2A9FA

Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
386
structure length
383
Chain Sequence
LKNQLGQLALEQAKTFGGKLEVQPKVDIKTKHDLSIAYTPGVASVSSAIAKDKTLAYDLTTKKNTVAVISDGTAVLGLGDIGPEAAMPVMEGKAALFKAFAGVDAIPIVLDTKDTEEIISIVKALAPTFGGINLEDISAPRCFEIEQRLIKECHIPVFHDDQHGTAIVVLAAIFNSLKLLKKSLDEVSIVVNGGGSAGLSITRKLLAAGATKVTVVDKFGIINEQEAAQLAPDIAKVTNREFKSGTLEDALEGADIFIGVSAPGVLKAEWISKMAARPVIFAMANPIPEIYPDEALEAGAYIVGTGRSDFPNQINNVLAFPGIFRGALDARAKTITVEMQIAAAKGIASLVPDDALSTTNIIPDAFKEGVAEIVAKSVRSVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decar
publication title Crystal structure of a putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))
rcsb
source organism Streptococcus pyogenes
total genus 105
structure length 383
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a9fA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 2a9fA01
5A9SA 3U0BA 3AFNA 2QW8A 1B16A 2QZZA 4XB1A 3GEDA 3RFXA 4MVJD 2AG5A 1GPDG 4Q9NA 2GF2A 3RFTA 4QQRA 5A02A 2FSVA 3OJLA 2VHYA 5FWNA 1JQBA 1NNUA 2TMGA 3QWHA 2E37A 2ZB3A 3MOGA 4YB8A 4D45A 3KTDA 3ZHYA 1NQAO 1R4MB 2I66A 4ONEA 1UXIA 3C24A 4OM8A 1NM5A 5EERA 2JL1A 1EVIA 2V6MA 4RZHA 2BMAA 4S3MA 1E1KA 3DBVO 3A06A 2DTEA 4UVEA 2CSUA 4TMFA 3IMFA 1QV7A 4FD3A 3JTMA 2UUPA 2D2IA 1OMOA 2H9IA 2OOSA 2C0CA 4CQMD 4GWKA 3VAZA 1DJQA 4DIBA 4A26A 1EK5A 3H9GA 4TRRA 4CJXA 3KUXA 1GUFA 3GOHA 3E8XA 4NK5A 3I9MA 3TDKA 3W4IA 2ZCVA 1YRLA 4CV0A 5L40A 4CV2A 2YZ7A 4R5MA 4QFCA 1SO8A 1CWUA 1ZNQO 2P5YA 2FPIA 1HL3A 2PKQP 2VYVD 3GK3A 1E7SA 4NBUA 3KHUA 4M1QA 4R3WA 4D43A 4QO7A 2HMUA 1LDGA 4LGVA 4B3IA 2C07A 1XLTA 3GFBA 4I5FA 1P9LA 3DEYX 4MVJA 5BT9A 3ZU4A 1H9BA 4CLOB 4CM8B 3GY0A 3ZNQA 1YL7A 3JQAD 4WLVA 1FDTA 3DAGA 1KVUA 3AU8A 1N7GA 2WJPA 4XX0A 2JHGA 5KKCA 4CMBA 1P77A 1VL0A 4BNXA 1T24A 2AQHA 4Y6PA 2CFCA 3NT4A 5HTOA 3KVOA 2A4KA 3H8VA 1NASA 1MV8A 4GKVA 2IZZA 5T57A 3WGGA 2UYYA 3ANMA 1VKNA 1WP4A 4CMCA 5KJFA 1R0LA 4CQMA 1BXZA 3NGXA 3D1LA 1CRWG 5DF1A 3U62A 2VHVA 1ENPA 1EUCA 3BHMA 4IIVA 4A7PA 4E5KA 4CM5A 1X14A 1ZMTA 4R1NA 5KJEA 3MJEA 3LC1O 3WJ7A 4IUYA 1XKQA 2VYVA 1EE9A 4NJMB 4W4TA 3DBRA 3FCOA 1C0KA 2FWMX 3GDOA 3R6DA 3T7CA 3ZHXA 3UCXA 3GGOA 5CP8A 4YEDA 4BB5A 1ZSYA 5JY1A 5JXWA 1LRLA 3PI7A 1T2DA 3JQAA 3BZUA 2AXQA 1YB1A 2C54A 2VUUA 4J2HA 4TZTA 1U1IA 4AFNA 3JD3A 4FIZA 1VLLA 4IMRA 5KJ6A 2VWQA 1PQUA 2NVUB 4UEKA 3TZQA 4UREA 3X2FA 1UP7A 2X4GA 4CMHA 3OIGA 2Y1FA 4YA6A 2NTNA 2E49A 1EVJA 3UUWA 1C3VA 1Q2XA 1U7HA 1GZ4A 2BKAA 1GY8A 2QHXA 1X7HA 1GUYA 3I9LA 1Q1NA 1T26A 1LU9A 1I3LA 4C4OA 5LCXA 3Q2KA 5TC4A 1EE2A 3KYDB 1PZHA 1ARZA 1H9AA 1T4BA 1P31A 1AUPA 1DC5A 3FNHA 1KC1A 3C3XA 3C7CB 3TL3A 4JROA 1GDHA 3PQEA 1KY5A 4D3FA 4RLHA 4GGOA 4U8GA 2Z95A 1E3JA 4BMVA 1GFSA 3A28A 4RF5A 4II2A 4K26A 1Y1PA 2PA3A 3VDRA 2D8AA 2Q99A 1WNTA 1JAXA 3GLQA 3PQDA 5F5NA 2X58A 4GSLA 1KEUA 4GLLA 3ONDA 3K92A 3ULKA 3QRWA 2GASA 4BGUA 3PXXA 5K6AA 2JJYA 1W4ZA 4B3JA 3INRA 3L9XA 3HADA 2FPGA 4IY1A 1GQ2A 4DLLA 3P5SA 3UOGA 5B1YA 4AJIA 4OSOA 2B0JA 4OKIA 3WQRA 1TI7A 2CUKA 3A4VA 1U5AA 3FTNA 4R1SA 3IJPA 3QW2A 2EEZA 4KTTE 3OQBA 4MKZA 1I2ZA 1DHRA 5HWSA 1ZMOA 3EK2A 3PZBA 4DQVA 1O8CA 2QG4A 4YCAA 2CVOA 2PZJA 5JMPA 3HDJA 4HNHA 1ENYA 4J0EA 2ZQYA 4GMGA 3A9WA 1JWBB 4DA9A 5IAAA 2BH9A 1BVUA 5BNIA 1RJWA 4NBRA 4WCFC 4F6CA 4J43A 5THKA 1LC0A 3EZLA 3BMCA 2JKVA 3PFFA 1A72A 1NAHA 4TROA 4B8WA 4LCEA 3IJRA 4Z0HO 4O63O 1GEGA 2C2XA 1TLTA 1X0XA 4H7PA 2X23A 4W9NA 3HN2A 5KNLA 3UXYA 3AM5A 5DOZA 4U0KA 1UR5A 2NU8A 4P4NA 4LMRA 1R4NA 1GR0A 3TOXA 5L7YA 3I5MA 1DEHA 4ND1A 1LSUA 5KJCA 2XXBA 2B35A 1DBVO 1DDOA 3G1UA 1D1TA 5G0UA 3T7EA 4C7KA 4Z9YA 1V3TA 3CIFA 4M49A 4N54A 4RJTA 2DUWA 2B83A 1N7HA 1PGQA 2Q1UA 3I52A 1QYDA 3RUIA 3PGJA 4B4WA 5JW6A 1XU9A 3PTZA 4IJUA 4BL5A 2O3SA 4UVDA 1PU2A 1MXFA 1PEDA 2JFGA 5C5IA 1A5ZA 3GNSA 2Y05A 3ZWPA 4AJ4A 3AM3A 2DTDA 4U6QA 4DMLA 4IINA 3ENNA 5GZ6A 1E1LA 1SEVA 3LT1A 2DFVA 1DPGA 4G65A 4IQGA 1RWBA 1W8DA 4RORA 4OOFA 3VPSA 4PG5A 4CMIB 3OSUA 5ADHA 3GMDA 2O2YA 4FDAA 1XU7A 3L0DA 2Q2WA 3MCVA 2Q2VA 1I01A 1HETA 3DFUA 2JHFA 3QVOA 3L4BC 1R37A 3FN4A 3WX0A 3ST7A 2AMFA 3ZWWA 2E4AA 3WGOA 1XHLA 4XWYA 2G1UA 4R54A 2EF1A 3DAFA 3BTVA 3DZGA 2WM3A 3QWBA 1FJHA 1X1TA 3FNEA 4DXHA 5B37A 4FCCA 1K89A 4NR0A 5JY6A 5G2OA 4N5MA 4GVLA 4E30A 3ZDFA 5AOVA 1J5PA 4CM4A 4J1QA 4LVUA 3DAPA 3I23A 5BQFA 4Z6KA 1PJLA 3FWNA 5JDIC 2VHWA 3GG9A 5BSHA 3NTOA 1GYQA 9LDBA 7MDHA 4MP6A 3AK4A 4TRJA 2B4TO 4WCDA 4OSPA 2OHXA 4TZKA 3SJ7A 1PZGA 2BLLA 3ZNNA 1U8XX 3KV3O 1XYGA 1ZSVA 1GYPA 1HLPA 3ZHZA 5HRUA 1CF2O 3GUYA 4U0JA 1KIFA 2X7HA 1I33A 3K9QO 3GGPA 1DAPA 1K6JA 4QX6A 4M55A 5ES3A 2JD2A 1MG0A 3UICA 3I9KA 1XG5A 2OORA 4EEZA 2RAFA 5ICMA 3ROQA 3FF4A 2HAEA 1WLYA 2HCTA 1Q7GA 5T64A 1HRDA 2PGJA 1JA9A 1NWHA 3RFVA 1VC2A 5BSEA 1U8FO 3AUUA 2Y93A 5FFFA 4IDFA 5IZ4A 4NFYA 3WLFA 4UVHA 2G0TA 3PFWO 3OJEA 2H1SA 3D3WB 2D1YA 3OJOA 5JDCA 4ALIA 3UGKA 4J1NA 3NDRA 3GRPA 2O48X 1Z75A 2C20A 4JP2A 4DBVO 1KEWA 4YPOA 4WLUA 4LCJA 4IDCA 5KCZA 3VKUA 5ENVA 3IQDB 3PYXA 4BNNA 2WE8A 1DLJA 1HSOA 1JKFA 4AJEA 3OBBA 1UDCA 1Y5RA 3JQ9A 3U4IA 3UKOA 1U4SA 3BMQA 2R6JA 2H5LA 2IRWA 4EUEA 5T67A 1DJNA 4CLXA 4P4LA 1PWZA 4NU6A 3TOZA 2RIRA 3V2HA 3VH4A 1YJQA 4ZVVA 3LYLA 2EKLA 1DRWA 