2A9FA

Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
386
structure length
383
Chain Sequence
LKNQLGQLALEQAKTFGGKLEVQPKVDIKTKHDLSIAYTPGVASVSSAIAKDKTLAYDLTTKKNTVAVISDGTAVLGLGDIGPEAAMPVMEGKAALFKAFAGVDAIPIVLDTKDTEEIISIVKALAPTFGGINLEDISAPRCFEIEQRLIKECHIPVFHDDQHGTAIVVLAAIFNSLKLLKKSLDEVSIVVNGGGSAGLSITRKLLAAGATKVTVVDKFGIINEQEAAQLAPDIAKVTNREFKSGTLEDALEGADIFIGVSAPGVLKAEWISKMAARPVIFAMANPIPEIYPDEALEAGAYIVGTGRSDFPNQINNVLAFPGIFRGALDARAKTITVEMQIAAAKGIASLVPDDALSTTNIIPDAFKEGVAEIVAKSVRSVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decar
publication title Crystal structure of a putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))
rcsb
source organism Streptococcus pyogenes
molecule tags Structural genomics, unknown function
total genus 105
structure length 383
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a9fA02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 2a9fA01
6ADHA 4DBVO 3Q9UA 1GFSA 3B1KA 1R0SA 1C3VA 2CVOA 2FMUA 2DTXA 7MDHA 1GQQA 2HLPA 4MINA 2J5RA 1PZFA 5U4QA 4N5MA 2VUTA 3UCEA 1GZ6A 4R51A 3DBLB 3KYDA 1GQ2A 1NTOA 4KWIA 1IB6A 4I5EA 3O38A 4WCFC 4YA6A 1MC4A 4UULA 5JXWA 2IZ0A 3KVOA 3U5TA 1N9GB 1ZEMA 3ONFA 4GPD1 4KDEA 5IG2A 1M6WA 1U5AA 4E2ZA 1T4BA 5ENDA 3Q1LA 2DBVO 2EP7A 3NGXA 4YXFA 4FFPA 1DB3A 3UXYA 3H3FA 1E5LA 5DULA 5A3VA 4ALKA 5JC1A 2Q2WA 5CDGA 1V3TA 2UUPA 2XXJA 4BO0A 2D8AA 4E0BA 2QQ5A 3FCOA 4E12A 4O5OA 1B2LA 3PWZA 3BMCB 2PFGA 1XU9A 2G76A 4JROA 1VE9A 1JN0A 1P1RA 5F1OA 3RJ5A 2EIHA 3E8XA 4TRMA 1OC4A 4GX5A 5IFLA 4ZGWA 1SOWA 4S1VA 4BV8A 5L4SA 3MEQA 4GQAA 4IY1A 3QVOA 3HQ4O 4FJ1A 3JD1A 3L0DA 4BL5A 4BO9A 1HSOA 2AQHA 1DDOA 1JW9B 3KO8A 3VH1A 4YJFA 3NTQA 3NYWA 3IKTA 4OM8A 1NASA 1XEAA 2JAPA 3GZNB 4DC0A 4BMSA 1C0KA 2OBNA 2VN8A 1U28A 1K6JA 4D44A 2I3GA 3H9EO 4CUJA 4YT4A 1C1DB 4XYBA 1T1SA 4F45A 2DPGA 4XDYA 1O95A 5JLAA 2RBEA 3ZV6A 4BGIA 3H65A 1NYTA 3F3SA 4I5DA 4BO5A 4MPDA 3WB9A 1DFIA 3SVTA 2V65A 1WXDA 4RPKA 2TMDA 1W8DA 4UUPA 1GD1O 3BYZA 2BI7A 4MVJM 1U3VA 4YB8A 3HE3A 3GRKA 2FOIA 2WYVA 2NQ8A 1DLIA 1B15A 5MDHA 1ORRA 3AJRA 1E6WA 1X1TA 3H9GA 5A9SB 4B7CA 1HDXA 3CUKA 5BNFA 3IJRA 5CEJA 5FEUA 1LRKA 5I7SA 2E4AA 2W2KB 1PS9A 1PJLA 2BGKA 1OBFO 3CTMA 1J4AA 3AFMA 4IINA 4MKXA 4CM1A 4D41A 3ZW8A 3P2YA 3WJAA 1E3JA 3ETEA 3DAPA 1LDYA 5JW6A 3NDIA 4Q3AA 1IPFA 2V6MA 4A27A 1OOEA 1SEVA 1XCBA 5ILGA 5CDTA 3BMQB 1B3RA 1PJ3A 1V8BA 5JAIA 1Z82A 4QO8A 1KVTA 1ISIA 1RYDA 2Y1CA 1DIRA 3HB4X 4Z9XA 1VPDA 3V5NA 3ENKA 4CPDA 2Q50A 1E7MA 3WIEA 1U7HA 4XIYA 3IUPA 4BNMA 3DFUA 3R6DA 3VZPA 4PRLA 3UN1A 1Q0LA 3OM9A 2BFOA 3X2FA 3A9WA 3NJ8A 3ZWPA 4PG8A 2X22A 4PLFA 1T2FA 5JMPA 1D1TA 3LF1A 4FN4A 3ASUA 3KSDO 4BNVA 5A04A 1DPGA 2NVBA 4Y6SA 5L7YA 3EY4A 4RVUA 1ML3A 4NJMA 4OOEA 2HMTA 4F3YA 3JD0A 3Q0EA 3RIHA 3QVWA 2OUIA 3ONDA 4J7CA 1K89A 3ZNNA 4NDNE 1MX3A 1ZBQA 2EGGA 2ZB3A 4HFMA 3Q2KA 2R2GA 4W9NA 1M67A 3ADOA 1BW9B 2O7QA 3DOCA 3GPDG 4DBZA 3JQBC 3PVZA 1HDCA 3AUAA 1SCUA 3B1FA 1JA9A 4R1UA 1QYXA 3UHAA 4CMIA 4IMRA 3F46A 4ZU3A 1DC6A 4NFHA 2JFHA 3F47A 2WMDA 1ZXLA 4A26A 1AN9A 3OQBA 2GLXA 1MXHA 4FJ0A 3ITKA 3FF4A 1I2ZA 3V1TC 1FF9A 2GGSA 3KLPX 3NJ4A 2QG4A 2GSDA 3JQFC 1QRRA 2VUUA 4JBHA 4EUFA 1V3UA 2H6EA 3RROA 4M86A 3HWRA 3U49A 1JKIA 3L77A 1N8KA 1CF2O 3FN4A 4E32A 2CSUA 2ZIZA 1HL3A 5F5NA 2BH9A 2I99A 1K2WA 2ZJ0A 3DTTA 4PLGA 4BO1A 4CM6A 5IJZA 3JQEA 2C5AA 3ST7A 4JQCA 1J0XO 3JYNA 2VNSA 2ILTA 3F1LA 4L4RA 1F8FA 2AEMA 5C5IA 2X4GA 1UDCA 4EJ0A 4EUEA 2NSDA 1LC0A 1OAAA 3JQ8B 1BXKA 4TWRA 5JO0A 1CQIA 4C4OA 1H6CA 4HV4A 3WJ7A 3GPIA 1PQUA 3U4HA 3E6AA 3DMYA 4YAKA 4GKBA 1ZJZA 2J6IA 2FR0A 3JQAB 3CMMA 4L9RA 1DXYA 2EERA 4CR8A 2X9VA 4NQZA 1ZK0A 3I9OA 4BNKA 1TI7A 2C7VA 2H9IA 4C7JA 1FDTA 4L4XA 4AJPA 2IYOA 3I6IA 4IQ8A 4ZA2A 2UV8A 3RBVA 5AQ1A 5HM8A 5CP8A 4XYLA 1F17A 3EUWA 5IDYA 4QQRA 4ZJUA 1VLLA 1ENPA 1K3TA 1VL0A 3DC2A 3RCBA 3VH3A 1PS0A 2B36A 3FNEA 2OMEA 2P2SA 3DBLA 3HNPA 4OGWA 5KTKA 5EQDA 3VTZA 1DSSG 3EAGA 4E2WA 3C7AA 3ZW9A 1ZK3A 3GR6A 4Z9FA 3ZWNA 2Y68A 4J4BA 2CDBA 2OL4A 4IJKA 3R0IA 4KZPA 1ISMA 2Z1MA 1Z45A 2POQX 2YYYA 3RC9A 4M49A 4XR9A 4CQLB 1Z74A 4AJIA 3VVCA 2VTEA 4R9RA 4EGFA 4MO2A 5I7FA 4XYMA 4CLHA 3OJLA 4CLRB 2GYYA 4TZKA 2HDHA 5L4NA 1WNTA 1ISJA 2YW9A 3FR7A 5G0TA 4FFNA 4P4LA 3NKLA 4JIGA 4FOSA 5T57A 3P5SA 3U09A 3D3WB 5CAEA 2YUTA 4LSWA 2QHXA 4NH4A 5BQFA 2V6GA 3MJ4A 2HK8A 4IGEA 5TJ9A 1VL8A 4E4YA 3HUDA 1R15A 4YRBA 1FJHA 4J49A 4B8WA 2B35A 1GUZA 4L73A 2WEKA 2JD1A 1H9BA 1LDNA 4NG5A 2C0CA 2BD0A 4OXNA 1GY8A 2O3UA 3A1NA 5IN5A 3DR3A 4FS3A 5JCXA 1RKXA 5H83A 2A9FA 4AJ2A 3U3XA 1CETA 1UXIA 4BNYA 3GZNA 4TROA 1PGPA 5ER6A 2D0IA 1VRWA 1Q7CA 4B3JA 4ALIA 3DZKA 4BNJA 4XGIA 4CQMD 2QZZA 2GD1O 3GN1A 2I67A 3PLNA 3JD3A 1C1DA 2WDZA 4J9UE 4R3NA 1OC2A 4RCVA 4BNNA 1LI4A 4A10A 3FPCA 4PLCA 4J7XA 3DAGA 1E3LA 2PZMA 1M6HA 4R16A 1VI2A 5U1PA 1D1SA 4DQXA 3C7CB 3MJSA 4J2OA 4FSHA 1LQTA 2DUUA 2AHRA 1NX6A 3GT0A 1P0FA 3IMFA 4CLOA 5HWSA 3KTDA 1LLDA 1RM3A 4YRAA 3AI2A 3GMDA 3W8DA 3MOGA 3JCZA 4BKUA 2EW2A 1U3WA 3EHEA 2EEZA 1BXGA 1FK8A 1A7AA 2E82A 3WQSB 3ZHXA 3TNLA 3ZV3A 1F0YA 5G0VA 2YHUA 5A9SA 3A4VA 2YJZA 1HDYA 1AHIA 4GKVA 4IBOA 4UVEA 4H15A 2BHLA 1MFZA 1PWZA 3CKYA 3ICPA 4TZTA 2DT5A 2W2KA 2C2XA 5G4KA 2VHWA 