3IEIA

Crystal structure of human leucine carboxylmethyltransferase-1 in complex with s-adenosyl homocysteine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
310
structure length
310
Chain Sequence
b'GVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLSSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKEITY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine carboxyl methyltransferase 1
molecule tags Transferase
source organism Homo sapiens
publication title Structural Insights into Novel Functions of a pro-survival PP2A-specific Methyltransferase
rcsb
total genus 121
structure length 310
sequence length 310
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.233: [Phosphatase 2A protein]-leucine-carboxy methyltransferase.
pdb deposition date 2009-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04072 LCM Leucine carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ieiA00
4E33A 1X1AA 1G8AA 5HIMA 3RODA 4MQ4A 4GF5A 5DT2A 4U7PB 4RVGA 2OB2A 5HIJA 3EMDA 2CKDA 4BLVA 3DH0A 4R8RA 5DXAA 3NVKI 1R8XA 2PVCA 1JSXA 2JHPA 3DXYA 5CVEA 1YUBA 3LDFA 5KS2A 3E23A 1ZG3A 2PLWA 9MHTA 2IIPA 2VS1A 3HM2A 3NDIA 1U2ZA 3GRVA 5EEHA 5LQAA 2Z6QA 2ZWVA 3B89A 2O06A 3SMQA 3KR9A 3EMBA 4YV0A 3B3FA 3KQPA 4KDCA 4E2XA 2ZLBA 2PSSA 1RI4A 4LG1A 3UWPA 3R3HA 3HCBA 3OU2A 4GOLD 4X1OA 2ERCA 5KQSA 2O57A 3O4FA 4CTJA 5M5BA 1QYRA 3GGDA 4QQNA 4GC5A 3GRZA 3HP7A 4HSGA 3DXXA 5E2BA 4GOOD 4PIMA 2H00A 2ZSUA 5EZQA 1FPQA 3EVGA 3G2PA 5G02A 3ME5A 2UZ4A 4ZTBA 2OXTA 1BHJA 1N7IA 4KVZA 3MAGA 5LQJA 3HVKA 4P7JA 4O29A 2KW5A 4OBXA 3M4XA 4FT4A 3P9IA 2GH1A 3UJ8A 1I9GA 3GDHA 4V0QA 4DM3A 4Y30A 3LX6A 2FCAA 5B1SA 2N47A 3C6MA 2AOXA 3EVAA 2ZBRA 4IV8A 2CWWA 3HNRA 1SVUA 1FBNA 2BM9A 3I53A 5K0GA 1L3CA 3ELUA 2GB4A 3LCUA 3KR2A 2IDJA 2IFTA 4XUEA 3UBTA 1QANA 4UOEA 2AOUB 4YUVA 4R05A 2YR0A 1R6AA 5EMLA 4PIPA 3SSOA 4EKGA 3FYCA 2I7CA 1P1BA 1ZKDA 3NTVA 4R6WA 3TPZA 2P1DA 5MHTA 2DULA 5EQJB 5BP7A 1P39A 3T7TA 4PYJA 4X60A 3GU3A 4C04A 3HTXA 4POOA 5EZSA 2GA9A 2XYRA 2AOTB 3EGIA 4PYLA 5EC8A 2ZZNA 2CMGA 4HGYA 3V97A 1NKVA 1JQ3A 4A6DA 1Q0TA 3TRKA 4RTLA 4E32A 5K09A 3OFJA 5FQNA 2PXXA 4QPPA 1XDSA 4ER6A 5K0CA 3KQVA 4GOMD 1O9HA 3LCCA 4PYQA 2P3QA 5DX1A 4EK9A 1WS6A 3AXSA 3CVOA 3OU6A 4FZVA 3PVCA 5DM1A 4X41A 4E2WA 3UJDA 1P91A 3M6XA 4RTRA 2PWYA 4PYIA 4V0RA 5HEKA 1YF3A 3HVIA 2QE6A 3CCFA 4KIFA 3I64A 2HR1A 1RI3A 3CKKA 3SGLA 1EJ0A 1I1NA 5K0FA 4RVFA 3KQWA 5CVVA 3REOA 3UJ6A 4RVDA 1UIRA 2O05A 1BOOA 1JQDA 2CMHA 2DPMA 1JG3A 3AWIA 2AVNA 3FYDA 3SX0A 1SUIA 1RJGA 3GRUA 3I9FA 3GRYA 5T67A 1KXZA 3GRRA 4PINA 5HFJA 2R6ZA 2AS0A 1JTFA 4IKPA 2ZZMA 5GINE 4NECA 5E8RA 4OA5A 3FTEA 4RTSA 1SQFA 4RYLA 3KQSA 4U7TB 1JSZA 3LBYA 4QTTB 3JWJA 5DSTA 3THSA 1KPGA 4YUZA 4AZWA 1D2CA 1AV6A 5U4XA 2OY0A 2XYVA 5DSXA 3THRA 3TKYA 2UYHA 4E31A 3VC2A 2XVMA 1L1EA 3HCCA 1H1DA 4KRGA 4BLWA 4EMSA 3P2IA 1I4WA 1VIDA 2IGTA 2PGXA 3LGAA 3NVMB 2I9KA 4PYNA 3MB5A 3L8DA 4ER3A 1MHTA 2F8LA 1Z3CA 3F4KA 5DXJA 4M38A 4GEKA 3MQ2A 2ZVJA 1XVAA 1MJFA 3DXZA 4ER7A 1KYZA 7MHTA 2WA1A 3EVCA 5E1DA 3EVEA 3P9NA 4RVHA 4GBED 3TQSA 4CWAA 2JH8A 1G38A 10MHA 3PFHA 3DMGA 3HCDA 1PJZA 3E05A 4RTQA 1VE3A 3TMAA 1FP2A 5LQKA 4PYKA 5T6BA 2C7RA 3LSTA 4PNEA 5LQUA 4QPNA 1NW6A 4E70A 3BKWA 2AOTA 5F2NA 2B2CA 4RTJA 1VP9A 4HRAA 1XCJA 2XYQA 2ZCJA 2YUIA 2QRVA 3SSMA 4YV2A 5EEGA 2PX4A 1QAQA 4AZVA 3FPHA 5DM4A 5C0OE 5DRYA 5K8VA 3P2EA 3G2MA 2PKWA 3FRHA 2EG5A 4HTFA 3PLAE 1RI1A 1RJDA 2EJUA 4CKCA 1G8SA 2Z6UA 3BWYA 1KHHA 3JWGA 3NW9A 4E2YA 1X19A 2UYOA 2EFJA 3IYLW 1WZNA 4QVKA 3EEOA 1NV9A 3G8BA 4PONA 5E8JA 2K4MA 3TM5A 3UJ9A 1DL5A 5FA8A 1X1DA 1XCLA 3HCAA 1RJFA 3TFWA 3GO4A 5HOQA 1WG8A 2JJQA 2ONYA 3JWIA 3OZRA 3X0DA 4F85A 5IKMA 3HVHA 4BP1A 4DZRA 1DCTA 3TR6A 3UJBA 2OZVA 2GPYA 1KIAA 3GIWA 4GQBA 3TKAA 3HA7A 1EAMA 3U81A 2NXCA 3PTAA 4A6EA 4M37A 3ID6C 2ZZKA 4GC9A 2AOVA 3BWCA 8MHTA 1NW8A 3NJRA 1O54A 3PT9A 4C4AA 2EJTA 5EMMA 1JQEA 4DCGA 2IH4A 3MTEA 2GS9A 2PWPA 3DULA 4FGZA 2C7QA 3D2LA 3T7RA 2NXEA 3P97A 5HILA 3PB3A 4M7RA 1WXWA 2UYQA 4PCAA 1ORIA 2XBMA 2V7EA 3HEMA 2G8NA 4HH4A 5CD1A 5JR3A 4E2ZA 5CCBA 1X1BA 4CTKA 4RTKA 2YXDA 1B42A 3PX2A 1M0EA 2FHPA 4RWZA 2C7OA 3AY0A 3KKZA 3QV2A 4H0NA 4LWOA 5LQCA 1FP1D 4RTOA 3KQQA 4DMGA 2WK1A 5LSAA 2IPXA 2FK7A 2NXJA 3BKXA 4XCXA 5E1BA 3KPWA 3CJTA 1IM8A 2NNWB 2IP2A 5CIYA 1RJEA 2G71A 5FWDA 3T7SA 4WVLA 1TW2A 3FPFA 3FUWA 1XTPA 3ORHA 5FWAA 3VSEA 2YX1A 5P8WA 3SXJA 1D2GA 5FHRA 3EVZA 2ESRA 3FUTA 1O9GA 1YB2A 3DMHA 5FTWA 5GP1A 5H02A 2NYUA 3O7WA 4IWNA 4RX1A 2C7PA 4B17A 2BR4A 2P7HA 3C3PA 5FCDA 5DTQA 3QOXA 5HIKA 3NDJA 5EGSA 1JG1A 4QDJA 3KQYA 2ZIGA 3G2OA 3FUUA 3MCTA 4QVGA 3KU1A 4DKJA 3CJQA 1N2XA 5K0LA 2IBSA 5E9JA 3C6KA 4KWCA 4OQEA 3UFBA 3DLCA 1ZQ9A 3OFKA 5JUWA 2AOUA 3ELWA 3G8AA 4E30A 2PX5A 2YXLA 3G88A 3OU7A 4WXHA 1L9KA 3DTNA 3A4TA 1XXLA 2FK8A 4QQKA 1UFKA 3R24A 2YTZA 5DPMA 2H11A 2ORED 1G60A 4XUCA 4GOND 3KQOA 2O0LA 4DQ0A 3RW9A 5DTRA 5FADA 5K0BA 4EKIA 1M6YA 1NBIA 3MHTA 5ICEA 2B3TA 3FTFA 4HC4A 2BM8A 4K6MA 3OCJA 4P58A 5EG5A 3T0IA 3LPMA 3TM4A 3GNLA 5DX8A 3M6VA 3V8VA 4ER5A 3FUXA 5HIIA 2PXAA 5EPEA 3SR4A 2UYCA 5DWQA 3EVBA 3P9KA 5DM0A 4EQZA 2YXEA 3CC8A 4ER0A 2IH5A 3DP7A 4YV1A 5EKXA 3E7PA 