4G0MA

Crystal structure of arabidopsis thaliana ago2 mid domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
SIVKHWAVLDFTASERFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Arabidopsis Argonaute MID domains use their nucleotide specificity loop to sort small RNAs.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
molecule keywords Protein argonaute 2
total genus 43
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g0mA00
2E4VA 5DTEA 5FBKA 4RS3A 4RDCA 3LUJA 3ILHA 1USIA 3CU5A 4KZKA 4LX8A 5IEJA 3H5TA 4EY3A 1FFGA 1S8NA 3SG0A 3L6UA 1ZH2A 3OM1A 3RVRA 5KQPA 2FEPA 4MAAA 4DADA 1JYEA 3UK0A 4HNSA 3QLUC 2FXIA 2NT3A 3H6HA 3O1IC 3QELB 1JBEA 4IMIB 4RXMA 3BILA 4NICA 4EVQA 4G97A 5IX8A 4KVFA 2A9OA 3LUCA 4YO7A 1PNTA 5ABPA 3RVPA 4CBVA 1E6MA 5TQ2B 4WXEA 3P9YA 1GUDA 2P9HA 2VUHB 4PYRA 4OLAA 1JFSA 1YK0A 1D1QA 3M9WA 1W9HA 1ZDMA 2FEWB 3LOPA 5CNJA 3G1WA 5KQGA 2PAFA 5EWLB 3A0RB 4YWHA 3FDFA 4Z4HA 2WMYA 1F4VA 1U8TA 1EHCA 3OLXA 1TVMA 3NHMA 3A0UA 3CZCA 4TLMB 2FLWA 1Z15A 3CHYA 2MSWA 3GL9A 1OXKB 3OLZA 1RPJA 2CD7A 2NUBA 1CHNA 4N0PA 3KHTA 4ETNA 4QYWA 2E4WA 4EGSA 3M6MD 2PUAA 3G85A 4RK7A 2V0NA 4G86A 3H1GA 5TE9A 1MAVA 4G0QA 1UDRA 4YRZA 1P2FA 1FSPA 2FMIA 1VRVA 2GWRA 3O1HB 5KC8A 5CNIA 1YTUA 1D5WA 4EYKA 4G0PA 1K68A 5HKOA 1ZHHA 4MR8A 5JS1A 3E61A 3LUKA 3H5WA 4KQ9A 5FBHA 2PUDA 2HSGA 3QLVC 4D6XA 3NBMA 1YVUA 4DN6A 3H5IA 1YMUA 4JP1A 4W5TA 1C0EA 4Z9AA 3QLUA 4P1ZA 3EODA 3I45A 1BDIA 1P6UA 1BDHA 2AYXA 2PL9A 1ISRA 3VNBA 1MIHA 3CG4A 4MR9A 4Z9BA 1JLKA 1JFTA 3RVMA 2JRLA 5PNTA 1JH9A 2F8SA 4OLBA 3MA0A 3Q9SA 4WT7A 4HNQA 3Q7TA 3QEMB 3QK7A 2JBAB 3CZ5A 5KQLA 4Z4EA 1YMVA 2IKSA 3CLKA 4FE4A 5TPZA 3UKJA 4IRXA 3L49A 2L18A 3I42A 2FMFA 3MM4A 1AB6A 4WXMA 5TQ0B 5JNUA 4M88A 2FN8A 2E4XA 3HSYA 3QLVA 3T8YA 1OXBB 4NQRA 1SRRA 5CHYA 2FMHA 3H5VA 3JVDA 5IUJC 2DRIA 4EYOA 1KRXA 3TX6A 3OMXA 2N9UA 4MR9B 4XAQA 4MR7A 1DCFA 2OENG 2VUIB 3LUGA 1EWKA 1ZITA 1RNLA 2QU7A 3RQIA 3H5OA 5TPWA 4E7PA 1M2FA 2O20A 3LFTA 3RVOA 4P98A 1DC8A 3EQZA 5TQJA 1YS6A 3QEMA 2PL1A 2MSLA 5BRJA 2FQWA 2KYRA 3N6VA 3ROFA 4MQEB 3RVLA 3K9CA 4IF4A 3HK2A 4XLTA 2PMCA 3SY8A 4F3TA 4KRFA 2A9QA 3H75A 2R4QA 3JVIA 4RK6A 2I6FA 2IPMA 3O2JA 3HJFA 4MS4A 1ZH4A 2QR3A 1LJUA 2GBPA 5HM6A 4EUKA 3VNAA 3TMYA 2YHAA 1EWTA 4F11A 4OATA 3MIZA 1DJMA 4O1IA 3SQNA 3Q15C 4KK3A 1VKRA 3LUAA 4LDAA 2MYNA 4KPYA 4W5RA 5B3JC 5IBQA 5KC9A 2HPHA 3RVSA 3FFWA 4RZSA 1Z17A 3JTEA 3T6KA 1QNLA 3I5AA 3KCNA 1E6KA 1DBPA 3HEBA 3RVQA 2FVYA 3KSMA 4IGAA 3O75A 1DCMA 1QP4A 2L19A 4GNRA 3EQ2A 4OG2A 3LTEA 4YS6A 2F8TA 3OQMA 1USGA 5T3YA 3TO5A 4UHJA 3CNBA 1SD5A 4XARA 2MYUA 1D4ZA 2RJOA 1EAYA 2MYPA 2E4ZA 1BAPA 2NZUG 2WJAA 3GYBA 2LUOA 4LDZA 4MR8B 4Z99A 4ETIA 5BR1A 1PUXA 3FGZA 1Z13A 5IUNC 1RZRD 2CHEA 2IOYA 1LBHA 2HQOA 2LIVA 5FWXB 3C3KA 4LE0A 3N0RA 2LP4Y 5B3JA 4KNYA 1SXGA 2IDMA 5JNSA 4MS4B 2WB4A 2LPMA 3MMNA 3O1JC 1QP7A 1Z26A 3W9SA 1NATA 3N8IA 4S04A 2A9PA 4F12A 3QX9A 2B1JA 1L5ZA 4YR7A 3HZHA 2QV0A 1HEYA 1JX6A 4KK4A 1NXXA 2JVJA 1TJYA 3HUUA 4FB4A 3HVRA 1RZRA 1ZN2A 2RGYA 3Q7RA 4MRMB 5EWMB 4B09A 3QLTA 5KWSA 3HDVA 4MQEA 1M2EA 2FTKE 1GCGA 4E7OA 2VK2A 4OBBA 3OM0A 4MLDA 4N0QA 4MR7B 3HUTA 2GI4A 3OLYA 3IP5A 3S99A 3CG0A 5C5EA 1I3CA 1ABEA 2GKGA 1EFAA 1XWWA 1H9CA 1ABFA 2QZJA 1QKKA 4RK5A 3OO0A 1DRJA 1P6QA 3KYIB 4Z0NA 4HYEA 1DZ3A 1PEAA 4KREA 1VPWA 3DGEC 1PEYA 1GLGA 3F7NA 1URPA 3C6QA 4JB0A 2E4YA 2JBAA 4G0XA 4YLEA 1E2BA 5GOTA 3ILYA 1DG9A 3RVKA 1CYEA 1QMPA 1QO0D 2WRZA 1ZGGA 1Z18A 2PKXA 3OLWA 3QEKA 4MRMA 2PUCA 1NY5A 1USKA 4ZMSA 1ZGZA 1LK0A 3IP9A 5JNRA 1P8AA 3IP6A 4F06A 1M5TA 3URMA 3RVJA 1YS7A 5JS2A 3EULA 3JY6A 1L5YA 2WJWA 1U2QA 4N76A 4YV7A 1NXTA 4W5QA 2VYCA 4NV3A 3E3MA 3FFXA 5EWMA 4H60A 4MS3B 1NXOA 3QX8A 4RK0A 2R48A 3F73A 2CWDA 4ETMA 3GWGA 2JVIA 3D8UA 5DGCA 3K4HA 1JF8A 2Q5CA 4O5AA 5C5CA 2NT4A 3MF4A 3MYYA 3FFTA 1Z12A 1M5UA 4L85A 2ZAYA 4JB2A 3UUGA 5GQSA 3KS9A 4MQFB 4MS1B 5E3JA 4WZZA 4Z4GA 4RY0A 4JAVC 1BDJA 3LKVA 4MYRA 3IP7A 4YCSA 4Z4CA 5D2CA 2MYTA 2PJUA 4IMJB 1ZVVA 1QP0A 1JDPA 3QELA 2PLNA 4LRQA 3C3MA 3GBVA 4EVRA 6CHYA 4IILA 2IPLA 1KGSA 3KYJB 1QQBA 4GPAA 2IPAB 3N0WA 1GUBA 2J48A 2ID7A 4RXTA 5IEBA 5EWJB 1Z2EA 1D1PA 4KV7A 2M1ZA 4EYQA 2HQRA 5BQ3A 3I09A 1TLFA 4MS3A 2RJNA 2JK1A 5EWLA 1ISSA 2B4AA 2M98A 3C97A 1CEYA 2GX6A 4JASB 3NNDA 4ZPJA 2PUFA 3HDGA 4NCAA 3LMKA 3KKEA 4NCBA 4Z4IA 4UHKA 4WUTA 3BRQA 7ABPA 2JCGA 2L17A 3HCWA 2FLKA 2X7XA 4ZMRA 5JNVA 2H3HA 1U2PA 2XDYA 1FFSA 4XASA 1TM2A 5F64A 1F51E 4QPJC 1KRWA 3TD9A 2IPNA 1FQWA 3F6PA 3T38A 1JYFA 4MGEA 4Z4FA 1NXVA 4G0YA 1DC7A 2P4UA 5JNTA 2NZVG 1Z25A 2FEKA 3OMWA 9ABPA 1PHRA 4W5OA 2R47A 3DZDA 3GA5A 4PZ0A 2WY2D 3CKMA 3OO1A 1DBWA 1JFVA 4RY9A 5HQJA 1K66A 2HQBA 3EJWA 4MLCA 1Y1LA 3JS5A 3EGCA 6ABPA 2W42A 3N0XA 4D6YA 4RV5A 1APBA 1MVOA 2MSKA 3H1FA 5HSGA 1J56A 3Q7SA 2FW0A 3LUFA 4L4UA 2QVGA 2ZWMA 1JHZA 2TMYA 3EAFA 4ML3A 1BA2A 1A2OA 2AYZA 1EWVA 3EDCA 4OTZA 5IUKC 5TQ0A 5BRAA 2PE5A 4W5NA 3SNKA 2PUBA 5IULC 1JL3A 1IIBA 3FMVA 4FE7A 3H6GA 1ZESA 3DGFC 3NNSA 3GT7A 3CTPA 1AB5A 2JB9A 4G0ZA 1XHFA 4G0OA 4RXUA 4Q7EA 1LJLA 5EWJA 4XFKA 4ZYLA 2YHBA 4YGXB 1U04A 2BGGA 4PEVA 2FKAA 1Z16A 5FWXA 4MPTA 5TPZD 3N53A 4KMRA 