3E9RA

Crystal structure of purine nucleoside phosphorylase from schistosoma mansoni in complex with adenine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
285
Chain Sequence
b'ESVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSVVGHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine-nucleoside phosphorylase
molecule tags Transferase
source organism Schistosoma mansoni
publication title Adenosine binding to low-molecular-weight purine nucleoside phosphorylase: the structural basis for recognition based on its complex with the enzyme from Schistosoma mansoni.
pubmed doi rcsb
total genus 92
structure length 285
sequence length 285
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e9rA00
4GKAA 5F7ZA 1Z37A 3TL6A 2Q7OE 3UAYA 4TXJA 1G2OA 1U1FA 1V3QE 3UAZA 1TCUA 5F7JA 1Z5PA 3ONVA 3LBAA 1LX7A 4OEHA 4X24A 1RXSA 4QFBA 4L5CA 2PGAA 3OOEA 3T94A 4D8YA 2AC7A 3DDOA 3EMVA 1U1CA 4G8JA 5F77A 5DK6A 1SQ6A 3C74A 5CCDA 1PK7A 5F78A 2AI2A 1K3FA 5CYFA 2ON6A 5EFOA 5F73A 1RYZA 1VMKA 3OOHA 3OCCA 4QARA 1NC1A 1T8SA 3DPSA 1PBNA 1A9SA 1A9PA 4DA7A 1TD1A 1N3IA 4YNBA 3DP9A 3ODGA 4UC0A 2HRDA 2I4TA 3MB8A 4NY1A 3IOMA 1XE3A 4MCHA 1JE0A 4D98A 1CG6A 2AI1A 4FFSA 4DA6A 1RR6A 3FNQA 3OPVA 2A0XA 2I8AA 1FXUA 1YQUA 2HSWA 4MCIA 2BSXA 2HN9A 1TCVA 4TXNA 2OXFA 1M73E 5B7PA 1A9RA 1Y6RA 1V2HE 4OGKA 1JDVA 1ECPA 3P0FA 1PR2A 1B8NA 1NW4A 3EUEA 4TTJA 1Q1GA 1Y1RA 4PR3A 4LNHA 5EUBA 4TYMA 4BMZA 1JYSA 1OU4A 1OUMA 4DAOA 2OC4A 4DAEA 4LDNA 4WKBA 4YO8A 1V41E 5B7QA 1PR0A 5FAKA 1Z35A 1JDZA 4WKPA 1RSZA 3NBQA 3DF9A 3BJEA 4JP5A 1ULBA 3NM5A 4NSNA 2RJ3A 1K27A 4TXMA 4I2VA 1OV6A 4WKNA 3K8OE 4JWTA 3O6VA 4QASA 3OF3A 3DJFA 3INYA 4TTIA 3LGSA 1PKEA 1T8RA 3ENZA 4D9HA 3BL6A 1CB0A 2ISCA 3GGSA 3PNPA 4ECEA 1LV8A 2B94A 4WKOA 2GUWA 1PR4A 4BMYA 3KUKA 4WKCA 1SD2A 1TGYA 1JPVA 4QATA 2IQ5A 4DA0A 4F1WA 5B7GA 1Y1QA 1Z33A 4EB8A 1V4NA 5ETJA 3GB9A 3F8WA 5F76A 4L6IA 4D8XA 2QSUA 1Y1SA 4E1VA 3OZDA 1VHJA 4JOSA 3LA8A 5JPCA 1PR5A 4F2PA 1ZOSA 4QAQA 1PF7E 4NS1A 1TGVA 1Z36A 3IEXA 1RXUA 1A69A 5CYGA 1Z34A 5F7XA 1JDSA 2QDKA 4G89A 4L0MA 2A0WA 1ZL2A 4G41A 4DARA 1T8WA 4QEZA 2AI3A 3KVRA 4L5YA 1JE1A 5EPUA 4GLJA 4TS3A 1NC3A 1PR1A 4P54A 1U1EA 1A9TA 2QTGA 3UT6A 2XRFA 4YMLA 4BMXA 3E0QA 3OZBA 3E9RA 4D8VA 2QTTA 4LZWA 1A9QA 5B7NA 4TTAA 5IU6A 4PNPA 1JP7A 3E9ZA 4LNAA 4OGLA 5CXSA 1JDUA 4R2WA 3UAVA 1A9OA 3NM4A 4L5AA 3P0EA 3NM6B 1V45E 4LKRA 3FAZA 1SD1A 4M7WA 2A8YA 2HWUA 2P4SA 3MMSA 1U1GA 4R31A 3FWPA 1YR3A 3BSFA 1RT9A 1RCTE 1K9SA 1ODKA 1YRYE 3UAXA 4IP0A 1Z38A 4TS9A 1VHWA 1T8YA 4YJKA 1YBFA 3BGSA 1ODLA 5K1ZA 1QE5A 1Y1TA 1VFNA 1RFGE 1PR6A 4F2WA 3EEIA 4K6OA 3KVYA 2QPLA 4BN0A 5CXQA 4M3NA 4DABA 4TXLA 5CCEA 1JDTA 3PNSA 3FB1A 3EUFA 3SCZA 1OTXA 2OC9A 4R2XA 4RJ2A 3UAWA 3KVVA 1YQQA 3FUCA 1SJ9A 4OY3A 1Z39A 5C80A 1WTAA 1Z5NA 3PHCA 4OF4A 3OZEA 4MARA 5I3CA 2A0YA 1PW7A 1V48A 3PHBE 4DANA 3D1VA 1ODJA 1RXCA 4GLFA 1B8OA 1PWYE 4TXHA 4F3CA 3OZCA 3FOWA 1OTYA 1ULAA 2OECA 1T0UA 4KN5A 4F3KA 4GMHA 1Z5OA 1PK9A 1LVUA 4U2KA 4OJTA 3K8QA 4M1EA 1OVGA 4H1TA 2H8GA 5IFKA 5F7OA 3QPBA 4DA8A 1Y6QA 1ODIA 5KB3A 4EARA 3U40A 3KHSA 1C3XA 3KU4A 3O4VA 1I80A 1U1DA 1RXYA
chains in the Genus database with same CATH superfamily
3QX3A 4GKAA 4DLKA 1Q77A 3E5RA 2XGJA 4YRPA 2GXAA 3MWFA 4GGOA 1XQVA 2PM8A 4J6FA 4M0LA 3PK0A 2JIDA 2GVZC 2VTKA 3DHWC 3TRIA 4XVQA 3X43A 5JNTA 4B3MB 1BVUA 2EZ4A 3GFRA 4M2LA 2DBZA 3VZBA 4XVUA 2LD4A 4J0HA 1P7VA 4LXGA 2GB4A 2TYSB 3N87A 1IUNA 4ZPXA 1DJNA 3LM8A 4LMAA 5SYNA 3PX3A 3GV0A 4GBJA 4KXNA 3R74A 4BC0A 1VL2A 1TCUA 3IAS6 3LBAA 1X14A 1ZKDA 2GM3A 4CF7A 4HK4A 3WDKA 3VPCA 1U9IC 4QTZA 1ZW6A 4MWOA 4QUGA 3SFTA 1IJFA 3ASUA 3ZBPA 5L45A 3Q3HA 2PSEA 4JUDX 1T0JB 2ZR7A 1QQ6A 2XT9A 3WQQA 1JVSA 1GPAA 2GAJA 3LFHA 5FPSA 1FFXA 4CM9A 4IIJA 5B4TA 1E2KA 1W1WA 1EFVA 3I6ZA 1NWCA 3MF4A 4OQ4A 4RGVA 4XA8A 3STUA 4DCJA 3O3OB 3IKTA 4BP3A 3MT0A 5TMEA 1UBMS 5JHGB 1WQ3A 1RS0A 1IXKA 1UFRA 3UGQA 2L17A 4Y2PA 2B3TA 3CVUA 2WSLA 2XCIA 4PFQA 4MV5A 5IDWA 3B13B 2QZJA 4RX1A 1D2HA 2C9MA 5D3MB 2FK7A 2D59A 3FPSA 3KE8A 4YJFA 1XTZA 1C8VB 3G88A 1Q1BA 4UE2A 4NR0A 2YOFA 4KPGA 3SQLA 3DCYA 4BMSA 2GD0A 4C29A 2HO5A 3OJEA 1B4DA 2WIDA 4MUEA 1YTUA 2RMKA 4Z2AA 1OGYA 1N2CA 2QTNA 1MB2A 2UYQA 3LIPA 5D5PA 2BTQB 2RDMA 4PPFA 4IH9A 2IXFA 3DPSA 4M6WB 2EF0A 4IPTA 4UJ5A 4KGXA 4PHGA 4BHTA 2A9VA 2H11A 2VSNA 3G0CA 4R1TA 4RA9A 3VXKA 2IH5A 1MB9A 4XGNA 3IX7A 5AKYA 1SXGA 1FFWA 1ZK3A 4URWR 5ICSA 1XF1A 2QX7A 1CE8A 3DP9A 2PZEA 3N2IA 4H16A 4DLXA 2H07A 2ZYAA 4Q1AA 1O5TA 2I4TA 3VPDA 4B5LA 5AUOB 4MAAA 2PXCA 2H4YA 5AFSA 1Z7WA 2ET6A 2F00A 2QPAA 1YXMA 1DC4A 3A4VA 2G1PA 3ECAA 1N2IA 3DCJA 4POOA 2DERA 2H9AA 5CIQA 3VAAA 4EJSC 5IH3A 3RIEA 2Y4NA 2REBA 2XBUA 4XQEA 5D51S 4FFSA 4KPFC 2A9RA 4BDTA 2I8LA 2BFCA 3OBIA 3TH5A 4BVGA 1CQPA 2L42A 4UDNA 4MGYR 5FIUA 1V6SA 2Q5LA 4EFNA 3RVSA 4XQ9A 1UAGA 5IDVA 4LF5B 1KK1A 4YX9A 2BSXA 2I4IA 2COEA 2NQ2C 3IR7A 2G88A 2OO5A 2DH6A 3BQ9A 2F3RA 2GN6A 3JQ8B 1DWPA 1K86A 3LZDA 3SDSA 4EB6A 2V1UA 4L4UA 1CR2A 4KMMA 4MQMA 5BSVA 1YASA 1AS2A 5T3YA 1JDNA 2VTVA 5D3QA 4PIPA 5CFQA 1Y5LA 1NI4B 4YBZA 3GXOA 3BGOS 4XI9A 1DBVO 3ZWQA 2P9HA 721PA 4OJNA 4DQVA 2VHWA 1T0PA 