2A9FA

Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
386
structure length
383
Chain Sequence
LKNQLGQLALEQAKTFGGKLEVQPKVDIKTKHDLSIAYTPGVASVSSAIAKDKTLAYDLTTKKNTVAVISDGTAVLGLGDIGPEAAMPVMEGKAALFKAFAGVDAIPIVLDTKDTEEIISIVKALAPTFGGINLEDISAPRCFEIEQRLIKECHIPVFHDDQHGTAIVVLAAIFNSLKLLKKSLDEVSIVVNGGGSAGLSITRKLLAAGATKVTVVDKFGIINEQEAAQLAPDIAKVTNREFKSGTLEDALEGADIFIGVSAPGVLKAEWISKMAARPVIFAMANPIPEIYPDEALEAGAYIVGTGRSDFPNQINNVLAFPGIFRGALDARAKTITVEMQIAAAKGIASLVPDDALSTTNIIPDAFKEGVAEIVAKSVRSVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))
rcsb
source organism Streptococcus pyogenes
molecule tags Structural genomics, unknown function
molecule keywords putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decar
total genus 105
structure length 383
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a9fA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 2a9fA01
3EZYA 3L07A 2YV3A 4RPLA 3PRJA 3EGOA 3WQRA 3KYCB 3ORFA 1PWXA 3FNHA 1PQWA 3RKUA 2YJZA 1N2SA 4FQ8A 5CAEA 2NSDA 3CUKA 4XIJA 1DJQA 4S3MA 1GUYA 4BKRA 2QHXA 1EUZA 3PP8A 2NQ8A 4RF4A 3GNQA 2Y66A 1ZK4A 2J3KA 1KEPA 4BQRA 1EK6A 1C1XB 3DAPA 4CV3A 2D4AA 3FNEA 2WD7B 2VTDA 3SEFA 2ZCVA 1X0VA 2DTXA 1ENPA 1M76A 2NNLD 2Y67A 2DKNA 3RUEA 1JKJA 1IHYA 1RWBA 2CNBA 3H2SA 1EQUA 4H16A 3PHHA 1GD1O 5FF9A 1JWAB 5JXWA 2GLXA 4QX6A 3WMXA 1D4FA 5DN9A 5TRTA 3DFZA 1U4SA 1OZAA 2BFAA 2DBRA 1VL6A 2GZ2A 2PA3A 3FTPA 1LLCA 1ULUA 4XD2A 1SBYA 3BMNA 1PWZA 3DAGA 2BGKA 4NPCA 1DC3A 1BTOA 1PZHA 3UOGA 5AXAA 4Y9DA 5A04A 4DA9A 2VT3A 3WGGA 1ZSNA 5KTKA 4GWKA 2XPCA 2CZCA 1T2FA 2NTVA 5AYVA 1C0PA 3DBRA 2HU2A 4GQAA 4D0RA 4KZPA 3PLNA 4YTEA 5I7FA 1NQTA 2BI8A 4ZICA 2VZ9A 3PGXA 1WP4A 3W8DA 2E49A 4BVAA 4JCOA 4Y67A 4IXWA 4Z0HO 2DPHA 5HS4A 3FF4A 1D1TA 4PG5A 4YACA 3H9QA 3H6KA 3D3EA 5KCZA 4DIBA 5JO9A 2DT5A 3T4XA 4J7XA 3JYOA 2AE1A 2FZEA 4II2A 4CMHA 2HLPA 4AJNA 1WZIA 3JYNA 1A9YA 3M6IA 5EQDA 4D44A 4CQMB 5JS6A 5EJ2A 4EJ6A 2HO5A 3ADOA 4NU6A 3UN1A 3FD8A 4J9VA 4BNNA 1Q7BA 4GVLA 3DTTA 1PGQA 4E0BA 3H3JA 3DBLA 3GVCA 4YJGB 3ULKA 4O63O 1A5ZA 2X58A 3TOZA 1I36A 3DBHA 3ETDA 4CM4A 1EBUA 1KVRA 3Q6IA 1LA2A 4D46A 1NM5A 3OIGA 3W8EA 3HN7A 1YS4A 5BSFA 1FDTA 1GEEA 1LQUA 1UDAA 3VZSA 3JD3A 1GY8A 3PJGA 4Q3BA 1ENOA 3LC1O 4CMEC 4GMGA 2XF8A 1I2BA 4PG8A 3ZNPA 2VN8A 4RL6A 1SC6A 4IIUA 2QRKA 1LSUA 4IIVA 1GV0A 1LDBA 3IDSA 3PHJA 3ENKA 3ZWCA 1WDMA 3G0OA 1P44A 1P1RA 3PHLA 4HXYA 3E5MA 1HYHA 1OC2A 1CQJA 1ZBQA 2O48X 3EMKA 1H6AA 3UGKA 3NKLA 2AQIA 1AXGA 4MIYA 4PLFA 4WK6A 4XR4A 3DZIA 4LCEA 1D1SA 4X54A 3IS3A 1XWFA 1RJWA 2X0IA 3STHA 1KY4A 5LDGA 3I9MA 4NFHA 2PKQP 5CEJA 2Z1NA 3ZWVA 1U4OA 3HNPA 1A27A 5I9MA 1Y81A 2HK7A 3E82A 1V0JA 2NUAA 3NDIA 2PGLA 3BHJA 4GX1A 2CVOA 3L0DA 4D3DA 1NYTA 1XYGA 2GF2A 4BNGA 3WYEA 1HDOA 4JGBA 3DOOA 2NVUB 1X7DA 2ILTA 1QRRA 4RF2A 5ENDA 3V8BA 5BQFA 1EVIA 2EWMA 4JJIA 4L4SA 3N7UA 3RFTA 1HF3A 4E30A 4YJFA 3HDYA 2IZ1A 3VDRA 1YQDA 4EEXA 4BNUA 2GN4A 2W2LA 4GX5A 5L9AA 5IFLA 4J1SA 5EERA 1HLPA 4PN3A 2PKRA 1ZW1A 4BO5A 4WOKA 3DXFA 4NBVA 2E4AA 2Z5LA 2OOSA 3AY6A 3GNTA 3NX4A 1JN0A 3U62A 2JCXA 1OBFO 5KVSA 3GGOA 4AJEA 4BNZA 1AGNA 3D3WA 5FYDA 5TC4A 3FNFA 3HADA 4GWGA 4W82A 1GU7A 4ILKA 4EW6A 2GR9A 3F6YA 4W99A 5AXBA 1DC4A 1FDUA 3C1OA 1VC2A 4LCJA 3W4KA 3UCXA 1SPXA 5ITVA 1N7GA 1ZNQO 3M2TA 1Q7CA 3PWKA 4N5NA 3N74A 1C0KA 2JD2A 1ZXBA 3OEWA 2H1SA 4R01A 4NBTA 4YAJA 4CM5A 3JYLA 1PJ3A 3CH6A 1P1KA 1JVSA 4ONEA 1J49A 4D3SA 1XELA 4R41A 3PQEA 3O8QA 1MP0A 2C82A 3PJFA 3KSZO 1KC1A 2VUTA 3IC5A 2V6FA 4IQ8A 4OSPA 4GSKA 3ZWMA 5G0WA 5A06A 5IG2A 1NVMB 3BAZA 3UF0A 4R3NA 4Z3KA 1PS8A 4FC7A 3UFXA 1PQPA 4RZHA 3WFIA 1KBZA 4WOJA 3HUDA 3AUAA 5HA5A 3PHGA 5I7VA 2YUTA 1U8FO 3MOGA 3ZHBA 2I3AA 1M75A 5TT0A 1MA0A 1JU9A 3DC2A 2BGLA 3GA0A 3GY0A 4IY1A 3U49A 4MVJP 4CMKA 2PD3A 1IPFA 3AK4A 2G1UA 2QZZA 1LDYA 3ZV4A 5HS6A 5H81A 2P5YA 1LRLA 1LSJA 1T2DA 2PZLA 3TRIA 2DU8A 4YA6A 1G0NA 3WJAA 3BHMA 4NNJA 1BWSA 5F1KA 2O3UA 3KEQA 5CDGA 4EUHA 3IP3A 3WGOA 3NTRA 1E7QA 1S6YA 1YJQA 1B3RA 1B16A 1CIVA 1D7OA 2DPGA 2TMDA 2ZKLA 4PG6A 1E3WB 4WPGA 1LDNA 1XLTA 1HETA 5CPFA 3UW3A 1GAEO 4P38A 5FWNA 3OETA 5BNFA 3Q9NA 3CZRA 1T1SA 2ZYAA 1Z82A 1R6DA 3SLKA 5G0SA 2NVBA 4WLOA 1RM0A 3DFUA 3TF5A 4IGEA 3DWFA 2EF1A 4R5MA 4K28A 4GBJA 1XU9A 3VPSA 2JFGA 4PRKA 4YT5A 2PLAA 1MXHA 4Z0PA 3RJ9A 4B4VA 5L95A 3QWAA 3C24A 4E5YA 4IJWA 3PTZA 1S7CA 4WLEA 3ITDA 1HSOA 1VKOA 5U4QA 2DM6A 1A9ZA 1Q1NA 3JQ9C 2B83A 2CDAA 2O23A 2O3TA 4CJXA 4DQVA 4DYVA 1LLUA 1NR7A 2FN7A 3K2BA 1RYEA 4WLVA 4I5GA 4JP2A 1VKNA 2C5EA 3GFBA 1C1XA 2QQ5A 2VUUA 5L7YA 3VZPA 3GEMA 5AXDA 2HQ1A 1KERA 1R4MA 2VHWA 4PLWA 1ONPA 2CF5A 4DYDA 3BMNB 1WMBA 4GPD1 3VH3A 1P74A 2EHDA 2GPTA 2RCYA 2YQ5A 3N58A 1XU7A 3PDJA 2P4HX 3RUDA 4GAEA 4OMUA 2H9IA 2HDHA 3INRA 1DHRA 3L4BA 1ZCJA 4ALKA 4BO0A 5ITWA 1I32A 1DOHA 1TI7A 1YL7A 1HYGA 1Y1PA 3UXYA 3H8VA 4G5HA 4NK5A 3ZWWA 1FDVA 1GQQA 4ZJUA 4CV0A 4IDAA 1PSDA 3PQDA 3GT0A 3AFNA 3VHRA 2YHIA 3QJ5A 3OH8A 4GI2A 4J16A 1UXKA 2AW5A 3WNQA 4FFOA 1GADO 3BTOA 2OMEA 1CF2O 4PZCA 3L6DA 5IAAA 4GH5A 5CEFA 1DJNA 3ETEA 3A1NA 3DHNA 5JAQA 3JQ8B 3S1LA 5CG1A 1R12A 3BMOB 1IY8A 1NTOA 3AW9A 4WECA 3VAZA 4C4OA 2Q45A 4P22A 3QHAA 3NEPX 3LVFO 4I08A 3S55A 4NR0A 3I3OA 