4BNGA 4ALJA 1PIWA 1LDGA 3HN2A 3AOEA 4DVJA 2PGJA 2AG5A 2GRAA 3D1LA 4DUPA 1EEHA 1ULSA 4WOJA 5TSDA 5IDWA 2Y0CA 3L4BA 1BG6A 1WVGA 3FWNA 3BMQA 4YWJA 4D3SA 2VRBA 3D4PA 3TL2A 2GASA 4XA8A 4CMHA 3K92A 1K5HA 5L40A 2HCTA 1I30A 1J5PA 3ETDA 3KHUA 1B8UA 3DTYA 4YT5A 4U6QA 5KVCA 3F5SA 4R4JA 1RJWA 2Q99A 4GWGA 3WGGA 5ER9A 5KJ1A 1O9BA 4PIVA 1RPNA 1NNUA 5KCZA 4EDFA 4FC7A 4II3A 5CHEA 4BUCA 4IDCA 3QVXA 3U4DA 3JQ7B 3MOIA 2CF5A 2I65A 2F1KA 2RH4A 1BHSA 1HDGO 2PD6A 1GQYA 4TKMA 2C59A 1T1RA 1FDVA 1YOVA 1JAXA 1ZEJA 1P74A 4BNHA 1DLJA 1C1XA 4BMNA 2FP4A 2BLLA 5JYEA 1MB4A 2Q1UA 3KLMX 3U4CA 3IP3A 5G0WA 4KQXA 1BW9A 3FTNA 4HADA 3EC7A 4JP2A 1IULA 3UUWA 3LLSA 4GX2A 2IXBA 4H16A 3AY6A 4N5LA 2B4RO 5DDIP 1IPEA 2J5QA 5LC1A 5CG1A 1I3NA 2H1SA 1P9LA 5L4LA 4CLXA 1GTMA 1KEWA 3COSA 3RUDA 1NR1A 4Z6KA 3WYCA 1X1EA 1AXGA 1L7EA 2P5YA 4WASA 3GQVA 1CYDA 1GCUA 2VZ0A 1QYVA 3LZ6A 4U0JA 3WSVA 4A5OA 1CWUA 1RWBA 2BMAA 1RYEA 2DQ4A 4WECA 3HDHA 5FFFA 4MOWA 5F3RA 2BELA 3FR8A 3PJEA 2G17A 1BTOA 2NV6A 1A27A 1O5IA 1CRWG 3ONEA 4P38A 5GZ6A 3K73O 1HDRA 1F8GA 4W99A 1PTJA 3A06A 3NTOA 5COQA 4XQEA 3H7AA 4NJOA 3VOSA 3IC5A 3ZWXA 5CEFA 4WLOA 1KBZA 4ZQHA 3WIDA 3KV3O 3GK3A 4E2XA 4TQGA 1N1EA 1KEVA 5DOZA 4MIEA 4NK4A 5JFOA 4RZHA 4JLWA 2DFVA 1A4IA 1GPDG 1EZ4A 2DAPA 3JQ8A 4J1NA 4AJHA 5L45A 5L53A 3R3SA 2X0JA 4ND1A 4RDHA 3EGOA 4D43A 1PWXA 1YBMA 3S2EA 2DVMA 1WDLA 3Q6IA 3ZZNA 3AK4A 1E92A 4R68A 3H5RA 1DOHA 3I9MA 4PLHA 4PG5A 3TZ6A 5IDQA 5KVVA 4O63O 4XGNA 1M75A 1H0KA 4G81A 3VPXA 5IN4A 1B0AA 5I7EA 3LC1O 1IZ0A 3BA1A 1JWAB 2C5EA 3RKRA 3T7CA 2VWQA 4K28A 5EERA 3WBFA 1P1KA 3WWYA 1K0UA 3C85A 1Q2XA 4XX0A 4WJZA 1TA4A 2EWMA 4PG7A 5AXAA 1NQTA 4A0SA 5TX7A 3DMTA 1EBUA 3HFSA 2BF7A 4NBVA 1PL7A 4MKZA 4NIMA 5TRTA 4YEDA 4OXKA 3O4RA 2B5WA 3TRIA 4DC1A 1HDOA 4GAEA 4PZEA 3KEQA 4RVGA 4CQLA 2DUWA 3GDGA 4XR4A 1GAEO 4DIOA 3MJEA 4U6SA 5HTOA 3WBBA 4LN1A 4CL3A 3OHSX 2QRLA 3ROKA 1PR9A 2VOEA 4J4TA 4RDIA 4RZIA 2W98A 2FY8A 3WGOA 4CLRA 4HKTA 4K6CA 3ZWAA 1DFHA 4WLVA 3H3JA 2FR8A 3I3OA 3I6QA 1A5ZA 3F5QA 3D4OA 4PLYA 3D3WA 1XR3A 1PX0A 5KJEA 3RUFA 3QP9A 3JQ9A 4J7UA 3H9JA 1X14A 4GMGA 1LRLA 1YBAA 3DL2A 3FRJA 2Y99A 2HO5A 2JD0A 1PU2A 1H6AA 4BNFA 4BVAA 4CM5A 2V6FA 5DOVA 1NVTA 1U3TA 1PJTA 1HF3A 1UDBA 4QO7A 1J49A 1WPQA 1KS9A 1JKFA 3E5RA 1YO6A 2W4QA 1P45A 7ADHA 4EYEA 1EMDA 5HS4A 3GGPA 1LSOA 1DBVO 3VPGA 1E1MA 4J9VA 4YQYA 1D7OA 5TIIA 4HWKA 5BSHA 1ZSYA 3FD8A 1C0LA 1DIHA 1NPYA 2RHRA 3SEFA 1I8TA 4AJ1A 5CEEA 3TOXA 1GR0A 5LCXA 1O94A 3TZHA 4Y9DA 1ZSVA 2X9NA 2GCGA 3K96A 3VKVA 4R1TA 2VUSA 2J3HA 1DC5A 1BVRA 4M55A 3VTFA 1HYHA 1XYGA 3GDOA 4WK6A 1ISHA 3OIFA 4B4WA 4EI2A 3F1KA 3G49A 3GF4A 4ZRMA 2X6TA 3BIOA 5T5QA 4CM4B 2HUNA 4IIVA 4E5KA 2IODA 2NU9A 2PGLA 4OSPA 1X0XA 3SLGA 4KP7A 4JX8A 2R00C 5DN9A 4R1NA 5K6AC 1X7DA 4HNHA 2JKVA 3ZU5A 4II2A 2ZTVA 2PZJA 1T2CA 3ZWOA 3NT2A 4YAEA 2Q3EA 3E5MA 1I10A 1Z7BA 3L9WA 3PQFA 4DXHA 4YVFA 4XDZA 4ZN6A 1VC2A 4XYGA 1KVUA 2CD9A 3KYCB 4Q3DA 4XIJA 4ALNA 3BXXA 1V35A 5ADHA 3WFJA 5IZ4A 4FGWA 3RKUA 3B6ZA 4WLUA 3MWEB 1Y8RA 3LT2A 1UR5A 4FJ2A 3WFIA 5A9TA 2QRKA 3GAFA 5IDXA 1WDKA 4L74A 4IDAA 4L75A 3PJDA 2GO1A 3I52A 1JVSA 3BZUA 1ISFA 4F6CA 4BNWA 5KVQA 5EJ2A 4TKLA 1RM4A 5AOVA 1NFQA 4DIFA 2CNBA 4BKRA 1HRDA 3AUUA 2FPPA 1C0PA 3JQ7A 4ZQBA 2Y0DA 4F6LA 1RM0A 3PYMA 4ESOA 1R4MA 2XAAA 4I08A 1PL8A 3NV9A 4QX6A 2NWQA 1E7YA 1GUFA 3C7DB 4IXWA 1UXJA 1O89A 2NLOA 3ZNQA 1GPJA 2C82A 3FNGA 3UKOA 4XD2A 1H6BA 2CVQA 3JQDA 1NPTO 1BXZA 5T8KC 3CH6A 3DDNA 1YQXA 2I66A 4E6PA 1UZLA 1GADO 3PGJA 3V2UA 4J90A 3AOEC 1GYQA 3FBTA 1IL0A 3DHYA 1K6XA 4NFSA 5EESA 5ENVA 2EKQA 1WWKA 1MC5A 1B8PA 2NNLD 3TZQA 5TT1A 4FCCA 3GUCA 3O8QB 1C0IA 4LMPA 4CJXA 5K9ZA 1NWCA 4FB5A 1NP3A 2ZB4A 2UVDA 4CM9D 4GVLA 3ETGA 2AE2A 2EHDA 5L7TA 3PIDA 5DF1A 2AQ8A 4HFJA 2ZYDA 4CLOB 1ARZA 3CIFA 4MIOA 3WTBA 2JFGA 4B3HA 4FFOA 3ZV4A 5JCJD 1I2BA 2D2IA 1P44A 2E48A 3GVCA 1LLCA 1H2HA 4GLOA 1H5QA 2Q45A 1BXGB 1P33A 1UP4A 1JLLA 4FIZA 2VQ3A 2WJPA 4GGOA 4P4NA 3GEMA 4J2HA 2VYVA 3OQ1A 2GZ3A 4YDRA 3VVBA 1N1GA 4DTIA 5A5EA 3G1TA 3OEWA 3GVHA 2VCYA 3TPCA 4NHEA 4PCVA 4TVBA 5G4KB 4N5NA 3PQDA 5KWEA 4CMEC 1SO8A 2VT2A 1GUYA 1Q0QA 4LK3A 5FYDA 1EVIA 1N2SA 2G0TA 1YBVA 4MP8A 4NU6A 3CINA 3G1UA 4FPXA 3OICA 1A9ZA 1N7HA 2JCYA 2QX7A 1Q7BA 1NHGA 1R16A 3FNFA 3RUHA 3LT1A 3DZIA 2PWZA 1LX6A 5CDUA 3HADA 4B4OA 4D3DA 4ID9A 1P31A 3AOGA 5JDIA 4EITA 4OHUA 5IAAA 3SLKA 4R54A 2CUKA 4NR0A 4FW8A 1L7DA 3HZZA 1W6UA 4B3IA 3BTSA 3GH3A 5IF3A 1IHXA 3INGA 4H7PA 2P91A 4OIMA 1MG0A 2GN6A 1KEUA 2OP0A 3I4FA 5A9RA 2JAHA 4U0KA 5HBRA 2W2LA 1AHHA 2DTDA 3NT4A 1YOVB 2X5OA 5T64A 4XJTA 4E13A 2VWPA 1GYRA 4ND4A 4XB1A 2BFAA 2H63A 5G0UA 5IZCA 1C1XB 4MKRA 5A3JA 2QZ9A 1HWYA 1H93A 2A35A 4CV3A 4QTZA 1QV7A 3WS7A 3JTMA 4AJNA 4UVDA 1GV1A 4WGGA 1QR6A 4NNJA 1E3EA 5JS6A 3UVEA 4E31A 3GY0A 2DFDA 2Y1OA 5L3ZA 1HLPA 3SX2A 4LISA 3K31A 3FI9A 2FWMX 4WPGA 1QXSA 1R4NB 2P4HX 2VRCD 3I9KA 4WEOA 2J8ZA 1A72A 3KRTA 1P1JA 3WGIA 3LLVA 2ZCVA 1XELA 4PRKA 5TS3A 4Y67A 5B4TA 4AFNA 3JYLA 3PIIA 1WLYA 4L4SA 4ALLA 1OI7A 2FHSA 1LLUA 4LCEA 1ZJYA 4IMPA 4XZ3A 1R37A 1QKIA 2NQTA 1EK6A 1I3KA 2B83A 2WD7B 4ILKA 3BMOA 1HKUA 3LK7A 4P4GA 5EL0A 1UAYA 3SC4A 4CUZA 3GVXA 3X2EA 3WICA 2DKNA 3RJ9A 4BB6A 4AJJA 