2PY6A 1E6UA 3Q9UA 3HJAA 3CMCO 1ZK2A 4GX0A 4Q3EA 3KXDA 1MUUA 4CMGA 4WE3A 2ILTA 1UP6A 3C8MA 3IDSA 4TSKA 4WCFB 4W82A 3PDUA 4DL9A 3QWAA 4YJHB 3HB4X 4H3VA 4CM6A 4L8VA 1LEHA 1O5IA 2O23A 1I8TA 2V65A 1O0SA 4PGFA 4YAEA 3RBVA 3O9ZA 2C29D 3I4FA 5EIOA 1B7GO 1PX0A 4P22A 5DBIA 3BA1A 2VN8A 3I9JA 4J7XA 2Y67A 2O3TA 3P2YA 1IYZA 2ZATA 2CDAA 1SAYA 1KEPA 3AFMA 4OAQA 5JAQA 4E31A 3FNFA 3AJRA 4NMHA 1D8AA 2Z1NA 3DDNA 3V2GA 5JCJD 2ZK7A 4JJFA 1C1DA 1KEVA 4PLPA 1ZW1A 3VDQA 5A3JA 1NR1A 2BELA 2GRAA 4RPGA 2X22A 1R0SA 2R2GA 5A4DA 1F8FA 4R16A 1ENOA 3OFSA 4ZQBA 1Q7BA 2NADA 3BMNB 4IDEA 2B69A 4RV9A 3GDGA 3JQ7A 4IJWA 1QV6A 3IIEA 4N18A 3WTBA 2IYOA 4IQ8A 4QECA 4BNWA 3PRJA 4MIOA 2I76A 5TSDA 1CJCA 2AEMA 3DL2A 4R01A 4ND2A 2J6IA 1ZFNA 1ZUD1 1YDWA 2DFDA 1D4FA 1EZ4A 3D5TA 2JFFA 3KSUA 2OGUA 4CMEC 2CDCA 2SCUA 4YJFB 3KETA 2EJWA 4ZHSA 1Y8QB 2PKQO 3GN1A 4FC7A 1RKXA 3O4RA 3RROA 3PLRA 4PLGA 5TS3A 4FGWA 4I5GA 3WIEA 3NGLA 1QP8A 3KSZO 3ICCA 1DFIA 3CKYA 4WECA 5DBFA 5I9MA 3RASA 5EESA 3NEPX 1QORA 4GBJA 1DFGA 2IE0A 1Y9EA 2HJSA 3PP8A 3JQFC 2CZCA 5B12A 1UH5A 4QSMA 4XGKA 3PPIA 2FMUA 4IS2A 3FI9A 2I9PA 5JCJA 1IZ9A 3I4CA 3PEFA 4KDEA 1ZH8A 1T25A 3QHAA 5FI5A 2RBEA 4A10A 2DC1A 1XDWA 1BDBA 1M2WA 3HDYA 5IXYA 4MVJF 4NH4A 5I9NA 1MFZA 1S6YA 3MEQA 5JCXA 3V1YA 1ISJA 2JD1A 4K6FA 4QT0A 5TT1A 2AHRA 4OYRA 1TVEA 3HSKA 3BTOA 2I99A 1NXQA 1HDCA 3P19A 3IP3A 4CUKA 4I08A 3PIIA 3OJ0A 3S8MA 3L77A 3AM4A 5ILOA 4HX5A 1CQJA 3GVHA 3VZRA 3M1AA 1LNQA 2OZPA 2J3JA 3L6EA 4AICA 4FOSA 4PLVA 3EYWA 3P7MA 4KTVE 2QX7A 3LLVA 5DP2A 1V35A 3FRJA 2GPTA 1ZEMA 1NQOA 1ULSA 1BG6A 1E5QA 1YB4A 2PGLA 1R12A 4MIYA 4UUOA 3DZFA 5KIAA 1KVSA 4Z3DA 2BGMA 5T8KC 2YW9A 2J3KA 2YDXA 4J9VA 4Q3AA 4R68A 3KYCA 3ROMA 2PD6A 5EQDA 3BMOA 1P1KA 2ET6A 1Q7CA 1VSVA 1PQPA 3FWZA 3AW9A 4O59O 3VPFA 2WYUA 5AQ1A 1VL6A 1M66A 1WAMA 4Q3CA 4E32A 1TA4A 1EFLA 2FZEA 3DBHB 3QVTA 4FBGA 4BNYA 4CUZA 1R6DA 1YGYA 1PIWA 4JJIA 3RUHA 3ZW8A 4FN4A 2WEKA 5JAIA 1HYEA 2BI8A 4EGFA 2RH8A 1PR3A 3B20A 3JQBC 3PWZA 3R3JA 2Q1TA 1CEQA 5IDQA 1PJCA 3FSRA 4FFLA 4W6ZA 4KUGA 5H82A 1XEAA 2DAPA 3AOEA 4IDDA 3QWFA 4E5PA 4BO9A 2GSDA 4J49A 4RF2A 1OI7A 5ENDA 4ALNA 1GZ6A 2Q49A 1IY8A 1GADO 1ZJYA 4CL3A 4D3SA 4C7JA 4KMSA 3D7LA 3K5PA 4B4OA 2VZ0A 1PS9A 3S55A 4IZIA 2EW2A 2NQTA 4BKRA 4D46A 4E13A 4EJ6A 2JD0A 3K2BA 3NJ4A 4YRDA 5A3VA 1GCOA 4AJOA 1GZ3A 4U7WA 3RCBA 3WIDA 2B4QA 3H65A 1BMDA 2P9GA 1PZFA 3GEMA 1SB9A 1NAIA 3Q11A 4ALMA 2D5CA 3IAHA 4FFOA 4M54A 4Z0PA 2P91A 4YT5A 3X2EA 2C7VA 1E1MA 1PQWA 4ZICA 1IB6A 4LVCA 1YL6A 4BO8A 3JQDA 2O4CA 1JU9A 3JQGB 3VC7A 3ZN2A 5JNLA 3CMMA 5IN5A 2DTXA 2RH4A 2YJZA 1M6HA 3LDHA 4ZRNA 1JLLA 1K6XA 1NWCA 2Q1SA 4BGIA 1FXSA 5AXAA 2BHLA 4D3DA 3G49A 5ITWA 4G5HA 4HADA 4XYEA 1BDMA 2XPCA 1W6UA 4LSWA 1TT5A 2ZB7A 2Y0EA 1KOLA 1NBOA 3ZWYA 1P74A 3H5AA 1K0UA 2W2KA 3K8ZA 1I30A 3DBLB 1PL6A 3LC2O 2GUGA 1JKIA 1OAAA 5CEFA 4LSMA 3B1FA 3O03A 2FZWA 4NZ9A 3TSCA 4LRSB 1VL8A 2QIOA 1IE3A 1HE4A 4BO1A 3OQ6A 4WOJA 2BFPA 3G1TA 4RQUA 1QYWA 1QRRA 2PD3A 3I9NA 1JVBA 4OOEA 3VPXA 3EVNA 3F1KA 4XRGA 3Q9NA 2GN6A 2RHCA 4A73A 2EXXA 1R4MA 2FP4A 4YAKA 2O3RA 5CDTA 3PVZA 1PJSA 2DKNA 4DLBA 3VPGA 1EFKA 3ONFA 1LC3A 1PJ4A 2B37A 2DBRA 4N5NA 1C1XB 4XJTA 2IYPA 1UXGA 2Z1MA 1IPFA 1HZJA 1TEHA 3V1TC 5IJZA 2ZTUA 3DR3A 2UVDA 2WTBA 4CQMB 2VRBA 4DRYA 4I5EA 4ID9A 2X5OA 3VH2A 4E5MA 2XOXA 3UFXA 2BFOA 1ZBQA 1PGJA 3MJVA 4XDZA 4Z3KA 4ALLA 4BNUA 4CMAA 1PJ3A 1O95A 1Z73A 2P2SA 4IDAA 4D44A 1WMAA 9LDTA 4GX5A 3OP4A 3DBRB 3L6OO 3IUSA 3QP9A 3NDIA 1ZZEA 3KRTA 3LF2A 3BYZA 4A5OA 4B7UA 3HN7A 2CD9A 3MJTA 3DZHA 3C1AA 3EW7A 5IXSA 4K6CA 1UJMA 1Y5MA 1E77A 4YJGB 3JSAA 3G79A 4CM8A 1BW9A 4EW6A 1GPJA 2V6GA 1XGKA 1B0AA 3IKTA 4ALJA 2D5AA 2WD8A 3WGIA 1MGOA 2TMDA 2D3TA 5U1PA 5TIIA 4GGPA 4R3NA 1G0NA 4JQCA 3Q1LA 1A7KA 3WS7A 2BFMA 4L73A 4OXNA 1BRMA 4H15A 5TGDA 3F6YA 3KEQA 2P4QA 3M2PA 3PLNA 4XQCA 3BIOA 4LISA 1KY4A 2D0IA 1GQQA 5C37A 1U7TA 5F1OA 1EUZA 3N58A 5THQA 1DB3A 4KQXA 1Y7TA 3ZV5A 2IEDA 1GD1O 1MLDA 1B8UA 3NTQA 4FQ8A 3ZH2A 2AA3A 2NM0A 3EUWA 3WWZA 3LQFA 4YAGA 2VHXA 4I1IA 4WUVA 1I10A 3DZBA 4BGEA 3HFSA 3LF1A 4NJMA 2R00C 1DAOA 1EBUA 4MP3A 3T4EA 1QYXA 1ZVMA 2DBQA 1LTHR 5JLAA 5T5QA 2VRCD 4FFPA 4IDGA 2BFAA 4Y98A 1IZ0A 3TZHA 1LDNA 1WDLA 2JAPA 3RSHA 4JIGA 1DHTA 4FJ2A 4JK3A 3DMTA 4RDIA 1B8PA 4U6SA 4IDBA 5CFZA 2HMWA 2UUOA 1ZJZA 5EQFA 1NVGA 3TZKA 3DTTA 5BSGA 3UAGA 1UUFA 5CPFA 5A5EA 2NVUA 5A9TA 2NLOA 2AE1A 3F47A 1T2CA 2D4AA 3EZYA 3LU1A 1G0OA 1WZIA 2HRBA 3HFGA 4D41A 4AJNA 1A9ZA 3VPHA 4CR8A 1XQ1A 1HZZA 4BMSA 3G0OA 4KWIA 3RC9A 4RPKA 4RVHA 2ZB4A 1XQ6A 3KYDA 4L76A 1B3RA 1X7GA 1VJ0A 3TZCA 1VPDA 3TN7A 1P3DA 2VQ3A 4FSHA 1DIGA 1HDOA 2QZ9A 3E9MA 3ZV4A 4B8ZA 5B4VA 1XIVA 5DCYA 5G0WA 3M1LA 4BO2A 2X0RA 1DSSG 4Y67A 1C0PA 2VT2A 4LMPA 1K5HA 1JVSA 3H9UA 1J0XO 3D3EA 4YDRA 3OA2A 1E6EA 4DGSA 4CLRB 1RYEA 2AQIA 2HJRA 5KVSA 3ROPA 4DVJA 2VRCA 1BVRA 2C59A 3RC1A 4CODB 4WJZA 3AU9A 1JDJA 3JQCA 4HWKA 1E6WA 3JCZA 3BAZA 4EEXA 5C3MA 4P8RA 4HFRA 1LLQA 4BKUA 3DOOA 4GQAA 2V7PA 4AJ2A 1LA2A 4XYLA 2Q46A 2IZ0A 1NPYA 3GHHA 5AYVA 4M89A 3RC2A 3ZWXA 1DLIA 2ZB8A 4J7CA 4TRMA 4TVOA 4XIJA 1EEHA 1TB4A 2J3HA 2HK7A 3GVXA 2OXIA 4M86A 4CUJA 1ADGA 1WZEA 1O94A 1EVYA 4UUMA 3WSVA 5EPOA 3NYWA 