QFFA 3SYTA 2J5BA 1P61B 4YAGA 5LQMA 4JROA 5DM70 5ITVA 2QUKA 2Y66A 3PZBA 4HEA6 4X54A 4M0CA 3BGIA 1H5NA 3PRHA 2FPOA 1OTHA 1TMYA 1RWNA 2XMBA 1FFGA 1A77A 3D02A 1R16A 3L6DA 4KUGA 5DYYA 4R9SA 3RVJA 4DCOA 3OO0A 1X7DA 4FW8A 1IC6A 2QTMA 4FZVA 3CLTC 1G8SA 4WNYA 1C3OB 1ESEA 1ETUA 1YASA 4CL2A 1C8BA 2GNPA 1V96A 2JK1A 5ECWA 1EFHA 2ZSEA 3KXPA 4KSBA 3DAPA 4QOJA 5ED0A 1I2DA 5HCIA 3G1TA 5IUKC 1WBJB 2ZPUA 2NUAB 1SO8A 4OP3A 3VPSA 4Y6LA 5C4IA 3R3ZA 4Q1CA 4F5WA 1IZ0A 2EC5A 4TTVA 1PSWA 3PICA 2NP6A 1OH6A 1L5LA 4BLSA 1V1MB 3QHPA 4CM1A 1Z68A 1E5XA 1FL9A 3GC6A 1KI9A 2J9XB 3IIMA 1RM3A 2FY8A 3EAFA 4PSDA 5B1DA 1KFCB 2WPNA 3SF8B 3PYXA 1YHNA 2DTXA 2G4LA 4N9QA 1JI0A 2WWGA 5FWXB 3HR8A 1XYGA 2C54A 4AUEA 2B4KA 5HEKA 4KAFA 5JEDA 3DKIA 2AG1A 1C9JA 2ACVA 4HG2A 3WMEA 1HYBA 5HJ7A 1VZ2A 3URMA 4M49A 4DLVA 1E2JA 3QTBA 4LOAA 3HRIA 5TDHA 5MGNA 4B7UA 1AZLA 1FYWA 2XMSA 3B36A 2EG9A 3BE6A 2XI4A 1PZMA 4MROA 4Q18A 2QQEA 4A6XA 4NV0A 1S2IA 1NQAO 4AO7A 1S89A 3V8BA 5EIFA 1B00A 3ZS9A 2R79A 1VA5A 3I73A 2BFDB 1ULZA 1P91A 1DJOA 2QE6A 3QYFA 2X0FA 3H84A 4WKGA 3LQ1A 4E0BA 5L4LA 3KOYA 1F2TA 3HFRA 2EJTA 4NPCA 2VIIA 4JI7B 5C34B 1ONNA 3ELBA 5YASA 1PFGA 1KJZA 5CLGA 4HLUC 3JQRA 5T7BA 1Y5LA 1CR0A 2CLEB 1VECA 1BG6A 3E84A 5LB2A 3ZYZA 3O9VA 4KLNA 2ZRGA 4QAQA 4QQRA 1PLJA 3V7YA 2JJQA 1QAQA 1R9MA 5CITA 2J6IA 3KUCA 1NMQA 1B0AA 2ZJYA 4PSVA 1ODTC 3IUYA 5EJ5A 4GKBA 2X8JB 5JH7F 3TIIA 2H2WA 1YKGA 4GKAA 3SYMA 2XB9A 5HQJA 2QWXA 2H08A 4AWXA 3MZ0A 2ZJ7A 5AXCA 3W8RA 1ODLA 3RS5A 2VPPA 3LF2A 1R0BA 3E9YA 3NWBA 4GXTA 2JHAA 4GYJA 2H5LA 3IMGA 4QBGB 1YZNA 4GFDA 5FUBA 1PT6A 4AAYA 2R86A 2BTQB 1WDWB 1YR7A 2B5VA 4OQZA 3OT4A 1JVNA 1UEXC 2CVOA 3ZJYA 3CNLA 4LXXA 3ZU3A 5F73A 5AVSA 3PDIB 1B2RA 2RGCA 1DUVG 1OLSB 4LJSA 4Y2VA 4FB5A 4MUYA 5BPHA 4AL4A 1P74A 2GBGA 3PFIA 1Z0KA 3L4SO 1NZDA 3QF4A 2B5WA 3HP7A 1F4PA 1BQEA 4G5OA 5DGXA 4D8XA 3EC2A 4N0PA 1XPOA 