3E9RA

Crystal structure of purine nucleoside phosphorylase from schistosoma mansoni in complex with adenine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
285
Chain Sequence
ESVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSVVGHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine-nucleoside phosphorylase
publication title Adenosine binding to low-molecular-weight purine nucleoside phosphorylase: the structural basis for recognition based on its complex with the enzyme from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 92
structure length 285
sequence length 285
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e9rA00
3OOHA 3PNSA 4D98A 4F1WA 5JPCA 1T8YA 5F77A 1G2OA 1RXCA 2QPLA 1K3FA 5IU6A 2IQ5A 1VFNA 1SJ9A 1U1GA 1Z34A 4YNBA 1VHJA 1SD1A 1K9SA 4TYMA 3P0EA 4FFSA 3GGSA 5EUBA 1PR4A 4EARA 4BMZA 2AI1A 3UAXA 1JDSA 3LBAA 4QEZA 4GLJA 3LA8A 3DDOA 4DA8A 4R2XA 3KVVA 1JP7A 1PR0A 4YJKA 1ODLA 3TL6A 4M1EA 3K8QA 4YO8A 1QE5A 1JDVA 3KVYA 4E1VA 1TD1A 3OZBA 4DABA 1Z37A 1RXYA 1TCUA 4F2PA 2P4SA 2BSXA 3EUEA 1Z5OA 1PBNA 1JDTA 4WKPA 3OF3A 3P0FA 5B7QA 1RYZA 1YQQA 1JYSA 3ONVA 2QSUA 1ODIA 1PR6A 1CB0A 4OGLA 4TXLA 1OVGA 4GKAA 3KUKA 1A9QA 1U1CA 3EMVA 5F7ZA 1T0UA 5ETJA 1OU4A 1TGYA 1Z33A 3MMSA 1LV8A 1V4NA 3INYA 3UT6A 4L0MA 4IP0A 3K8OE 1I80A 2AC7A 1A9SA 4OGKA 4D9HA 3F8WA 4I2VA 1Y6QA 3OPVA 3E0QA 4LDNA 1SQ6A 2GUWA 4P54A 3LGSA 1JDZA 4R31A 1Z36A 4G41A 1ZOSA 4DA0A 5B7GA 4MCHA 2OECA 4H1TA 5C80A 3GB9A 3OZDA 1TCVA 1U1DA 4G89A 1WTAA 3QPBA 1OTYA 1ECPA 1YRYE 3NM6B 4D8VA 4D8XA 1PF7E 1PK9A 4F3CA 4X24A 2HSWA 1Z35A 4QAQA 3PHCA 4OY3A 4PNPA 3BSFA 3SCZA 1NC3A 4KN5A 1ODJA 5CCEA 4TS3A 1PW7A 4BMXA 1LX7A 3IEXA 2Q7OE 2A0YA 3UAZA 1ULAA 3KHSA 3O6VA 5FAKA 1PR1A 4JP5A 4NY1A 1RXUA 5F76A 5KB3A 3FOWA 4BMYA 3KU4A 1XE3A 2ON6A 1PKEA 5I3CA 2I4TA 3FAZA 5EFOA 5F78A 3OOEA 4TS9A 1RCTE 3U40A 5B7PA 1U1FA 4OJTA 4WKNA 2OC9A 2QDKA 1LVUA 4F3KA 1RR6A 3BL6A 4WKCA 3OZEA 1JDUA 1RFGE 1CG6A 4M7WA 2OC4A 2A8YA 4M3NA 2AI2A 1FXUA 1V41E 1Z39A 3FUCA 4LNAA 1A69A 3BJEA 4PR3A 1Y6RA 1Y1RA 2PGAA 3UAYA 5IFKA 5DK6A 4TXHA 1YR3A 4WKBA 2AI3A 3T94A 5F73A 4WKOA 4GMHA 3DJFA 4NSNA 1OV6A 1V48A 4QFBA 4LZWA 4R2WA 4RJ2A 2RJ3A 3DPSA 2B94A 1OUMA 1NC1A 4TTAA 3BGSA 3EEIA 4D8YA 3KVRA 1PK7A 1M73E 4OF4A 4DANA 1Y1QA 1VHWA 4DARA 5CYFA 1T8SA 5CCDA 1U1EA 1ULBA 1A9RA 1JE0A 1PR5A 1Z38A 5F7JA 1JE1A 4DAEA 3E9RA 5CYGA 1V3QE 3FB1A 3ENZA 3NM4A 4LKRA 1V2HE 5F7XA 1NW4A 1SD2A 3OZCA 1A9TA 1Y1TA 2H8GA 3DP9A 1Y1SA 4MCIA 4L6IA 4MARA 1B8NA 1Z5NA 3UAWA 3DF9A 4L5YA 4QATA 3E9ZA 4G8JA 5B7NA 1B8OA 2HRDA 1ZL2A 4DA6A 4UC0A 4TTIA 5F7OA 3FWPA 2QTTA 1T8WA 1PWYE 5CXSA 4DAOA 2HWUA 3O4VA 3PHBE 3EUFA 4TXJA 2A0WA 4LNHA 4DA7A 1V45E 1PR2A 3FNQA 3OCCA 3NM5A 3D1VA 1Z5PA 2A0XA 4GLFA 3NBQA 3ODGA 1TGVA 4ECEA 1JPVA 3C74A 2I8AA 1ODKA 2QTGA 2ISCA 1T8RA 1RT9A 4JOSA 5CXQA 4U2KA 1RSZA 4BN0A 1A9OA 1YBFA 3IOMA 2HN9A 3UAVA 4TXMA 1OTXA 1A9PA 2OXFA 4L5CA 4OEHA 4F2WA 4NS1A 4TXNA 2XRFA 4L5AA 4QARA 5K1ZA 1Q1GA 4JWTA 1K27A 4YMLA 1RXSA 1YQUA 5EPUA 4EB8A 4QASA 4TTJA 1VMKA 3MB8A 4K6OA 1N3IA 1C3XA 3PNPA
chains in the Genus database with same CATH superfamily
3RFCA 3H1TA 4U9UA 2AVDA 4FR5A 1ZGHA 2H4XA 2WZCA 4PNZA 2BP7A 2H65A 4R84A 1I7PA 3FDIA 4URVR 3HADA 6CHYA 2SNIE 4C43A 2B8TA 3MUEA 1MRZA 1H65A 2HSJA 2C1XA 3L6CA 4YV0A 4H59A 2DUWA 3L1VA 1U9CA 4KPGA 2VT6A 5C46F 5DGTA 2XE6A 3OQOA 2VNAA 1RRFA 3JQ7A 4ZYLA 1RNLA 2VK4A 2YJ4A 5TQJA 3ZVKA 1AE1A 1FNMA 4FDLA 4M0KA 1YIAA 4O4HF 1WXFA 4YJ3B 4TMVA 3C1AA 1D1QA 4YAOA 1M1YE 2WU1A 1P7YA 3GJ4A 3GO4A 1BDIA 3K0CA 4JVOA 4KE6A 4Z6KA 4NYIQ 4TKMA 5EWLB 1KE1A 2ID7A 4BQOA 3T5PA 2EWVA 2JEYA 3G9XA 3A9VA 1F9EA 1OCEA 1JEJA 2KJQA 4QQKA 5EEHA 2Z9DA 3EFOB 2HO4A 5CAEA 4G0NA 4E7OA 3SR0A 5ALLA 1G9TA 1I4TD 2H4WA 1V96A 2NG1A 4EF6A 2WJGA 4LEIA 5EIBD 4IDCA 4RMNA 4ZVOA 1ZISA 3K09A 1TVKB 3WADA 4BEWA 2I34A 2WDPA 1ZRSA 4WK4B 1SBTA 3L06A 3EE6A 2GVDC 4NV1A 3CYFA 3H7AA 4II3A 4NNOA 4O29A 4RC9A 1M5RA 2E5FA 2GFQA 1NW6A 4KDFA 1FYDA 3GC6A 2Q3DA 1TK3A 2VF8A 3HRIA 4AJNA 4XR4A 3O3NB 4NHEA 2Q5OA 2YHBA 3L93A 2TMKA 4O3MA 3HFGA 2YOHA 3IQWA 1IY1A 1IBSA 3QJYA 4Q1FA 1R0CA 4V02A 1QLWA 3LWDA 3B51X 4WK2B 3V7YA 1PQWA 2GZMA 3MTDA 4YRQA 4GHWA 5BNTA 4FYVA 1OFIA 5L3QA 3IDQA 2AQHA 1JKJB 3DVAA 4DWWA 4TRMA 1FB5A 4XARA 5FOUA 3PR2B 3WGIA 2HYIC 5HIKA 1YVDA 1G60A 1SCIA 3BSSA 4K6HA 1CZLA 2JD2A 1NXXA 1CEYA 3JD0A 4EGCB 1RJFA 1C7ZA 4KVFA 4IHJF 4GQIA 4ACAA 1BCRB 3KUDA 4FGSA 4W5OA 3CZCA 2QD4A 3QZUA 2XADA 2VCHA 2BFBB 3ETHA 1RWOA 3P0RA 1XD8A 3LUBA 1IWBB 3D1LA 3S2IA 3SZOA 4DR5B 1T0JB 3COZA 3ZW9A 1OB2A 1MC8A 4P38A 1D4AA 2QR5A 2YWEA 3E9YA 3O92A 4AZSA 2QV0A 2VHWA 1L9KA 3T5AA 2QW1A 2HIMA 5ESXA 1WY5A 2WWYA 3N7UA 4Q24A 3FPEA 4JJ4A 1K0UA 3LIIA 3CM0A 1TYEB 5AVVA 1FF9A 4WBNB 5ADWA 4HQKA 2YRWA 4NPAA 4YROA 1O95C 3G0IA 4ARZB 4QOHA 4YFVA 4GS5A 1R9NA 4OFXA 2OPBA 3NRBA 4BRZA 3R9WA 4INAA 2M1XA 2V7VA 5DCWA 5DRYA 3L8CA 1CZHA 4M0CA 5IK2D 4INJA 1TXGA 1XMXA 2JCXA 1CUZA 1QUFA 2IIPA 3ZTTA 4NG4A 4BGIA 1K89A 4Q05A 3M6LA 1E9EA 1F1JA 3M5WA 3MIZA 3KOYA 1YQQA 2R6HA 2QW8A 4C30A 3QX8A 1ZHFA 1QNLA 4DLVA 3IP6A 2VPIA 1Q7TA 3DQPA 5HE9A 3IYLW 1H0HA 1GFZA 1KS9A 