3RU7A 2PZLA 1YQXA 3AY6A 3HQ4O 4KDFA 2POQX 4IMPA 5F21A 4P38A 3RUAA 4ILKA 3JQ8A 5CAEA 3SLKA 3AY7A 5IZCC 3UVEA 2PZMA 2YFHA 1XR3A 3DC2A 4OO3A 4XCVA 3RWBA 4EUHA 4DC1A 4II3A 5CDUA 1OFGA 3VZSA 7ADHA 5TRTA 1QLHA 4IXWA 5KVVA 3DOJA 3QE3A 4YBZA 3O26A 3WQQA 1GQYA 4AJKA 4PLHA 5B4TA 4WLFA 1Y8RA 4WOKA 4E33A 1GAEO 3HE3A 3H5NA 2DPGA 5I7VA 2PK3A 3WQSB 2AG8A 5BSFA 2FN7A 3GUCA 5I7SA 3F1LA 4KZPA 4JLWA 3WBBA 1LDEA 4B79A 1PGPA 4YRBA 1ZKMA 1L7EA 4OQZA 3ZWAA 4DLAA 4EYEA 3GEGA 1LLDA 4CM4B 4O0LA 5KVQA 3I6IA 3ZW9A 3A14A 4O1MA 1A7AA 3WSWA 4E3ZA 1E7QA 2V6FA 4XQ9A 1ZK0A 1DOHA 4DYVA 5L3ZA 4BIIA 3BHIA 1JWAB 3RBXA 2X0JA 3MTJA 2OMEA 2Q4BA 2G82A 2FR1A 2NU7A 5I7FA 4XIYA 4E4YA 2X1HA 2E82A 2GCGA 4EITA 3TFOA 2O7QA 3L6DA 1BSVA 2X6TA 4DC0A 1YOVB 5BNFA 4EI2A 5A04A 3F5SA 1E3IA 2EKPA 2ZTMA 4MJLA 1NFQA 3HHPA 3ZCXA 1NQ5A 1F12A 2CMDA 2F1KA 3GQVA 2GZ3A 2Y1EA 4R51A 4BNVA 3R3SA 2VZ8A 5TJ9A 4R41A 4TKMA 1NFFA 4ZQFA 1H0KA 4O5OA 1P1JA 4TWRA 3AUAA 1X1EA 4WKGA 2I67A 1A4UA 2EP7A 3GAZA 5H83A 3DHEA 5JS6A 2EGHA 3E9QA 3L07A 3E6AA 1B26A 3MWDB 4JP3A 3EC7A 1VSUA 3KB6A 1SNYA 2HU2A 1DIHA 1M75A 5DZSA 2Y1CA 3DO5A 3PHLA 4LW8A 3MOIA 4GLOA 2FOIA 4OMUA 1Z7BA 1SZJG 2NTVA 2X9VA 1EBFA 2Z5LA 4RVSA 4MKXA 4WK6A 3LK7A 4BNHA 2VTDA 1ONPA 3H5RA 3WNVA 4DPKA 1EDOA 4WPGA 3GNQA 1Y6JA 4HY3A 1DC4A 3S2GA 1FF9A 1N1GA 2NV6A 1D1SA 4NFSA 2Q50A 1E3LA 1GV1A 4PLZA 3PK0A 3GZNB 3CPSA 2PNFA 3B1KA 4BNMA 3KBOA 3PDJA 1YQGA 3HDHA 1U2DA 3CZRA 3E82A 1DRVA 1P0FA 2VCYA 3CEAA 3OHSX 4RDHA 3ZHBA 1X13A 1PS8A 2GN4A 4J4HA 4CM3A 4B7CA 3ZU2A 2JFHA 4IQ0A 4JBHA 3GT0A 1WWKA 4R5HA 5U4QA 1YKFA 4GI2A 4EZBA 4L74A 2EP5A 5G4LA 3W1VA 4BNIA 4J16A 4W99A 3NX4A 1HWYA 3VKVA 4BGVA 1I36A 3TFQA 2VOJA 3O38A 2CVZA 3FHLA 2VYND 2FHSA 4ZU3A 1LSSA 1QXSA 3PHHA 3D3WA 2HK9A 4MKRA 1VJTA 1BXGB 1DFHA 1H2HA 4TQGA 2A35A 1EMDA 5IDXA 1LDYA 4Y6SA 4IGFA 4ESOA 1N9GB 1LI4A 1MFPA 1H6CA 3ZWVA 1E0DA 3K6JA 3RBZA 3EY4A 1HE2A 4WEQA 3RAJA 3RQSA 1DXYA 3Q6IA 1Z82A 2GDZA 3AUSA 2GO1A 3RKUA 2VOEA 2BD0A 2YHIB 1Z7EA 1EUDA 1EQUA 1F0YA 2Y68A 4PZCA 1GV0A 4Z9XA 2GLXA 2XXJA 1TT7A 2EG9A 3H6KA 1YBAA 3JD2A 4YAIA 3IP1A 4E12A 3KM0A 3GN2A 4D7AA 2I6TA 1S7CA 2WMDA 8LDHA 4RGBA 1K3TA 3K2EA 2DLDA 2VNSA 4OH1A 2HQ1A 1JN0A 1SMKA 2HMVA 4NPCA 1U5CA 4WCFA 2VYNA 4Z0TA 1CDOA 5JE8A 4BO4A 4BVAA 4CM9D 5K9ZA 5KTKA 4YJHA 3ON5A 3ZNPA 6ADHA 3KSDO 5IF3A 4BV9A 4BS9A 3F4BA 3IOYA 4JCOA 4I8XA 3E1KA 5DNAA 4XRRA 1ZXLA 1E7WA 1OC2A 5KVCA 3E5RA 3SJUA 1DO8A 2Y0DA 1P44A 5B4UA 2QQ5A 3PWSA 4RVUA 1FMCA 2VWHA 2CF5A 3FPLA 4WEOA 4DIOA 3GA0A 5COAA 2WD7B 4J1SA 2NSDA 4FFMA 3F4LA 4MPDA 3OA0A 3AI1A 1HE3A 3HB5X 3OEWA 5ITVA 2NNLD 3QLJA 4XZ3A 4QXMA 1QSGA 4MOWA 5C7LO 1NFRA 4KQWA 2IXBA 1ZK4A 4AJLA 4L4RA 3GZ4A 6LDHA 1MP0A 4WGGA 4ND4A 5L7TA 2XAAA 4ZQHA 5DOVA 1T1SA 4BOYA 1QG6A 1X0VA 3AY3A 3JYQA 1A4IA 4FR5A 3UCFA 1E3EA 3DFZA 3OJFA 2O50A 2EW8A 2WYVA 4HFNA 4CM9A 3NJ8A 1E3WA 3UCEA 1U9JA 1J49A 2CDBA 3KOUA 2WDZA 4F3YA 1I5RA 4XQGA 3L4BA 4N5LA 3MJCA 5HS6A 4NBWA 2NU9A 4YJFA 2O3UA 4RZIA 4GPD1 1Y8QA 2LDXA 4CL8A 3FD8A 4QTZA 4FFRA 4Q3NA 3GVIA 1FK8A 1CQIA 2X9GA 2YDYA 2O3QA 5CDGA 3F9IA 3ANLA 1IULA 1E1NA 1YXMA 3FPCA 4HKTA 4EUFA 5CHEA 5DP1A 3MJ4A 5EINA 3WLEA 5ICSA 3KYCB 3W8FA 1I3MA 3SX2A 5ILGA 3U5TA 1LXCA 3EDMA 2Y1OA 5JMWA 1M6WA 3GFGA 4OJNA 4YAJA 4ND3A 4PG6A 1LDBA 5C7OO 4IS3A 5JDIA 5H81A 4LRTB 1RM0A 3O8QA 3KLMX 1P1HA 1XCBA 5ER9A 1AHIA 1B14A 5I8WA 2P4HX 1CIVA 3H2ZA 3QJ5A 1Q0HA 3TWOA 4HV4A 3WYCA 1VJ1A 1LRKA 3DB2A 4PIVA 1NVMB 2IZ1A 3U3XA 5JFOA 1D3AA 4YVFA 4BNJA 1Q0QA 1YBVA 2Q2QA 1WDMA 4A2CA 3NDJA 2DUUA 1K2WA 2ZYAA 1O89A 3CH6A 5TLSA 2Q45A 2VUSA 1LQUA 2CY0A 5ER6A 3ADOA 5G4KB 3PWKA 5TQVA 2DVMA 5DDIP 1YONA 3DZJA 3FNGA 1H5QA 5EMHA 3ZNOA 3D4NA 1MXHA 4YXFA 4E2XA 5K0ZA 4KWHA 4ALKA 1NHGA 3HG7A 3IC5A 5A05A 3DQPA 4MVJG 4HFMA 5I8ZA 5K6AC 5F1PA 1RPNA 5A5FA 3RUCA 4R9SA 1VI2A 4BQRA 3DONA 2H63A 4NI5A 5FYDA 4XYBA 3AUTA 4J0FA 1NTOA 4R69A 3FBTA 3PYLA 2NQ8A 5A03A 5CEEA 4CQLB 3IL2A 2JAHA 4DTIA 4RPJA 3GC6A 1H94A 1P1IA 4UVIA 2GD1O 1ADBA 1HE5A 1AXGA 1N5DA 2X0IA 5COBA 3TZ6A 5A9SB 3QIVA 3NT2A 4D42A 2HSDA 5J23A 1P1FA 1BHSA 2HRZA 4PLYA 2J5QA 3PHIA 4MVJH 3EMKA 1NPDA 3ROKA 3I9OA 3KEOA 2PGDA 3DHNA 4PLTA 4HNGA 5JAZA 4HFJA 2HMTA 3VHRA 3ETEA 4E2WA 2PD4A 4OQYA 1RYDA 1T1RA 2VHZA 2I3GA 2IEBA 3WGQA 1QYCA 4RLSA 3FR8A 2W2KB 3H9EO 3HUDA 1NP3A 4OGWA 3VOSA 3C7DB 5GMOA 5L51A 4J4TA 4WASA 5L53A 1EVZA 4W9NC 1RM4A 5JYEA 1ONNA 4J9UE 4MP8A 1QLJA 3ZV6A 4YQYA 3R0IA 1T2AA 1B2LA 1SOVA 2JCXA 4JBGA 1PJQA 1QMGA 5KJ1A 2B5WA 4CMJA 2WE7A 4NBTA 5CEJA 1YVEI 1HKUA 4BO7A 3DOCA 1LRJA 1R66A 1LLCA 3NT5A 4XGIA 5F5LA 2GERA 3CTMA 1IPEA 1CYDA 5GY7A 3WYBA 1SCUA 3ZWBA 1MB4A 1YQDA 5KWEA 1YDEA 3IS3A 1KC3A 4GSKA 1ML3A 3TRIA 2VT3A 4F45A 2Y0CA 1EK6A 4RVFA 3JQGA 4R1TA 1NVTA 3CZMA 2YV2A 5A9RA 4ND5A 3QV1A 2FSSA 4UUPA 3E03A 1ZCJA 3SLGA 5LDGA 3WFIA 2A94A 2DPHA 3CSDA 1UAGA 2VZ9A 4IXTA 1SOWA 2I5PO 5G0VA 2YV3A 4AJPA 1A71A 2BF7A 1XELA 3U4DA 4JN6B 4BO0A 1Q0LA 5TNXA 1F17A 2Q4EA 4HUJA 1JKJA 4ZN6A 1NX6A 3GHYA 2OUIA 1ZXBA 4OXYA 3SC4A 3DBLA 1ID1A 2X5JO 4RF4A 1BWSA 2CNBA 1SC6A 2EKQA 4NHEA 4XR4A 3KYBA 4OXKA 3H9QA 4PVDA 1HF3A 4BNFA 4CR6A 4URFA 1V9LA 2GNAA 3G17A 1P33A 5CDYA 1KVRA 2EIHA 4IBOA 1BW9B 