3NAQA 4GSLA 4QUKA 1DHTA 3RC2A 3RU7A 3B1JA 5ICMA 5JC8A 4GBJA 3JYOA 4WLFA 1Z7EA 1EDZA 1ADGA 2WD8A 1G6KA 4DMLA 1EVYA 3HB5X 3OSUA 1DIBA 5A1TA 3OECA 1T2EA 3U0BA 4DPKA 2ZTMA 1WDMA 2JHGA 3UAGA 1GZ4A 2AMFA 5CPFA 2VHZA 3HDJA 4TMFA 3DEYX 2GN4A 5JSFA 3RC7A 2AE1A 3OJ0A 1AUPA 1U8XX 3ZU2A 4IIUA 3NUGA 2O3RA 4GSKA 8ADHA 3M6IA 3TQHA 3WGTA 3S2FA 3DBVO 3AM5A 3DFZA 4NBWA 4J0FA 4M1QA 1ADCA 3TFOA 1W0CA 3VAZA 2QYSA 4O1MA 2I5PO 1MA0A 1QYWA 2GN8A 5ITVA 4IJVA 4BGEA 4YAGA 3QSGA 2RHCA 4DREA 1VJ0A 3NDRA 1D4FA 3WQRA 4EEZA 1E1LA 4CM4A 4IS2A 3V1YA 1S7CA 4JCOA 3D0OA 4EBFA 3HFGA 2VT3A 1E6EA 5C37A 2G1UA 3TSCA 4LMRA 4CV0A 3HDQA 2Q46A 3STHA 2A92A 2GNAA 5AXDA 3O03A 2Y1DA 3ROPA 3QVTA 1DHRA 2AW5A 3ITDA 4IQ0A 1LSJA 2PKQP 3QJ5A 2IYPA 3OETA 3QE3A 1EQUA 2PV7A 4ONEA 2V6BA 3KYCA 3CZRA 3DZBA 4FOOA 3AM4A 3H2ZA 4JP3A 3V2HA 4C7KA 1SAYA 3WGZA 2C2YA 4Z0TA 2WYUA 4HNGA 1YB5A 9LDBA 3K2EA 4BNXA 3MJCA 4CL8A 1SPXA 2HJSA 3ULKA 1XQ1A 1XQ6A 4YYZA 2PGDA 1JDJA 1YB4A 2RCYA 1X13A 3PHHA 1XSEA 2C07A 2P9CA 3QW2A 2NTJA 1NQAO 4BNUA 4B7UA 4EJMA 5JNLA 5KIAA 4WE3A 3P2OA 2VZ8A 1JQBA 2C7GA 1YJ8A 2I3AA 2YFHA 2XOXA 4MVJG 3NT5A 5COBA 4AL4A 3ORFA 1DAPA 4EZBA 4HFNA 5BR7A 5T67A 3NRCA 3W6UA 1TT5A 3P19A 2HMSA 3INRA 4I9HA 5U9CA 3M1LA 3W4KA 1LRJA 4DQVA 1UZNA 2CDCA 4E5NA 4BKPA 3VH2A 3NDJA 4NBTA 3QV1A 4WLEA 2D5CA 5A03A 2C20A 3Q9NA 3HJAA 3KM0A 1LBEA 4TRRA 3T7EA 4BNLA 4MVJD 2X0NA 4JBIA 4Y98A 1UUFA 1HE3A 4NZ9A 1LSUA 2WE7A 5AXCA 1UDAA 3QVSA 2Q4EA 4CM8B 3O8QA 4D7AA 4WCFA 1EK5A 3O26A 3DAFA 3DO5A 3TN7A 1C14A 4FR5A 1E7WA 1TEHA 1P0CA 3Q2IA 4MVJP 1YDEA 4RF4A 1U1IA 5B1YA 4U7WA 3VPFA 5F1KA 4CMCA 5L9AA 2NVWA 1FMCA 4YJDA 3OFSA 1E7SA 1YQDA 3JQ6A 3DZJA 5JDCA 3PQEA 2Y0EA 4M89A 5CPBA 1U4OA 2LDBA 3HG7A 1P3DA 4QXMA 3AI1A 4GX0A 2B4QA 3GNQA 3K2BA 2HSDA 1ENYA 3OIGA 4HXYA 3NX4A 4WNIA 5FF9A 5TNXA 4CQMB 3ZWVA 2DBZA 3I9JA 4RPLA 1PEDA 3G17A 3E18A 3DQPA 4RLSA 4ND3A 3M2PA 3S1LA 1F06A 5G0SA 4DLLA 1HE2A 4LVCA 2VHYA 5I9MA 4D0RA 4CM9A 1DJNA 1E77A 2ZATA 3JD4A 4BO3A 1Y1PA 1Y8RB 4D46A 4LCJA 4R9SA 4WCDA 1PL6A 1NAIA 1PGJA 4DYVA 3KETA 1YWGO 4J6FA 1G0OA 2DPHA 3QHAA 1MG5A 3AUTA 3KZVA 3OJFA 1PJSA 2FR1A 4QEDA 2EXXA 3F6YA 3WOHA 4GL4A 3WTCA 4DA9A 4KOAA 1CQJA 2BFMA 4RF3A 2O2SA 3OH8A 3ANNA 3OMLA 1UH5A 1R4MB 2H5LA 2G82A 2ZQYA 1U8FO 3R3JA 5THQA 4B8ZA 3W8FA 4IZHA 1ZK2A 4S3MA 5ES3A 1LEHA 2DLDA 2QIOA 3PLRA 1U2GA 4JN6B 3WYEA 1YJQA 3MCVA 2VYND 2X9GA 3AWDA 1ZH8A 4PG4A 3LF2A 5A06A 1ADFA 1WAMA 2EKPA 3LDHA 4W82A 5DBGA 2O2YA 3E9QA 4XQGA 2WYWA 2YDYA 4GLLA 1ZMOA 5JAZA 1HXHA 3PHLA 4HY3A 2OGUA 3ZGYA 1B16A 1PQPA 3I4CA 1R4NA 3D3EA 3PFFA 1W4ZA 4DGSA 3O9ZA 3I1JA 3PI7A 4CMAA 5JDIC 1GYPA 4R1SA 2HRZA 3ICCA 1ZKMA 4Q39A 1DC3A 3GNTA 1I24A 3QIVA 3ZN2A 3UICA 4B79A 4IJUA 3B20A 3GAZA 3RUEA 4UUNA 2WD7A 1ZIDA 2B69A 4DIBA 4UREA 3MZ0A 1X7HA 1PJ2A 3TJRA 2O4CA 3BTUA 2IRWA 1ZFNA 1Z6ZA 4IDFA 1NBOA 3RFTA 1HT0A 1U9JA 3PRJA 2VWHA 4XKJA 5K0ZA 3JSAA 1ZO8A 1EE9A 1ZVMA 4OQYA 2X5KO 5H82A 1GDHA 3A28A 2AEFA 3LYLA 3PK0A 4W9NC 2VRCA 3RSHA 4J43A 2OBYA 4I8XA 4BNIA 2AQIA 4F46A 4PLZA 4NMHA 1ZW1A 3BTVA 1DRUA 1ENZA 4CUKA 3IUSA 1TLTA 3N58A 1JWBB 2NACA 3DB2A 1BGVA 5TJHA 5KJFA 4PVDA 4AG3A 2RIRA 3QQPA 5A05A 4E5YA 1E3WB 1V6AA 3EVNA 3NGLA 4PFJA 1YL5A 2NADA 4IM7A 4RLHA 5IXSA 1FXSA 2FZWA 2PH5A 3PZBA 3GEDA 3IAHA 4PN3A 5TLSA 3OA2A 3EZYA 1B8VA 1QYDA 4NBRA 4U8GA 3RFXA 4KUEA 4O6VA 4Y6RA 1GEGA 3K8ZA 3UW3A 3AI3A 1SB9A 1LDBA 5AXBA 3E9NA 3FPLA 4OH1A 4EJ6A 4M8SA 1YDWA 5FWNA 2O3SA 3KB6A 1LC3A 3QWFA 1XHLA 3ZWMA 3LT4A 2X8LA 4CMBA 2O23A 1U7TA 4JBGA 1FDWA 1XWFA 2O7SA 3PHGA 1B3BA 3PPIA 4LSMA 1VJTA 4KUHA 4NK5A 1QP8A 4PZCA 3EW7A 3JQFA 4GH5A 3PP8A 1PSDA 4N7RA 1I3MA 4G2NA 4KUGA 3ZWWA 2IZ1A 2JFFA 1D3AA 1DEHA 4BB5A 1Y8QB 2PNFA 2OXIA 1SOVA 1BWSA 1ZK4A 4R3WA 4Q3BA 3ADPA 2XPCA 1I0ZA 5BSEA 1NWHA 4J1SA 4EUHA 3L4SO 1ZSNA 2O48X 3AY7A 3W1VA 4YACA 1U4SA 3PTZA 1PGOA 3GEGA 2Q2VA 4ZD6A 1ISGA 5JBIA 2JD2A 3ZHYA 5CG2A 3NTRA 3EYWA 3DHEA 1E0DA 3DWFA 3WXBA 5LDHA 3PJFA 1YRLA 3LQFA 5CDYA 2IEDA 1KY4A 3BMOB 3RU9A 4K1LA 4NPCA 3RWBA 3JQCA 1Q7GA 3ZI0A 1KVSA 2YDXA 2I9PA 1QG6A 3DZHA 2AXQA 3IQDB 3AU9A 1WW8A 2QRJA 4WOKA 5IXYA 3C24A 3U4IA 1B7GO 5A4DA 1M66A 5I9LA 2IZZA 1ZCJA 1CEQA 5HA5A 1YB1A 1YVEI 3RQSA 1H6DA 2PLAA 2Z95A 3HN7A 3GVIA 3I23A 5EINA 5JPIA 4XQ9A 4U5QA 3AY3A 5T6BA 3TWOA 1P1FA 3LSYA 2AQKA 2HU2A 1MUUA 3LU1A 5COAA 5F5LA 4BNZA 5FI3A 1DRWA 2YQ4A 3GHYA 4MP3A 4IDEA 3UCFA 4J1TA 2YV2A 2X0RA 3T4EA 4CM8A 4CM7A 1EUDA 2PD3A 2CY0A 4J4HA 3CPSA 4R5MA 1IUKA 4D42A 2YV1A 1BDMA 4KWHA 5EQFA 1SC6A 3H4VA 5GZ3A 1DIGA 1ONNA 2UYYA 4CR7A 3CXRA 1I5RA 1PGQA 1VKOA 3GUYA 1B26A 1CERA 4OYRA 1SMKA 2JCXA 2UUOA 3SBOA 4AJEA 3RBZA 3LT0A 5DBFA 2Y66A 1YL6A 3PYLA 4UUOA 1E3IA 4MVJA 4WLNA 4CQMA 2IDZA 4MDHA 2FRDA 4E33A 2PR2A 2NVUB 4IZIA 1KC1A 2XXBA 4AJ4A 1NVMB 3F4LA 1OMOA 2EW8A 4OKNA 1NPDA 5L7WA 2GZ1A 3BTOA 5B37A 4RQTA 3C3XA 3SJUA 3GZ4A 3OQ6A 3ZHBA 2BI8A 4Z3DA 5I8ZA 3MTGA 4BO8A 5L95A 3IKVA 1R66A 1V3VA 3OIDA 3DXFA 4RPHA 3TL3A 3GDFA 5DZSA 4I9UA 4TVOA 3QLJA 2W8ZA 1YONA 5HS6A 1XKQA 4ROSA 4AJKA 4P22A 2GUGA 1Q1NA 2GR9A 2NU6A 2DTEA 1P77A 2DBRA 4HX5A 4BO7A 5KJCA 3ZWYA 2Q1WA 3Q3CA 3ON5A 2DM6A 4XEHA 3M2TA 4Z9YA 3KEOA 4ZQGA 4RPJA 4DLBA 3TOZA 2WTBA 4OKIA 5JDCC 