4Y2HA 2NP7A 3Q7EA 2LD4A 2GLUA 2P3OA 4HGZA 1XJ5A 4FSXA 2PT9A 3LL7A 1UWVA 3C0KA 3UZUA 4FT2A 4OA8A 3EEYA 1KP9A 5F2KA 1VBFA 3ANXA 4OBWA 1EIZA 3UJAA 3DR5A 3KPVA 2P41A 4C03A 1JTEA 1KPIA 5CVDA 1KR5A 1R8YA 3DLIA 3MERA 3O31A 5K0NA 5HZMA 1V39A 4PYOA 1SQGA 2HMYB 2XVAA 4X61A 5EIFA 4IV0A 1X1CA 2FRXA 1NE2A 2NXNA 1NT2A 2WA2A 3HVJA 3Q87B 2ZULA 5BXYA 3TLJA 1ZHFA 3B3GA 1R74A 2ONZA 5GM1A 1WXXA 3KR1A 1N7JA 3ER9A 2HWKA 3UJCA 2IDKA 5E9WA 1NBHA 3IHTA 5K0EA 3B7PA 3BT7A 2BR3A 1TW3A 3ELDA 3JWHA 2I62A 3GCZA 3B3JA 4MTLA 2P8JA 3BGDA 3EGEA 4F86A 1RI2A 5FUBA 5FULA 4R8SA 5DLYA 1BC5A 4GUAA 2ZBPA 4HG2A 4MHTA 5C1IA 4LECA 2BZGA 1SKMA 4CKBA 2JH9A 5GM2A 1G55A 2E5WA 2G70A 3KR0A 1NW5A 3G5TA 3OZSA 3LKZA 5CVUA 1L3BA 3UJ7A 3EVDA 3R6TA 1YFLA 5GWXA 5EKUA 1EQAA 3M33A 2FPOA 3A7EA 2ZBQA 2ZIEA 4G56A 4OQDA 4QDKA 5E2AA 3SM3A 2Y1WA 1ZGJA 5GOZA 5K01A 1FJXA 2JG3A 2OKCA 4C05A 5LQRA 3ERCA 2I6GA 3LKDA 5ERGB 4BLUA 5EMKA 3ER8A 3VC1A 4DCMA 4FP9A 3KQMA 4C08A 3FPGA 3MCZA 1NW7A 3KHKA 3G2QA 4KDRA 2VZ9A 1QZZA 5CCXA 5BW5A 2JHAA 3FPJA 3GJYA 1AF7A 4P7FA 5KQRA 2R3SA 3M6UA 3VYWA 4FSDA 4R6XA 1R00A 1VLMA 4YUXA 4ATNA 4YMGA 2PBFA 3FUVA 3LCVB 3UA4A 3BZBA 5F2OA 3FPEA 1HNNA 3KPJA 3EPPA 4PWYA 5BW4A 2AN4A 5FA5A 5IH3A 4C07A 5C9ZA 4RTMA 2AR0A 1JG4A 3K0BA 5E1OA 2O07A 1TPYA 1NW3A 5CUQA 5EHIA 3TOSA 5DTMA 1G6Q1 3HA3A 4RTPA 1ORHA 2Z6AA 2BR5A 3BGIA 3OE4A 4FS8A 5T64A 4CXMA 3KPUA 4PGGA 3P71T 5GIOE 4DA4A 3BUSA 3M6WA 2IH2A 3ELYA 3R9XB 1WY7A 4EVIA 5K03A 3AJDA 4PYMA 3OE5A 5K0JA 1KPHA 1Q0SA 3FTCA 2VDVE 3NWBA 3P2KA 1XDUA 3LDGA 2OO3A 4JXJA 3SSNA 1JR4A 2PXCA 5LR6A 5CVJA 1AQJA 3CGGA 3IV6A 4XUDA 3S68A 3I5UA 2QM3A 1F3LA 4YMHA 2B25A 2VDUE 1D2HA 4PGHA 2V74B 3A26A 3FZGA 4FR0A 3GWZA 3HA5A 2ZFUA 1R18A 2B9EA 3CBGA 3EGVA 4PCLA 4AZSA 2AZTA 1ZGAA 2EX4A 3KQTA 2AN3A 2HNKA 4DF3A 1INLA 3P9CA 2P7IA 3LHDA 4RSRA 2BH2A 1T43A 2QYOA 1DUSA 2AVDA 2PJDA 2ZW9A 3G89A 2AN5A 3HCEA 4BP3A 4M36A 5K05A 3KPYA 4KIGA 1IY9A 2PX2A 3A25A 3DOUA 3DUWA 2PX8A 3AXTA 5DX0A 5ICCA 3UA3A 1NV8A 4AX8A 2OPBA 4MIKA 1YZHA 3SVZA 1IXKA 1M6EX 4F84A 1JG2A 2IBTA 5D1NA 5ICGA 5EVJA 2QY6A 1AQIA 4X63A 4OX9Y 1L3IA 2ZTHA 1RI5A 3DMFA 5FQOA 1EJ6A 4L7VA 1F38A 3LDUA 3B5IA 3EVFA 2FYTA 2JHCA 2OBFA 2PV0A 4CKEA 3RIEA 1YZ3A 5KYGA 4AUKA 3CJRA 3BGVA 3I58A 3GXOA 4P7GA 5EMJA 5DM2A 2Q41A 3OZTA 3NMUF 2GAFA 2QRVB 4RV9A 4Z2YA 4P7KA 5CM2Z 3LECA 1EG2A 1VP3A 5LQNA 3QOWA 4QTUB 2H1RA 1YFJA 2NP6A 2ZIFA 1SUSA 5ICFA 2YQZA 4HTFB 4KW7A 5E9QA 1Y8CA 3G7UA 2ZWAA 3HCFA 3R0QA 3FRIA 3PX3A 2PT6A 1XDZA 2P3LA 2CL5A 3M70A 5EIWA 1VL5A 2A14A 1VPTA 2AOWA 3A7DA 3BWMA 5EOVA 5D1HA 5DRTA 3P8ZA 1OR8A 1SG9A 2YVLA 3BWBA 2PY6A 3MGGA 3A27A 4AZTA 2G1PA 5FHQA 1PRYA 4MWZA 3BXOA 3WSTA 1VQ1A 3G5LA 2P40A 5GIPE 2HTEA 1QAOA 1KYWA 2ADMA 2HV9A 2VP3A 1QAMA 3H2BA 2OB1A 4LWPA 3K6RA 2P35A 4ISCA 5EHGA 2Y1XA 4YUYA 2VDWA 2B78A 3E8SA 3FTDA 3IEIA 1P1CA 3LBFA 3NWEA 4YUWA 4RTNA 4BY9E 5KVAA 3OPNA 3PFGA 3PS9A 2OYRA 3C3YA 2G72A 1BKYA 5E1MA 4C06A 1HMYA 3MTIA
chains in the Genus database with same CATH superfamily
2ADFA 1BHQ1 1X1AA 1XC7A 2WU4A 3BBLA 3JZIA 4HEHA 5DSZA 3TKLA 4J2TA 4MINA 3DKRA 1ZONA 2PBLA 4HZUA 2X58A 4B33A 5LLSA 2GDJA 2GILA 2VJBA 4WZBE 4BLVA 1TYBE 3WIVA 4TS3A 1JG7A 4XEUA 4DW8A 5BUSA 5DXAA 2C7BA 4K9KA 3A6FA 2JFZA 4K3VA 3F3YA 3FYUC 2YWGA 1Z7GA 1IXRC 5IARA 2O3RA 4R8MA 3MIIA 3RLFA 4DSAA 3W9BA 4MIEA 4RLFA 4G1UC 4D0GA 4UU8A 1MU0A 4LRSB 3B3FA 3KQPA 3GNSA 1U5BA 1G5HA 2XB9A 4XWAA 3CVWA 2PUBA 4PZEA 1MT0A 2GZDA 4HQ6A 5KOJA 5BN4B 1YZQA 3OIDA 4BJ6A 4I50F 3ZGOA 4BQFA 1SXJD 5BSUA 2PGAA 2V97A 1WMDA 5IN5A 2FB9A 4GC5A 1I80A 3JZAA 5AO9A 1E4EB 4PTZA 2XKJE 2PPLA 3I5XA 1BG6A 1P9RA 2GZSA 1VKHA 2H00A 2P9QA 3A11A 4GOOD 4NOJA 5G02A 1QOZA 4ZTBA 3C8ZA 2C9DA 1LK5A 2V0NA 3L9XA 2B7LA 5FI1B 4D5GA 1ORWA 1VBMA 4V3BA 4WXEA 4O29A 1JNXX 1GFWA 3DWEX 3FNQA 5CM9C 5KJCA 3P9IA 3DDUA 3AFIA 4C3VA 2WJ6A 1RHKA 2BFMA 1KMHA 3OF2A 3EQ9A 4MW0A 4Y30A 4G5HA 1OBFO 5HFAA 4HTAA 5JVDB 4EFKA 4LWQA 1NN0A 2ZBRA 2YCLA 3GVHA 4CIYA 3T1YB 3PNPA 4DUPA 3GT0A 4IINA 4CTMA 3QF4B 2WIBA 1V5IA 3L7KA 1ZKMA 3ORYA 4HNAA 1RXUA 4KPEC 4RA9B 4HPXB 2IFTA 4WFJA 5AHOA 3ZEIA 5E7QA 4ZU1X 4QO7A 4XQGA 2ZDHA 3HDJA 3STHA 2YJ3A 1J8QA 2YMQA 4NBLA 4UUPA 2VKTA 2GJ4A 5EMLA 3RANA 4ERNA 2PWBA 3O26A 2FN8A 4B8WA 2RHLA 1VOTA 4ZVOA 4WCFA 3STYA 3P94A 5EQJB 2CXPA 2GHTA 3TX2A 4HVCA 5E4FA 3C6QA 1Q1ZA 3ROQA 5JLAA 4RY2A 5HQTA 5IM4A 1G5RA 1ADYA 1MZVA 4B9AA 4WDQA 1OHHA 2CMGA 2M9MA 1BTOA 4DY4A 5I9LA 1RYEA 1NI4A 3PYLA 1Q0TA 3SXPA 3VR2A 1Z38A 3H87A 4LGYA 3JTEA 1EVJA 4DR5B 1X13A 2QRPA 4MWTA 4LJ7A 3LCCA 3B1JA 3TK1A 1C1DA 1W34A 2FQQA 1UBFA 2J85A 2P9TA 2LVBA 3ZIUA 3M6XA 4L5IA 5TGTA 1DJPA 4CN8A 3U5TA 2J3HA 4KWIA 2WOJA 4M0LA 1OH6A 3CCFA 1GVHA 4OHCA 1GHTA 2ZPUA 3B53X 3LCRA 2GRUA 1W1IA 3CKKA 2AG0A 3LJKA 1G66A 3B3AA 1CUGA 4LRWA 5C8YF 2YRWA 2D2XA 2IA5A 3KKOA 2IPMA 1Y5LA 2FW8A 1SB8A 3STWA 5A71A 3C8DA 3W6UA 3LF2A 1JHUA 4C4YA 2C5LA 2LP4Y 1E64A 4A2PA 1KYXA 2GA8A 2WUFA 1HO3A 1AB5A 3BZWA 3FCEA 3WXBA 3B70A 2GM9A 2K2WA 1E98A 3EZNA 1W46A 3ANMA 3DP9A 4OA5A 1RWMA 2B98A 4LYEA 4YP0A 4RTSA 1NG9A 2AXEA 3NYWA 1NVMB 1YRBA 5IC5A 3WL7A 4OVKA 4QTYA 1WPXA 1UINA 4XJSA 3AG6A 4NJEA 3ZWBA 3X2SA 3TIXB 4LDNA 2WUEA 1Z47A 3P2IA 4GMKA 