4GL4A 4CMEA 4Q3DA 4CMKA 3A1NA 1DIBA 3K73O 2DM6A 4MO2A 3RUEA 4E6PA 3M6IA 3SVTA 1PR9A 1R15A 4UVGA 3M2TA 3CE6A 3VTFA 4ZRMA 4J7UA 1ZEJA 4L0QA 3LT0A 3JQAB 4AG3A 1CETA 3WFJA 4CLOA 1HT0A 1C1XA 1W0CA 3GR6A 3PYMA 3INTA 3FTPA 2FY8A 3GAFA 3JQFA 5HBRA 4BUCA 4OHUA 4I9NA 4O6VA 4BKPA 1ZO8A 4CLDA 3DWFA 4BB6A 2EV9A 1B15A 3GRKA 3ITDA 4DPMA 5JO0A 3VVCA 1WMBA 3JD0A 2ZIZA 2AEFA 4CM1A 2OFPA 3WGTA 2YQ5A 2B4RO 4PN3A 1XSEA 3KO8A 1R0KA 1W73A 2HUNA 5L4NA 3DHYA 2G5CA 1HSZA 4BO3A 2PZKA 3I1JA 4RPLA 3Q0EA 3BXXA 5DN9A 3STHA 1IHYA 1NPTO 1FDSA 3H9JA 1ISGA 3HZZA 4B4VA 3NV9A 4G81A 2I65A 4BMNA 3TL2A 4PRKA 1KYQA 1E92A 5DULA 4CM7A 4FGSA 5G0TA 1U3UA 2B5VA 4XKJA 4PLFA 4YJGA 2C5AA 1PS0A 5AXBA 4FFNA 4QO8A 2DBZA 3H4VA 3VZPA 3OH8A 2O3JA 1UP4A 4B7XA 5JDCC 1C0IA 1UDBA 3HNPA 4E5NA 1O9BA 1MC4A 4Z9FA 1I2CA 3UHAA 3W6UA 2A9FA 3ASUA 3C1OA 1AN9A 3C85A 4BHTA 2Q1WA 3QWIA 5T8KA 3MTGA 1JAYA 1UAYA 4TKLA 2BRUA 4AVYA 3V5NA 3SEFA 3JYNA 1LQTA 4H16A 5U9CA 3JQ9C 3GPDG 5JYDA 4UULA 4JNKA 2DT5A 4DWVA 2D59A 4L4SA 4PCVA 5TT0A 5FI3A 2PWZA 3CUKA 3RI3A 4EJMA 2IDZA 1XWFA 2GN9A 1RM3A 1PJTA 3QVWA 2OBNA 1ISHA 4GX1A 4JX8A 4NDNE 3AOGA 3ORFA 3OMLA 2W90A 2ZYGA 3JQBA 2UV8A 1LBEA 2OP1A 3SC6A 3ONEA 2ZYDA 3RUFA 4QEDA 2VNAA 1P0CA 2P68A 4DUPA 2OL4A 1VM6A 2ZJ1A 5BNTA 5JSFA 2PH3A 1YH3A 3ETGA 2NVWA 4FJ1A 4QUKA 2W4QA 4BNZA 3NRCA 4DBZA 1U4OA 3QVSA 3AI3A 3LSYA 4NG5A 4B3HA 3S2FA 1I3KA 3BMCB 2XF8A 4AL4A 1H2BA 4WLOA 2O2SA 5F1KA 1DRUA 2YYYA 3GNTA 2HDHA 4Y8VA 2OO5A 4D0RA 1YJ8A 3EHEA 5LC1A 4PG8A 3K30A 1RM5A 1QR6A 2CVQA 2H6EA 2YY7A 4BV8A 4DQUA 1WDKA 3PIDA 3WOHA 1HTBA 1R4NB 3F5QA 2Q3EA 4GKBA 1U2GA 4M87A 3OF2A 2RHRA 2J5RA 2Y1GA 2Y99A 4CV1A 4J6FA 2GZ1A 4MVJI 4D79A 4ZGWA 2JCYA 4K9DA 1YB5A 2IODA 3N7UA 5L7WA 1GU7A 5JC8A 1Y9AA 3V8BA 4BQPA 2WSBA 4A03A 1EDZA 4P4GA 3L4SO 3JQ8B 5JAMA 3ASVA 5JO9A 3I83A 1WVGA 1PL7A 1N1EA 1PJBA 1ISFA 1SB8A 4FW8A 4J3FA 3NTRA 1T2FA 3W4KA 3GDFA 3E18A 4CLRA 4WLEA 1IHXA 3NUGA 2DQ4A 1UXKA 1P1RA 1Y8RB 3ZV3A 4YACA 4E0BA 3JD1A 2PFGA 1PTJA 4XGNA 1LDMA 3S2EA 3TPCA 3UH1A 4KUEA 1HYGA 5HA5A 2UDPA 1V0JA 4NBVA 2HMSA 4DPLA 1U3WA 4M8SA 5F3RA 2NACA 4AJJA 2HLPA 5DBGA 3EGOA 3ZI0A 1ZK3A 2QYTA 2FR0A 2W2LD 1ONOA 5HM8A 1F14A 4BO6A 1DC3A 4OIMA 3RVDA 3H3JA 4WNCA 2FRDA 1HDRA 3QSGA 5DT9A 4GMFA 5AVOA 1HDYA 3P2OA 4QFDA 4PG4A 4NU5A 5MDHA 5LDHA 3LVFO 1SEPA 3G3EA 4BNKA 5FF9A 1JW9B 4GH5A 2F00A 4EBFA 3T4XA 1L1FA 3ETDA 3JYPA 1Z6ZA 1Y81A 1UZNA 2NU6A 1X15A 3W6ZA 3W8EA 1LLUA 3HDQA 3KLPX 3ZGYA 2C7GA 2P5UA 2Y1DA 5DCUA 4CLEA 5CDSA 2X9NA 3AI2A 1YBMA 3S2IA 4MVJE 5BR7A 1LX6A 3TQHA 1F8GA 4CMIA 4DREA 3LT4A 4XR9A 1V3UA 3TF5A 2EGGA 1I3NA 3WBFA 3C1TA 5EL0A 4FJ0A 4DMMA 2IXAA 1T4DA 1MA0A 4TRNA 3GVPA 3N74A 3V1UA 1V8BA 4ITUA 3DZKA 1YE3A 1A27A 3VVBA 5AXDA 4IGEA 1G6KA 4CLHA 2W2LA 2ZQZA 5COQA 3W4JA 4XEHA 4MDHA 3ENKA 3BTSA 5L4LA 2AQKA 3U49A 1KBZA 3RC7A 4D0SA 4ZD6A 2ZTLA 4ROSA 2LDBA 4LK3A 4X54A 2O4UX 1I2BA 4JGBA 3WGYA 1ISMA 1LSOA 3PJFA 4W7IA 4N7RA 3WNQA 4E21A 3WG9A 3QY9A 1PZEA 2W8ZA 3F46A 2EWMA 1BGVA 4INAA 2YQ4A 1YOVA 1OBFO 2ZKLA 5JC1A 2ZJ0A 1C14A 2FPPA 4ZQGA 5IDWA 5TX7A 3COSA 4KUHA 1E7RA 1SPXA 1UZLA 1UDAA 3PQFA 2PH5A 2QRJA 3DMYA 3E9NA 1HEUA 4RF3A 2NWQA 2VTEA 3OICA 5TJHA 1K6IA 3AOEC 4K1LA 1IOLA 3BMQB 1U3TA 4YRAA 4ZQEA 3IUPA 1ZSNA 4BKOA 2C2YA 3V2UA 5L45A 1KVQA 4LN1A 3WXBA 1OC4A 3TJRA 3C7AA 2AW5A 3JQEA 1WW8A 2GGSA 2PTGA 3RJ9A 3CINA 3GG2A 2R00A 1KETA 1E3SA 1ULUA 1B8VA 1P45A 2V6BA 1I0ZA 4PFJA 4FS3A 1PGNA 4A0SA 1CERA 3FR7A 4MINA 3WICA 1V3VA 5FEUA 4I9HA 4J4BA 4E2YA 1DIAA 1FDVA 1UXJA 1KVTA 1Z45A 2YFQA 3ZU3A 3RU9A 2YUTA 5T6BA 1YS4A 3ABIA 4A27A 2J8ZA 3ZZNA 3ANNA 2JCVA 1UZMA 5JBIA 1FDWA 3R1IA 1ZIDA 2AQ8A 3GZNA 1R16A 4XYGA 1QKIA 3QVXA 1UXHA 4DIFA 4HXYA 3S1LA 5L9AA 1AXEA 4CV3A 4YR9A 1XA0A 4YQZA 5L4SA 1F06A 1HYHA 1OZAA 2VUTA 1YWGO 5I7EA 1TXGA 3OEYA 4GX2A 3WYEA 3B70A 3LC7O 4HBGA 4IJVA 2BGLA 4PZEA 4XA8A 1PWXA 4KP7A 3GVCA 3I3OA 1C1DB 4FB5A 2AEJA 2YHUA 3OETA 2E6UX 2CF6A 3Q3CA 4F6LA 4HP8A 2YV1A 3MZ0A 4AJHA 3EVTA 5TF4A 4NK4A 3IKVA 4EDFA 3GH3A 4I5DA 1JTVA 1J6UA 1GL3A 1NYTA 1G1AA 2OP0A 3JQ7B 5GZ3A 1BXGA 1M67A 5KOIA 1C0LA 3ADPA 3LT2A 1NR7A 1PSDA 1N9GA 2HO5A 3WWYA 5IFLA 1AGNA 1MG5A 4RQTA 3RKRA 4E2ZA 1I32A 2NTJA 1O6ZA 4JJGA 4RO0A 5IN4A 2GN8A 2GYYA 3DXFA 1U3VA 4L4XA 2BI7A 1GEEA 4BNGA 4RVDA 2NUAA 1L7DA 3PJEA 2YHIA 3I6QA 3BTUA 5KKAA 4DQXA 4L75A 2GZ2A 5IDYA 1E7MA 2VWPA 3VZQA 4GWGA 1PL8A 3JQ6A 4BNLA 1AHHA 2EERA 3JV7A 4PVCA 2BGKA 3K31A 4IJKA 8ADHA 3TNLA 1BTOA 1GUZA 4J2OA 5HS4A 1VKOA 2ZCUA 4NJOA 2PKRA 5EJ2A 3H2SA 5A1TA 4R4JA 4YT8A 1N2SA 4IZHA 5MGBA 3VTZA 2E48A 3CXRA 3WGHA 1NQTA 1KS9A 3WB9A 5IZCA 4RPHA 4RVGA 3FBGA 1E3WB 3KZVA 3RJ5A 3WDSA 3WJAA 5CG2A 1BXKA 4E5YA 2J3IA 3AWDA 3U9LA 3UF0A 3D64A 1YO6A 3F3SA 3H7AA 3BMNA 1V6AA 3DZIA 4KOAA 1AE1A 4Q39A 4J91A 3LLSA 2WYWA 3U4HA 4G2NA 1GYRA 1U28A 3B6ZA 5C7IO 4BKQA 2WD7A 3ICPA 2RCYA 5L95A 3OECA 4R1UA 1QYVA 3ZU5A 4BO5A 2QYSA 3VH1A 3UW3A 1Z74A 1HDZA 2WWRA 1WXDA 1DC6A 1D7OA 1IUKA 3OIDA 4NNJA 3WMWA 5G0SA 2X86A 4MVJM 1EQ2A 4YJDA 3OM9A 4CPDA 4PLCA 4UEOA 3WR5A 3O8QB 3U09A 3DTYA 1YL5A 1HXHA 4IPTA 4IIUA 3WTCA 3BMOB 3LZ6A 4I9UA 5EN4A 4GVXA 3GF4A 4IM7A 3B1JA 2ZTVA 4PG7A 1GTMA 1PJ2A 2C5EA 3E48A 4YYZA 1ZK1A 