3V1UA 2X1HA 4BV9A 3BHIA 4CODB 1H2BA 1YKFA 1HYGA 1B14A 1TT5B 3UH1A 2Q2QA 5KVSA 1YGYA 2Y05A 3VC7A 3WGYA 5EIOA 2O3TA 3MTJA 2HK9A 5EPOA 4CV1A 4Q3NA 4ZICA 2B0JA 2B4TO 4I9NA 1NM5A 1KVRA 2Y93A 4G5HA 3QWBA 5KNLA 5ICSA 3GG9A 2CF6A 4CV2A 1LA2A 1U5CA 3LVFO 3OA0A 4DWVA 3ZWCA 4EW6A 1ZUD1 1F12A 2B5VA 4NBUA 3L4BC 3KUXA 3GFBA 4XWYA 4WCFB 2P68A 4NI5A 3ZU4A 1YXMA 3DBRB 2VOJA 1PZEA 4L8VA 3D5TA 1Y5MA 1G0NA 3G3EA 1BSVA 5JY6A 3KSZO 2ZCUA 4XCVA 3K30A 1I2CA 4ZVVA 5BNIA 4ZQEA 1BMDA 1FDUA 1TXGA 4RF5A 3S2GA 2V7PA 1VSVA 1Y7TA 2Q4BA 1NFFA 5J23A 4IDGA 3PWKA 2ZKLA 4OSOA 5CFZA 2PD4A 1PQWA 2EJWA 4ITUA 1LTHR 2NTNA 4ZRNA 2VYNA 1Z75A 4WKGA 1Z73A 3IJPA 2PK3A 4XYEA 4UUMA 1W73A 3GRPA 3JV7A 4YQZA 5HRUA 3H5NA 1HTBA 2ZTUA 1O0SA 1GEEA 2GDZA 3PZRA 4YTEA 3ZCXA 2EP5A 2NM0A 4XQCA 1IZ9A 3QRWA 3WYBA 5F1PA 3K9QO 4YJHB 4BNTA 3H9UA 3ZV5A 4A73A 3FWZA 1KC3A 1MLDA 2ZB7A 1UP7A 4Y6PA 1WMAA 3SJ7A 3EZLA 1KY5A 1AGNA 1MV8A 2HJRA 3U9LA 2HMVA 2I76A 3RC1A 1DJQA 4RV9A 3WLFA 1PJ4A 1HE4A 3L6EA 3WMXA 1E3WA 4IGFA 1ZZEA 4CLEA 3TFQA 2EGHA 2NU8A 4RPGA 1R0KA 2C54A 3WG9A 2HAEA 4G65A 5EN4A 4J91A 3DOOA 1NFRA 5BSFA 1N7GA 1MP0A 2YFQA 3RI3A 2E49A 2GF2A 1ID1A 2PKQO 4OL9A 4DMMA 1PR3A 5JY1A 4XJSA 2IXAA 1SEPA 3F9IA 4E5MA 1ONPA 1HE5A 3JQGB 3KYBA 3BMNA 4R01A 3I9LA 2FPIA 1WMBA 3S55A 4QFDA 5I7VA 4CLDA 4PLVA 4CMJA 3KOUA 3QY9A 3MJVA 9LDTA 3I83A 1Y8QA 4R69A 3WSWA 2Y1FA 4FBGA 1N5DA 3G79A 4GGPA 2AG8A 4JGBA 4JNKA 3DZGA 3P7MA 5DCWA 5MGBA 5JMWA 4DPLA 2D1YA 1ULUA 3ANMA 4UEKA 4PLTA 5DNAA 1BRMA 1GCOA 4OMUA 1E5QA 4M54A 1ADBA 1PGNA 5TF4A 1KEPA 1I36A 1LLQA 1U2DA 1WZIA 2PA3A 1EFKA 4D0SA 1UXGA 5DCYA 1TB4A 3C8MA 2YHIB 4RVFA 2E6UX 3W4IA 4HBGA 4ALMA 5B4VA 1PS8A 3VZQA 1MXFA 4BQRA 1LU9A 4L0QA 2CFCA 3AFNA 2BGMA 8LDHA 1XU7A 4W7HA 4W4TA 2VHXA 5EMHA 4E3ZA 4AJLA 2A4KA 3M1AA 1EVJA 3DMTC 3CSDA 5JAMA 4DRYA 3VDRA 5I9NA 3VPHA 1IY8A 3IP1A 3JQAD 3DBHB 4UVIA 1OFGA 3PFWO 1K6IA 3GVPA 2ZQZA 4GX1A 4FD3A 4RF2A 3D4NA 1CJCA 1NR7A 4O0LA 3LC7O 4Z0PA 2CMDA 1QSGA 1MFPA 3WQQA 1NXQA 4JJIA 1JU9A 1ZXBA 4RVHA 1LXCA 2ZTLA 4TSKA 3GG2A 3QWHA 3G0OA 3EK2A 2ET6A 3H5AA 2X7HA 4E30A 1TVEA 3UFXA 4MJLA 1VJ1A 5GZ1A 1Y5RA 4PZDA 2VZ9A 3MWDB 2OOSA 5A02A 1LNQA 2BKAA 3R1IA 1HETA 3HHPA 4ZHSA 5JAQA 3JQ9C 2J3KA 1VM6A 1I32A 1KYQA 3ZNOA 1HEUA 4JJGA 3UF0A 3PEFA 3L07A 4A03A 3CE6A 4GWKA 2J3IA 4WUVA 1YQGA 3K6JA 1XA0A 1O8CA 5DT9A 2X58A 4XRRA 4N18A 3MJTA 4BO6A 3UOGA 4BGUA 5TQVA 3PWSA 2NVUA 1M2WA 2OO5A 1JAYA 4EEXA 1DRVA 4BHTA 3PDJA 3VPSA 4FDAA 1M76A 3QWIA 1XLTA 3E9MA 3H8VA 1G1AA 2YZ7A 1GV0A 2ZYAA 2O50A 2AA3A 4MIYA 4XGKA 4J3FA 1KERA 3I9NA 3FTPA 4RO0A 2Q1SA 1EVZA 3ROMA 2G5CA 1I3LA 2PKRA 3IIEA 4INAA 3GNSA 1A71A 1X7GA 2D5AA 3D7LA 3EMKA 1N9GA 1BDBA 2FZEA 4J0EA 1EE2A 3U62A 1T2AA 1EFLA 4LGVA 4BO4A 2JL1A 3WGQA 4DYDA 2QYTA 4JXKA 4BGVA 2P4QA 1LDEA 4X54A 3RUCA 3ZWBA 2EJVA 4O59O 4OO3A 4YAJA 4YT2A 1EDOA 1EUCA 2BFPA 1Q0HA 2WM3A 1D8AA 5GMOA 3ZHZA 2QW8A 1JTVA 1PJQA 3UCXA 2A94A 2Y67A 3Q11A 2HMUA 2WE8A 4FGSA 4E21A 5B4UA 2ZYGA 3AUSA 1VSUA 2HQ1A 3BMCA 1GL3A 4D3FA 1ZMTA 1XIVA 1I33A 4AICA 4BOYA 1SZJG 1AXEA 3EVTA 1E1NA 4RORA 4W7IA 5B12A 1F14A 4RJTA 1LDMA 1CIVA 1DIAA 5KOIA 2J5KA 3RUAA 1S6YA 3DZFA 2UDPA 4DQUA 3PHIA 4PGFA 4CMKA 4CM3A 4UAGA 2PH3A 1P1IA 3GFGA 1BVUA 5DCUA 1XGKA 3ASVA 5I8WA 2R00A 5K6AA 4IXTA 1A9YA 2JCVA 1VKNA 3ABIA 5KJ6A 2OHXA 3DBRA 1PZGA 1HDZA 4DL9A 5L51A 1SBYA 5DP2A 4OXYA 1MGOA 5ITWA 2Y1EA 3H2SA 3CZMA 1V0JA 4TRNA 2FPGA 4RGBA 4TRJA 2HMWA 3SXPA 1Y6JA 4KTTE 1EBFA 3PHJA 1UP6A 1NAHA 4J1QA 1JKJA 2P9EA 5H81A 3TDKA 2Z5LA 1WP4A 2PY6A 3JD2A 3L6OO 4YCAA 1YL7A 4OQZA 2O3QA 4YJGB 4HUJA 1IE3A 1QORA 2OFPA 1X15A 2EF1A 1P1HA 2IE0A 3GHHA 4IDDA 4NFYA 3VDQA 4Q9NA 3OEYA 3PXXA 4R5HA 5G2OA 4XRGA 1LJ8A 4GMFA 4YJHA 4BKOA 4I1IA 3RASA 3E03A 3B70A 4CMGA 1KETA 3KYDB 2HKIA 1ONOA 1A4UA 5FI5A 3OJOA 4K26A 1H94A 3WNVA 2WSBA 5JCJA 4UVHA 3ZNPA 1RM5A 4ND5A 3EDMA 3GC6A 4Y8VA 3IDSA 3BHJA 5T8KA 1SNYA 4I5FA 4M87A 1UXHA 1UZMA 4YBZA 5KKCA 3L9XA 4UEJA 4B7XA 2D3TA 1T2DA 1ZNQO 2CVZA 4JK3A 3WWZA 1H9AA 3WR5A 1DAOA 3FNHA 5ILOA 1QLJA 3FBGA 5TT0A 2IEBA 3ROQA 3C1OA 1T25A 2O3JA 3RAJA 1T4DA 4D79A 3VKUA 3GOHA 3I5MA 5JO9A 2I6TA 3OP4A 3E82A 1O6ZA 3WMWA 3PJGA 2OORA 4FQ8A 1R12A 4URFA 3K5PA 1T24A 1E7RA 3JQGA 3DOJA 3RBXA 3WLEA 1R0LA 3H9QA 4PG6A 5DP1A 1HZZA 2OP1A 3T4XA 2UAGA 4E5PA 3RD5A 5F21A 3WX0A 3UGKA 3QA9A 3A14A 4Z3KA 3HDYA 2RH8A 3VZSA 1E3SA 2BRUA 4GI2A 1KOLA 4PVCA 3WGHA 1X0VA 4BQPA 2FN7A 4YJFB 2W90A 4B4UA 5JE8A 4BMVA 5THKA 1HZJA 4UVGA 4MVJF 4LW8A 4OAQA 1SB8A 3AM3A 3C1AA 1NHWA 1Y9AA 2GPTA 2X0IA 4QECA 4CMEA 3JYQA 4A2CA 2FSSA 5KKAA 1XDWA 5C7LO 2VYVD 3N74A 5C7OO 5GY7A 2F00A 3V2GA 1NQOA 2HK7A 1KVQA 2X86A 2PZKA 2JHFA 2PZLA 1Y81A 4IDBA 3V8BA 1E1KA 2NTVA 3AW9A 2Z1NA 3L6DA 4P8RA 4ZQFA 2RAFA 3VHRA 2YHIA 3JYPA 3AU8A 4Z0HO 2DBQA 1LUAA 2NUAA 4NU5A 5IZCC 3PDUA 3PYXA 4YR9A 4AJOA 4PLPA 3W6ZA 4W6ZA 2X23A 1HYEA 2Q1TA 5AVOA 3DBHA 4KMSA 1OZAA 5A5FA 1HLDA 4OOFA 3ANLA 3TZKA 4XB2A 2P5UA 3LC2O 4IQGA 1PJBA 4FC6A 1NQ5A 3ZH2A 4Q3EA 4YPOA 5C7IO 3KXDA 5LDGA 3IOYA 4MVJH 4OJNA 3BAZA 4BO2A 3OJEA 1NVGA 3H6KA 4N54A 4FFRA 1UJMA 2W2LD 4QT0A 4RL6A 1E6UA 2Q49A 3JQBA 3BHMA 3D64A 3RVDA 3IL2A 3ZDFA 2HRBA 3PGXA 1DFGA 4MVJI 4ND2A 2VTDA 