4IJMA 3W5HA 3GOHA 4F71A 3RTCA 5FLKA 1MHTA 1C7EA 5K3FA 2LIVA 2G7ZA 4BNGA 2GETA 4P2BA 5LA6A 3FSEA 4QEKA 4WLOA 3NGXA 5I7RA 2V0GA 4ZOAA 4C6TB 3FDZA 1EK6A 3L4JA 1ECPA 1GTG1 3R6GA 3RC8A 1P4AA 4RM3A 3PFHA 4DJTA 4EIWA 3P20A 4JI7B 2BBWA 5JCJD 4CEJB 2DVMA 5B1YA 1VHDA 5JZMA 4RTJA 2F17A 3GJ4A 1ONPA 1XCJA 2FUG6 4AG5A 2RB4A 1NNLA 4N0EA 4WL0A 3RYTC 4YV2A 2WZCA 3AYZB 3V80A 4B31A 4EITA 3IE2A 4YT2A 2ZXEA 5DRYA 5K8VA 2PGOA 3EN0A 1P1JA 3M6AA 4R41A 3KYCB 1CC1S 3CE6A 3V1UA 1YUMA 2AT1A 5ALIA 4GSYA 2Q3FA 2QMHA 2XE7A 1FMCA 5E6UA 3DAOA 3DC7A 5BURA 4NIMA 5F7XA 1XEAA 4FMPA 2IU6A 3EVNA 1J2JA 2IE8A 3CB2A 3K96A 3JV7A 1YHYA 5F64A 1EQUA 3WK8A 4J75A 1ATIA 1G17A 5AKXA 3KXPA 1RMTA 3SNKA 3LYHA 4JASB 3SHWA 4IJ6A 3BHMA 4J6EA 4JC4A 4KXFB 4CIXA 4DMKA 1E1QA 1UUFA 1Z8NA 4J4HA 4KITB 2REXB 2VO1A 3DSRA 1HLFA 2ZQYA 3FLEA 4FOOA 2PUJA 2ZQZA 3L8FA 3BH6A 4M37A 5F21A 2QYTA 3RUCA 5BMVF 5LU8A 3PTAA 2AOVA 1PV1A 3NKVA 3SF8B 3W8FA 1GZ7A 1VL1A 1T1EA 3WL6A 1QLJA 3UG7A 3QMWA 3QLVC 4XWKA 5TB5A 5K0ZA 5LN1A 1BDJA 1XQ6A 1KJZA 1KYTA 5K8CA 1E3IA 1FNCA 1OLUA 2WT8A 3WR5A 3QFHA 4MICA 3W8DA 2OFOA 2WVAA 2NV6A 5DBEX 2YQ4A 1FFXB 3GPBA 4HAUA 4DLTA 4E2FA 3HEMA 1MOSA 2BI7A 2EP5A 2VHEA 4RQBA 5CCDA 3HMQA 1RLUA 4LTMA 1C0IA 4R9RA 3ZJTA 2ZTUA 3LQ4A 1EVLA 4M9QA 3H16A 4OHMA 4LWOA 3R44A 1TM4E 4TLEA 5HIAA 3EMKA 1S3GA 4XCXA 5HF8A 1QHSA 3KPWA 3MB8A 3T9EA 4HCJA 4N76A 2QD3A 4KYVA 3ORSA 3ASYA 3M3PA 1VG9B 1RKXA 3FPFA 4L4YA 4EYOA 1CJVC 5JI2E 1ZISA 3FUTA 4FJ1A 2Z2KA 2JKYA 1GG2A 1OXSC 3O7WA 2VP5A 1JILA 4MS3B 4MZDA 3SBOA 2PUAA 4B3SB 4LN1A 3ZD6A 1EWRA 5IVKA 1QHXA 2C97A 1EUYA 3OQBA 1NP6A 3N6RA 3U7QB 1PQWA 3INYA 1I6WA 4NOLA 5C31A 1P5JA 1ZSYA 4JWKA 4CIWA 3ZWXA 5FAKA 2J33A 3H11A 4HMQA 5B2ZA 3IEVA 1A5SB 3FUUA 1Q1QA 3GP5A 1E6MA 2P30A 2QMUA 3D6VA 4GOKA 3RC2A 3UKDA 4PG8A 1ZPDA 4R16A 2C29D 5J1SB 3EGWA 4IWXA 4FMCB 4N1AA 1VCHA 2PBRA 5E9JA 4ZCQA 1JJ7A 3H42B 1Z4IA 4YLEA 4C4XA 2FPMA 2Y1LA 3KTAA 5SY4A 3LOQA 1VE9A 1XRJA 1ATZA 1ZK3A 3B6JA 3ELWA 3QX8A 3OETA 4KUHA 4UJ3A 3TECE 4AKEA 1UBJS 1MB3A 2HMTA 4NZ9A 4WESB 2X0DA 4MPDA 3TTTA 1OAAA 4NCKA 4OOEA 5ECYA 5EXXA 4JCCA 1S0UA 4QQKA 4BBJA 3DFMA 2JAQA 3K1YA 5D6NA 4KRFA 1XP8A 2PKYX 4HNGA 3HS3A 2PLAA 1FLDA 1FUKA 1X1SA 4MQ6A 2FFAA 3BOSA 4RHYA 5CCEA 1IHPA 2O0LA 4D4LA 2FX3A 4Q01A 4U7FA 2I71A 1M6YA 3GCXA 3FTFA 1Q7BA 1BGXT 2PSDA 3QSGA 1R6TA 5KZMB 3GFVA 1ISGA 3GJ5A 3J7TA 5CFRA 5KPJA 5CGZA 4K26A 3IKJA 5TJHA 4BRWA 1ODJA 3M6VA 1C3VA 2XDYA 2DR0A 4JT9A 2XV1A 3I4FA 2H4WA 3QMVA 1QORA 4QO8A 1EP1B 1GA1A 4BU0A 2IH5A 1I9CA 3DP7A 1QYIA 3TFQA 3DVLA 1ADGA 1DTWB 3ZE1B 3DE7X 4DABA 3NFRA 5KPDA 2F3QA 2J46A 4PO3X 2VHXA 4QWWA 3CT4A 1ENOA 1B6SA 2QVYX 2FPXA 5K3CA 1OA0A 3SFZA 2WHXA 3DDNA 2WJ3A 2D74A 1IXZA 1HWYA 1I2BA 1X7DA 4EMBA 1L7EA 2FWMX 1LWOA 4KBGA 2GF0A 3OKCA 1ZVVA 1IPHA 3RVLA 4FUTA 3WGKA 3ZQ6A 1UXGA 1Q0QA 2FPIB 3LDAA 4QRHA 3UH0A 2WA2A 1FPMA 2FWIA 2IPAB 3HB9A 3FAKA 4I4CA 5KVCA 5L9AA 2HHHB 4LXHA 3OICA 1WUTA 1K2VN 1R74A 2CFRA 3PQ6A 2WWTA 3P0FA 4BWYA 4BB9A 5K45A 4FFPA 1JL3A 3KR1A 3R4VA 2DHRA 3K0CA 1SKQA 1Z5WA 2I0FA 2C84A 2AJDA 4N82A 4BLQA 3AJEA 1OXXK 4M2LA 5K0EA 1OHHD 2C5GA 4HATA 3WNDA 4CLDA 3ELDA 2VHUA 3JWHA 4JL6A 3GCZA 4ZEVA 4MTLA 5IT4A 1U7HA 1RI2A 3C7AA 3QFCA 1U9ZA 4DCTA 4TKMA 1BC5A 4AX4A 3CF2A 1NSTA 4PPGA 2ZUEA 3MLAA 1DAEA 3ZWQA 3ER6A 4HZUB 3G59A 5C1IA 1QFMA 1R9JA 1SKMA 1FNSA 2AYXA 2ZUDA 3D7MA 2O20A 1XTRA 3OX3A 3S99A 5ICMA 1T2NA 3IJEB 3IQGX 3ROFA 2R6HA 1JWBB 5KU1A 3FOZA 1XZEA 2R0QC 2XYHA 4CF6A 2YFYA 1UK6A 3LYUA 3OUTA 4LI0A 5KTYA 4KXMA 5EXPA 4WCDA 2ODNA 4GXTA 2VPTA 4OHRA 4HWPA 4I6JA 5GP1A 3SJ7A 1NI4B 3BTVA 1G41A 2F59A 2M32A 1DWUA 4IKEA 4ND2A 3RGWS 3RARA 4ENQA 1WBDA 4HNVA 3NC0C 1SC4A 5F1OA 2HF9A 1RXIA 1ONNA 2WP8J 4BGIA 4H7EA 1TMGE 1B41A 2Z98A 2EC5A 4IJKA 4QPDA 4Y18A 4QDTA 3DO6A 4MKZA 4ZJPA 1E4EA 1ARZA 1Q57A 1S9DA 1U04A 2E4UA 2WWFA 4M0KA 3AU9A 3K73O 1VLMA 3T38A 2H51A 2PCJA 3U3XA 2R4QA 3K9QO 1XK6A 3KVVA 1MNQA 4A8HA 2CHFA 3G85A 1CB7A 1R6DA 4RD6A 1J0CA 5FH9A 3RAPR 2GN2A 3PYMA 3N0VA 2WUWE 1LGYA 1IBRA 1ZUNA 3DS8A 4ZVRA 1WETA 5K51A 2PH3A 3SC4A 1H3FA 4NYIR 1ZMXA 1W44A 2QX9A 1M8JA 3BA6A 2W6PA 3DCYA 2W8BA 1P1FA 3KPUA 2V7XA 1JGTA 2R4UA 3AM3A 4OQQA 3VM6A 3DE2X 5MF6A 3A14A 5YASA 3BB1A 5B3KA 4PBRA 2JCSA 2AE2A 5EMHA 5TQ0B 3AGPA 1H6CA 1R0YA 5E4YA 3V6LA 5DASA 2UV8A 1X9HA 3L6BA 5BNIA 3WK5A 3I5UA 2CEAA 1E3EA 3DOFA 1R4ZA 1CEXA 5GONA 4AY5A 5T4HA 4DIUA 2EYUA 3SLRA 1AQNA 1W36B 1JTVA 4NH4A 3ABOB 3HB4X 1BVUA 1KFKB 2JAHA 4W1QA 4ETMA 3HSSA 3NHYA 2DT5A 1RPZA 4E5YA 2O48X 1WXQA 3FGOA 1PIWA 5BN1A 5B57C 1Q17A 2JFOA 1PX2A 2NZWA 4DAOA 1ZOOA 2YUTA 1X42A 3IERA 1IEXA 2QYOA 4JBWA 4EW1A 5DWVA 1LEHA 2XECA 1BMFA 3E3LA 4PLYA 2ADOA 2WSBA 2PX2A 2VJNA 3LFUA 4Q4CA 5L3ZA 2CYBA 2ZANA 3THXA 5AR1A 1B15A 4B3IA 2AFHE 4NAVA 4PPNA 1Y5NA 2IHZA 1MAHA 1M6EX 4Y6OA 2WAAA 3DEIA 3ED5A 4MQEB 3BEDA 2AIRA 3B85A 4HRYA 3DMFA 2XRZA 1EJ6A 4CTOA 2G83A 3GZJA 4FCCA 4G2NA 1Z7BA 2XUGA 5EIOA 1ZUD1 3Q3VA 2J6CA 4M7WA 4JJZA 5AIBA 4JXXA 1ZA2A 1Y9JA 3CJRA 3ZGYA 3A6EA 3O03A 1I2AA 1VSQA 3BMNB 4UVEA 3SF0A 2Q3MA 1A9XB 4BWFB 4C2UA 2EATA 1E79D 3DPSA 1OOEA 3F74A 4RJJA 5BQXA 5E7JA 2PVPA 2D7CA 3IELA 3OPYI 4GWGA 4BASA 4BCBA 3ND9A 2CBXA 4EGJA 4ARCA 2Z3VA 