1E7YA 4BNTA 2NVBA 5CG1A 5JPIA 4TVBA 2J5KA 4CR7A 4UEJA 3GPIA 4S1VA 1MC5A 3MJSA 3W8DA 1SBYA 3BHJA 3WGZA 1H93A 3PHGA 1DIRA 1J4AA 3UN1A 4K28A 2AE2A 3Q2IA 2B36A 4JBIA 2X5KO 3NKLA 3DMTC 4ZA2A 4Q3BA 5GZ1A 1ISIA 2PV7A 3RD5A 4FPXA 4MVJP 4RCVA 2I3AA 4Y9DA 3PZRA 5IG2A 4L9RA 4EJ0A 4YT4A 1FDUA 3JD4A 2O7SA 1A9YA 3INGA 4AJ1A 4NIMA 4NFHA 1MX3A 4Y6RA 3PGXA 4XDYA 3QQPA 2UAGA 2GR9A 2G17A 1ADFA 2FR8A 4UUNA 5A06A 3PHJA 1H6AA 2QRLA 3NAQA 4RL6A 3D5QA 4F46A 4PZDA 4R9RA 4ZJUA 1X7DA 1B3BA 5CPBA 2G76A 1HLDA 2VWGA 1KERA 4J1TA 3D0OA 4B4UA 3D4OA 2X0NA 3VH3A 2C82A 4WLNA 2HK8A 1ADCA 3JYOA 4YTEA 3ITKA 4U5QA 2A92A 3PJGA 2P9EA 4YT2A 1N8KA 1H6DA 4DYDA 5I9LA 3PJDA 2Y66A 1NHWA 2PLAA 4PLWA 4UAGA 1HDXA 1VRWA 2P9CA 3DBHA 4PRLA 2EJVA 2DU8A 4OKNA 4FC6A 5G4KA 3JYLA 4W7HA 3OIFA 3MWEB 3SBOA 2PR2A 1N92A 1PGOA 3D4PA 1ORRA 4J90A 2W98A 4NQZA 4OL9A 4YWJA 1LSJA 1ENZA 3WMXA 1WPQA 2DBVO 4XD2A 3QA9A 1T2EA 4FOOA 3ZWOA 3ZWNA 4XQEA 1GCUA 5DCWA 3RIHA 1TT5B 2HKIA 2X8LA 4XB2A 2OBYA 2EHDA 4GAEA 1E5LA 1HDGO 3GMSA 3OQ1A 1VE9A 2QRKA 1OOEA 3U4CA 4MIEA 1H6BA 3K96A 4JXKA 4CQLA 1LUAA 1M76A 1LJ8A 3GGGA 4XYMA 4XJSA 3L9WA 3HWRA 3H3FA 1I24A 1IL0A 5AXCA 3ZWCA 4WNIA 3ZWMA 3EAGA 3RUDA 3SXPA 3E5MA
chains in the Genus database with same CATH superfamily
1Z7YA 2GJSA 5BN1A 2JLWA 1D6NA 3U0BA 4BFCA 3PQ8A 1BQEA 5IABA 2JIPA 2QZZA 1T4CB 2HPHA 4MVJD 1N2CA 1M6EX 1J8FA 4G4SP 4EUSA 4UTRA 1UKBA 4P54A 2VEOA 1SJ9A 3OJLA 4K81B 1HKHA 1HQDA 2OV3A 5FR2A 2TMGA 2O52A 3DMFA 3QWHA 4MW1A 4D45A 2FSIA 3TQCA 1J21A 2ODQA 4MPJA 1EVIA 1LBHA 2OBBA 3QUTA 4OQPA 3V33A 1T1JA 4S3MA 2EKDA 3DBVO 3M5CA 1BMFD 2DTEA 4TKVB 4TWIA 4RENA 1N5IA 2RBGA 1RJGA 1REQB 2QRQA 1R3UA 2YHAA 5FHRA 2GETA 2PLNA 2J0UB 1FYWA 2C8JA 1DKUA 3PUJA 2XZDA 4O5AA 3VAZA 1Z6XA 1N8NA 5MGNA 2CLEB 2XGMA 3KAKA 1EK5A 4TRRA 1E1DA 5AD1A 3MT7A 1NBAA 2QP4A 3N2KB 4CJXA 8MHTA 1G4AE 3KUXA 1RXCA 4GP6A 4PC7A 3E8XA 5BN3A 2BVNA 3TCKA 1ZX1A 9MHTA 4CV0A 5DGDA 1QVVA 1BD4A 2JANA 2YZ7A 3L2OB 1TUEA 1GKLA 4QFCA 2FG5A 3TLCA 1SO8A 1CWUA 1ZNQO 4M83A 2HADA 2FCRA 3AR7A 2A7XA 3GK3A 1V5WA 3L46A 3A32A 3D5EA 5F77A 4JY7A 1EIZA 5E2AA 1CUCA 2HMUA 4L0MA 3E3MA 4B3IA 2BTQA 3EQ2A 3G2LA 1VL2A 6CHYA 5EA2A 4LZOA 4OHOA 1RACA 1UJ4A 4I5FA 4MQUA 4E11A 1IXRC 4CLOB 5HZMA 3REQA 4CM8B 4ZMRA 3GY0A 3ZNQA 3QUAA 4PRYA 2O8FA 2YZMA 4AWXA 3D0RA 1F60A 4NBUA 2QL6A 3DZDA 1N7GA 4PSCA 4XX0A 5AW5A 1LNZA 4CMBA 4UDYX 4QYSA 3TX2A 1VMIA 2IPNA 2OO3A 3JWPA 4B09A 4BNXA 4UM9B 1T24A 2AQHA 3BXPA 3AL0C 2Z3WA 5ANRB 1ZYUA 1GRVA 3KVOA 1CHDA 4HVCA 3L0CA 1CUEA 4NBKA 3GJ6A 5LBUA 3FGNA 3OLYA 3H8VA 3HLKA 1E4VA 2XZTA 5D51S 3UAWA 1YB7A 5KS2A 3U4AA 2ANBA 3E3NA 1GNTA 1GAWA 1KYYA 3CGGA 3KJXA 1WP4A 3ORHA 3WO1A 3ZXXA 1CZLA 2AS0A 4HDAA 1PDVA 2YWEA 1BXZA 3BILA 3NGXA 4NFLA 1VIVA 2JGJA 3EVCA 2IPOA 3AEZA 1AHNA 3R8XA 5ALFA 4D97A 3ZPXA 4Z7QB 3V8NA 5DF1A 2IXTA 5H5JA 2HHCA 2WW8A 2XOKD 4EG3A 4WHMA 4YP6A 2C99A 1DWUA 4CM5A 5LMUB 3T3HA 1GVHA 1F4VA 1MNAA 2AOVA 1P7PA 2JLBA 3MLEA 5CA0B 2P9HA 3C8ZA 2F8SA 1XKXA 4IUYA 1XKQA 5HE8A 3P4YA 4GICA 4W4TA 5BURA 3N2YA 4FYMA 4TWJA 4NVRA 1PEAA 1RZRA 3LSTA 5J2TB 1TQDA 2EX0A 3L8HA 4KC0A 1RVV1 4RANA 4OQFA 4LVOA 4DA4A 1NSYA 2EOAA 3W1WA 5CP8A 3ZE6A 5A0FA 3OE4A 5C5EA 3E58A 5JRDS 3EFOA 3MBOA 4QXOA 4E14A 2WPNA 1IN5A 3ZTWA 1Z17A 3G5LA 2P11A 2VUUA 4J2HA 2HXYA 1U1IA 4EHNA 1INLA 4FMDB 4FIZA 1VLLA 3KZMA 3Q3HA 5IMSA 5AVWA 2VWQA 3OPMA 1TADA 4Y18A 3TZQA 1MDFA 2W4IA 4KNYA 5TARA 2X4GA 3LPCA 2GEVA 2V9ZA 1M10A 4YA6A 1I4LD 1W93A 1XRSB 1UKEA 2NTNA 4JT4A 4RZQA 2E49A 1EVJA 3NUQA 4MWZA 2IUEA 1XK6A 5E9QA 4DF3A 1C3VA 1Q2XA 3BWEA 1EGQA 2GLUA 2ZWPA 5C1OA 4GPEA 1D1QA 2CMGA 2GCIA 1U04A 1T26A 4RKFA 1LU9A 1QVZA 1RKBA 4FHEA 3T3IA 4C4OA 3FB1A 3KYDB 4CQNA 5KX5A 2AYXA 8OHMA 2A8YA 5HQ3A 2D54A 3Q8LA 1DC5A 1N2EA 3O1JC 5D7NA 4OFBA 3C7CB 1Q11A 1MJGA 2QM3A 2DOKA 3ENVA 4YJ2A 1KY5A 1ODSA 5BRJA 1KZ4A 1C4OA 1EKXA 1G20B 4PZ0A 4MWDA 2VZLA 1U81A 4M0EA 4Y2QA 4X3CA 5AVUA 3ZHRA 1ECBA 1QH8B 4RF5A 1KZYC 4HWRA 4II2A 3TTTA 1Y1PA 2XVMA 4UAVA 1SKQA 5BYJA 3VDRA 5CBPB 2D8AA 1VP3A 3PQDA 4MB6A 4A5SA 2Q3MA 3NNNA 3HZOA 4KFTA 3UMYA 4RVCA 2GASA 4G5FA 1W4ZA 1V47A 3DJYA 1EWYA 1J90A 2Z6UA 1Y8CA 3SNHA 4Q6BA 3HADA 3P0RA 3W3AD 3HB0A 2WNIA 3FI0A 2FPGA 2W37A 1GQ2A 1OSNA 1FLDA 2EQBA 4FXOA 3ZXIA 1VMKA 3TR6A 4OSOA 5E9WA 4LOLA 4D6PA 3NHZA 3A4VA 3S2ZA 3D3JA 1P18A 3SEQA 1DV1A 4Q4JA 5HOQA 3K8YA 5KNDH 1OI3A 1AMNA 3DQZA 3IJPA 2QS9A 5TPWA 4MKZA 4P7JA 1MA3A 1JPVA 1KZ9A 1L8QA 2GTIA 4PWYA 1QQTA 4DSNA 2B34A 4EY8A 1J24A 4FCWA 5LDDC 1Z8HA 3ISJA 1RJFA 2TSYB 4FX5A 4YCAA 2NSLA 2HHHB 1S02A 3DVQX 4OGKA 3FCSB 4J0EA 3O47A 1KTVA 4L2IA 1TC1A 1Z26A 4Y30A 5EXPA 3OZRA 3ABOB 1JWBB 3DD5A 3OHMA 4MUGA 3P96A 4QTUB 4DA9A 2VSOA 3RAGA 5IJ9A 1ZIXA 5CAEB 1SOAA 1BVUA 1KFKB 4GNKA 4M8IA 1G18A 1R9NA 1Z2AA 4F9FA 4WCFC 4F6CA 2FHPA 1OFUX 2GM3A 3LCVB 3V6MA 2I4TA 4J43A 2AN1A 5THKA 4REMA 3BMCA 4ZQIA 1K4YA 4TWAA 1E9FA 1A97A 4LQLA 3SQDA 2OO7A 3MMPA 1GEGA 3DTVB 4K1XA 1BXRA 2X23A 3P9RA 1FNNA 5ARCA 3WHKA 5DOZA 1N2CE 4Z1MA 3SC2B 4GOMD 2W42A 2NU8A 1T5BA 3TBFA 4LMRA 2ID9A 1QHNA 5AI5A 4B6SA 3HA3A 4DV3B 2WJHA 5KB3A 3GIWA 3ZHSA 3WP1B 5DLDA 2A9KA 1HNZB 5KAPA 3ZCRA 1YFKA 4JLKA 4G09A 1GPKA 1DEHA 3R44A 4LTDA 