1NWHA 5CDYA 1ZKMA 3F1LA 4DBVO 1L7EA 4GVXA 1Y8RA 1HE5A 3TL3A 1IE3A 1PJBA 1BXGA 3IAHA 3ON5A 1JAXA 2ZTMA 5B1YA 4JXKA 3UVEA 3G1TA 4R3WA 5CPBA 3RKRA 5B12A 1KVQA 1EVZA 4HADA 2OBNA 1NASA 3L6EA 1JKFA 3PYLA 4YJFB 1HZJA 4OXYA 3JYPA 3W6UA 4OSOA 4FB5A 5B4TA 4O59O 3IJRA 4J0EA 1T1RA 3H2ZA 4DMLA 2ZATA 3ROMA 3RWBA 1NWCA 2BF7A 5KVVA 1ZUD1 5T67A 2DLDA 4PVDA 4R69A 1UH5A 5BSHA 1U2GA 4J1TA 4UEJA 1NVTA 3I4CA 1XR3A 4Q3EA 2QYTA 4J4BA 2P68A 4YPOA 1E3IA 1NPTO 3ZU5A 2CUKA 3VZRA 1F17A 3AOGA 3WGQA 3PI7A 3R6DA 3WG9A 5KJFA 1P0CA 3LT2A 2HAEA 2CSUA 5I9NA 2W4QA 2D5CA 3DOJA 1UAYA 3FRJA 3TFQA 4LW8A 4XQEA 1P1IA 3RC9A 5T57A 2JHGA 2WMDA 2HUNA 4LVUA 4WEOA 5CDUA 2GN8A 2YDYA 3M1LA 2Q2WA 1H9AA 3QA9A 5A5EA 2D2IA 3GUYA 3NT2A 2O3QA 4AJLA 1ISJA 2GNAA 1VI2A 1J4AA 5LCXA 5DULA 3ANNA 2ZYGA 4UREA 2J5KA 3O9ZA 1F0YA 2EKPA 1JKIA 3HE3A 4WNIA 4K6CA 3RBXA 1FDSA 3R3SA 4FN4A 5I7EA 3ENNA 1OAAA 4ND4A 1NR1A 3DEYX 3KHUA 4IQ0A 5KWEA 4ROSA 1XCBA 4JQCA 3C7AA 1ISMA 1E3LA 1MX3A 1XG5A 4U7WA 2EP5A 4KDFA 1LSOA 2X9VA 3AOEA 4BNMA 3L4BC 1PJ4A 4I5DA 1P31A 2JFHA 3SLGA 4QO7A 1YB4A 4Q9NA 3OA2A 4EGFA 2C07A 2EGHA 1H2BA 4J90A 4LGVA 2IYPA 2RH4A 3JQ7B 3VVCA 5JDIA 1T25A 1W6UA 4A03A 4DUPA 3A14A 3QVTA 3WLEA 3ZDFA 4CPDA 3PQFA 2P91A 4ALNA 1LLDA 4UUMA 1QORA 3RU7A 3W6ZA 1DFHA 5A5FA 4MP6A 4ZQBA 3SXPA 1EVYA 2UDPA 3OIFA 3U4IA 5I8ZA 4R54A 3RQSA 1DIHA 1NAIA 4F45A 1WDLA 3FTNA 5JBIA 1NVGA 3ZNOA 3DO5A 2QZ9A 3KETA 3IUPA 1QP8A 2JAHA 2VHVA 5KVQA 4F46A 4INAA 1SEPA 1YQGA 1KC3A 2IYOA 2Y1CA 3FPCA 4QT0A 4A27A 1BRMA 1O94A 4NJMB 2C59A 2R00C 5DBFA 4CQLA 1PJTA 1UP4A 2EKLA 4AJ1A 1DB3A 2UYYA 4WUVA 2F1KA 4BO4A 2OFPA 2ZK7A 1E7WA 5L7TA 7ADHA 3O26A 4RVDA 3EVTA 2GRAA 3WYCA 2I3GA 1E7SA 3GVXA 3WIEA 1PS9A 4MKXA 2JL1A 4JBIA 1N9GB 1QYCA 3PPIA 4CM9D 1V35A 2P9GA 3NRCA 1YVEI 3HHPA 5T8KA 2Y0CA 1K5HA 2HMUA 3FBTA 2CMDA 3H9JA 1YOVB 4E4YA 5C7IO 3H3FA 2VHZA 4PG7A 3DQPA 1IUKA 3NDRA 3WSWA 4TZTA 5IXSA 4CR6A 1N7HA 2W8ZA 1E7YA 1I33A 4G65A 3QWBA 1ENYA 4XWYA 3WB9A 2JCYA 1P1JA 5JCXA 1WDKA 4YWJA 4AJOA 3G17A 2YV1A 4BGVA 4PIVA 1Q7GA 4UEKA 1DIRA 4CQMD 4UVGA 1BDBA 3LLVA 5C7LO 4IXTA 1E5LA 1DRUA 2X9NA 1E5QA 3GRPA 4OQYA 4QO8A 2D1YA 3VPHA 5A05A 2FMUA 2HJSA 4R1SA 3U4CA 1P77A 1BVRA 3RFVA 5C5IA 3PLRA 2I65A 1V8BA 3PIDA 4XCVA 2BFPA 4YJGA 5TS3A 4MOWA 3QP9A 3VKUA 3B20A 1X1EA 4U5QA 2ZQZA 3GVHA 3BMQB 2B4RO 3A06A 3TQHA 4F6LA 3W8FA 2Y0EA 3ICCA 3RBZA 2EW2A 3ZW9A 2DC1A 2POQX 1N5DA 4HUJA 2UVDA 4BO2A 4FGSA 1KYQA 3CIFA 3JQ7A 2QX7A 2G17A 3JQBA 1K6XA 3TZHA 2Q49A 4MKRA 1P1HA 1NFQA 4CUZA 3QVXA 4QFDA 1UP7A 4DRYA 3A4VA 3JQAD 2C0CA 1M67A 3EY4A 4NH4A 1ML3A 4AFNA 1UXJA 4KTTE 2EG9A 5LDHA 1H6CA 3ZV6A 3C8MA 1E77A 4UVHA 4CM9A 3X2EA 3DDNA 3JCZA 4BNHA 2YDXA 5BNIA 4WJZA 2X6TA 1EFKA 5L51A 2WD8A 3K6JA 5JW6A 2GO1A 2ZYDA 1E92A 1WW8A 2O7QA 3PDUA 3L77A 1Z45A 4ND2A 3TPCA 3SVTA 2PWZA 3GGGA 2O50A 4RVSA 1JDJA 3WJ7A 1UZLA 1X7GA 3ANMA 4J7CA 3H5NA 3DZHA 5HBRA 1EDZA 4AJHA 3I52A 4YAGA 3SX2A 1Y6JA 3CEAA 4EUEA 4IGFA 1DPGA 5CG2A 4H3VA 2PH3A 4R68A 4N18A 5I8WA 1Y9EA 3RBVA 3QV1A 2ZCUA 3T4EA 2VTEA 3OECA 3OQ1A 2PZJA 1C1DA 1LI4A 1P0FA 3G1UA 5TT1A 1CJCA 9LDBA 1T24A 4HNGA 4G81A 3LLSA 3VZQA 2PZKA 4PZDA 3ROQA 3PFFA 3VTFA 5A1TA 2X7HA 3HSKA 5GZ6A 3Q2KA 4CMEA 3NUGA 4ND1A 2Y05A 3MWDB 4KWHA 3L4SO 1Z7EA 5GMOA 3ST7A 4NDNE 1D8AA 4FIZA 1LTHR 1YRLA 4GLLA 5A9SB 2BFMA 5F5LA 3OJLA 2WWRA 3I23A 2BHLA 3ZU4A 1GR0A 3GOHA 4JNKA 1YWGO 3FR8A 4PCVA 3HJAA 3JQAA 3C7CB 4NZ9A 3WXBA 3FWNA 1EFLA 1P3DA 4Y8VA 4ZQFA 1X1TA 4FCCA 1IYZA 4QQRA 3CINA 2VOEA 4XIYA 1AHHA 4JBGA 1BDMA 1I8TA 4ZU3A 4KWIA 1DDOA 4WEQA 4F6CA 7MDHA 1I3MA 4RGBA 1HT0A 1YXMA 2EP7A 2R6JA 3MCVA 4CLRB 2BGMA 2CDBA 3GRKA 4XYLA 1LC0A 1C14A 2C7GA 3ASVA 3RU9A 4FFPA 1TVEA 5L4SA 4M49A 4KQWA 3U4HA 4BNXA 4MVJF 4IPTA 3WGYA 1DO8A 5DCWA 4PVCA 3TZ6A 3VH2A 4XRGA 4A73A 1JQBA 4RLHA 3H7AA 1UDBA 1T2AA 3UKOA 4OGWA 1U5AA 1F12A 1YGYA 3CSDA 4M89A 4UULA 5HWSA 5HRUA 2OXIA 1GZ4A 1FF9A 1GZ3A 4OYRA 3K31A 8ADHA 5L4NA 3ETGA 3MJSA 4FJ2A 2VZ8A 4FS3A 3OJEA 4CQLB 1DFGA 3WNVA 4BUCA 4RJTA 2NV6A 5IN4A 4YT8A 1H94A 1T26A 4ALIA 4RV9A 4BMVA 3UCFA 2FPGA 3MJVA 2FWMX 2EXXA 4AJPA 1BGVA 2C7VA 4URFA 5BSGA 4XJTA 3QVOA 3ROPA 4RPGA 4ND5A 1LDGA 1UZMA 3RVDA 5K6AA 3DR3A 2AXQA 2EERA 5K0ZA 1DAOA 4HV4A 5B4UA 3IIEA 4IDBA 4IS2A 2Q50A 4CM8A 3KUXA 4N5LA 4AG3A 4D7AA 1I30A 4IUYA 4B3JA 1A71A 4NBWA 3OP4A 1IZ9A 2UV8A 1BXGB 2Y1OA 4DGSA 3K92A 3EW7A 4YR9A 3ZV5A 2HRZA 3KO8A 2PNFA 3INGA 4MVJA 4J9UE 2ZJ1A 3ANLA 1JWBB 1NP3A 1TLTA 2OHXA 2RAFA 5ILOA 5JDCA 5KKAA 3A28A 4CM7A 3WWYA 1I10A 1ZMOA 3D4OA 2YFHA 3HB4X 1B8UA 4A7PA 3CMCO 5JC1A 5B4VA 1HDCA 4O6VA 3U3XA 1E7MA 4XJSA 4IDFA 1IOLA 4J7UA 4I9HA 2E82A 1N1GA 2BKAA 3DBVO 2J6IA 3RFXA 4EUFA 2W2KB 2DAPA 2WJPA 3KSUA 4JIGA 4AJJA 4EDFA 2NVUA 4CODB 4OQZA 1XHLA 4DMMA 5ER9A 1KY5A 4ZRMA 4D3FA 4YAEA 1VM6A 2W98A 3ZHYA 4BKUA 1VJ0A 4XQGA 3ZH2A 5EPOA 1WNTA 3OQBA 3PJEA 1W0CA 4OL9A 4E5MA 1FDWA 3JQ8A 3OJ0A 4ZQEA 3TL2A 4WGGA 1QSGA 4CMBA 4CMCA 1DSSG 1LXCA 3WTCA 1F14A 2Q4BA 1RM5A 2NM0A 4ZHSA 1U3UA 3WICA 1E3JA 2PGJA 2HMVA 4QTZA 1E6EA 3EZLA 2E6UX 4RO0A 3E9NA 3K30A 4BO1A 1SEVA 1DLIA 2O2YA 1IL0A 2B35A 2FP4A 4TZKA 3RASA 1B7GO 2FZWA 1Q0LA 3GMSA 4I9UA 4RPKA 3JQEA 2W90A 4E32A 5IDWA 5G4KB 1XQ6A 