1NQVA 2PZGA 3PHIA 4LDAA 4QUEA 1E79A 2JCYA 1M8GA 3QPCA 4LX8A 5BPHA 3R0QA 1P44A 2Z09A 3TD2A 2GKOA 3IUJA 2YYAA 4NU0A 4PSUA 4U2EA 3L7JA 3CZCA 1SA0B 2VHTA 2J48A 5K03A 2A0XA 1DIHA 3QXXA 4Q19A 4GI7A 4OQNA 4KWTA 2F62A 1W96A 3M1AA 3P9SA 2H18A 4RPLA 1ZM9A 1USWA 4LHEA 3K94A 1XZQA 3KUDA 2BMJA 1GUDA 2A3NA 4DMUB 4Z4QA 4BNHA 4OK6A 5FFFA 4ISCA 4P3NA 2WHYA 3HA2A 4Q7QA 3CTPA 1RWWA 4FGWA 4D99A 1S2IA 8ADHA 5CG1A 3DZGA 3W90A 2FEWB 2OHIA 3DMYA 3NXSA 1ESDA 3MMZA 3V8EA 2F3UA 4D8WA 4LY0A 2NQ8A 3U7HB 2KJQA 3QENA 3S40A 1VHWA 4L5JA 2B2NA 1H0KA 1HT2E 2P4HX 3QV1A 4MGHA 4RO0A 1YDWA 2VATA 4JB3A 5CB4B 1FFXA 1R50A 3OZBA 1EK1A 1IMOA 4BCCA 4QJ3A 1A3CA 1N3BA 3LUJA 3E1KA 5CNJA 2P6OA 3AL0C 1RPTA 5BW8A 1Z7YA 1TZ2A 1VHTA 3RKRA 3IAFA 2P1ZA 2R1TB 1NUTA 1RRCA 4S3MA 5JRZA 2CL7X 5J23A 4HUQB 1RM0A 3QPDA 1N2CB 1ICEA 3C87A 4MW4A 5B3JA 2VC2B 5T3YA 3CSDA 4Y6RA 5JQGF 1HYGA 2J5RA 4YFYA 3L8ZA 4GP6A 5DNEA 3X44A 1FPQA 2GZ2A 2OHJA 2WR8A 4CBVA 3RRYA 3KJEA 3LCJA 4KVZA 1DQRA 4OBEA 2X2EA 4QXMA 2E5LB 4ZKEA 5JDCC 2RH9B 2BCEA 4KFSA 3G0HA 4I3GA 5IVHA 4B6EA 1MQAA 4G5SA 4KIWA 2Y67A 3I5MA 4C0XA 1N0HA 2G77B 4W82A 4PSVA 3AU8A 2I3DA 1YACA 3R7WB 5K0GA 2XT6A 3UUGA 5IUKC 3L7YA 1ODKA 3GFPA 4QGSA 1UT5A 3EJWA 1JQAA 3GLQA 1GPKA 3K09A 3EC7A 1O94D 2IYZA 4RZXA 3DFUA 2FW9A 4G36A 4QJ4A 2QLFA 1HF3A 2OM2A 4FYYA 4YK7A 4D0NA 3DQZA 4A1OA 1B8UA 2R8RA 1EXNA 3OOSA 3QVTA 1QJCA 1W75A 5KWJA 1ZGBA 2OEPA 1BMQA 1HDRA 1R6AA 4ZRMA 4NMXB 4GYWA 3ZJVA 2E5FA 1M74A 3K0CC 4IJWA 1JFTA 2UXBB 5GMOA 3EFHA 4ROTA 1W1WA 3TBFA 3UT5A 2IHYA 1X7ZB 1IUPA 3OY7A 3GA7A 4JZYA 1BDBA 3EGIA 3DAHA 1EBFA 1QCDA 3NYIA 1XLVA 3EGDB 1UPXA 2VP4A 2IXDA 1AZSC 1SKUA 4HQFA 1QV7A 4PN7A 2QAGC 2EV9A 1NBOA 1WP9A 2AXPA 2JBHA 2O8CB 3L7MA 3IXQA 1FRVA 4RAOA 5KYYA 4M9XA 3UJDA 1G5QA 2B8WA 3O2SB 5JZVA 3DHVA 1RS0A 3BJRA 2ZRIA 3UMGA 4DQLA 3AP1A 4V0ME 3OFVA 3B6ZA 4Z7NB 2DU8A 4M0FA 5I8WA 1GR1A 3M9WA 4MQUA 5PGMA 3IO5A 3QEMA 3UH1A 1U2DC 2OWDA 2Q5EA 3C5EA 1DJQA 1EVZA 5LXTB 1T5TA 2WTUA 2QOEA 1F6WA 3SX0A 2YY7A 4FSHA 1NVKA 1TPZA 3EQ7A 4PX5A 1F5NA 1VPVA 2PHZA 2VN8A 4MS1B 2FG5A 1Z9BA 4MB2A 1EFDN 4MKRA 3KOMA 4JLWA 3QQPA 2FKNA 2IYUA 2I2AA 4AUEA 3CLTD 2H7CA 2PUDA 1CE8A 1D2CA 3WP0A 1C7FA 2W43A 3THRA 3P9PA 4LSMA 4D25A 2RAUA 2X2PA 3QUTA 1K68A 1KMIY 3VC2A 4QEDA 4P9NA 2H92A 5AESA 2BRUC 3NBUA 2H07A 3I6ZA 3TVTA 3V55A 2V6IA 3HCRA 5C18A 3NHSA 1W47A 5JS7A 2VK8A 3H4IA 2PL3A 4M38A 3T5CA 2CC2A 4P36A 3FNBA 3Q3HA 4KL8S 1J9GA 1ZINA 5AW7A 1J22A 4OHKA 2CT8A 2ZIUB 5E3JA 4WCFC 2OAGA 4DILA 1E2BA 1OIVA 1ZESA 1B93A 5D8DA 3O0DA 3OBIA 4MVJH 1U0HC 3TL3A 1Y3IA 2LE0A 4R7TA 4D8YA 3AUAA 4RGBA 1FW6A 5KOYA 1OV6A 1MO3A 1Y1SA 1OD6A 4Y6LA 5H0IA 3TQTA 2GCOA 2GOYA 4NCBA 2W00A 1G3IA 1GQQA 1SG6A 2QRVA 1H8EA 3E3AA 4KZPA 4CUZA 3DEYX 1E6WA 4D56A 2GLTA 4BFZA 1EP9A 4KJZA 1GQYA 3P2EA 4OGLA 3HCPA 1IG0A 3D1VA 4J0GA 5AM1A 1RKVA 3NTOA 1Y5RA 2XT0A 1C9DB 1S8OA 4B09A 3D4BA 3UUFA 2KPOA 3AF4A 3DEHA 1JQ5A 2QA5A 2V7TA 4BWVA 4I6GA 1H05A 3QYPA 3CT6A 1J70A 4I19A 4Q3CA 4AMVA 4ZYLA 4Z9FA 1XDDA 1S5PA 3W78A 2FFHA 3AHDA 3HXMA 2EWWA 3U2QA 3I6BA 4I8DA 1CZKA 2ONYA 1HL3A 1W5EA 2YN4A 1CRLA 3LOPA 3M6LA 1YZLA 4O33A 1TAGA 2WLSA 3W05A 2QI9C 4G1VA 4OLAA 1MLDA 3U1VA 2JNWA 3ABSB 5FUYA 4OP3A 3TKAA 1C30A 2WHPB 2H2DA 2VCHA 2XMGA 3GN2A 3Q41A 4XB1A 3VYRB 4EL0A 1TADA 4OJNA 4U02A 3RVJA 1NW8A 5EIHA 4PRLA 4WOKA 4FR5A 4NDAA 1OILA 4IXWA 3GJ0A 1SZJG 3O4JA 5KC8A 4LJSA 3ORFA 2HYIC 1JZSA 4BDTA 4DKXA 1T3ZA 1ZICA 2EKBA 1KS9A 2C7QA 5K7SA 2QTAA 4GMDA 4QRDA 2AFRA 2FR0A 2JI6A 3QLUA 1C50A 4DIFA 1QWOA 3AM4A 4BO8A 1PG5A 4F4UA 3EPHA 3FHCB 1RDFA 1GRNA 4FHGA 3WDLA 1E9RA 1JVSA 1XA4A 3EC2A 3CLSD 3PX2A 1CUBA 4JOSA 4I6EA 2VJMA 4ANFA 4TWJA 2IPXA 4Y0VA 5C51B 5AW5A 1M34A 1IJFA 2P2YA 1MGOA 3N2LA 2OHHA 2WUVA 4U6NA 5K2MA 3NIGB 3S2FA 5FLXA 1O95D 3EDOA 3A1DA 3JW8A 5IYZA 2BT4A 1IAVA 4DEXA 3IILA 3CRMA 2FPGB 4U1RA 2M6LA 2X76A 4YJDA 4HNSA 4OLJA 1DIGA 1Y1RA 3LD9A 4V0OA 5H02A 1FU7A 2V7UA 4OFWA 1L7AA 1PYDA 5ILGA 3BJIC 2FSFA 3OT1A 3NBQA 3WWEA 1T6NA 4O4LA 4B17A 4ZCRA 1YCFA 3TCXB 1BA3A 2RHBA 1DQSA 1IJBA 1M8PA 1OJ7A 4G5XA 3AIMA 1HFWA 4Z99A 2X7JA 1Y63A 2L82A 1RYFA 2BFPA 4FXPA 3TI9A 3G2OA 4YLGA 1CJCA 1H8ED 1UEIA 2GK6A 3F3SA 3EE6A 2GASA 4JCOA 4YJFA 4ZT7A 3TXYA 4ARIA 4BRUA 2P6MA 3GRPA 3PCTA 1SWWA 1C1HA 2E6UX 1AUQA 1ZC3A 4L1KA 2D0PB 5LL6P 1PK7A 5EQDA 2JFFA 3PXBA 4X91A 3X1WA 4A23A 2K7ZA 1NQUA 4PAGA 1A8PA 3IB3A 1JYFA 1DUIA 2ZYVX 1QTNA 3KTDA 4OHFA 4OHBA 5MFZA 4Z5XA 3TTYA 2YTZA 2H11A 1TEZA 4YQZA 1PTJC 1UR5A 3OX2A 1EFCA 1J20A 2Z5GA 3CUEF 1BW9A 4OGGA 4XUCA 3E4DA 1NP3A 2CUTA 2ZYGA 3SYRA 3UC9A 3V4PB 4ZI5A 5K0BA 1MH1A 1BJKA 1UDCA 4CU5A 6GPBA 3FPBA 4D9GA 1RABA 2H0QA 4YASA 2D54A 3UOWA 2F9FA 1RM5A 2H1VA 2WTMA 3FUXA 5JC1A 1AHNA 3TPFA 1I0ZA 3PQFA 4EMTA 3ZGZA 1CJKC 2AUMA 4X8LA 4IJ5A 3T1OA 2V9ZA 3IALA 4JS0A 3DBRB 3DL4A 1RRFA 3HNOA 3FNGA 1ISIA 2WAXA 5ALNA 4Y2HA 4HX2A 4ENTA 1OLXA 4MHSA 4PG7A 2QD1A 1ULUA 4HGZA 4Q93A 3GB9A 1J8FA 1PNQA 1Z28A 4XWTA 1OA1A 1UWVA 4RQAA 1F12A 2AKAB 2WSSD 3QU5A 3RRMA 1VBFA 3TOVA 5KCZA 3H8JA 3ASUA 1TRHA 1HR0B 4R2MA 2JZOA 3N1UA 1BN7A 1KPIA 1UKEA 2QSYA 1P62B 1OXTA 4NH0A 5KTRA 4NPAA 4PYOA 4F4FA 1WF3A 1XJWA 2QHXA 2MSKA 4UBKA 1NE2A 3LT1A 3ZU6A 4EHJA 1PD1A 3B5JA 