1EUCB 2HHCA 4HUQB 4RVFA 3MIIA 3ZIUA 1HH4A 2QI9F 3EQ7A 3EZYA 4ZCTA 3B3GA 3O4HA 1GJRA 3ELYA 3IO5A 1E3JA 5KTRA 1CZUA 2E9SA 1E1CB 3RTDA 1U9ZA 5AWFC 3U4HA 4CM4B 1I5EA 1Z33A 4NULA 2V8BA 4V0RA 4HXYA 3ZU3A 2X6RA 2ZR9A 4GP7A 1M76A 4RKYA 3TI7A 3DDHA 3QTBA 4DIMA 4B2YA 5KWJA 3FWNA 2Q3FA 1S4QA 4UVGA 4DLZA 2V1UA 1RM0A 4M0LA 2Y8EA 3JQDA 1ID8A 1Z0DA 2PKRA 3NPMA 2C5SA 2CK3D 1VXRA 4XB1A 4OQMA 5TE9A 3V1YA 3VZDA 4D92A 4OHVA 4YXFA 5LJIA 1M9NA 1VCHA 1UMKA 3D7RA 4N8SA 2QD1A 1JLRA 3HJTA 1UK8A 2ZG6A 5TS3A 4F96A 5K8IA 1PFKA 4KQ6A 2ZI5A 4FI3C 4QUDA 4RETA 3WYDA 4LRUA 4YFYA 4HY3A 4R9UC 5K0EA 1MN6A 4LFAB 1JLLB 2AA3A 2JCSA 4ZZ2A 3VSDA 1MPXA 4Y9UA 1GGKA 3TSAA 5KYKA 3NBXX 5E9WA 2EP8A 3VH3A 4D80A 1DI0A 1RQ7A 1SXIA 3JY6A 3PFWO 3RVDA 2QA5A 3WGMA 4AKGA 2PSHA 4YP7A 3MILA 2JFZA 4YJGB 3NYQA 1UANA 3I09A 3IR6A 5ENZA 5KNDA 5TNXA 1HNZB 1IY8A 2O2IA 3JQAA 5CTAA 3T1OA 5JEEA 1F0KA 3F8TA 3DM5A 3KKMA 4ZJYA 3K1TA 3F96A 3QF4A 2ZSDA 4N1AA 4QXPA 1GTJ1 3QLTA 4JJIA 2DWPA 3I2FA 1ENPA 1G8KA 1KK0A 2RBGA 3GRUA 4DDVA 4YLEA 4G56A 4KC0A 4O4LF 5E7JA 1H3EA 3OZTA 4BQRA 2PWYA 2FHPA 2Q2NA 4H1HA 3TNDA 1PF7E 3L6RA 2JGEA 3A2NA 2G71A 4X24A 1P5ZB 5KHOC 4L57A 1KDRA 1UF9A 3DC2A 2DAPA 3P5BA 1JPNA 3HG7A 4EGAA 2BH2A 3HKBB 3ZJ5A 4PGHA 2J6IA 3F7MA 4RDIA 1NM5A 1YDWA 4BEVA 3AFIA 3LPCA 3ND8A 3VFDA 1SBIA 1NE7A 3FUUA 4ZRDA 4XPIB 3V42A 2AS0A 4J0JA 3JRWA 2XT9A 2OEPA 1N4AA 4C3OB 4R3UC 1CJMA 3VJLA 3EFEA 4RD6A 5KX5F 1ZVVA 3SC2A 3ES9A 1D2MA 1J23A 2ZIVB 4MQBA 2R44A 4J29A 4OI1A 4II2A 1QAOA 4Y2YA 4CHTA 3P0JA 1A88A 3NIGB 3KJQA 1M74A 2R8EA 1R6VA 3S1SA 1FRVA 5FV7A 1JIKA 2HRCA 3U0VA 2WQ6A 3KSMA 5J59A 2YMQA 1U2QA 2G80A 2Q21A 4KAXA 3DPIA 3ZXUB 2UUOA 3IUPA 1OF1A 1EWVA 3EW7A 3OZ7A 4DC0A 3D0OA 4PYJA 3TOXA 3E27A 2DFTA 1KEEA 4KODA 2HIGA 4DG9A 1EHCA 1G8GA 4DRXA 2Y93A 3BMCA 3LCMA 1KSJA 3NCTA 5FUXA 5TLSA 4CHGA 4WNAB 1VHTA 4DV4B 1V4VA 1EDDA 3THOA 4L50A 4HB2A 4CDNA 4BAUA 5BSMA 3HEBA 3WICA 3FMFA 2F90A 1UAAA 1UBHS 1N0IA 1GPJA 3IRVA 2IYXA 5CLQA 4CKBB 2VYNA 4WCFA 1Z28A 1CETA 1Z12A 1DXYA 4AI6A 3AJDA 3L7OA 4AY4A 1FMJA 2FJUA 4AUEA 4CODB 1KNXA 2ENWA 1PD1A 4GQAA 1WPQA 4P92A 4K8OA 3N9IA 3LNCA 4EJ2A 3BL6A 2GD1O 3FPHA 3C7TA 2GN8A 3O0TA 4JKYA 1R0KA 1PDVA 4IHJA 5ARBA 5KS2A 4I1SA 5CX1B 3W5IA 4IHAA 3HYTA 2G6TA 3KPJA 4K9MA 4MULA 1OHHD 2EF1A 5BV2P 1WW2A 5ALFA 4IDPA 4YDSA 4A16A 3B70A 4EI7A 5C5EA 1L4GA 3OCJA 4OHKA 2GH1A 2WV7A 4O5AA 5ED4A 2GCOB 5GP1A 4JBYA 2WTUA 3LW8A 4HPXB 1CR0A 4HZUA 3DMYA 1WMBA 3AB8A 3LBIA 4WEOA 5AUQA 4URZR 4ZGGA 3GGCA 3OU6A 2CEAA 2V1XA 1N1DA 1N6KA 3V4OA 1CHNA 2XRYA 5HXAA 1OLXA 1VIMA 1YHZA 4YCSA 5BYAA 1Q44A 5CG2A 2XWSA 4N3BA 2R1VB 4MXDA 4HAZA 1OBVA 5C3MA 1CEXA 1HEIA 4GOMD 4KE9A 4N9WA 4PAQA 1Z4QA 2KLHA 1O6BA 2FF5A 4P6VF 2X0RA 1YDHA 2CJPA 2O6HA 1JEQB 3QKTA 3WRWA 4PC7A 4C9BA 1VHDA 2C07A 1MX3A 2X76A 4XQEA 3NT5A 4XJXA 2XMCA 2C5BA 4Z9YA 5J5CA 5K0FA 5IN5A 3EX7C 4KRFA 1MOSA 2XIJA 4RQUA 1GKYA 1HQDA 4GI1A 4DCUA 1Z62A 2YJ5A 2WM9B 2KBEA 4XYEA 3T94A 1G21E 1A8PA 1EGQA 4WBXC 3DD1A 1UJCA 4YUXA 1NBAA 3R6WA 3K9CA 2VPQA 4HLQB 1QC5A 2W6OA 3IQDB 3K1YA 3U7JA 1KOLA 1VHLA 2IHYA 2B2CA 4RY2A 4GSKA 1PYGA 1C8LA 1GZ6A 2VNKA 3F6PA 3I1JA 3ND6A 4LDAA 5F1YA 4EX6A 1DTSA 1GNTA 3VR6D 1B74A 5B6JA 2O8CA 3DKPA 3GIWA 4PRLA 4U6NA 4L2IB 5BQ5A 5L45A 4GECA 3DYIA 5JCJD 1LQUA 1ZXBA 4G37A 1GGVA 4O02B 2P7HA 4JJGA 4UJ5A 4E5PA 1KZ9A 1B0PA 1YZVA 2FF7A 2VH2A 3SJCA 5KWSA 3KVRA 1FP4B 1UEIA 3MGAA 1QGED 2FXIA 4H77A 1DCKA 4XVUA 4ZC1A 5LP6F 4TQ9A 4PCLA 3SI7A 2FUKA 2PQ0A 3IIIA 1J8VA 1OWLA 1GSIA 2L69A 3LDGA 2ZPAA 2QEQA 5I5GA 2PJDA 4FKZA 1SQSA 4XDGA 3N2KA 1PQ4A 5E1MA 3GK3A 4HEJA 8MHTA 1RHKA 2GARA 2V9CA 2QTZA 3B1XA 2Y4OA 3ILYA 4QYSA 2PANA 4RVUA 4UU0A 2IE8A 3PC8C 5EL0A 3KYCB 3BK2A 5HGJA 1R3UA 3BN3A 3NKFA 4RCYA 1M2VA 4DUYB 1K88A 1SOVA 4MV7A 4HX9A 3ZDQA 2R2GA 3BD8A 4CE6A 3FMPB 4G8DA 2XQVA 4B3GA 3OH8A 2ICAA 3O74A 5ECDA 1UQTA 5BWMA 1FFWA 5IP5A 1XZJA 3WR5A 1SBCA 2FEXA 2H08A 2L2QA 4E30A 1K8ZB 1DHRA 4XGRA 1GILA 2RH9B 1N57A 4NENB 2GUGA 2JRLA 2GN4A 3WLOA 1DJLA 3TR6A 3LC0A 5HSGA 5F1OA 2GEBA 3TIXB 2BI8A 3AH8A 1DXQA 3WNVA 1DOHA 1DO8A 4P84A 1DKRA 5EJEA 2P27A 3IFSA 3H3JA 2XPCA 3RWOA 2QQGA 4ZOBA 3OZAA 4UQPA 2Z4RA 2IZOA 4Q1CA 4DPLA 1BEEA 2ZIUB 4WXYB 1Y3HA 3KL2A 2F3TA 4XYGA 5IT0A 3L4JA 5J5VA 2HRDA 2IKSA 1EQUA 1T8UA 2RGDA 4PO8A 1ZDMA 3T06B 2ZSUA 3QSYA 5CFQA 3NP9A 4IRUB 1Q7BA 1T8WA 3KKLA 1AK9A 3MMXA 4WXRA 4U2GA 3KPUA 2ZTLA 1N2GA 9LDBA 1MAHA 2OKGA 3EWIA 1Q20A 3V34A 2FR1A 4CDMA 2R1TA 4RAOA 4RGQA 5TMDA 3UV3A 4ESOA 1T6BY 3L0OA 3ZWYA 1SCJA 1TOAA 4IFBA 1GZ7A 2PZKA 3F7NA 4CQNA 4BVJA 1RABA 2ZB7A 1KU6A 4I50F 3R75A 3GRAA 1B6TA 4TSRA 1OH5A 1UKCA 4JSYA 4V0QA 4RJJA 4QTXA 4UM7A 2FG6C 2F9MA 1XJ5A 3GQBA 4Y67A 2I9KA 2C2MA 2GK7A 3GUCA 1DVRA 2QZPA 4A27A 3TFWA 3TQHA 3COSA 4RVDA 4WK0B 1BQ4A 1UJ2A 2DTDA 3N0XA 2I54A 1IFXA 1Z75A 1XL0A 1CV2A 2OB2A 2W9XA 3QXXA 5IYZF 2P2YA 3K16A 1WVIA 1Z63A 2XDQB 3V4RA 2RGEA 3W1VA 2DBZA 1M5TA 1XNGA 3EG9B 2OCDA 4BIMA 1S2OA 1YJCA 1F5SA 1H2BA 1PJAA 4F56A 4F2GA 2YRXA 3GMTA 3I39X 4QTTB 4Y6OA 1F14A 4BE4A 4U2KA 2H63A 2JFGA 3I0ZA 5JC1A 2IHJA 3S2FA 2QYHA 3C3BA 1W76A 1TF5A 3K72B 1N5OX 2PT9A 1SMKA 2AF3C 3A58B 5C7IO 5EMHA 3A6LA 3NHRA 