4NULA 5CAEB 5TQ2A 4IWYA 4U2DA 3UAVA 3VUEA 4HMQA 4NABA 2PS1A 3D3JA 1FYDA 2EL7A 2CZGA 5BVHB 1AO3A 3C7DB 1V1RB 1YDWA 3DQQA 1L8QA 2OXEA 3QE2A 4U7HA 1G1AA 3M6XA 2OXRA 3L0PA 1CD5A 2GM4A 5LIRA 4P4NA 5KNBA 1X3LA 4O29A 2I9PA 2E6KA 5DBOA 1H85A 1NNSA 2OK8A 2ZIZA 3A1EA 3EULA 1OWMA 3BICA 3LC7O 4G2NA 4DV2B 3KB6A 1QHNA 3UJDA 1KVQA 2QF7A 2L42A 2PD6A 1JAXA 3A06A 3BD8A 3QWFA 5DGIA 1FSSA 1CUEA 4P3XA 4PGGA 5A7HA 3W2GA 3VYUB 1S8FA 2QPLA 4ER6A 2WIAA 1L7XA 1NQXA 1E3SA 3MM4A 2W2LA 5BQXA 4JLOA 2GAOA 4ZI2A 1WZEA 4PZLA 3O8OB 1UM8A 4Q9LA 3DOCA 2ZDHA 4FONA 4NAVA 3VTAA 4B4WA 5EVJA 2GEUA 4CV1A 1Z63A 2BKUA 4X41A 4CF3A 1U90A 1GTRA 4NEHB 5IFKA 3IUJA 5AUQA 2I33A 4G5HA 1CZKA 2D1TA 3KUDA 3CEHA 3HVRA 4IIEA 1Z4KA 5I47A 2F1OA 2E37A 2Y0PA 3IURA 4L3WA 1ZVMA 1YE8A 2A88A 4IOKA 2ZUTA 3BDVA 4OYYA 2DQYA 3OIFA 4FYYA 3GNSA 5BUZA 2IZ5A 3GRPA 1N9KA 1X87A 1YDGA 2JGEA 4MV7A 2BMVA 4UUOA 2FFAA 3O2JA 4QBHA 2AN1A 4G9EA 4XM1A 3GA0A 2IHJA 3OCJA 1KYVA 1VLZA 4LDNA 3PC8C 2H1VA 3CH5A 4TWZA 5FI0B 3SZUA 4EI2A 3QLJA 4FGUA 4U02A 1PE0A 1J0XO 1EFPB 2BEVB 2ZI5A 3NVMB 3H2SA 4G2TA 3KWLA 2WTEA 2BLLA 1CY2A 3QOXA 3SS9X 4ID3A 4A2QA 3EXHB 4M0FA 2B0JA 2B61A 4O25A 3LY8A 4TXHA 2AMJA 3CKKA 3L46A 4F93B 1E6LA 3M3PA 2V6FA 1GL7A 1QHGA 4M37A 4DRXA 3OFND 4ZV4A 4QG3A 1EYZA 2YQZA 4M8NE 5T4BA 4XM0A 2AFIE 1K89A 4QBTA 2OMKA 4JKIA 1HTBA 2CJYA 4F9FA 5A9RA 2QP9X 5J4YA 4XGQA 2DHEA 4JSRA 3C5CA 1T2FA 4OG2A 4HNAB 1YS4A 4OB8A 4YAWA 1U28A 4HB3A 2XXJA 5J2UF 3CVVA 4D46A 3NEAA 3N2EA 4D80A 2H3HA 3D54D 3FDXA 4RK1A 4TX1A 4U00A 3WX0A 2XQKA 1VSQA 4O4JF 5I7FA 3ZHTA 3VU8A 3WHLA 1ZGAA 1RHQA 2CLMB 3CF4G 3FUUA 2J9GA 3SZMA 1SXJD 1YF3A 3SHTA 4C6TA 1OGJA 2D4AA 1HRKA 2EHDA 3A9SA 4M1TA 1HMYA 3H5WA 2BKLA 2JJ2A 5AVRA 4LG1A 2IRWA 4RA6B 3RVKA 2VYVA 3TS1A 1CQJB 4UM9B 2JLQA 4IZIA 4JB3A 1MDBA 4MIYA 4MR8A 2IBTA 3JQ8A 1A9RA 1EI9A 2WZCA 2GVZC 2IODA 1JTEA 1I9CA 4IQ0A 