4HNHA 4W9NC 2G76A 3F4BA 5G2OA 3VH4A 1ZH8A 4K26A 4Q3AA 3ZWBA 1HYEA 4DWVA 2YHIB 1J6UA 3AI2A 2SCUA 1ZK0A 4IZIA 4XYGA 3GF4A 4GX2A 3K2EA 4K6FA 4B4OA 4AVYA 3K73O 2JKVA 1XIVA 5BT9A 4PLPA 4ITUA 4IDDA 3JSAA 1EE2A 3AUUA 4D79A 2J3JA 2PFGA 3OF2A 2EJVA 4B7UA 3OQ6A 3IP1A 3WGIA 1UXIA 2X9GA 3FHLA 4FPXA 4ALLA 3HQ4O 1Z6ZA 3A9WA 3E6AA 1HXHA 4UAGA 4M8SA 5A02A 2VHXA 2PKQO 2JD1A 3GVIA 3KOUA 4UUPA 4HBGA 4YCAA 3GEDA 4TRMA 5JYDA 3KRTA 4E3ZA 4RDIA 3JQBC 1W4ZA 1DXYA 3HB5X 1UXGA 1SZJG 4RZIA 5G0TA 1V3VA 4CM3A 1OC4A 4ID9A 3BHIA 4MIOA 4E5PA 2PZMA 3WGHA 1F8FA 5AXCA 3UAGA 1ADFA 2Z95A 4TRJA 4D45A 1ISFA 4FFLA 2VCYA 4XR9A 1TEHA 1E3SA 2NU7A 1VJTA 4OM8A 5GZ3A 2JFFA 3NV9A 4CL8A 3KB6A 1VRWA 4FC6A 1T4DA 3ZCXA 4DC1A 1EUCA 1ORRA 1SB8A 1ZK1A 5KKCA 3KYCA 1PZGA 4GGPA 1QLJA 3PIIA 1GFSA 3MWEB 2V7PA 1YB5A 3MJEA 1V3TA 2LDBA 4YDRA 4XQCA 4J91A 3DBLB 1VPDA 4DC0A 5ICSA 1HE3A 4U0KA 2A4KA 3WR5A 3NT4A 3DOCA 1PQUA 4BNYA 4CM6A 5CEEA 5U9CA 3WGZA 4WLUA 3AI3A 5G4KA 3ONFA 2OO5A 4CL3A 3QVWA 1DIBA 4XX0A 3TZKA 5CDSA 4CV1A 1P45A 5J23A 3SC4A 1B8VA 4OAQA 3FWZA 3ZWYA 4CR8A 4BOYA 2ZTLA 5JLAA 1JW9B 2AG5A 5A9SA 1R0KA 4YQZA 3O8QB 3VDQA 4Z0TA 1BXKA 1SB9A 1XSEA 3G3EA 1X0XA 4YQYA 4HKTA 3F5SA 3GC6A 5T6BA 4R5HA 5CFZA 4Z9YA 5GZ1A 2RH8A 3ICPA 2O3RA 3G49A 5EESA 2OBYA 1SCUA 3F47A 4OXKA 2VZ0A 3M1AA 2GN9A 3L6OO 4IQGA 1BHSA 1U9JA 1HDYA 4JK3A 2QIOA 4II3A 3R1IA 4NIMA 1N1EA 2B5VA 4YB8A 1NPYA 3PJDA 4N7RA 5EQFA 3E1KA 2W2KA 2FY8A 2X0NA 1ZEMA 2IODA 4IJVA 4CM1A 4E33A 1UJMA 3RC7A 1PGJA 4WCDA 4U8GA 3I5MA 5HM8A 2IEBA 4IZHA 3V2UA 1MB4A 4TROA 1YJ8A 5ICMA 1YE3A 4JJGA 3Q0EA 2Y1DA 1PJLA 3BMCB 4NHEA 1PEDA 4B4WA 1TT7A 1AXEA 2UAGA 4TMFA 5KVCA 2DTDA 4PLZA 2PD4A 5F5NA 1Q0QA 2P5UA 3CZMA 4M55A 3RIHA 1HE2A 2D59A 2ZB4A 3LSYA 1T4BA 4R9RA 2BMAA 2Q4EA 5L45A 3KTDA 3FBGA 4YT4A 2I99A 3DAFA 1LC3A 1A4IA 3IKVA 2A9FA 4J2HA 4WLFA 1NAHA 4ZA2A 2D5AA 2Y1FA 4NBUA 2UUPA 3RUHA 2ZB8A 2I67A 2Q1WA 2IE0A 3NTOA 4NBRA 2AEMA 1I01A 2HK8A 4NI5A 4CLRA 1O8CA 3BTVA 1HDXA 1X7HA 3KVOA 3E48A 1BW9B 1BVUA 4XQ9A 3GG2A 4YT2A 1EE9A 4IM7A 1MC4A 5IJZA 4J2OA 1LRJA 1LDMA 4DL9A 3KYBA 2X1HA 2J3IA 1U1IA 3I1JA 4XEHA 1H0KA 1B0AA 4QECA 1DC6A 3JQDA 2X23A 1KEUA 1NQOA 4ND3A 1K89A 4A0SA 1N8KA 2WYUA 2ZTVA 3BYZA 3VOSA 1ENZA 1G6KA 1TT5B 3IOYA 3KXDA 2CVZA 4PRLA 4G2NA 4I5EA 1H93A 1R4MB 1R4NA 4KP7A 2DBZA 1BSVA 3H65A 3P19A 4WLNA 2NTNA 5EMHA 4Q3DA 4E5NA 1GYPA 4EITA 4Y98A 1E0DA 4BNFA 3PYXA 4GMFA 3H9EO 3MTGA 3K5PA 3D5TA 1U3WA 2I6TA 3NGXA 2PTGA 2CF6A 3QW2A 4LRSB 2DTEA 4MPDA 4AICA 5JCJD 5CDTA 4RQUA 5T64A 4MVJH 1YL6A 1ZJYA 4E13A 4E21A 3DZFA 1K6IA 2LDXA 4CLOA 2VWQA 1IHXA 1N92A 3GVPA 2CY0A 3AUSA 4TSKA 1EEHA 4H7PA 3S2IA 1R37A 2VYVD 3RSHA 1V3UA 3PGJA 2IXBA 3I6QA 2PY6A 3P5SA 4EJ0A 5JYEA 6ADHA 1HLDA 3VVBA 3UH1A 4NFYA 1GL3A 3LYLA 4R51A 4UUOA 5JAMA 2VRCA 4L8VA 1H5QA 4DPKA 4MO2A 4RPJA 2B37A 2DBQA 1ZIDA 1F06A 4DQUA 4L9RA 3RUAA 4EBFA 4Z9XA 1KVSA 3P7MA 1SO8A 3O38A 3V1UA 2W2LD 2GERA 3DMYA 4A26A 1E1LA 1GTMA 3NTQA 2DFDA 5F3RA 3WTBA 5TQVA 4BO3A 4LK3A 2NLOA 5TF4A 5JPIA 3M2PA 3WIDA 4BKOA 3GQVA 2HJRA 3I4FA 4AL4A 5JE8A 1LQTA 4BNJA 3EK2A 4BHTA 4YRBA 1B14A 4NJMA 3AFMA 3ZWPA 3L9XA 3QWFA 2A35A 1N9GA 4KTVE 3ZV3A 5JO0A 4QUKA 5ENVA 1NNUA 3W4JA 3OA0A 1V6AA 1YL5A 3OBBA 3V2HA 5DZSA 4L75A 3VTZA 8LDHA 3QIVA 2AQ8A 4CLDA 4BS9A 1PJ2A 1GQYA 1Z7BA 2WYWA 3PEFA 4BNIA 1I3NA 3ITKA 4Q3NA 3Q11A 4I8XA 3D64A 4I9NA 1TB4A 2DBVO 1NPDA 2F00A 3B1FA 4E31A 3GLQA 1DRVA 4W7IA 1O6ZA 2EGGA 2QG4A 1NQAO 3GEGA 1NHGA 4I5FA 1HRDA 3LQFA 4Z9FA 1IB6A 3I9OA 4CLEA 3D1LA 4OOFA 1CERA 3NDJA 4RVGA 2NU8A 4BKQA 3ZWNA 3GHYA 3GDFA 3Q1LA 4PLGA 1CYDA 3OJOA 2Q1UA 4XGIA 2ET6A 4YRAA 5IN5A 2YW9A 1PJCA 3WGTA 3KV3O 3MEQA 1R4NB 3QWIA 4RF5A 1LX6A 5G4LA 5TLSA 4YRDA 1QG6A 3IQDB 5BSEA 5GY7A 5DOVA 5TX7A 3NJ8A 4KDEA 4KUHA 4FFMA 5F1PA 4JJFA 3WMWA 2TMGA 3AY7A 3F9IA 4LVCA 2AQHA 1Y8QA 3MJCA 5AQ1A 2E48A 3GGPA 4O0LA 4S1VA 3U0BA 4BV8A 3LT0A 2WD7A 4BGUA 1E1NA 1WAMA 4L74A 2O3SA 1QKIA 1JA9A 3RUCA 1YOVA 3AM4A 4BO7A 1SOVA 4GL4A 4CMJA 5A03A 2BFOA 4DPLA 3NJ4A 4TKMA 1ONNA 3VH1A 4D43A 1I2CA 3DMTA 1M66A 1GUZA 5DT9A 1TXGA 4JP3A 4XGKA 3GAFA 1HE4A 3EAGA 4DLLA 3BMOA 3GN1A 4A2CA 3FCOA 1I5RA 4OIMA 1Y5MA 2NACA 2VWPA 4YYZA 2ZJ0A 1ARZA 2GN6A 3VKVA 3ZWAA 5ES3A 2WYVA 1AUPA 4J43A 4CUJA 3AUTA 3TZCA 1CDOA 4TVBA 1PU2A 1G0OA 4MVJG 3UUWA 5L7WA 3PK0A 4IS3A 3BMCA 1U7HA 4ZD6A 2VOJA 1RKXA 3NYWA 1BG6A 5ER6A 4RDHA 3EC7A 4QSMA 4IDEA 5JNLA 3RCBA 4HFNA 2J5QA 4UVEA 4K1LA 2DFVA 1CEQA 1MV8A 3GZ4A 3X2FA 3SBOA 3CMMA 1PR9A 4QFCA 4CM8B 5KOIA 4ZVVA 3GG9A 1QR6A 5A3VA 1UR5A 3ZZNA 1BXZA 2VUSA 4NJOA 3PWZA 1H6DA 4JLWA 5EINA 4H15A 1LNQA 3HFSA 1LRKA 3U4DA 2AHRA 3JQFA 5ADHA 2OL4A 3GPIA 3ZW8A 3ZN2A 5EN4A 5K9ZA 4FGWA 5G0UA 1LLQA 1IULA 1FXSA 1U28A 1LDEA 1X13A 4RVFA 5THKA 4MJLA 4FOSA 3PFWO 2Q1TA 4CMIA 4I1IA 2JD0A 4BO6A 5IXYA 3EYWA 1CQIA 2BLLA 3Q3CA 4GLOA 4ZN6A 1Y8RB 4ZGWA 3FR7A 2C20A 3MOIA 2I5PO 5KJEA 1LUAA 1DFIA 2QRLA 4HFMA 1QV7A 1PS0A 1QLHA 2YHUA 2FHSA 3BIOA 1D3AA 3C7DB 3PXXA 4BB5A 1FK8A 5TIIA 3F5QA 3DONA 5IZCC 1M6HA 4EEZA 1XDWA 2EV9A 2B36A 1RPNA 4WCFA 3O03A 3JD0A 3IKTA 4U6SA 1QYDA 2GZ1A 1ADCA 2OP1A 3ONDA 5C7OO 1IPEA 1YKFA 1I2ZA 4BNKA 1WLYA 2HCTA 1H6BA 4JN6B 4B8WA 2X0JA 3D4PA 4CMGA 