4KX5A 4H7DA 4CEJA 1SXJA 1WBDA 3H16A 2FQXA 1IN7A 4YAKA 3LCUA 3NH6A 4FYMA 1WDTA 1IM5A 3RT7A 2OXFA 2YVUA 3TPFA 1MX1A 1ORRA 1RQLA 1UBRS 2JIZA 2XTAA 1I4OA 1Z4OA 3CUKA 3ESAA 3SKVA 4DQKA 3UICA 4HQ0A 3SX4A 4O4IF 5DULA 1QZXA 3L6OO 5FUYA 1EVLA 3GFBA 3OKFA 1M1ZA 1GQQA 2VHXA 3BXXA 4I9FA 4WLFA 3AJEA 2ZUDA 2CEKA 4FPXA 5G2OA 2UAGA 4ZWNA 1NLUA 4FE4A 1E2NA 4DIEA 1HE1C 1WCV1 3RW9A 1DBIA 4C4PA 1CJCA 2VO1A 3IV6A 3MB8A 1ORDA 4RXUA 1SVUA 4TKVA 5K0TA 2B35A 4M0UA 3DMTA 5EMJA 1E62A 1KI3A 1VSQA 3QWBA 4JKIA 4RMJA 2ST1A 2VKTA 3RRBA 1C3XA 1O57A 1H6CA 2EFJA 4REOA 4UNPA 3HJUA 3TW4A 1TA9A 1L3CA 2FRDA 4I99A 4J0EA 4OSPA 3KOXA 3SQOA 3VVLA 4MUBA 1SCQA 1MJHA 4RMHA 1IQPA 5TS2A 2YWXA 1QVAA 2EU8A 1QG0A 2Q46A 3CLSC 3W04A 2ACEA 1QOZA 3C8ZA 2M6KA 1C9DB 3OC0A 4HWTA 4Y1FA 2IEBA 3TH5A 3R9IA 1COWA 5CG1A 1CERA 3O75A 2ZJ6A 1EX7A 2FN9A 2PYIA 3BUSA 2QPLA 5IC6A 1IY9A 4PGFA 3RAJA 3TF5A 3PJFA 3DL7A 3DDNA 1WB4A 3LGAA 5U1PA 3C3EA 3V4PB 4A2CA 5BR8B 2V7XA 3BEOA 5A0TA 4PHTA 5H0IA 1AHHA 1U1GA 3GUYA 5F2EA 2ODWA 3MCZA 3ECSA 3RK4A 1QV7A 1XZLA 4PBTA 3WGVA 3FPLA 4Q03A 4INZA 2IE0A 1BKSB 1P1HA 3G82C 4GYKA 4HDMA 4MR8B 4Y2XA 3WMFA 1U6IA 4LF5B 1MIHA 1P8JA 3N74A 3SBEA 3VR5D 1K9SA 5DHRA 5C8XA 4UTOA 4W7HA 1JHOA 3UGJA 1YFJA 5JEDA 5LP6A 2DXIA 4A8TA 1C4KA 1G6KA 3WL4A 1UOQA 3OLYA 1JLKA 3LX8A 5MFPA 1QGAA 3MOSA 3VDQA 2B21A 2FKNA 1PLLA 1QKJA 4JT9A 1FTWA 1J7KA 1KMIY 1D4OA 3IVXA 4KAAA 4L4ZA 1GUBA 6PFKA 2QSYA 3MWJA 4B3SB 3H9GA 1LCIA 1L7BA 4R69A 1PHRA 1Y8RB 1XAHA 5IEBA 3VR1A 2Z2KA 3A1UA 3TLYA 4B33A 2A9KA 2Q41A 4FCCA 3TL6A 2YHUA 4FFVA 5KNDD 1SM4A 3T41A 3JQAD 5LYJB 2C8VA 4MQ6A 4RAQA 4CI0B 1RLMA 4R8RA 3F90A 4MW0A 5T8KC 4WY5A 2DHCA 4QU0A 1HQCA 3U3ZA 1E4YA 1TM5E 2ZJ0A 3G1WA 2PVCA 5ITWA 1ADFA 3QVXA 1INLA 4ZQFA 5AVQA 5HIAA 1IK6A 4WBSA 2J4DA 3AR9A 5KVCA 2OV1A 1NQOA 5H9VA 2AXNA 1JZQA 3RS4A 1M0SA 5C9ZA 2ZWOA 1C4OA 3PFKA 4BLRA 2Q1UA 3QEOA 4FOSA 4OIFA 4BKPA 1W88A 2IUUA 2ZRCA 1P6XA 4QRDA 5EQDA 4FZVA 1Y7IA 1G3RA 2VH5R 5LZ2A 4RVGA 4BBAA 4CKWB 3OKCA 1UEXC 3EVGA 4LMRA 1P2VA 2SECE 2JGKA 5EZQA 4BDTA 2BKVA 5LP6C 3EIEA 3W7BA 5GONF 1I4WA 3AF6A 2BZGA 4E4YA 5JUWA 4A6DA 4D3FA 3CGGA 2WJ3A 2W6NA 1H3NA 1PFWA 4ON9A 3TSWA 3ZEIA 1NR7A 4LBVA 1C3OB 1OROA 4EHJA 4DIBA 4CL8A 3QVUA 4OQQA 1AQNA 4RVOA 1NQXA 2R5NA 5TB5A 1RP7A 2HI0A 3V8VA 3FVRA 1DKQA 3PUIA 4BVFA 1CB0A 1UBOS 4AROA 1SK9A 2PKQO 2HBYA 2X6TA 7REQA 3TR0A 3HDQA 4ALLA 4NCBA 2JGLA 4CXMA 1TC2A 3C3KA 1IG3A 1GCAA 3MF4A 5D3KA 3I5YA 1J99A 3PIDA 3PX3A 2Q1YA 1LSUA 2ZUVA 3AGQA 3EXHB 5A2GA 1DAHA 4N7JA 3EGXA 2VYFA 2MIIA 3GF4A 3NHUA 4NZNA 5EP3A 1JYFA 5IYZA 4YHHB 1WW8A 3K4HA 1KK1A 7GPBA 2L19A 1PT8A 4FHCA 1ZRNA 1U2ZA 2VYND 1VGVA 1G8MA 3O8CA 1KOGA 1L3IA 1S2MA 4ALMA 4ZCIA 4TM7A 2CDAA 4EEKA 2PD4A 3H3XA 2HA5A 3INYA 4ZCLA 5GVRA 5HJ2A 4GPD1 1WABA 2K2QB 2QVYX 3ORFA 4PFSA 2OPHA 1Z4PX 1JIUA 1J5XA 1WOMA 3W4IA 5G41A 4HJRA 2FV8A 5LJLA 1JA0A 1MC5A 1NYRA 1PZMA 1V9SA 2XB6A 2ZW9A 3QUTA 1MB0A 3JZDA 1T0IA 2YJNA 1LW6E 3LQ2A 1A9SA 3PE6A 4REQB 3UATA 5DGXA 4J76A 1LH0A 2NW6A 4ZCPA 1AKUA 2EL7A 3FI9A 3IJRA 4K88A 1BDBA 4FMDF 2HV9A 1TKCA 5KSYA 1D8TA 1MO6A 4TS1A 2B1IA 5AI9A 3AMVA 3IH5A 4CN9A 1V5FA 1AGRA 1W8DA 3A4TA 3GPCA 4WXMA 3VOTA 2H5EA 4D97A 1E9CA 5K0CA 1Q83A 4DMFA 3ZW7A 5KBYA 1ZOSA 4J2HA 5LM3A 1RKBA 2VSOA 3KL4A 4QBHA 2WYOA 1ZCBA 3N6RA 3RVPA 5P8WA 1PUIA 3GRYA 3WMWA 2ZVQX 3GCGA 2Q28A 4CETA 3FCEA 2O8BA 4MVJE 3O83A 5FLXA 3RI3A 5AXDA 5IDXA 5AVRA 1UC8A 1E0AA 1P75A 3GLIA 1RBYA 5A4AA 2YHIA 2WJPA 1EJ6A 3NM6B 3VNVA 1JGTA 2G7ZA 2Y0CA 1KPIA 3KAKA 1QX3A 4UW9A 5ENVA 5E9AA 5CD1A 1E3WB 3BBLA 3HZOA 3LUDA 4L3WA 4IDAA 2ID4A 3SM9A 1I3NA 2AOXA 5BSEA 2V58A 1XZCA 2DHEA 1ZIPA 5CH5A 3F0TA 1WPXA 1XNJA 1OTHA 2ZYWX 3VO2A 5FI3A 4YAGA 1R0LA 2HBZA 3TB4A 3GDWA 3MJ4A 2UZ4A 2XGGA 3A4YA 3OX2A 1VJ5A 1N6HA 2P3OA 1VKNA 1C0PA 4AO7A 1ISMA 1DCMA 4B4UA 2P30A 5IC4A 2GBFA 2UZ1B 1T9DA 2AEMA 3AJAA 5JXJA 3SHQA 3ZKWA 3KHSA 1OIXA 2J8ZA 1E92A 2XMBA 4PZ9A 2CL5A 1VKJA 2AN5A 5E95A 2ZUWA 2H18A 2ILTA 2IY7A 1DS6A 3EISA 3D3WA 1THGA 2SKDA 1KVQA 4IXMA 4O1HA 1PK8A 3JQCA 4QBGB 1S4MA 2DULA 1IRIA 4IIFA 2P79A 2H16A 4I3HA 3O93A 1FUIA 3MJDA 5B6PA 1W48A 1DQZA 3SZ3A 5G0UA 4D8TA 5EFOA 1ZD9A 5ELXA 3P52A 1ZN7A 1KP2A 3QEMB 4Q7MB 2FJ0A 3FKSA 5FBKA 1JTFA 3RPEA 5EHQA 4I5FA 3I2KA 3P1JA 1M1YA 2NSHA 3IQEA 3ZCSA 1AUVA 4ASUA 4J07A 2JIOA 1JVNA 1ZIXA 3L07A 4LQLA 3IDAA 4XIGS 1FLDA 2D7DA 4ZV7A 5GMOA 1E2FA 1UH5A 2M98A 4FGZA 2HJHA 1GDHA 3D6MA 3VSCA 1TCCA 2OZLB 4ISBA 4XLLA 5E7QA 4AY3A 4EMUA 1VLQA 3UW1A 1JEYB 4F3RA 3ETNA 3DTNA 4IG9A 2G1AA 5HM6A 2QP3A 4NOMA 4B7AA 1XDWA 2WMNB 4X6UA 5EMLA 3RGGA 1OXBB 3CR7A 1JSRA 3DL0A 3I4CA 2QZZA 3EPPA 3DMHA 1JHMA 4IRXA 4IXTA 3WNQA 1EJ0A 1TUBB 2P3QA 3D4OA 1KYZA 3ETLA 1XO1A 3CZMA 2QXYA 1DWOA 2OV3A 4NYJR 3SEZA 5KCZA 5IVKA 2AI2A 4QPCA 3KDPA 3H2IA 2RHLA 4ABYA 1BFKA 4H3KB 4JT4A 1YT5A 2EX1A 1FJHA 1O3YA 2WJJA 1GV1A 5IASA 5JZOA 1LLDA 4UTVA 1CJKC 2A94A 3D4IA 4S0ZA 2C5LA 4BJ5A 3WTCA 3FUCA 5BW6B 3PD0A 1Z47A 3A14A 3LOUA 3RBXA 1GZ5A 1KKMA 4J4TA 1TZ2A 3QUAA 3Q2IA 1G3QA 4RQTA 5GONA 5JSQA 1B93A 1YACA 2E4YA 5CHYA 5K4GA 1ZSYA 5IZCC 3H4TA 1L5NA 5ARCA 4K05A 1HYEA 3A31A 4EVIA 5DK6A 2DQZA 2UKDA 3GJXC 5BRAA 1TUEA 