5L7YA 3IT0A 4BV3A 4PZPA 2D62A 1LKZA 4AS2A 4XWAA 1U8EA 2R47A 1G9TA 3MWGA 1D1TA 3CC8A 1G8YA 2WOOA 4Z0NA 2WVGA 1V3TA 2PRYA 3C48A 4M49A 3PPVA 3ORRA 3NALA 1VHTA 4OQLA 4UDOA 3RSZA 1JZTA 4OLBA 1KDTA 3I52A 2J85A 1XYYA 1W0KA 3O2QB 4B4WA 4L5CA 2FI1A 4BL5A 4UVDA 1PU2A 3V8MA 3M0EA 4TMXA 4J0HA 4HZUA 1USUA 2XUPA 4H9GA 1A5ZA 3GNSA 4NAUA 4RD1A 1SQFA 4D9MA 1Q0ZA 2EP8A 3IKMB 4R2MA 4UU8A 3AEUA 1SEVA 4ZWNA 2HSJA 4HDRB 5DNVA 1RWBA 5BSKA 2C2ZA 1W85A 3MOSA 4AY5A 5I7HA 1W25A 4QXPA 3TECE 4PG5A 2FUKA 1U0EA 2FZVA 3OSUA 4CMIB 4U7FA 5ADHA 1QR2A 1Z2PX 1XMJA 3G5TA 3OD1A 3L0DA 5ESXA 5KTNA 2LCFA 1A95A 1U3GA 2Q2VA 4MGZR 3V7FA 1HETA 3DFUA 5J4YA 4PNPA 2C5GA 2HQBA 2JHFA 1LCIA 3A26A 1J9EA 1Q44A 3E1SA 5FI1B 3ZWWA 3ST7A 3AGPA 4P4SA 3WGOA 3FDXA 1JL3A 4Q9HA 3W4KA 4Y0NA 3WIVA 2OCBA 1CUZA 3DG9A 4WOCA 1W1IA 3DAFA 6NULA 2WM3A 1W0JA 5IMBA 3ZS8A 2YICA 3HO6A 3G0GA 3HVIA 3RC8A 1H8EA 1DAHA 2PGXA 4MR7B 4ZGGA 1HDIA 4LFBB 1NVVQ 5B37A 1TCVA 2ZRLA 1ZOOA 2VBCA 2A9VA 2VJMA 5G2OA 3O84A 4GVLA 3C4JA 4GD3Q 2HSZA 1C80A 2QR5A 4PFSA 4Z5XA 1C30B 1ECCA 1Z39A 1QZ3A 1J5PA 3S5JA 4IGKA 3GLFB 5CTJA 4E1AA 1E2MA 3TW8B 4LVUA 3DAPA 2D6FA 1CTQA 2VPWA 4N01A 3I09A 5BQFA 4RZXA 1PJLA 1T4GA 2PZ8A 3FWNA 4I4NA 3RHSA 3SPXA 4LRQA 3K9CA 3EEOA 1RWVA 4J0CA 3NTOA 4GZ5A 3CB4A 2IYZA 2ZBDA 4MP6A 3B9QA 5KU1A 2DWOA 5LWHA 2P75A 2C0PA 3OCXA 1L7VC 2F43B 2Y3IA 2X6QA 1IWBB 4TZKA 2Y4OA 6GPBA 1D09A 2HQRA 1WU8A 4TV8A 5BUQA 4H7JA 1CRQA 5C4GB 5K8IA 2XKKA 3ZJVA 1GYPA 621PA 5D6NA 5HRUA 2PRZA 3GUYA 4R98A 1P19A 3DVAA 3MRVA 5BWCA 1X1CA 1TQ6A 1UMCB 4Y9UA 1K6JA 3ILYA 5E6SB 1Z0FA 2JD2A 3BE5A 2KB0A 3I9KA 1XG5A 3HP4A 3JALB 5I4CA 4DV6B 2QMYA 5KPDA 2OFFA 3FDZA 4X7PA 1R9MA 4IRMA 4L15A 3FF4A 1WLYA 2HCTA 2IH4A 3X1KA 4IIYA 4GSYA 1J33A 3OCYA 1G5QA 2FZKA 4INZA 2G67A 4MW6A 5B57C 2FQWA 1FB5A 5C1BA 2ZJ4A 3QPWA 3F3YA 3PXGA 2ENUA 4GMDA 4Y0VA 1C4XA 4NYIR 5AKKA 3F6EX 2IC5A 4KMOA 1PV2A 4P53A 4KYIB 3WLFA 3ZCVA 2RSLA 4UPDA 3P26A 3NBXX 3R7LA 3H11B 1F2TB 2H1SA 5EWMA 4QDJA 4EPXA 4LV6A 3OF5A 2D1YA 2GXUA 2WPDA 1MMFB 3GFPA 3IIJA 2R1UA 1U0JA 4E70A 4ALIA 2QXTA 4M4SA 4AI6A 2AKYA 4JLVA 3VSEA 2PSFA 2ZAIA 2JJ1A 1KEWA 2BAGA 3GP3A 3GRAA 4LCJA 2RD2A 5KCZA 3I37X 3KKKA 5E2IA 5ENVA 3IQDB 5AJWA 1KK3A 3LNCA 2P6PA 4IW3B 3TRFA 4G0WA 1NL3A 3AR5A 3EQ8A 3MHTA 1HSOA 1JKFA 3BUSA 4AJEA 2IOYA 3UKOA 1U4SA 3M6WA 4MGHA 4EJSC 1QGUB 3ND8A 1AKWA 1ZRSA 4Y2XA 4LTMA 3ZXSA 4YHHB 5H80A 5CR9A 1B8NA 5LMCA 4AMUA 3QOYA 5JNVA 3LYHA 5F12A 1J1ZA 1O03A 2OB2A 3D2CA 5DXFA 2CHQA 2EKLA 3FF1A 3ZLUA 1JFLA 2XVXA 1OWLA 2ZUBA 2JFQA 1SHZA 2VPYA 4WMLA 3CMCO 4CCYB 2CLOB 5C8ZA 3WLPA 4CRWB 5EZ6B 1QONA 3LBFA 3R09A 2PT9A 3S2YA 2BM0A 3O2SB 3IBCA 1RWOA 4ZI7F 1UP6A 1QWSA 3BWYA 3GW8A 5KTYA 1JHZA 2CLCX 2IZ7A 3D8HA 2PT6A 1X8JA 3HI4A 3B85A 4W82A 1UPUA 4HDMA 3RKSA 3QWAA 4DL9A 1JI3A 4MV0A 5JASA 4EWLA 3BH7A 4L8VA 3WQHA 1LEHA 4KE7A 1FP6A 1GUAA 1O5IA 1ACLA 4FZRA 1ATIA 4PGFA 3EZFA 1PFKA 3DDHA 2C29D 3I4FA 1B7GO 4Y2JA 4P22A 2I3ZA 3KL4A 2Z4SA 3CUSA 2NSJA 3I9JA 1E1QD 3L0BA 1TU3A 3KZNA 4NBNA 4URXR 1V9SA 2WT9A 2UZ4A 2OV4A 1IYZA 3CNEA 5CURA 2CDAA 5C18A 2XDAA 4DA0A 2Q21A 3AFMA 4OAQA 5ARDA 3OAAA 4MWTA 3MTQA 1OT3A 3A4IA 5EHQA 1U2ZA 2ORVA 3OPVA 1Z5ZA 1FFGA 2WWTA 3AEKB 3IHLA 3MUFA 2VNKA 2IYEA 3R6LA 4PQYA 5GV8A 2IYYA 3R8CA 2ZK7A 2ZYTX 4DUGA 1N3YA 1RKQA 1ZW1A 2LZ0A 3VR3D 1SIOA 1Z4IA 3LP6A 2Q5FA 2YVAA 1DBIA 2G63A 3KWJA 4QULA 4F0JA 4NXNB 3DFIA 1N36B 1EJ0A 1P8JA 2G25A 2XLBA 3F71A 4WXMA 5A4DA 2QUHA 3H9BA 1F8FA 3R0ZA 1ENOA 2UXBB 1CJUC 1M2OB 3OFSA 1P2UA 3R7NA 3PU6A 4EKEA 4ZYVA 2BHSA 4ICIA 1LJUA 1IXYA 5A5DA 1CX9B 1LS1A 3BMNB 4RV9A 2B69A 1OWOA 3C3KA 3JQ7A 2INGX 5HJ5A 1IQUA 2R1TB 4IQ8A 5TSDA 3Q5GA 3FLMA 1CJCA 5SZJA 1DMSA 5CLIA 1R5BA 5AKIA 3BPSA 1G8GA 5NULA 2ZBFA 1ZFNA 3L4KA 1EZ4A 2H08A 1M54A 2AF4C 3O2NA 1M74A 4H1UA 4K9LA 2CDCA 2XJ4A 1AKMA 1QYRA 1QZZA 2FW7A 2O0LA 3KBBA 4FYHA 1CFJA 4JA2A 4ZHSA 1OZGA 3I0NA 4WBSA 3QXHA 2AJTA 5B2ZA 4TXLA 1SXJC 4BRSA 4MGEA 1XMIA 1T1IA 2VJQA 4YUVA 5TS3A 4BN0A 4AS3A 1XX6A 1DFIA 3Q7TA 2O9JA 1K7XB 4WX2B 4X6YA 3RASA 3SK0A 4HXFB 3ES9A 1MX5A 1T5OA 2HHJA 3GPBA 1Y9EA 4LWQA 4LGYA 1KQ3A 1SUCA 5B12A 5I7UA 1UBKS 1LNSA 4KDRA 4XGKA 4EF4A 1WZ2A 1HQYE 3TIXB 2I9PA 3MUNA 5F4BA 1ZI8A 4PGHA 5JCJA 3ZDCA 1KI4A 1IZ9A 3WMGA 1U5BB 3K32A 1E9RA 5FI5A 4ZYTA 2PGAA 5TQ0B 1RRVA 5I6DA 1Z68A 1P29A 2X2FA 1BD3A 1BDBA 5JD3A 3IP9A 3LD9A 4IF4A 1RPZA 4ZI2A 1KNXA 5A7FA 3KPUA 2Q7OE 1KYVA 1MFZA 2BUCA 2DUJA 4CNBA 2JD1A 4QT0A 4ZODA 1O2DA 1H4QA 3EARA 2R6HA 3TOCA 1CE8B 3B6KA 1K3FA 3FMPB 1TJ3A 2ISQA 1M5UA 3BTOA 4P7FA 2F8MA 1L5MA 4EKGA 3CRW1 4FFSA 3H7IA 1NNEA 5DX0A 3PIIA 3L77A 3J7TA 1W4BA 2XRFA 3W8RA 3OY2A 1YIDA 3KALA 3IP6A 3LHIA 3B53X 4FLMA 2H4JA 1LNQA 1WUIS 3T5DA 2J3JA 3TGWA 1KAQA 3DLHA 3BB3A 3HBNA 3C41J 5E4FA 1HI9A 1I1NA 1ZUNB 2VYCA 4MS4A 5DP2A 2YYSA 4DKXA 1ZEMA 1DRJA 2ZJBA 1YB4A 2UYCA 2PGLA 4UUOA 5HR5A 3DZFA 1HFJA 1KVSA 4Z3DA 4J9VA 4Q3AA 1MOQA 3K5WA 2BRUC 4DIMA 3ROMA 2PD6A 5M5BA 5IVKA 3INYA 3BMOA 3LTNC 4EI9A 4P7GA 1I7QB 3VV2A 1M0SA 4U6NA 1E9SA 2ET6A 1Q7CA 1VSVA 3IUNA 2LGJA 5DGXA 4O59O 3FFBA 5FB3A 1M34B 3O3OB 3OT4A 4B81A 3UAVA 1O4VA 1PT9A 2HUPA 4OBXA 1XE3A 4F9TA 1HPLA 2G80A 3FRIA 5HSGA 1TA4A 2IPXA 3B89A 1VG8A 