3ONEA 3ZHXA 4YAIA 1YO6A 1R0SA 4CLOB 1GQ2A 4J49A 4M87A 3I9LA 2Q46A 4KUEA 2DUUA 1UUFA 3EUWA 3MTJA 2B5WA 2BD0A 1Y9AA 2Q2VA 1QYVA 1WMAA 2C5AA 1MUUA 2EEZA 1XKQA 4EI2A 5L40A 3HWRA 3V2GA 4EYEA 4PG4A 4PLCA 1I3LA 4P4GA 4MDHA 4NK4A 1PX0A 2IZ0A 2R00A 4R1TA 4JX8A 3CTMA 1MFZA 1YQXA 1U5CA 1J5PA 4MVJE 4XYBA 3QRWA 3HDJA 3GDGA 1ZVMA 1OOEA 3BTSA 2CVQA 3JV7A 3Q2IA 3QVSA 4D41A 5JC8A 1J0XO 3F4LA 2AEJA 5HTOA 1GPJA 4R4JA 5B37A 3S2EA 3NAQA 1DEHA 1FJHA 1A7KA 3TNLA 5L3ZA 4LSWA 1GYQA 1EZ4A 2NADA 1ZFNA 2BH9A 3E03A 3PYMA 3Q9UA 4QEDA 2JAPA 3GNSA 4BKPA 3OMLA 5TJ9A 2Y1EA 3E5RA 3RUFA 3V1TC 5I7SA 1LEHA 4BNLA 4DLBA 1P1FA 2EKQA 4HP8A 4F3YA 4XB2A 5KJCA 1NX6A 3TDKA 5COAA 3JQ6A 1Y5RA 2O2SA 2DQ4A 4BMSA 1EK5A 1W8DA 1Q0HA 1U3VA 3GN2A 4A5OA 1GCUA 3LF1A 1Z74A 3GR6A 4K9DA 1JVBA 4CV2A 5THQA 2YV2A 4LN1A 1QYWA 4BNWA 4J6FA 4PLHA 5F1OA 2J3HA 3LC2O 1H2HA 2RBEA 1HL3A 3DHYA 5JY6A 1L7DA 1DHTA 1HDZA 1ZK2A 2X0RA 3QY9A 4DXHA 1CETA 4IJUA 4UVIA 3H5AA 1AHIA 3B6ZA 5EIOA 4M1QA 1NHWA 2AG8A 3HFGA 4E2YA 3I83A 3D3WB 4P4NA 1ADGA 1C3VA 1DRWA 3WWZA 4EZBA 1MXFA 1PL7A 3LC7O 3AM5A 5DBIA 3PZRA 2VT2A 2Q3EA 2VHYA 3SC6A 5BNTA 1GCOA 1PGPA 1PGOA 1QXSA 1AE1A 5JDCC 4PLTA 3UHAA 2V6GA 4XDZA 3T7CA 4U6QA 3DBHB 2P9EA 3CE6A 4FD3A 3BA1A 3AWDA 1DAPA 3EVNA 4EJMA 4HWKA 2FR1A 3ZNNA 1HZZA 1AN9A 2AEFA 4DIOA 3WBFA 5DP2A 3DZKA 1GV1A 2J5RA 2E37A 5L53A 3IMFA 4NQZA 3P2OA 1BMDA 3LT4A 3ZI0A 5AOVA 1EDOA 4IJKA 1E6UA 3ZWXA 1YBAA 1VJ1A 2V6BA 2I9PA 4CR7A 2C54A 2C2YA 1K0UA 1G1AA 3CXRA 1B15A 3OM9A 1EVJA 4GGOA 2XXBA 2VNAA 1NXQA 3C1TA 3PHIA 5KIAA 4XB1A 1H9BA 2B4TO 1CRWG 2H63A 4PLYA 2CD9A 1R66A 1I24A 2D0IA 4XA8A 3AY3A 1ADBA 3GDOA 3SJ7A 3MZ0A 4CMAA 4C7KA 1RYDA 2QYSA 4YJDA 4XZ3A 2X5JO 3OIDA 5H83A 3PZBA 1Y8QB 1UXHA 4TVOA 5T5QA 1ULSA 3AU9A 1GPDG 2XXJA 4Q39A 3JQGA 3S2GA 1PL6A 2O7SA 1FMCA 4M86A 4Q3CA 2FR0A 9LDTA 3WOHA 3KBOA 3KSDO 4M54A 4N54A 1B2LA 1OI7A 2O4CA 1KOLA 2IDZA 1UAGA 3COSA 3WLFA 1VL8A 3H5RA 3WS7A 3HG7A 5JDIC 4OHUA 4LMPA 4RQTA 3VPGA 3DZBA 3DL2A 4W6ZA 4TWRA 3TFOA 2GASA 4FFRA 4PFJA 2Y93A 3RAJA 3TZQA 4BQPA 1O89A 1E3EA 4D42A 5TJHA 1NFFA 5TNXA 3ADPA 3AOEC 1PZEA 3KYDA 3ZU2A 2OGUA 4E2WA 5KJ1A 1U7TA 1MG5A 1X15A 2IXAA 1QMGA 1DIAA 1KEWA 4TRRA 1NQ5A 3U9LA 2OUIA 3FN4A 3TJRA 3TSCA 4BGEA 1ZSVA 2G0TA 4PLVA 4QXMA 3BZUA 3RJ5A 4XKJA 3RUIA 3WYBA 2IZZA 4W7HA 4BO9A 2GD1O 4UEOA 3JQCA 1YBVA 5H82A 1F8GA 2RIRA 3ZWOA 4BB6A 4OJNA 3W4IA 3JYQA 1KVUA 2X8LA 3B1JA 2HMSA 2PR2A 5JY1A 1K2WA 1LJ8A 4E6PA 2DUWA 4YEDA 2IEDA 3KYDB 4KQXA 3E8XA 4R9SA 1UP6A 3EDMA 4XGNA 1WXDA 3IJPA 3OJFA 4KOAA 6LDHA 5FI5A 1C0LA 4CLHA 1ZSYA 3SJUA 5JAIA 3LT1A 4GX0A 4KMSA 5JAZA 2YFQA 2NU6A 4P4LA 4L76A 1RM3A 5EL0A 2Y1GA 3D0OA 3TN7A 1O0SA 1RM4A 4C7JA 4YBZA 3CPSA 1ID1A 3DB2A 4FDAA 3JD4A 1KVTA 3DZGA 1PIWA 2OORA 2PV7A 2V6MA 3GMDA 1OMOA 4NMHA 1DC5A 3NT5A 1B8PA 4OOEA 5A9RA 4ZQGA 5IDQA 2FPPA 1TA4A 2RHCA 1V9LA 4IDGA 2X5KO 1MGOA 2YYYA 3TWOA 3JD2A 3WX0A 4NG5A 1QYXA 1VSVA 4J4HA 2B4QA 4IDCA 2C2XA 3DZJA 4IINA 3WQSB 3ROKA 4CMIB 1EBFA 1U8XX 2WM3A 3C1AA 3GK3A 5IZ4A 1HWYA 1MLDA 3VPFA 1ZMTA 2PK3A 4OH1A 5MGBA 5G0VA 3H9GA 2PD6A 3WQQA 1YB1A 3KLPX 2I76A 4J3FA 4O1MA 1CWUA 4FSHA 4BIIA 3HDQA 4U0JA 1PTJA 1QV6A 4J4TA 4B79A 4RLSA 1PJSA 2Y68A 3IL2A 3C85A 3ASUA 5FEUA 4OO3A 3GPDG 1EMDA 1PJQA 4HX5A 4RORA 1XGKA 2EJWA 2GGSA 2UUOA 4WASA 3RROA 3I9NA 1ZZEA 2IRWA 4YJHB 1MC5A 3QSGA 4CQMA 4FW8A 3T7EA 3D7LA 2VYND 1VL0A 2FSSA 5A3JA 1VLLA 4Y6PA 4RVHA 5A4DA 5JSFA 2VRCD 2XAAA 4Z3DA 1K6JA 1HTBA 3I6IA 4GKBA 2B0JA 1SMKA 4WCFB 4E2ZA 1VSUA 5L4LA 3H4VA 4R1UA 1A4UA 3ABIA 5BR7A 4XYMA 2Z1MA 3JTMA 3KEOA 5A9TA 2BI7A 1SNYA 3WBBA 1YONA 1PR3A 2WE8A 4DPMA 3ZGYA 3G79A 3ZNQA 3KZVA 1ZXLA 2H5LA 2Q99A 4JROA 1ISGA 3D4NA 2VQ3A 2Y0DA 5JCJA 3S8MA 1GYRA 1OFGA 3OFSA 3HN2A 1KS9A 1YDEA 1MFPA 1PL8A 2YY7A 3QE3A 4BV9A 1M6WA 1M2WA 2HKIA 4Y6SA 3RC1A 4DTIA 3H9UA 1HEUA 1PGNA 5DDIP 1KETA 3OSUA 1XQ1A 1VE9A 4NU5A 4MP3A 5CP8A 1ZO8A 4FOOA 5AVOA 2YQ4A 4LMRA 1Z73A 3LZ6A 4R16A 4ALMA 2EIHA 2FPIA 1P33A 2YZ7A 4BL5A 3UICA 1E6WA 1YH3A 2WTBA 4ZRNA 3JD1A 1HDGO 4D0SA 4CM4B 3K8ZA 2VYNA 2G5CA 1GUFA 1WZEA 1X14A 3BMQA 3QLJA 3KM0A 4YVFA 3PWSA 4MVJI 1E1MA 2VWGA 3GZNB 1HDRA 3F3SA 5TGDA 2NU9A 3PVZA 1HKUA 5KJ6A 2P4QA 1GDHA 4PGFA 2AMFA 1NBOA 3GFGA 1ZK3A 1UDCA 4GSLA 4CUKA 2X4GA 4DREA 2BELA 4GKVA 3D5QA 4B3IA 4DLAA 2NWQA 3BXXA 3GHHA 4BO8A 4KUGA 4LSMA 1BW9A 2R2GA 1LBEA 4L4RA 5FI3A 3I9JA 4TRNA 3R0IA 5I9LA 2HRBA 4HFJA 4ALJA 4W9NA 5COQA 4MINA 5IDXA 1YDWA 3WDSA 5JFOA 2VNSA 3GUCA 4R1NA 5DCUA 3S2FA 4P8RA 4TQGA 4UVDA 4NFSA 4OKNA 2WEKA 3GZNA 4L73A 4UUNA 4JBHA 1A7AA 1WWKA 1R0LA 1ISHA 2AQKA 4WE3A 4E2XA 1B26A 3WFJA 1HSZA 5DOZA 3W1VA 1UZNA 2OP0A 2JJYA 4IBOA 5DCYA 5IDYA 2GZ3A 1KEVA 1O5IA 3EHEA 4WCFC 3DHEA 2JCVA 4ZQHA 3FI9A 3NGLA 1T2EA 2D3TA 2DVMA 4IMRA 3RC2A 2Q2QA 2B69A 4BMNA 4Z6KA 2HMTA 2ZQYA 2FR8A 3LU1A 4YAKA 4AJ2A 3RD5A 3VPXA 1O95A 1E7RA 2NTJA 1NFRA 5KNLA 1GZ6A 1U2DA 4DIFA 1W73A 3OHSX 4MIEA 5FFFA 2X5OA 3INTA 4W4TA 4XDYA 2X86A 4MP8A 4RCVA 3DBRB 2J8ZA 1R15A 4B8ZA 1R16A 4YXFA 4DBZA 2O4UX 4XYEA 2BRUA 4A10A 1DLJA 2QRJA 1LU9A 2EW8A 4N5MA 2WSBA 3B70A 4FJ0A 2JHFA 1O9BA 1ZEJA 2X22A 3C3XA 3UCEA 4MKZA 2A92A 4FFNA 5IF3A 3BTUA 4Y6RA 2HSDA 3TOXA 4L4XA 2GYYA 2WE7A 3I9KA 