3FIJA 3GFGA 4EF5A 4IGAA 2B21A 1Q92A 1KMQA 1SFRA 2P2SA 3HFSA 2D2VA 3NFRA 3LCRA 3QQPA 1UODA 2P3LA 3CBQA 2PO7A 4IV0A 2R8PA 1TOAA 4LVCA 2BKEA 1TEHA 3SNHA 1HDGO 3WRXC 2QMEA 2KS6A 4G1MB 2REOA 3WGGA 2EWMA 3DG9A 2IKSA 2V0GA 3RNLA 1HLPA 2UUPA 3RO7A 3O2NA 3ER6A 1C4OA 2B6NA 3OCUA 2BJWA 5DTMA 4YK7A 5L3ZA 4HVTA 2FSFA 1J0DA 2LR0A 1E3JA 2P9GA 2IEIA 4Q1CA 3WWCA 2WWXA 2PS3A 4FLEA 5T4BA 5KSZA 4HRVA 2C84A 3U49A 3HY6A 3PWSA 1ZUIA 4I6GA 4JB8A 3U9TA 2FHSA 5E6SB 4FYYA 4MW5A 3ANMA 1Z35A 2ZT8A 1QH1B 3GRVA 2WC1A 3MBIA 1WP9A 2H0RA 1RIIA 1U7ZA 1YFKA 5TR9A 4RE5A 5JS1A 3CLSC 5IJ9B 4UM8B 2LTAA 2BFAA 1XFAA 3Q41A 1X77A 4WMLA 1DO2A 3MTEA 5H3HA 3EQ8A 4GMFA 4OQQA 5FBQB 3A36A 2M6RA 1JWLA 3GUYA 1I94B 4TUYA 3GD7A 4LYJA 5BURA 2VUHB 2CJPA 3QJYA 2SHKA 3V4OA 3JSXA 2BDUA 3AKDA 2C5GA 5CU7A 1JJAA 1SBQA 1TJ4A 1Z6GA 3RANA 4TWZA 1E2UA 3W5VA 2YWXA 1RHMA 4FGWA 4AKIA 1UXOA 4LOIA 1HYBA 1B00A 3CM0A 2PQMA 1W1IA 2FI1A 2NO6A 2X2PA 1E77A 3EDMA 2ZI7A 3K8OE 1DEHA 9LDTA 1A8QA 1OBOA 1WAMA 3AF2A 4N03A 4OXYA 1G3UA 3B9QA 5D3KA 2YJZA 3A31A 2P9TA 2W0MA 3FPFA 2J4CA 3H1AA 1FS5A 3GRZA 4Q7KA 4XOIA 3U7IA 5FWNA 2J0SA 3ILVA 3KJGA 3LLVA 2QMOA 1Z07A 2VT3A 2QU7A 3TECE 3VNBA 5J47A 4ER6A 1TT5B 5CX1A 2IP2A 1G5QA 2Z6VA 1NYLA 3HACA 5J2UB 2VPYA 2Y2VA 4DBZA 1U2GA 1N6HA 5JS6A 3DOOA 2CCGA 4BMNA 4G37A 4B09A 2R1ZA 2H00A 1X7ZB 4FHFA 5JFGA 1XTJA 1E7WA 1CDEA 2W9XA 2A94A 4BLTA 4D3DA 3L04A 4MWTA 2MYTA 1YRLA 5JAZA 3RYCA 2BT4A 1TGYA 1LLUA 1ST2A 3QXHA 5IPFA 2GM5A 1WDMA 1E9AA 3WGZA 4CL2A 1M5UA 3RVRA 3WJ7A 7MHTA 5AW6A 2WV9A 3GXBA 2R8RA 4H4EA 1KZGB 1UBJS 3PXGA 1AKMA 4IVNA 4DUPA 3OQ1A 4BZQA 4Y1EA 2Y27A 1KOFA 4QUJA 4Z4FA 1YCHA 4HEA1 4AWAA 5B2ZA 2F67A 4UE3S 3U7QB 2FZLA 4JOSA 1M6YA 4CMBA 4R71A 2PUWA 4PGFA 3HXMA 4LTNA 2W7TA 2VDNB 4MXDA 1ZOSA 1OWMA 3PB3A 4OP3A 3VR5H 3ZDYB 4CG2A 4ER7A 1TEZA 1EGHA 2VK8A 1E3EA 1NULA 1UMBA 2J45A 2B20A 3M4NA 4IL5A 5GIOE 2HA2A 2BONA 2JH9A 1F5NA 2O2HA 4UM9D 2ACVA 1A4XA 2M9MA 2UVQA 4GLBA 4X1KB 2I2WA 2BGIA 3MJSA 1Z2EA 5CK4A 3PC4A 2V3CC 3T54A 4OUKX 2AQIA 1X0XA 2J9ZB 2VOEA 3BD6A 5E8RA 2A4KA 1ISPA 3AFHA 5E6RA 1OIVA 1XXLA 1G8YA 5K20A 2B0CA 4CEHB 3PLAE 2QYTA 2A7XA 3CF2A 2UZAA 4BB0A 1QU3A 3PEWA 2FUKA 5ECWA 2G1UA 4KQKA 4F2HA 4OMFG 5LU9A 2E6UX 3W2IA 5GJWC 4F6RA 1FUUA 1YZLA 4M9ZA 2EBUA 3A27A 1PS9A 1O5OA 2RC6A 2IZ1A 5EE0A 3HR4A 2E55A 3R6GA 5B1DA 3G5MA 1RM0A 5GY7A 3A9WA 3IQWA 3ACBA 3NTVA 3ZCUA 1OYVA 4FGZA 4KB5A 3QHPA 4ZV9A 5HIKA 3I9OA 1A9TA 2QTGA 1H5NA 1FSZA 3CUWA 4GKBA 3GLGB 2DKOA 3RRYA 1KEEA 1FMTA 4RVNA 4EQZA 2WEKA 4BASA 2OBLA 4H4DA 4NMMA 5FQNA 1CW2B 2IBTA 2R2AA 1VL5A 1CVLA 5H4GA 3KZNA 2I87A 3P19A 1Q1QA 3TQOA 1W5BA 1CFZA 2ERYA 2PD6A 3L18A 2ZQZA 5LBUA 2JAUA 1GA6A 5IVPA 3T9FA 1E9FA 1M1YE 1WE2A 3GAZA 3K20A 4OFWA 2VK2A 2JD2A 3LH5A 4U6NA 3E9ZA 1GTRA 1NUAA 3ZLVA 4LK3A 3ZJ4A 1XD2A 3E8MA 1ZN8A 4MWBA 3LWNA 2IGBA 3KTOA 3OZFA 1N1DA 2FZCA 4PSDA 5A05A 4EJ6A 5DMHA 3JQRA 3O75A 4QDJA 5AUQA 4EG4A 2JZOA 2DECA 2AQKA 4C88A 5ICEA 3NDBB 1XXHA 1Q15A 4OXRA 5GGXA 3FFXA 4UQOA 1DOAA 2GHRA 2W2QA 4S2EA 4PGMA 1FVOA 3Q7IA 4RKEA 4ASUA 2IUUA 4ZXFA 2CJWA 4XX0B 2SCUB 1N75A 3RHTA 4XXHA 3G9TA 2FP3A 4JFAA 1IPHA 2XY4A 2GVNA 1U2ZA 3AJAA 1WPRA 1QDEA 3HR8A 3HXPA 4IDCA 4RK6A 2Q45A 3WK8A 1VOTA 4UVDA 2PUTA 1M5RA 1SXJB 2H7CA 3OESA 4HV4A 4D79A 2FSVC 2JGDA 2WV7A 2KPOA 2QTFA 1NFQA 4Q9LA 5HKAA 3DFKA 5CH3A 5FBLB 4GHWA 1D2CA 1NV8A 4PZ0A 4IP0A 3QUBA 5BV1A 5LP1A 5JNLA 2XNJA 2YV2A 4TTTS 3ZBUA 2UUCB 1RHJA 5IVIA 3VR4D 3QTLA 2B9VA 2NACA 1K63A 3QFFA 4IIYA 1YBFA 1ODLA 1CT9A 2J6CA 4F6LA 3NBMA 1P9NA 4GXRA 3I1IA 1CY8A 4MQEB 4K81B 1IG0A 4GBED 1X7ZA 2ZAIA 3MNFA 2VAMA 3OA2A 4CXMA 1S7GA 5DX1A 2YJ4A 3VDQA 1E2HA 2QY9A 4K6OA 1CQIB 3H75A 2XKBA 4UVEA 5EXEA 4NF2A 1O94C 2XCQA 3CVVA 2H7YA 3BE6A 5TNXA 5COAA 3L4SO 5B1HA 3UPDA 1KEZA 2D7JA 4PLGA 4CMIB 4B74A 1QYVA 1L6IA 2O2XA 1WB5A 1YDMA 3HDVA 3TSZA 5EA2A 2GZHA 5EE5B 3JQAA 4DBVO 2GPTA 5CXUA 1Y6GA 2GDZA 4L0CA 2HU7A 3CWZA 5DTRA 3SSMA 2B5OA 2BCJQ 2ENWA 2JGAA 3IDFA 3YASA 1JAXA 2QVBA 1AK9A 1L0BA 1NOKA 1QVVA 3QE4A 2F8MA 2ICAA 1PJAA 5BRAA 3E23A 1H8HA 1OTXA 4RSGA 4JSRA 2G5PA 2P41A 3UC5A 1TUBB 4E2XA 3LLCA 3IXQA 2YHIA 5F51A 5TDHA 1DBRA 1CF2O 3V80A 4PNZA 1C4WA 3JVDA 1RMQA 1SZPA 4L51A 3HDJA 4JBNA 5EOVA 2O1XA 4I55B 3EDYA 5HG0A 4WZAB 5LD2B 2A5LA 2C2MA 3AHFA 5HDBB 3W5DA 2P0AA 1EEHA 5JBQA 2DYKA 3D3KA 2VSYA 1JW9B 1HYEA 1LKZA 3KYCA 4GLOA 4GU5A 4LA4A 1OIXA 2QKYA 3E8SA 3REQB 1EXDA 4FZ3A 4RIHA 4W7IA 1QHNA 1QYDA 1RCUA 1T9ZA 3CB4A 2GZAA 3GUZA 4PQGA 4ZALA 3ZQ6A 3ZHRA 1X8LA 5K0SA 2HRQA 5KTOA 2PKCA 1TZCA 3COWA 3T9BA 3AJRA 1CUUA 4CMAA 3F8SA 1H9CA 3F9CA 1MH9A 1RJ9A 2BMWA 2YZ7A 3SSNA 4Y6LA 4KACA 4TM7A 1MTZA 3FOWA 4BQSA 3H9UA 4D44A 5T5QA 3I30X 1I2AA 1MC5A 4MS4A 2JI6A 4C4OA 1EUCB 1ULAA 1EK6A 2OECA 3FTQA 3IIIA 2YMQA 1ABBA 3V6MA 1BU8A 3GUCA 2ZJ7A 4WNAA 3T5DA 1ZRNA 5C8YF 3RD5A 1B8PA 4ZVMA 4ARIA 3B78A 3P20A 2OO7A 1J5EB 4AS3A 1UJ4A 4G07A 4OA5A 4G67A 5EZQA 4H1TA 3TQCA 1SCDA 2QN1A 1VLMA 3ZOZA 1BVHA 1GA1A 4EFMA 4L76A 5JE8A 3NT2A 2YW9A 4WBNA 3KAKA 5HF8A 5BOSB 3A4YA 3CTMA 1M6WA 5EFZA 3WWZA 1RM3A 1AN9A 4R0VA 4D96A 1L2TA 5DO9A 3VU3A 1CRQA 2MSKA 3JATB 3UOAB 1HQYE 1GZ7A 2ALJA 3MCUA 4KXWA 1UWCA 1TI7A 4JY7A 