4D74A 1T34A 3JPWA 3BREA 5T7BA 4QYMA 3IDOA 3IPAA 3Q41A 1U0SY 4Q6WA 5I4CA 3OQOA 1RXEA 3HM9A 5CNMA 3DLBA 3C3WA 3RH0A 2FN9A 3CRNA 1XHEA 4TN5A 2H0AA 2FQYA 4H3KB 3HV2A 2L2QA 3H5LA 1E6LA 3F6CA 1QQAA 4RKRA 3BBLA 4DQDA 2RDMA 1JDNA 1YK1A 2A9RA 4WWHA 4N41A 4MS1A 2QW1A 3R0JA 3SM9A 3N75A 4KQCA 3M9XA 1ZAYA 4LE1A 3LKBA 3KLOA 1MB0A 4XXHA 5DKFA 3NNNA 4YP9A 4MQFA 3KTOA 1B00A 3GBPA 2PUEA 2E4UA 1NXWA 5KI6A 5CNKA 1LBIA 2PUGA 2QVCA 4KFCA 4G0MA 2OQRA 1NXSA 3KJXA 3IPCA 1RXIA 4TMYA 1DRKA 2QSJA 3GRCA 4JOQA 2QXYA 4N03A 4RK1A 5TQ2A 3H1EA 1NTRA 3T95A 4RK4A 4EYGA 1Z2DA 3BRSA 4RSMA 4Y9TA 5IC5A 4PICA 1BVHA 3LUHA 3CFYA 4H3HB 1JWLA 5DCLA 4RY8A 4JA2A 2CHFA 2FSPA 1TMYA 1QO0A 1SXHA 4O1HA 3HXMA 1QPZA 1R8JA 4S05A 1KMIY 4TLLB 4QICA 4RU1A 1WETA 5FWYA 4RWEA 3SAJA 2JVKA 1DCKA 1VLZA 3HS3A 3DBIA 3KG2A 1MB3A 8ABPA 5KQMA 4HNRA 3D02A 3CS3A 2ID9A 3LUDA 3O74A 3NHZA 3DLHA 2FMKA 4Q6BA 1W25A 5TPWB 3MQ4A 1NXPA 3ROTA 5JNWA 4EVSA 3KLNA 3TB6A 1C4WA 1DP4A 1SXIA 2HJ9A 2FQXA 5FWYB 1A04A 2R25B 2LBPA 1YIOA 2WWVD 3OLVA 4ZJPA 5ED4A 1D2AA 1ZY2A 4N47A 4RKQA 3O2SB 3GV0A 4F8JA 4LE2A 3OQNA 3A3KA 3O21A 1DBQA 3O2QB 5DLEA 3HO1A 4LZLA 1A0OA 1FFWA 1GCAA 2IYNA 1PNRA 3RVNA 3B2NA 3JPYA 3A10A 4PE5B
chains in the Genus database with same CATH superfamily
2J4FA 1DKMA 1IU9A 1JA9A 2VHEA 3H2GA 4MP8A 3ZWNA 1X19A 2YZ2A 3BHNA 2PWYA 3R20A 4DJJA 1VYHA 5LP1A 2Q2OA 1W85B 2QD5A 3L6UA 3FDZA 2G9NA 4BE7B 1SIBE 4E5DA 2I71A 1A9QA 5CB4A 4GP9A 1UMDB 3ZCPA 2AG8A 4EVQA 4DS3A 3F67A 3T5TA 1R74A 1F8FA 2JIRA 4PGHA 5D3QA 3VPXA 2Q2QA 4AT1A 2YJNA 1VMKA 4S3MA 4ESHA 4XYMA 2A57A 1OREA 3RIMA 2QT9A 2GPJA 3H9CA 4CCSA 3A1WA 1PJTA 1W9HA 2AT1A 4LFAB 4K3VA 5JI2E 2JCSA 1BG6A 3N7TA 2PGNA 2XMQA 3GDOA 2PAFA 4XWTA 5BOVA 3KTAA 5IAOA 3DLIA 4R71A 4KQFA 4PQYA 5EIBC 1F4VA 4O8ZA 2ZUBA 2VNHA 1L5HA 1QIDA 2PXAA 2UXDB 3OC6A 3LM8A 1M66A 3KKQA 4WY2A 3GFTA 4UTZA 4FW8A 1CHNA 5MFZA 1MU0A 3R77A 1M3SA 3LPNA 4CV1A 4UARA 1VMDA 4X8LA 4RNCA 3KEOA 3IP1A 3M6MD 3LS2A 3VR2A 4HNAA 1H2AS 1IWBB 5TE9A 5IRCD 4NWIA 4CM5A 4E1VA 1OZGA 2R7MA 3NHJA 1JG7A 4Q7KA 3JXEA 3IQGX 1UDRA 2RGDA 1XA3A 2H85A 3JQ7A 1XTQA 3TFWA 3QV2A 4YO8A 5CNIA 2ZIWB 3O9MA 3HB4X 5AVJA 1P1CA 3I2JA 5FTKA 2F1HA 4TS9A 1RYEA 1Q15A 5LZ8A 1KC1A 3OFVA 2YKGA 4G5HA 3IKJA 3HHPA 1PZNA 3LKZA 2OQVA 1M1XB 5LXTB 4N5LA 4DLKA 3IT1A 4JP1A 4N3CA 2V7UA 3NIGB 4CMJA 4LQ4A 1A9YA 2Y1XA 4I1YA 3RYFB 1QC5A 4ISCA 2GZHA 4HAUA 4W5WA 3ZV3A 3NEYA 5H3HA 4ZZ3A 1BE6A 2ECFA 4AIIA 4D9FA 5A03A 2C61A 1XDBA 3BH6A 1WQ1R 4PHGA 2F1OA 4ZZ0A 5AKGA 3K9HA 2Q6LA 3L49A 4WXMA 2Q3LA 4LHWA 1Y6GA 2E4XA 3ITNA 2VVTA 4XLLA 3NRBA 5I4BA 4KR3A 2F67A 3F3YA 1RQGA 5CHYA 1F5SA 3AIIA 3R5HA 1KY5A 2DRIA 4I5FA 4IRMA 4PTZA 5IUJC 2BMWA 2IKQA 4EF4A 1U94A 2JJ8A 4QOEA 2KSQA 3DV0B 4P4TA 3T34A 2XB2A 5JNLA 4PM4A 1Z68A 4WKPA 4E3ZA 4HPWA 3NIWA 4BGDA 1C1XB 4UVEA 3LLSA 4FWTA 1Z4OA 4XCXA 1FY2A 3TGPA 4LJ8A 3LFTA 2XLBA 1JTVA 1DC8A 3CPSA 1F7VA 3QFFA 1YFZA 5C1IA 1NYRA 4CDRA 4TOIA 4C6RA 1J8MF 1B8OA 1F6DA 2F3PA 2V6FA 4HLQB 2NSDA 3PLNA 2CNKA 5EPOA 3OEEA 3GGJA 4H18A 1G38A 2D59A 4ITUA 2XAAA 4O4JF 2CK3D 1YR2A 4C78A 3R75A 3BGDA 1KWKA 5ALQA 5JAHA 1M2OB 1LJUA 2QNBA 3QUBA 3MIIA 3SJCA 4JSYA 4CEIA 1JE0A 4Q4AA 2XRFA 3IEIA 3U1VA 1G5HA 1R66A 1VGVA 4BN4A 2WW8A 2MMCA 4NYJR 5PGMA 3TTTA 2RH9B 2GPNA 2BLNA 2GPBA 1GU7A 1AY0A 1ZICA 2B2XA 1VC2A 3P71T 3PNQA 3SHQA 5CAEA 4PONA 4TGLA 5AM1A 2ZUTA 4GOMD 4AN1A 3VMMA 2O5EA 4V0LA 4GIBA 1CXZA 4S24A 3HCOA 4DLRA 2VZLA 5BOSB 1QX4A 1SCJA 3ROMA 3RC3A 3WLNA 3UJDA 4RQBA 4QXRA 3QPDA 1CUWA 4OIMA 3LBIA 1FB5A 4M9SA 2XT6A 2I3AA 4YJ3F 4R1SA 4XARA 1EAYA 2PKRA 1XDWA 4D43A 2ETVA 3AUAA 1GQSA 2HHJA 3FGZA 3I37X 4EHIA 4JJFA 3FFBA 5K01A 4CF6A 2OXRA 2FPRA 4BVAA 3C6YA 5HF9A 4C2AA 3E58A 4ZYTA 4RVFA 1TM3E 3I6ZA 4MLPA 1V16A 2JIZD 2REBA 4KXLA 4UBLA 1PP4A 4BBPA 4QDJA 1SUPA 1Z4JA 3KZ1E 3G02A 3MJRA 3QX3A 2VUUA 1NATA 4XPIA 4GWLA 3T1VA 1PLKA 5L3SB 5JSFA 4WFJA 5LOVF 3H99A 4LMPA 2D2XA 5EYPA 1JLLB 1N5DA 5JO9A 5CAEB 1VGRA 2H1CA 1A50B 1JEAA 3QNUA 1N2BA 4XD7D 3V46A 1N25A 1NBMA 3CIFA 3QLTA 3R0XA 3KKZA 4BO2A 2DBZA 3HDVA 4JKIA 2H92A 1E3MA 3AVVA 1L7XA 3FLAA 3TAXA 4OXNA 5EAIA 4Y6QA 4U3JB 3DV9A 1RFLA 4A6EA 4ZYWA 2YV3A 4N0QA 3ID6C 1HNXB 4LPKA 2J59A 4YHBA 4WERA 2R7NA 1D2RA 3IP5A 4ZCPA 2Y9MB 1E0AA 2VDPB 1KH3A 5ESWA 1A27A 2QRGA 3GCZA 4TRJA 1U8UA 4EF6A 1IZ0A 1MNAA 4PRYA 5DGXA 4AX4A 3QYPA 4YJ2A 1ZHOA 4TMVA 3IIKA 3O4VA 4DG5A 4DA8A 1TEVA 3PUWA 4IKPA 3EHEA 1U8CB 1EA7A 2N3ZA 3SDSA 1AX9A 1VL1A 1Y8RB 2ZFUA 5CPFA 2OBMA 5SZJA 3THXB 3N59A 4G0XA 5CA0A 2EGHA 3SJZA 1OWOA 2C9DA 1R0BA 1B6GA 1ULBA 5CX1A 3W6UA 4F4DA 2XZLA 3LP8A 3C6XA 4ZT5A 3IAHA 3H9JA 2DJ5A 2HHAA 1FYVA 1O4WA 3OZTA 4HS4A 3OLWA 3UENA 3IPXA 1KZ4A 4BPRA 4M0EA 2AFHA 3RU3A 3CLTD 3S1SA 3D64A 4W8HA 2VTBB 3O9ZA 4S1TA 3IP6A 3K5HA 3UXYA 2Q2NA 3AR8A 3EWNA 2H7XA 3L8GA 5TQVA 3UXEA 4CN8A 1QZZA 1XTIA 1FPMA 3GZTB 2GF0A 3ZI7A 1E1LA 3QKRB 3ACCA 5C31A 1C9EA 3WK6A 1RAEA 5BNWA 4RJJA 1QOQB 3GR6A 2NZ8A 4MAMA 4YRKA 2DFVA 1FXSA 2HKIA 1H0HA 4XVHA 4NS1A 1EFDN 5CA0F 3ICVA 1ZW1A 1ZM2A 3Q5EA 3N8NA 4K81B 1SBHA 1KMNA 4QU0A 5ARCA 4B5LA 4E3WA 3R8FA 1C7IA 1E18A 3K4HA 4DR3B 2XECA 5E6SA 4PZCA 2ZAYA 3L7OA 3O31A 1C0IA 