4PZEA 4E12A 2GCGA 2RHRA 3VC7A 1DIGA 3QQPA 4WNCA 4DVJA 1Z75A 5DBGA 2NVWA 3MJ4A 3RI3A 3L9WA 1LSSA 1XEAA 2QW8A 5MDHA 2Q1SA 5IZCA 2VWHA 3E18A 1SOWA 1E3WA 4WKGA 3E9MA 3B1KA 1EQ2A 4B7XA 2P9CA 2A94A 4OXNA 5DNAA 1E1KA 1C0IA 3MJTA 1GEGA 3F46A 1ZJZA 5CHEA 2PGDA 1ISIA 2VRBA 2OZPA 4BNVA 3U09A 1PZFA 3DMTC 2C29D 2GSDA 2CDCA 4OKIA 3JQFC 4O5OA 3GAZA 4LISA 3HZZA 2H6EA 5JMPA 4B4UA 3GH3A 4MVJD 5F21A 1KIFA 4AJ4A 3K96A 5C37A 5COBA 1MG0A 5DP1A 3HDHA 1IZ0A 2ZIZA 3LF2A 3QWHA 2ZTUA 1JLLA 2GUGA 2V65A 4BNTA 5T8KC 1ONOA 1JTVA 1U3TA 2PH5A 3JQAB 3O4RA 2D8AA 2FSVA 4AJIA 4CLXA 3AU8A 3WSVA 2ZB3A 1K3TA 2FRDA 4LRTB 3U5TA 3CKYA 3DTYA 3LK7A 3OICA 2GDZA 3R3JA 2AA3A 1B3BA 2P2SA 5K6AC 4L0QA 3LDHA 1YBMA 2NQTA 4ESOA 1JAYA 1I3KA 5JMWA 3AM3A 3ZHZA 2O3JA 4IMPA 1SAYA 2HK9A 4J1NA 3OEYA 5TSDA 3JQGB 4HFRA 4YJHA 4DQXA 1C1DB 3AI1A 2I66A 2ZB7A 5LC1A 4AJKA 1DBVO 3KLMX 3IUSA 4B7CA 4FBGA 1I0ZA 2G82A 5C3MA 4BGIA 3AJRA 5DF1A 2XOXA 3P2YA 4HY3A 4MVJM 2WDZA 4RPHA 3FNGA 4B3HA 3FPLA 1A72A 3FSRA 3E9QA 1Y7TA 2VYVA 2AE2A 2HMWA 4FR5A 1T2CA 2CFCA 1P9LA 1XA0A 2Y99A 3ZU3A 5U1PA 4FJ1A 1TT5A 3V5NA 1WPQA 4J0FA 1WVGA 5ILGA 4J1QA 4RVUA 1L1FA 4E5KA 2FOIA 4TKLA 3F1KA 1EUDA 3JQ9A 3V1YA 3K9QO 4RF3A 1Q2XA 4XRRA
chains in the Genus database with same CATH superfamily
1E79D 3TSOA 1PJ8A 3SS8A 1SUFA 1P18A 2G06A 1OX5A 2PV0A 4A8TA 3CLUD 1TKBA 1Y1QA 3ZYCA 3BIFA 1NLYA 1PWXA 3VPDA 1PQWA 5CNMA 4IEFB 5EE3A 4TXNA 1SPBS 3RKUA 3SY8A 4ZCQA 1DI0A 5CTAA 5GQSA 4XIJA 1DJQA 1T0JB 3BDVA 4QDKA 5EZYF 3JZMA 3L0PA 4NBLA 2QHXA 5EIHA 4CKZA 2X77A 1QVZA 2QN6A 4H7IA 5DTRA 3T3MB 1B23P 4M1WA 4UBIA 2BHSA 2XXAB 1NI5A 4NX2A 5IT4A 5DSZA 3HA5A 2LVBA 4EMSA 4ABYA 2Z08A 3DAPA 4O4LA 1VPLA 3GARA 3K9WA 4EJSC 1AQNA 3UPTA 4OHYA 4UHDA 1A1SA 3OM1A 3OZIA 5AJWA 4J0QA 1TKCA 5AH0A 2QP3A 3KVRA 3ZXSA 2VLBA 1M76A 2YN4A 3HK2A 3EGCA 4ENPA 1M2OA 3NHYA 3U26A 5BSUA 4YCMA 5EJEA 4P3OA 1IHYA 3ZGXA 4BLQA 4IJQA 5JTTA 1N6NA 3PHHA 4AWBA 5C46F 3OHPA 2PE5A 3WMXA 3NO4A 1XTVA 4L0DA 2P9ZA 2QP9X 3DA8A 2PWPA 5DN9A 3R3XA 4K9OA 1U4SA 5LNK6 2DOKA 2AIRA 3U5ZB 4UE3S 1PEAA 2IXFA 2IZ6A 1ATZA 3H1PA 3GMTA 3OQMA 1EU1A 4NZPA 1ULUA 3KVNA 4FKZA 4OY3A 4XD2A 4D6YA 5DHFA 2IHJA 2YX1A 3CFYA 3BJRA 1WQ1R 3C48A 5BMVB 2VT3A 3BH0A 4BLRA 1ZSNA 4JDUA 3IV7A 4QXQA 3KQTA 1SCNE 2B9VA 2WLSA 4H1WA 2X19A 2CZCA 1ZIOA 3V48A 3W6OA 2NTVA 3DE7X 2EKDA 4YUWA 1C0PA 2C1ZA 3DBRA 5H16A 3MIIA 1U3CA 2AZ4A 5AHKA 4KZPA 5K0LA 4C0HA 1FSGA 3PLNA 4NWIA 1UODA 1PG5A 2H2DA 4HPWA 2VJKA 2BAGA 3PGXA 1WP4A 5BWNA 3CVYA 1N2CB 2A57A 4O4JB 4OBBA 3J81A 4W5TA 3CF6R 2P6OA 1CDEA 1KYVA 1QE0A 3DMGA 2WJVA 1U9ZA 5HS4A 2IX3A 1D1TA 1T8WA 5JRZA 1EBBA 3H9QA 5KCZA 3OQOA 3PNMA 1OXTA 5JO9A 4B6OA 3KCQA 3T4XA 1ZH4A 2VDNB 3G5TA 2CW5A 3WGJA 1FFXB 3N6XA 2NO0A 2WUWE 3VPBA 2BC9A 4JBYA 1P5FA 2QNBA 2XTZA 4MV1A 3IOCA 3USZA 2ZSKA 2BGIA 1ILEA 2XUJA 1DWOA 2ZI4A 3OAAA 3UB3A 4YCBA 3M6IA 1Y4UA 4WTOA 1GGEA 3EXIA 4X1IB 3IAAA 5EJ2A 3ADOA 3EG9A 1YCGA 1GCGA 4K87A 1OV4A 3SQMA 3UN1A 1GGKA 3MYRA 1VHQA 2J4DA 3OFVA 1EFUA 3FD8A 5NULA 1PW5A 1KL7A 3AC0A 3I8OA 5AVJA 2DPXA 4PC2A 2OR3A 3DTTA 3GPLA 2VJQA 2HHHB 1W8IA 8ATCA 3DBLA 4YJGB 4O63O 2VQDA 1R2QA 1G3MA 1EIWA 5JXHA 3LX8A 2B8JA 2I80A 3GRAA 2QM7A 2VNHA 1EBUA 5DFAA 1KVRA 3Q6IA 4WCVA 5KOJB 2A6PA 2FGKA 4MNTA 3OIGA 3HN7A 1UJNA 3DQQA 3B38A 1FDTA 1GEEA 3L7BA 3JD3A 1C9YA 5K2MA 1F3LA 2XRYA 5IUNC 3A2KA 1FFEA 1MNQA 1G8MA 2B9EA 3ILYA 4GMGA 4H7JA 3V3KA 3EQ2A 5JFTA 5H7XA 2XF8A 2YZNA 1DXQA 1S89A 1Z38A 3GFOA 4RVCA 1UBKS 2QZ4A 2WWTA 1L4YA 1GV0A 1P0PA 3HI6A 3IDSA 3QPWA 3ENVA 4I14A 4QEZA 4EG7A 3G0OA 1NRWA 1P1RA 2VAPA 2Q9UA 1I0LA 2MSWA 4GZMA 2QJTA 2YY5A 1GARA 4HXYA 3LL7A 1G9TA 3G2HA 4MHOA 1OC2A 3MWKA 5HDBB 1CQJA 1OXSC 4F2GA 1H8HD 1YZGA 3C15C 4XWGA 1ZBQA 3I32A 1BOOA 2H52A 3R5JA 5T7BA 1GQFA 4ZYVA 1H6AA 1ZOLA 4BN4A 1JR6A 5ALQA 2N42A 1I7LA 1YJXA 1AXGA 1ZESA 2OCDA 2PHZA 4OQPA 5GM2A 3UK6A 4XR4A 4LCEA 3S68A 4Q48A 2UVPA 3CVUA 4JXXA 1D1SA 4OMDA 1RXEA 3WLLA 1XWIA 3IS3A 5EMJA 4DJTA 2P2GA 2Q5OA 4XWTA 2CNLA 1AOXA 1SHJA 2FPGB 1P2BA 2JFYA 2VH1A 2XADA 2ZDHA 3DD1A 2X0IA 2GYWA 2GUWA 3ETNA 4PCLA 5FEMA 3RS8A 1E6LA 3MTBA 3H8SA 4ER6A 4P84A 5LZ2A 1TMKA 1IEVA 3A1CA 4A2PA 2HYDA 3E82A 3RRBA 3BHJA 4XTCS 2Q6KA 4RIFA 4W9RA 3H2JA 3L0DA 4D3DA 4DRXB 2ZLBA 4ETNA 4ZO8A 2A33A 3ZHRA 3ZJ4A 4BNGA 4COKA 4G26A 1FLAA 3Q5DA 3KT0A 4JBWA 4JGBA 5KWJA 1Q15A 2ILTA 4RF2A 2ZEJA 5ENDA 4ARIA 2XNHA 2EWMA 3M81A 2AFIE 4L4SA 4DB4A 4S1NA 3RFTA 1SN7A 1KJJA 4DQKA 5LPNA 4MLCA 2OCLA 4FYYA 4R2MA 3HDYA 4D2IA 4HYEA 2I3BA 1YQDA 4I1SA 3VDRA 4EEXA 2GN4A 2W6CX 5L9AA 2ZI7A 4WY5A 3KFLA 4J1SA 5EERA 1XLTC 5FUVA 3R8FA 3KYJB 2WYOA 3PUWA 2GZSA 4OQLA 3TXAA 2PKRA 1SQFA 1ZW1A 2O5VA 3BCHA 3FZGA 3DXFA 3JSXA 3OUZA 3OY7A 4U7JA 4ZYZA 2Z5LA 1W36B 5H02A 3I9V6 1JN0A 1V96A 4A6EA 1TJNA 4C1BA 4EHLA 1G5HA 2IP1A 3IE0A 4KMRA 3VTKA 4MVXA 4O8CA 1OBFO 3I1FA 3GGOA 4D6PA 4F3CA 4ZFNA 5K4GA 3QE4A 4U7GA 1WV1A 1QQAA 2H06A 2J45A 1I14A 1RWPA 3QXHA 3IR6A 4GWGA 3ESBA 1GU7A 1XK6A 4W82A 4DR6B 3TJZA 4B74A 3CF0A 3IAS6 2FFAA 2NOAA 3F6YA 1L2TA 3AFIA 1JMVA 4LCJA 1NMEA 3R5TA 1YQ9A 4YCJA 2JNWA 4IHJF 1VMDA 4Z8YA 1R18A 3M2TA 4N5NA 1C5KA 3AFHA 3N74A 1C0KA 1JFLA 2H16A 2JD2A 3OEWA 5TEVA 5KYKA 1OQAA 