1I7NA 5A4AA 1EJ2A 1G21A 3EDYA 3FKQA 2VT3A 3ETDA 3FWKA 4J2HA 3REGA 4IHAA 4AJJA 1QU2A 2QVYX 3EPJA 1Q2UA 2P41A 1N2JA 4IAOA 5DI9A 1QMGA 1OSNA 3KOOA 2IF0A 4EJSB 1K8XB 2FPSA 5FBHA 2UXDB 2FZ5A 1U1CA 1R5OA 2IW1A 3MAGA 5LMUB 3DSRA 5ISMA 1UJ6A 2OE2A 1L5ZA 1TPZA 1OA1A 3P2MA 3DE2X 4US1R 4XXHA 3HCEA 3FDFA 3G9TA 1RRMA 5DULA 3F7OA 1GQSA 1V16B 4KV7A 4JLMA 4EMSA 4RHXA 3TRFA 2O14A 1XTIA 3WIDA 2ZBEA 1C1DA 3BIJA 4EL0A 4ALLA 2V6GA 3LYLA 2WE7A 5D3ZA 1KAMA 1W36D 3QMPA 4FYVA 5JAUA 4CL3A 2YDYA 3FGOA 3AVUA 3A4TA 3IEUA 3K5IA 3GPCA 3MG9A 3BH0A 1EUCA 4OLJA 4QOIA 1Y5RA 3THXB 4HXGA 4KO8A 4XYLA 3AFHA 2O07A 4X00A 2QGZA 4KITB 2JG3A 4ZQIA 2JBWA 4UNNA 3B70A 5F2OA 4DDWA 2HYDA 4G01B 4YQFA 1HFEL 3G0HA 1EWKA 1K0FA 4FINA 2I6UA 1LBQA 3GZ4A 1P2UA 2HRCA 1PYDA 3MK31 4JEUA 4D97A 4DJJA 1NATA 1Q19A 1E89A 4AECA 1KI6B 3QTLA 2PR2A 4UARA 1IOLA 2WWVD 1JIJA 3A3KA 4D3SA 5JMOA 3J81k 1S8NA 2PZMA 3PX7A 4XUGB 3IXLA 1I6LA 3QA3E 4NAHA 4EMBA 1CUDA 5BXQC 4FS3A 4DV6B 2EFHB 1Z47A 4GGMX 2IOQA 4MCAA 1LY1A 3DTNA 3EPRA 3DWFA 1MOQA 3G82C 3GB9A 4J1TA 3AEZA 4ZKDA 2QJOA 4RS3A 4B7XA 1UXJA 3FTEA 1YIDA 4HQNA 4ER5A 3U5TA 4GM1A 1UKZA 4F1KA 2H07A 3CT6A 2OCGA 1GCGA 3QITA 3FXAA 2VOEA 5BQOA 1NBMD 1SHKA 4WKNA 1Y6QA 2BCJQ 2ZPTX 4XFDA 2F55A 3E4CA 4OK6A 1XMQB 3F3YA 3ELWA 3CB4A 2FUEA 1KH3A 1YULA 3T0IA 3WB9A 3IYLW 3NIBA 4R8LA 2WMNB 3A1NA 3IKMB 2BFWA 1LS1A 3F4BA 3JWGA 2ZAIA 1ZESA 5KAPA 4ZHSA 1W46A 1G20E 4DF3A 1KI1A 4G0ZA 1NYTA 1V5IA 5GM1A 3NOXA 1MGPA 2IH5A 2C29D 3JY6A 2I91A 3O4VA 3GWZA 5IAOA 1SBQA 3GJZA 3T4PA 4NYJR 3UJ3X 1RYDA 4LHSA 4TMWA 4DNPA 2AMLA 2H7CA 4H7KA 1G8AA 4ZQFA 2IBMA 2XUDA 4ISCA 4EG4A 2OFXA 3RLIA 2R68A 4FYHA 3VI4B 4Q4AA 5FA6A 3UJHA 4TN5A 1RAGA 3N0VA 3TIXB 1VJCA 2RC6A 1QUFA 4J2OA 1SIBE 1OV6A 2A0XA 1ZD2P 5EIBD 3HKCA 1M33A 3AGQA 4EO7A 2O8FB 1R6TA 2L82A 3UW3A 4NH0A 5KOJA 5JVDA 4P7BA 2HT6A 4PYKA 4ATNA 4CDGA 1Z37A 1TDJA 