3ZY4A 3EXIB 4LMPA 2H1CA 4JP3A 1CVLA 1KP3A 1YBAA 1WXXA 1H69A 2CD7A 3HJCA 4CKCB 1QB7A 1M8FA 5L3VA 1Q0PA 2HQ1A 2RHCA 1LDNA 3O1LA 1KH3A 2HF7A 2X4GA 1GNPA 4S1PA 5DVZA 2FWRA 2I2WA 1A97A 2CFIA 4EF6A 4IIUA 1XB2A 4B3JA 3HYCA 1ZM7A 4RF5A 1WD7A 4Q4AB 4QGFA 4CQLB 2JLZA 2Y2VA 5TGZA 3EDMA 4CKBA 1IN4A 3E22A 3OZSA 1F60A 5E4JA 1MC4A 1YQ9A 2ZI7A 3QEJA 4ARUA 1DKLA 4DQDA 1ORTA 7MDHA 1R1DA 2XCRB 1W35A 2FPOA 1DWPA 3R8XA 2B1RA 4PGFA 1Z6AA 4O3FA 5GOZA 3SS9X 3QFTA 3EMVA 2FEOA 2FFBA 4QOIA 4A91A 3O9MA 3GEDA 4WERA 1CUZA 3L2OB 1YBFA 2R751 3R3JA 1XYYA 5FUVA 2J8ZA 4HLUA 1ZAYA 3WGQA 3UT5B 1GXSA 4GZMA 1T15A 1UF9A 2C5HA 1YB4A 1AN9A 3D6FA 4JLDA 1U9CA 4GLBA 2AGVA 5FLEX 4C3ZA 4YI5A 4AKIA 4D6YA 3WGGA 4AS3A 3Q7QA 2QYHA 4YUXA 2QRKA 4C7MA 2O50A 5AI6A 4DMRA 2C5SA 3REGA 3HR4A 3KPJA 1VSUA 2CMFA 2C7VA 3QU9A 3QM1A 3DNMA 4N8DA 1YMUA 3MJSA 2QL9A 2GAIA 1TPYA 1NW3A 1T2CA 4K87A 1KARA 4D44A 3SFVA 1ORHA 4GPIB 2DLNA 1TJPB 1LY1A 2JLUA 1EX6A 4J1TA 4I55B 4QKQA 1J00A 4PCVA 2I22A 2IH2A 4R1MA 5CAEA 4MS4A 2G07A 5K2OA 3MG9A 3FTCA 3AB7A 1PD0A 2UZ3A 4HWKA 3PHBE 3U5ZB 1LXCA 1UKCA 3EB9A 5BV2P 1G18A 2YW2A 3UJAA 1KQFA 4Z4EA 3TG2A 3DOCA 1W87A 4TMVA 2J3LA 4IIDA 3KHTA 1XDWA 3EUWA 1GQOA 3PFKA 4BVEA 4EB8A 3ILHA 1XZHA 2DTDA 4EDHA 2CNKA 1T0HB 4Z4FA 4ZYUA 1M33A 3CCCA 5AJHA 3FKJA 2JH3A 2P4QA 3T15A 4BP8A 4ZICA 3AJ9A 4PCUA 4P3XA 4BV3A 4DG5A 3PLRA 5BRAA 2RAFA 4I99A 3ZLUA 4MDEA 3CH4B 1NF3A 4P86A 2EX4A 1I7LA 5JAHA 3VR3A 4DSZA 1TVMA 1A9SA 2WOOA 4DF3A 2M1ZA 3D59A 3IP3A 1O96A 3KWLA 1QDEA 3VOTA 1NVFA 4KI7A 1EB8A 1BD3A 2B9VA 5A02A 3Q6MA 4ZAFA 4BQSA 2O2YA 3IIIA 2J45A 2CNDA 2BBSA 2PCLA 2P9BA 2OVFA 1YNOA 4M1YA 4XM1A 4OX9Y 5SZJA 2B1JA 3GGSA 2H7XA 1PGNA 3QF4A 3OZUA 1PTJA 3I2FA 3VDMA 3A05A 3KV3O 1FSGA 4QHSA 2IEAA 2VLIA 2PNFA 3O2NA 1TMOA 5EMJA 4ESEA 4TN1A 1QNFA 1SCAA 4XVCA 1CUCA 4FNGA 3ZU4A 1ZD9A 1OX6A 5KYWB 2VBGA 2HSGA 2OV1A 5FWYB 1HZZC 3GYBA 1MIOA 5K3AA 4QTUB 2GJ9A 2Z9CA 1XMIA 1U5AA 5KNBH 1GSOA 1Y6QA 3O90A 3AT1A 3TPCA 3O47A 4F4DA 3IPXA 1ND5A 2XMCA 3TQHA 1K97A 1L7BA 1VMEA 3E18A 4MWCA 1XK7A 5DBHX 5GJVC 1W93A 2A6PA 2NZXA 1XT6A 2G1KA 1RLIA 3K0EA 2Z3WA 3HYRA 2EW8A 1XDGA 1YAJA 2X6TA 1JYEA 3WKCA 1K06A 1Y7TA 1ANKA 1OXVA 4MPPA 3WSTA 4X7RA 1NRWA 1YQXA 2IU0A 1T34A 2OB1A 4LWPA 2GEUA 3E4CA 5LYJF 4YUYA 1XLWA 3QW2A 1U8CB 1HX7A 1I7QB 2VAMA 2BM0A 3DJYA 1G3MA 1UWCA 3PFGA 3OZVA 1VKRA 2O0JA 1AKNA 3JQ8B 1AK2A 3CLUD 2W2NA 3OJLA 4Q34A 3I0MA 3AIKA 3T7EA 1NBWB 3DTYA 4M8LA 1PZHA 2VT2A 1M1YB 3NU1A 4RH0A 3NPAA 1G6OA 3BL8A 2V3VA 5LP1A 1E8DA 3D31A 3NCHA 2GK4A 3EWSA 2GN1A 2HDHA 1SXJE 3A9TA 3ESBA 2WKWA 1OVMA 4JIMA 3RRXA 1ML4A 3L05A 4L6CA 4JQZA 1WVMA 2Z30A 3IEKA 5KS2A 2VJYA 5LPNA 3AUJB 2F4VB 4TYNA 3HCWA 4FDVA 3UMYA 3Q4GA 2ZWVA 4Y1RB 1UOEA 2DHCA 3FWYA 3HJUA 2R5WA 1VECA 4RKEA 2XXJA 1BJRE 4KLAA 1ZS9A 4IQGA 1SQ5A 3HI4A 3KKQA 4LG1A 4BNDA 4O2LA 1II8A 2ZSHA 2RHTA 1E7SA 3MJDA 3G2LA 3CWZA 3NAMA 1Z0FA 1D2NA 1ULSA 4ZD6A 5AVRA 4N3CA 4ZXPA 2FGJA 1RLMA 1T5DX 4AAYA 2UZ4A 3ME5A 4MKXA 1J2EA 2EKLA 3NHPA 4J76A 5B55A 1S4MA 2OXFA 3C7CB 3R3UA 1EFRA 3OO1A 4TPKA 5E7IA 1C41A 3VR4A 3ZJYA 2XQJA 3E53A 3TJMA 4NBVA 4V0QA 4G09A 4DLXA 2X4LA 3NC4A 4H3HB 3RWOA 3BICA 3RS3A 2AQIA 5B1SA 2N47A 2QTMA 4W5RA 1KU6A 4GP7A 1FBNA 1IHYA 4OXYA 2G5CA 5TF4A 1T5SA 1W1UA 3ULKA 3N8DA 4UEKA 6ADHA 1Z34A 3FSGD 1ITZA 4BVJA 4X66B 4CKEB 1LUAA 1U3GA 4NLLA 4UM5A 4J03A 2AOUB 3KVOA 4LNHA 3SJBA 3H3XA 1MJGM 3PFFA 3OX4A 2CJFA 5EN4A 2C2XA 4MQFA 3ZWCA 3GDOA 2FUEA 1HL7A 3GL9A 2X7HA 3KEMA 4ZK2A 4KO4S 3H2IA 3MMNA 5EJ2A 4ACAA 4C89A 3ZY3A 1NSFA 1EWQA 1P4RA 2GA9A 2BP7B 4EENA 2E18A 3R3XA 1UT6A 2X2OA 4OL9A 1JIVA 4QYTA 3K92A 2B61A 5IVIA 1GLNA 1OFTA 3OFJA 4HB4A 3FE2A 4CT0A 4QFCA 1S1CA 2J5BA 2BZ1A 2J59A 2OZKA 3HY6A 3MA0A 4QNNA 5DX1A 3UGKA 3WB9A 4TS4A 4F38A 5JLJA 4RTRA 2PQ2A 4F3CA 4PHFA 4X93A 4DV0B 1M10A 4V0RA 3DTVA 4JKOA 4GL2A 1AO3A 4RELA 2Y99A 3OQOA 5JZOA 1QG2A 2CKMA 3W6ZA 3B7GA 4GT1A 3GZTB 3BF7A 3WGHA 1NNSA 4JMLA 2VPZA 3EXIA 2FZCA 1AKQA 5CVVA 1IEWA 4BQEA 4RVDA 3VTKA 4GDFA 3MWKA 1IZZA 4LCEA 1PZMA 5EIBD 4YT8A 5IK2D 4BAZA 2RI1A 4J9UE 2P5YA 1JI3A 1CUSA 1F5SA 4KX5A 4WJLA 4YCBA 3E7FA 4OIMA 2X77A 1OT3A 3GRRA 1GL9B 2OCAA 4TVBA 1PCXA 1JR3D 1YZGA 4W99A 3EUAA 2F1OA 2O14A 3O0TA 1EE1A 5CH8A 4YRJA 4CMEA 5B7NA 2OXEA 5ALWA 2VBFA 3ORQA 3EAFA 1JSZA 2E4VA 1MKYA 4UEWA 5LUAA 1H8HD 3HN2A 5U4XA 1OE0A 1QMGA 1M6NA 2XDAA 2XNJA 3GPCA 1U0OC 3PNYA 1EP2B 1X80B 3A3KA 3BGSA 4M88A 4MGIR 1H1DA 5FOWA 5AI0A 5BQ5A 4OYRA 3AVYA 4IF6A 1JMYA 2IGTA 4N54A 5AW9A 1JLSA 3L8DA 1PK9A 5IC6A 4CLOA 4G89A 5DXJA 3HZHA 5BWOA 1TMYA 1F06A 3FSJX 1XVAA 4QPJC 2OSBA 3ZY2A 4RZUA 5A6VA 1TTHA 3AR2A 3CB4A 1KI7A 3MGCA 2WA1A 5KQSA 4OKNA 3IKTA 1FS5A 3IEUA 4GBED 5JWOA 1N34B 3GWGA 4TLAA 3MMSA 4UHEA 2DECA 1JHXA 2OXIA 4D45A 3AEQB 1BQ4A 3PJDA 4JI6B 5IXYA 1O0CA 4GLOA 3KV1A 1OMOA 1ZCZA 1P8AA 4K05A 5D87A 4AP9A 5F2NA 4AJPA 2NNLD 4MS3A 1N1GA 4B3BA 3AG5A 3QYJA 5JNTA 3AFNA 2WJ4A 4LYAA 5TNXA 2V96A 2X3UA 3G13A 4JIGA 5ITSA 3L43A 3BHJA 1KGDA 1H4VB 2YWBA 3QBJA 3W9SA 3MXOA 5A06A 1R0RE 2GO7A 1Q0LA 2VYVA 2W6JA 4IIHA 5EUBA 3B8EA 3B13B 1ZU5A 5FPTA 1URPA 1VRWA 1V11B 2Q1SA 2WB4A 2NO6A 3URMA 3DFKA 1WVIA 2P6UA 1QKKA 5E8JA 4JGGA 4OJMX 3U48A 1NBAA 1NMSA 3I9JA 