1AHPA 3KR1A 5H9VA 3UG7A 3KT6A 3Q3JB 4HQOA 1DMRA 4B81A 1NYRA 2ECQA 1JN0A 2PRKA 4ECAA 4P98A 1WY7A 2AFIB 2KI5A 5DBIA 1YHNA 4MDYA 4ABTA 3SAJA 2YFKA 3RUDA 2PK3A 3RJMA 1N0VC 4NBTA 4TL7A 4ARAA 3FCUB 1J1IA 3EIQA 1ZHHA 3NC4A 3ZU5A 3SE7A 4QTUB 4JOQA 1SOVA 4DEVA 1RBYA 4RS4A 4E6EA 3VDRA 4GH5A 4CYMA 2HQSA 3AJ8A 3PCRB 4KDEA 3ZIDA 3O8CA 1ETHA 1G2OA 4JT2A 5T41A 3RHSA 1Y8RA 2Z9DA 5EEHA 3HN6A 1R9MA 3ZKAA 1MQAA 4HUQA 1C3OA 4B0OA 4FFPA 5AKKA 3TPZA 1RRVA 3AR4A 4XCQA 1KQPA 4EY8A 3DB1A 3RKSA 2I1LA 5HIIA 1PEAA 3IGFA 2OMKA 1E3SA 1CS0B 4IUYA 1N3BA 1OIWA 2VDJA 3JALB 3ACDA 3RSLA 5JS7A 4NX2A 2WQ7A 2PZKA 1UP4A 1Y5NA 2OO5C 3I83A 1GUFA 4OH1A 4HP8A 2XECA 4N39A 4FMCF 3BJRA 1N2EA 4O2BF 5EZ5A 2VJKA 5BQFA 5KU7A 2ETXA 1L7NA 1L4LA 4Q3NA 2MYUA 1H5QA 1YVUA 2QVLA 3M3HA 3PJGA 2JI9A 2QRJA 1PK7A 1F3LA 1WVMA 2Q3MA 1XCJA 3H18A 3PR1A 1GDDA 4G4SO 3DFUA 3HU3A 4AULA 3EVDA 3GRCA 4J7XA 2PBFA 1E1LA 1XZIA 1NQWA 1Q7TA 1RYZA 4NEGA 3MWKA 1CF4A 5LLTA 3WLMA 1H4TA 3IUQA 3OHPA 2XMSA 2O5EA 2QF7A 3BWCA 4BV8A 1RQNA 3PQDA 2EVWX 4J0FA 2XE4A 4EPWA 3ZGYA 4H6XA 1ZIXA 2VSFA 3NJ8A 2FCRA 5ELLA 2RGNA 5KNCD 3SP1A 1YKFA 1V8OA 4H7DA 1QWOA 2A4MA 4DRXA 2BMJA 2B37A 2Q3BA 4B8WA 5JR3A 1H22A 1UR5A 3KSUA 4RV5A 2IHYA 5AVVA 4IJ6A 3I0NA 4YPVA 1SM4A 3E4DA 3BXFA 1GZVA 4PSKA 3PEEA 3MYYA 3TOVA 2RJNA 3UV6A 2GPNA 2QI9F 3PVZA 4R1MA 1L4BA 3RSGA 2NNLD 3DOUA 3PUHA 3S70A 4DPLA 2BVNA 2I6TA 2I6UA 4HNSA 4Y30A 5EWLB 1S02A 1JVNA 2FRDC 3RTGA 2RKWA 3WZLA 2RARA 4ZDWA 1PR9A 1HETA 2I8CA 4F12A 4PQFA 4ZQBA 5A62A 1ECBA 4HWKA 4EMSA 5AJHA 3QEJA 4YASA 2X0FA 3ZLUA 3V5NA 2QUKA 1QFSA 1U4SA 3THRA 1BGXT 1YB6A 3Q2IA 2QTBA 2Z4RA 1MO6A 4Q4HB 1B1CA 4PVCA 2A92A 2W43A 2FMKA 1GWNA 4DLZA 8MHTA 2QG6A 3ANTA 1GHTA 4F5WA 2PQ0A 5J1SB 2OCDA 2XYPA 3QYAA 4FFDA 4QGHA 1TYDE 4NVRA 3C1TA 4O1IA 3UY4A 3LI2A 1C9YA 2Y1EA 1TCVA 2EG5A 3QIAA 1PQ4A 4H1UA 2J87A 3PRHA 3RVLA 4JT9A 3ONWA 1E9DA 2Q6IA 1XZJA 1IZZA 1M2JA 2W71A 4U7HA 4IYJA 4WZBA 2O0KA 3OM8A 2XDYA 2JIPA 5GZ6A 1L8QA 3CLUC 1P0QA 4FR5A 1KYYA 1XZBA 4L3WA 4XR9A 5KYXA 2GZDA 4UARA 5F98A 1Y82A 2QYSA 4UCQA 3Q72A 4BGEA 4OX9Y 1ECPA 3ESDA 2XUGA 2G36A 3B3AA 4QFDA 1KH2A 4ENUA 4Z4QA 4QLOA 4G63A 4DN6A 3L4KA 2X9GA 3HCFA 4WIAA 1RPTA 3MAGA 1ZI6A 4IMIB 1MBZA 3G7UA 5JY1A 1NI3A 1EJ6A 3HNRA 1DBIA 1Y1RA 5IYZA 5EUBA 2FG5A 5LP6B 5AH0A 1RI1A 1MJNA 3OPXA 3ADCA 4DIDA 4LDNA 1UZUA 4ED9A 3NWOA 1BDIA 2QQEA 3QH4A 4MRNA 4IH4A 2V7QD 4OHYA 1Y0BA 5EMHA 1IATA 3CZ5A 2OBXA 3H97A 2YIVX 2V58A 5IS2A 1XLUA 4IJWA 4BRWA 1E3MA 2IHJA 4TQGA 5TEWA 3NLLA 1RZUA 1QONA 1Z7YA 2EJUA 1JBKA 4HWGA 4DQDA 1P0MA 5CBKA 2E4AA 3AL2A 3KWLA 4WZZA 2N46A 2RKOA 3IYLW 4UBMA 3W7VA 2NU6A 3OLYA 1M8FA 2PSSA 2CNWD 1LLDA 4LXYA 3WB9A 2CV1A 3P8ZA 1Z7EA 3ND5A 4X7BA 1I2BA 4Z0PA 5ALMA 3KAJA 3MIIA 1PBTA 3QUCA 2IDKA 3A9SA 1DNPA 3BULA 3K71B 1O4WA 4C4RA 2INGX 2BH9A 2FW1A 3KQSA 2G04A 1FLNA 4YDRA 1QGAA 1V8BA 2AW5A 4UUBA 1P7YA 1QLHA 1XCMA 2QGZA 2B2CA 1GKUB 2GKGA 4ZZ0A 3LPNA 1G5RA 3D5TA 3NUQA 3F5MA 4L50A 1DIAA 3LWBA 1TO1E 4CUZA 5SY9A 1C3VA 4V1CB 4EY7A 1YOBA 5E0KB 3DXXA 4E5VA 1ZMXA 4FYHA 5AK6A 1GILA 3DGEC 3V97A 3DMTC 3CH5A 3WLIA 1Q22A 4DF3A 4P7KA 1Y5IA 3A25A 2AF3C 2XJ9A 2YUIA 1ACLA 1C7ZA 3HUFA 1Q6YA 5BYJA 2WSSD 1YI8A 3JQFA 3VPGA 3ZXUB 2C00A 1QYXA 4IQ8A 2WSSA 3WXMA 5I9NA 4TYPA 5KCMA 2R2GA 5HJ5A 2EFCB 3A11A 2JAHA 3SF0A 2Y6UA 1HF3A 1VIYA 2Z6AA 3HP7A 5F9FA 1M34B 2QQGA 3DDZX 1GG9A 4RESA 5HZKA 1SRQA 3N74A 2EL7A 3CHYA 4P3OA 1IZ8A 4KVAA 4D46A 2J4DA 1N6IA 4GKVA 3D3NA 1QQAA 1MJFA 2ZCUA 5TJ9A 2VNSA 3RAEC 5GV7A 3DOFA 4L6IA 1OZ0A 2V7WA 5HKKD 4I50A 1KQGA 3ROTA 1Y1SA 1U0LA 3D8NA 3FTEA 1YVEI 1VKOA 1SXJE 1JQ5A 2FSUA 3R3VA 4H6WA 5HUQA 2ATVA 4E51A 4D0GA 4ZEOA 5E3HA 4O3MA 3WGMA 4UDXX 5EHNA 1JL3A 3U4HA 1O1YA 4OQPA 2OGZA 5KYUB 1DTSA 3F97A 4HDSA 3VDNB 4BJHB 1SKYE 1CZKA 1C50A 2OXCA 1PG5A 5CB4A 3QEMB 1NR7A 1W2GA 4UKDA 3AVVA 2OCLA 1OREA 2R47A 2W5UA 3DOEA 2JHPA 2CXHA 4B0PA 2IWHA 3EZ6A 2HLDD 1DVRA 5H83A 3KXLA 1NF9A 1W73A 2XVMA 4GAEA 2WSYB 4DQLA 2YYAA 1ZQ1A 3HXTA 3NATA 1OILA 3N75A 3P5BA 1QH8A 3F1KA 4X63A 5H59A 3UW1A 3WL8A 4ZHSA 2CN1A 5J4KA 4DY6A 4IQ4A 1H2BA 3CFYA 4EYSA 2Z5GA 1QHHB 1QK4A 2X8BA 1T9HA 1NUQA 3TQQA 1JR6A 1WDKA 1AQ6A 4Q7MB 3TLBA 1KK3A 4RVCA 3TIFA 1PG2A 2GN4A 2AI3A 2VOJA 4YDHB 1EE2A 4MR8B 3DC7A 4GLJA 1HT0A 3QLVA 3NIGB 3HJHA 1PR1A 1Q7GA 1CS4C 1L9KA 2JATA 2XRYA 2YQ5A 2J32A 1QF6A 4G4JA 5L3VA 3T38A 3FBTA 5HZMA 4FMDB 3NG1A 4K28A 4LV6A 1FNDA 1G55A 1YDFA 4JJGA 4LJYA 4OUDB 2EBHX 3TDKA 5FOQA 1I0ZA 3B3FA 3HVKA 1F9EA 3WIBA 5TJHA 1O3YA 3JVEA 2AEJA 4ZC8A 1A27A 2C9OA 1KY3A 1A9QA 1HE8B 3VYUB 1ZGHA 2DF8A 2YFQA 4YMGA 3IBTA 1NW7A 2RGCA 4GWKA 4XPZA 2ORED 1NVVQ 1L4GA 2GAOA 2XNDA 4TKVA 3UAWA 1U28A 3PLRA 1AKWA 3PFCA 3WP1B 3ABQB 3IDSA 5EZYB 5KYTA 4Z4GA 3BH0A 4AS2A 2DFDA 3IAUA 3DR3A 1LRLA 1UKEA 3P4YA 4B1FA 4BMVA 1YRAA 4RACA 3TE7A 2D54A 3V7WA 3ZU6A 2RB4A 2OFWA 3RJTA 1U9ZA 4C6TA 2QVYX 1YMVA 3ZWBA 2HD4A 3ZE8A 4WOKA 2H4WA 5AOAA 2BKLA 1WZNA 3CNOA 1V45E 2VHTA 8LDHA 1M0EA 2WM9B 3TDNA 2JNWA 5D87A 4PG7A 1R8YA 1QPGA 2EW1A 4LZZA 4XD7D 2Z04A 4A16A 2HLDA 5CDFE 4N5DA 5IJWA 2JFXA 3D6HA 2DJIA 5DULA 1KDTA 1T1JA 2PJZA 1J39A 1M2KA 2AQ8A 1F6WA 4K1XA 1QB7A 2I33A 3QXJA 4GMXA 4I55A 4QYTA 