1E2DA 2RHMA 3MOGA 3RK1A 1CE8B 4CG0A 5I7VA 1K63A 3JQGA 4LF7B 4XSGA 4MKZA 4WLNA 4F97A 3THOA 3H4TA 3T9DA 3LKVA 1XIVA 5B1IA 1P1BA 4MO2A 4DQLA 5JZSA 1UF9A 2Q5OA 4D42A 2B4QA 3CZQA 3EY4A 4DSAA 2GARA 1YO6A 1N2OA 2O52A 4ZQBA 1GZ3A 5EE0A 5FPHA 2Z2KA 5G1OA 3E53A 1V3TA 1VHQA 5CDHA 1AIPA 1KGSA 1Z37A 3S2GA 3ZKWB 1CJKC 1ZD2P 3PKIA 4K6GA 1CV2A 3N0WA 3NATA 5I8ZA 3F96A 1A4IA 2VBGA 3L7KA 3DWGA 3WYAA 2BRUA 1RP7A 2SBTA 2ZXFA 3PR2B 1TQHA 3HJHA 3N0TA 2I1VB 4MYTA 1US8B 5KYXA 5ILQA 1WO8A 2EKDA 2WFLB 3V00A 3ZU4A 4EI9A 3RRFA 4WD3A 1SCUA 3ORHA 1XTRA 3Q0IA 3BRQA 3SC2B 5JMOA 3T52A 3R41A 4NMXB 3O90A 4CMGA 2YBDA 4EOGA 3KDSE 1NJ2A 4AJKA 1U3FA 4XLZA 5EIHA 4MGIR 4WUVA 4CEIB 3ICEA 3G5LA 3HCCA 2GEVA 1DBIA 5MN5A 3BXFA 1RQRA 1SJ9A 2PNJA 2GRUA 3UAGA 1SQ0A 3HM2A 6AT1A 1RWBA 1TJPB 4Q21A 1NXVA 3GDGA 3MHPA 1WU8A 2R5NA 3KJFA 1NMYA 2FEKA 4QXAA 4OAOA 1HYEA 2PMKA 3KJZA 4REMA 5KYWA 2A7XA 4LEIA 4B2YA 1ZK2A 2JGEA 4IJVA 4WKCA 3UPTA 3P4XA 2G4LA 1R18A 4I08A 5AUNB 721PA 3HA7A 3N2IA 2NUPB 3S8MA 3SDBA 1Z4PX 2AFHE 2Q9BA 3NHUA 2ZJ7A 4JS0A 2VQFB 2IIBA 3EEQA 3DE0X 3ZUPA 1U80A 4FKZA 5IHPA 1GKLA 4Q1DA 1E1NA 2IYVA 1FUIA 4L4UA 1T8SA 3TW8B 2QVGA 4CETA 2BCGY 3Q9NA 2AOTB 3LYUA 1TC1A 2W8BA 3IBFA 3CN9A 2GKSA 2Q3BA 3CV3A 3Q0TA 4B4VA 3GLIB 3C6KA 2O0MA 3UHOA 3EEOA 1Q57A 4WRRA 1JL3A 1UADA 1X9HA 5CT8A 3M3DA 1KJ8A 2JI9A 5ICEA 2PLFA 2MSDB 2AN4A 1SCBA 2JCVA 4QOHA 2P69A 4KYTA 3BXPA 5ALMA 2VS1A 1QH8B 1LJLA 1FFBA 2PUWA 1TGVA 2YYSA 3I01A 1H0KA 2W70A 4MUJA 4X9XA 1Z16A 2ECPA 5H9VA 1GGHA 2O23A 1BKDR 4GR9A 4BNFA 2YJ6A 4ERNA 1HZZA 1X6VA 1CY2A 2GJ4A 4OB6A 4QYMA 2OHFA 2XW6A 4RENA 4HVCA 1I01A 4F5EA 1EEXB 1C1DA 3LE8A 1P9OA 3F6RA 2ZYHA 3A05A 3LP6A 3G7SA 2W6CX 1V4VA 4LWPA 4A0HA 1V9CA 3VZDA 2HDHA 3ZWOA 3GLFA 4UCWA 4UM9D 4BP8A 2BEJA 1A9RA 4KFRA 4F2GA 3I9V6 2XIJA 4L50A 2BFDA 4JJIA 3L8FA 2I6GA 3T3GA 1GRNA 1QRDA 1NV8A 2PZMA 2JAQA 4JOSA 2YN4A 1AA9A 1CR1A 2BP7B 2UAGA 1YK1A 2WD7B 1HTBA 4J4TA 4MS1A 5AJVB 1U63A 5JV5A 4MUKA 4I1PA 2A0WA 4GXTA 1GZHB 1CB7A 1USWA 2WSMA 4FW9A 3LT2A 4K9QA 4QUAA 2P2NA 2G76A 4MH0R 3TNLA 4D8TA 5K09A 1GFSA 4MWEA 4TRRA 2PIAA 4EHNA 3WOHA 1NJFA 5K8JB 3ONEA 5CD1A 4O4LB 3G9UA 1M2OA 5KINB 4JLPA 3JQGB 2G88A 2IPOA 5AK4A 1Y5RA 1YAHA 1H2HA 2QGZA 4KH0A 1ZIDA 1U8EA 4FSHA 1BHQ1 5IABA 3JQ8B 1P2VA 4Q9HA 4S1PA 1Z0KA 3NP7A 1ULZA 3IPCA 4UXIA 2B1RA 5F12A 1XTUA 1V1RB 5EXTA 2J1LA 4NH4A 1O6GA 1VLLA 3ICCA 1NTRA 4GOXA 4TQUS 3NUGA 1BMDA 2Z04A 5F76A 4AB1A 4LXTA 4XVCA 4JI0B 4FN5A 4RZIA 2QZZA 2CXTA 3CT4A 3SMQA 3FCCA 1M83A 2DHCA 1MJGA 3NKVA 4I2NA 3QF4A 3BWMA 4OKNA 3LRXA 2ONJA 3RROA 3WMGA 4GOKA 2GPTA 2CNBA 3OZBA 4FC6A 2O54A 4BNTA 3RRYA 4DANA 1QPZA 1Z6ZA 4BRSA 4XM1A 1FU8A 1U9YA 1TZ2A 4RU1A 3IOBA 1KI8A 3GPDG 2VK1A 2JS7A 3R23A 5BPFA 5AW5A 1C9NA 2C8KA 4EA8A 1P3DA 3OPNA 1K86A 5G3YA 5C32A 3RSZA 1M6HA 3RC7A 3O74A 3NHZA 1SY7A 1BS1A 1E7MA 4RWZA 3V1YA 4TTSA 4MULA 4C05A 4U9HS 5JCZA 3MQ4A 3JD1A 1RKBA 2OGUA 4NZ9A 2AVNA 5AVOA 4BVLA 2REQA 2W4IA 3N9IA 4BX9A 1A04A 1T26A 1F0PA 2BBSA 5K2OA 5GADl 5FL7D 3BJZA 3KZNA 6REQA 3HYNA 4UEQA 2J30A 2WYWA 2IH4A 1XZLA 3WGVA 2NXNA 1ZHFA 1GTZA 3PD0A 3PFNA 4UZSA 5E95A 4B74A 4NFSA 2AHOA 4TSFA 1NP6A 3IQWA 1GSAA 1AHIA 1JALA 2PXXA 3EFHA 4FBLA 1DBQA 4J1NA 5EE3A 4TYNA 3IEMA 4WXHA 1JB9A 4ZAZA 4ZHQA 3EGIA 4F7DA 2WIKA 3OU7A 1PNRA 3ETLA 3BK1A 2Z83A 4B81A 3B2NA 1C9JA 3X2SA 3BE4A 1TKCA 1R0WA 4BFXA 1CUBA 1SOMA 3KSRA 4DY6A 3TXXA 5LYJA 2IDKA 5AYVA 4DLLA 5KBYA 1T9BA 2AW3A 4IXMA 1G3RA 1W4CA 3C7AA 3CCBA 5KB3A 1P44A 1V7QA 2D1QA 1QXSA 1O77A 1SULA 3DAGA 3RBZA 1GAXA 1FJ2A 1J1ZA 3O93A 3PDHA 3NPMA 4K9MA 2QY9A 2V98A 4FMPA 3SJBA 3KEGA 3QTTA 4U7PB 4QM7A 3HWRA 1RPNA 1YRLA 3SYTA 4PTLA 4AAYA 3L07A 2JLUA 2HNBA 2P5YA 2A9VA 4AZSA 3QWHA 3CVVA 5ED0A 3I5MA 2ZQYA 2P9HA 2OLKA 2VUHB 1KJJA 1Z73A 4RMHA 1QX3A 4XJVA 1MG0A 2YS6A 5ALLA 1VKOA 3X43A 4KTTE 5EJMA 4ZAGA 3V7UA 5HZMA 2VSXA 4LXGA 4R2KA 5A6SB 4A8PA 4CTKA 1X74A 2C2OA 3FR7A 4EATA 3ZVKA 2I9KA 3VHXB 2WUFA 4L4RA 2WMYA 5JAPA 1Z28A 4CLOB 3CNHA 2QN9A 4V1CB 5L51A 4RIGA 3QF7A 2JLWA 3QHQA 2YVAA 4BJHB 2ANBA 1B8VA 3WWYA 3R6TA 4DYHA 1YJ5A 5FUWA 4L02A 3GPLA 2EX1A 2GYWA 3EAQA 4RUKA 5AKYA 3U39A 1RPJA 3LDFA 5F2KA 4N0PA 4U2GA 4KQIA 2O8EB 1XZHA 2W71A 4ZCLA 3W5CA 1OASA 4HLCA 4RDHA 2B98A 1M1YE 2NU8B 3TG2A 4U5QA 1G2QA 1GGMA 4RVUA 2IEYA 3ADPA 1VYVA 1X86B 2ONZA 4YRZA 1HT1E 5IMBA 3TLJA 1BD3A 5LDHA 1Q16A 4LKRA 1XRPA 1CKEA 1WG8A 4J0CA 3UV6A 4JLOA 1HY3A 2IYAA 3DEFA 3GF4A 1GG8A 1UBLS 4MUAA 2PCLA 2VSYA 2H2DA 4ZQHA 4AXXA 1U1FA 2ZT6A 4ABYA 4JI3B 2I2AA 5U4QA 3UA4A 1MORA 2ZRJA 3QG5A 2ZRGA 4AJJA 2BR5A 1NASA 1ODTC 4K6CA 4B3HA 4Y2HA 1CZHA 2P0EA 3EZ2A 2OZLA 3S28A 1PJQA 2JFOA 5JDIA 3AUUA 1SUFA 1PSDA 2LCFA 7MDHA 3A7DA 1GSOA 1DQPA 1EK5A 3UWDA 1ZG3A 1KQNA 3WGYA 2ZU6A 4K9PA 3TJMA 2A84A 2V96A 1UQUA 1IOLA 1G64A 4FINA 4JLDA 4XJXA 5GAJA 4F8YA 1VBFA 4QTUB 4RSRA 5KX5F 1I6LA 1ZOPA 3W79A 5IVPA 4MQUA 3UT0A 1ILEA 1XAIA 3AR2A 4CIVA 1N8NA 2X8AA 4G0VA 1D4AA 4IM7A 3B89A 4KBFA 2HJVA 1Z9BA 3DMTA 2VWGA 3CRZA 3IS3A 3K31A 4IHJF 1ETHA 5AOVA 5FFNA 5HMMA 3ZHSA 4QKQA 3I9JA 2DVMA 4UZEA 3G8YA 3F3MA 4XAQA 1JDZA 1QB7A 3BCUA 4KUGA 4TM7A 3TAHA 4UXHA 2CXHA 3NDBB 1E4VA 2QU7A 1WZ2A 4CWAA 