4G0MA

Crystal structure of arabidopsis thaliana ago2 mid domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
SIVKHWAVLDFTASERFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Arabidopsis Argonaute MID domains use their nucleotide specificity loop to sort small RNAs.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
molecule keywords Protein argonaute 2
total genus 43
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g0mA00
4OATA 4RXUA 3LUKA 3LUDA 2IPMA 2VUHB 4MRMA 3KLNA 4RDCA 1DBWA 4F11A 9ABPA 2FN8A 2LIVA 2NUBA 5TE9A 4D6XA 1DCMA 3OLZA 1JH9A 1EAYA 3KKEA 5E3JA 4W5TA 4KPYA 3RQIA 3FFWA 3CKMA 3ROTA 1JFSA 3KSMA 3RVRA 4WZZA 2F8SA 3HK2A 4N41A 2I6FA 5GQSA 3EQZA 4Z4GA 2FXIA 1DZ3A 1VLZA 1C4WA 3K9CA 2FN9A 1VKRA 5FWYA 3CG4A 4G0PA 1MVOA 3VNBA 1DJMA 1ZVVA 3HXMA 1JFVA 4PICA 4P1ZA 4KNYA 3GT7A 3O1JC 1J56A 2WWVD 4G0ZA 4ZMRA 3D02A 3UK0A 4F3TA 2FQWA 3KHTA 5TQ2A 2LUOA 1ZESA 1DRKA 1L5ZA 3QK7A 2PLNA 3O21A 3C3KA 3LKVA 1ZY2A 2IDMA 4EGSA 4ETIA 1LBIA 4MS1A 3CLKA 4MS3A 4ZPJA 3QEKA 4YV7A 4QICA 4RK5A 1KGSA 3JPWA 1NXVA 1P8AA 1QO0D 3JY6A 4HYEA 4IMIB 5JNRA 1ZHHA 4MR9A 3I5AA 1OXKB 2PMCA 3FDFA 1JLKA 3FFTA 1U0SY 4S05A 4JAVC 4F8JA 3M6MD 5CHYA 3LUHA 1DP4A 1ISSA 1YK0A 4WXMA 4RS3A 5JNVA 2NT4A 2GI4A 4E7OA 2TMYA 1DG9A 3SQNA 4D74A 5FWXB 3P9YA 1E2BA 3IDOA 4Z9AA 2FQXA 3OQNA 3HJFA 5TQ2B 5T7BA 2JBAB 2W42A 3M9XA 3OO0A 4WXEA 3RH0A 1JYEA 3LMKA 5B3JA 1JWLA 3LUJA 2PUCA 4Z9BA 2R48A 3H5WA 1ZH2A 4KQCA 2QW1A 4QPJC 4YP9A 4MR9B 2E4UA 1Z16A 2LP4Y 1L5YA 2WY2D 1DBQA 3UKJA 2PUGA 4JOQA 3RVMA 3JS5A 4FE7A 3H6HA 4NICA 4IGAA 4KMRA 3SG0A 4RK6A 4ZJPA 4RSMA 2V0NA 2FMKA 1MB0A 3C3WA 1Z25A 2O20A 4GNRA 3RVNA 1KRWA 1YVUA 2HPHA 4F12A 3O2SB 1PNRA 1XHEA 2A9QA 3H5LA 5TQ0A 4TLLB 4W5NA 1QPZA 1BDJA 4Z4IA 1JFTA 3W9SA 1ISRA 1PEYA 4KK4A 1Z26A 4QYMA 4RWEA 3NNNA 4DADA 1P6UA 2M1ZA 4TMYA 4YR7A 4YRZA 2FMHA 3KS9A 4MLCA 5C5CA 3OLVA 4TLMB 3OLYA 3Q9SA 2JBAA 3A3KA 3MF4A 4LX8A 4MAAA 3URMA 4UHJA 3KG2A 1YIOA 4G0XA 2A9RA 5JNSA 4JASB 3Q41A 4H3KB 1U04A 3TO5A 5EWLA 5TPWA 1P6QA 1BA2A 1PEAA 3DBIA 