3ECSA 4OHCA 3ZOKA 1DDGA 3H3XA 3KQYA 3G13A 3BDVA 2V45A 3LG2A 2KHZA 3OURA 1A4IA 4KO3S 1HE1C 1CQJA 5HVNA 1F2TA 2EP8A 2R3SA 4HZUB 5KYXB 1XI2A 4EIWA 2DR2A 1O9GA 2IEBA 5CA1F 3KQHA 1PNTA 2HREA 4N6GA 3R40A 5TQ0B 4BGDA 2X40A 3ROPA 2QMUA 4MOWA 4NCAA 1ZRSA 1VHWA 2AMFA 2C0QA 2Z30A 5BY2A 1LPBB 1KSFX 1AS3A 4YP5A 1JA1A 3ZGLA 1OLOA 2OCKA 1E99A 1W88A 2BFBB 2O3TA 1P5ZB 2HXYA 3B9BA 5JADA 5KYNA 1F38A 4JQCA 2WU4A 4RZ3A 3OF5A 5ALQA 2C2XA 4KI7A 2WJAA 4BO2A 2IWRA 4MAMA 121PA 3W1EA 1ZJWA 1FP4A 4HTFB 4Q1VA 3W3AD 2PUEA 1DDOA 3HXKA 1C9NA 4RVGA 5K8UA 4WK4B 2EQAA 4INPA 4OFBA 5B6PA 2IDMA 3IOYA 3LDGA 1YFJA 4JHLA 3SYLA 5FWAA 4A6DA 4HQRA 5KX5F 1L5QA 5ELMA 2ZJ0A 5F3RA 5CLJA 2V96A 1O58A 5EJ4A 4GYYA 3GNQA 4RTJA 2H51A 1K0FA 4M8LA 3C14C 1UOQA 2JIZA 4B7XA 1H65A 1MC4A 2ZUFA 4GPTA 4AKGA 3RM3A 4CR6A 3LW8A 5HEKA 5KQSA 2X13A 1EJ0A 2XQJA 1ADBA 4FEYA 4ANFA 1VHDA 4XD7A 3HJUA 3OIYA 4HFMA 1DC3A 2J85A 1YQQA 2Q0SA 2FN8A 3DLAA 4O1HA 1O6ZA 1Z8HA 1NATA 2QZPA 3S55A 4Q3EA 3W78A 4X1YA 3WC4A 4MVJE 2WDZA 3B82A 3OZRA 2ZSFA 4F04A 4X20A 1CP3A 1OC2A 2I5PO 4ZO4A 3ZHXA 2F62A 5FYDA 3HCOA 1PV4A 3ES9A 4YR7A 1WXXA 4R40A 3R20A 1EVJA 4CV3A 1EFAA 2AUNA 2P90A 3DCNA 3DMGA 4QYWA 3FR8A 1NNEA 3T7EA 2BFDB 5ILGA 3WRVA 5KNDA 1O8CA 2G9UA 3OPNA 1PW7A 4UQPA 3QVVA 1KGSA 2C7VA 3EHDA 2RGYA 4Z3DA 3PHBE 2HUPA 4LXUA 2O14A 3BE8A 4UU0A 3VPFA 4BFSA 5KNDH 3CLRC 3U60B 4UJ3A 3FKSD 3HCDA 4D3ZA 3ZWAA 1E4OA 1PWYE 1FRZA 3KAPA 4FNMA 4KQ2A 1KARA 5DYYA 5JSFA 3JQCA 3B5IA 2FMIA 1H85A 2EQ5A 2IIBA 4JQOA 3WAGA 4KJXA 2BR3A 4U2CA 3LGAA 3UMVA 4KUGA 5JNVA 3OQ6A 3H04A 3NT4A 3MUNA 2FH5B 3FLBA 3B7GA 4L9RA 3O4GA 2C98A 1HTWA 2Q1XA 3FYUC 3AOGA 4Q4CA 1KZHA 5LFAA 3E9MA 4K9KA 3ADBA 4LMBA 2OCPA 4JUAA 3PUKA 4NMHA 4Y6QA 3R7WB 3DE7X 4R0NA 1VPDA 4BQFA 1VSTA 4IW3B 1G7RA 2QV7A 3VYVA 2QNIA 5EKXA 1OVGA 4F85A 2OXRA 1UJNA 5CT4A 5K05A 3VH2A 2PL5A 5JWRA 1JDJA 3CWCA 1EEXB 2XYRA 3A6HA 1G0NA 1EP1B 2QTRA 5HOEA 3U7QA 3QPBA 4FGLA 1WLSA 4JLJA 3TX6A 3HCBA 3ZWCA 4R9SA 1JG4A 1HQCA 3DHVA 4LRXA 2DFTA 4DCOA 3N86A 3G2KA 3VHXB 1QK3A 2F1IA 3KHSA 5ALDA 1C3XA 1QAQA 1ZD3A 4KQ6A 3LHKA 3LUAA 4GX0A 2IS6A 2WKPA 2XF2A 3KU4A 1GGVA 4N9WA 3AEKB 5F12A 1RXIA 5HCIA 2JLVA 4O4HF 3TVYA 4JXKA 2BDTA 4FLFA 2DHRA 1MA3A 2X0KA 3JZMA 1XAGA 3OPQA 2OXIA 5CFRA 5KHOC 2VEDA 2A2ZA 2N75A 3CPJB 2NT4A 1B93A 1QGUB 3HM2A 2D7DA 2ZCJA 1U4OA 4CEHA 1T1SA 3L0IB 4NENB 2C77A 2R84A 3WJ2A 3KV1A 1WB6A 4OKSA 3JXEA 1SUDA 3U44A 4G4IA 2OGUA 3EJ6A 2P91A 4QUEA 4IX9A 5C8VA 3K0EA 3VR2D 4DDVA 1KK2A 3D5QA 3JVVA 3LX8A 2C8JA 4OEHA 3DV0A 4DLPA 1YFLA 3W9BA 2NXNA 3NVKI 4GZ5A 2Q50A 1DAMA 2EJVA 2IYZA 1JG3A 1H0RA 4PAWA 5K0EA 3R7BA 5I01A 2YRXA 1LFAA 4Q4HA 3FXAA 4H7EA 1XX6A 3EBOA 3RC7A 3JARB 3WY9A 5I7FA 2PXAA 1Y5MA 3F98A 3PNVA 1U3FA 3TN7A 4L95C 2R87A 4CCAA 3DXFA 4RTNA 2WNIA 2JDID 1SQ0A 1T9CA 2XBMA 1H0HA 1GJRA 4MVJD 1TZBA 3BRCA 3IS3A 4G8JA 5A3VA 4E4YA 2HK9A 4MI1A 1C0KA 5F21A 2J9GA 4QFCA 1HK7A 4BEJA 2XHZA 4QRHA 2Q9BA 1KOGA 1DJMA 4M1QA 1YUMA 1UDBA 2WI8A 4RMIA 3E1KA 3LC2O 4Y2TA 3WADA 1ILEA 1M7HA 2AI2A 4BX0A 1YIAA 4U7TB 3CY6A 3QOYA 4AMBA 1A3CA 4BWFB 3R8XA 4CFSA 1M1XB 4E88A 2XXAA 1KAGA 4A03A 3DW3X 2OCBA 3CUYA 4WCFB 5AJZA 1TCAA 4B43A 1MD9A 3ZYCA 3BWDD 1NL3A 4PO1A 3IB6A 1T9KA 4GOXA 3LA6A 1NMEA 3EEBA 1EB9A 3TW8A 3BSWA 4KP7A 2H85A 2JZNA 2IXAA 3GRUA 4XAQA 1VM6A 5H5JA 2W6QA 4TQ9A 1E58A 5KI6A 3TAHA 4CLDA 2WD7A 3ZDAA 1M75A 3PJRA 3DUFA 3KZCA 5D6OA 1JEQA 4HN9A 1Z83A 1B8VA 1KI8A 4Y7DA 5EIFA 3IAM6 1E1YA 3GEEA 4MV8A 3TPCA 4X85A 1Q17A 1NBWB 4WN9B 2Y0PA 4TRMA 1ZK0A 1FYEA 1BWPA 1KORA 2P11A 4GRAA 1TLFA 4C89A 3QGMA 3AYZB 3EIUA 3UGKA 3BD8A 1YS7A 3SQWA 1B14A 4NXNB 4DUGA 4S12A 2H2AA 3VR3D 4QRIA 5HHTA 2XMPA 1WL8A 1E1CA 2Y3IA 2ZI3A 1V16B 2X0JA 3LWDA 5CPFA 5HGJA 1ZOPA 4RDXA 4YP9A 4XWWA 3ASVA 1FTNA 2J9RA 3ABZA 3EMBA 3LIIA 1GRCA 1VPVA 3NYIA 1SULA 4K8RB 1Z29A 4ROTA 1DQRA 1Q57A 5CVEA 4CLOB 4FFWA 1ND5A 3GFSA 3IT3A 2CBZA 2FZ4A 4LJAA 4N1AA 4F5ZA 3EVFA 2DRIA 4TMVA 5C1BA 3LUKA 4F9FA 1G8PA 4MYRA 1Q3HA 1OTHA 1W29A 4NU0A 2HN9A 5AOVA 4D3SA 4CKCB 4UU8A 2QD4A 1QIDA 2B4RO 3GDWA 1VGRA 2FEOA 1N2JA 1QHXA 3LD9A 3PUWA 3GRAA 4WX2B 2PMBA 3HO8A 4LHZA 3VTFA 3LNCA 4RWZA 2JJMA 4QQFA 3B60A 3DMDA 4INOA 4IXWA 4MUAA 5DYIA 2AR0A 3COPA 5FJJA 3VSDA 4DADA 1GCAA 3I9JA 2O54A 3B52X 3MXOA 4B4OA 2B98A 4EA8A 1KJNA 5CEJA 3UH0A 2CL0X 3FTCA 2D7CA 2VP2A 4C7VA 3LYUA 1PL0A 1JLRA 1WMSA 5DGHA 3C45A 4I5DA 3O1JC 4KXMA 1W7AA 2FUCA 2WLTA 3DE2X 3LRPA 1X7WB 2YVLA 3AY6A 1U99A 3W5BA 2BBWA 1GGEA 1U0OC 3C43A 1FLVA 1PUXA 5LP6A 2WWVD 1VRCA 4WAUA 4X1YB 4JEMA 5J1TB 4WGGA 2OC4A 2G07A 5G1NA 3IBGA 1EQAA 1RHRA 2J3IA 4Z7QB 1J23A 4HDMB 1I3KA 2RONA 1XTUA 2FW6A 1O77A 4PRZA 4JKIA 2XCUA 2V9ZA 3L6DA 2A5GA 2C5AA 1A7UA 2PZAA 2JCGA 2C2HA 4NCJA 4ZKDA 3DPUA 4LF6B 5KTRA 2ZSAA 3L7NA 3PJFA 1W93A 1T3GA 2ZI9A 3OWXA 1IBCA 3FSGD 3VHXA 4KR3A 1FNBA 3AZOA 3GY0A 4Y2GA 1U3VA 4AMYA 2NZWA 2G77B 3HABA 2PMEA 4DRYA 2XNSA 2Q2OA 1V16A 2QRGA 2XR1A 1GTMA 1JG7A 1GDHA 1WUYA 2IW3A 5FPTA 2AD5A 8ADHA 1UM8A 4ENTA 4CKWA 2JA1A 3O03A 3CR7A 1MMFB 1IFXA 3QU2A 1II9A 3O92A 5DHSA 3G85A 1MO5A 3M6FA 5ER6A 1NRJB 2XMQA 1GNPA 2RHOA 5IK2D 4IJQA 4EKDA 1U7OA 4QGGA 4MV0A 2OPBA 3D2LA 1H4QA 3L2OB 1N32B 4HN4B 