4Y2UA 1K27A 2FUG1 4EHLA 2DKFA 1C3XA 1FNBA 1BU8A 3FI0A 3IJ5A 3SC6A 3VR1A 1UCFA 5IDQA 3GLGE 3A27A 1RWMA 3FOAA 3QVWA 5G0WA 2H00A 5E7MA 5FBQB 4RL6A 3IPYA 5D3ZA 5EIOA 4OLFA 5ALHA 1KFJB 3VH2A 5JBIA 1KYWA 1WCYA 2IH2A 3PCRB 3ZDZB 4UDXX 1RCUA 2DWUA 2ZJZA 4IQGA 4MWSA 3RFVA 1MHTA 4FGJA 4F3TA 3DZCA 3VSCA 1XQYA 2GVDC 2Y93A 1C5KA 3AESA 2A3RA 3D2LA 4EA6A 4GI3A 3HJFA 2X5NA 3FDXA 2R8PA 4Q4CA 1H22A 2O2JA 2VZEA 2ZKLA 4ZANA 3UTCA 4ZIRB 4KFUA 1UBJS 1WXHA 2YVQA 1ORVA 2JEYA 4C4SA 1SKQA 3LHIA 1I4DD 4MWCA 1UT6A 1W2GA 1E60A 3BRWA 5FUYA 3HYLA 3WMXA 2VJAA 1L7VC 2J32A 3WGQA 5J40A 5CM2Z 2WAYA 4J3FA 1UKCA 3AYXB 3CPHA 4B6GA 4E1AA 2B8WA 3KCNA 3LF1A 2AK2A 2QEQA 1KAQA 1U8AA 2QMEA 5EQJB 2A5FA 3ZDAA 2FZKA 3OURA 1USGA 5J63A 3K1TA 4BMPB 1MAAA 4KLZA 5AXDA 4BP3A 3MUNA 3WJ1A 1H3EA 4GAEA 5T5QA 2VF4X 4J7UA 4LQDA 4ZFNA 3CWZA 2Q07A 5LA6A 1AURA 4DDKA 2IYSA 3D3WA 4JUDX 1LX7A 1KJYA 1QAQA 2CWWA 3I05A 4CHGA 1IAVA 4RELA 4WKOA 1KSHA 4WINA 3VR6D 1K8ZB 2P9GA 4BAUA 3TINA 4DVGA 2VBCA 3UK1A 3JYNA 4GVXA 3SKXA 4MKFA 4E94A 2SHKA 2CL7X 1K2WA 3U3XA 1DC5A 1E8MA 4PQRA 3V9PA 3S2FA 4EBFA 2B8JA 2I4RA 3QX9A 3L8ZA 1L5ZA 4JGIA 4D41A 2BF4A 1Z2NX 2BFCB 2IUYA 2PZAA 1GG5A 3WIEA 1IY1A 3GZJA 1RZRA 2ZE5A 3HG7A 4OYHA 4B09A 4BJ3A 5IMSA 3DKVA 4G23A 3CUUA 4HS9A 3W6ZA 1C7JA 2K6GA 3KQNA 2PHZA 2FTKE 4MW9A 4LTMA 3EWSA 3PPXA 5ER6A 3GRFA 1F2TA 4FQ7A 3F5FA 3ONWA 4HP8A 5DM1A 4FGSA 4MA0A 5T4HA 3TNFA 3NANA 4EPYA 4E5SA 4F72A 4AZWA 5KUTA 1NQWA 2X1HA 4GKVA 4KTVE 4OI4A 5H3LA 5HDQA 3GJYA 3Q2OA 3G9QA 4K8RB 3VR4A 1I80A 1EPUA 4TLDA 3FOZA 5KYWB 3I61A 2GKGA 4U4AA 5C5DA 3JWJA 1QKKA 3EMVA 3P2IA 1EVZA 3HBLA 2ODTX 1CB0A 1SUSA 2WU4A 4LHEA 3ADBA 2V6JA 1GQFA 2CZCA 3CN7A 5FR1A 2ZROA 1B0PA 1B23P 3LY8A 3QP9A 4CCYA 4LJYA 3PC8C 3PX7A 4CI0B 1KH2A 4WNAB 2WD8A 5HR5A 4A0SA 1G59A 1TJ3A 2JJQA 3H7AA 2W00A 1KFKB 5DSZA 2R7KA 1N2SA 1YS9A 3ZY2A 3GC6A 1Q1GA 1UOQA 1Z18A 3QEKA 4HX9A 1T6YA 1TMKA 3BGSA 4JGGA 3SEQA 3H2KA 4B48A 2PWBA 1FOEB 3WQQA 1T9GS 1UODA 1H5NA 2CVPA 2AH5A 3OCYA 4MGHA 4G0UA 3ERCA 3T3DA 2IZ7A 2HCJB 2XJ4A 5ERXA 2V9CA 1IBCA 1MOZA 2IZ5A 3GUUA 2Q41A 3L6DA 3MWYW 4YRSA 5GIOE 3RJZA 1F2UA 1X2EA 4GWKA 3JY6A 4DG8A 4V0OA 1NVBA 2GCPA 1P91A 4BX3A 4BO3A 4C7VA 1NXTA 4YTEA 3I0ZA 3L6BA 1GSHA 2GMWA 2I2BA 2YXDA 2QRQA 3E3MA 1YQWA 4Q93A 4CLRB 1M0EA 3TLYA 1MB9A 1SA0B 3WRYA 4PBRA 1ATIA 4GPEA 1DKLA 3FNBA 3OD1A 4B45A 2PJZA 2J3DA 5IWCA 3M6WA 1L1EA 1VJ1A 3QOWA 3AK4A 2BFAA 5F77A 3U4GA 3D8UA 3VU8A 3DMYA 5K03A 2Q4EA 3G79A 4O5AA 3AL0C 1J25A 1XFAA 3MINA 1Z12A 3IT0A 4WXRA 5HVNA 4JBHA 4YQYA 1LI7A 3DUWA 3S3TA 4KYVA 4W8OA 2FB9A 4J43A 3VC3A 1I13A 2IZ1A 1GXSB 2VIIA 1WMFA 1NURA 4KQ6A 1I5EA 5M5BA 2FMTA 2O3QA 1C3JA 1VL2A 3FMPB 1NMEA 2AEEA 3C8UA 3HFRA 3KYBA 3R3ZA 1QHHA 3LK7A 4HGNA 4L16A 5D2CA 3ZW8A 3HCFA 3L6RA 1KGDA 4CLDA 3ROQA 2EKBA 2RHRA 1Q1QA 6CHYA 4IILA 1CVIA 4MVJI 3K5IA 1YDGA 2IELA 1F3LA 1VOTA 1R9JA 2J48A 2KBFA 2RBGA 4RZHA 4WKGA 2VBFA 2VRBA 5L3ZA 4C89A 2ENWA 1U3DA 2P90A 3BJRA 2B4KA 3NOOA 5I7AA 1UKAA 3PE3A 4R51A 3DPUA 1SXPA 1DEHA 1SCAA 1P0PA 1F6BA 1Q95A 4YMHA 1CEYA 5GGXA 2CB0A 3UYKA 4J9UE 3AQIA 3GO4A 3H2SA 4FFSA 2LCIA 2XNJA 1AK9A 3DNFA 3S5JA 5DMXA 4E14A 2Z4RA 4OMFG 4GR4A 4BNGA 5K45A 1FSZA 1FFSA 2ODBA 3UB4A 1H6BA 4ALKA 4Z1MD 4I8DA 4FXOA 2Q1TA 4K9LA 5E6UA 4D44A 4KU4A 4U39A 5LL6P 3OJCA 4TMKA 2ZJFA 1IJBA 1TAHA 1V47A 8GPBA 2NXJA 2NZWA 5L4SA 4A8JB 4YAEA 3AB7A 4W63A 3UT6A 5LZ2A 1U81A 2V59A 3EXHC 1G7SA 2CK3A 3M34A 1T5LA 5ALTA 4E32A 5EHNA 2DBVO 2QLBA 4JYPA 3IQZA 5LMZA 2EWWA 4LYFA 2Q50A 1MBZA 2QTFA 3PUHA 1Q7CA 2J33A 1XZEA 3I2KA 4JR1A 4OGGA 4RABA 1XRQA 3JZMA 2F2TA 4F45A 3U44B 3QENA 4PANA 2G83A 3PE4A 4NESA 1ODKA 3FKSD 1IY2A 2VP2A 3RAEC 1E0DA 1EB8A 3D4NA 4QATA 5DXJA 5K0EA 2PS0A 2WWXA 5EJAA 3MAGA 5LMUB 3MERA 3TQFA 2ZTVA 2JATA 4FILA 1BA2A 5TQ0A 4DKXA 1HE5A 5A4AA 3RHZA 2A58A 5CURA 3EXFB 1MQSA 3A1DA 3IH5A 5JSHA 3UHFA 4EECA 3AZOA 2XUDA 5IULC 1MRSA 1USUA 1LB1B 2NW6A 3O3CA 3SXJA 2OUIA 2P9YA 3B9RA 1PS9A 4R2JA 2C8VA 1ORHA 1HT3A 4IVNA 4RXUA 4Q7EA 1CJUC 4YLYA 1QF6A 1QO9A 3I9KA 1JZTA 1PQPA 3D81A 3BOSA 4IJMA 4YMVA 3CUKA 1NOKA 5A1JA 3WIVA 3HDHA 1C9MA 4KWIA 2PBRA 3ICOA 1FIUA 3LCVB 4NAUA 3KWJA 4JC5A 4PS0A 3D5TA 4XPZA 4U8HA 1K8XB 3F4BA 2XH8A 1D0IA 4H7PA 4C07A 2GPYA 2D7DA 3VGJA 4RDXA 2BTOA 1PR3A 3E5HA 5CT6A 3C3WA 4X64B 2GZAA 4C4PA 3RH0A 1P1KA 2ZQZA 1T91A 1UBTS 1VE7A 2VYND 4TN5A 5K99A 5KO2A 4YUWA 2FQYA 4JT9A 2DFPA 1W0CA 4BTVA 4EAAA 4W1SA 1XMPA 3ROEA 4D82A 1OAOC 3VPHA 3DBHA 4EPVA 1JR3E 4ZC8A 1AGNA 4RVGA 1J33A 3ZZTA 1UBSB 1KO1A 4H7JA 1E9SA 1GTMA 1V6AA 2W58A 3OT1B 2VCHA 4NOKA 2VTDA 5J4KA 2YZ7A 4DRXB 4LE1A 1Y6ZA 2Y0BA 1O9HA 1XL0A 5TLSA 1UEXC 2VDNB 5C3MA 1FMJA 2JLYA 1II8B 2G80A 1R4NA 1KO8A 4L2IB 4WESA 4O3FA 1TIKA 2M6LA 3NIDB 1CDOA 2IP4A 1NT4A 3MBKA 5B58T 3UICA 2ZXEA 3H4MA 5AI5A 2C31A 1SKYE 4AO6A 1O6BA 1NXSA 1PN3A 3KUUA 4RPLA 5LD2B 4HB0A 1F38A 1E3WB 1GOTA 1IM2A 3BS4A 1XLTA 3GRCA 2X2OA 3SBEA 3WYGA 1TQ4A 1FBTA 5F1OA 5CT9A 3GAFA 4RK1A 2EG5A 1CUFA 1RCTE 3T95A 4Z6KA 3SS8A 3R0VA 4KDEA 4RSMA 4ZI2A 4HWOA 4F3CA 3IAS1 4RD2A 4RJLA 1Y42X 3QVSA 3WLRA 2ZB3A 1SUDA 1TU4A 4LY6A 4YCJA 4BFLA 1AC5A 4M53A 4BFUA 3E2MA 1YIAA 4EW6A 2DETA 