2ZJ1A 5BSGA 4GVXA 4WEQA 2DC1A 3TZCA 2BGLA 6LDHA 3OBBA 1LQUA 1YH3A 2XF8A 3JQAA 2ZB8A 4Q3CA 4YT8A 3BMNB 5TGDA 3KBOA 3GN2A 1DO8A 4QSMA 2YQ5A 3GA0A 4HP8A 3C1TA 1N92A 4IPTA 2CDAA 3RFVA 5AYVA 4IUYA 5DBIA 4KDFA 4KTVE 4K9DA 4RVSA 3OF2A 1DC4A 2AEJA 1PJCA 2JJYA 3INTA 1QYCA 1YE3A 4NJMB 4RQUA 2GN9A 2OZPA 5BT9A 4MVJE 2LDXA 4JJFA 4R41A 3CEAA 3CMCO 4H3VA 1U3UA 1VL6A 2PTGA 4KQWA 4MP6A 2J3JA 4LVUA 3D5QA 1GU7A 1IYZA 1UXKA 4WNCA 4YAIA 3W8EA 4CR6A 4LRSB 1TT7A 2NU7A 1HSZA 1AE1A 4E2YA 3E48A 4YRDA 2SCUA 3VZRA 1ZK1A 3GGOA 2GERA 3DHNA 3DONA 4CMIB 2C29D 2D4AA 3GMSA 1WZEA 2O4UX 4LRTB 2VNAA 3GGGA 3WDSA 4BS9A 1JVBA 4D45A 2VHVA 1IHYA 3ENNA 3VH4A 2ZK7A 3E1KA 3N7UA 4IS3A 1FDSA 4A7PA 3S2IA 3S8MA 2E37A 3GLQA 3F4BA 1QMGA 1XG5A 2EG9A 4I5GA 4UEOA 4AVYA 1QLHA 4J16A 1V9LA 3TF5A 1CDOA 3HSKA 5CDSA 1KIFA 4FFLA 1QV6A 2Y1GA 3QWAA 1J6UA 1ENOA 1A7KA 4K6FA 4BIIA 2CZCA 2DU8A 1LSSA 2P9GA 2WWRA 4RVDA 5TC4A 3WNQA 1R6DA 3SC6A 4FFMA 1UAGA 2R6JA 4IJWA 1PZHA 4B4VA 4DPMA 5BNTA 5JYDA 1T26A 2YY7A 1Y9EA 3W4JA 3FSRA 4DLAA 1E7QA 5G4LA 1EUZA 4HFRA 2TMGA 3RUIA 2GZ2A 3KSUA 4L76A 2B37A 4PLWA 3FHLA 2EV9A 2X5JO 1EQ2A 1L1FA 1IOLA 3ZU3A 2YV3A 1I01A 2FSVA 2D59A 4QFCA 2VWGA 3IS3A 2EKLA 1YS4A 3NEPX 4YJGA 1GZ3A 5C3MA 4BKQA
chains in the Genus database with same CATH superfamily
2BUCA 3PE6A 1VQ1A 4ZHQA 1GFSA 1SXIA 3Q7EA 2CVOA 2FMUA 3KQLA 2NP7A 2OV4A 3BBPA 4NYMR 1ZIOA 1C81A 2HLPA 2Q0QA 3PPWA 1GTVA 5U4QA 4N5MA 1AB6A 2OWEA 2JIRA 2XLBA 3EBLA 5F73A 4KYTA 4YN3A 3PLAE 1H1TA 1E1CB 4IWNA 3BWEA 2YWCA 1KR5A 3KKNA 4RIHA 3OPVA 2HZ7A 4TV9B 1JILA 2NZUG 3BGVA 1H4QA 1O57A 4I5EA 3QIAA 2NO6A 4WCFC 5ALOA 1MC4A 2ISSD 1NJGA 4NYMQ 2MSNA 1R8JA 2CLOB 4RAQA 5H70A 2IZ0A 1NJ8A 3X44A 2HA6A 1ZEMA 2EFHB 2X2PA 3ONFA 3Q5EA 4KDEA 4MWZA 2HTFA 4RCZA 3C3CA 4DKJA 1P4AA 4UASA 4LF6B 2F17A 3VNVA 3OVMA 4B80A 5HIMA 4D1YA 2PSEA 3QYFA 4PSKA 5FA8A 1GNTA 2F7SA 2ZZNA 3DOUA 1IH8A 3BICA 4MWEA 4BZZA 1G64A 3PDIB 5KSOA 2HIGA 3KT3A 1E5LA 4NY1A 5A3VA 2FW0A 3NIBA 5TF0A 1V3TA 3G5LA 1OH5A 5M7EA 2J67A 4UMFA 3QH4A 1ZRNA 5ALDA 2QQ5A 2OG2A 3D81A 4N12A 3BIFA 4E12A 1B2LA 2C78A 1IM5A 2HCRA 2PFGA 3NIDB 4V0LA 1TF5A 1VE9A 1JN0A 1P1RA 3E2IA 1WXWA 1V25A 5BOVA 3WHLA 2NO7A 4GX5A 4Y9UA 3RRJA 5H4GA 3EFOB 2M9MA 3MEQA 4GQAA 1H1LB 1QAQA 2H4ZA 5L4SA 2VQ6A 2ZE5A 4MRSA 3T9DA 3WY9A 4ZCRA 2WU4A 1LPNA 4HN2A 3L0DA 3A32A 3PKZA 3OUUA 4FGUA 4BO9A 1Y8ZA 1XZMA 1QE0A 4A15A 4U2EA 4LBWA 3VH1A 3P4UA 2GTHA 5JHGB 4GXNA 4YJFA 2A7XA 4FOTA 1PLLA 2P79A 2VSYA 3KQOA 4Z7JA 4IFBA 3TLAA 2GYUA 3NYWA 5B1IA 3PXEA 4LC9A 3RT1A 4NG4A 1J7KA 3R9WA 4L16A 5BO5A 1KKLA 1M5TA 3AKCA 4BMSA 2Z5FA 1TTPB 4GRDA 4WTOA 1DS6A 1FDRA 4DV3B 3FVVA 4D0LB 1JFFA 1U28A 2QUAA 3UMYA 1GHTA 4Z4IA 3BT7A 2GOYA 2I6FA 2ZOSA 2HEIA 1T1SA 3D8UA 3PUHA 4KI7A 1ZCBA 1AZTA 1XP8A 1O95A 2ID8A 1PFQA 4R40A 5AI8A 2XIJA 3ZV6A 4ZRDA 3U39A 4JUBA 4C76A 1CLEA 2E4UA 2AF4C 3WB9A 2PT9A 3G88A 1DAFA 1P4GA 3ND9A 4N0DA 5HQ3A 3ZZMA 1JR3D 4EY8A 4W5TA 3ODGA 2CUNA 1GD1O 2BI7A 1R6AA 1D2EA 1V7PC 1U2GC 1CZOA 2WWHA 4GBGA 2A30A 3B5EA 3IQFA 4KVZA 5LA6F 1WPRA 3L93A 2NQ8A 1DLIA 3KFXA 3BX1A 1UPCA 1XTVA 2XGSA 1ORRA 1GPYA 3L40A 3N7TA 1Y8CA 3B8HA 1E6WA 1X1TA 2H4FA 3H9GA 2Q5LA 1M2OA 3BMXA 3IVAA 3O3CA 1HDXA 4KSYA 5AKLA 1YNSA 2GZHA 3W1WA 3C3AA 1DJPA 3GB9A 1H65A 2WJGA 1JJ7A 1C5KA 1LRKA 1R8YA 3SJBA 1T8PA 2E89A 2GK6A 1PS9A 4Q6BA 3HWWA 2BGKA 4IINA 3F7NA 5DMXA 4Q9HA 4D41A 3ZW8A 4PIMA 5KTTA 3WJAA 1F5SA 2PRSA 1BC5A 4RXUA 1W8IA 3SIXA 1ZOLA 3F3MA 1LDYA 4WV3A 4Q3AA 1IVNA 1O03A 4AN4A 1SEVA 1XCBA 2B7CA 3OY7A 4ZT7A 5ILGA 2E4VA 2O54A 1U9ZA 2YIVX 3B1XA 4BYMA 1PJ3A 4P5EA 4AK9A 5JAIA 1KVTA 3AP2A 2FEKA 2CWDA 5BYJA 1RYDA 2Y1CA 3DMRA 3DZ8A 3O8CA 1C7QA 2J32A 4ZDWA 3K6KA 3NH9A 5BXYA 4NPAA 1N6PA 1E7MA 1Z6AA 3WYGA 1L5YA 1NUUA 3LFTA 1C0EA 3LPLA 5LBTA 4POAA 3RABA 3VZPA 2E4XA 2OQVA 1Q0LA 3H5IA 3MS2A 1TU3A 1Q3KA 3UJ3X 1Z34A 4JUIA 3HO8A 4RA6A 3OQHA 2VBCA 5E6SB 2P4UA 3QBTA 5CB8A 1Z6PA 2X22A 4GBMA 2CNWA 4S1NA 5F77A 1D1TA 2VATA 5A04A 4BNVA 4C7XA 3RAFC 1TQ2A 1P72A 1DQPA 1S96A 1H8ED 4FDMA 1Q15A 3F8WA 5LQMA 3H1BA 4NJMA 4OOEA 1S0UA 3W5UA 3JD0A 5FORA 4DS3A 1KAMA 1XKLA 4DV7B 4FYJA 3LFUA 5E4FA 1E9FA 3OZFA 5H16A 3ZNNA 2GM3A 3ONDA 1K89A 4DUGA 1UAAA 2O59A 3WHKA 1GGMA 2ZB3A 1SQGA 1L9XA 3Q2KA 2J30A 1PQ4A 1XZ8A 2R2GA 1T10A 1KYZA 1M67A 1U7DA 1RWXA 3CW9A 2O7QA 4W9NA 3EZGA 1LFDB 1DEXA 3LTEA 2YNMC 3B78A 3HNOA 4DBZA 3GELA 1ZS9A 3E4DA 3ORYA 1E2PA 3LW7A 1NUAA 2XEXA 2EFYA 1ODTC 4LOIA 1Y6QA 4OP2A 1TIPA 3F8SA 4F3KA 2VJDA 4ZU3A 4GBED 5LQJA 4YXWD 4PC7A 2EJUA 4OXQA 4D6PA 3L01A 3UO8B 1Y37A 1KFEB 1ZXLA 2COUA 4A26A 2ZRQA 4HDKA 4JI1B 1WCV1 3OOHA 3QE9Y 5K2OA 3V1TC 1LK0A 1FF9A 1ZM7A 4TMYA 2Q6LA 1YU6A 2QG4A 2YWEA 2GSDA 1F4VA 4F86A 5JWRA 4EUFA 2FPSA 2D0OB 3LX5A 2AV6A 4JBHA 4TKZA 5C4GB 3QOFA 1V3UA 2R3SA 4LJRA 4V0RA 2BKUA 1V16B 4OQFA 3ZDBA 2ISQA 3RROA 4Z4FA 2FU5C 3GA5A 3TRDA 2BHTA 1QLWA 3EBOA 4NFLA 2AMYA 1CF2O 1DG9A 4MWBA 2YOGA 3UHFA 2ZIZA 4HN4B 4B3XA 2VF2A 3OZEA 4BO1A 1J2YA 2ACVA 3DTTA 4CM6A 1IRXA 3AHGA 4F5DA 5IJZA 4MHOA 5DM60 4MUFA 5IDVA 4EVSA 5LN1A 5KQGA 3I04A 2GNOA 3GP3A 2H51A 3IEIA 3PNMA 3HVRA 4DR7B 2DPXA 4CXMA 1YF3A 1K6EA 3F1LA 3OT1B 2PQMA 3L1HA 1F8FA 3LX4A 2XE7A 5BR4A 1UDCA 4RU1A 4EABA 