1VE5A 4CRWB 2WHPB 5FEMA 4EK9A 4UASA 3WDMA 4P8RA 5B1IA 4Q3KA 1RE0A 1ITZA 3CN9A 4Q6BA 3W5JA 2WV9A 1R5NA 3ANLA 2REOA 1GRVA 5DXJA 1L8QA 2G4CA 2G9QA 1Q21A 2NM0A 2ZE7A 3KK0A 4MICA 1DG3A 1WJGA 3GR6A 4RMIA 4Q7QA 2OM6A 4NNPA 1BMFA 3PENA 4LWQA 4BZZA 1OV6A 1IIBA 1C50A 4CG1A 2XRMA 2XUFA 5D86A 2DFVA 4G0YA 2Z8ZA 5GIOE 4M6WB 1J70A 3D4PA 2QQ5A 1NASA 2JRCA 1DUVG 3PKIA 3QU5A 2IHBA 4PFJA 2MHCA 1JMYA 3CLSD 3MELA 4AECA 5CDTA 4ZZ1A 1N6NA 1OUMA 4D5EA 4P4SB 3ZJ4A 3GG2A 3O8LA 2LCQA 4PRYA 4IZOA 1KMHB 3N53A 5ALIA 2R11A 3BGSA 1FUKA 1F60A 1PK7A 4YP9A 3NZEA 2O05A 2XCLA 3TIFA 2IYPA 5CM8B 4A0RA 4RZ2A 1HEYA 1G55A 2G06A 2ERXA 2R8PA 2QF7A 5F12A 3EVCA 3R8CA 4ERNA 2GZHA 5LU9A 3DT6A 4BV2A 3NBZC 3F6SA 3OQPA 1L7PA 3N87A 2EJCA 4CMIA 2Z2ZA 1A9RA 4DHEA 1GZSA 1XZGA 3K30A 5H82A 4EHIA 4KXMA 5EP1A 4TKLA 3F5MA 3FSGD 2XCUA 4YGXB 4NFSA 2EP5A 2JIZD 5FPYA 4DLSA 4JUFA 1X39A 1NPDA 4C4SA 2Q5JA 1ZKMA 4PPYA 2QT0A 1JR3D 1XKXA 5A71A 4A0HA 1C3EA 1RKUA 1PJQA 1PZHA 1W581 4K9SA 3HEAA 3VNQA 3SC4A 4ACBA 1RMYA 1VA4A 3QMMA 4NARA 2VQEB 1FEZA 4QOIA 3A9WA 2P1DA 1PL7A 2IIVA 3QWIA 4M86A 1GM5A 4JUCA 1L7DA 5AJWA 1R9JA 4H4CA 3L4EA 3TXAA 3STTA 4CF4A 1F7UA 1RQGA 3AL2A 3G13A 2BJHA 4GFDA 1F51E 4PXAA 2I1WA 3DONA 2PVSA 4IF6A 3S70A 3SDSA 2DFLA 1NHWA 6REQA 1WUIS 2D2VA 3IELA 1WSAA 1I7NA 1NJ6A 3DE5X 4PZEA 4O59O 2XYRA 1O1YA 1QG2A 4P3NA 2O7SA 4R5MA 2DECA 3EF0A 1G42A 1OZ0A 4U0KA 2IWRA 1CY6A 5JFTA 2E6UX 4D8UA 5LU8A 4D3XA 2WD9A 4RDCA 4L5YA 3SIWA 3GVCA 4ZDJA 1EP3B 2X3FA 2BSAA 2Z30A 2ZYHA 2MMCA 1QFSA 4F84A 4DUZB 2DKNA 2IU0A 3ZQ4A 5ERYA 2W4MA 2HOQA 3AEQA 2OD9A 2X14A 4XVHA 3K3PA 5F51A 1US8B 3KB1A 1A82A 4WI1A 4ZRMA 3I04M 2FPKA 3C6QA 3DBHA 1VKHA 2FEWB 3I34X 2AEFA 4PN7A 4XJVA 4B5LA 3K0SA 2XGJA 2GEUA 4UVDA 1R8QA 1NRJB 3E9QA 5CVTA 3HMQA 3GVHA 1M6VB 2R96A 1ZNXA 2KW5A 3R20A 1EUDB 1PWEA 3BM5A 5KYVA 1IPHA 5FI5A 1KAMA 2AC2A 2H1OA 4MR7B 2PMDA 1LBHA 2PMCA 5BVGB 2J0UA 3H1GA 3OZRA 2Q4BA 2VJKA 2NPOA 3L02A 2BHTA 1GKLA 3AV3A 2CXPA 4ZIRB 2GXQA 3WHIA 2W48A 1K5PA 1CUWA 3WLLA 4EFNA 3G88A 4RABA 2OGUA 3KJGA 2J33A 1T35A 3KT0A 3PGVA 4NMMA 4ZYWA 5KU1A 2O6LA 1BXGB 4UATA 4ZAGA 3TCKA 1WZ2A 2P2CA 4NU6A 1RWNA 1USVA 2IUFA 2WSBA 5KPDA 3C15C 1CLUA 2UVPB 2Q4OA 3OTHA 4H7FA 3IKMB 1XA4A 4WWHA 1ZWKA 1NUHA 2RAFA 1N1EA 4J7CA 2X9VA 1NBMA 4Y18A 3WL6A 3Q98A 4M9UA 4P4LA 2QROA 3RIYA 2VT7A 3TAXA 3MWDA 3A3NA 2XWJI 3OJXA 4A73A 4XDYA 3A9UA 1FDRA 3ADKA 2IH2A 1J20A 1KVSA 3VISA 1E0DA 4UCQA 2ZYSA 3VPGA 3IJ5A 4CCWA 1OTXA 3GFVA 3LH5A 4UNQA 1LPOA 3ZU6A 1P81A 5C7OO 1FP7A 1C9JA 1NDQA 1XN1A 2ZJ5A 3BXEA 1FIUA 2B5VA 3QU9A 4NS1A 1WVGA 4TXNA 4GQBA 1PGJA 3GBPA 3GJTA 4OMDA 4BNVA 2VXYA 4BC0A 1S8OA 3FCYA 1PT7A 4DTIA 1RXSA 1PZGA 4QASA 5DP1A 3SP1A 2Q50A 5K3BA 3FOFC 5EVJA 3N86A 1RAIA 5CVJA 1QIDA 2V6FA 2J0VA 4KBFA 4Q4HA 4P36A 4Q4LA 1S2LA 4US0R 5TF4A 4RGYA 3ZHCA 1C3JA 5KMGA 2GDJA 4ZU6X 1P4AA 5IZ4A 5FPTA 2D0OB 4OHMA 3PNSA 3FD8A 5ADVA 3WIOA 3ZWKA 2C1EA 3V1UA 3L8YA 4M9SA 2A5YB 2OCXA 4U7HA 3KYDB 1E8DA 4IJWA 4BWVA 4F12A 2R4TA 2HQRA 3W9BA 2JEOA 4G0UA 1E69A 1N9GB 5K6AA 2G1KA 2ISQA 3C1UA 2UUCB 4EG7A 1Y8QA 4K0KB 2I4OA 3ZH2A 1WCWA 4BRWA 1V11B 2ZB4A 1Y37A 2IUSA 5B2EA 4PYIA 2O4CA 4MEAA 2PUJA 1UM9B 2QZSA 3RHSA 4FQ7A 3OM1A 1GRCA 4BFLA 2F67A 2Y05A 4PG4A 5E6SB 3RJ5A 1ZYUA 4ZT4A 1Y4UA 1IY2A 1FNBA 2KB0A 2YV4A 5IUKC 4K5QA 3ZHYA 5CFOA 2NO5A 1PJTA 2PZGA 3BRQA 3D8BA 4M60A 4YO7A 3DEYX 4PYNA 2BTOA 5A05A 4YMHA 2I6UA 4YLYA 3H2JA 4G5YA 4Q82A 4RTOA 4G0QA 3SNKA 2E21A 3CV3A 1UMBB 2R5FA 2B4AA 1WHTB 5DO9A 2ZE5A 2IV3A 3QA9A 4FP9A 4KYUA 3A2MA 1QCDA 3PFBA 1AQLA 3ZE6A 5LKRA 4UMVA 4BMZA 3DBVO 3GFRA 4OQEA 1HO3A 1NKSA 3HR8A 2IUYA 3D02A 1J8QA 2FWJA 3DOJA 3PR3A 4H7JA 3VU9A 3GUZA 1XZAA 5JDIA 5JTUA 2OCYC 3IX7A 1WB6A 2CVPA 4HVTA 1AOXA 1EFPA 3D64A 1TA4A 4KGDA 1N8NA 4HDSB 5LC1A 5AKKA 5H81A 1FRZA 5E4TA 5KOHB 1TU3A 4HS4A 2PGLA 1H3FA 3ESBA 4Q7LA 4I5DA 4U2EA 3EIOA 4YJKA 4ZEXA 2CXOA 2WJ6A 4QQFA 2XOKA 2F43B 2N3ZA 1V3VA 1P4HA 3OOWA 1NW8A 2IYYA 3H5IA 4I5GA 1D1PA 3F73A 1G20B 1YC2A 2AG0A 3UJPA 2ZUFA 1YBAA 4M76B 1GL6A 2JAQA 4OSOA 5ED0A 3V9AA 1CPYA 3STHA 1IJEA 4YPOA 1E9BA 1M66A 1WCIB 1RWQA 2B69A 2D5CA 2ZJYA 3FNHA 5AKEA 3V4VB 4C88A 2BHNA 4BO1A 3CHYA 3LX4A 5DXAA 4FYKA 3SSAA 1QFXA 4G84A 4ZT7A 2HRRA 1C81A 3OJOA 4MDEA 4KWEA 3HCAA 3O8QA 1FQWA 4LGVA 4ND1A 1RVDA 4TRJA 5LUBA 2VTVA 1RAGA 3CJTA 3UK7A 2HA0A 4KIFA 3K96A 2FFHA 2KPOA 5DT9A 2GILA 5C1IA 1DAPA 4UREA 2K5UA 1NNI1 3UMJA 3QP9A 4DR7B 5EQJB 2E37A 1VL6A 4MRRA 3I1YA 2EGUA 2C2KA 2PAFA 2HT6A 4U39A 1BNCA 2NLOA 4GM0A 2ZRLA 4HB4A 2LXNA 5DHTA 1NMSA 1VI6A 2J48A 3F5QA 3PIIA 4CYMA 3LRTA 4JASB 1NXOA 4KR9A 1N2EA 5FA6A 4CCYB 1N2XA 3HVKA 1V5IA 1DUIA 1TECE 1WPGA 4M1WA 4W99A 1JQJC 5IJ0B 3RWBA 4XUCA 3TFQA 3BSYA 1PR6A 3SQDA 3V8NA 1OFGA 3EYWA 1MJGM 1NV9A 4NWIA 3TBKA 2G5CA 2QXTA 2FPWA 2V3WA 1GO2A 4IR7A 4K9OA 4KR0A 4WTOA 5B3LA 5C8YB 3K4PA 1N3BA 1ADGA 1J8DA 3AHFA 4MVCA 4RACA 4KNYA 1UOPA 1VG0B 2J5RA 4J1SA 1XZHA 1TDJA 2Z2YA 4HQOA 4LZPA 3VOAA 3RNLA 4P80A 2M2IA 1TGYA 4FNGA 4OM7A 1F8UA 1UBMS 2QR3A 3FKSD 5CFPA 4IDBA 4EKIA 4C0JA 4URWR 3QWAA 3OKAA 2QTAA 1T1RA 5LQDA 3UM9A 1UXKA 2WYIA 2A14A 1SXHA 3AC0A 3L0SA 3OT4A 4KIGA 1EE2A 1H66A 1YDGA 2P8JA 5FRDA 