1JDTA 2G70A 2PU5A 1ONPA 4DMLA 2QAGA 1KMIY 3MWKA 4DV4B 4LYGA 1FFXB 3HLKA 2JHGA 4H3VA 5IDVA 1Q77A 5FKJA 4DRZA 4UHEA 5I48A 2C7RA 2D1FA 4DDHA 1P4HA 5FPQA 3TEMA 4B7CA 5FOVA 4JSTA 1HPLA 2PSHA 1HFKA 4B6EA 3T5DA 1NVUQ 5A71A 3RUCA 5IJZA 4LOHA 4IIHA 3CNLA 2BBWA 3A9TA 1R2QA 3O4JA 3UFXB 3IOCA 3QU9A 5CLHA 1JAYA 4MV0A 2JLXA 8LDHA 1OBFO 2WU0A 4D5EA 2BV3A 4AY6A 4LJ6A 1IXSB 3U26A 2Q1WA 2W4MA 3GCGA 4M0KA 4B3CA 1OBCA 1E3SA 4LV6A 1QV6A 3Q6MA 2BFNA 3T1QA 5GPBA 5J58A 3I0MA 3WISA 3ZE1B 5DNCA 4U02A 1VCNA 1G2OA 1L5LA 3VV3A 4DUGA 4E2XA 5A4DA 1NW6A 2B69A 5BSMA 4RD3A 4Z8YA 1TZCA 4OL0A 1USIA 1WXGA 3L8HA 4HAYA 3ITDA 4LX8A 2QN6A 3IUMA 5FJIA 5IYZF 3SG0A 4C5BA 5IYZA 1V11A 4RTPA 4D4HA 1U99A 4D1YA 3OM1A 4YAIA 1N9ZA 3H8VA 5BYKA 4NABA 2OV8A 4PLVA 3ZLVA 3OQPA 4DPMA 2FXIA 3ETJA 5DNYB 4FJ1A 3KEQA 2QHXA 5IX8A 4A8JC 1WUYA 3STWA 2Z9CA 4WFIA 9MHTA 5DX8A 1T2AA 1E99A 2PKQO 1X14A 2KWIA 4JI8B 1KEVA 2Z09A 1NDUA 4Z8XA 3K0AA 1G6HA 1P60A 2V6IA 5DNVA 5CW2A 4BRUA 4YRNA 3FKQA 1L3BA 3CF4A 3MTQA 2ZE8A 2P11A 2RAFA 3MJ4A 1SEPA 4KIJA 4ND6A 1ZU5A 1EZ4A 4G89A 5JWHA 1IHDA 3A0UA 3O5AA 1L5SA 1JDBC 4L7QA 3G0HA 3GL9A 2VUTA 3COYA 4GLOA 1ZGHA 4E2FA 3NWOA 4NQZA 2A30A 2QT0A 4QYWA 5EXPA 3KUXA 4MI9A 5FUBA 4NK5A 1JJFA 2QRJA 3NQ41 1GYPA 2QT1A 5CEJA 4ND8B 4ADSG 4M8KA 3FVQA 4MCHA 2VK4A 1VRVA 3OJFA 3BEDA 4G26A 4LRXA 4YX9A 5KHOC 2Q5FA 2B4RO 1JZQA 3PHLA 1JDUA 2JI4A 4B44A 1K68A 1Z2OX 4MHOA 2CEKA 3KJIA 1KL7A 4IEIA 2JAPA 1AQUA 3CE9A 4BFCA 3H5WA 1H85A 5TEWA 5JIBA 1Y0BA 2AEMA 4G63A 2AX3A 4H4CA 1YB1A 2W2XA 5J2TB 1MV8A 4YCNA 2G8LA 4F86A 5DGIA 1QUFA 3K70C 3HKCB 5A3QA 1JIQA 3KVVA 3MRXA 1BDHA 1RHJA 2GLTA 4QT0A 3CG4A 1BEUB 3D6FA 1G21B 1FA9A 1RT9A 2UVQA 4I2VA 5LLTA 1LWNA 3V4FA 5FCDA 4ACAA 4OLBA 1V0JA 5TF0A 2V4ZA 3GEEA 2OBXA 3OZXA 4FZ5A 4JU9A 3OWOA 1P5JA 3ND9A 2GCOA 3JSXA 2PSJA 2HPZA 1LS1A 4KSCA 4NXMB 1XCMA 3JYLA 4P6VF 2H1LA 1FCJA 2L18A 2DFDA 1CPYA 4D57A 3K9WA 2JCXA 3NVMB 5DU2A 3L1VA 3FH0A 2DPLA 2RAUA 5K3CA 1UBFA 4E2WA 1SRRA 1YHYA 3H5VA 3JVDA 1XCOA 2GN9A 3TRIA 3UHAA 5C52B 3C1TA 5CCXA 1KJZA 2N9UA 3TI7A 2YWRA 1AUQA 1ZEMA 4BU1A 1K97A 1I94B 2JZOA 2HIHA 1UK9A 2OENG 5E4JA 2VT6A 1R0RE 3LXMA 3KUDA 3OPXA 3AVTA 3B1YA 2X86A 4F91B 3STUA 13PKA 2I2FA 5ALNA 5TPWA 3REQB 2TSYB 3HGQA 4Y2JA 2OZKA 5A05A 1XVVA 2QLMA 3ABSB 3IOEA 2GJ8A 3P9KA 1NE2A 1Y4SA 4O25A 3T35A 4D9EA 4MKXA 3ZY3A 5IC4A 3GHHA 4CF7A 1OXMA 1S2NA 3EDOA 3AINA 3PEUA 3VSEA 1Z5GA 4B83A 4DIEA 4EKYA 3NZEA 2QS9A 5HGJA 5EA2A 3JD3A 5DGTA 2JHPA 1AGYA 3NT5A 3Q3JB 4UUNA 3UPDA 3RC8A 1V5FA 4Q18A 5BURA 1LK7A 2I87A 5BN5A 4RF3A 4R83A 4ZVLA 1R00A 1SOAA 5A2QA 3PBKA 3DCNA 2JGJA 2NXWA 2I1LA 4MGZR 3ZD6A 2IP1A 3ANYB 2UYGA 1JQAA 2WJIA 3H04A 4G0NA 5J2TA 1IQRA 3IVRA 3QSYA 2GVZC 3JQEA 3FLMA 1B4DA 2W93A 5C1BA 2I6QA 4F11A 2J07A 3T7TA 3IUEA 1YVEI 2ZYSA 1OAOA 2PQMA 3RE1A 4C6TB 1L5QA 3KJQA 2GYUA 3LLCA 2QSYA 3VSAA 3X1WA 1LKZA 5IS2A 4FCVA 4J0QA 3HYRA 1C4OA 2ES4A 1R6XA 3ABZA 1XRSB 2Z5GA 2PNFA 3FFWA 2O2SA 4JUAA 4K0RA 4RZSA 5AI0A 3I5AA 3UJ9A 3VVBA 1T2DA 2Z8YA 4BNMA 3RVQA 5FTMA 3UKOA 1R16A 1TK9A 3O75A 1OV4A 4DDWA 4UNRA 4OG2A 2W6IA 3WNVA 1XK6A 3S6JA 1HKUA 3OJOA 1BS2A 5FTWA 1CIPA 1U02A 2BMAA 5IFLA 4D25A 5A0TA 5IAJA 2BFDB 4XRRA 4HDQB 2QVLA 3HZZA 4NMMA 2C5HA 2E4ZA 2MYPA 1NYQA 5CD9A 2PDAA 3TRKA 4HSGA 2WF7A 5IFKA 5ENVA 2C03A 4OP1A 1QHHB 4PYKA 1CP3A 4RF4A 4X93A 3G6KA 3CLRD 1KS2A 4LZAA 4DSOA 3VBCA 3IODA 2V3VA 3MRSA 5BN3B 1HSOA 1WZCA 4FS8A 3I34X 2OM2A 1E2KA 4KVGA 4S04A 4JJ6A 1VSVA 1WVMA 1FSFA 2FEAA 5JAQA 5A7GA 4R0MA 4TSFD 2QV0A 2QPLA 1Y6RA 4OK3A 4PXAA 4RQAA 2RHJA 4ZGWA 3PNPA 2CNLA 1X80A 2OAGA 4JLAA 2X0EA 1OFUX 1ZN2A 5A5EA 5DYYA 3Q7RA 5EWMB 1M7HA 1T3ZA 1ISJA 4BYMA 1GQQA 1XGKA 2WTMA 2WB2A 5SYNA 1NM5C 3SZRA 1GKIA 1UXJA 2PQ0A 3OUZA 3CT6A 2ZU0C 4ZHQB 3KZMA 2R8OA 3OE1A 3OEWA 3VDMA 3BB4A 4X1YB 1T9KA 1U9IC 1PL8A 2C54A 1JLSA 2ZT7A 4MR7B 3PK0A 2XR1A 3RYHA 1NYLA 2XNHA 2XMPA 4JNCA 3WKDA 4QLBA 3WGIA 1H4VB 3N2NA 3OEHA 3QITA 4KXNA 4WNYA 1EFAA 1ABFA 1U3CA 2PSDA 4TTRA 3STXA 1VJDA 2GHQA 3WZ2A 2JKYA 3KBBA 2TMGA 4HMOA 3DMRA 1ULSA 4QUGA 4ER3A 4G5OA 2J3MA 4WZAE 3RIHA 4IDFA 4F4JA 2HA7A 5LYJF 4G9GA 4UD2A 4FIDA 2DC1A 1DUIA 2JBAA 4AS3A 1U28A 2WWGA 1MO4A 3M7IA 4RNDB 4LYYA 1F0KA 5EVJA 2Q1YA 3B3QA 1I2CA 1LA2A 3D7KA 4GMGA 4YJHB 4K6HA 4C76A 3UF0A 3FOCA 1X7YB 1I1QB 4P38A 3RUDA 1T29A 3ZWCA 2G07A 1O95A 2BSAA 2BVNA 2ZBUA 2IU3A 4AF8A 3VHQA 5BSVA 4US0R 5BSRA 1JFLA 5F1PA 1Y4AE 3NM4A 4CIDA 2VF2A 5FRDA 3RFUA 4QFBA 4LHVA 4ZMBA 5EJ9A 4YACA 3TMKA 2VHQA 5BXQC 1V3UA 3V1NA 1DAGA 3DZBA 4OJYA 5EKTA 4TV9A 3TCKA 2G17A 2ODPA 3ETEA 3F2VA 3CUTA 3GLVA 3G49A 4RMNA 1LF5A 2CHVA 2GCNA 3OIDA 4ZVMA 1FYXA 2VJDA 3NH9A 1XUOA 2MOKA 2UUCB 4NV3A 1P4JA 2C9BA 2CJWB 3TMAA 3ESRA 1KZGB 1PWHA 2X9QA 4NJOA 4ZQGA 4DLNA 3WXMA 4BLVA 3PICA 1BFKA 2R48A 2WUWE 4D81A 5ADVA 3ZQ6A 2FPIB 1UIRA 3RADC 5HILA 3ZEAA 3T5GA 4RE6A 2YWXA 3AIKA 1XD2B 2GILA 4YRPA 4NEHB 2YN2A 3CBQA 3FJOA 4OH1A 4E09A 3JR3A 1ZUNB 4GRAA 2BR4A 4YP0A 4HX5A 2FSHA 5P8WA 1S9HA 3A6KA 2DUMA 3CR7A 8ADHA 5JTUA 1CR4A 5DM4A 4NHOA 4B2IA 1FRNA 2TECE 3LA6A 3PQEA 4NR0A 5TS2A 4M87A 3ELWA 1BH2A 1E66A 2DECA 2IU6A 3MG9A 1HE3A 3NJ8A 1T8YA 3C6MA 2HJGA 3HV0A 