2W2XA 2GK4A 3JQ8B 3FGZA 4DLWA 4C3UA 2R7KA 4PC2A 1RSZA 4C4OA 1H6CA 3SR3A 4HV4A 5L3SA 1OH8A 1NF2A 4QRDA 1UFRA 1YB2A 1PQUA 5ERYA 3K3PA 4DCTA 2KLHA 5LFAA 2ONKA 2WF9A 5HMMA 4RHXA 4GKBA 3AYXB 1RS0A 3GUHA 3H11B 2FR0A 1W5TA 4K9KA 4H1UA 1JMYA 4L9RA 4BAGA 1DXYA 1L7RA 1XCLA 2BFEB 4FD2A 4I1UA 1TTHA 1DE0A 4PZLA 5C51B 1T8UA 4NQZA 1EUQA 2ZJZA 3OI7A 4Q48A 3TX2A 3SIPA 3GLIE 1RADA 4HLCA 1QU3A 1TI7A 3IR6A 3U3MA 1TX4B 3R5HA 4HLUA 3RTEA 1W49A 3TKLA 1T4CB 1H8HD 4YRGA 4EB3A 4IQ8A 1QM5A 4ZA2A 4UJ5A 1L4LA 3AR7A 3LKZA 3RBVA 4AYWA 5HM8A 3DDWA 1MQ9A 2HF7A 3EUWA 1O3YA 2YTZA 2W7TA 5DV9A 1QIJA 3LUPA 4YREA 5JNTA 3AL0C 1MHTA 2MINB 2NZXA 4ZJUA 4ZP1A 4HZIA 3FSGA 5CT9A 3RCBA 3DV0B 1K3TA 2ZJAA 1PS0A 1CUVA 2OCGA 3EIOA 4B6FA 1QPBA 2Z8ZA 4OI2A 2G83A 4B8YA 1GCIA 2ZSAA 4QBIA 4NOKA 1O5TA 5A6VA 3EAGA 1XPOA 3C7AA 1CE8A 3MCUA 5AKHA 1OKKA 4ME6A 3ZW9A 3GR6A 5HXAA 1HG0A 1Y1SA 5DX0A 4KZPA 1WBJB 3R0IA 4IL5A 2VJLA 1GOTA 1P5JA 1IQPA 1EDEA 1SUEA 1PZNA 1G8FA 3DYBA 3LA8A 3OZ7A 3RS2A 3R24A 4D5EA 1A50B 4XR9A 4CQLB 5CNKA 4M9CA 3IRVA 3VVCA 1E2FA 4G5XA 4IJ5A 4EB0A 4KAAA 1WHTB 1IDN1 2HWXA 2EL7A 2O0LA 5KTMA 4G97A 2EBUA 2HM7A 4EPTA 3B48A 5E9AA 1Z25A 2CLKB 3M9LA 4K9QA 3R2JA 4CLRB 1REQB 4HGQA 2HDHA 1P0PA 4Z49A 2YW9A 2EBWA 2HRQA 5G0TA 2D7DA 3OT4A 1UDXA 4DABA 1Y1RA 2QVZX 3NWOA 2QRHA 4RPIA 4JIGA 2PL3A 4YECA 2WFLA 3SQLA 3VDMA 1G5RA 4EA8A 2I8LA 3D3WB 1VIYA 1CJUC 4JXJA 2NXCA 3NWPA 1NVAA 5BNZA 4JDUA 1EG2A 4QD3A 2IH5A 2HK8A 5A02A 1JDUA 5E6RB 2KLBA 3HUDA 2GBPA 3PHCA 4PZPA 4MTCA 3ILSA 3NAMA 4L73A 3LD9A 3L7LA 3ZS8A 5CT8A 1H9BA 2BD0A 2R47A 2OZLA 4IGKA 3OZVA 1GY8A 3EA0A 7AT1A 4A0HA 2NV2B 5JCXA 1OILA 3B2EA 3NHZA 2C96A 3AVTA 2A9FA 4RNDB 2CD7A 4FT2A 3VNRA 4U2FA 4QGSA 2D0IA 4Q4JB 2ZLBA 4HSEA 4HX9A 4AF6A 4B3JA 4PINA 4JU9A 4PPQA 3RVNA 4ETNA 1EWYA 5T6MA 3KQPA 1C1DA 2CHFA 4PV7A 1K92A 2O8FA 2G7MC 1LI4A 2Y9MB 4ER5A 1SA0B 4J7XA 3F90A 1VI2A 3ZDCA 1RTKA 2O52A 4PIPA 4FSHA 3VI3B 4B3TB 2X42A 3KUKA 4WW0A 4M38A 1RP7A 3RWMB 3GCXA 1KDOA 1P0FA 4JV5B 3FHCB 4GEGA 4G8CA 4MYTA 2BISA 1SR8A 7MHTA 1DWOA 3UJCA 2UUCB 1XAJA 1THZA 2HJHA 1F0PA 4HDCA 4K6MA 4PYOA 3ET5A 4PSAA 2NU9B 3U60B 3R5JA 3A6PC 2P2ZA 2CW5A 1PVVA 4BKUA 3EHEA 2PZAA 1XMSA 1BXGA 1YKSA 4Y18A 3TNLA 1MCZA 5A9SA 2FQQA 2YJZA 2XB9A 2QMEA 4GKVA 1SQ0A 2RHHA 2X41A 1GO2A 2BHLA 4UVEA 4YONB 3WZ2A 2VDJA 4W1PA 3A0UA 1G8GA 1KAEA 5AW3A 4WBNB 1ZAKA 3D0RA 3F3KA 2C2XA 3DGFC 2Z4RA 4TTRA 2EX4A 5DEOA 5G4KA 5BSTA 5KB3A 1A97A 3OQMA 1MOSA 2M1XA 1PIWA 3KJQA 3I6YA 5BN4B 1Y82A 4DVJA 3I2KA 3ADBA 1ZNZA 1Z16A 1X9HA 2GRAA 4JWTA 4LJLA 5FOXA 1I3CA 1EEHA 1ULSA 2SKDA 4WOJA 1X86B 1N0HA 1GQOA 1KZYC 2V7XA 3OKFA 4AQYB 4HEA1 2YZMA 3OLVA 2K2WA 3FWNA 3HCFA 3O3OB 5KTYA 3PT9A 1TU0A 5H4HA 4YHHB 1K5HA 1X80A 3KEGA 3SHWA 3HY3A 4Q1BA 1J5PA 3IEKA 1Z2DA 2HLHA 1RWKA 1B8UA 5BWMA 1P9WA 3D7RA 4M1YA 4M22A 1G3QA 4YT5A 4YUVA 4U6QA 2MMGA 2VLIA 2NXWA 2JLQA 3F5SA 4P32A 5T4EA 5C1PA 5C80A 3URMA 3V00A 3X43A 4TZ6A 4Z53A 4JMPA 1E61A 1K08A 2F2TA 4XVCA 3V8QA 1RPNA 1CS0B 1W36C 4EDFA 3I2HA 1V41E 2DKOA 1J2JA 2CCJA 4M1WA 3ZE0B 2G9QA 3QVXA 4UDOA 3U4DA 3S1AB 2CF5A 5AICA 3ZD8A 4DE5A 2ZPAA 3FTEA 4KW7A 1G42A 2I54A 2C5HA 4W5RA 3IAAA 4QU8A 3ROGA 2PD6A 2ZULA 1GQYA 2IHUA 2C59A 5HILA 1T1RA 1HDEA 1FDVA 1RJFA 2B30A 3BK2A 3IBFA 1Z9BA 1JAXA 3T9FA 4C89A 4IQ4A 1J1UA 2RAVA 1P74A 2PSFA 1RP1A 4GDMA 4BMNA 3VNUA 2JGDB 4JQOA 1K0FA 2BLLA 4F5WA 3LUCA 2XZPA 1BKYA 1GPUA 2Q1UA 3KLMX 3A3PA 2H5JA 2XQFA 4HMPA 4O4LB 5DRTA 5G0WA 5IAOA 3GO4A 3TZLA 4HADA 3G0CA 3GCGA 4L5CA 4LECA 1Z0FA 5CGZA 3V55A 4LVNA 4EYGA 4URWR 1G17A 1QIKA 3DMPA 3LLSA 4AYXA 1ECLA 4WKOA 3QU7A 4GI1A 1BX3A 4OLFA 1I2DA 5IKPA 4HXGA 4UHJA 3W6PA 3N2YA 1I3NA 2JLVA 3T61A 2ZRJA 1OE0A 9MHTA 5L4LA 4RJIA 2IOFA 3COSA 1CUCA 1B2RA 1SVUA 2EHJA 4HTFB 2VAVA 3LZ6A 1GCUA 3IESA 2GA9A 3LUBA 4GRIA 3WAKA 2ZAGA 3ZHSA 2VP4A 3FWYA 4TMTA 5SYMA 4HWRA 5BW8A 4EGAA 1NJ2A 3L0SA 3LW8A 3R8FA 1RYEA 2X0KA 3IOBA 4I50B 3HDHA 3FUCA 3DT9A 1E0KA 1OGJA 1UK9A 3W2IA 1T8YA 2BELA 1KXZA 1P29A 2LD4A 3T0IA 3NBFA 2G17A 2YXLA 1A27A 2WVGA 1P6XA 3ONEA 3F2VA 1JR6A 5JI2E 3IIIA 3TW8B 1Y6ZA 1LBIA 1HDRA 4GXQA 4AY3A 4OIFA 4FDLA 5AVWA 1NXSA 1Z0SA 3A06A 3EA4A 2OCPA 3A4NA 2RGUA 2R8XA 4ZI2A 4IH1A 3EXG2 1FXUA 1MX9A 2ONCA 4ZQHA 4F9GA 3WIDA 4CL0A 2GAAA 3KV3O 3VPAA 4E2XA 1PCXA 4MCIA 3WZMA 4X7RA 2RGWA 3G2MA 3AQ4A 3KTFA 3OJCA 4XXHA 3ZGOA 3SMVA 3GGDA 1E79A 2DFVA 4FWBA 3EZNA 1VFPA 3ZCVA 1DC8A 4BQFA 1EZ4A 2DAPA 4J1NA 5L53A 3LYUA 3KOMA 3WRXA 3GRCA 2AFHA 2ZI3A 3QEBZ 2IH4A 1GZ7A 3MTEA 1U5BA 1JKMA 1NZFA 4ND1A 4D43A 4D4IA 4FNAA 3S2EA 5FX2A 2F90A 2ATEA 2LGJA 2VP5A 1PQYA 2O7NA 3AETB 3EGIA 4C0BA 5EJIA 5KNBH 4O2AF 2X8JA 2ZIWB 3AK4A 4B4DA 5JISA 3WMRA 1AF7A 4OAPA 3TOCA 2QUIA 4GPZA 2R7LA 3GP5A 3LOPA 2ZRGA 5KVVA 1TYCA 1GPMA 3T7DA 1H0KA 3DUWA 3VPXA 4X85A 1BXRB 1IZ0A 1PL0A 1UBCA 1YCGA 3A8TA 1L1QA 1JWAB 2FQXA 4TX1A 2VRWA 4XUDA 4FZ5A 5LJLA 2VWQA 5EERA 5LP1A 2NUBA 2IKSA 2IHVA 4Q01A 1P1KA 3GJ3A 3WWYA 3TW6A 2HRCA 3E3LA 5CB6A 2RK4A 5FOWA 4A1OA 2H2GA 1VI5A 3ANXA 4FUTA 1TA4A 4AUKA 4EUEA 2H7XA 1NQTA 3PC8C 3F67A 3RU2A 3LQRA 1O77A 1Q7EA 2OFXA 1AA9A 3IMEA 2ZRKA 3BIWA 3NB0A 3HFSA 1TM4E 2YS7A 3P9KA 3HJHA 3GJ6A 1U0EA 2BF7A 3JX9A 4TMZA 3IALA 2JBWA 