1O96A 2JAPA 4MUFA 1XZBA 3SHWA 4JGGA 4NFHA 1NT4A 1UP6A 2VLIA 3KJHA 1THGA 2LTAA 3WLLA 4HPWA 1CX9B 2PL3A 2Q5FA 3FGPA 2RGEA 3QHAA 1G2OA 3C7CB 3PNKA 4GEGA 3ZCSA 1EINA 3FZNA 1R8SA 4N0MA 5JS6A 3TD2A 4H77A 2Q4BA 3OKFA 1MR3F 2OCBA 3AY3A 5KSZA 3LBIA 1J4AA 2ZJ4A 2VEOA 2C78A 4AYWA 3E8XA 3MTQA 1FX0B 5DYIA 2PUDA 4UVDA 1LF0A 4FMBB 4U5QA 2V6MA 2I6TA 3D3NA 2HBRA 1FDUA 5DTMA 1AKQA 5LOVA 3LCJA 3RYCB 4KXNA 1RVV1 2XQFA 5FOWA 4WHMA 2W0MA 3H2JA 4WY5A 1UMCA 1KQNA 4BEVA 3SP1A 4F46A 5J4HA 1AUXA 1KH1A 4ZICA 1VB3A 3C3JA 1EQ2A 3G2HA 3ZJVA 1JMYA 2A0KA 1L5FA 2O2SA 5JJKA 1JT9A 2P7IA 2QZ9A 3Q7RA 4DA6A 5C1OA 5DXFA 4B6QA 3KTOA 3MLBA 4K7JA 1Q7BA 2ESRA 3NHLA 4WOJA 4X45A 2HL6A 3IEIA 5TE9A 4DANA 5IXYA 3F8WA 5TC4A 4H2DA 5D5HA 1F0KA 4QTUB 2X58A 5D6OA 3PL5A 5TMEA 3TKLA 4KFTA 5IU6A 1L5OA 1NTOA 3MMSA 4OXXA 3N2ZB 3TAXA 3GYBA 5T5QA 1ZINA 3TCXB 2WSSA 3EXFA 4LRTB 4BO3A 1L8AA 2YL2A 4FDTA 2ZJ0A 4KSYA 2VT2A 4Z7QB 3M2PA 1HBJA 1KY2A 1N5KA 2YRXA 4KGZA 1ZOOA 3SXPA 1XQXA 4DM4A 3BM5A 2PWZA 4KBGA 2AFRA 5I51A 3H7IA 4FFSA 2C5FA 5BNZA 3UH1A 1VHTA 1QE3A 3H3XA 2OAQ1 3L0ZA 1J2RA 1AS2A 1MX3A 1HDZA 2H7YA 3FNHA 4LZZA 5DMXA 1OI3A 5J1TB 5TV2A 1P2VA 4XASA 4C4AA 4YRKA 2C0CA 1TIBA 5DW0A 1GUDA 2I1VB 2P30A 3Q88A 3T35A 2ZE7A 4FDLA 4MRAA 1GRQA 4KI0A 3RS9A 2CK3A 1OFVA 3ZVNA 5DTQA 1E79A 3FD8A 3NM4A 3KNZA 4RQBA 4DRZA 1ZN9A 4B48A 2I7DA 2ZYUX 2GTIA 4LF8B 1JJBA 4KO4S 1U7XA 3T9EA 2VI5A 1QRRA 1UADA 3H1PA 5F1YA 3ZW8A 2J9RA 2MR6A 5KMGB 5REQA 3VKUA 2FPGA 3QX8A 1S0UA 1C7EA 1SKUA 5HQTA 1ZA1A 1G2IA 3KLMX 3P9PA 1NLUA 2LKCA 2QVBA 5BRJA 1A9YA 1JZSA 1VMDA 2CJFA 2H0QA 3PQ7A 4KQCA 2P90A 3C5VA 3FETA 4EENA 3D7MA 4P3YA 4K0RA 1F8YA 3CIFA 3IO3A 1BMFA 1ID1A 1EFTA 3BN3A 4UEJA 4Z2YA 3PKZA 3NKVA 1Y81A 4FFOA 4RLQA 2HPAA 2WHEA 3W8FA 5JRZA 3C4JA 1RU3A 1KQPA 2A5JA 3FTPA 4MKFA 5EXPA 5SZJA 1DO8A 3JQEA 3ZHBA 1YI8A 4TV8F 2FWIA 2X42A 4YRQA 2G06A 2D3TA 4F56A 