2C7PA 3STWA 4LSZA 3P9IA 5AJYA 4L0MA 1LV7A 3CUVA 2ONZA 4IH9A 1EGVB 1ISFA 2H2GA 1AKQA 4RD4A 5F1KA 1U3GA 3HFSA 3K8OE 1VJRA 1YS4A 1NXTA 2BFEB 3Q7QA 5DYWA 1K6IA 4G4GA 5ALZA 4D9HA 3ND5A 2F8TA 1DBQA 4I9HA 4BMOB 1HKUA 4KDCA 1GNVA 2X42A 2O2YA 2IKQA 1XEXA 2XAUA 4OGWA 3K0KA 1GG2A 3E0XA 5JHHB 3IAEA 4JB2A 1JJVA 1CC1S 1DIAA 4KX3A 3G9QA 1DEOA 2QW0X 1N2ZA 2B7LA 3FPBA 2O52A 3IOCA 5HF8A 4L3OA 1QKIA 1UXHA 3LFTA 2XQFA 4YAJA 2YYSA 1LRJA 2UZ3A 1NATA 3C6XA 3WB9A 1WAMA 3ZHOA 1VSTA 3THWB 1L7AA 1FYVA 2E4UA 1ZY2A 3M3DA 3SYNA 1EFVB 3BQ9A 4WX2B 4OV6B 3L7KA 1Y1LA 3DOUA 3ILXA 1KH1A 2HLPA 2JK1A 3N0VA 3X1XA 2EV9A 4E31A 1ZCFA 1QBKC 2ODAA 5JT1A 5IXJA 5DU2A 1CBUA 3B85A 5G1NA 1XTPA 3KVOA 5GTDA 1NNLA 4R51A 5TGDA 5DW3A 2EBHX 3NHZA 4MS3B 3LLSA 4RK7A 3JASA 3PQ5A 4HDNA 4L75A 1PK9A 1L8OA 2QX4A 2AYYA 4BJHB 1NQWA 3HJHA 3PNBA 4K03A 4PX9A 1QRTA 2PJRA 2C5AA 2GPBA 2O2SA 5I8PA 2AZTA 3P45A 2VQFB 3I12A 4I46A 3PEFA 2QTFA 1BMFD 4N01A 4UPEA 1WHSB 4EKNB 3OD1A 4HQLA 2AUNA 5BUSA 4NCNA 1NR1A 1N7IA 1PJZA 1W0KA 4D6XA 1ODJA 3O47A 4C7OA 2I80A 1Z88A 1LJUA 2RAPA 5EE3A 2AOTB 2ADFA 2X5KO 3MK31 1N2OA 1TM4E 1P0PA 5JDCA 4MVJF 4IUYA 2JIRA 3UAZA 2BGMA 4L07A 1XVAA 1ZM9A 2R79A 5EA2A 3ZBTA 4H6PA 3BCRA 5FAKA 3SXUA 2QBYB 4JP5A 1XALA 2G63A 4YDHB 4W5NA 4QXOA 1ML4A 1U0HC 3CS3A 3EZFA 3PT9A 3RSOA 4AN0A 1Q92A 4R9RA 3HXTA 5EJ4A 1EQ2A 4RV4A 1OILA 4XIIA 1NN5A 1BYIA 1G8FA 1J7JA 3PTZA 4GMXA 3B2EA 1KK3A 4F38A 1ZNYA 4JYAB 1C1XB 1B26A 4J6FA 1LDMA 3ICVA 5CFMA 1E9RA 2J6CA 2YN4A 4CV1A 4UNRA 4DFDA 4NCKA 2FY8A 2QRPA 2XVXA 4YUVA 1Q17A 1GY8A 2PU7A 2QQFA 2WMDA 4Q0MA 4B3JA 3U7EB 1NUQA 2CXTA 4Q9LA 1BQ3A 1DEAA 2AD5A 3OCXA 1JHQA 3EOBI 2YW2A 3GJ3A 4G5OA 1M1UA 2NZUG 2QJTA 1YB1A 4ZZ0A 2JCGA 1NOIA 3F2IA 4MS4A 2RHCA 2G67A 3WMXA 4DHWA 2VK2A 4U6QA 2Q07A 4BTVA 5LDDC 4F3KA 1QTNA 4H3SA 4JHLA 2LKCA 4QFMA 1QVRA 2NVOA 4N5NA 1H2RS 3EFOA 3OAAA 1XTVA 3PI7A 3QV2A 1DU4A 3TPCA 4RF5A 4JLAA 2RHTA 4C4YA 2V7EA 3HQ4O 1NSYA 1YD7A 2C57A 2ZBFA 4S0XA 1XA0A 4CMGA 3E1SA 3KO8A 4MUYA 4OCZA 5FDFA 1TVKA 5JNWA 5GJBA 3NNSA 4XR9A 5CNIA 5DIFA 1BE6A 1RWKA 1JECA 2A8YA 2P0AA 4GOND 4KFUA 3O82A 4JJ6A 2XUAA 4LYFA 5C37A 1RKVA 3W2EA 2J3DA 1DMSA 4KPFC 3FHTA 4GX2A 2D5IA 1OWOA 4PSKA 2FGKA 3I5MA 4B17A 1GXSB 4DT1B 3DHVA 3O2JA 4Q37A 3OQMA 2NTYC 4CL3A 3RVOA 1OMOA 3HM9A 3ZQJA 3W5AA 1I7SB 1MC4A 3VO9A 1ATZA 3SHFA 3X0DA 2ACKA 1BN6A 3NBAA 2Q49A 2OCPA 3VOBA 1T5HX 2G1UA 1F4PA 4L7VA 5IFKA 3DO6A 1ZXLA 1B76A 2PBZA 4NQZA 4GDMA 1CY4A 3UA4A 4X00A 4R8MA 1YR3A 3DOEA 4GEKA 5L6LB 3TJZA 1XV5A 3PICA 1ORIA 4P0PB 4NPCA 4W5WA 2BFBA 2GCNA 3IXLA 1DPFA 5JROA 1IATA 5LPNA 3TSCA 1EUZA 1VQ1A 4D0SA 1NNSA 1M2GA 4H2DA 1U0NA 5T41A 1OE0A 1YV9A 1M72A 2Q3EA 2X3UA 3GNSA 4RM3A 4AP9A 3D31A 4RTPA 2BDEA 2A0KA 3BWEA 2C7QA 4X41A 5IS2A 4WE3A 4GPAA 1HLPA 2P9ZA 1XQXA 3UV7A 4YMGA 3M2TA 4GWLA 2YL2A 4A8PA 3VNAA 1SG6A 3D8TA 5E9JA 1T2DA 1E1RA 4RJ2A 1E2MA 5T4EA 4GBGA 1U4NA 5AKGA 1O5TA 2D5LA 1F0PA 1C80A 1SY7A 1M33A 5HMLA 1XCJA 4LXUA 2I71A 1XRSB 2WKPA 2NYVA 5TQVA 1EHIA 1LXCA 3Q8WA 1OLSB 3GLHB 2O8FB 3RUCA 2FWAA 1E6WA 3RFFA 2Z95A 1RLTA 3M0EA 1NBMD 1DARA 1CVRA 1FFXB 2XECA 4X1IB 5A06A 2P6OA 4GXRA 2OV2A 5CLJA 1OJ7A 4HDRB 2PCJA 1Y9EA 3PZBA 1U1EA 1BFUA 1NLZA 1BU8A 2AR9A 3R3YA 3I6YA 4UBLA 4D8WA 5M2QA 3HVRA 1RYYA 3JV7A 3NOQA 4HUQA 1EUCA 4KN9S 1EA7A 1YBHA 4TWRA 4RGBA 2C5FA 3VBEA 3FUVA 2ZBEA 3EMBA 4IF4A 3BJZA 1F8GA 2LRHA 5CYGA 1M0EA 1KJ8A 1L9XA 3UJAA 1E1CA 2OFXA 4B81A 4CM4A 3L9XA 4B2PA 2CUKA 4QSMA 1JFTA 3DBIA 1PJ2A 1C2YA 2HDOA 1ZR2A 1PQPA 3S55A 3FDZB 4HXGA 4ZJPA 3BHNA 4OHXA 3WK4A 4U2CA 4FC7A 4HQRA 4U7WA 4AF7A 1L4HA 2QTMA 2WTNA 3O5AA 4AMBA 2AKAB 1NF8A 2PJZA 3V7NA 3UWKA 4QGFA 2W98A 1EINA 3PQ2A 3WGKA 1JJAA 3AY3A 3AI3A 2AYXA 2Q8NA 1EZ1A 1CJUC 1FFEA 2WSMA 4B6SA 3COPA 4LZAA 4KSYA 4WRRA 3S5UA 5E0KB 2ZYDA 1S2DA 4EB3A 2QE7A 2JLWA 1DT3A 1TTQB 4QXMA 1GAQA 1JLLA 1GPLA 3N8DA 4U00A 2Z2XA 5GOZA 4NYMR 4YJ2F 1EE1A 1EP2B 3C24A 1TVMA 1Q3TA 3FPGA 3OSUA 4QDKA 3ZWMA 3KXLA 1FYWA 1SWWA 1QBGA 2NN3C 1RYNA 3GX1A 1B8OA 2R4QA 3N0TA 1SUSA 4JU8A 2XYHA 3QK7A 1CP3A 4UBNA 1Q3HA 1USKA 3TDMA 4J2OA 2WF5A 4IMJB 5FADA 1JFFB 4C01A 5FPQA 3WGNA 4F8EA 1XRQA 3FF1A 4Z7OB 1PRYA 4E13A 3KEQA 2NQ8A 4MVJA 2LCFA 3FNEA 4P3YA 3G9UA 3MBKA 5JCXA 1EXNA 3Q9LA 4N82A 1TIBA 4N49A 1R8XA 1NUUA 3KZXA 4QD3A 2OBLA 4PHFA 3M89A 1PR2A 3SDZA 4OAOA 5DLEA 3U17A 9GPBA 3TZCA 3NU1A 4WUTA 5CUQA 3ZWXA 4KV9A 1T6NA 2BMAA 1Z5PA 2H9IA 2OLJA 3HKDB 1E94E 4PG7A 4HAIA 1QU3A 1JQEA 4BRSA 5IUNC 1HEUA 5K01A 3ENVA 4TWBA 2EC5A 3EC7A 1E9DA 4NFHA 1SKAA 2EKQA 1SEPA 4URHA 4XOIA 1W94A 3B60A 3RU3A 3TQQA 4XPIA 2NO7A 4ER7A 3TSZA 5FI1B 3RVRA 3B1ZA 4BWFB 2O0MA 4E08A 5ALPA 5CDYA 1N3YA 5H80A 1ZU4A 3WK7A 3DB1A 3G2MA 3GN2A 2Q7DA 2QTGA 1RPJA 2XOKD 3H87A 3W8DA 3FOBA 5C5IA 2ZUSA 5CW1A 4YP5A 4JKOA 3LCCA 2YJZA 4FUQA 1KPHA 5KYGA 2XKAA 4AZ0A 4OH1A 2AJ8A 4BWGA 4RJTA 1H4QA 1T3HA 4UDXX 1H94A 2KBFA 3K70D 4BNMA 1PL6A 1C4XA 1MX9A 1X14A 5DTJA 3M9XA 4NCXA 1U8EA 4DV6B 1MKYA 3AJ9A 1UMCB 1I5OA 2PO7A 3H2GA 2A1TR 3HN6A 4YRTA 3U9SA 5ISMA 1FRFS 4RA6B 2QVXX 4LSGA 1R8YA 4EPVA 5GJWC 1EVZA 3JZIA 2XV1A 1EFKA 1UMDB 2D1TA 3AWIA 4L5AA 4WNAA 1AMUA 2WIKA 2EQAA 2GRJA 1DV2A 3A70A 3N6XA 4KMOA 