5HSGA 5FUWA 3OU7A 2I1QA 1PG0A 3B3GA 2BTEA 4G36A 4A0FA 4D3SA 1FSPA 4R41A 1M6VB 3PQEA 5AW0A 5ESXA 2JFXA 5EVJA 2C82A 3PJFA 5BN4A 2NT3A 4QBTA 4MYRA 3AETB 3P0HA 4Y3UA 4IGAA 3UMMA 5GIPE 5CAEB 3ZWMA 5G0WA 1NVMB 1Z28A 3TXYA 3VUFA 2BEKA 2Q3FA 2PBRA 1G21B 3OO1A 2DQZA 2ENUA 2NV2B 1WR8A 3C97A 3L8HA 3T61A 3UFXA 1KDRA 2HA7A 5FUXA 2W37A 2B25A 3CA8A 5I7VA 2YUTA 4MQMA 2BDUA 5AW8A 3MOGA 1JXQA 1MORA 4KV9A 2AI3A 3GIWA 2I3AA 4XTRA 3MLEA 1CUVA 4Q3KA 2CB0A 3U49A 4AN0A 4F91B 2OXEA 3BRSA 4HTFB 3WE7A 1IPFA 4WZAA 1ZUWA 2G1UA 4WW0A 5I4KA 1LDYA 2NP6A 5HS6A 4K9LA 4YP6A 3M4YA 1XTJA 1LRLA 3L5KA 1AUVA 2EQAA 1XRRA 2DU8A 4MJXA 1X80A 2W2QA 1Z16A 1ZI8A 2H5IA 1UOOA 3NBXX 4NNJA 3O4JA 3AIOA 4V38A 3TTXA 1TEVA 2F2TA 4UAUA 3GRUA 3F96A 4NCJA 4CI9A 3T5BA 5JT1A 5LP1A 4HLNA 1QB7A 1S6YA 3PT9A 5B7GA 1SUPA 3QW4B 1W5AA 1KZ1A 3CUYA 2DPGA 2TMDA 2YJ5A 4I6EA 1LDNA 1XLTA 4GZ5A 4LGYA 4FB4A 1MA3A 2ATXA 5CPFA 1MMFB 4WZBB 3UW3A 5GM1A 1XMJA 1VMAA 4RS4A 3KZOA 3OETA 1T8SA 4LDAA 2ZSHA 5D3ZA 3RG8A 3CZRA 4FLFA 1Z82A 3OQIB 4UDYX 1E8MA 2Z2KA 2ZP1A 4N82A 1X1BA 3ORYA 5E1OA 3THWA 5ECYA 3NIGB 1Z5PA 3O2QB 3HU5A 2NVBA 5G0SA 2PUJA 5G3ZA 3R76A 4Z4CA 1QP4A 1XTBA 1QQ5A 2P1DA 3D1VA 2RHMA 3F97A 2PT6A 1GXSB 3G5MA 5K03A 3OTOB 3BH6A 4K28A 1UZUA 3GDWA 2Q1YA 2QS9A 3S29A 4XFJA 2JFGA 1SXJD 1SXQA 1II9A 1MXHA 1Y1LA 2FNAA 2ZJ4A 1ZNWA 2GBIA 3QWAA 3R0VA 4I4LA 4ICIA 3RJ9A 4RKRA 4UTXA 1BROA 4ENSA 2PKEA 5U4QA 4G67A 4MPRA 3K35A 2Q5LA 1TIKA 5BVHB 2B83A 4WFKA 1UKCA 2CDAA 3DXYA 1Y33E 5PNTA 4DQVA 1PLKA 3PCTA 1Z22A 1CX9B 1NN1A 2WFLB 4O08A 1TEXA 2VAMA 5G02A 5CDFA 4AO8A 4B9AA 1Z2CA 5DLYA 1RC8A 3FAKA 4GBED 4TT8A 4WLVA 4DR5B 3FIUA 2J4CA 2F1RA 2ZYIA 2C5EA 3DE2X 4JMLA 2O9JA 4RMIA 1C1XA 1EUQA 1GLVA 3PBKA 1JTEA 3GEMA 4QU9A 4ZWNA 2HQ1A 2HWXA 2OYCA 3ZQ6A 2OBBA 2A88A 2CF5A 3CW2A 4ZU1X 2KWIA 2P40A 3BMNB 4GPD1 4DYDA 5C1DA 3GJ0A 5A6VA 4C5BA 2PUGA 2YQ5A 2AOVA 5DNDA 2C03A 2R11A 1P4GA 2CUTA 3FWPA 4RD3A 2H9IA 1M34B 4LY0A 3L4BA 4DIDA 4P31A 5IJ0B 5LYJB 4ALKA 3N05A 1DOHA 1XTUA 1HYGA 4LTMA 2JIQA 1GU1A 1Z18A 5JCOA 5CA1F 2IH5A 2IPOA 1FFGA 5T3UA 1V2GA 1GQQA 4P7BA 4JLVA 3WZMA 1CY8A 4ZJUA 5KOHB 3M4JA 2ZBEA 3AEYA 4FWTA 1ZN7A 2DUNA 3WC4A 1XTQA 3VHRA 3GUZA 3O74A 1FSZA 1CF9A 3NHRA 3OH8A 2CCKA 3CWQA 3OT5A 4HGRA 4D26A 4E46A 4GI2A 5AHXA 1RYMA 5IJ9A 4NCNA 3FFAA 3X1WA 1E99A 1ZZGA 3ESAA 1W2WB 1H8EA 1JLKA 3WLRA 3WB2A 5JISA 4UBMA 3R2JA 2Y6VA 1FFCA 3QH4A 3HYTA 1ZUNB 3A4YA 4PZCA 5HIJA 4DWJA 5IAAA 2Q7DA 5CEFA 1DJNA 2UVPB 2YJ4A 1Z7WA 1RE1A 3DLPX 1WJGA 1JFSA 2CMHA 3TBHA 5JAQA 4RA9B 4M46A 1ESMA 5KQRA 1R12A 2XWSA 4RTSA 2GB4A 5J2UA 2YVQA 3AW9A 1KSJA 1HQCA 1V11A 2IEYA 4N0QA 4P22A 3PFNA 2Y71A 1K06A 2XTAA 2QQGA 2IDJA 3ACCA 3N0TA 4MWOA 3S55A 1FEZA 1V8FA 4BZZA 2QUJA 2ZXFA 1NWHA 1CR0A 1UC5B 1XKLA 3HU1A 2ECFA 1UMDA 3Q5EA 1R0XA 3TK1A 1KEZA 4GVXA 3R6TA 3UK1A 3E7PA 1IE3A 2O05A 1PJBA 1HEYA 4W5HA 3IAHA 5EZSA 2HL6A 2ZTMA 1O54A 2F90A 3AW8A 1RRKA 3BWCA 4JXKA 4KDCA 3GCZA 3UVEA 4CKCA 3EGXA 1KVQA 3JALA 1QUEA 3W78A 3FGOA 1GAQA 4WAUA 1JKFA 1MJ5A 2PRZA 2WIFA 3OCYA 4LZZA 1QVWA 4UU0A 3W6UA 3T9CA 1HFEL 1IHPA 1L7BA 4GOND 4A1OA 3EIWA 2VUHB 4BLVA 4C43A 3ZIUA 3SHVA 4PHTA 3EIQA 2WZQA 1M10A 2CLDX 3KJEA 5TMBA 4OHFA 2ZATA 3VX3A 1XD2B 2BF7A 1PTKA 3LQKA 1U8YA 1VKRA 1XK7A 4ZVOA 5CYFA 4Z86A 4BJ3A 5LMZA 5T67A 5AHWA 2DLDA 3O5AA 4PVDA 4R69A 3A27A 3MLAA 1FP6A 4KSBA 5E1MA 3RTBA 3IGFA 1XR3A 1Q57A 2HTFA 3A6ZA 2CKMA 4AX4A 3OUUA 2WSMA 2AX3A 2VXOA 4Q1VA 4MW2A 4TVKA 1CS4C 2XLCA 3PRYA 1FMJA 5CJPA 1A69A 3AOGA 3WGQA 4L51A 4BAZA 2F4NA 2CMKA 5AW4A 4TQAA 4C3UA 1E5XA 3PXEA 1WTAA 1XZQA 5IDVA 1GA1A 2OZLA 4U7TB 3VZBA 1UAYA 4UOEA 2BRUC 3FRJA 4N7MA 2UXBB 5JUWA 2BMFA 3PNSA 2HA3A 1SZPA 2Q4TA 2QX9A 3IQXA 4LBYA 3T0GA 3BORA 1VYHA 1YACA 3TQSA 2WMDA 3GT7A 2M98A 2TSYB 4KXNA 2GN8A 4ITRC 4DJ5X 5CDUA 1VE6A 4IVNA 1CUBA 3NT2A 2RGXA 4CIAA 1JS1X 3H2HA 1ISJA 1EFCA 2E3JA 3IAUA 3FXAA 1LK7A 1VI2A 5DULA 3ANNA 2E4XA 2HMYB 2H7CA 2ZYGA 3C8HA 3GH1A 3PX2A 1T9CA 5AKJA 2GX6A 4FLEA 4EBBA 1JKIA 4L50A 4WNIA 4K6CA 2V98A 5FPSA 1CG6A 4NOKA 4FN4A 3PQ5A 2JK1A 4FX2A 1AHNA 5AOAA 5CTJA 4US2R 3U7JA 4RTNA 3NI2A 1JIXA 2BZSA 5ISMA 1DOAA 4IQ0A 2PL1A 4ROSA 4QXPA 3RSLA 3RARA 3KU4A 4WKPA 3N75A 1H65A 1MX3A 5ALEA 2E4ZA 1CUZA 4WXEA 3AP2A 4Y7CA 2JVKA 1LSOA 2ATIA 3D4IA 3AOEA 3PUZA 5BVHA 4I4TA 1YJCA 3NBKA 3MTIA 4L5IA 3V9PA 5FKJA 1EG2A 5GGYA 3K0HA 1VPEA 4S2EA 3ZHTA 2EGHA 4EGFA 4G0MA 1NKTA 2WOOA 1G9SA 4WK2B 3LPLA 5D2CA 3A14A 3ZDFA 3O8RA 3PQFA 3M6XA 4RPIA 4ALNA 1B43A 2R68A 2CB9A 2WUEA 3TLBA 3Q3JB 1TE2A 2XDYA 4GPAA 1TF7A 1JIIA 2IX9A 1XD9A 2PL9A 1U7OA 1RMQA 3L0OA 1RLJA 2VPWA 4F45A 1APBA 1RJDA 4KCGA 1WDLA 4JV5B 3ZU6A 1NVGA 3FYSA 3ZZTA 1Y5IA 2I33A 1QTRA 2Q3JA 3DO5A 4B17A 4NC9A 1JQ3A 1GRRA 1AZSC 5B57C 3FJ1A 2PUCA 4O3MA 1QP8A 4DCTA 3TSZA 2W6OA 4DUYB 4RE6A 2V9ZA 4LVNA 1KC3A 4YDQA 2Y1CA 3CYFA 2ZRAA 5C7YA 2C59A 5LA6A 3WBKA 1C9EA 4CQLA 3NALA 3RIGA 4UQOA 4AJ1A 4DLPA 4GXNA 4RTJA 4NQRA 2NXWA 4AS3A 4BO4A 5E9QA 1YA6A 4NDAA 5BSMA 5BMOA 2BCEA 1RQPA 4X3PA 4EY6A 7ADHA 1YFKA 3LYUA 3O26A 4H4DA 2LIPA 3E22B 1W4CA 4PXYA 4MRRA 1Z0DA 4DDHA 4B3TB 3WIOA 4IZOA 1E7SA 1XD8A 3V1LA 2CE7A 4HRAA 3WIEA 5KPDA 2JL1A 2LR0A 4TWZA 2IU6A 1NW9B 2XGMA 5EJ5A 3I5UA 4PAMA 