4OSPA 1E7RA 1IU9A 2ZYUX 2DFPA 1QH8B 1X8KA 2FSHA 4MWEA 1YIOA 4WBXC 4WJKB 4X6YA 1JNXX 5DVZA 5BNTA 2REQA 3IIJA 1U0SY 4KRGA 4BNWA 3KJQA 3MLEA 1BXGA 3U16A 5AI9A 4DQXA 4C0LA 4E1AA 3FNEA 1IONA 6ABPA 2F1OA 1Y80A 1CUFA 3OX1A 2X8AA 5F3WB 3G0BA 2Q5OA 5AJWA 1XZFA 3DPIA 3PTAA 3EVCA 4OH7A 4ECEA 1QIFA 3AZQA 4DILA 4HMOA 3UHFA 3U4IA 4ND3A 3HS3A 4CIXA 3WNDA 3L7DA 3V6LA 2ZDGA 5AM3A 4E2FA 5F4BA 1RJ9B 3TZBA 3O8RA 1IY2A 1X2BA 3KWMA 5FLYA 3ROQA 4EPXA 4M8NE 2QBYB 3SICE 1RPNA 2Q9AA 5I9TA 4U0JA 4DXHA 3FPHA 3RVQA 1Z13A 2CLSA 1OMOA 4V0MA 3R24A 5I5EA 2W70A 1QCYA 3HA3A 3NRBA 4BBJA 3IUEA 3EDRA 3KR0A 2D3TA 3SYMA 3WS7A 1HE4A 2CXTA 5GINE 4Z0HO 1KBQA 4WHMA 4AO8A 1NMZA 1R0KA 3T12A 3KQPA 4RENA 2K4MA 2H29A 4WSOA 1D5CA 2ZRFA 2GTPA 3DBHB 1Y6ZA 2NVBA 1JI3A 2G5GX 2FN7A 3GLKA 4PXAA 4QOFA 4UHEA 5K45A 2NADA 2O48X 5TS2A 4MTLA 4QOHA 1ORVA 5GZ1A 1TUBA 1A97A 3D7KA 2WUFA 4IXDA 4TMTA 4AMGA 1GLNA 2ISSD 3NTLA 3WZ2A 1RXUA 1WXQA 3I39X 2HHHB 3OCZA 3QTTA 2BZ0A 1AH2A 3HV2A 3VKGA 1NKVA 2X8LA 3KKLA 2DLCX 1WF6A 4K9DA 3NTUA 4F8JA 1EINA 2CVHA 2AC2A 3IV6A 1DQYA 1JDSA 1X7YB 3HZOA 3ELWA 3VAYA 4FNOA 4CIAA 1FL9A 4FD2A 4NCNA 5L95A 4CKBA 3GLFA 1ZL2A 1ZN9A 3BWVA 3IB3A 2G5CA 4OI4A 1XOIA 1V8DA 2UDPA 1JF8A 5I3ZA 3CZMA 1P7PA 4AIIA 1USGA 4KIFA 2FP4A 4NZ9A 1PD1A 4ENSA 2D0OB 2YIDA 1O6BA 2BC9A 3LP6A 4GC5A 4IFEA 4LJSA 4M9UA 3MMNA 2WMYA 5I9SA 2AEMA 2BZ1A 2QTVA 3H83A 4C05A 3IVAA 3W6ZA 2FN4A 1GAWA 2HCTA 2ZIXA 4ARVA 4O08A 2FFRA 4P4SA 3MILA 3QKWA 4HR7A 4LX0A 3L7MA 2RHLA 1OKKA 1ZYUA 1QTNA 1BS9A 2O4CA 4BKPA 4W5NA 2GCPA 4Y2JA 3S68A 1CJBA 4ODIA 2XV1A 1JMKC 4H7FA 3LT1A 4FOPA 4WXEA 5EXDA 1ZM4A 1Y6JA 4DS3A 4K2AA 3S81A 3NXKA 2Z1DA 3KR2A 3KYJB 1PV1A 1Y4SA 4I0WB 4A8JA 5C32A 1KXJA 1CVRA 5B1EA 1J8VA 5LDDC 1B15A 3GAFA 2JHCA 2Q2WA 3HBNA 3DAYA 3KKOA 1X2EA 4OQDA 3WMWA 1X92A 2Z09A 1H2XA 4RQUA 3THYB 3CONA 4PHHA 4U7GA 4W5JA 4CKEB 4YJHB 2YDXA 4CI0B 4ZHQB 1MB4A 2D1FA 3HKDA 3JR3A 5CXXA 3GGPA 3MS7A 5IZCC 2CHGA 2QJOA 1R4MB 3CTPA 4EUNA 4PPQA 1UXKA 2I99A 5DNAA 5FR2A 4Q24A 3U3RA 1J97A 2X5XA 1VIAA 4KFUA 3RS2A 3I3OA 3RGGA 4CM9D 2YMPA 4HFNA 4N76A 2P9BA 1CIJA 4LKRA 3P52A 1ZSYA 3DWFA 1FOEB 1BGWA 1NE2A 1NLUA 1DT3A 3NUZA 1PW5A 4H4CA 3PHHA 5DNCA 2HCJB 1FYDA 3QBTA 4YUAA 1TU4A 1FUKA 3D6AA 5FFMA 2H1HA 4QSMA 4RM3A 4U9UA 3EDOA 4BKUA 3V4ZA 2FFHA 2P4SA 1SVNA 4N54A 4ICIA 2ZUVA 1P72A 1ZNXA 1ZH0A 3N0VA 1JR4A 2Y93A 3AX6A 4JBYA 3C1UA 3TTXA 3B2EA 2XUDA 4I46A 1RT9A 1I3CA 3DFIA 4YN3A 3NTXA 1DARA 5HFAA 1BDMA 1YR1A 1BKSB 1T26A 2Q49A 4BJ5A 2PPVA 1YB5A 2D06A 2NPOA 3NXSA 4DIUA 1YS6A 2BM0A 2DQSA 3LRXA 1BS2A 1U2DA 3FHLA 2GEFA 3OMWA 2JFWA 4NI5A 4NC9A 2R6FA 3QY9A 1QXSA 4YJKA 1SUFA 4LRQA 1Y1TA 3ZW7A 3O1LA 3LC1O 4JXXA 2D1YA 3LUFA 5J5AA 3LECA 4I4CA 3H7AA 3NP9A 1F5SA 1RKXA 4MQLA 2MR6A 3W6NA 1K4MA 3FMPB 2PS0A 1EBUA 1YBMA 2NAPA 4F3NA 4GKJB 2VP4A 3L4BA 2CFCA 4GQIA 1D0SA 1VIMA 2ZQYA 3PV0A 5H3LA 2A5JA 1QK5A 2FETA 4MUIA 1Z6AA 4REOA 2NX2A 3QPUA 2R4TA 1DEAA 5FUXA 2VPPA 4FYMA 1FDUA 1TCCA 4KE7A 1E9EA 4W9MC 3GT7A 2IZZA 5GJBA 3ZZTA 1WB9A 1PCXA 2ZRPA 4NBLA 5ITWA 1FFEA 3M6UA 1ODSA 4FYVA 4D9KA 3FRIA 3FB1A 1UWKA 2PYDA 2W6JD 3HBAA 1JLMA 4MHOA 5E6UA 1WDTA 3UMBA 1UM9B 2AK2A 4HGZA 5AKJA 5JRDS 4LQ4A 2C4KA 3UWMA 4K6MA 4RIIA 1YZUA 3HA2A 1J99A 1A72A 4JODA 1Z6ZA 3FUCA 2B4YA 4WKGA 4UHKA 4XVRA 3LT5A 3PNYA 4J2HA 4NP6A 1RRMA 3FWYA 4AKHA 3ZWYA 5IYZB 3ROXA 1RHKA 3NBYC 4FMPA 3T5AA 3Q8MA 4NAVA 4PBTA 4ZRDA 1IQ0A 3EQ7A 4JUFA 1NQTA 3R44A 3SKYA 3HL0A 3QKRB 3SC3A 4YACA 4B40A 3OQIA 5A6SB 4ZO7A 4C2AA 4UBIA 1QG4A 3HTXA 3WB2A 2D0IA 3GPIA 1IQRA 4ZT7A 3Q7PA 2ID4A 1UKZA 2Y99A 4X3CA 3AKEA 4IJMA 1HT2E 4DLSA 2D6FA 1OCEA 2HCRA 4AJPA 2LBPA 3N9IA 3PUZA 2XMCA 5ICGA 1VMEA 1HORA 3DLIA 5FFFA 1T15A 2JKVA 2UUOA 3MRVA 3E3LA 5B6JA 2SKCA 4Q4AA 3DVQX 4LEIA 3HCWA 4KYVA 3DLPX 2FPGA 1P2FA 2B8WA 2PS1A 3DT8A 4HL6A 1O57A 2ZSIA 1A4UA 2GRUA 3GEHA 1NLZA 1U8ZA 4WLNA 4ZYVA 5FBWB 4A0HA 2E37A 3RVOA 3AUAA 2YV5A 3K9LA 3MFYA 4GPBA 3BICA 4BGUA 3MLBA 4GEKA 4P81A 5ECDA 5JXJA 4EJFA 3KPWA 3U5ZB 1Z5UA 1VMAA 4GS5A 3AR6A 5UKDA 3EVTA 4QGSA 5JCJA 1GL3A 2B35A 2VHCA 1BZYA 3DVSX 4EH1A 4AY3A 4I1RA 4BQEA 3L0CA 1C9JA 4AL4A 1OWLA 4U2KA 5BV0A 1VG1A 3IEKA 2RK3A 2BDEA 5D84A 5T4FA 3AY3A 3BTOA 4BPBA 4MJXA 4OQYA 3GVPA 2BP7A 2AR7A 2OAEA 4KQMA 4D8WA 1HE2A 1KHTA 2WLSA 2NZJA 4X97A 2X5NA 1PHPA 2EP7A 3E35A 4MYUA 4CT4B 3R9XA 3HLTA 1K5PA 2D0PB 3LXUX 3MCVA 3U5TA 3L0BA 3AHDA 4FKMA 4DDUA 2B0JA 5DP2A 1PVDA 2NP6A 3WLEA 1J0CA 1TRKA 4CU5A 2VCEA 3PUYA 2A57A 4GECA 4BX8A 4YP0A 1Y9ZA 3PQFA 1YONA 4Q9NA 3IAHA 5KQRA 3C87A 1COZA 2UVPB 3BB3A 3CXRA 3OJWA 5JIBA 1YVDA 1D1QA 2ZS9A 3PPIA 4FZVA 3JQ7B 4HDCA 4E5SA 5A5GA 1XMQB 1FXSA 3ZXIA 3ADDA 5SZKB 1WR8A 2FSGA 5KOJB 4V0RA 4L72A 2FR1A 4ZI7B 2R6ZA 2R86A 5IAJA 4WCDA 4L6CA 4ZVVA 2O3SA 3RS8A 3ZZNA 4EFDA 3L0DA 2JGLA 2Z8YA 3LYHA 3S27A 3A6EA 3G9XA 1W6UA 4E08A 2IU4A 3DZFA 1CRPA 3FMIA 1XNGA 2NZ8A 1WMBA 3SBXA 3SXUA 2HF7A 4K6HA 2MDTA 4OFXA 4AP5A 4KX5A 4ETWA 4JJ7A 3ZD9A 3ZDRA 2O7VA 5AIBA 4I8IA 2ZBPA 1YRHA 3F6RA 4MRVA 2WQZA 4FFVA 3G0IA 2A9JA 5KQGA 4ARCA 2OZPA 2VR1A 2FZKA 2QB5A 3NH9A 3RRZA 3HYNA 2PIDA 3K6KA 1RXSA 1Y9DA 1UEJA 4HPXB 3KKMA 5J63A 4B46A 2AYYA 4R2HA 3LFUA 4XR4A 4NNJA 3UAYA 