5TRTA 4QPZA 1XZLA 2IT1A 1LTKA 3WLPA 1DJMA 1PBTA 1D7AA 3O4RA 4KIWA 1SCUB 4B0OA 1CRLA 1HDOA 3F71A 3KEQA 4G25A 4GAEA 1H22A 4PZEA 4RVGA 3BJZA 5FNVF 5HF8A 1CNFA 4XR4A 3U31A 1O9GA 2Y1XA 3BFKA 3PFGA 3GJTA 4P7FA 4MW1A 2OLEA 2QRLA 4UDXX 5A0FA 1N5JA 1TK9A 1E8DA 4KO4S 2FY8A 3FBWA 4HKTA 2ZRBA 3D6AA 1WW2A 3LL4A 1OROA 1BE0A 3NAGA 1L8LA 3PI6A 4FYKA 1M1YE 2AIRA 2WLSA 3DD1A 4B44A 3FW1A 2HFKA 2IYRA 2O2HA 3EDOA 1T3LA 1ESNA 3NBAA 4YAOA 3OUZA 2O8BA 5ALSA 3WNCA 3EG9B 4IUBS 1IK4A 2R1VA 6YASA 1XUOA 4AZ3B 2G4VA 4HX2A 2ZJ6A 1XLTC 3U1BA 4C0WA 4DM3A 5K6RA 3M6UA 4IAOA 5GJCA 5IX8A 5D6OA 3ND8A 2HH9A 1UADA 1Z0DA 2AOWA 2D54A 3LWBA 4BVAA 4BNFA 3QPVA 3WB0A 2V6FA 4DLUA 4ZEMA 4JGIA 3PE4A 3P32A 4M8LA 5LR6A 1V1RA 5HJ7A 3OCZA 2HXGA 3L0IB 4YMTA 1RVV1 2OCAA 5KU7A 1WPQA 5DGXA 1XEFA 3MN1A 5FQOA 3QK7A 3P96A 3U26A 2PGXA 1EX7A 1NI4B 4K9NA 1WCYA 4NCKA 4WJKB 1G20A 2IY7A 3FUWA 3GLHE 1EMDA 3NHJA 3IAFA 4MIKA 4XWTA 1TM5E 1VPLA 2B1RA 1DBVO 4WY2A 3VHXB 3PXDA 4M1MA 3UK0A 3AR9A 1R3DA 4GP6A 1GL6A 2PX2A 4P36A 1BYUA 4FZRA 5AR1A 4HQRA 1VBNA 3AMVA 2ICAA 1NPYA 4KPYA 2X0FA 3IBTA 4MYUA 4ZK6A 1KP3A 5LUAA 1AK2A 1OPRA 2IPOA 1O94A 3TZHA 4EO7A 4B84A 3K6SA 2X9NA 1SWWA 4R1TA 2J9ZB 1SXJB 4XX1A 3H19A 2J3HA 2BMJA 2ZIEA 3R40A 4KXFB 1W96A 4HAIA 1HYHA 4Y7DA 4BO2A 5DW3A 4PWZA 2H9YA 4UE3S 1Y0BA 5DI3A 3WWPA 1MBZA 3F1KA 3QPBA 1B6RA 4ZRMA 5T5QA 3X1ZA 3TQQA 2I7VA 4FWIB 3BFPA 2OXTA 4PYQA 5JQGB 1X1BA 2XTJA 4EGQA 2V8BA 3R76A 1F38A 2OFOA 3NANA 4QASA 3KBBA 1NBME 1OLSA 1GPNA 2Q9CA 3KQQA 4LDRA 4UW9A 4MB0A 4R1NA 3T7JA 5JNRA 1NMZA 1Z29A 3STUA 2ZTVA 1PLJA 1TCUA 1E9RA 4ZOAA 3ZWOA 5GIPE 2V7QA 4DCGA 3NT2A 2BYTA 2R7MA 2FPUA 1YDHA 4YP7A 1M3SA 1Z63A 2Q8NA 4LPSA 1YI8A 3E5MA 1I10A 2GEKA 2PZEA 3B89A 3GFPA 4LJ5A 4DXHA 5ABPA 1N5LA 1W9HA 4ZN6A 3LHKA 3P2KA 1W7AA 2CD9A 3AIMA 2B0CA 4ALNA 2O8EB 3UJPA 5ADHA 1EXDA 1I0IA 2HIHA 5AJHA 1GN8A 5TEWA 4BWFB 1EWTA 2XBMA 2G72A 4G4IA 4KPFC 3OHPA 3BWDD 3NYIA 2FPOA 5KWVA 3E22B 5C34B 2ZIFA 1Y8RA 3LT2A 4BE9A 1UR5A 1QOPB 4B3CA 3O5AA 5FTJA 4UQLA 1PNOA 3KCQA 3DT6A 2DERA 2QD3A 4PX5A 4YROA 3ZCTA 2XUZA 1N75A 3PJDA 1MB3A 1G3MA 4EI8A 4QUEA 4WJLA 4LHZA 3SZLA 4WNAA 4F6CA 5KVQA 4TQ9A 1FYXA 2XHEA 3BULA 5AM0A 4DIMA 3GPCA 4WL0A 1C9EA 3OCJA 5CVJA 2ADMA 2EEPA 2ZUVA 1EFCA 2XRFA 1GRVA 1MJFA 5LBIA 1HRDA 4QGFA 4D8WA 3C3WA 2H4HA 3Q40A 1IC6A 5I4BA 4DLSA 1NIJA 1RM0A 3HKEB 3PYMA 2BGNA 1R4MA 2XQGA 2CB0A 4NENA 4GWLA 1S9HA 4RY2A 2NP6A 1R8QA 3IO5A 3S8YA 2P9BA 3O4JA 2YOFA 4HQKA 3MINB 3EEIA 1O89A 1SCBA 2B21A 2ZRNA 4YWHA 5I48A 3RTCA 2CVQA 4RFSA 1BXZA 1UINA 2JJ2D 1V5FA 4M83A 4XEUA 3SSAA 1YQXA 2V5AA 3BWBA 2FN9A 4ZVNA 4HI0E 2XNDA 3R20A 2DH5A 1GYQA 4N0QA 4KAFA 4JQZA 5EESA 3M6LA 3GUVA 2QVYX 3LGXA 3OAAD 3OQNA 5TT1A 1QVVA 1W75A 3GCDA 1C0IA 5EJ6A 1I1QB 5GONA 2ZUCA 4KB5A 3DR5A 1EGHA 1X7ZA 1XZKA 4MWSA 1G6Q1 3RS3A 4EHDA 1C7FA 4UU7A 1RKBA 1UBGA 2O2XA 3EGDA 1M1NB 1S2IA 5CJPA 5B6IA 2YIJA 4MUNA 1HOTA 1DXQA 4TMKA 2FVYA 4CKEB 2OORC 1UMDA 2AOTB 4CLOB 2AX4A 1CP3A 5KYKA 4DV5B 5JAUA 2OHGA 4MIOA 4Z9AA 5EHGA 2JFGA 5K0BA 4A8JA 3ZV4A 2H0RA 1MEJA 3IEPA 4KXQA 2IYTA 4TM7A 1MF7A 2GM5A 3I5XA 3E9RA 3ZBPA 5ALKA 1H2HA 1TUIA 2H00A 4WZBA 5AIAA 3DT8A 4D8UA 2F43B 4V0OA 5D01A 2WJPA 5J3JA 3QE0A 3GEMA 1QHGA 2LUOA 1IOWA 1LS6A 2VYVA 3GQBA 1EK1A 1N1GA 3EXIB 4HUQA 3SJZA 4QL3A 2TMKA 2ZRCA 2VCYA 3DLCA 2AR0A 3DKRA 4NHEA 3DEFA 1C4WA 3NC4A 2Z3ZA 4HH4A 3AUFA 4CMEC 2VT2A 3A05A 1LK7A 3LBYA 2XBUA 4A0QA 2G0TA 1AMNA 3KHSA 2HT6A 1YBVA 1BS1A 4R6WA 3X1YA 1CG6A 4NNPA 2PO5A 4FPXA 1I1OA 2JI8A 1WV0A 3VZCA 3VO2A 4L6CA 1R16A 3DTVD 4WQMA 3MGKA 4Q7LA 5CDFE 3PPYA 1OWPA 2DUMA 2ZYIA 3DZIA 4EELA 1E6KA 1SOUA 1QRUA 3T3DA 3ZXYA 4LZLA 1RTTA 1JHXA 4IZ6A 1EZZA 1GRCA 4ID9A 4D3DA 5JDIA 4EITA 3ILXA 5IAAA 2G4CA 2J87A 5B6PA 3SLKA 2A0YA 3C5EA 3G5MA 3KHTA 2HA7A 3T7KA 1PR0A 4NR0A 4FW8A 4QUJA 3U16A 4LEIA 1L7DA 2EYUA 4B3IA 1ZUIA 3EXHC 5IF3A 1IHXA 4Y2TA 4H7PA 1U31A 4OIMA 5F4BA 5HF5A 4FYVA 1MG0A 5F64A 1M8KA 2OP0A 1T1IA 2A86A 4G5RA 2F48A 2LR0A 1LD3A 3KZOA 5HBRA 2H2HA 1OH6A 2DTDA 4ER0A 2X5OA 3CC8A 3MAGA 2OD2A 3ND5A 4KLCA 5FHRA 1ZH6A 1G7CA 4E13A 3BH6A 2H63A 4LRXA 4II7A 2RAUA 5BN5A 4MKRA 2QZ9A 3I0ZA 2C4MA 3VR2A 5K01A 4CG3A 2EDCA 3MYRA 1CJKC 1CHNA 3WLAA 2REBA 2QR2A 4CV3A 4QTZA 1QHHB 5EVCA 3NHSA 4QDZA 2VJOA 1W2GA 2IZ6A 2Z2ZA 1ODLA 4PYIA 3VR6D 1VPVA 3IYLW 4QQFA 1IWPB 4HH3C 4B43A 4NNJA 1GA1A 2AG0A 2QSUA 3G9QA 2V6JA 3QLEA 5BWBA 4OYLA 1MJHA 5IAKA 3A70A 3ZI4A 2Q3LA 3FKJA 1OYOA 4WPGA 5CIWA 2XGMA 1ZI9A 2P4HX 2ZXEA 1NW5A 3I9KA 3TQFA 1WUKS 2I6UA 4CIVA 5AUPB 4JITA 1YMVA 2ZCVA 3SHFA 3JQRA 1XELA 5FR1A 1JHYA 2JI7A 1OA1A 2R6R1 2V7BA 4AFNA 3HKDA 3PIIA 1C9DB 3COPA 1WLYA 3IPYA 4XWOA 2FDCA 2FQ1A 3I4LA 1KGDA 1TQHA 2PYIA 2KYRA 1ZJYA 2B61A 4DQLA 4TTSA 4LXGA 2NQTA 4G1FA 3VTAA 4OHBA 4DB2A 1RHMA 5GM2A 2RG1A 4RDCA 4P4GA 3OOEA 1UAYA 3RVRA 2Z43A 3GVXA 3SOPA 1NR5A 3KWFA 4QBFA 4RBNA 5EHQA 3VO9A 3WICA 4BMZA 1ILEA 4GPAA 2ZAIA 4QBGB 2CLSA 1DWPA 2Y1WA 2BKXA 3HPRA 3RU7A 2KPOA 2P2LA 4RSGA 3INYA 1GTJ1 4NOLA 3JYOA 3RRFA 1VSTA 3Q98A 1B0UA 2QQGA 3TQCA 3TSZA 2ACKA 4L50A 2D7CA 4DCOA 3OSUA 3TAUA 1N3YA 3M3PA 4IEEA 3RRBA 5A1TA 5JASA 4B81A 3KKZA 2F8TA 3ZE8A 3PNSA 2ODAA 5G3YA 5B1DA 3TDNA 1WDMA 3ZQ6A 2JHGA 2VQSA 