5BR7A 1AU9A 2VDRB 3IOCA 1QGAA 2QRVB 4NOLA 1UXGA 3TN7A 2WVHA 1O0BA 1EHCA 3SC2A 1KJQA 3M6FA 4X8HA 1T5LA 5A5EA 1JHDA 4QRIA 4WGFA 3NHBA 3VSCA 2JGKA 4Y6PA 2CK3D 4DG8A 1XRLA 2VDPB 3WFIA 1PSDA 1XC7A 3THYA 3NHYA 1GGMA 2CZCA 3G5LA 4HUJA 3H6KA 4TMZA 1FPQA 1E1MA 1SHTX 2I1LA 2QXUA 4NU6A 4U9HS 3C8MA 5E1DA 4IJQA 1ACJA 3EGVA 3ETNA 2Z83A 4HB0A 5CDFE 2VDJA 2JFHA 3NTVA 3ADOA 5KOHB 3RFFA 2VSYA 3ASVA 4PFQA 3E03A 3LCRA 3JWIA 3BGOS 4W5QA 3G8BA 1TRHA 1CB7A 3OKAA 5EYPB 1CK4A 1Q1EA 1UM9A 2B25A 3BWCA 3GOQA 5AI6A 1OLOA 3SHOA 1PVDA 2CHQA 1WUHS 5BYBA 1R0WA 4NARA 1A5ZA 4RHEA 3ZVKA 1K6MA 1W5BA 2J3HA 3GL9A 3WISA 2JH3A 3O74A 2PFSA 1SU8A 1UDRA 2VWHA 3IXMA 3O90A 2AOTA 3L8CA 3U7QB 5IKEA 2RGYA 3V8QA 4A82A 4DBLC 1ZRHA 2V8BA 1RQ2A 1V0JA 4MH0R 2BFOA 3LIIA 3DV9A 4PX9A 4BUCA 1KJYA 4FYKA 2QEQA 4LXUA 4RNDB 3IMCA 4ARBA 3MS2A 1Z8FA 2PLWA 3TMKA 2IHTA 3JW8A 1GSAA 1MX5A 4IZOA 1PG5A 4GS5A 2JF0A 2A1UA 1KSFX 1PEKE 1Z2OX 3KYDB 4BFWA 3HCDA 3H16A 4PNZA 5AVTA 2GN2A 1T9GS 4ZOLA 4JC8A 1X1RA 1GSIA 2V96A 4MPPA 4TTQA 2L19A 4KFUA 4TLAA 3C24A 1C1YA 1D7OA 3EIFA 4JVMA 2Q07A 3B60A 4HZGA 2ZSUA 1I6MA 3PVZA 2W71A 4ENSA 4AY5A 4JBYA 2Q1UA 3OUUA 4LSZA 4KL8S 4MULA 4PICA 2YIVX 2LCIA 4AURA 5K0FA 3QUAA 1EDOA 1KMMA 2P4EA 4OLHA 4TYQA 2DC1A 3DTVB 3CS3A 4LXQA 4DS3A 4EHDA 1SC9A 4HLDA 1D2EA 1I2CA 2Y9PB 2PZKA 1NXPA 1RP1A 4IVQA 3D3KA 3HVIA 5COBA 3T1HB 1HSOA 2I54A 2Z43A 1TVEA 2W43A 4WERA 1U3UA 1RPAA 3UKDA 1E62A 2W2TA 3DVLA 3LLCA 1QKJA 2QZPA 2IX9A 4E5YA 4Z54A 1C81A 1XAJA 4MA4A 5JHGB 3N2GB 3MTJA 1JEYA 1UWCA 4A10A 5AJWA 1SIOA 3W3AH 2HBYA 1R27A 3U2QA 1YOBA 1RM0A 3KKEA 4EBFA 2PO7A 5E6SA 5J2TB 1T3SA 1B41A 3VR6D 1D1SA 3GFGA 2ABWA 1Z2NX 2BY4A 1O6GA 1IU9A 1QRDA 5KVSA 5A4MS 3UEOA 1HE1C 1NMXA 1SOMA 3BXPA 5EP2A 4HH4A 4EUFA 2C4UA 1K6IA 3M5WA 3DOIA 4JCCA 4NU5A 4DW8A 5KYYB 3RAPR 3P20A 4EGQA 3NTUA 4Z4QA 1S9HA 3QEMA 4D5GA 4I8XA 4U9UA 3WC4A 