1U63A 4B82A 1Y1RA 1QANA 4JEHA 5T8KA 2IIPA 2Y0CA 4N3GA 3H9JA 2A67A 2CMDA 2WYIA 4M0KA 4ZQCB 4AYXA 4PGAA 3JQQA 1XZJA 2AOUA 2VHZA 3VC2A 3WAGA 3HKDB 4EPRA 3NBAA 3HWSA 1TLLA 2JGJA 3KYIB 1L5HA 2H31A 3TL6A 4QJ5A 1NMSA 5IXSA 5JZMA 3AKZA 2MSDB 1RW4A 2O52A 3KZKA 4X61A 5KYVA 2OQRA 4HVTA 3O0DA 4CR6A 1SRRA 1U3GA 2XF2A 1NR5A 2ZIFA 4XWYA 3LY5A 2JCYA 3E05A 1ODTC 2HCRA 3GWZA 4HAWA 3B3AA 2REXB 3KAPA 4NU0A 4UNIA 4XLLA 2QN8A 4AJOA 3PEWA 4DRXA 1J24A 3DE4X 1OZHA 4PTYA 4PIVA 3JAWB 3T3IA 5AVTA 1DIRA 1LLFA 4UVGA 4B83A 1WHTB 4RTOA 3IQIX 4IXTA 4PTLA 3GRPA 1E5QA 4G4SP 4KQ9A 1PEYA 2NAPA 3VPHA 3T7DA 5A4IS 4B7AA 2VSFA 3AJ8A 3OF3A 3U4CA 2XB2A 1XN1A 3LHSA 5C5IA 5E95A 3PLRA 2R6HA 4D5EA 3PIDA 5TS3A 3UBTA 1FUUA 3L7IA 1SKUA 4D25A 3K94A 2J9GA 4U5QA 4XUDA 9MHTA 4YRFA 2DR2A 1FZTA 3I28A 1G2QA 1JR3A 1M2GA 1T10A 3MWFA 5F4ZA 4XWKA 5C81A 3CRNA 5EHZA 2V6IA 3WBJA 2X13A 1QOPB 3ND8A 1JZSA 1ZIXA 1R3DA 2FFRA 4RIHA 5K99A 2LW7A 5K8CA 4GPZA 4U5XA 3KJXA 3LFTA 4Y6OA 4F2HA 1JYFA 3KOXA 4C7BA 5LJLA 3N2LA 5HJ2A 3DE1X 1PBTA 3X1ZA 2QXUA 2RB5A 1MZPA 1IMOA 3C3JA 3R7LA 2N46A 3WWEA 1UP7A 4GRDA 2YH2A 3HACA 1N4DA 1X7WB 3EPKA 2C0CA 4NH4A 5EZYB 4PPYA 4PPQA 2IYFA 1UXJA 4ENUA 1ODKA 3CLUC 3P2IA 1Q12A 1MT3A 5E6RB 4MRNA 3X2EA 3JCZA 4RACA 3CX8A 2YDXA 1KDPA 3DD5A 4Q5IA 1EFKA 5EHGA 5BNIA 4JT9A 1QX4A 2Z5VA 2BFFA 4AMUA 5JW6A 4X95A 2ACVA 4RZUA 1T36A 5DB4A 3TNDA 2O7QA 2MYTA 3LX4A 3S70A 4IGKA 1ND6A 3JVUA 1SKAA 1MB3A 2VP4A 1IFXA 1T9ZA 4FOLA 3DCIA 4TS4A 3WJ7A 2GN0A 1L6IA 3EEOA 2PG3A 3ANMA 2I8CA 2H08A 2QN3A 4P34A 4EUSA 4KNYA 1EDZA 1KE2A 2RHDA 4IGFA 3TQOA 3R3WA 2I2WA 5E6RA 5EJGA 1RFGE 2IF0A 5AKIA 3T95A 4YH1A 4H3VA 4AKSA 4DDKA 2EG5A 4UZEA 4IIJA 5BOSB 5I4BA 1KYXA 1QK3A 1G4UR 3KPYA 4HGYA 1A9PA 2JFPA 2YC4C 5CLLA 3QOFA 3UIEA 3RBVA 3BL5A 3QV1A 5AKYA 2WNSA 2ZCUA 5D7NA 3IVXA 1ZOSA 2FUCA 2VTEA 3NUQA 1WXWA 2GF9A 4HEHA 3K9BA 4LOJA 4BTEA 3OECA 3IPXA 3OQ1A 4RNCA 2PZJA 5IEBA 4QAQA 4ZOLA 3DL0A 4BY9E 3CZQA 1DJPA 1U8ZA 2G70A 4II7A 1CJCA 4BJ1A 2NPIA 2UU9B 1U0FA 4G81A 3LLSA 3VZQA 3HYNA 5JR3A 2P9BA 3ROQA 4NATA 3O3OB 1Q1QA 4HBZA 5G4KB 1G17A 2QQEA 1QU3A 4OPMA 4HGQA 1YVDA 1Y82A 1M7HA 5A1TA 3HSKA 2RHHA 4CKWB 2IY9A 4Y0NA 2Y05A 3MWDB 3EISA 4KWHA 5GMOA 5TVGA 3B36A 3ST7A 4G1FA 4NDNE 5IJ0A 4AKIA 3RYTC 1H3NA 5F5LA 2IBSA 2O2EA 4R81A 3T5CA 1AUOA 3S44A 1AMUA 1XEWY 1FU7A 1YCDA 4L8LA 5D51S 3C3EA 4ZEVA 4UAJA 3B7GA 1VB5A 2GN2A 3AIMA 3FWNA 3M6MD 4NE7A 4NZ9A 5FBRB 3WJ2A 4C2UA 4Y8VA 1FX0A 4ZQFA 1A97A 2WT9A 4FCCA 2O2DA 1SVSA 4GMXA 2W2VA 4QWWA 4CKWA 2GEKA 4YRSA 1BDMA 1EX9A 4IQ4A 5ALZA 4ZU3A 1WBBA 4KWIA 4DCCA 1DDOA 3AVYA 3GDHA 1VXOA 2RK6A 1OROA 1QS0B 1L9XA 4AU1A 2GI4A 5BV2P 4CLRB 3S2YA 3U7RA 3CJQA 4XYLA 2VF2A 2R44A 2WU4A 2HQRA 2C7GA 2JIMA 2AGVA 3EBLA 1PWEA 3UT5B 1DAFA 1SCKA 1V37A 5DCWA 4UAVA 2J6CA 2WHPB 3FHOA 5CCDA 3T52A 3D8SA 3TTUA 1N2OA 2FUEA 3TZ6A 2JJMA 3JZFA 3Q3EA 3CNBA 4RLHA 1N9ZA 1JU4A 5FWDA 1PNQA 1R6XA 4LC0A 3UKOA 1KJNA 1QKKA 4QNMA 1FW6A 4BLPA 2J9XB 3ANYB 5D87A 4ZIRA 5BN3B 5HWSA 1TYZA 1DKQA 4OYRA 3TAXA 3ETGA 3MJSA 4FJ2A 2FEXA 3DE0X 4IUCS 1ODFA 2FQXA 3FYUA 4MITA 5G53C 4B6PA 3OZVA 3WNVA 5GADl 4YDSA 2NV6A 2WT4A 2XY4A 4RVNA 1H94A 1G3UA 1YZYA 4YT8A 4CTMA 3IDOA 3R9XB 1MQAA 3BDAA 2R0QC 3UCFA 5ALWA 2FWMX 4AUNA 4BBJA 1YULA 3L7DA 3A58B 4DXDA 5FOQA 1EGHA 4RFSA 3U7QA 2EP8A 3EBPA 2JLVA 1V41E 2BOVA 4KO8A 4O5AA 5B58C 1LDGA 1QKJA 3DG9A 4GICA 3DR3A 3I58A 4I6JA 5JNUA 4MDFA 3P9YA 3OVMA 1M8GA 4HV4A 2NUPA 3G7SA 1KYZA 1EDBA 2I3DA 1JR3D 2FX3A 4IDBA 5EFOA 1BQ3A 1X7ZB 3WHLA 4ES6A 4PS0A 4G24A 4A5SA 3BULA 4N5LA 1LBIA 1IPHA 4KLZA 2ADOA 4Q47A 5FJJA 10MHA 3DYVA 2CHGA 3U7IA 1Z63A 1VYTA 3TNFA 1W47A 5I7OA 1D6JA 1G7RA 1W88B 4EHBA 1WW2A 2UV8A 2HN9A 1X77A 3W7AA 2Y1OA 3EGIA 5NLLA 5TQ2B 5THXA 3RK1A 2QTTA 4MVJA 3KO8A 2PNFA 3INGA 2HZ7A 4J9UE 3AUYA 1T1EA 3ANLA 1KI4A 1NP3A 3LXUX 4DVGA 2N0SA 1LH0A 1HT1E 1OFTA 2RARA 5KKAA 1F6WA 2PLNA 1DMRA 3NVMB 1I10A 1DQPA 1B8UA 3RSZA 1RYBA 4DA8A 1LS1A 3U3XA 2BJVA 3KE8A 4PAGA 1CLUA 2XB9A 4I9HA 4J7UA 5JATA 4LY6A 4UTPA 4ZZ1A 5K0SA 1J8YF 1DEKA 1QGAA 2IQIA 3A7EA 3MTQA 3RVOA 4EUFA 1CEXA 1Z3CA 1B1AA 1JIVA 2DAPA 3KSUA 4URZR 4JIGA 1U8TA 3DCNA 4AJJA 3DH0A 3H97A 3DT8A 3B3QA 4UZFA 3EYAA 1ZISA 5CH3A 5KOJA 2OCAA 1BXRB 1SHUX 5K5EA 2FW9A 2XE7A 1WF6A 3I1IA 3K1AA 1VM6A 1UOQA 1T3SA 2QZJA 4JJ7A 4L22A 1ZJ4A 1KOJA 3DEZA 3ZHYA 3H1GA 4EB3A 5FL7D 1G291 5K0NA 4G0PA 3ZH2A 4F0JA 3V32A 4EECA 3CX4A 3PJEA 3PICA 5DBEX 2C0PA 1NUHA 2B1GA 3NOVA 5E9AA 5L3QA 4EP1A 3JQ8A 3NXKA 4ZQEA 2CZQA 3TL2A 1G98A 1AV7A 1K9VF 4WGGA 1QQBA 1QSGA 5CMLA 4RY8A 2WOJA 1JSXA 2ASVA 4KK3A 4CMBA 4RJLA 4ENVA 1WSWA 4C0KA 4WKNA 2O2IA 3PGKA 3DJYA 4PF1A 4LC9A 3N76A 5E0OA 3WICA 1E3JA 2PGJA 4QTZA 3EVFA 4B3RB 1JDTA 3E9NA 2YW2A 3INNA 4IIDA 1NXXA 2UYGA 4BO1A 1XZHA 3BCUA 4RY0A 2VJLA 4DR7B 3BHNA 2FP4A 1Z47A 5KSOA 4M0EA 4BTLA 3OTIA 1F5NA 2J08A 2E4VA 3B9PA 1Q0LA 3DVQX 5ERXA 1WA5A 4IGIA 5FPYA 3JQEA 3LBNA 3EODA 3KD3A 1EDEA 4HNHA 1CJUC 5JMOA 1J1ZA 4FMDB 1IATA 3LHKA 5SY9A 3VH4A 4EDFA 1ZH8A 4Q3AA 4GIBA 5KS2A 5HCIA 1J6UA 4CQJA 4NARA 3W77A 4RK7A 4ZGGA 2TMYA 4IZIA 1M1XB 4K6FA 5ESDA 4F06A 4AVYA 2EZTA 1JZQA 2UZ0A 5LBUA 5F7OA 2G5GX 2IYRA 1Q3HA 1I5OA 3PE4A 3M6WA 3SC2B 3WL5A 3EUFA 