1K27A 1K97A 2OXCA 5EKSA 2W90A 1CY1A 3NFRA 5CB4F 3M81A 1HYBA 1P2FA 1X77A 4DCMA 5CA1B 2OL4A 1E5TA 4P4NA 5EESA 3N8GA 3WZMA 3ZHVA 4CQMB 1IB6A 4MKFA 4KKVA 4BMCA 5HQ3B 1YR1A 2DUJA 2O07A 4PE5B 4J0QA 4D9JA 2MTBA 1CE8B 3HY3A 2A5DA 4DSTA 3BH7A 3F9CA 1Y6JA 2X9NA 1FTNA 2XQGA 4HL6A 4LVOA 3SXJA 3WKAA 1NMXA 2AZ4A 5DT2A 3OOHA 2YWGA 1MC1A 5CVDA 3Q11A 5CX1A 1X86B 3C6YA 3AR8A 3E05A 4ARAA 4XYLA 1FS5A 4F1WA 4FJ0A 3HVJA 2VDPB 3I6MA 4JFRA 3WKEA 2ZOSA 3GFFA 4L85A 5IC5A 3ICQB 3HYLA 3TVDA 2VNIA 1SU4A 1I2ZA 3B6MA 1QH8A 5HUJA 2XMGA 1SRRA 3A1NA 1OYOA 1VKOA 4MVJG 4B6PA 4BWYA 1GZUA 1H22A 2DH6A 5AW1A 1IG0A 2F17A 3I76A 1B0UA 1MEEA 3F4KA 4C7KA 3NDBB 2GWHA 1MT3A 1JDBC 3NNDA 4ROSA 3MT0A 4FN4A 1P73A 4DMCA 4HVAA 4EYGA 3T1YB 1TAUA 1ZO8A 1WKVA 4X1KB 4GPEA 1QHIA 1F2TB 2VDOB 4P0QB 3V6LA 3A7EA 3TG8A 1XHFA 3W3AA 3UPTA 3QX3A 3N05A 3FGPA 5SZIA 1Z82A 4AKEA 1PS0A 1BA2A 1Z4KA 5I7OA 1J33A 1PEAA 1QE0A 2EQ5A 4RBNA 2JAPA 2AN3A 5LCXA 2WJVA 2BN4A 3FJOA 4FFSA 3GGSA 2CMFA 4LMBA 3OWXA 2BUAA 3A10A 2XJ9A 3LJKA 1PV2A 4WAUA 5DW0A 4C1NA 4EARA 1MHTA 3EXFA 4O1IA 2MDTA 2NPIA 4RUKA 2UVQA 2Q5EA 3IV9A 1U04A 2WAXA 2GM3A 2IZ5A 2CLDX 4FK8A 2WILA 5JCOA 4L95C 3RANA 1D9XA 3G85A 3Q88A 1QHFA 4R2JA 4HNTA 2JLUA 2ZRGA 3RAGA 1E2HA 1OYYA 3DS8A 1YU9A 2H5LA 4V3BA 4E5VA 2POCA 1M8GA 1K1EA 2ZJ7A 3DDWA 3R6GA 4NOLA 4ZDIA 1LSOA 3DHWC 4EKGA 4JI6B 2JLRA 3DQZA 4XWGA 2BWJA 4EG5A 1JKXA 1C9KA 4XVQA 2HXYA 2WEKA 3ZIAA 1XP8A 1U0SY 4QYIA 1OT5A 2D0DA 4BFWA 2JCVA 3GUUA 2AZXA 3LKVA 4ZJUA 1VG8A 2ODPA 1NKVA 1Y5IA 4KIWA 3V8QA 2R84A 4D5GA 4MUJA 1JIIA 5BYBA 4M1OA 4U6SA 1FP4A 5DGCA 4BEJA 4JP8A 5J2TB 1XZMA 1S0UA 2YWHA 3PFNA 4BMPB 4ERXA 3USCS 3CW2A 1C4WA 3PR1A 1P44A 1L4FA 5AOBA 3RDPA 2YN0A 1T24A 5CHEA 4CT4B 5B64A 2AJBA 4PZLA 3H11B 4S04A 1E6UA 1UDBA 3CRQA 2OGWA 4QLOA 5K99A 4OOEA 4UEJA 4CTMA 4WJLA 1ZKDA 4N3CA 5JY6A 4AB1A 2RHDA 3IGFA 4EF5A 2VS1A 2ZRIA 1TCAA 2ZLBA 4IIGA 3KYCA 1Z5OA 2OQRA 4GXTA 5I7AA 5EIXA 4KLNA 4O2BF 3HP7A 2QZ9A 1V8DA 1W0KD 1DAKA 3ROEA 1HDGO 1S9DA 5B1EA 4RF4A 1EQAA 3OF3A 2V74B 4UFPA 1R3DA 2I3GA 2QYOA 3IBFA 3TVTA 2HXGA 4NCHA 1ZNWA 2I3BA 4D43A 4A36A 1CZOA 5CMLA 5LA6F 4ER0A 1AF7A 1AU9A 3DM9B 1RE1A 2QS9A 4NENA 2NP6A 1L5LA 3BTVA 2D2EA 3ZI0A 4LYHA 1VRWA 1G8JA 2Q3LA 4B82A 1X38A 2AHRA 1E6MA 4X45A 3WX0A 3P4UA 1OIWA 4ZVLA 3FH0A 1SVKA 4G9EA 4GYWA 1GU1A 1OAOA 1FTYA 2C94A 3ESDA 2YBEA 5LZ4A 1SFRA 4MIYA 5K3CA 4H1UA 1U8ZA 2Z6AA 1A98A 3QPVA 4FX2A 1OU4A 4U63A 4FNAA 3N75A 1M8FA 4IWYA 4QYTA 2VF4X 3RCBA 1F6BA 4BVEA 1PLKA 4EHAA 3KFXA 1RBQA 2QN2A 2CE2X 3KLOA 3ZCRA 2VA9A 1JFSA 1FSSA 3HWWA 2Q9AA 1BW9A 4FDVA 2FH5B 2MR5A 3BWXA 3TUIC 1Q0SA 4BO9A 3Q5DA 3SOPA 4CMEC 4R71A 5JS8A 2OHIA 3I6BA 4LHEA 4CM9D 5BURA 3E9EA 1IUKA 4H4EA 4PBSA 2QG9A 3NHFA 3WC4A 3OAAD 1GRNA 1RJ9B 1QCZA 3NFYA 2HZBA 1FDIA 3AF2A 4KLRA 2JZNA 4TLDA 2I2XB 4H16A 2FAXA 4N8EA 3M6VA 5JPDA 3U6BA 2HQOA 1Y6QA 3RJMA 4F06A 3PXXA 3V2HA 1WM1A 2RCYA 4ZXPA 2NU8A 4GE3A 3E22B 3G0DA 3OD5A 5LQKA 3LOQA 2ADMA 1R0BA 1BS2A 4AS3A 1X74A 2EKDA 1YB5A 1I7DA 4Q1AA 3FM9A 5CB4A 2XDQA 4M88A 4OX9B 2BHRA 3HCWA 3CZQA 4XX0B 3TS1A 1XNQB 3CO5A 4NBNA 3AXTA 2DHDA 1Y5RA 1UBNA 1W49A 1CUGA 5IT5A 3BJIC 4FZ5A 4NU8X 1WZEA 3C7CB 4DZRA 1OAOC 1MW8X 5CIYA 2WKWA 2W2OA 4ND3A 2PIAA 3V8PA 1RLJA 5EE9A 4LJ9A 5CDSA 1XMPA 4DV0B 1ZVQA 4YALA 1CUVA 1B14A 1WTAA 2IVZA 3O4RA 4LBYA 2RB5A 3OTWA 1KEUA 1GRQA 5HPYB 4AJ4A 1XPRA 1LKZA 2OY0A 4W82A 3FPCA 1T5LA 1R50A 4F86A 2D2XA 2HNBA 2YVLA 2VHQA 3C98A 4QO8A 1YRBA 2QSZA 4R1UA 2BMEA 4ZKDA 3D3EA 4O33A 5J23A 3AG6A 2AQIA 1ENYA 1I3LA 4JEIA 2QNRA 2FPOA 2UXCB 4Q47A 3AG5A 5CA0F 1AB5A 1T2NA 2EJVA 1ECCA 1BE8A 2I3DA 1XZKA 4NS4A 2UV8A 2QN6A 2WLSA 2Z58A 3QNMA 4QAQA 1M83A 3NC4A 3DHEA 3ENKA 1QANA 2UZIR 1IUOA 3MGKA 3MYYA 1SCUB 3V7WA 2WUEA 2F1JA 1TL7C 4N3NA 3S99A 3LBHA 2NAPA 1A7KA 1U3VA 4DCTA 1Z13A 4GRIA 1E1RD 3EEQA 2CCJA 1GNSA 4GYYA 4RX1A 3E84A 3SX0A 3AUUA 1JR2A 4ZMSA 5HF6A 3K0AA 1PEYA 4BU1A 2GF9A 2XNCA 3MMNA 2IOQA 3WK6A 3RVMA 3LBYA 2JBAB 3EZ7A 2O48X 2YFHA 3DLHA 2WAYA 3MWYW 5A1TA 5HMMA 3CU5A 4WMLA 3LCVB 4R68A 4MKGA 2XODA 4K86A 4RZSA 4YACA 3RUEA 3SE7A 3T3OA 3KWLA 1WULS 2YXEA 4KFTA 4I8IA 1P4RA 4CI9A 1YCGA 2VQ6A 2CBGA 1UL1X 3KHKA 4BO8A 2AF4C 2CLKB 4M8NE 4NBLA 4LW8A 3IB6A 2K7FA 2QV7A 3PUJA 2J9YB 4QODA 2J41A 1YQDA 4LE2A 2O2HA 3JYLA 4L51A 1CD5A 5EZYB 2VJMA 2ZCJA 4GRAA 3SFTA 1SVNA 4V1CA 1XXHE 5IJZA 3UB2A 4EO4A 1E5XA 4L16A 2R85A 4AMGA 1XEWX 1T4GA 4LOJA 2KMLA 3VVBA 4JP1A 1QYWA 1OAKA 1XEAA 4OH7A 1G16A 4GVLA 2JFBA 1U11A 1XRNA 3I9MA 3TNYA 2OZVA 1XPJA 1ADBA 4N12A 5DCUA 3TTXA 5LDGA 2CD9A 3D6VA 4ABTA 1FTSA 1E1NA 1JQKA 3FGOA 4ZFNA 4D96A 3KKNA 5BMVB 1I1QB 2FPLA 5KU7A 4MR8A 5TPZD 2ZTMA 1W30A 4R2KA 4KBGA 1G9SA 2RI1A 2RIPA 1HETA 3H4MA 2WA1A 5IF9A 1GGFA 1FY2A 1XRMA 3W9SA 3DNMA 4C4OA 2HF9A 5G1OA 4CFZA 4G25A 5G4KA 5AD1A 4L6AA 2XMZA 1PFUA 4F7WA 1RKQA 2QE7D 2ZXFA 5L3RA 4ALJA 4D6PA 4MS1B 3UWMA 2WVGA 3ZQKA 4MQUA 3UG7A 1ULTA 1YHYA 5K8VA 4G09A 2YY6A 3AZOA 3QHPA 4LHXA 3HZZA 2PS3A 3VNSA 2KHZA 3HY4A 3EOAI 3P9XA 1HZJA 2GCPA 2A4KA 5JSHA 1Y8RA 3H86A 4Q00A 3BQMB 4O2BA 4C3VA 5BUQA 4FOLA 2VRBA 4FE3A 4IVQA 1D0VA 4S35A 5G4LA 4KRXA 4OXNA 1HE3A 1Y4ZA 2HA6A 1YB6A 3H18A 4WPGA 4KWCA 