4BNYA 2NNWB 2R3SA 1OU0A 5A4FS 4FKMA 4OH7A 3S4YA 4R2XA 2TYSB 3R5KA 4LTNA 2RH8A 1IN7A 3JQBC 1C8LA 5C32A 2JI6A 3P9XA 4A0RA 3IAUA 5IDQA 1PJCA 4GQBA 3PTLA 1IJKA 2HSGA 5KYUB 5H82A 2FFQA 5HFNA 2XMPA 3QWFA 4E5PA 3ZKAA 5J1SB 1JR6A 1KR2A 1XQWA 3OIVA 3C6BA 4EA6A 1PEKE 1M7GA 1JHDA 2JHCA 4AQ7A 3HY3A 2AZDA 1ZJYA 4RIFA 4IIJB 3EGDA 4CL3A 3T15A 5CDUA 4D3SA 2FG7C 1NUSA 3WAJA 5KX5F 4E5VA 1BE1A 1I2MA 2GFHA 1MH9A 1GVNB 4KMSA 4Y2GA 4KQIA 3U60B 2VZ0A 4G07A 4QOGA 3QKRB 4E13A 2ZUEA 5SYMA 4EJ6A 4TOIA 3K2BA 1QCYA 5A3VA 1U2GC 1XD2A 1GZ3A 2AFHA 4U7WA 3B51X 4HQRA 2HM7A 2ZRAA 3AJAA 1EAMA 3DXYA 3QKTA 3H65A 4I55B 1PZFA 4IFIA 2J9YB 1YJAA 4TMTA 1AOXA 3FMIA 3Q11A 5DLPA 2I55A 4DARA 2MSDB 2JA1A 3IAHA 1UFOA 2P91A 1PG0A 1JG3A 1TIBA 1E1MA 2A2ZA 2OCDA 4G4IA 2VSFA 5C34B 4LVCA 4JLPA 3E3LA 3JQGB 1LZLA 3ZN2A 1FYDA 1U0BB 4L16A 1M8PA 3NOQA 5IN5A 1KAOA 2OD9A 3PF9A 5F7OA 3LDHA 1JLLA 3CEHA 1CUYA 5JJLA 4DV1B 3QYFA 2BR3A 3MWEA 2G5GX 3OESA 5AXAA 3K0AA 1DBPA 4CKWB 4CT5A 5JU6A 1W52X 4GE3A 1MT3A 4O4LA 4D4JA 5ENDA 4UHKA 4XYEA 3NKFA 4HYEA 1BDMA 2XPCA 1KAEA 1W5TA 3EZ7A 2J59A 2J7KA 3UB3A 3SZLA 2WAMA 4LF7B 3PICA 3NONA 3H5AA 3ZD8A 2OFOA 5EIHA 2WILA 2R7LA 5J40A 3DBLB 2XDYA 3LC2O 3RSQA 2QLTA 1E4YA 4N8SA 2XTMA 1PFUA 3ME5A 5FWYB 1JKIA 1OAAA 5EIEA 2H5IA 3AF2A 2NZYA 1CZUA 1UEJA 3B1FA 2FZWA 2CLLB 3IMGA 4JXJA 4PCUA 1ORTA 4BVGA 5JMOA 4LRSB 2KSQA 3W5JA 3G9UA 1LD3A 1VL8A 4ZOEA 4Y2RA 1MGPA 3R3YA 3ZCTA 5LWQA 4PWZA 2BUAA 1QH1B 3OQ6A 2FRDC 5HDQA 2EVWX 3L7CA 4L3VA 3IQGX 2JLQA 1QYWA 3IOEA 4UBJA 3OC0A 2BFWA 3F6SA 4AY6A 3QNUA 1MHPA 3OZDA 4DR4B 3F1KA 4EQ6B 3R20A 4ZGBA 2AHOA 1I3OA 3A1UA 2F1OA 4PPFA 3D8TA 3RM3A 3ZWDA 1K8QA 2RBKA 4C7BA 5CDTA 4RS3A 1PJSA 1YULA 3P9QA 2F90A 4LY3A 2PWPA 3QKUA 4NMMA 4PTYA 4D4GA 3ONFA 1PJ4A 4H3KB 1C1XB 1CS4C 1IEVA 1U11A 2A5LA 2IYPA 3Q4GA 4XOIA 4AAYA 3CRNA 1IPFA 4L78A 4TKVA 5LQRA 1W48A 1KQOA 1SC3A 4IXNA 4N7BA 1REQA 3A36A 3K1JA 1JT2A 1RYYA 3QY0A 2J0UA 2FZ5A 2GYWA 4C78A 2JBAB 2RHDA 4R31A 3TXAA 4BWYA 4DRYA 4ZMBA 1ZGJA 2YC2C 2FPMA 4ES6A 4MQFB 5JJBA 4KIGA 2R8EA 2ZFUA 4P36A 3VH2A 2H00A 1ZBQA 3N2KA 2OY0A 3QUSA 1YS1X 4XDZA 4Z3KA 4BNUA 2HA7A 4D9JA 4PE5B 1YIAA 1B0ZA 1PJ3A 4RA9B 1L0BA 3NANA 2O8DA 4PR0A 3JR3A 2QD3A 2P2SA 3OFND 1QDEA 4IHKA 1XNQB 5LZ7A 3P71T 4D44A 1CK4A 1KR5A 1RXSA 5CH8A 4NCIA 3OTGA 3QP9A 1NN5A 4HNVA 1XCGB 3NDIA 4TMWA 2J87A 2HU7A 4RJIA 3PGVA 1FTSA 4B7UA 2OPBA 1VKHA 4YNBA 2OGWA 5JRZA 1X87A 2EZUA 3T3MB 3DZHA 4G5QA 3EW7A 3IHKA 3N0WA 5IXSA 4YGYA 5ESDA 1UBFA 2RJOA 4L02A 1UJMA 5CX4A 2V7BA 2WFLB 4BZXA 4CM8A 4DYHA 3L4JA 3ICEA 3OI7A 1GPJA 1QX3A 1XRQA 2PVPA 1SCBA 2V6GA 3E81A 2HOQA 3H42B 3L8CA 5JAUA 5BXYA 4G8BA 1QDUA 2WBLC 1MO2A 1IVNA 5J58A 4LNAA 2TMDA 5U1PA 3GPCA 4GGPA 2BEVB 3U7GA 3WS7A 4LZZA 2B7CA 2BFMA 4OXNA 1FFXB 1JYEA 4OHBA 3Q5EA 4DDTA 3SR0A 3KEQA 4Q1DA 3PLNA 2JGFA 3C1UA 5LA6A 4FYJA 1RS0A 2IELA 4NMWA 1GQQA 3WLQA 2GO7A 4J3JA 1WZNA 1V5IA 1Z34A 3C3BA 3HCAA 4LXTA 4TYQA 4X63A 1EUZA 2C61A 3HJBA 3LOQA 4KQXA 2ENWA 2IEDA 3R7SA 1MLDA 2JGMA 5AHKA 1N8TA 1P2FA 3ZV5A 2AA3A 1FLAA 2O2GA 2LBPA 2UUBB 5CK4A 1FL9A 4GVPA 4C5AA 3EUWA 1VBFA 4C0HA 4YAGA 5CUQA 2NUTB 4CKXA 1B0UA 1V1JA 2VUIB 3NETA 4ZV7A 5CA0A 3DZBA 4RE5A 3KQLA 3M9WA 3VNBA 1ZMBA 4BGEA 1WO8A 2OBLA 3HFSA 3LF1A 1Z2OX 2C3OA 2RC5A 5WRFA 3ZJYA 4YK7A 1DAOA 2WB4A 2JH8A 5AP9A 5J2TA 2I22A 3QX9A 3RWMB 3D3QA 3D8SA 1OWMA 2PX0A 1ODJA 1QG0A 4YPVA 1EH5A 3WRXA 1Q17A 2GH1A 3SY8A 2DBQA 3TW6A 1J99A 4IDGA 4HGPA 1LDNA 4IFEA 1WDLA 4O2RA 3RSHA 4JIGA 3UHFA 1E5XA 4FJ2A 3K1AB 1WSDA 4R2IA 2VIIA 1V1RB 2Q5LA 3MTDA 4IDBA 1JSRA 4RQAA 3V4SA 2HMWA 2UUOA 4F1KA 1OGYA 3KSAC 4N6NA 4IHJA 2RHWA 5EQFA 3P9KA 4Q1AA 5AKYA 3QYJA 3U3OA 5BSGA 4QOHA 3UAGA 5KNBH 1U6JA 5C8DA 5DGTA 5A9TA 2D4AA 4A0QA 2HRBA 3RTEA 2QY6A 5HKLA 1PDOA 1A9ZA 1XDDA 4CR8A 1XQ1A 1I7DA 3ISVA 3LWBA 1FDOA 3OJXA 4M1WA 1KKLA 2VF2A 3WDLA 5KNCA 3L06A 1QE3A 4ML3A 1RJDA 3G0OA 3E05A 2QN6A 4KWIA 4EDHA 5L3SB 4RVHA 2BFNA 1F2UB 1RJEA 1SZCA 3A3OA 2AB0A 3PV0A 4R1LA 5IUKC 4D4HA 4D5GA 5JNTA 3AIKA 4N39A 4ER3A 3KYDA 3BSWA 1MB9A 2ACEA 3K0KA 3TLBA 1O94D 1T9GR 5DT2A 1SG9A 1P3DA 5A4JA 1GTZA 2AWOA 2IH5A 4HUTA 3NR2A 3CRZA 2Q5CA 4GYWA 1XIVA 2ADMA 4TMVA 5DCYA 3KKLA 4KREA 1XZEA 3G0BA 1XTJA 1ZJ5A 1YR1A 5KCMA 1TVKA 3EGWA 2JVKA 2AKAB 1JVSA 1CP2A 3H9UA 4IDOA 2I6FA 1ZL0A 2P77A 5BPHA 4MUBA 2X8JB 4EPTA 4MWCA 1OX4B 4B3TB 3QFTA 3RRBA 3ZR4B 1Q3KA 1A88A 2EJBA 2VRCA 4DVJA 1IJEA 1KO8A 2FWIA 4CODB 1XQYA 5CB4F 4UJ5A 3SSOA 1L5FA 4UFNA 3BAZA 2H1OA 2A33A 2NYRA 2Z2XA 5EKUA 2QTLA 3QBTA 4EW2A 3I1FA 4F2WA 3K9NA 1VHWA 1FYVA 1YQ9A 1FUIA 3DOOA 3IUBA 3T5AA 1NXVA 1XZNA 2OD7A 3DUFA 4IRUB 4LI0A 2IKQA 4AJ2A 4IYRA 4P4TA 3WXMA 5KNDD 2WWVD 3DMGA 1IWOA 4OM7A 4IJ5A 4P31A 4IEEA 5CMLA 5FUWA 2PX3A 5TV2A 1USKA 3PNMA 1FA9A 2H85A 3RC2A 3V7YA 3NXKA 3K20A 2ZB8A 4J7CA 1F7VA 3ETHA 1TB4A 1G8AA 1B41A 2HK7A 3GH1A 1H65A 3MAJA 3RSCA 4OVKA 1WZEA 2NO1A 2R6AA 1GKIA 5D5QA 4U39A 5KSOA 1KOFA 5TGTA 2POQX 2XRZA 4IMPA 4Q7JB 4TT3A 4P38A 1J8QA 3DL7A 2C78A 5IUJC 4DHWA 5CAEA 4KV9A 4QAQA 3AY7A 3DD1A 3DC2A 2Z2IA 3LLCA 4HF7A 2REOA 3RWBA 5CFLA 1OIVA 3A25A 3T52A 4FDTA 3ONWA 2R1VB 4ZVUA 4C22A 5KNBA 5AVYA 4ZTUB 2LWIA 3WIBA 1OVMA 4AZTA 1QLHA 4POAA 3OLCX 