4H3HB 3ZKAA 5KNDA 4NF2A 2W0MA 3F8TA 2VHZA 4H7KA 3NO4A 2AE1A 1K75A 2OV1A 1U2QA 3EN0A 4QG3A 1JEYA 1BKSB 1TMGE 3K0KA 3WGTA 3UQZA 1HTTA 4LJSA 1QS0A 4NBWA 4NECA 4QYWA 4TL6A 4GYKA 5DTEA 1W0CA 4URHA 4ZAYA 4DLTA 4ER6A 1T1EA 2QYSA 3HP4A 4O1MA 4P3KA 1VCMA 2FR8C 2IYFA 1LVUA 2QX8A 2GN8A 3EPRA 4IIJF 4MMZB 4KE9A 5EYPB 5ITVA 2X7JA 4ZMSA 3QSGA 1I2MA 3ESQA 4GECA 3UKJA 3C8DA 4DREA 5LNK6 4IIHA 1V4NA 4C20A 2EL9A 1E1LA 4AB1A 3NDBB 4PICA 5F2KA 3WLTA 1CULC 1WD5A 2P67A 1JDTA 1E4OA 2FOLA 4JCOA 1T15A 4AI6A 3L8CA 4EBFA 1F6BA 3TNYA 1S3SA 1F20A 2IK8A 2WBLC 2ZSJA 5KWIA 5C37A 3H5LA 4FDUA 3UTCA 4B35A 2G1UA 4Y2JA 3TSCA 1JX6A 1WNFA 2YBEA 3PA8A 1HEIA 2Q46A 4EZIA 1XAIA 3TOSA 2GNAA 3QKWA 3U7FB 3QVTA 2VXOA 1PJRA 1DHRA 1E1QD 1ZVQA 1O1YA 2C3UA 2PKQP 4IQ0A 4ENRA 2ZQ5A 4G23A 4GI7A 4GUAA 3FUXA 4LOHA 1H9CA 1HRKA 4HYQA 3KYCA 3DPSA 1K5PA 1A8HA 3DZBA 3W3AH 3AM4A 4C7KA 2HHCA 3AFOA 4P3XA 1SU4A 3O94A 5CCXA 2YRXA 4UMVA 421PA 3O75A 1JZTA 5CIQA 4P7JA 3NHKA 9LDBA 4KNYA 3MBIA 1DNPA 3NP9A 5AOBA 1U94A 3ULKA 2RGBA 4PXAA 2PGDA 3K0AA 1YB4A 2RCYA 1NVDA 3K9NA 3PHHA 4Y6OA 2QN1A 3QW2A 4B7UA 5JNLA 5EI5A 4E7PA 2HZBA 4ZO4A 2JFZA 4RK5A 4H9GA 3H5OA 4QNRA 4OHKA 3F5DA 4R81A 2C7GA 3OX4A 1RHUA 4R0VA 4ZFNA 5IJ0A 3U56A 2WKRA 3Q9SA 2EFEB 4LYHA 5BR7A 2KM1A 3QMPA 5DN6D 3IULA 3UJ6A 1PKEA 3W6UA 1TT5A 2XSZA 4H35A 4BAZA 1NULA 5AW9A 4A36A 4R1PA 3LHDA 4DQVA 5IBRA 3ZEIA 4K87A 4MW7A 3ZJYA 4YDSA 3I04M 1O96B 3QV1A 3LBIA 2XMDA 2I4LA 5JG7A 4CEIB 1JWLA 4AO8A 5A03A 3P20A 5BSKA 1QQTA 5JADA 3HJAA 1LBEA 2QRPA 4BNLA 3KPJA 1PT9A 5TEVA 4EW1A 1IWBB 2FSFA 3GGSA 3VOBA 1UFQA 1JHDA 1PFKA 1XXHB 3EMVA 3BH7A 4QYTA 3WHIA 2ADFA 3MWJA 3LV8A 2Z9CA 3O8QA 2HDNB 5SYNA 3L1UA 1TYAE 4HWPA 1LH0A 3O26A 3KQVA 4I55A 1XQ9A 4UC0A 5HDBB 1OB5A 2KBFA 4RTQA 1G21A 4DDWA 1IY9A 4HAXA 1E7WA 1TEHA 3DAYA 5EUCA 4AU1A 2QG6A 3Q2IA 4S12A 3ZLJA 4RF4A 1I51A 2ZIVB 1U1IA 3AR3A 3HJUA 1FP2A 3AM1A 4IIXA 3K72B 3VPFA 1M54A 3A31A 5A4JA 3UJBA 3F3YA 4WZZA 1SHZA 1FEZA 4HDOB 1G4UR 1GL7A 1YQDA 3JQ6A 3DZJA 3GEBA 1E4VA 1AKQA 4FFDA 1TOAA 3PQEA 2B8EA 4N6OA 5JDCA 4DXDA 1NVUQ 5IM4A 1U4OA 5K3FA 1P3DA 4GVPA 1UDWA 1WSAA 2IUUA 4GX0A 3V8MA 4MUAA 3GNQA 4IFTA 3IR7A 3ZE2B 5TNXA 4YPFA 4H4DA 1ATZA 1SQSA 2NZVG 1M34B 1FQWA 3O8OA 4Q82A 4DMHA 3G17A 1WEHA 3E18A 3C0KA 3NM4A 4FI3C 4NARA 4ND3A 4RLSA 3RREA 4IHKA 4JASB 1L7BA 1MIOA 2YXNA 3I2FA 1ZUNB 1U28C 1HE2A 4DLLA 1YE8A 1F2TA 1JF8A 5I9MA 2J9FA 4F8EA 2VDKB 5D7BA 2UYGA 1C9JA 2ZATA 2FEOA 3JD4A 4LMAA 4LOJA 1JR3A 4KK3A 4UCWA 3V8EA 4OU5A 1E9VA 1O95C 5IK2A 4WCDA 5JYCA 1KZ9A 1TYZA 1XTBA 2AX3A 1XQVA 3NVMB 2IXDA 4LMBA 3F2IA 1YWGO 4QPJC 2DPHA 1MG5A 1YTLA 3KZVA 3PD7A 4TUYA 2OBBA 3H1PA 1PJSA 1KARA 2FR1A 3R5XA 3FHTA 3R74A 3NTXA 2P69A 1G66A 1IATA 3KUDA 1ECGA 4UBJA 3G9XA 3WTCA 3EOBI 2H1HA 1SVOA 1NW9B 4KOAA 5ALMA 2BFMA 1XT6A 4KGXA 3MXTA 1R8SA 4RF3A 3R9KA 1OZFA 3EGXB 3OMLA 4EB8A 1ZY2A 1C2TA 5DXJA 2G82A 3OD1A 3ZJTA 3UV6A 3EH1A 1YVPA 3BD7A 2JARA 2P0YA 5THQA 4ZZ2A 1ZK2A 4S3MA 4QE3A 2E2WA 1LEHA 5FWDA 5CFOA 4ZCTA 5FBKA 3PLRA 1QHEA 4E5DA 3MMPA 2V3WA 3WYEA 4RZXA 4ZVMA 1N33B 1XD2B 3MCVA 3AWDA 3VR5H 2V98A 3W90A 1ZH8A 3BOSA 1RZRD 1XDBA 2BHNA 2Q5IA 4QBTA 1W4BA 4W82A 4YMSA 5DBGA 5D7NA 3QX3A 1P8JA 1RLOA 2J0VA 2EWVA 2ILVA 1T1GA 2YDYA 3TXYA 4TLBA 1T5TA 2WIFA 3VNAA 3VNQA 1Z17A 4UTNA 3BE6A 3KKOA 2OGUA 3PHLA 1B16A 4ZVUA 2XE8A 3AJEA 4DAEA 2XUPA 1JA0A 3JATB 4WACA 3D3EA 3PFFA 2PMKA 1PD1A 4FS8A 5HM6A 1MTZA 5SZIA 2WJ3A 3IEXA 4RK6A 3C5VA 1EFHA 4F38A 2HK6A 4RCYA 2A67A 4WBNF 1IBMB 1H8EA 2VC2B 4NE9A 4Q39A 1DC3A 3JZDA 3QIVA 3ZEAA 4YDQA 1IJKA 4U7TB 4N7MA 4B79A 2H06A 3HXMA 1WPGA 4Y7CA 5CNIA 2GESA 2CLDX 1X8XA 3MQ4A 3IB6A 1ZIDA 1Z6YA 2QPAA 2C3YA 4N3NA 1IY0A 1AGRA 1X7HA 3KE8A 4FIDA 1KY2A 1YT5A 3P0JA 4B7AA 2IRWA 2RE8A 4Q7EA 1Z6ZA 1OFUX 2RGYA 4HDRA 3CUTA 4JFAA 5B2EA 3RFTA 3S0JA 4LNHA 3HVKA 3D1JA 1EE9A 2R6DA 3WQHA 5LOVF 1W36B 3PGLA 4G41A 1PDVA 2QXUA 1K2VN 1SG9A 1VHJA 3HABA 3LYLA 4W9NC 2VRCA 1QGED 4YXWA 2Q5OA 3N86A 1GZVA 4I8XA 4BNIA 1LB1B 4Z51A 5I45A 1ZR4A 1P18A 4NMHA 4D9NA 1DI0A 2HV8A 2GN2A 4O4IF 1T8SA 3DAHA 3FCUB 4ZIRB 3FPSA 2B98A 2NACA 1BGVA 4M0PA 5DYNA 3NM5A 5TJHA 4L0CA 2ZSKA 1VMDA 4TVSA 1DUIA 3EFHA 1V6AA 1CUSA 1DQZA 3EVNA 4L51A 4OQLA 4IM7A 4RLHA 5IXSA 2FZWA 1X9IA 1X6VA 1MDBA 3IPCA 4AD8A 3OA2A 1E3TA 1Y98A 4RD3A 4E3WA 5FWYB 1S2OA 3H6HA 4LYJA 4R8KA 3UW3A 2OQRA 2QE6A 3K8ZA 4CTMA 5HJEA 4DWWA 2ZPTX 1F3OA 1ABEA 3BRWD 3E9NA 3FFXA 3T34A 3S68A 5E3HA 3T94A 4D74A 2EFJA 1XJ5A 2GRJA 3QWFA 1XHLA 4HAZA 4HDNB 1Y3BE 4HZUA 5GQSA 1NXXA 2N75A 3LT4A 5DLPA 3ERCA 3IQHX 1S4QA 3QKSA 1RAEA 1NXVA 3QBVA 3IODA 2ATCA 2C1EA 1B3BA 3CZ9A 1RAGA 2VAWA 3Q3JB 2UXCB 1J5XA 1PJZA 3IO3A 1QP8A 4FMBB 2WF5A 1J1IA 3ZWWA 4N7RA 3P9RA 5EEHA 3KOOA 1P3Y1 2ABWA 2IZ1A 2NMVA 1FXWA 2E4ZA 2W6CX 4BB5A 4Z4GA 3I2IA 1T6YA 3U7QA 4BEWA 1Y8QB 1VBFA 2VCHA 3O83A 5EGSA 4TGLA 2QB5A 4CIXA 1QDEA 2VUHB 5ITZA 3V48A 5DWDA 3ADPA 2FG7C 3HRKA 4RE5A 3WK7A 3EZ6A 3ADKA 3W2EA 1KAHA 1VL1A 3SD7A 1OYYA 3HV0A 3KQWA 4J1SA 3WL6A 3AY7A 2O48X 3W1VA 3GLFB 1H8HA 5J2UA 1LBQA 3AIIA 3LCUA 3PB3A 4JUDX 1WLSA 2PXCA 1TA0A 3GEGA 3LOUA 2XA1A 3HB1A 3P0RA 1ISGA 2DPMA 4G26A 1QDUA 3NS7A 3WDKA 1F8UA 3ZHYA 5CG2A 1ODIA 1O97C 3S28A 3DHEA 2ZAMA