4JVOA 1THGA 2J0VA 2BDEA 3DD5A 4WNIA 4IYRA 3VZQA 1ESZA 5CW2A 4CCYB 3W06A 3DYBA 1YZNA 4HBGA 3DDCA 5AM3A 1OWLA 1TLFA 2I1LA 2V3WA 1ETHA 2Y1EA 2BFWA 4MI6A 1NURA 1YNSA 4PSKA 3LZ6A 2P65A 1K4YA 4A6EA 1Q3HA 2Q8QA 3FR7A 5CJPA 3HNPA 1YO6A 4KBFA 3PT5A 1L8OA 1ECFA 2F3PA 5FORA 1N2EA 3U3MA 1UMCA 2WU0A 3EF1A 3H7IA 5FWXA 4G0MA 1D7OA 1SHUX 1F7VA 3J80A 4G0UA 2REQA 5EZYB 2J87A 1ZVKA 3QE2A 4QPZA 4F2PA 5I6DA 2IP4A 3QUQA 4P32A 2GTHA 2AX4A 5J5CA 3SZUA 2XMQA 3E6AA 3S29A 4RTKA 2UXCB 4I9NA 4EHLA 3WNVA 1H8HA 2CHGA 4CM1A 5LDDC 3ZQJA 1T4MA 2LW7A 3BKXA 1HLDA 1W76A 4LNUA 5ALTA 3S1AA 3QA3E 2F8SA 1XVLA 4P2GA 3LPDA 3ZX5A 1R0LA 2Q9UA 2G71A 3MQFA 4R5HA 4ZQCB 3DUFA 1TW2A 3IODA 4PXSA 4X20B 1TTPB 2WF7A 3DE1X 3U3RA 1PR4A 2PMBA 3PTLA 1R0KA 2G9NA 2J9GA 4IM7A 1TOAA 2DFVA 3EXG1 1JAHA 2YIMA 1WV1A 3RUPA 5BR4A 5HJ5A 3CUYA 3NT4A 4IEEA 3S2UA 3HFSA 1RC1A 4G0QA 5CDFE 2NMVA 4QU8A 5A2GA 1OBHA 2NTYC 5KWIA 4PFJA 4B0OA 4ZCTA 2LR0A 3FIUA 1VLVA 3BWDD 4XE5A 4QDJA 1OXKB 1TLTA 4RZIA 4S2EA 4AZ0A 4CF4A 1B00A 2GEBA 1XQYA 4KMOA 3MCTA 4NKRA 3V2UA 5EJ5A 1N57A 3QEAZ 5FJJA 3GP3A 4ALJA 3U80A 2XADA 3QE3A 1N2XA 2X4IA 2W37A 5SY6A 2OILA 3OURA 2GYWA 1YDHA 4LYYA 4D4GA 1PR2A 1R7RA 5IXJA 4FPXA 2WKRA 2PUEA 1H93A 3UFBA 1P2TA 3I2HA 2P6RA 3I28A 2OGUA 3EOBI 2C92A 3BCSA 5A3RA 2CJWA 2DXIA 4R8LA 3C14C 3W2GA 1AUVA 1ZK0A 4JJ8A 2G3YA 3A1CA 3WYCA 3UHFA 3WJ1A 4DFDA 5EFOA 4G9GA 1FP4B 1UFKA 1UBNA 1ZHHA 4EZIA 3EPKA 5M3BA 2UAGA 5IU6A 1XWFA 2E2WA 3DEAA 4BQQA 4KREA 2WE7A 2I1QA 3LO5A 4PQGA 2GF9A 2AMVA 3W3AD 5I8PA 5FADA 2AW5A 4EKIA 4AFNA 2FR1A 1XZPA 1HORA 5J5AA 1QZUA 1X8XA 1ECLA 3S1SA 1MAUA 1OGIA 1Z7WA 3LLVA 3ECAA 3DDWA 4HH0A 3T0IA 1XNRB 1AB6A 3ZU2A 5FTMA 5ALRA 5TEWA 3QMMA 3U44A 1RQLA 3T4EA 4ER0A 5A6SB 5KIAA 4BEJA 1Z82A 4II7A 1ZBDA 5JOQA 3BWEA 3DQQA 4UHCA 2I87A 1LV8A 4Y1GA 2JARA 4IMIB 1IE3A 5IAEA 4EG6A 5FL3A 3K0AB 2O2ZA 2X19A 1JSRA 4FSXA 1B8VA 3CZ9A 3PU6A 2AR9A 2Z1MA 4ZANA 3U1BA 1FDSA 1NTOA 3PUHA 1KETA 2VR1A 3EW9A 5HK9A 3GFOA 3TQRA 3EUEA 4ZVNA 2A0UA 4FYPA 2BHNA 3PUWA 1TIBA 2EBWA 3L8GA 3VSBA 4RA6B 4HJXA 3DM9B 1K7YA 2EX1A 1B2RA 2WYWA 3IP9A 3TOZA 3LQ1A 2DBVO 1GPBA 2FRXA 4AG6A 1R0WA 4IR7A 3LUKA 2AV6A 4H31A 1X2BA 3R0JA 1ZIDA 2FMUA 1ULTA 3NX4A 3WYGA 1V6AA 2K5UA 5HKKA 5JASA 4OQLA 1YU6A 2I4NA 2ZJYA 3F5MA 1IN8A 4ZA2A 2DG2A 3MZ0A 3LUFA 4DBLE 5JCOA 3KYBA 5BMVA 1GKLA 2R6JA 3AX6A 3KAQA 3MYRA 1IZ8A 4IRUB 3V4FA 4PZLA 3KJXA 1KDTA 5B2FA 2IHUA 1ECCA 1WHSB 2J3KA 2VLBA 4RD0A 3OKPA 4HG2A 3OLZA 1JR6A 3MGKA 2X42A 4N5LA 3QLVA 2EHJA 1ZJ5A 3F96A 3RVMA 4JVMA 2JAXA 3ETGA 3M8KA 2CCJA 5CLHA 1NW5A 2YS6A 5CMLA 2Z2IA 3M4ZA 4ZQFA 5C34B 1O0SA 2DPYA 1TK9A 2C96A 1C80A 1QH8A 3DOEA 1UXKA 1CJMA 3NRBA 4O4IB 2LCQA 3SXUB 1A2KC 2ZIEA 1LPAB 2ATXA 2FQWA 3L41A 2VQFB 2V59A 2WEKA 3D7RA 5CLFA 1H4QA 1O8BA 2O2EA 3R0VA 4P4LA 3ER8A 5H1YA 3NUGA 1BYIA 4KNYA 1WAMA 2WNSA 2ZT7A 1K8XB 4YJGB 2R85A 3JYLA 3T4PA 5JAMA 3ENZA 2EGHA 1U81A 3U0VA 3QX9A 4KHZA 5CCXA 1SVKA 3T9CA 1XRLA 2JHAA 4G3XA 1AF7A 4J94A 4N4AA 3KVNA 4QSMA 3VYWA 2AJLI 4D41A 3GCWA 1T9DA 1G21A 1F2TB 3QGMA 4UEJA 2JLVA 4DSOA 1NOIA 1CDDA 1LI5A 3GFTA 3IDZA 3FPEA 2PQ0A 3PUKA 2Q1TA 3CEMA 1Y5MA 1TGVA 2OLEA 3TQCA 4F5EA 5IKXA 3OOJA 4RAQA 3GEHA 2Q5FA 3H8VA 2DJIA 2WMOB 2EZ4A 4OQYA 1J9EA 1NZFA 3F9RA 5CDUA 1BVHA 1MEJA 2ZE8A 3OE4A 1DFHA 1E3LA 1QPBA 1Y4DE 3QKUA 5CB4A 1QRUA 2JIRA 4DJAA 2AMLA 4EVIA 4QM6A 5CB6A 3FOBA 4EEZA 1Z0AA 3PNBA 3TVYA 3GNQA 1G8YA 2J0SA 3AIIA 3SSNA 4Q9IA 5AI5A 3T1TA 2WT9A 1PU2A 1U8XX 5FD8A 1XTVA 2IYAA 2W42A 2PPVA 4DWVA 3CWCA 2W9XA 4CR8A 3BRWD 4LMAA 4KLRA 3FCYA 5IJZA 2B25A 2OL4A 3HR8A 4OHWA 3LVBA 5CXXA 1B8NA 1OXMA 2ATCA 5IMBA 3WRXC 2ZFUA 1C9JA 3I2IA 2GHIA 4R1TA 1BWPA 4CI9A 3UG6A 1E1DA 1U28C 5EWJA 5GOTA 1DKOA 1P0CA 4C29A 4AP6A 4KI0A 3TIIA 1LI7A 2ZJ6A 2ZW9A 4A10A 3ZVNA 4J7AA 1ULHA 3BYZA 3JQ6A 1DO2A 1G0NA 4P81A 4POAA 4KEAA 3ZXUB 4C4ZA 3B9PA 5C1OA 4MEBA 4G1BA 2O8EA 3RVPA 2PR7A 1W4LA 1PK8A 3N5CA 3BORA 1TUEA 5LYJB 4UD6A 2BFCA 2C77A 3QVGB 2B8EA 2Z08A 5CIWA 4MUNA 4HGNA 1D1TA 1NUUA 2ZTHA 3FN4A 5EJAA 2HRBA 5KWEA 4FHDA 3TQQA 4ZC8A 4D3FA 6CHYA 3VZPA 1QRTA 1DBQA 1LDGA 1Q92A 3AVWA 2W90A 3B51X 5IX8A 1MX5A 2REOA 5JMWA 1H3EA 1KAOA 4NYMQ 1GCUA 3L46A 4IS3A 4IH9A 4DDUA 3RSQA 3JX9A 5C32A 3L18A 4MROA 2JHFA 4P7KA 3PE4A 5CA1B 3OPYB 2VFAA 2VWQA 4X1IB 3CKYA 3VJKA 5F77A 2AD5A 1K8YB 1U3DA 1CX9B 3RYIB 4EG3A 4L0MA 1YS9A 3CMCO 4OXNA 2VNJA 2OPHA 4BO3A 3HRKA 4QREA 3A4VA 3VR6A 4PANA 3KQKA 2WD8A 4LE1A 4GHWA 3A7DA 2AG6A 2MDTA 2WJIA 1V11A 3F0TA 3C16C 3MAJA 4OEHA 1UKAA 2QY9A 2PY6A 3C3JA 4KP7A 2E85A 4QUKA 5EY5B 4U7GA 1UBLS 3DE4X 3L6UA 3VU3A 1VQ1A 1XO1A 3I4LA 3OI7A 4B75A 4DTCA 1YR9A 4RPHA 2ADMA 1KYWA 5F1PA 2DUNA 2VP3A 1JDVA 2JJYA 2CLCX 3QEKA 5DNUA 4IIXA 2VIIA 3WWPA 2JGFA 4QU0A 3OJFA 4YROA 5EGNA 2EZ8A 2AUTA 2NO1A 3JQAD 2LGJA 3KJNA 4U8HA 2IWHA 3WICA 4A2CA 4CEHB 2JGDB 2H9AA 3HU1A 4TRJA 5DT9A 4YHBA 2ZRBA 1QF7A 3DDSA 3KLBA 1G5FA 1OC4A 4YCDA 3QEMB 3JD4A 2OQRA 3NHMA 1E1KA 4LOHA 4CYMA 4XARA 2DB3A 5JSHA 1BXRA 2ID8A 3LQKA 4DYDA 4E7PA 3PHCA 5AKGA 3P52A 5JQGA 5EZYA 1T6ZA 4M1MA 4M0DA 3OAAA 3F8WA 3WBJA 3EZLA 5CVEA 2PVCA 3HB1A 5AFSA 3RJ9A 1E62A 1EA7A 4S05A 4XX0B 1TQ8A 3HM2A 3MTBA 3UOAB 1I2DA 3AKEA 3FKSD 4XLLA 4CN9A 5A4AA 3S5UA 