2CZGA 3P2YA 1D6NA 2A9JA 1P74A 3NO4A 4FPXA 3TDKA 4QO8A 3TYXA 3UG6A 1EUCB 4NE2A 3LUPA 3KYJB 1QRRA 2RI6A 3KU1A 4FLMA 4KLRA 4M86A 2BHLA 2GZRA 2NVOA 3PJDA 3ANTA 3FROA 3M1IA 3TIFA 4DG9A 2WAXA 5CFPA 5LIPA 3PFHA 1BCSB 1WQ4A 4WKBA 2HW8A 2JAUA 1WXQA 4ARBA 5CLJA 1Q19A 2F90A 1E62A 3K35A 2B4AA 2PUFA 2YOHA 2QTRA 4LZJA 1DEOA 2V7GA 1ZP6A 2BFEB 2QNRA 1CQIB 2JA2A 4YCBA 1IPHA 2O8DB 2OHXA 3EYWA 3AVWA 1E4EB 4ZMRA 3GK3A 4PCUA 4ALIA 4KMOA 4PSAA 2H3HA 4LHSA 4F93B 1YBVA 4BKPA 2C9YA 1Q0SA 2ZJ3A 2IPNA 2C77A 3K1JA 3AJ8A 3NHPA 3AHEA 1HFEL 1DE0A 1G8SA 2Q5IA 5AKEA 4KGZA 3NTLA 1XV5A 1Y9EA 3MCWA 1I7PA 3EQ7A 3FVVA 3BFPA 3ZZ1A 2XKKA 2C7GA 3D31A 3QKTA 4R98A 3MS2A 2I34A 3RK4A 2X40A 2WY2D 3HR7A 4EHHA 1G41A 4R0VA 4US2R 1GTSA 1T35A 2HNAA 1XXHE 1JR6A 4D6YA 3ZGOA 1J2RA 3GT3A 4U8GA 3HJCA 2E18A 1PJRA 4J4BA 2OPBA 3ENNA 1CJVC 1DTSA 1R6UA 2D7JA 3BRWD 3KAKA 4N41A 2WTUA 1HNWB 2P2CA 2YYAA 3L6CA 2HSWA 2W2MA 3TFOA 4DR7B 5FV4A 3TM5A 1XPUA 2VSNA 1IIBA 3ZHQA 1ADGA 4BVJA 1ZJ5A 1QIMA 2PUAA 1GPYA 3O4HA 1BYIA 1MD9A 3OZIA 2X3UA 4ZA2A 5AK6A 4XR4A 4HGRA 3UAZA 5C53B 3TLGA 3BERA 1OZHA 1SXJC 4ZD6A 2DLNA 1HEIA 3TKYA 2HK6A 4ZVTA 4ZYXA 4PEVA 4XZ3A 2FKAA 3IYLW 3TNYA 4E5UA 1L6RA 1VYTA 2XI4A 4YAOA 5F7OA 5JSKA 1VL0A 2LD4A 1ECJA 3BMQA 4UFNA 1Y1QA 1ESNA 2CUKA 3GLUA 4NOMA 1QCDA 1CYDA 2J9GA 3T7KA 1TLLA 4IMRA 2WUEA 5B4VA 1Z0ZA 2UXBB 2ZS9A 3HY6A 1ZX1A 4N6OA 3FHJA 2B5WA 3IAM6 2AC2A 3T9EA 3PFBA 3UJAA 5IJ0A 5FWAA 3TZLA 5FPTA 1SG0A 1KI1A 4ODIA 3TIGA 2OPHA 4KO2S 1XRJA 1B2LA 1KVRA 3S2SA 2YFKA 2WWWA 2H2HA 1TX4B 4QREA 3H84A 1A95A 3IOYA 4OYYA 4A7PA 3M4NA 1VPEA 4RKRA 3MD0A 4XWOA 2A94A 3AUYA 3E8XA 3F9CA 1JDVA 2WV7A 2BHRA 2IEAA 1ZMBA 4O2AA 5EMHA 3UMJA 3IEUA 1GTJ1 2ZYGA 5LJLA 1A88A 1NVWQ 1TF7A 3VYWA 3HA5A 2HJWA 1LF0A 3W3AA 2ZRIA 4HDSB 3LY5A 4IYRA 3R3UA 4LMAA 2CGEA 1ULHA 2FETA 2UZ1A 3INRA 5ERYA 5E3HA 2FWJA 3I9MA 4X7MA 1N0WA 3SX2A 2FHPA 2OBYA 4UBMA 2II6A 2J3KA 4OMCA 4KUEA 5IM4F 5AI9A 5A4KA 1NBHA 1FW8A 1ZVMA 3CIOA 1DJQA 1WP9A 3PC2A 4FGLA 4EJ6A 5HOEA 3ZLBA 4PPFA 4D3SA 4TV8B 4I4NA 3EVGA 3ZI4A 1G8JA 1XDGA 3U81A 5EESA 4JOQA 1VJRA 4JROA 4N03A 3PE6A 1C8VB 2QTCA 2IDZA 4NY1A 4ZOBA 4DDUA 1XKLA 1NQXA 3O73A 1W88A 4JT8A 3WDMA 4B43A 5JASA 3BSFA 4YAWA 4JVSB 2Z57A 3L9WA 1RWKA 2I3ZA 4D98A 1SKUA 2C3UA 5GWXA 4DR5B 1IK6A 4HHEA 4KQ1A 3PUIA 4JA2A 5CU7A 1UAAA 2ET6A 1QG6A 2B9VA 4RKEA 1XXHA 2R62A 2EXXA 2FZ5A 3HLYA 4GX1A 5J23A 3KP1A 2I03A 2IDJA 2R1ZA 1PNOA 1WABA 3PDWA 3UFBA 2NUPA 3UMGA 3WP1B 4C3VA 1Z5VA 2DTDA 4DNPA 1I7LA 1KWGA 3KG2A 1A9PA 3CLRC 3WLFA 5CB8A 2I8LA 1E2UA 3ESDA 1U0HC 4KN5A 4TTJA 1GZUA 3IV6A 3HDQA 5IH7A 3MT7A 3PHBE 2I55A 4MUFA 1Z7YA 4H59A 2SKCA 1YASA 3N70A 3RIEA 2EOAA 4R8SA 5TVGA 2FP3A 3DXFA 1SXIA 2B5OA 3DS8A 3U0VA 5LKAA 4KDCA 3PXXA 3ZR4B 3GQBB 3LYLA 4TL8A 3RASA 1RWOA 2IYQA 2JJ2A 5JD4A 5KU1A 2ALJA 5DHFA 4IWYA 4MV3A 4J2OA 3TXAA 4J1QA 5ITZB 2WQ7A 3VH3A 2PUTA 2GLXA 4U2CA 3F8SA 3L0DA 4TRNA 5ALSA 5SZHB 4G1UC 1KOLA 1JMKC 1GCAA 1PJ4A 2VBIA 4UCXA 5AICA 1H8ED 3EOZA 1KPIA 4EKIA 1SQ5A 2RHLA 4DCCA 3HTXA 5TEVA 3P2EA 5DN9A 3DHWC 2WKRA 3AY3A 3LUJA 4DIOA 4D3DA 2NV2B 5KNDA 1GU1A 3PGJA 1NSFA 2OA0A 3J7TA 2J3HA 3FNHA 2QUJA 5EOVA 2JFGA 1Y63A 5GMOA 5KQPA 1J39A 3WX0A 1JFFB 4B6PA 4IEEA 1YF3A 4LSGA 2OCGA 2NVUA 4LQCA 3GXOA 4MB2A 2ZXUA 2RK3A 2QYSA 4IJ5A 2Y2VA 2YRXA 5ABPA 2D7CA 5IWAB 3SBOA 3V8NA 4PVDA 1I2MA 2QAGC 1J00A 3DZIA 1ITZA 3ZE2B 2BW0A 2CXNA 1O8BA 2HDNB 5KSWB 2MHCA 1TU0A 3B3JA 3CF4G 4XE5A 3GFBA 4MP3A 2RI1A 1B3RA 1MABA 3HU5A 5TX7A 4CFSA 3DKPA 3PITA 4CI9A 1JUDA 2OKCA 3RV4A 3S2UA 4B47A 1QZTA 2Z8YM 4C4TA 4YWHA 3JQAA 2XA2A 4AW9A 2H6EA 4NNOA 2V65A 3CKLA 4RSHA 5JG7A 3OT1A 4PX5A 3MGKA 4G6ZA 1YJ8A 1XN1A 2HB6A 4PCAA 3J81k 5AUPB 2HU2A 2XQFA 1IG3A 5J2UA 4EG0A 2H9AA 3NV9A 4ZAXA 4F9FA 3K2QA 1Y7TA 3PFGA 1FVFA 3A9RA 1RI4A 1ST2A 1FYEA 1I1NA 1ZVKA 1TB4A 3ECAA 1W96A 2HXSA 3KHTA 5G40A 5BN1A 5JADA 1WCIB 5IT5A 4BVBA 3TN7A 1Y7LA 1PGQA 4TKMA 5EZYF 3W5IA 1G4HA 3FVRA 1QOZA 4Q0MA 4JZKA 1ODFA 2ACWA 1BNCA 2HA5A 2VWQA 2PGDA 3S68A 4YP7A 1DAKA 3ZX5A 4YWJA 1B43A 5DX1A 2ZIEA 3I0NA 3WWDA 5FF9A 2JIMA 4MWDA 2VXCA 3DZGA 5JS1A 5CG2A 1PR0A 1RWQA 1MC8A 2EATA 2YRFA 3P27A 1CY0A 2OCXA 4J94A 2WJYA 2WV9A 4UNQA 3X1ZA 4N7RA 1DXQA 4Y6OA 3UWKA 2OOSA 1C0EA 2EJCA 3A3NA 2EARA 5I4IA 1BDIA 3RFTA 1EWYA 1AK1A 1UEJA 4QA9A 4R31A 2RKOA 3AEXA 3KR9A 3JQFA 4GRIA 5LDGA 2IXGA 2E6KA 3O4GA 3PL1A 1D2GA 3Q1KA 3T7RA 3L92A 2C2WA 2JFPA 3U9TA 1WPXA 1JH9A 4KLCA 4ESEA 1QFSA 2QX7A 1E94E 4ZQFA 1LNZA 1E7QA 5A62A 3DTVD 3Q85A 2J4DA 2WSIA 3GARA 5KQLA 3EEIA 5TR9A 1WDWB 4R1QA 4H4DA 2ZTLA 3NWPA 1VHJA 5CIYA 1LSUA 3DT9A 3OCUA 1P1JA 1R5BA 4PN3A 3TBFA 2PYZA 5H59A 3VJRA 3L4SO 2CE7A 3X1XA 3CUWA 4XM2A 2SKEA 2XODA 2ZIVB 1JQ5A 5CLFA 2OAEA 1DXOA 4FIZA 3C16C 4CKEB 1JEDA 2GZ3A 5LSAA 4BPBA 1YC2A 2D4AA 2XUJA 3ZXSA 1WB5A 4AF6A 1Q11A 4DQUA 1ZVJA 5K3AA 3M5CA 3U7FB 3ANSA 4HPXB 3RQIA 3WGGA 4S1NA 1OR8A 1QYRA 3H5OA 4AMUA 3CLSC 1CUXA 4E7PA 4WJZA 4O0MA 1M2FA 3STVA 4BB6A 4JV5B 3EZLA 1IN8A 3JQRA 3UUWA 5GTDA 2CLHB 4FMCF 5CFZA 2EW1A 4PC7A 3LQ4A 3NBKA 2ZI4A 4C0WA 2KYRA 2GM5A 4U9IS 4IH1A 3RRJA 3UAXA 4Z3KA 1PBNA 2IXAA 4IHQA 4NBWA 4MGKR 2A1TR 2ZRBA 2ZWIA 3IT3A 1WULS 