5LYJA 4AD8A 3F6RA 3UAYA 4MVJD 4YUYA 3ZHQA 1MO3A 5EGSA 3G49A 1EK2A 4IVRA 3AB3A 4FU0A 3GL9A 5LA6A 1OZAA 3QELA 1TM7E 3IAM1 1G8SA 3QVVA 2V6MA 2C4TA 2PMKA 4WUVA 4ER6A 1O4WA 2OGTA 2CLOB 4XWKA 2H1LA 3H9CA 4YJHB 2X40A 2ONCA 4CLHA 2H8KA 4MWGA 2CHGA 4R5HA 3KQKA 3CG0A 3H97A 4U7FA 4M36A 1GWNA 3M9WA 2XKKA 1H9BA 4EJFA 1PZXA 1XGKA 4CLEA 5CEEA 1SGWA 1G3MA 3SEAA 3VGPA 4HWPA 4CKWA 1Q2XA 4Q3NA 4BO7A 1U8YA 2QR2A 2VJAA 4PIMA 1D7AA 1Z6GA 3VPSA 4Z4QA 2E82A 1E2KA 5L7TA 5C1BA 3A4LA 2EX0A 5IAJA 4LF6B 1V71A 2I3AA 2JGDA 3I04A 3AFMA 3P9SA 5AIAA 1YE3A 1XCPA 2GZRA 2WF7A 3I9V1 1GQSA 3COVA 4AYTA 1QQAA 3HJCA 1F8XA 3LYLA 2A9JA 1SZJG 2HRBA 1RWBA 1FP1D 4PLTA 3ZKAA 5ULLA 4ZEVA 4F91B 1LZLA 2B1JA 2OKCA 3DXYA 1R37A 1R0ZA 1UPAA 1V3TA 1ZL0A 1KZ1A 2I7CA 4KLZA 1IBMB 2QRQA 3LUPA 1Y42X 1GGHA 3UMVA 4FYJA 4CTKA 1G0OA 5EYPB 1VGQA 4BBPA 5JS1A 4EWLA 1SXPA 2IH4A 1Z38A 4LY0A 2MSNA 5DLPA 5F7JA 3ZUGA 1GITA 4Y1GA 3DZIA 3E9RA 3EPJA 1WW3A 3GAZA 1CU1A 1V6CA 1PG0A 4PXYA 4UD2A 4YC7A 1J21A 3EXHA 1Z4JA 4AS1A 4GKJB 3TR5A 1O97C 3EPKA 2CGEA 3HZRA 1RJWA 1T25A 1YMQA 3FB1A 3L8HA 2HJVA 3QKSB 1JG4A 5DJ5A 2EJWA 3T12A 4BMDA 3D0RA 1N92A 3VKFA 1G4AE 3D8NA 2GHQA 4A10A 2FLKA 1RDFA 2FXVA 4FMBB 4FUTA 1LS6A 1ENOA 1TQ6A 4TWIA 3QBDA 4Y2VA 3DF7A 3TLXA 2PZ8A 2EWWA 4F3NA 2Z6UA 3ESXA 4ZVKA 4ZCMA 3WMEA 2GCIA 2H8GA 1T4CA 3B9BA 4IIJF 1EFTA 5BN4A 4OQPA 4XDHA 1VJ0A 3JQ9C 1G5TA 3EK2A 5KCMA 3EC2A 4KMRA 2BHLA 4MARA 4R1OA 4M1ZA 3CVXA 2PX0A 3TLGA 3BFJA 4REQA 1TTHA 2BKAA 1N36B 5CT8A 5LZ7A 1XK6A 2PM8A 2Y1OA 4KDEA 1G6Q1 1RRPA 4C1BA 3ZE9A 1T6ZA 3B6IA 1VLLA 3G9TA 3CONA 3EZ6A 2KSQA 2O3RA 5B6IA 2AKEA 5JSZB 5DBOA 4P5EA 4B74A 4N40A 3G2IA 3TQCA 4QIHA 2QMYA 4DA6A 5F7OA 1G5IA 4JX8A 4Q9DA 5B4VA 3HU3A 4E5SA 3DUFB 2O57A 3VV3A 1HE5A 1LNQA 1AKTA 3MJTA 4IJMA 4YS6A 5BQOA 3KFVA 2XMRA 3UWDA 1G17A 2GA9A 3ZNPA 3T95A 2C9BA 4MV5A 4DAOA 2QMOA 1KYXA 2ISSD 3LC7O 1Q57A 2EW8A 4M7OA 4TPKA 1ZK4A 2ANCA 1UBJS 4WOCA 3W3AD 1Q1ZA 2VAMA 4NU5A 4AO8A 4QJ5A 1ONBA 2J07A 4HWOA 4R9SA 1TT7A 1IMJA 4EMBA 4IIEA 3E23A 1QQBA 1HXHA 3RS3A 3Q10A 2E5WA 2W83A 5BORA 1V7PC 2HU7A 4ZAXA 4UCWA 4TUYB 2BCEA 1NSFA 3LSYA 4Y1RA 1SKYE 3DAOA 1E3WA 3FNBA 2BYTA 1SVMA 2JPDA 4BVAA 1BH6A 1UC9A 3DEAA 3UY4A 3DE1X 3PEVA 2JZCA 4R05A 2ZM5A 1X0XA 3E5MA 4C06A 1JVBA 1KYQA 1ABFA 3JD2A 4R1QA 1XTRA 1GPH1 1N7JA 2QHXA 5FNVB 4DZZA 3OTIA 3R2JA 4PLYA 4XYBA 3SG0A 4ZK2A 3HBFA 3ZIAD 4Q19A 2WFZA 4OQ4A 2UZ1A 3QGMA 5EQTA 2R8OA 1CQJA 1Q0LA 2FPIA 3ETJA 1MENA 4AG5A 4EA6A 1MRSA 5CDFE 3BWMA 2RHWA 5DGDA 3IUQA 1JXMA 3CR8A 4HLUC 3B8HA 4HAXA 3W90A 2WTAA 3OWOA 5JV5A 1K5DA 4HZGA 5C51B 4JBXA 1XPUA 4BFTA 3AOGA 4L0QA 1X8XA 2RG1A 4PVDA 4B8YA 1CK4A 3DW1X 4MCAA 3F6EX 1K7FB 3SKYA 3MQ2A 2PGNA 2NOAA 2YFQA 2DHQA 2A78A 3LDFA 2IC5A 3CZAA 1M2OB 1QYRA 4N7MA 3SR3A 5L3SB 3IBYA 2MYUA 3QEMA 4XW2A 5FWYA 3OFSA 2C4UA 2QGZA 2WPNA 3D8UA 1PDWA 3IPCA 3OX3A 4OQZA 5EPUA 1J8MF 1FA9A 3CLVA 8LDHA 2L0XA 2QM3A 1O96A 3D2BA 4LJ4A 5JWHA 4MPDA 3KR2A 2DYKA 1UZUA 2W2TA 4K0RA 3ICPA 1EUYA 4KFRA 4US2R 3TTSA 1CDOA 2IYWA 3PQDA 1ODTC 2XUOA 4QNNA 4UUNA 4X3OA 521PA 5F3RA 1IAVA 2OZLA 3H7IA 2CYCA 1L5ZA 2N47A 2PT5A 4OGFA 2VTBA 1X3LA 1BKDR 2UYOA 3D2AA 5JI2E 3VKWA 1EESA 2ORIA 4JVLA 3OOSA 4PPQA 3WQBA 2ZIGA 4OHBA 4BZQA 3AU8A 4ZOLF 3OUUA 3IPXA 3KS9A 1WCXA 3V4LA 1EEHA 3PVCA 2X77A 3H42B 4M9RA 2EBWA 4PRKA 4E32A 1DRWA 1GTL1 2IVFA 3DCNA 4IJQA 1VJDA 3CNQS 1ZUIA 4NBVA 2ZIWB 2GOYA 3CVJA 3TMKA 5CBPA 4H7PA 4ILKA 4HT3B 4WQMA 2X3YA 2Y1CA 1LY1A 1F2DA 3S2YA 5KOJB 3DV0B 3FZQA 2WNSA 3BFKA 2WU8A 2QTCA 1YQ9A 1ZLYA 1JR6A 1Q5PA 1ZJ4A 1ESEA 3K05A 4EMTA 3W0LB 4C6TB 2C3UA 1NULA 3KXKA 4EJ6A 2NMVA 3IOBA 4WACA 2INGX 5F2OA 4RD2A 1Z7BA 1VDMA 2VDWB 3MWEA 1EGAA 4QC2A 4C20A 4H3VA 4DDWA 1CUAA 3LZDA 4FEGA 3OZXA 4DLYA 1IDOA 1KRXA 3WYNA 3B5IA 1Z15A 1KGDA 4IUBS 4HHEA 4BGDA 2WFLB 2HH9A 4JQSA 4YV7A 2IODA 2RK3A 3CSDA 2G9RA 4L5BA 1YQTA 1PKXA 1MJGA 4H7KA 5ICFA 4JLDA 3T52A 3DFIA 3ZS9A 2IH5A 1ZD3A 4BRUA 1QGDA 5DM1A 4IGKA 1EM6A 4E22A 2C2GA 2FOIA 2P41A 2PS9A 1ZK0A 3EODA 4G3XA 4EBFA 5FAXA 4I36A 1PGOA 4R2XA 4DQ0A 3KOWA 5DK4A 1KOFA 3KVVA 3RG2A 1JP7A 3GLGE 2WIDA 3A6KA 4HWKA 5KVAA 4M6WA 3UB3A 5CM2Z 4E5DA 1DLIA 4IDDA 4MYTA 3HBLA 3U9LA 4ZD6A 3FMOB 1XD2B 2QJOA 3H1PA 1XDUA 1GT91 4P4SA 3ONWA 2FRXA 3ONDA 2FQWA 3PFFA 1KMHA 4RH3A 1ZQ9A 3ORSA 5F5NA 4UZSA 2DPGA 3RTEA 3KD2A 4LYYA 3QI7A 3JTMA 4FINA 4C0AC 4DCNA 2FZCA 3CF4G 1ZK2A 2VRCA 1NMQA 1V1MA 2Y76A 1DAOA 4ARIA 2W7TA 3ANSA 3WMRA 1TD1A 3OZBA 2I99A 2C5EA 1NU8A 2N75A 1PSWA 4LOKA 2HT1A 1XCBA 2IRWA 2PSDA 2PBLA 4JU9A 4FB5A 5AI4A 1I2AA 3DMRA 2HREA 4LVCA 1T1SA 2QE6A 2AK2A 1R27A 2WF6A 3FZYA 4NU0A 3BMOA 1XMVA 1EDZA 3WYFA 3T5CA 3DFMA 2OM2A 3OO0A 2LTAA 2G07A 5CVVA 2VZ0A 2PYDA 2H7YA 3LXXA 4L72A 1PBNA 1U81A 2QX6A 3EULA 4MMZB 2W93A 4GRDA 3ZK9A 3V3TA 4MTLA 1RI1A 3OEHA 1BWSA 4WD3A 5ILQA 3LG2A 4L0DA 5CB0A 1ZUD1 1PL0A 4C7JA 5DPMA 4IUCS 2FZVA 4ZHQB 3IIEA 4NFYA 3P0FA 4F45A 5T7BA 1R7RA 2OHFA 4ZO6A 3U3MA 5L4NA 4W9MC 3B78A 2BP7B 4G8CA 1U8XX 2WHEA 1V16A 2I2AA 1I0ZA 2L82A 3HNPA 3BA6A 3ONVA 4XGNA 5B58T 1SUEA 4RLHA 3MBOA 5CD9A 4CVNA 5ES4B 1LZKA 2IYAA 3NC1C 5J58A 1UKYA 2C3PA 3HDJA 4K26A 3ENQA 4GU5A 1PFVA 1QGZA 3DV2A 2B20A 2WKSA 