2X5KO 1A50B 4A0RA 1OGIA 1R0CA 5JU6A 1FIUA 3M89A 3GQBB 1MHTA 4BQIA 1RMTA 1EM8B 3QJ5A 3V1MA 2GILA 2ZIZA 3RRMA 2HJHA 5BNWA 3ZVKA 4GEGA 4PAOA 1R6XA 4RCZA 3G1UA 1BH6A 3KAQA 5FKJA 3UMSA 3UWSA 4EA9A 4Y6SA 4YWHA 1YKSA 3Q7RA 2HNBA 4XWYA 2XTZA 2YJGA 3VSBA 4CT0A 2YJTD 4L8FA 3IOEA 3PD0A 2AYZA 2Y1FA 4BLOA 2Q8QA 3DBVO 2HBRA 3PEVA 4AF8A 5CD9A 1OB5A 4KAJA 5CUQA 4MGEA 4DLVA 4CF4A 4Z86A 2OO3A 5C4GB 2W83A 2X2OA 2Z3VA 3ZWPA 2CNDA 1NPDA 3B70A 3NBFA 4CKYA 3G23A 3LUPA 1Y33E 2BOVA 4UNSA 2KBFA 3BCUA 1EFHA 3DMTA 4I3GA 1UKVY 2DQ4A 2V5AA 4ZVNA 1Z15A 3AHIA 3L82B 2WWFA 1E0KA 1TKBA 2GS9A 3I8XA 3ITNA 1O96A 2WVHA 1OAAA 2W2OA 2CD9A 4V02A 1JH9A 4R6XA 1A8UA 2ODQA 4HS9A 5F35A 1A9PA 3VR0A 3WL6A 5AW1A 4D4LA 1HT3A 4UPEA 2XUHA 1DC7A 1OT3A 4O4HA 5CR9A 5JS2A 3EW9A 3JWEA 2H7VA 2XT0A 5ADUS 2JFZA 2ZBRA 4K40A 5A7GA 4C5BA 1E2DA 3OIVA 3I1YA 4ABYA 3WP0A 2R96A 3X0DA 4JITA 1PS8A 1OLSB 1RP7A 1TMGE 2OAGA 4PYRA 3OQJA 2R11A 3F6CA 2ZKIA 4KO1S 4P3YA 3SJCA 2CDCA 5CGQB 2YW2A 3THOA 1TA4A 1EU1A 3BXPA 1ADJA 1LBHA 1R8QA 1A8SA 3A3YA 3CISA 3IP8A 4LGCA 5DEIA 1ISRA 1NYQA 3K2BA 3TAXA 4F8EA 2X3UA 3OTQA 4YLYA 5HJEA 4EYQA 1AO0A 1P1KA 1GFWA 4QWWA 1P3Y1 5HA5A 5DTEA 4WERA 3QBJA 4YDSA 4HX9A 1LDMA 2G28A 4KNYA 4LZAA 2BZSA 2HA5A 1WHSA 3QXCA 4OREX 5ERXA 1Y8ZA 1K8XB 2NAFA 4Q7EA 2UYYA 1M2OA 3PIDA 3Q2OA 2ODPA 5FT9A 1JHDA 1AM4D 2WE7A 2COUA 3L8HA 1PE0A 5U4QA 1CYDA 4NULA 2GSDA 2ZRQA 3LNTA 3E5MA 3KQMA 4EENA 4WDQA 4L5IA 1U0JA 2PG3A 3HBLA 3ORRA 1R0SA 1VRVA 4Q12A 3VR2A 4EUKA 3PQ4A 4QM6A 2QLMA 5B3JA 3C3BA 1V96A 2R60A 2NXEA 2QTLA 1ZK4A 2HQ1A 2YVKA 4M98A 3E9DA 4FDAA 4B3IA 1BSVA 5GWXA 3DWIA 5E6UB 1RJEA 4GOJA 4IHJF 4DYVA 3DDSA 1U63A 2JDIA 3B3GA 4AK9A 4NBSA 1IMOA 1YDWA 2G0NA 3F0TA 3HSSA 3PL1A 3QUSA 3FOCA 3WLLA 4WJLA 3EXEB 4XB6B 1A2KC 2FR0A 3INRA 1WMFA 3I0ZA 3O2SB 3NFYA 4K6KA 3VYWA 4JR1A 5FRDA 1A82A 1OUMA 4GYJA 2DUMA 2I3GA 5ITSA 5REQB 3IP5A 4ISCA 5AI8A 4HI0E 2BHTA 1NIPA 2H1CA 1NGSA 1F0KA 3JV7A 1RFLA 5LIPA 5KYGA 1L1FA 2XQFA 2FYTA 3JWGA 1RQ7A 4EGFA 4JLMA 1XQYA 3OJFA 1KJWA 4JBWA 1PGQA 3A3PA 3NR2A 1AV6A 1VBNA 3OG9A 2DFKB 2V74B 4OCZA 3NEAA 5C34B 5HQ3B 2CK3D 1KSHA 2E5WA 1XYGA 1RZ3A 1SKQA 2YWGA 4YT8A 3M1LA 1DOZA 1TQ2A 1HE5A 3W90A 5FOSA 2FZEA 1YS4A 5ED4A 4RY9A 1I4OA 3OE7A 2QX4A 1ZD1A 1IM8A 2BAGA 2PKQO 5ARDA 4D41A 5A9SA 5GVSA 4EQ6B 4P3PA 3ZY2A 4Y2SA 3LY5A 1EAMA 1KTVA 3MQFA 1NBOA 4GBGA 1UDCA 2RH4A 2CL7X 3LBFA 2GCNA 4Q9JA 3E9CA 1CXZA 3L4EA 4BV3A 1FP6A 2ZB7A 4JT8A 1KEPA 4OBEA 1GZHB 2N0SA 2P62A 3AI2A 2A9FA 5IC4A 2ZLBA 4JD5A 5CAEB 3BZUA 4G0WA 2HI0A 3GW8A 4NBVA 2RHDA 3HZHA 1ZA1A 4XLTA 1Z0FA 2PR2A 4D9IA 1PJ4A 2YV4A 1FVHA 2AYXA 5KSYA 2OY0A 1FJGB 4BVFA 2HBYA 1UOEA 1L4YA 1WDWB 2VDOB 3DBHA 4L0QA 2HSJA 2ZJYA 5ES3A 4AU1A 3UCXA 2JEOA 1TPYA 3UNXA 4RKYA 1XVTA 4MINA 4IS3A 1QH0A 1CB0A 4XDYA 4AZTA 3DNMA 2Z4SA 2RGRA 1U5BB 2H6EA 4RFSA 1Y1LA 4ZYLA 1U8TA 1JB9A 3AI1A 1U9IA 4JWKA 1UQTA 3O0DA 1IK6A 3B1KA 3H9EO 3SZGA 1Z0KA 3EE6A 4HLUC 4IZ6A 3ZW8A 2CLKB 3TRHA 2Q2NA 1I4LD 1TADA 2SICE 3MCZA 4P3KA 3TCKA 1X1SA 1MAWA 3MG9A 1FQJA 3FZGA 1NN1A 1JPVA 4PINA 1VIVA 4BMOB 4G2NA 1AG9A 2HTFA 5KKCA 2C1XA 4DA0A 4BCCA 4ND1A 1U3WA 4LYDA 1N5JA 2YINC 4UXHA 4I81A 4RH0A 4EHFA 2AZXA 4X66B 4QXAA 1Z33A 3Q9NA 2VP0A 3TLGA 3OZUA 4LGYA 2RE8A 1DIHA 1P1IA 1PS0A 3DUWA 2JFPA 3GB9A 3F8WA 3OETA 4GO1A 3FPEA 4A0QA 4D8XA 4DLNA 1JRLA 4P32A 5KNBD 1H2RS 3ACCA 3F3KA 4G23A 5KTNA 3R0ZA 3DW1X 3NWJA 3FHOA 1ZEJA 1NXOA 3A05A 3HNOA 3PE4A 4OLHA 3HYTA 2XOEA 3CEHA 4JVLA 4B6OA 1XUOA 1YJ5A 2HC9A 4QYIA 3K0KA 2CDRA 4K6FA 5EJIA 2PVCA 1C1HA 2V0NA 3Q7SA 5C4IA 3D5EA 1KEEB 2B36A 4P9NA 4MUXA 1CUWA 1G6OA 1CDDA 1KVUA 2JJ2D 4M0MA 4NESA 1Z34A 4Q03A 3V7NA 4B48A 1VFPA 3SJAA 1XBTA 3QLJA 3RAGA 4ARBA 1ECJA 2IPMA 2QDKA 3C85A 4PZEA 1A7JA 3NGLA 1VA4A 4KLRA 3VMFA 2OB2A 4MW2A 5HF6A 3GU3A 1DXHA 4FKBA 1SQFA 2WYOA 4MB2A 5K6AC 3JYOA 3L07A 4ZOCA 3UWOA 1U2QA 3SIPA 4EI9A 2M32A 3A70A 1MAVA 4RE6A 5LYJB 3VBEA 1AHIA 5HUJA 3KB1A 4PG4A 2IPXA 3OP4A 2MU1A 1AZLA 2PRJA 3WQRA 1EGMB 1NZJA 2EDAA 2JW5A 4JI7B 3IHWA 3PGXA 4YJFB 3QLEA 1G63A 3HCRA 1YDHA 2VG8A 3VJRA 1CZOA 4HGRA 2ZYHA 4LDJA 1JIUA 2H4XA 1RM5A 3NEJA 4PSUA 2GR9A 1JKFA 1K4KA 3QEBZ 3UT6A 1GCOA 1NNSA 1CETA 2QUZA 1DADA 1U3UA 2HK7A 3FJYA 4FE7A 1Y5RA 1ZNYA 1GGFA 2GD2A 2ARKA 2JJQA 2ZWMA 1X7HA 3HHEA 1NUSA 3TRDA 4D9MA 3IAS1 1HYGA 4P0QB 2WPDD 4XSVA 5KX5A 4O5OA 5A0VA 1NY6A 3EG5A 4AN0A 1QQTA 4WOPA 1ZZEA 3AETB 4RK5A 4LDZA 5TGZA 1NVEA 3GLUA 1QHHA 5E95A 3H2BA 1XKXA 3M8KA 2O0JA 4RV4A 1BWRA 5THXA 4CMGA 3BK7A 3DE4X 4QVGA 1I5OA 2WIBA 4MVJF 1JR2A 3PDJA 3MTJA 4DMMA 3OFVA 2WK1A 4MLZA 1ND6A 4DLRA 2YC2C 2D13A 2P9FA 4AMUA 1JHAA 1V1JA 2OZLA 3DL7A 1WUIS 4M87A 3HWWA 1EP2B 3NM4A 1L7OA 3P0EA 4NYMQ 4ZVRA 4ZCTA 4CF6A 2N9UA 5BO5A 1HDRA 1IWPB 1L7RA 1X3LA 2ACWA 2X4GA 4F7WA 2W48A 2GK4A 1SBTA 2Y0BA 5JBNA 2PGOA 2VQSA 2OK7A 1XTVA 3CNQS 4R1UA 4WZAA 4IIFA 1NPYA 3V4RA 4DPMA 3LDFA 5K8LA 4YJ2B 1YI1A 3G68A 7MDHA 4PX2A 4RK0A 2VTEA 2NTEA 3ZZUA 4M22A 2EKBA 3NBAA 4FD3A 1J25A 1FYFA 3RJZA 2JJ1A 3ZBQA 5ANRB 2MSCB 4WBNB 5BOSA 3IPAA 3VKUA 4RANA 4GM4A 2XQKA 4L9AA 3ZLTA 1N2GA 1SG0A 5IARA 5GADl 3CX4A 4NZZA 5JWHA 3I5UA 3ZHYA 5E7MA 3VVLA 1EFDN 3G9ZA 5C53B 1TPZA 1Y6FA 2B4QA 4JBGA 