1EXDA 1EZ4A 3V48A 3WYFA 4PG5A 2NUBA 3MTAA 4V0MA 2AFVA 3RWBA 5JDIA 3AEZA 1RI4A 1LFDB 5ALVA 3HCBA 4X1OA 4J0QA 3RRJA 4E70A 1DV1A 1M2WA 4U5QA 2V7BA 2R7NA 1BE1A 1DEHA 1QRDA 3GGDA 5BSHA 2OV3A 4I1OA 2QP3A 3CLVA 3MMXA 4LJ9A 5E2BA 4B7ZA 3U7FB 1XF9A 4V0NA 3VO8A 1I3KA 1J0DA 1N7IA 4M0UA 1DVRA 1Z2OX 4EECA 3AUUA 4K2AA 3GUUA 3IX7A 1M1YE 4P5EA 3OQMA 3AHFA 1AURA 2QT1A 5CT4A 3CRVA 4BLPA 2BGMA 2XNSA 2OZLA 4HYQA 4GZLA 5KHAA 1ZH2A 1SVUA 4BX8A 3ZEAA 4NWIA 3EHEA 4OI1A 4UM8B 1HMPA 4YAFA 2A9JA 4E4YA 4IAOA 1KVSA 1WO8A 2CF5A 4NS1A 2W2TA 3ESXA 1RBQA 4FN5A 1V96A 3OIWA 4MJXA 1ZGZA 2DC1A 4K9QA 1FXWF 5LP6A 4WXYB 1YZKA 3HU3A 1YQGA 1YQEA 2SECE 3DT8A 4G8BA 4CQMA 1P1BA 1ZKDA 2OBNA 2R8BA 5CFZA 1S8AA 1MB4A 2ORIA 4NMHA 2G5TA 4BTVA 3V9AA 4EPYA 3HKCB 2GZRA 4EG8A 3T5DA 2SBTA 4YPFA 3IOMA 3K1AA 4C87A 4FX5A 2ZZNA 3PWSA 3FMPB 3KAJA 4GUDA 4C2BA 1NKVA 3RBXA 1MORA 5EJ4A 1E0AA 3ROEA 4KQ1A 4E32A 5AJUA 2AQKA 1Z29A 1EGVB 1CCWA 3NC1C 1NFFA 5IZCC 1E94E 2IOFA 1U3VA 3CW9A 3NV9A 4DLVA 1K8QA 2I3AA 2PWYA 3UNXA 4ZP1A 5TQJA 4GE3A 1CHDA 4EI9A 3ESQA 2M6SA 3IKMB 5CT5A 3KSMA 3H2KA 3I64A 2X9LA 3JCZA 4IDOA 3BJMA 2W6OA 2FQ1A 4FZJA 1APBA 2ZUBA 3SNHA 2JD0A 3ZD9A 2WF6A 3HKBA 2VJPA 4Q9NA 1VSVA 3B6KA 4MRNA 2VDJA 4WFQA 4YRIA 1JEAA 3AQIA 3L5KA 5IH7A 4A8JB 4P0PB 1C30B 4KFTA 1BS1A 1HQCA 1AF4A 1SXJB 3EIWA 2R8PA 4MUYA 4PINA 4LC9A 3VHXA 4PTLA 4UBJA 1ACJA 2MWMA 3T7DA 1FSPA 4DR4B 2NAFA 4KIUA 3UQYS 1JZTA 5CBPB 3P32A 1KKUA 1UPFA 3JASA 5LOVB 1WHSA 4HWGA 3KB6A 3X2FA 3AVVA 1TECE 3THSA 4QNRA 4A8JC 5F1YA 3CG0A 4IDEA 2BTOA 4REMA 1M5TA 1Y1TA 4G1EB 1EK5A 4LJ6A 1AKWA 1ABEA 3SX4A 2OO5A 1I3NA 5CDHA 3ABRB 1C3OB 2PRSA 4BVFA 4D4JA 4QUGA 3SKVA 1Z63A 2WD9A 2CXOA 3EG5A 3COYA 3ZXXA 3NVMB 1F4LA 2WVHA 3KYCA 1UM8A 5F7OA 2IOQA 1CXZA 1FQOA 1AGPA 1G21E 3LC2O 3OD1A 1CQIA 1E6EA 4OD0A 2AI2A 3WLJA 1JQLB 1MC1A 1M34B 3OCVA 3EVEA 1V5GA 4Q4DA 4BTEA 1GN8A 1KNXA 1T0IA 3NNSA 4HQNA 4R40A 1KI3A 1SVOA 4ZMRA 4OMCA 3UT0A 5IYZB 2YHBA 2IX3A 2OYCA 1EG7A 3M3DA 1RPAA 2V6GA 4C5AA 1NU8A 4D6XA 1GGJA 1OX4B 3BM5A 3LP8A 1F2TA 3IUBA 4J4BA 5BYKA 1BH2A 4DLYA 3KOZA 4KRYA 1NVVQ 1P74A 5D3MA 4DR2B 3VDRA 4OQZA 1I2MA 2VQDA 3THWB 1XWWA 1JBEA 2NT4A 3NZEA 1HM5A 4M46A 5IRCD 4MJ3A 3SF8A 1U8EA 2PKWA 2ZSEA 5ECWA 1ZM4A 4GLJA 5LA6B 1GOTA 4E1BA 2JLSA 4Q7EA 1F8UA 3P2JA 3NI2A 2Q0HA 4RD3A 3QVXA 1QH1B 3EXAA 3A6PC 4FEEA 4ZDJA 3N8IA 4F1KA 5B4VA 1RFGE 4QPCA 5E6RB 2AEJA 4TTRA 4H7DA 3TM5A 1E96A 3D1LA 2JLBA 1KOFA 5D7NA 4CM9D 3PR2B 1L7NA 1RHUA 2ZT6A 4IX9A 4JLMA 1R8JA 3HN7A 3OZRA 3DKVA 4MEJA 2OGTA 3GLFB 3QKSB 3RF7A 7REQA 5L3QA 3OZEA 3TE7A 3FH0A 4PIVA 5CYGA 2XCOA 2ZZKA 3L04A 3VR6H 1TF7A 2XD9A 2PZBA 3MTJA 1I3OA 4GU5A 4X54A 4ZVLA 3AETB 4DCGA 1RADA 3IHWA 4DIDA 2G1UA 1W8DA 1UXJA 1WR8A 1CB0A 2QJWA 3HJTA 3OEWA 4JUCA 4KSYA 3F7MA 3RFVA 4BEWA 5B4UA 2HBQA 2W2VA 3U49A 2PIDA 3ZE6A 3GEEA 4PYRA 5BVHA 1T4DA 1ORIA 2WFLB 2WV9A 2A4MA 3F49S 1KEEB 1PDOA 3LUDA 3VDXA 1KK3A 1ZN9A 3Q0TA 4EUKA 3U6BA 3IOYA 2FHPA 2G06A 4RWZA 3WS7A 4B9EA 3QG1A 1VKNA 1F0NA 1JU9A 2YZGA 3QV2A 1J24A 2V6FA 3OHPA 1SULA 5AOVA 1PJRA 4PRYA 5AVKA 5LSAA 2INGX 2X0KA 2HZBA 1QVZA 3O91A 4IFTA 4EKDA 3KD3A 1Z17A 2O4UX 3N86A 3E1GA 5TQVA 2R1VB 3Q6NA 3VSEA 5H8WA 5P8WA 3CXRA 4C43A 621PA 1A0OA 3S5JA 5EJMA 1O9GA 1YB2A 4YRBA 5ADHA 3AVXA 3ZDFA 2JI9A 4IWNA 4EABA 3ENNA 2NO5A 4WK6A 2EP8A 2XNDA 3LRXA 3QE9Y 3RG2A 1XG5A 3KDPA 4IDHA 2QP9X 5LZ4A 5JY6A 1JG1A 2OG1A 2OBLA 3LRTA 3MJ4A 2QN2A 4Q7KA 5JD5A 5A0TA 1JKJB 4LV5B 3UK2A 2IS4A 3EW7A 3IP8A 5M04A 2GX6A 1NUSA 5KOHB 3L77A 4LOKA 1V4NA 2C59A 1I1QB 3A0RB 4X1IA 4IL5A 1E1YA 4X1KA 5TPWB 5K3EA 4DSTA 3Q8KA 5CRIA 5FTNA 3CWQA 3WKAA 4JHXA 3LLSA 1OWPA 3GBSA 3PQ3A 4LMRA 3ZWOA 1S3IA 4EO7A 2I99A 3PEFA 3UANA 4JQSA 5B4TA 4CQLA 2OXCA 2UZ1A 4V1CI 4OI0A 1U0LA 2A0YA 1LBEA 3CINA 3CR7A 3GFGA 1XXLA 3R8FA 1AGNA 2E55A 1SPBS 2OK7A 3KCQA 1C2YA 3PUVA 1CR6A 2HTFA 2A78A 4PC7A 1LRLA 2I2DA 3HO1A 1WXGA 1ZWLA 4L3WA 1EUDB 1VCNA 5JDIC 1MD9A 2H16A 4BMXA 3MD9A 1U0GA 4PSCA 1HSOA 1Y8QB 3TM4A 2HPZA 4PN3A 1KK1A 4R3WA 4WBNA 5FBVB 2O8BA 3L6CA 4WZAE 2X1MA 3MK31 2J08A 1GRQA 2QM0A 1BN6A 2UZIR 3C41J 3EVBA 3EYAA 2QIPA 3PUJA 5J4LA 3E1SA 2CBGA 1ZO8A 2Z5LA 1KZ6A 1LLDA 2ZU6A 3SE7A 3IHKA 2GM5A 4DMCA 1PLLA 4XQEA 1FZTA 2ZSDA 1GZSA 1H6AA 4MW7A 3BS4A 4QBHA 2VSQA 5EHZA 5I7HA 2CDRA 4PNZA 5KDDA 3S27A 1NKTA 5AVOA 1BWSA 1KO4A 4IKOA 1KP9A 1KIMA 4YJ2A 5TVGA 3DR5A 1NVEA 1KOGA 2CLMB 4CRWB 4B43A 2ORVA 3IPYA 4YJ2F 2B5VA 5J2UA 1SFRA 4ZO7A 4I55A 4OI2A 4BKRA 2BW0A 1PFKA 4OO3A 5HZHA 4GGMX 1A9XA 3A3OA 1QQ6A 3PL1A 3D3EA 2C42A 4U2GA 4WACA 3NHRA 4EYEA 1QS0B 4M99A 3BZUA 2WE8A 3KK0A 5DN9A 5JARA 4LF6B 2VYND 4KPFC 4GGOA 4I66A 4DT1B 5L53A 1N6HA 2RHRA 1XAGA 1Z75A 5IVDA 1TJYA 5E9WA 3A2NA 4CLHA 5KSPA 4IIVA 4NTZA 3DQPA 1TAHA 1PYGA 1ZNYA 2DMRA 3WIEA 2VPWA 2DQ4A 2HLDA 3CH5A 4ROSA 4XVHA 2CNLA 2YV3A 1RAHA 1TF2A 4UKDA 5HUJA 3U4MA 1TAUA 4EKNB 5LP6B 5DLYA 2Q3EA 5KNDH 4GUAA 1E3WA 4I2NA 4D79A 3LUGA 4GM0A 5A7GA 1KSGA 3UCFA 1Y7LA 5KREA 2BZGA 4X6UA 3KSUA 2JH9A 2FDXA 1KOLA 3WIDA 4G1MB 1S3SA 1U3CA 3GG2A 3PEUA 4IHJF 5LKRA 1ZYUA 2B37A 3PQ4A 1SIBE 2A9OA 3C1TA 4DBZA 1C8KA 1CP3A 3JVIA 3U3JA 2ZBQA 5BSGA 1MV8A 3V32A 2PZMA 1DKMA 2PBZA 5BN5B 4ARBA 4YRZA 3SKXA 1NDHA 1G8PA 