2QN3A 1GVNB 3QVKA 4QYWA 3TRKA 5K4HA 5KVSA 1MV8A 5EIWA 4JI5B 4UZFA 4BUJA 3V6MA 4RZUA 1VJ1A 2Q27A 3GJ0A 4EELA 3AW8A 3PVZA 4U2BA 1CX9B 1XQ1A 4MRMB 4NATA 3VZRA 1NGSA 3M6UA 4XUGB 3WHKA 3IUNA 1ETUA 3OQ6A 4ENTA 2WT8A 4XQGA 2FOLA 1K7YA 1US8A 2RKBA 4Y2TA 1L6RA 2X8WA 3Q7SA 4PHGA 3S1LA 5P21A 2B37A 1LS1A 1LV8A 2GHIA 1UM8A 4Z3OA 2IUTA 2V7UA 5KNBA 3CRVA 1RBMA 5AICA 2VEOA 1JI3A 1SBHA 5F23A 3RIGA 4PAOA 4J0CA 5TF0A 5B57C 4AIRA 1M2HA 1Z6XA 2C88A 3KXPA 4Q1EA 5AKIA 3WTBA 4UUOA 4BB6A 2J3MA 1DWUA 4RLQA 3FSRA 3O7WA 1W6RA 4YRGA 4JZKA 3KRTA 1TIPA 1MTOA 2KWIA 2XB9A 4I2VA 4P9NA 4KXVA 4UEOA 2DZDA 2CZQA 3BSWA 4MPTA 4MR7A 4NJMB 2IZ6A 5AOVA 1KRWA 2DF8A 2Y2UA 2WSSD 4DGQA 1JRLA 5CDHA 3M4XA 1E63A 1EBUA 1XZ8A 1JDZA 1YJQA 3K9GA 1AKVA 1ZJZA 3DVAB 4KO8A 3VYSB 2EFGA 4KHZA 4AW9A 3NDJA 3PUZA 4NNJA 1KK2A 2WM2A 1W5BA 3SR4A 1QJCA 2VRWA 1VPLA 3K53A 4HDCA 3UBTA 1EFLA 1QTIA 1FFYA 1BXGA 3O90A 4YHBA 1ZOOA 1YI0A 3HSKA 4X64B 2JFOA 2OVBA 3CT6A 3CLKA 1BS9A 1FJ2A 3CLTD 5KQMA 1FP6A 3CE9A 3VZCA 3OZDA 4ROTA 4RPGA 3BTSA 3THSA 2OZPA 2UVPA 4FGLA 5DRTA 3FLMA 1R0XA 1Y8AA 1PYOA 1XDGA 1JB1A 2UVDA 1O97D 1XLUA 2VP2A 2YC4C 3FCOA 4PZUA 4QOFA 4YK7A 3V1LA 4AAYA 1YZ3A 4NK4A 4DILA 2JJMA 3PHJA 1H5QA 3D3KA 4KREA 2CXHA 3HU5A 3BHJA 4ZOLA 4IOKA 1S9HA 1VZ2A 2JIQA 4Z3DA 3OQVA 5MDHA 3R0QA 2R1ZA 2QVLA 4H6WA 3M4ZA 3KAQA 1EI9A 1NX6A 2VDUE 3B52X 3ILHA 4YH1A 3PCRB 5F35A 2RH4A 1ZI9A 3P32A 5KNCH 2NU6A 5M04A 4KH0A 3FPKA 4DIUA 3U7IA 1SC1A 1Z2DA 3DDUA 1T2AA 4K6MA 3U4CA 3X1KA 1NVFA 4BLSA 2FI1A 3QLVA 3LP5A 1YUMA 2QVBA 4JROA 2Q7OE 5KYUA 1Y89A 2I7VA 3IVRA 3AZQA 4PU0A 1SU7A 3NRJA 1BFDA 4C0QC 1UDCA 4ZKEA 1QZZA 1W2WB 1XELA 1UC4B 1GPUA 2FCRA 4RSHA 2Q9CA 4NV0A 2HK7A 5AKXA 3C0KA 4EW3A 2EKLA 1FFBA 4WXHA 5I7SA 2CLSA 1GLVA 2FPUA 3ADPA 1S2NA 1BD3A 1BX3A 1T2UA 2BGRA 1KIFA 3KYDA 3CF2A 2E1RA 3H1AA 3KCQA 2AL7A 4MUXA 4EYOA 1VBKA 4CDGA 2FUCA 1WU8A 1N9GA 4CIVA 3FDXA 3OM8A 1DFIA 3E9CA 3FAZA 3GCZA 3TOSA 3CX7A 5FWXB 1Y1PA 1EVQA 1YZTA 2AW3A 4RKFA 1E20A 1V11A 4M8LA 4TS9A 1RCTE 5KNLA 2QX9A 4TTSA 1WV1A 4G26A 4P35A 1FCJA 3E3LA 3WZ2A 5CVUA 4DVGA 5AUOB 4E4RA 3I28A 2I6XA 1TJ3A 1E9FA 2XDYA 4WKNA 2OG1A 3IAAA 5E6SA 1DX6A 4D42A 1ADCA 3GEDA 1NJ5A 2QU8A 5LXTF 3CJQA 4LJAA 1ZGBA 2QP9X 4QQ8A 4QNRA 1W4CA 7AT1A 3NH9A 3ZDYB 1S2IA 3IDZA 1E6KA 3JVEA 3R74A 1JU3A 1A77A 1W47A 2Q0HA 3EVFA 2ZSIA 5JMPA 3ZWBA 2VSQA 1JDUA 4JP2A 1WHTA 2OUIA 3GRFA 3ZV5A 1L5WA 4Z1OA 3MSCA 2ZZNA 5F5XA 2YWFA 3R5KA 1C8BA 1ECFA 4KPUB 3MT7A 2ZBDA 1VP3A 3HO8A 1XB2A 1XU7A 2PL3A 4GPBA 3CRRA 2C95A 3AO0B 4M3NA 4PS0A 4WDQA 4L4SA 2WYWA 4EPXA 4X1YB 1QYDA 3MMPA 4JDUA 4MUAA 1TYBE 1TQ8A 3SF8A 2G76A 1LTKA 5IHPA 4AJKA 2EIXA 1ESMA 3N0RA 4MQMA 4X61A 4MGHA 3ZYZA 1GNQA 1OXTA 3JQAB 1V41E 3PCTA 5KOHA 1JIVA 1Z39A 4OHOA 3OIGA 2DVMA 4F9EA 3QF4B 2X4LA 4E70A 3ET4A 3PVSA 1W59A 4EVRA 4EAAA 5KQRA 3BD6A 4RQAA 5HIMA 5FPSA 1G20A 1SKBA 1DX4A 1JHVA 1UQRA 1UXJA 2OENG 3QPDA 5FJIA 4N54A 3W2HA 1ZONA 4DYHA 1THMA 3ICCA 1Y4SA 3RAFC 3BF8A 1CDZA 1BVHA 3P9ZA 1TU0A 5EE5B 1HE4A 5COAA 2XBUA 1JSZA 1WCIA 1H8HD 3W5SA 5C5DA 3HR4A 1PT5A 1KTIA 3GIDA 1WQ1R 2FZ4A 1ZWLA 3QM1A 4MMYB 4Q9IA 2CNKA 3M6XA 5SYAA 2AI3A 3T3IA 2CZGA 3KQMA 1QHHB 1MGOA 3ELDA 4GOJA 3WWYA 3E70C 2JI9A 3EQ2A 4OJQA 1QQ7A 4WFKA 4BKMA 2HK6A 2LZ0A 3E9NA 4GPZA 2XI4A 3CUSA 4O4HB 4JLSA 4RQBA 3VHXA 5BWNA 3NC0C 4NH4A 3SC2B 2JLYA 2AG8A 13PKA 2NV2B 1VLZA 2C03A 2PU5A 1VE7A 4MYSA 3SX2A 1F4LA 3HRHA 5AUNB 3A25A 5KTNA 2VK8A 2DSNA 1TJ5A 5BP7A 2N1BA 1DADA 1UBEA 2EZUA 2V55B 3EH2A 2FWIA 2BZ0A 1UAGA 1PT6A 2O3UA 3EAQA 5TDHA 4JBWA 3I0NA 4FR2A 2DE0X 3LDAA 5FL3A 4UPVA 4D25A 5G53C 4D8YA 3HNOA 7ABPA 4W6ZA 4CCYA 1AZLA 2ILVA 1KJIA 1KEEB 1YUBA 1I8TA 3ADBA 5IJ0A 1JPUA 2R6DA 1T8SA 5BUCA 1GPDG 1IEQA 4QPDA 2JFQA 1LSSA 1O5IA 2HSDA 2WHQA 2ZYAA 1QIKA 1QO9A 3NUZA 4JOQA 4LNUB 4TLBA 1BKYA 3AVYA 1EA5A 6NULA 2P6NA 1XG5A 2J9ZB 3R76A 3CIFA 1C3VA 2JKYA 4CKZA 5JQGB 4YR7A 3K6SB 4UBKA 5HZGA 5HDQA 1RPTA 3EY4A 2JFHA 2OHVA 3AY7A 3NIBA 4WIAA 2Y9PB 3BX1A 5HGXA 2G5PA 1Z5GA 3K9NA 4IILA 4WVLA 5DNYB 3I23A 4IHJB 2A9VA 2VNHA 1VPEA 5E4FA 3F6CA 1N25A 3EH1A 2OCGA 1DJPA 3T15A 4FW8A 2R8BA 3L79A 3MAAC 1Y1SA 2X4DA 4F4UA 1P7VA 3WP0A 2BFEA 1I32A 2QMQA 4X65B 1FBTA 2HNAA 1BZYA 3I5XA 4YI5A 4E03A 3HDHA 4TTTS 1LPPA 1XA3A 4W1SA 5L3ZA 2PUDA 4DR6B 1RYFA 2WJ4A 3E8MA 4AFNA 1CXZA 1N2BA 1UPFA 3C7DB 4B48A 1E64A 4G8JA 4RD0A 4F04A 5LQMA 2GETA 3EEOA 2JI8A 2IXFA 3PUYA 1ARZA 3FTCA 2RG7A 4IVNA 1OLXB 4JI4B 5DASA 1DO2A 3EUWA 5FFMA 4DDUA 3Q3IA 4EW2A 1JBKA 3X1ZA 2M32A 1U0LA 3ZD6A 4JI7B 1BHQ1 4QLBA 3KETA 3RU2A 4RY8A 3THWA 2QNBA 4I08A 1Q0TA 4M0PA 3F9IA 1BAPA 1FVOA 5IUJC 1GPKA 1P62B 1EFVA 1ETHA 3FMGA 3AR6A 2WC1A 4IWNA 4TT3A 3ZXIA 1ZG3A 3S8YA 2OFOA 3SIXA 2OV6A 5KOYA 4MEJA 3CNEA 1Q6ZA 1R66A 2Q45A 2AN1A 4DA7A 2RHGB 3FNQA 4YP1A 4M7PA 2BLLA 1NXQA 2D1QA 3EVDA 5IRCD 4BFCA 3H9BA 2VJDA 4U5XA 1IY0A 1QC5B 3SYRA 3S2EA 4YY3B 3NNNA 4OXQA 3HSSA 1KJ9A 3NASA 4O4JF 2OQVA 4ALIA 2IDZA 2H29A 4M9QA 4PC3A 4AN1A 4N0DA 4CM3A 3ZK7A 1QKKA 1JTVA 2EDAA 3WK8A 4ZODA 1FOEB 1U3DA 3VPAA 2MYTA 3D5TA 2C2BA 3R5TA 1JPVA 2AFRA 1A97A 1AKNA 2FLWA 2ZB2A 4MEBA 4PW0A 3E2PA 3THYB 3G8YA 4BCCA 1YAJA 2Z0MA 3UZUA 2AOTA 2CN1A 3K0FA