3WDSA 1JMVA 4HGNA 4PYKA 3I6QA 3QMWA 4FX2A 3RYHB 1KBOA 1U6JA 1K7XB 2CWDA 1CERA 3ZC3A 2B9EA 1BX1A 2KLBA 1ELOA 2OZEA 1RQLA 5LUAA 2XMRA 4WN9A 1E20A 1I14A 1LSSA 3K4QA 3D8SA 3AUJB 3VH3A 3GR6A 1SIOA 3BS4A 3QHAA 1IQPA 4IBOA 1DCMA 4NMXB 4HYEA 3UMMA 2RGBA 2HXGA 3GFBA 3DEKA 3RE1A 5FTKA 4CLEA 2A86A 1EQ2A 2AOXA 4JYBA 3MWGA 1YVRA 4MMZB 3TD6A 5A0TA 2B1IA 1W36C 1T36B 4DV5B 4GRIA 1KE1A 4ZFNA 3CKYA 1SZJG 1GPWB 3TXAA 2NZ2A 1S01A 3FB4A 3IA7A 4TXLA 3BJIC 3W5IA 4IRXA 3FZQA 3FG9A 2Q4RA 1SC1A 1MG0A 4FZ5A 1IZ9A 1T2DA 2HO4A 4JXJA 1C2YA 4CN8A 1JU4A 1S9HA 1SBNE 3P9ZA 4EX6A 1AKUA 1DAIA 2P75A 5A4IS 2IEGA 3N0XA 1T1EA 3EPKA 2Y1CA 4UTXA 5JSKA 2YCBA 2F4NA 3SCZA 3H5OA 3SN6A 1TM7E 4IV8A 2IEZA 3AHJA 3AUSA 4KRYA 5IULC 1MVOA 3EGIA 4M53A 4QREA 1JDBB 3ESAA 3Q5DA 3HU1A 1XKTA 3PUVA 3PITA 1BRTA 4A8PA 2EDCA 3AFIA 3D0RA 3IIEA 4JROA 3K30A 1VA5A 3T9CA 4F4IA 1QVZA 1XHFA 3CPEA 1Z5NA 3TTVA 1X86B 4Q1BA 3PFWO 2Y6VA 4CCYA 1T13A 3SQDA 1AKYA 2BM1A 1FDSA 3IHKA 2H0QA 3CF4A 2OYCA 2A0YA 4Y2XA 3TW6A 2ZRMA 1XDBA 2DCUA 2G70A 3DL4A 4WADA 1UZAA 1X70A 3D3WB 2P9CA 1F8GA 1R9NA 2D5IA 4M1WA 1QJCA 3FVQA 2FWBA 4NE7A 1OH6A 4N40A 5H82A 2WNHA 3OE1A 2NNWB 4MW4A 2PUCA 3RH0A 1PSDA 4UFOA 3P2JA 4CJXA 4G1CA 5BVGA 5J4LA 3EZXA 4UZEA 4UMVA 1DIBA 2IRWA 3H9JA 1JBEA 4V0LA 3BCHA 2FW7A 1W87A 2G0AA 2KJQA 1TQ4A 1W96A 1ZZGA 2JA2A 1NMXA 2BMEA 1NXVA 4PZ9A 10MHA 1MZPA 1V1RB 3S2EA 3R09A 4REMA 5FEMA 1VCMA 1X7GA 2ZEJA 3U17A 1VB5A 5BPHA 5IN4A 1WVGA 3KCQA 1GRQA 5T6BA 3ESYA 4FZJA 1Y8QA 1G3IA 4OAOA 3PR3A 5DNDA 5AXCA 1NJ1A 1PR3A 3ABOB 1UBSB 3QW2A 1GPUA 2SKEA 3AOEC 3RCBA 3AM1A 4TM8A 1MX1A 1M1NA 3VI3B 4Z7NB 3VGPA 1E7SA 1KI2A 3GGGA 4WY5A 4YMUA 5GTDA 2I62A 3DLHA 4WVFA 3L0YA 5JDCA 4ZGBA 1B74A 3RIXA 4URXR 2HJRA 3C7KA 3GMIA 4BO3A 3M1YA 3JRNA 5KYVA 3C1OA 4ZVUA 2IDJA 3SU8A 4WA8A 3UYKA 4NMWA 5A4FS 5L3SB 1ODIA 1V2GA 3B8EA 4G5GA 4UOQA 1QQ7A 4WVLA 5IWCA 5JW6A 4O8ZA 1VKRA 2W6NA 4X20B 3IUSA 5T3UA 2FW0A 4MW9A 4OHUA 1LK0A 4ESVA 1E1QA 2JC3A 4GPIB 2WJ4A 4JUBA 4OQLA 3WGHA 4CL8A 4Q4JB 4AI6A 1Q12A 1L4EA 3V2IA 5ALVA 1DTWB 4V39A 3HU5A 1GCIA 5E6RB 1SOUA 1UBHS 1XU9A 2BRUA 2HBZA 1QHSA 4ZCQA 1TAUA 3BK2A 4MR7A 3QMVA 3LOPA 1UJ5A 1KO8A 7REQB 1P5JA 2E18A 4IJVA 5FNVF 2YWHA 3AY0A 1WD5A 3OOWA 1Z62A 3TL6A 2MCFA 1G2PA 1V1MB 4GOMD 1N6PA 1CU1A 3C7AA 3CZRA 3QE3A 3T3IA 4R1OA 7GPBA 1SBIA 1V3QE 1MEJA 3UAZA 1UFQA 4ZCPA 5AT1A 4ER3A 5EC8A 2EFHB 5A9RA 1WULS 2JIQA 2A3NA 2IYWA 4MUFA 5J40A 1AZTA 1L4KA 2EFJA 3ZDZB 2A84A 3WZMA 2YZMA 4HUTA 3CR3C 1WBJB 4QFBA 3W79A 5IM5A 1IRXA 3ETCA 3TZKA 1RLUA 2PGAA 5G0WA 1CWUA 3HB0A 4CUKA 2GPBA 3WI7A 2GTHA 5IX8A 1Z47A 2AC7A 5KYKA 4TKMA 3RUPA 2WTXA 1TKRA 2X3YA 2XNCA 1EXMA 4J7UA 3O31A 1IN6A 3T6KA 5EHZA 4KXYA 4RLQA 2HMSA 1DV1A 3P2KA 5DGXA 1JILA 1KMNA 2G8NA 3IVRA 4WNYA 3QKIA 2LPMA 4XZ3A 4JC0A 3ML1A 3RAFC 1BMTA 2FPPB 3JQ8A 4NQRA 3H2JA 1VYTA 3C74A 3NEPX 4PSCA 1SIUA 2CMFA 1JHPA 2C3MA 3CNLA 3PC8C 3PHGA 1TC2A 1J2TA 2VXOA 2XNDD 5EQJB 1G3MA 1OYWA 2DBVO 3Q85A 1OD6A 4YTEA 3FYTA 3N05A 3UV7A 1X1AA 2V3VA 1DHTA 2IPNA 1V3TA 1SOMA 4AC9A 1AMNA 3PDIA 3ESBA 1H5UA 3I37X 1X8XA 4UHFA 1HY3A 4NBUA 2WZDA 5JNWA 3JAMA 2CV0A 2QUBA 3Q3IA 3OPMA 1ODCA 2C95A 4LV5B 2WFMA 2DEUA 4ES6A 1GUBA 1VL6A 3GFVA 3KJZA 3NVDA 4IIUA 1XA0A 3OFJA 3NI2A 1J7KA 3A3OA 3E2PA 5MGNA 3SKVA 1HXHA 1NBAA 1RCFA 3AF0A 3MRXA 4TYNA 1R15A 4FXOA 2WSBA 3L8MA 5GONB 2YY5A 3M81A 4EG3A 1RAAA 5DXFA 4QOEA 4P1ZA 3ESXA 1JSLA 1U11A 1KJIA 2Q46A 2HEGA 2VWHA 4RIGA 4IS2A 1J2RA 4DDTA 3ZDCA 5CDGA 4IMPA 3ZU3A 2HRDA 1P75A 1AHNA 1ZMBA 2V4MA 2PDAA 1S3FA 3AFGA 4W1RA 5BSWA 2WAYA 4RK1A 3A4NA 2EZTA 3U19A 2QVCA 4TS4A 1XKLA 3MQ4A 3N8DA 3CC8A 4BATA 9LDBA 5IC6A 1B41A 4A7PA 4B84A 4WZBE 1QS0A 4TYQA 1EVYA 2NU7B 2W6MA 3GG9A 4Z9BA 4J16C 2DULA 4KQIA 4ZI3A 2JJYA 4KQGA 4MLDA 3HJBA 4HB0A 5C1IA 1RYFA 1D4AA 1H6AA 2B83A 1EDBA 2G63A 4DA6A 2MINB 1CNMA 2FJ0A 2QM7A 3B20A 3QBEA 5J2TF 4YQZA 2VDPB 3RFCA 3WFZA 3L6BA 1XAJA 2E5LB 2ES4A 4H08A 3CZCA 4A27A 4AZ3B 1NXWA 3WAKA 3A32A 4I8DA 4F5EA 4P34A 3U0VA 2X0RA 1P4SA 2IXEA 3IT2A 1KY4A 1RXEA 3MGCA 3MM4A 3TEJA 4HNAA 4C0AC 4LY6A 4QUBA 3SY8A 2BGGA 1NE7A 4Z7JA 2OV3A 3AG5A 1NG9A 1P2TA 3PFIA 3QVOA 1NR1A 3DEYX 4CODB 4B2PA 4DWVA 5A1TA 2C58A 2HA6A 2XW6A 3B38A 1NI4A 4NFLA 2G7ZA 4TWRA 1QHIA 4YS6A 3OJOA 2WP8J 3KNZA 1NHGA 1X13A 3I2KA 3U3ZA 4QQKA 3GK3A 4G5OA 4PC1A 4OGKA 1JDVA 4RVFA 4C6HA 4NFYA 4YQFA 4BGIA 2XF8A 3LBNA 5AI5A 3DQZA 2CB0A 4GXTA 1UBCA 2WIFA 5LQAA 2NO1A 2QI9C 2PYIA 4XWTA 4XYLA 3G8AA 2SNIE 1YRQA 4G1EB 2C29D 2FQXA 2QM8A 3QEMA 4W63A 3FCEA 4CM5A 1VJTA 1NJSA 3VYSB 4Z51A 4KODA 1WCYA 1NASA 3OQMA 1F14A 4M49A 3VC1A 1NDHA 3FNIA 3U7JA 4YV2A 4G1BA 1T0BA 4WKBA 4GZMA 3AEUB 3P45A 1DKOA 4WK6A 1Y81A 1LFDB 5CLGA 1BQEA 4D81A 3H65A 4NJEA 3EXHB 5CVDA 1J5PA 2B1QA 5CX1B 4JLUA 5M2QA 3V4VB 4OXKA 2WHEA 4GM1A 4HUJA 3PCTA 2EGGA 1QFZA 1CDZA 4G4GA 3ESCA 2HEIA 2FPLA 1UJCA 1QZZA 1P45A 3IE0A 3DKVA 5DV9A 4ZANA 3V8RA 5AVTA 4DCUA 4J75A 2F3QA 5AHOA 1H05A 2VJDA 3DF9A 3CUSA 4DT1B 1D2RA 3E84A 2UUBB 3A37A 2C5BA 2NUAB 4B82A 2TECE 2ZCVA 2ZREA 5J4VA 5BN3A 2VT2A 4BOYA 1W2HA 2CXSA 2QAGB 4EHNA 5K6TA 4OI0A 4HB3A 4PIVA 1EUQA 3SQXA 4MULA 2ZOSA 4OBXA 2COKA 3RVJA 4J1SA 2FWRA 3SX0A 5JANA 1VYUA 