4FGKA 1GP2A 1RCUA 2WIBA 3WQQA 1VLHA 2OB1A 4YP0A 1SM4A 4Y2HA 3DTVA 4WLFA 1ORWA 1T9KA 2WZDA 3IO3A 4G41A 3DV0B 4WOKA 3IQEA 2D5BA 3STWA 3H5NA 8ATCA 5CYOA 1N0WA 3SC2A 5HQTA 1XNHA 2PK3A 3FLAA 1RQPA 1G3IA 1V5FA 3I5XA 5L3QB 3PGKA 4YRIA 3C7TA 3K0SA 1JHPA 1Z4KA 4RKRA 5JAPA 2QZPA 5BQ5A 1MBZA 1XXHA 4OQZA 3J81k 4EYEA 4BP3A 3UG7A 3GEGA 4YRTA 1D2HA 2WI8A 5CDFE 3F67A 5BSUA 1DAMA 3MWKA 4Z4FA 4JXZA 1PK9A 3FZGA 4KODA 4O1MA 2MU1A 5HW0A 4YMIA 3CLRD 4C0AC 4L9SA 5TMPA 5C52B 4P92A 4DYVA 1TKAA 1DO0A 4S04A 4BIIA 2R85A 4R0VA 2H4XA 4NWIA 2X0JA 2ZAMA 3MTJA 5FWDA 3FWYA 4UU7A 4H7DA 3RANA 4D74A 3ZI4A 4BMPB 2GCGA 4RGYA 1RR6A 2O7QA 3MMZA 3UV6A 4DV0B 3WIUA 1R4AA 3K94A 2C4WA 4QLBA 3ND6A 1YOVB 2CCKA 4HDRA 4EI2A 1GGFA 2ATEA 4QVKA 5DSTA 3T7KA 4OI0A 1DVRA 2LCIA 2JAUA 2HX1A 5HZKA 1SC4A 4O4JF 2FPPB 4O4IB 2COEA 5D00A 3ZVNA 1W4LA 3BF8A 2BZ0A 4MA0A 4WNAB 2ZTMA 2V74B 2O2DA 3BKWA 3QF7A 3HHPA 4OJMX 2QVYX 1F12A 5C1PA 5HRCA 1IOWA 1GA4A 1FMTA 3R3SA 3OUUA 2JIZD 2FQYA 4GPAA 2IE8A 5K3SA 1EFVB 1UPBA 2XCLA 3H2GA 4R41A 1SXJE 4TKMA 1H0KA 1K5PA 1X1EA 3D6MA 2V98A 3NBYC 3I2IA 4U9IS 1W581 1A4UA 2EP7A 2PPVA 3GAZA 3K6RA 3CX3A 3NXSA 3VR6H 1JI0A 3DHEA 2PZAA 1QE5A 3E9QA 4RLFA 4ZU1X 2WHPB 2OXCA 1B26A 4JP3A 3EC7A 4ND8B 4Q9AA 2VDVE 5K3OA 3AHFA 2HU2A 1DIHA 2AN3A 5DZSA 2Y1CA 3DO5A 3PHLA 1D0VA 3CLTC 3KJQA 1C30A 4BEVA 3LS2A 1BCRB 2ZSFA 4OMUA 3GLFA 1L8OA 1SZJG 2D0DA 3BA6A 4OYHA 4P3PA 1UJ5A 1C7IA 2RGNC 1BS2A 2KS6A 5HFAA 3SJZA 1JQDA 2PUJA 4EYGA 1P6QA 3ZHCA 3H5RA 4HNAA 4PO8A 4DPKA 3WHPA 3EVFA 3MW8A 1W5FA 3F8WA 1LW7A 4GF5A 2F43A 4LKOA 3FPKA 1DC4A 3S2GA 4MJXA 2AYYA 2Q50A 1T0HB 4ZT2A 2OILA 1NDQA 3CPSA 4BNMA 1GKUB 3IQIX 3MFQA 2IYFA 3MG9A 3PDJA 2CV0A 2BGJA 3HDHA 1OB5A 3R6GA 5C1DA 1UMCA 3LDGA 4RDHA 4U8HA 1Z47A 1X8LA 2WF7A 4CM3A 2C00A 2ERXA 1CW2B 3JALA 4IJ6A 1OH8A 3SN6A 1HFKA 4Y2YA 5DK6A 3RFFA 2NYAA 2RHMA 3TQIA 2EGUA 2GD2A 1CR4A 1E4OA 4BKMA 4GI2A 4EZBA 2ZYHA 4L74A 4XPZA 2IYSA 5IM5A 4J16A 3RVLA 4FGLA 1X3LA 3ETNA 4EW1A 4OHYA 3FA2A 2BI4A 3SYMA 2YFYA 5F9FA 4GPIB 4HQFA 4MITA 2VOJA 3KJGA 3O38A 4X84A 1XZBA 4OGGA 2PMFA 4EG0A 1JQAA 1NLMA 2FHSA 3MGAA 3H11A 1F2TA 2C1EA 3H2HA 5DGHA 3KQWA 5B1IA 5H8WA 4MKRA 5EE5B 3UOWA 1K68A 5FJIA 4JDPA 3RRNA 2XKBA 1SRRA 4BEWA 4GIBA 3QYAA 4QBIA 1UKYA 4D2IA 2DLCX 1LI4A 5MF6A 2PFKA 3H5WA 1BVHA 3F0TA 1HYQA 1GCIA 1H5NA 4XLTA 3RBZA 2AJ8A 4GC9A 1HE2A 1J2RA 5JCOC 3RQSA 1NOKA 4AQDA 1EWTA 3L6CA 4YMVA 3AUSA 3FCXA 1G20E 2VOEA 1KI2A 3M34A 2H2WA 1KP3A 4LXYA 3VR6A 2I7XA 3JAKB 1AKTA 2JFNA 3HFRA 1E5TA 1QGUA 2FQ1A 3LAWA 1VBNA 2Y68A 3S1AB 4DRXB 4LWOA 4EY3A 4UNQA 2QYHA 2JI7A 2WM9B 1SBQA 2JGAA 4RKQA 4NZNA 4MRPA 4YUWA 1ILEA 4ZAWA 3WA6A 1XCJA 1G4UR 5DSXA 3Q8MA 3SX4A 3DKIA 1M5TA 2IWHA 4EVSA 2EG9A 4CCYA 4QUDA 3FYTA 1CNMA 2WF5A 3ZTYA 2WG2A 1RQLA 2GPNA 1H23A 5ICCA 3IP1A 4P0PB 2VQDA 2X3UA 1MO3A 2XGSA 4WK0B 1M1UA 5BW6B 4XQ0A 1SXPA 4DZZA 4AN1A 1S7CA 2EBUA 4Y6OA 1K8YB 8LDHA 1PT5A 1I4OA 2ZIUB 4RGBA 4S1NA 4MQEB 4ZZ3A 2HQ1A 1JN0A 1I6WA 3TKYA 1THTA 5DTQA 1WHSB 4BVAA 2QAGB 1J0CA 3QZUA 4CM9D 5KTKA 3BGIA 5IAKA 3ICWA 1L1EA 5HCUA 1MB3A 3QKSB 4BV9A 4BS9A 1K97A 4PR3A 3WADA 1S8AA 5ERGB 4JCOA 4I8XA 1P61B 3E1KA 4NAHA 1PDWA 3A9RA 4O4LF 5H02A 4CIYA 1SUEA 1W2HA 2HJ9A 5AW0A 2HY7A 3PWSA 1M6VB 3OCCA 4X6XA 1QP7A 2EQAA 3KCQA 4KO4S 4AS1A 4QUEA 1Q0PA 2CMHA 2GVNA 3OCUA 4MPDA 5ITVA 3O7WA 1T3LA 3OEWA 1KYXA 3L6BA 4YWHA 3QLJA 4LRYA 1P0IA 4OXXA 4CKEB 4ZTZB 1FJGB 1NBIA 3AY0A 5L3RA 1XVIA 1NFRA 4G0OA 2ODTX 2IXBA 3NBKA 5DE3A 3AEKA 5AOAA 3W2IA 5KYWB 4ZYXA 1VBKA 5GJCA 4AJLA 1Z08A 1L5HA 3SSNA 3V7UA 4X00A 2A9JA 1L8AA 3D7MA 3FSGA 5GTDA 3GZ4A 1H2RS 4A8JC 3BCHA 4OP2A 1MP0A 4PNHA 4B2IA 3A1VA 1ZGZA 2XAAA 3CZQA 4P9NA 1PR5A 2DFNA 4WNYA 1JH9A 2HZ7A 1A8QA 2YXBA 1SU6A 3DR5A 3MJFA 4YUZA 5BWBA 5I7RA 1G16A 3EA0A 1VRCA 1R0CA 2YX1A 1RHUA 3DFZA 2O50A 2QSZA 2WYVA 3ESBA 3OJFA 1NI4B 4Q1BA 2HU8A 1ODCA 2P0AA 4QTXA 4F7WA 2R1TA 5KZMB 2ICAA 3UTDA 2UXDB 3GUHA 3VBEA 1U9JA 4XLLA 2O8CB 1J49A 2IHJA 1OXUA 1SVLA 3T1HB 2WDZA 1C7RA 1XALA 1I5RA 2HCFA 3BG5A 2XNDD 3FY4A 4FBLA 4N5LA 2I0FA 3R5XA 5KSWB 2JIQA 3AVQA 2W11A 1AGYA 3KYJB 5K0BA 3NG1A 4W5TA 1XRMA 4C6TA 4XFKA 2BYTA 1NNSA 1FK8A 2X9GA 1BAPA 1KI8A 2O3QA 2ZRKA 2VJCA 1Q77A 1E61A 2V8OA 2COKA 3QFSA 4I6EA 2AMVA 4MO9A 4D8TA 1T29A 2Z4TA 3GFQA 3FPCA 2WAAA 3T7IA 4EMSA 1ZVQA 2ZUWA 3WLEA 4KITB 2VNJA 3ZZTA 5AVXA 2IVFA 5J4VA 5K45A 4MCAA 1OH7A 3W8FA 4Q24A 1K0FA 1RMYA 3N2EA 5AHXA 1EFAA 3LL7A 2IT1A 1FTQA 5HF6A 2J5XA 4BFXA 3U5TA 2Y1OA 5DW3A 3C3PA 5CVUA 5DO9A 4YXWA 1M6WA 3VO8A 5TQ0A 2XBLA 1LDBA 3B7GA 4GBGA 3G2IA 4Z99A 5C7OO 5ELXA 3EIOA 1QPGA 2ZJ6A 1CEEA 2PLFA 4I6GA 3O8QA 3KLMX 1XCBA 1L7OA 5ER9A 5J4LA 4GPTA 4OLHA 4ZQCB 1FW8A 1Q0HA 1TPYA 2VPXA 5GM2A 4E6EA 4ERNA 5ICGA 2YZ2A 3WYCA 4MICA 5LQNA 3DMHA 1CE8A 1NVMB 5KEIA 2BIFA 2ZS7A 3FW1A 5CT6A 1P17A 3NW9A 2H9AA 2Q2QA 1WDMA 1A5BB 2B21A 2WVAA 2XCUA 3NBQA 1K2WA 3OIYA 4U2BA 5LOVB 1W35A 4B8YA 1O89A 2PRIA 2OOKA 1A8PA 3D2LA 3QX8A 4FKZA 2AFVA 4A2PA 2B8JA 3WYGA 5LA6F 1LQUA 2Z8YA 3HUFA 5ER6A 4BXOB 3AF0A 3HBJA 4UQLA 1JG1A 4JBNA 2QB5A 3LRXA 3DZJA 5EMHA 3LHFA 2QRPA 5FT9A 5M3BA 4YXFA 1MXHA 5K0ZA 4G8DA 1CZRA 4ZEVA 1FZTA 4F7DA 3NASA 1E96A 1N1DA 3DDCA 5GWXA 1ZUNA 3UMCA