4UVHA 3RVLA 4AWBA 4AS1A 1A8SA 2BJWA 5ECWA 4TS3A 4YXWD 1QGUA 2EZTA 1PG0A 1ESDA 4LJ5A 3IURA 4WXYB 2IPMA 4X71A 3P2KA 5SZKB 3RODA 3TRJA 1GM5A 2BH2A 1II8A 1M2JA 2J6BA 3JCZA 4HR7A 3INNA 1CS0B 1IY0A 1CRQA 1XBTA 1XMVA 5ALZA 4ZO8A 6NULA 4OHZA 5KTPA 3B70A 1N6HA 1CWUA 2H7VA 2WILA 3D4OA 4QGAA 1H2RS 4LZPA 3SQNA 1VKRA 3U3DA 4A15A 1HRKA 4LDAA 4DMMA 4IXTA 4JKOA 3N5KA 3GJXC 4R3NA 2G1AA 4DMFA 2YHIA 3T6KA 5KKCA 3S2EA 2YQZA 4FM9A 3ZE6A 3VO2A 3HBMA 3LHKA 2GERA 5HIJA 3ADCA 2WYUA 4K1XA 1S2MA 3IQIX 1DGQA 1L2TA 1YSCA 4MYDA 1T1GA 4R7GA 3TRFA 1HV8A 3FGNA 3N07A 4OX9Y 1U65A 3RTDA 1NP7A 3GI1A 4YP9A 4Z99A 4DR6B 5AKJA 4Q00A 3FGOA 1T0BA 1ZZEA 4NFHA 3U3MA 1S2GA 4DNOA 4YI3A 1CRLA 1D8AA 4P32A 3GRAA 2HQOA 2J4CA 4BUZA 5KTTA 1XVAA 4LE0A 1MDBA 1MB4A 3BHMA 2Y4NA 2FF5A 5FLYA 3ZY5A 1DCTA 4LISA 4NU6A 3CW8X 5K8IA 2EBUA 4QRHA 2GJ9A 2Q6VA 1J0DA 2AC7A 4IKEA 4MRNA 3MMNA 4EUSA 2YDYA 3JWGA 3LO5A 5DM0A 3OA2A 4LRUA 3AKZA 4YXFA 2E89A 1G6Q1 5L40A 4X5OA 4M7WA 4GZLA 1HEYA 4MA4A 2EBFX 3KQUA 3GEGA 1ZM3A 2RARA 4E11A 4FB4A 1COZA 1J70A 2AN1A 2O48X 3AOEA 1FRZA 5G41A 3BZUA 3WNBA 4I6JA 2RGGA 3I9FA 3NHLA 2A92A 4EM6A 4AI6A 2B20A 1N6IA 3ACDA 1G5RA 2FWBA 4WW0A 1IRXA 2GRAA 3UVEA 2YVLA 1VKHA 4TLAA 1FTYA 1CQJB 1ZRSA 3N7UA 4X1KA 2WNSA 4ZGBA 2I80A 1XWWA 1R6TA 2JIPA 3FF4A 3ZNPA 3OO0A 2WKPA 4QYIB 4J6EA 4DC1A 1P6QA 2CLMB 3FCXA 1BXZA 5NULA 1FFXA 4XIGS 1C3OB 1HYHA 2W83A 3ET5A 3PNOA 3ZVMA 1RTTA 2HU7A 3WLEA 3GGCA 1MEOA 3K8QA 5L53A 1FBNA 4F21A 3LHDA 4CIAA 2G25A 4E1BA 3U5TA 1L9XA 1U9ZA 5C80A 3THRA 4HB4A 1EX6A 2WHQA 1KEZA 2K5UA 3OEYA 4O2AF 1SXQA 5AKZA 3U1TA 1HLDA 4PG7A 3BFVA 2D8MA 4ZMSA 3N2GB 3W8EA 3L18A 2WP8J 3PTAA 3FVTA 5LA6F 4CV2A 3W5BA 1AGRA 4B32A 3GJSA 4PLTA 3SKVA 3P19A 5JOQA 3R7AA 3RKRA 1MT0A 2I0FA 1P9LA 2P4HX 2O9JA 4FNGA 1WM1A 4GKAA 2ZSEA 3DWIA 4H7DA 5F2NA 3HCRA 4EGCB 4YV7A 3C85A 3I1YA 3KPUA 5EZSA 1P9NA 3ZHBA 4M9UA 2CBGA 3AP1A 1U31A 3D5QA 4P5PA 5TNXA 3UC9A 1E9VA 1SPBS 4BZQA 1Y8ZA 2A1IA 1T43A 2QD3A 1NSYA 4H60A 4OXQA 2JZNA 4BQOA 2PXHA 4DMGA 2W37A 4M22A 4NCKA 3VDNB 2YMQA 3L46A 3A14A 4YP1A 3ZNQA 4PSUA 5ICFA 1N6RA 5JCPA 5JMTA 3TG8A 2JW5A 4G5FA 2ZVPX 2RGNA 4TRMA 2QDKA 4UULA 4OJQA 2NYUA 2EFGA 5EXDA 4DJEC 1U0EA 4J2HA 5B4TA 3W5VA 2NVBA 4WZBA 4EPTA 3K1YA 4O2BA 5BR4A 3D7MA 5HJ7A 4RY0A 4C43A 3DZKA 3LFHA 1KMHA 2COUA 3G8CA 4NYMQ 4BNWA 4O4JB 3M6LA 3GPIA 4RYDA 3EXEA 4HVAA 3Q11A 4TVKA 4BX0A 1CY6A 2PJUA 3DB2A 5BMVB 2VJMB 2Y0EA 5CK5A 3RF7A 1OFHA 1UBGA 3NTVA 2R8EA 4RTOA 4N5IX 2IHTA 1KNXA 2LGJA 3ICWA 4R1UA 1YFJA 3NAGA 1CSEE 3AYZB 2F1IA 1WZEA 2X0KA 2NZJA 3KXLA 2QX6A 4R9VA 3HMQA 3SFTA 5ADHA 5DEOA 1CQPA 3MWDB 2IU0A 1VLMA 1ZINA 4ARAA 3SPXA 5BWMA 2G5TA 5EWLA 2WIJA 3L40A 3F3SA 5CJPA 5D6NA 3GFSA 1BMFD 4JQZA 2NOAA 2RBEA 4KBGA 4XYEA 1UIMA 2J5XA 2OG2A 5U1PA 3TW0A 1R15A 3W2IA 4P4LA 1W75A 2P75A 2SCUA 1P0QA 4TYMA 8AT1A 5JNVA 4UATA 4FYHA 4CR8A 4PXYA 4A5SA 2HMSA 1EFRA 4WBNB 1HM5A 2XDYA 4URUR 1W2WB 3X1KA 3T0IA 3ORYA 3V4RA 3TD9A 1AF4A 5KAPA 4AX8A 3LGAA 3X1DA 3MSCA 3DC7A 4YV0A 1X7GA 3TTXA 4OVKA 1R0XA 1DJPA 1NDQA 2ZRNA 3ZY4A 1JYSA 4OHKA 3E7DA 2A0YA 3T1TA 3DMNA 3FZEA 3JYOA 4ZV9A 2A35A 3FM9A 2AJBA 4PAWA 4UTNA 9ABPA 5IKPA 2YJGA 3DZDA 4PZ0A 3DAHA 4D9GA 2FA9A 4L4SA 1TADA 3A1UA 3T7JA 3WG9A 1FDOA 1CUZA 1Y1LA 3JS5A 5DM2A 3IUQA 4OUDB 4ARCA 1Q14A 3H1FA 3TGWA 3GMSA 1J1IA 2FW0A 1JIUA 4FLFA 5K6AA 5IT0A 3ET4A 1YR8A 5JZ9A 4YY3B 3I52A 1QIHA 1UDWA 5F9MA 3TL3A 4YH1A 1P1IA 3CEJA 1EWVA 4MW2A 5CMLA 5DK4A 4OPMA 2VOJA 1O94D 4JVOA 5FOSA 2ODQA 2B25A 2IL1A 3H6GA 4AMZA 1VJ0A 1HGXA 1ZXLA 3IO3A 5IC6A 4WBNA 1AB5A 3NWBA 3L1IA 3I8OA 3R9XA 1Q5PA 2J3EA 4IDCA 3EIWA 5H0IA 1RABA 2JFUA 4XD2A 2YHBA 2AX4A 1OV6A 1PYDA 2VJOA 4RIEA 3AHDA 3DZHA 3RTCA 4B1FA 2OD7A 1MX3A 4OGKA 1J9EA 4AUMA 5BSKA 3UKJA 1I9CA 1DOHA 3UKDA 1FJHA 3A2KA 1DRVA 3GZNA 2JCYA 1Z62A 3I8XA 1YGPA 5D3MB 4LRYA 1G3UA 2DERA 3A1CA 3L04A 2PSFA 2VT2A 4HDKA 2UVPA 1CUCA 5I7EA 1KHTA 1F7UA 3C87A 3QKWA 1TFUA 1ZMRA 2DU8A 2VYVD 2NUAB 1Z88A 4TX1A 1FDRA 4B6OA 4DV1B 5HEKA 1SOWA 4BBAA 5HYVA 2GFQA 1FQJA 1QRAA 3FMGA 4KFTA 1L4UA 1ADFA 4BMDA 4QG3A 2V7XA 3F6CA 4HGYA 3PENA 3WGHA 2HRCA 2QX4A 4JJGA 2V74B 2W2PA 5FJJA 1F8GA 2XLCA 3NTRA 4IX9A 2GEJA 2XMDA 3PA6A 3K1AA 3ZU5A 3C7CB 2IQIA 1PZGA 2VQDA 4OXYA 4XXHA 4QFCA 4DT1B 5FEMA 1EBFA 2O2IA 1G0OA 1ZJYA 4Y18A 4AJ9A 1LPBB 5I9TA 4H6VA 2FPIA 2WF8A 3PHCA 1OLSA 5LFAA 4Z0PA 2XBUA 4WOCA 4PPYA 5DTRA 4DUYB 1RM0A 1QGYA 1JJBA 1ZR2A 1JKJA 1L4NA 4KFCA 1AQ6A 1SKMA 1NMXA 1OHHD 1CR6A 1LRKA 2B8NA 3ZBQA 2O8BA 4P3NA 1UPXA 1JH8A 5HRUA 3GFGA 1JIVA 2VPYA 4B82A 4B3IA 1X7DA 2MMGA 2Q3HA 3MINB 3TDNA 2A0KA 4AKHA 1F1BA 3NPAA 1OB2A 3QXCA 1OGYA 3PXUA 5CFMA 1Z4MA 4PICA 2ZDHA 3EF0A 4Y1GA 4EIWA 5AHWA 1QIKA 2J9FA 2O2XA 4RHXA 4FCWA 2Q3FA 2OYRA 3IEVA 1Q44A 1CC1S 1RHRA 3DMPA 2H1WA 5E2BA 3AR4A 1DG1G 1XZNA 4J1TC 4GM1A 1JJVA 1WUHS 3EGWA 3SQMA 1OX4A 1NVTA 5G1PA 9GPBA 1R3UA 1W94A 2H2GA 1JV2B 1SNYA 3HS3A 4G85A 3SI7A 1M1NA 5K0SA 2H31A 4BY9E 2J0SA 3KB6A 5ES4B 1YZKA 4R1NA 1I36A 1YWGO 4ZVRA 1H69A 3KAPA 1M7GA 4LNHA 3TKLA 4COOA 3G13A 3CSUA 5J4YA 1PSWA 3BGIA 2G7MC 4OJKA 5FOWA 3PNVA 3V4ZA 1PK8A 3OZCA 1GJRA 2ZYDA 4E5NA 4HKTA 3MT8A 5TS3A 1YIOA 5ED4A 3ELYA 2CXPA 