3DGFC 5LQNA 3QNUA 4WKNA 1D04A 4I19A 4E2YA 2XGMA 1O95A 3L92A 3GGJA 2BEWA 4GD3Q 2NU8A 3S7ZA 3DKIA 5LWQA 4H2DA 5CD1A 5B2EA 2ZTVA 3CV3A 1N5OX 1B1AA 2GSWA 3M5WA 4C4YA 1ZITA 2CNKA 2WKWA 1EI9A 1XZLA 2QJRA 3TQSA 3R8FA 2CNBA 3BKWA 2ZUBA 1QF7A 3PVSA 4CCWA 4GDFA 4Q6WA 4CRWB 5JDIA 5J2UA 1O54A 1QOQB 1UMCB 3BL6A 4D9HA 1W4AA 1N34B 2O8EB 2PL1A 3DT9A 4X84A 4RPCA 5EMKA 1P4RA 2B8EA 4C6TB 3C7CB 2ZB3A 3D7RA 1B3RA 4N0MA 4PGAA 5E4JA 1XA4A 4BYGA 1OHHD 1RACA 13PKA 4PG5A 4A1OA 3NRCA 3R0VA 2AG5A 3C3PA 4IIDA 1WMAA 4Q7JB 5EIWA 4O4LA 4RVDA 1WU8A 2QGFA 5AW4A 1D09A 3C4VA 1P5RA 3COYA 4WKCA 5M04A 1QVWA 1XP5A 2O2IA 4JJZA 4LF4B 1CYEA 4TKVB 3RHZA 4D0SA 3SPXA 1V8ZA 2CDAA 2B92A 2GPAA 2J08A 2C97A 3E3OA 4KK3A 2QMYA 2W37A 4GG1A 2MHCA 5IASA 4LXQA 5JD5A 4AX8A 1XC7A 4F9EA 2ZRHA 3LFTA 1QDLB 4YRNA 4Q9HA 1ZUNA 4PYLA 1EPUA 2OM2A 2ZVPX 3ZVRA 4EY5A 4EBFA 2QDXA 2RCNA 1UPUA 4TKUB 1CJVC 1N1EA 1JZSA 2BZGA 2PMKA 1YRBA 4JJ6A 4JJFA 5TMBA 4ENWA 4M0EA 3LA8A 4ITVA 4M7PA 4DSOA 3PC8A 3WQSB 3G0HA 4F2PA 3FSGA 1MJGM 3T3HA 4B79A 1YT5A 3O8OA 1G3RA 5G0TA 4M0UA 4Y6GB 1QCDA 3OMLA 2QLLA 4NS1A 3U7FB 5AQEA 1KAMA 3PYXA 3LYAA 4EP1A 1VSVA 5DLDA 3KLBA 2BF4A 3RSZA 2WABA 3AI3A 3ZE2B 4PCUA 1G4UR 4YT4A 4QELA 4JUCA 3QMPA 2FDXA 4TMXA 1GL7A 1K8ZB 3OPYB 5LXTF 3ZY4A 3ZS9A 1HURA 4E5KA 1BFDA 2LVBA 1ZAKA 3BCSA 4IXNA 4Q3LA 1YS2X 3LXXA 1HLFA 2W00A 4G41A 2CDNA 4YJGB 3S3TA 4EG1A 2ZDHA 1RKQA 4BB5A 2ZIGA 1D0IA 3O3CA 5K0JA 4HEQA 1MP0A 1PFQA 3C24A 4FYWA 2PUFA 2B78A 1FSSA 3H0CA 2VJYA 1CY0A 2W11A 1JFTA 2A1UB 3QQ5A 4PTYA 2JFHA 3EWIA 3OTIA 1DIGA 3WA7A 5B1SA 3I76A 4QG7A 5AUNB 2ABWA 1Z6TA 4R1QA 3Q12A 4L9SA 4RMGA 1R8SA 3U13A 4PRLA 4AG5A 2Z2XA 1NBHA 4WFKA 2QJWA 2XGGA 1JLKA 3CSSA 4PS1A 1RC8A 2HSGA 3BSYA 4FTWA 2YRFA 3DQQA 1H6BA 4MKXA 3D4OA 4CCYB 3E3NA 4HS4A 4UFNA 3ZY6A 3A1CA 4E13A 2R25B 3FOFC 3K1AA 5AVOA 2JB9A 1C3JA 4KV9A 1VJ1A 4LIPD 4XIIA 2FB9A 1ZGGA 4RKWA 4WOJA 1AKQA 3OUUA 2C4HA 2R00C 2WHRA 5BV7A 1IJEA 1G6Q1 3CMMA 3D6NB 3NWPA 1YZ3A 4UMFA 1PUIA 1N1MA 5DZSA 5CG2A 3N2NA 4OTZA 1KJYA 2DWPA 3WBFA 5C81A 3PWTA 4XFDA 1C7IA 1YR2A 3PLNA 4FR0A 4UUPA 1C1YA 3HLYA 2GFHA 1F4VA 2I6GA 3EWSA 3LO8A 4GQAA 1PWHA 4LY3A 5GQSA 1RPZA 4ZAXA 4KMRA 2PUBA 2O2SA 2KSQA 2BEKA 3BN3A 3S1LA 1VBMA 2WD8A 4NV0A 2Q1UA 4HJRA 4Z99A 1BNCA 2ZSHA 1NXXA 4KXLA 2MSNA 3TGLA 1LVHA 4L5AA 1JHOA 5DBEX 1QM5A 3QELB 5EHXA 3QEKA 2Q2VA 5HQTA 3ZD6A 3EJWA 4JYMA 4DNFA 5JCOA 4JYZA 4RPHA 5CM8B 1I51A 1MABB 3QU7A 4C7KA 4NAUA 1XRPA 3IXLA 2Q27A 4C06A 1U7HA 1YZGA 2AJCA 1KI3A 5EE3A 4D0LB 5TIIA 4Z4IA 4K9MA 4AZ0B 3I45A 3LVRE 2FU5C 3EXAA 2PUVA 4RJJA 5K8JB 1UXHA 1W44A 1OYOA 1ZJJA 1FP2A 4IDOA 1Z06A 4JH0A 3IMKA 4R2KA 4UBJA 4YC7A 3RU7A 3TX2A 3KJNA 4BO6A 4BUZA 2ANCA 1YUBA 1ULHA 4RZQA 1O9BA 5IMSA 3TUZC 4IDHA 3KD3A 2P0YA 4S1VA 3V4LA 1YR8A 4BY9E 2RCYA 3WIEA 4B9EA 3DD1A 5ALGA 2PV0A 5HIMA 1E6UA 2OG2A 4DV6B 2UZ1B 3G3EA 1GN8A 1DBQA 4XKJA 1MORA 4OIMA 1S4QA 5CLIA 1K6EA 3RUIA 2BGKA 1P7CA 5AOBA 1L3CA 1USVA 5HILA 2OHOA 1KQNA 2Q6VA 4YCBA 1E1NA 1UEIA 4OU5A 3C3KA 1N8KA 4ND7A 5SICE 3RFXA 1N6KA 3G9UA 1V3UA 5B5SA 3A6DA 4LOLA 2E4YA 5I5GA 3OM0A 3OT4A 4HWSA 4M0FA 3ZQUA 1OFVA 4X95A 2R5WA 5EMLA 4UTPA 4F92B 4YA6A 2QIPA 5BQPA 1RTTA 1XR3A 1RD4A 2Y1KA 2VJOA 1SU8A 1XV5A 2QPLA 4LDQA 2R7NA 4GFDA 2PQ2A 4C6RA 1I1OA 2VQ3A 1P91A 2GO7A 5KDLA 1Y3CE 3WLSA 4YRQA 5M34A 4NE9A 2WVJA 1ZR4A 1MT0A 2CLIB 1FDOA 5JYBA 1WXWA 3VZRA 1WKBA 4DCVA 3G02A 1YR9A 9ABPA 4DR6B 2FP4B 3U37A 1J09A 4X8OA 1E92A 1JDPA 5GM1A 1AOXA 4XVHA 3ROKA 5BUQA 2BE9A 4EYOA 1N0IA 1FBNA 2P7HA 5JPDA 2HPVA 3MBOA 3QPDA 3R0QA 1WVIA 1U3TA 1XVLA 4HLQB 9MHTA 4JC4A 1ZGCA 3V9PA 2BR4A 5I3CA 4MLPA 2LP4Y 2HWYA 1JNYA 2XZOA 4TS1A 1EJ2A 3EXIB 1E9VA 2OORA 3AMVA 3HYSA 3R6DA 4CW7A 2ZI5A 2P2ZA 4S05A 1N2HA 3QM1A 1Z0AA 4P82A 5JAHA 4U02A 5JZSA 2G9ZA 6PFKA 1UJMA 1NN0A 3EGCA 3IH5A 3FCSB 5KTPA 4CR8A 1YQXA 1DBWA 2FXIA 2Z4TA 4RS3A 5TT1A 4X1IA 2DQKA 3SJ7A 2GN2A 4IHKA 3RLIA 4IILA 1B8OA 4KR9A 4DG5A 2VAWA 1TYEB 2QLTA 3TZLA 1P5HA 4G24A 2XZLA 3JQGB 2E89A 2P4HX 4YMIA 5AVZA 3HDHA 3GT3A 4I9UA 4JA2A 4Q1DA 4QVIA 3SLRA 2IF2A 4NBKA 1AMUA 1V43A 1I6WA 1W5EA 2C03A 1NNUA 1TJPB 2VFAA 3KP1A 4L27A 4PU0A 1OTYA 1A5AB 3GDGA 4RL6A 4A0GA 1N9GA 2PPLA 2Z1MA 2BW0A 4B4UA 2PXHA 2IZ5A 4O59O 2R00A 1D9ZA 1KO1A 4YEDA 3UJ9A 1LVUA 1QRAA 3K2QA 5TQVA 4FB5A 1JZQA 1EQUA 4JUIA 4CMEC 4TYWA 1SVSA 3JD1A 1W4CA 4RLHA 4HDMA 5G0UA 2HA3A 4EATA 3I4FA 4I9GA 2R6R1 2HU5A 3ZW9A 1C1XB 1M2WA 2BMFA 3QKSA 3UTCA 2I29A 1M8PA 3U3KA 3B6JA 1VCHA 2VPXA 3ZNOA 3KEFA 5A71A 1R6VA 3KU1A 3EZYA 4YR9A 2PUDA 4Q48A 3FYUA 2WUEA 3GJTA 2GJ8A 3RFUA 3SVLA 2VSXA 5EI5A 3EISA 5FADA 3AUYA 2OA0A 5EIAA 2P2LA 2VDKB 5EERA 5GVRA 1AVTA 5L7YA 3ORHA 2VDUE 1X87A 2F8LA 4YXFA 2JVIA 3EIFA 3U7GA 1VL8A 4D5EA 1F9AA 4QJIA 1GKLA 1D7OA 4B3DA 4TV8F 2OVFA 2G72A 1GNRA 5HM6A 2PQ6A 4L75A 4YVFA 4BKMA 3GJXC 2BE7A 2FX5A 3BGIA 2O0LA 1II0A 2Q5HA 1W0CA 2B2XA 2QYOA 2FGKA 3BMCB 3BD7A 1Z37A 5KAPA 1D1TA 1RWWA 1X7DA 4MV3A 2H48A 5DT2A 4EPRA 3WL3A 1HLDA 2PTHA 5FD8A 2B6HA 2GASA 4LOKA 3L7KA 1BCRB 5KX5B 3T3OA 1IN8A 1Z8DA 2YZNA 3V7YA 2ZAGA 4BKRA 2F8SA 4B33A 1RQPA 1XZMA 3CIOA 2H5IA 3EGOA 4ZYZA 2YQ4A 2DWCA 4DQ0A 2G4LA 2Z9CA 1VJ0A 1X19A 2UV8A 4EVRA 4YRZA