2X0EA 4HJXA 4EGCB 1RCFA 2QYHA 4TL6A 1Y34E 1W93A 1ZMRA 3MSCA 4D79A 1FYWA 3LUBA 4G63A 1XYYA 4B7UA 2KE5A 1CVLA 2VDQB 3RU3A 4M9UA 1FP7A 1TTTA 2X9GA 4ALLA 3HJGA 1JBKA 2NUPB 3RAFC 1J8DA 4I4TF 5A02A 4XEUA 5KTSA 3TR5A 3OTQA 4HBGA 1AK2A 4IFBA 5KNBA 3GEDA 2ZJ3A 1IWPB 1OFUA 2A30A 5FWAA 3JQBC 1W4ZA 3PE3A 5G0TA 1L3BA 1D2RA 3DE6X 1OC4A 2IHYA 1GG2A 4L8GA 3WGHA 1F8FA 4D45A 1OFUX 1CXZA 2Z6UA 4OA5A 4OB8A 1CFJA 1X80B 3NAGA 1ECPA 4Q4CA 5CFQA 1M1NA 2ZAGA 4NZZA 1YVUA 4CL8A 4QBIA 2PAFA 3E23A 5A7HA 4JR1A 2JI7A 4HEQA 1RVDA 2JAWA 2JRLA 1E79A 1T4GA 2DPLA 3A0UA 4K6OA 4DC1A 1ORRA 4UOZA 2I6QA 3CVWA 3N87A 1ZMBA 1PZGA 1N2XA 1QLJA 2F1JA 2H4WA 1GFSA 3MWEB 1SIWA 3P2JA 1A1VA 3MJEA 5CYPA 4FKMA 1CY0A 3W5SA 4YDRA 4BAUA 2DE0X 4I8DA 4J91A 5K2OA 3R5HA 3DBLB 3WOVA 2Z9DA 2I7DA 3H42B 4M6WA 4UBKA 2PU5A 3THRA 3BBLA 4PC7A 1IOZA 2A4KA 3TBFA 4B0PA 1OGYA 4Z7NB 1R0YA 3JRWA 4OUKX 5B2ZA 3R0JA 2PJZA 5DIZA 4BNYA 2G1KA 1K98A 4WLUA 1PT5A 3AI3A 3TFWA 4B0OA 3FYUC 1USVA 2VEDA 1DIBA 2GPJA 2GT1A 4XX0A 1J2YA 4XPIB 5CDSA 4CV1A 1P45A 3DLHA 3WK9A 3N6VA 3QE9Y 4Y7DA 4AG6A 3G02A 3ZWYA 2C8VA 1C30B 4UEQA 5HQJA 5JLAA 3K9HA 1D2GA 3MINB 1S3FA 4MWTA 4QARA 1IM5A 4YO8A 3VDQA 4Z0TA 5KTNA 3HEBA 3LVQE 4EVQA 1SB9A 1YIOA 1EM8B 4KMMA 3WKAA 3GC6A 3M5PA 4NONA 4R5HA 4GOKA 2GBLC 3BVPA 3N0XA 4MV8A 2ZGVA 3ICPA 2O3RA 2JDIA 3G49A 3U3KA 4ESEA 3LM8A 5GZ1A 1A4RA 1M1YE 2HPVA 3NHSA 1MV5A 4XX0B 5FFMA 3BFVA 1XF9A 1KZYC 5ADUS 3M1AA 1Y4ZA 2FFHA 3LRXA 2IITA 3D6HA 4ZZ0A 3UMGA 3G7UA 1WXQA 5DX0A 3P4XA 2I87A 5LQAA 5KAMA 2QIOA 1VB3A 2QLJA 3R1IA 4UDXX 4NYJR 3LY8A 3AF2A 2B5VA 3S5UA 1NPYA 1OH8A 3IEVA 3HGQA 5B36A 3TNJA 4G09A 3LL4A 3NQ41 4OYLA 1XNHA 3OCUA 4CM1A 4IJVA 3TW8A 2M6SA 4H1TA 2PYDA 3IE2A 4X0EA 1X1CA 2FFJA 3M1IA 4E33A 5CFNA 1ECBA 4Q9LA 3W5AA 2HJVA 1T3LA 3I5MA 3JARA 2NZJA 3NNDA 2YVAA 1XCGB 2C95A 4IZHA 1HT3A 3V2UA 4M1EA 1YJ8A 2BEVA 1NW7A 3QTBA 5ICMA 3NGMA 1ADYA 3ZLVA 3VA7A 3DTVD 2YJGA 3Q0EA 4GOJA 4KXXA 3RJTA 1G5IA 5EE0A 2WAXA 2WV7A 1J2RA 4BLTA 4JR0A 4P54A 2IVZA 1H23A 1BHJA 1PEDA 1T0IA 3CPEA 4RJKA 5LDDC 1U6JA 3AR2A 4KJZA 1EESA 1ORTA 4E4RA 1KSGA 3A0RB 2LKCA 4PLZA 4A8JB 5F5NA 5FRDA 4B85A 3BD9A 3LFHA 3C41J 1ZX1A 1JDUA 3DAHA 4YIKA 1HE2A 2D59A 2ZB4A 4GUAA 2W6ZA 1J56A 1QVAA 5IC5A 4BVKA 1RWXA 4CTOA 3QF4A 1QGUB 5AI8A 5E38A 3B2QA 2BR3A 2QVLA 1ZQ1A 1A4IA 2A9FA 2RG7A 3LP5A 1NAHA 2E1PA 1UBRS 4ZREA 1YAHA 1T3TA 2Y1FA 3KZ1E 4FDVA 2UUPA 3RUHA 2ZB8A 2I67A 3QEOA 2DR0A 4I36A 4ARCA 2IE0A 4QUAA 3MT7A 4X92A 2PR7A 2AEMA 1YJAA 2NTEA 4NI5A 3WLKX 1HDXA 1J99A 1N8SA 1T29A 2Z09A 4N5IX 3GLFE 3GG2A 1KO5A 3V46A 5K3DA 4M8IA 4J2OA 1LDMA 4DL9A 1FJGB 3I1JA 3TD9A 2WYUA 4A0SA 5HF5A 5LQCA 3HUTA 4TGLA 1NDQA 1NVKA 1TT5B 2QR5A 2TS1A 3QKUA 4K6MA 3KXDA 2CVZA 4XOUA 2O0KA 1YZLA 2ZYRA 2CHVA 4G2NA 3RU2A 3ZI7A 1IVSA 4L6CA 4P81A 2H8GA 5FHRA 3P19A 2O7NA 3CCFA 4HGZA 2G63A 4Q3DA 3T54A 4I8IA 3PLAE 1XCJA 5GOTA 1T5TA 3IMEA 3AB3A 1E0DA 4BNFA 4MW7A 3WRXC 2EWVA 2JAQA 2WIGA 2WWWA 1D2HA 3MTGA 5F33A 3THWB 2IK8A 2I6TA 3NGXA 4WVLA 4ZTBA 2PTGA 2VP9A 4MGKR 1UK8A 5ETJA 3I5YA 1NBMD 4LRSB 1P72A 2DTEA 2QROA 3C4VA 3MJDA 1IN8A 2FG5A 1Y8CA 1YL6A 1JEEA 4U02A 1XJQA 2XUKA 3EXHA 2IW1A 4F5ZA 5KQMA 3CRW1 1AKVA 3L8EA 1W5BA 3KVVA 3FPEA 3JYHA 1KK1A 1WPGA 2LDXA 2XMSA 4JLDA 3PKJA 4MV6A 2RSLA 2VK4A 3K1AB 3GPCA 2XYGA 1R0WA 1N92A 4RS3A 2WMYA 2CY0A 5ALLA 3D6MA 4TSKA 5TF0A 1M2OB 4ENWA 1CNMA 3U4QA 4JJ4A 5T4EA 3P2KA 4ZC1A 1V3UA 5HOQA 2IXBA 1IRIA 3D0RA 1QCCA 3GJTA 4MQFB 4EJ0A 1HLDA 2VBFA 3UH1A 3GB9A 3AEQA 1QUFA 2H2IA 2IXGA 3A6HA 3ESXA 4R51A 1TU0A 4DCMA 4OX9B 1H5QA 1UKAA 1E9BA 3BXGA 3GFVA 3KDSE 4FUQA 4RY2A 4DPKA 1XEXA 4RIEA 2R62A 1NVUQ 2VAVA 4IOKA 3CRRA 2QPAA 1NJ1A 4EG8A 4DQUA 3EVEA 4KRGA 3GU3A 3KR1A 3WXMA 1Q0PA 4ABTA 2QVZX 1SH7A 3ZKWB 1LF0A 5KQLA 3MCZA 2SHKA 1TA0A 2W2LD 4Q1EA 2PS0A 3C6MA 1L7VC 1PNOA 1E1LA 5HHTA 3H2GA 2IPMA 1ECGA 3E35A 3RGWS 3KJIA 4AAYA 5JPIA 2DUJA 5K0GA 2FETA 4JLKA 4QRHA 3SMVA 4BKOA 2JIRA 5JWRA 5LXTF 3FCXA 4AL4A 2J30A 2Q4OA 1LW6E 3CLTC 1LQTA 1L4BA 2PMCA 3AP1A 3FPKA 1I2DA 2Z2XA 4RD6A 4AM8A 5C1PA 3QWFA 1NIPA 1SCBA 2A35A 3WO1A 3NBZC 4ZTZB 5JO0A 3OOYA 2K87A 1D2AA 4LTNA 4QUKA 3U13A 1K7YA 1MH9A 3VYWA 1P4HA 2V5UA 5CDFE 3VKHA 2X3FA 3A3KA 1M34E 1X1DA 1ISPA 3CRZA 4F72A 4B3GA 1HBJA 2YIVX 2EFEB 4R2HA 1QLWA 2RKOA 2IUUA 1OB2A 4LXGA 3VTZA 4RUKA 3ZE6A 4BX8A 2WYWA 4BNIA 1Z7BA 1E2EA 2QUAA 2VSXA 2WC1A 2E5WA 4Q1CA 1A8HA 3UJCA 1Z6GA 3Q11A 3QVJA 4I9NA 2YMMA 1DQSA 1YZKA 3NHKA 2XJ9A 4E31A 1DRVA 3AEUA 2ZI6A 1O6ZA 4N0PA 1R0ZA 1DEOA 1MB0A 1TYDE 3JASA 3N6RA 3TRKA 3LQFA 5K8VA 3DDCA 3F2VA 4Y18A 4Z53A 3I9OA 1CUDA 2WUDA 3LWNA 1ZXXA 5DM1A 4X1KB 5L6LB 3AVVA 1PL0A 1DJMA 3QU9A 1TCAA 1JG1A 3AGPA 5D6OA 1CYDA 1G8YA 5JARA 5FNVB 2Q1UA 2QD1A 2ZPTX 5IN5A 3WGTA 5EJIA 1AZLA 2IIVA 3D2CA 1XNRB 3QWIA 2A78A 2PS1A 4V0KA 5I3ZA 2L69A 3FRHA 4GI5A 3EX7C 1EXMA 1PN3A 2ZIGA 4YRDA 3IQDB 2CBGA 3G8BA 4EEKA 5BSEA 3ZZ0A 4FGZA 3QXGA 3FPHA 3ZQUA 3MVEA 4FYVA 4FFMA 2KQUA 2UVQA 4JJFA 2R4QA 2AD5A 1ZS9A 1TK9A 3FNIA 1K4KA 3AY7A 4QASA 2E48A 2VDRB 1EHCA 4OGLA 3UOWA 4BFXA 3DUFA 4MSUA 3R6GA 4R9VA 2DF8A 1S3GA 1Z4OA 2IYZA 2EYQA 4S1VA 4J6EA 3RTCA 5AW2A 2F3TA 1G1MA 2CBZA 3FE2A 2JJQA 4G89A 2X1MA 1ZD9A 5BOVA 2VVTA 1JYSA