2QORA 1G19A 3V4OA 2VWPA 4WN3A 2HQSA 4BLSA 4CL3A 1KY4A 2XKAA 4IIYA 5K6RA 3NEJA 3OQNA 1DIBA 5ES3A 3U4CA 3H1PA 1EXMA 2ACKA 4FHDA 1GA6A 2NSYA 1YZTA 3DVLA 1DC3A 4PRLA 1T9HA 5DLEA 4QLAA 1W1UA 3RC1A 1QGED 3FPAA 2AE2A 4TKLA 1OI4A 1T5SA 4L28A 4M0LA 5CB4F 5HIKA 2IHNA 4CL2A 5HTKA 3ZHZA 1KI7A 2FWAA 2QY6A 3ESBA 2D74A 4GNKA 4J6FA 3V8RA 1VTKA 3IIIA 4M99A 2PS9A 2QUBA 3C4JA 5IBPA 1WIWA 1PUIA 2P0YA 3UN1A 1BXGA 2ODWA 1JKJB 1ZH2A 3B3AA 2BEWA 3DBLB 1M72A 1EXNA 1H5QA 2YOGA 3EVZA 3UJ6A 1XNRB 3V4SA 1ST3A 4RPHA 4EL5A 2XGGA 1J8DA 1UFOA 3RARA 1Q0UA 2ACEA 1CF4A 4BBJA 4PLYA 1RAFA 3BILA 3FYSA 4PZDA 4G97A 4NFYA 3OE5A 4KVFA 5EIAA 1CQZA 2C4HA 1W36D 1J2EA 4GYJA 3ZYCA 2J9FB 4ZCSA 4JYZA 4I46A 1R6DA 1UMBB 5GGYA 1RXVA 4DLPA 1DT3A 2Y0DA 3A1TA 1KTVA 2ZIZA 5TJHA 2BEKA 3AXTA 4ZKDA 3PF9A 1ELOA 5JT1A 3KKOA 1ZQ9A 2AOUA 1AUPA 3P45A 7MHTA 1G5PA 3ZDBA 4N1AA 1U8TA 3OFKA 5KNCA 3GA0A 1EHCA 3IDAA 4RFLA 4TKUB 4LTDA 2QJFA 4UD6A 2WHYA 4GEKA 3EXG2 3OCVA 5FOTA 1II9A 3K15A 3DLTA 2NUBA 3A4IA 2FPSA 2FSVA 4RZ3A 3SEAA 1A98A 4I1UA 1JAIA 4L5CA 5IN4A 5GJWC 5ITSA 4NENB 1S1CA 3D8NA 1KI2A 1S5PA 1QWOA 1Y3IA 4C7BA 1HOTA 1U7TA 3T3EA 1J22A 2OP0A 3V55A 3RT9A 1RXCA 4YROA 3WKBA 1REQB 2ZUSA 3LC2O 4RE5A 1ISGA 3OIWA 3LX4A 3EW7A 5FUMA 3WGOA 1KOFA 5AVSA 4AUNA 2XOKA 3I2HA 1TE2A 1Z0JA 1Z7EA 3G5TA 4P35A 2F6RA 1F2DA 3HCNA 3I01M 5G0SA 5K05A 2GNAA 2W2NA 5L3RA 3CGGA 3ZWMA 1DO0A 4M83A 2H0QA 1YU9A 2CC2A 2XCQA 1FP2A 4Z9AA 2C84A 4EY5A 4IDHA 1DINA 2JLAA 4EHBA 3I9NA 4I36A 4PC6A 4CGZA 1ZL0A 3CCCA 3DW3X 3HVIA 3JTMA 3K9LA 4JMPA 4LHYA 4O4LF 1TUBB 4UUQA 3TLCA 5TV2A 1K3UB 1JXQA 1O6ZA 3RVMA 4GOND 4BECA 3B78A 4EJSC 4F5DA 3C39A 1E69A 3K09A 3GCWA 2VPZA 4W5HA 1YQXA 4GUAA 4WCVA 2MCFA 3QK7A 3V34A 1QDUA 3EIUA 5JEDA 4WJKB 2Z6QA 2FNAA 5TPZA 2ZJ1A 1DOZA 1S9DA 2P79A 3O3NB 1AOXA 3MM4A 1CVRA 2OGZA 2VP4A 4PYNA 4CTOA 2ZE7A 5F3WB 4HNUA 3IR6A 2PMBA 4JX8A 2PJRA 4LOJA 1FFDA 4IVQA 1YKFA 3IDQA 3Q7QA 1P45A 2LW7A 5BT8A 1YHNA 5G0VA 2ZRKA 3RLIA 2O57A 2C42A 4AN4A 3H19A 5EJ6A 1PZXA 2O0JA 3DHYA 1V5GA 3TW6A 1E61A 3H7IA 1EINA 2IYRA 2P1ZA 1N5RA 2J5RA 2O20A 4UU7A 2FZLA 4GM4A 2PTGA 3H13A 4YAUA 2QMUA 3EQZA 4NKRA 3VNUA 5JATA 1YZVA 2PL1A 1NZFA 4I8IA 2DH6A 4JNKA 4OMUA 4RTSA 4B73A 4HDRB 2FK8A 2P1RA 5F51A 2QJRA 4P7FA 3CJRA 2HWWA 2QMQA 3GJ7A 1GILA 3HJGA 2DE0X 3M1AA 3N6RA 3I9OA 5HFAA 3SZOA 4HQ6A 3K9CA 1L4BA 1P61B 1K7SN 1G17A 1NG1A 3HBAA 3PGLA 4HTFB 4PIVA 5FTNA 4BN5A 4HT3B 5CUQA 3AEZA 1A9TA 2R4QA 5INTA 2M2IA 4QODA 3SYKA 3ZTWA 4L3WA 4MS4A 4CEJA 1LBSA 3B48A 1RLOA 1OBOA 2EJTA 2ERXA 4U00A 1BXRB 2VXOA 4BE4A 2XNKA 1TOAA 1MO5A 1EWTA 4O4JA 3F9IA 4RLFA 3ZS8A 1EBBA 4OATA 5KOHA 1JQLB 4NLLA 3PHGA 3RRMA 1GQRA 1HI9A 3KZKA 3TQOA 5EUMA 1SC3A 1XJWA 3C0KA 1HEUA 3WL8A 4BX8A 1CY7A 4DWOA 2EFJA 4IOJA 1YI0A 4EKEA 3F5QA 2J6IA 2SICE 4PYJA 1BN7A 1TK2A 1OTHA 1YR3A 2XUFA 2NU9A 3TXYA 1J97A 1DCMA 3L5KA 4QZVA 3MLAA 2WJ3A 3AKCA 1E1RD 3HDYA 1GGFA 4LDNA 5AJYA 5FBZA 1PWZA 3AZPA 3U3JA 2QRHA 4UHBA 5EE1A 1KYYA 4F38A 4XVUA 2QRLA 3GIDA 3EPRA 1BC5A 2X2EA 1T4MA 3O3MB 2SKDA 1T24A 2LDXA 2EIHA 4ZO7A 4DT1A 1QQ6A 2YIMA 3D43A 3D4BA 3JQCA 4AY3A 5FYDA 4YPVA 5FWXB 5ALRA 3WK9A 2PV0A 2GR9A 2R751 3IL2A 1XKTA 5B3JA 2CFOA 5JNSA 2FRVA 1KYXA 4M1OA 3JR7A 4E07A 4MVXA 4OHYA 4PZLA 2PX8A 1PG5A 2HA2A 3VHXA 3O1JC 4EFLA 4GG1A 1BGVA 1WAMA 1M0SA 2A9PA 2FFAA 4Y1FA 2NTNA 1U8XX 3LT1A 4ZWNA 2QX8A 5AQ1A 2PGOA 5M3BA 5TMPA 2Y99A 3PXAA 3IUPA 4EMSA 1IDOA 4IFTA 2ZZKA 1EQAA 3KOZA 3DYBA 3BDIA 4HBGA 1KS9A 1DQZA 1PJ8A 4NOLA 4XOIA 5D8DA 3USZA 1LPSA 3WNCA 5EERA 1A9XA 4M9ZA 4OBBA 1TL7C 1XU4A 4FUTA 5JECA 1N78A 3KJNA 2REQB 5C37A 2HA3A 4QD3A 1SBZA 4MUEA 2D0DA 1DIRA 3HUTA 1E9DA 3JU3A 4OL9A 3AV3A 4JYCA 1Y8RA 4P58A 5LQAA 4BL5A 4OGLA 2A88A 2V1UA 3AHHA 3T4UA 2QYTA 2XNDD 1M2WA 4RQUA 2IH5A 3NBQA 2WF6A 3W5DA 1I0LA 4ZOLF 4Z0NA 2NQ2C 1NBOA 1Q0PA 4JYAB 1JI3A 1CUDA 4ZVOA 1DAIA 5CK4A 5AP9A 3FTPA 3BQNB 5A3VA 5KS2A 4L8LA 4CQMB 4JB0A 2YY7A 4DBLC 3RFCA 4CEHA 3WGMA 1KIFA 5E4YA 5AH0A 4URHA 1A1VA 4KXXA 3VR5H 2ZB7A 3C1UA 3DOIA 3JQAD 4M7PA 3R7WB 3WL4A 1C80A 3H1AA 4UVDA 1ZGGA 3H86A 1MOSA 3L43A 4LJLA 4UM7A 3EF1A 4X41A 2FR0A 2V7VA 4HGQA 4R8MA 3DPIA 3G2PA 4CV3A 1P6XA 1GA4A 1VZ3A 2YZGA 1SBIA 3EMBA 3MS4A 4JXZA 1FC0A 4CDNA 1PKEA 3BULA 1M5TA 1VCOA 1X7WB 2XTMA 1EH5A 1BXKA 1YS7A 3GLRA 3HB9A 5A5DA 3B1FA 2QBYB 1Z5PA 1MZPA 4QBHA 1ZNWA 4DCTA 1GZVA 2GTIA 1QH9A 2O4CA 1K0UA 2HZ7A 2W9XA 4RA9A 4D0GA 2VYCA 4D9CA 4PV7A 5AI8A 5AXAA 1E1KA 1M0TA 3TSAA 3IUNA 2PKCA 3VU3A 5AVTA 5KTYA 1USVA 3RC9A 4B0OA 5IANA 5J1SB 2JVIA 2P40A 2VHTA 5E7IA 3NKLA 1TUIA 3GCXA 1CW2B 4I4IA 1OUMA 2AFRA 4TV9F 4DLAA 1NOJA 5BSUA 4W6QA 1EXDA 1Y1PA 3FRIA 4U7WA 3BKXA 1Z82A 5HUQA 4I1SA 4WGGA 4X1IA 3OQIA 2FUNB 4J2TA 2Q7OE 4HUTA 1YZHA 4GGPA 4HLNA 1RHMA 1K4KA 2AXNA 3E4CA 5BSWA 2R44A 2ZR8A 2HT1A 3QELA 4TZKA 1IN6A 2GHTA 3IBYA 1TD9A 4N8SA 4ILEA 4MJ7A 2ZJ0A 4K6OA 1EGAA 1NSTA 1WV0A 3NLLA 4O4HA 4ZP1A 4ARSA 3K9GA 1SZJG 4MHSA 3W1WA 1GUBA 2ZETA 3ND7A 1WTCA 2VA9A 3WLSA 1R0KA 4EO9A 4Y6LA 2QR5A 1C0PA 2IYEA 1RWVA 4U63A 4X62B 2YUIA 3L93A 4GSLA 1TQ8A 1NBIA 5KVCA 2I22A 3TF5A 3QSGA 1RMTA 2N42A 3KB1A 2I4MA 3L8EA 4POAA 4JASB 1P0MA 1RZ3A 1VA5A 3KBOA 4ZCRA