3HHPA 4X8OA 2QG9A 1M76A 4JT4A 3EEQA 2ACVA 4RENA 2QGZA 1AUXA 3KXDA 5F1KA 1GTL1 5CURA 4GD3Q 5GZ3A 4JUFA 3W8RA 5AQ1A 5BW5A 1CTQA 2P9EA 3OTWA 4JITA 3UWOA 3IIKA 2RJOA 4HNTA 3AIOA 3BMOB 3DV0B 4GQAA 4BMNA 3FVVA 4F6RA 4ZI7A 5INTA 4JBLA 1KJ9A 4QLOA 2Q5IA 4S1VA 2PN1A 2XTJA 1VIVA 3RVKA 1O87A 4DXDA 5IH3A 1JPUA 4C07A 4UTZA 3I83A 5KU7A 2AR0A 3B9RA 1TQ4A 5EUMA 4BNUA 5AJTA 1PJ3A 2QV0A 2ZSJA 3W6PA 4R0NA 5AWFC 3VX3A 1YGPA 2OZLB 4TL9A 4H7HA 1M75A 2BR5A 4QAJA 5EERA 4S35A 4R71A 2YJ4A 4EYSA 2M98A 4WE3A 4DNQA 4PGGA 3P71T 1XJQA 9LDBA 5IXSA 2ODBA 1DGQA 1PBNA 1AKEA 3PGA1 5H9VA 4PYMA 4FFWA 3QE0A 4DA7A 1PJLA 4I55F 2QTRA 3PDJA 4AJIA 1CEEA 1L6IA 1RCTE 4NPCA 1BXGA 1WZIA 4WV3A 4UM9B 1FJGB 1RPJA 1NULA 4ZAZA 5IFKA 4XUDA 3BTSA 3FCSB 3TLYA 2PX0A 2O23A 2VJDA 4F92B 5ADWA 4MB0A 2JCBA 3OMLA 4TKLA 3F5SA 4GR9A 4IQ0A 4V24A 3T4XA 2VF7A 4B7CA 1KYQA 1WKCA 2O2GA 3FPSA 5ARCA 5B7PA 1GFIA 1NY5A 1WHTB 3D6TB 3JASB 4FKBA 3A26A 4U9IS 3WLAA 2PMCA 1NU6A 1A7UA 1E0DA 3WLNA 1G8GA 3KT0A 3LTEA 4JSTA 4MVJA 1CQJA 5AHRA 4M1SA 1AOXA 1FU8A 3B9BA 1XD8A 3WJ7A 3OIGA 3CEAA 1RM3A 4QG3A 4A27A 1CLUA 2OCGA 2JGLA 4ZALA 1V3VA 1XTKA 1VKZA 2Y6UA 3LG2A 3DUWA 4FONA 3WBKA 2ZB4A 4RZSA 1W2GA 2HDOA 3BXEA 3FPKA 1QP7A 1TRKA 3OX1A 1OX4A 1XZ8A 1JG2A 2ILTA 3AF5A 4JOCA 5D1NA 1P5HA 2X0EA 1BDIA 3A6LA 3ZV3A 3N2GA 2OR3A 1J33A 2R8EA 3PXEA 4P92A 2FRDC 3RSSA 4DMFA 2IIVA 4JYZA 3H6KA 1F38A 1LJUA 1GUYA 2X1VA 4AF8A 3B5IA 1TM1E 1E7MA 3I6YA 1TQ6A 1BSVA 2IYEA 2ZRFA 3PC2A 1OYWA 2VPQA 3O92A 4H1UA 3RIEA 4H35A 2FEMA 1TK2A 4AUKA 5L3SA 4P7GA 4N7JA 1T6XA 5DM2A 1DXQA 1LNQA 5IM4F 2YOGA 3O8NA 1OAOA 1X86B 1WSAA 4E4TA 3NHFA 2GPSA 1VP3A 3H9QA 3WLHA 1C8LA 2QQ5A 1WDWB 1RYDA 1RQGA 1SB9A 3K8ZA 3U31A 1QHNA 1F2DA 1U31A 3TTWA 3ZWMA 4BATA 1XZBA 3G7UA 1O6CA 2ZWAA 3D9QX 3FMOB 3RJZA 4EX7A 1U90A 3Q3IA 1N0VC 3U56A 1XTBA 3C5WP 2I78A 3SQDA 1WPRA 1P2GA 3A58B 3UMRA 4R1SA 4HB3A 2ZI4A 3LOUA 2D1QA 3PFIA 3FFXA 4MPRA 4I1SA 2A86A 4TMYA 4C7VA 4JBNA 2D2VA 4L0QA 1O6GA 4JSYA 2QV7A 5B6PA 3ZHQA 1M2VB 3D2AA 5CPFA 2J0QA 3JTMA 2VZEA 3S7TA 4CJXA 4ARSA 1VDMA 4G5YA 5AVJA 3RK0A 1P1CA 3LBFA 4FNAA 3R7NA 5KVAA 1Q19A 1RCUA 4L22A 4QUJA 4ZMSA 4LZZA 1JDBC 1JBKA 1ZD4A 3NHZA 2DUMA 1DKPA 3MTIA 3ROZA 5ENZA 1L5HA 4BAGA 4FIZA 3NAZA 4M22A 5U9CA 4U7PB 1XQVA 1YI1A 2J30A 3RAEC 4GPEA 5D5QA 1KDRA 1FP6A 2NU9B 4BKUA 2CXSA 1TZBA 4XJXA 4KFRA 1MMFB 4NBWA 3PC8C 2QIOA 4C30A 4PLPA 2FPWA 1LSOA 2XDQA 1IN6A 1QHHB 3R4CA 3L3BA 5A9RA 4MKGA 4G4IA 4P83A 3L1KA 2X8WA 2EW2A 2FW6A 3FFTA 4DIKA 4E2XA 2ZLBA 3CFYA 3BE8A 4TS1A 1CY4A 3KXKA 4HVTA 3MCWA 5EZ6B 4N5HX 5CXUA 1UEJA 2HU2A 4YJ3A 5MN4A 3VA7A 2R1VA 1ZCAA 3K2IA 1W85A 3NHLA 4NQZA 2D8MA 4MSUA 5DW0A 1XRMA 1XELA 1L7OA 3SHOA 3L8YA 5EZQA 3HL0A 1SEPA 2C0PA 2HRRA 5DGHA 5FBZA 4DBLC 4ZJYA 4Q1CA 3OESA 3R0IA 2UXDB 5BWNA 1J21A 3V42A 4KV9A 4ISBA 3HVKA 4IUBS 3UV7A 2D1TA 4JGIA 2GPJA 3VQTA 1NXVA 2HJWA 4CR7A 1PLJA 1KEPA 1LDMA 4W7SA 3E5MA 1MJHA 4W63A 5FOSA 3L0SA 5AI4A 1MCZA 2FCAA 3P45A 1MA3A 4GP9A 1AGYA 4L2IA 4N03A 4YRFA 4EHFA 3R41A 5KNCH 1T2EA 1ZLXA 4L51A 3IBSA 5HJ7A 1G20A 1U8TA 4K5QA 1VJCA 2FEPA 5DB4A 4ZV7A 4YB8A 3AB8A 1LQUA 3JQGB 2QK4A 1ONOA 3EARA 2IXFA 1OY1A 1V1RA 5DULA 3IUMA 1TUGA 5TMDA 2MT9A 3CX4A 1FZQA 2P4UA 3VOBA 1DB3A 2HXSA 3N87A 4UCFA 4P38A 5LQDA 2CHEA 3FYCA 4Q03A 4R6WA 4RD1A 5CA0B 1H2EA 2DULA 3GJRA 2WG1A 5CXSA 4PYJA 2WM8A 3NHBA 5BQ3A 5BV0A 3DKPA 2VRBA 5DH9A 2ONCA 5H82A 5IJXA 3ICOA 2JCXA 2JAWA 1F0PA 4WKGA 1PX0A 5EC8A 3V4OA 1UDAA 3U16A 4LZWA 2A7QA 4QOEA 1XQXA 3WZ2A 3TGLA 4F6CA 5C5IA 1A7JA 3ESDA 5AVYA 1XNQB 4B3RB 3OE1A 3FHOA 4NFYA 3VKHA 3ETCA 5FR1A 1PBTA 5MDHA 1Z0JA 4MRVA 4PYQA 5FBHA 3SSAA 2PKXA 1P5ZB 4B45A 4YJ2B 5F73A 2VF8A 2A1IA 1KKLA 1NM5A 4TM8A 3ZDZB 1SOWA 1N3YA 4ENSA 3OQIA 1KAQA 4KQMA 2VP2A 3USES 1EJ0A 1Q21A 4PZ0A 4QU5A 2RCNA 1Y7PA 4WFKA 4XSGA 3VNBA 1J07A 3UYKA 5THKA 2FZVA 2O0KA 2CLIB 3KYDB 3FGZA 2C2OA 2P91A 4QIHA 2W2MA 5J2UB 1LKZA 4DT1A 2WIJA 4U9HS 1D8TA 4KPUB 4E21A 3S2ZA 5T67A 1KXZA 4CI0B 5A3JA 4MR9B 1E9CA 4AO7A 4FCTA 3G9ZA 4IHAA 4M87A 4XDZA 5JSZA 5DIZA 2D1FA 1E1NA 2C8LA 3K2BA 521PA 3BD9A 4AMBA 1N8KA 1CIPA 1E1QD 1B0AA 4GKVA 1WM1A 4QUBA 2Q2OA 3F7NA 4MR8B 3QXJA 1AN0A 2R62A 3AKDA 4RFLA 3V1NA 4BNJA 1H0SA 5IBRA 2GSDA 2MINB 3I05A 3RHTA 1DBVO 1F8FA 2ZGVA 3FNRA 1QE0A 4KN6A 3EH2A 3B2NA 4MGEA 1DZIA 1BKSB 1I4WA 3HDVA 3SZOA 3LT5A 5B12A 1Q5PA 3DKIA 2JK0A 5IK2A 3LGAA 2XB6A 4AJHA 4II3A 3B3QA 3O3CA 4RGQA 4XFJA 4CT4B 2FMXA 5KYUB 3QX3A 1XHLA 4J0HA 1PWYE 5HMMA 1FFEA 4ZOCA 1K8RA 3MWDA 1YQDA 4LV8B 1HPLA 221PA 1YRAA 4YLYA 3EZXA 3BWVA 4H77A 4DHEA 2W8ZA 2XSZD 4J49A 4X64B 3ILXA 4CL8A 4ZVSA 2H63A 3DMGA 4G5QA 3QW4B 1FE8A 4TLMB 3WADA 2BMAA 4D7AA 1N78A 2ZYTX 4QPNA 3O21A 1JBQA 4J29A 5CNKA 4TV8F 4M8IA 1YKGA 3O38A 3ZPXA 2ZS7A 4UUMA 3L8HA 4NULA 5DYNA 4I1IA 1HETA 2PRYA 3EDCA 1ECJA 3AZOA 3PXGA 3PLAE 1JEEA 3ZK8A 1US8B 5KINB 2UYYA 1IZ0A 4DXHA 1GWNA 4RFSA 1ODSA 4FBGA 4E2YA 4D43A 4N18A 1R5OA 1ZXLA 4F5DA 1NASA 1Z5ZA 3IYLW 3E70C 5KKCA 3EEOA 1SUCA 5KHLB 1FX0A 3IQEA 4TUYB 4Y1FA 4X1YB 1ZA1A 4P93A 4TXLA 5KYKA 3WG9A 1UBCA 1WUYA 1EP3B 5HOQA 2OQ2A 4EHKA 3X0DA 4Y3UA 1Z5OA 4XDYA 3IJPA 1OBVA 2XB2A 4IDAA 3GIWA 1IYZA 4IDNA 4PX9A 2GAAA 5H68A 2R48A 1GG5A 2R6CA 1ZMOA 4OKSA