3G79A 3X1YA 4NENB 3W9SA 3OX1A 2XF2A 1A9TA 2ZCUA 4V1CB 3A1VA 3HCRA 2IEGA 1QDUA 4EPTA 2IV3A 2O5RA 1B93A 4Z1MD 4ZGBA 3FYUC 3GBVA 2SNIE 4I4IA 3W5AA 4ZMBA 3U3RA 2FZVA 2E89A 4RMJA 1VLLA 1SCNE 3OQOA 3QE9Y 2I4IA 1NQVA 1FP1D 1SVIA 3BK1A 1ZGZA 2AZDA 2W4IA 4DGSA 3O8LA 3X1KA 3FVTA 5EWMB 5H80A 1W1UA 2SHKA 4Z9FA 4HNRA 4V1CI 1Z22A 1KDYA 1BU5A 1XBTA 2XDYA 3IP3A 2I6SA 3NH9A 4PLCA 4TV8B 4PO9A 2JAHA 4YNBA 2QGFA 4ZI5A 1O0CA 4DARA 1N5JA 1AUQA 2I78A 4FD2A 1NYRA 5A3VA 5FORA 4D0GA 1TTPB 2HQOA 4I5FA 4DABA 4QECA 2X0DA 4ACBA 5KVQA 4Q3NA 1L3IA 1Z5VA 2GD0A 2AJLI 4ZMRA 3DEYX 1XTSA 2VSQA 3IAAA 1VJ0A 3ESDA 2HD4A 5CPBA 2WZQA 4H31A 2FEMA 4D6XA 4OHKA 4EH1A 4UBJA 1N2GA 1HSZA 2WZDA 5AKIA 5KOHA 1U02A 1KNQA 1W85B 4LGCA 4CIXA 2WKRA 3FJOA 1SBHA 1I4WA 5F9FA 2D00A 1YCDA 4HH3C 3PGKA 1HO3A 4NBUA 4F04A 5I7WA 3N7UA 1CP2A 3ENWA 3KHTA 4JT9A 1XCLA 5B64A 2QMQA 4CM8B 4KCGA 3F6EX 2AG6A 2ZZKA 5BP7A 2RHWA 3ENVA 3DULA 1SUEA 4HMOA 3AESA 3FVVA 1A98A 3E4DA 3LP5A 4LNHA 5AVVA 3L1HA 4OU5A 2J08A 2WJGA 1A88A 3FSRA 4GXQA 4M6WA 3KLNA 1S7GA 5K8IA 2O8DA 3KYCA 3Q5EA 1K4MA 1MXHA 2Q29A 3I04M 3G8CA 2DLCX 5HS4A 2Z1NA 1H94A 3IRUA 2GTHA 3B7PA 1DBSA 3OLXA 1LVUA 2JGJA 2HCTA 4RD6A 3USZA 4HS4A 1SKYE 1HFJA 5AK4A 4YUWA 1O94A 1N6OA 1IHXA 2H8GA 2W70A 5CK5A 1GKKA 3OZIA 3EMVA 3VKWA 4BO2A 3R9XA 2W00A 1NHWA 1UPUA 4MW7A 3J7TA 1ZUNA 3HGMA 4V24A 4AWAA 1DG9A 1SVUA 4TZ6A 5GWXA 3TRJA 3MQ2A 3VR4A 5B3AA 3V9AA 5LDDC 2CF6A 1L8OA 5AW1A 2WVAA 2ZJBA 3KQUA 4TTTS 5HE8A 4RTSA 2PLNA 1XEXA 2ASVA 2DX7A 4NZNA 4J0DA 1ZD4A 3DXXA 4FMDB 5ALHA 4RK0A 4U6NA 5JZSA 1QF9A 2G1AA 2FLWA 5EHXA 2ZQZA 4HFMA 5FO0A 1IDOA 1U9JA 3FY4A 3AVXA 3HDTA 5BR4A 1RMQA 4E21A 1E9FA 1PZFA 1X13A 2P40A 2XOEA 1W4BA 4C6RA 4W5RA 5BSEA 4YT8A 4CKEB 1WW3A 3U3DA 4YP6A 2F3QA 4ARCA 5HF8A 4RELA 1MIHA 2R00C 1Z5NA 3Q3CA 3LZDA 5AKKA 5DNCA 5FV4A 4N6GA 4KOEC 2JIBA 1JFLA 2RBKA 2UZ0A 5BOVA 3FTDA 1AQUA