2J48A 4MR8B 5FBKA 5TQJA 4YCSA 3E3MA 3OQOA 2FMIA 1M5TA 2LPMA 1WETA 1A2OA 1SXHA 2P9HA 3O1IC 4YLEA 5JS1A 5KQLA 4RY8A 1ABFA 5DLEA 3CG0A 2KYRA 5CNJA 4EY3A 2AYXA 5KQGA 3D8UA 3NHZA 4DQDA 1ZAYA 5EWJB 3LKBA 4LDAA 4MYRA 4RXMA 3IP9A 4N47A 4KVFA 3LOPA 3ROFA 3QLUC 4CBVA 1TMYA 1CHNA 3B2NA 2WMYA 2E4VA 4JA2A 3F6CA 4O1HA 3OLWA 2H3HA 4QYWA 3EJWA 4LE1A 4NQRA 1F51E 3T95A 2E4XA 1FFWA 3Q7RA 1NTRA 5T3YA 4O5AA 3N6VA 4OBBA 5CNMA 1JL3A 8ABPA 2PE5A 4PE5B 4ETNA 1LJLA 4TN5A 1MAVA 3RVQA 2YHAA 3I45A 3DLHA 1E6KA 2ID7A 3G85A 1LBHA 2B4AA 3O2QB 5JNUA 3N0WA 5DKFA 1RZRD 2OENG 3L49A 1EWTA 3LUAA 5JNWA 2B1JA 4RV5A 5TQ0B 3CRNA 5BRAA 1CEYA 4OG2A 3IP5A 3F6PA 2L19A 1FQWA 4G97A 4UHKA 4XASA 5KQMA 3LUCA 1PHRA 4RU1A 4ZMSA 3K4HA 4XLTA 4N76A 1ABEA 5ABPA 5PNTA 2JCGA 2JVJA 3MA0A 2P4UA 7ABPA 3S99A 3EODA 2FQYA 3JTEA 3CFYA 1SXIA 4IILA 1ZN2A 4S04A 6CHYA 3LFTA 2JVIA 4LE0A 3L6UA 2FLWA 3DGFC 1GUBA 3GYBA 2PUBA 3BBLA 3FMVA 4N03A 4KREA 2GBPA 1YMUA 2QU7A 1ZGZA 4MQFB 5CNIA 2H0AA 2JB9A 4YWHA 1ZITA 2XDYA 3MMNA 2WRZA 3RVKA 1DCKA 3DLBA 2QVCA 3QELB 4B09A 2R25B 2GKGA 4Z0NA 4H60A 1USIA 5IEJA 5TPWB 4Q6WA 4RK1A 3H5IA 3MM4A 5HM6A 1A0OA 2QV0A 1GUDA 4KQ9A 4KZKA 3NNDA 4Z4EA 3H1GA 3LTEA 3SY8A 1JX6A 5TPZA 4E7PA 1NXSA 3T38A 4YGXB 5FBHA 4MR7A 4LZLA 3T6KA 3H1EA 3OO1A 3GBPA 1FSPA 4RK0A 1P2FA 4IRXA 1URPA 4MLDA 5GOTA 2PJUA 1JHZA 2QSJA 5JS2A 2VUIB 4LDZA 2FEKA 4GPAA 4M88A 1Z12A 1JYFA 3RVOA 2E4WA 3LUGA 3RVJA 3GRCA 4EVQA 1GCGA 4G0YA 2CD7A 2QZJA 2MSWA 1TJYA 2RGYA 4Z4FA 4FE4A 1NATA 3HCWA 3Q7TA 1VPWA 2HQBA 4WT7A 2X7XA 5EWLB 1YTUA 2FKAA 1QQBA 3F7NA 3HS3A 4NV3A 1AB5A 4W5OA 1H9CA 1IIBA 4MS3B 3CHYA 2MYNA 2R4QA 2L18A 1Z2EA 1LJUA 3QX8A 4OLBA 4G0QA 3BREA 6ABPA 1DCFA 2FEPA 4MPTA 1W25A 5DGCA 3NBMA 5B3JC 2FSPA 1QNLA 3HDVA 2FLKA 3QEMB 2PL1A 1DC7A 3FFXA 1C0EA 4D6YA 1EWVA 3E61A 4MR7B 4RK4A 1JDNA 4PZ0A 1USGA 1QP7A 2L2QA 4RK7A 2E4ZA 5ED4A 1FFSA 1K66A 1NXOA 1S8NA 3GBVA 3QLVC 4XARA 5F64A 4JB0A 4DN6A 1ZDMA 3NHMA 2HSGA 3KYIB 3M9WA 3N8IA 1I3CA 4LE2A 5IBQA 4MQFA 5IX8A 2GWRA 5KWSA 1EHCA 3A0RB 1D1QA 2HQOA 5HKOA 1Z2DA 1LK0A 1TLFA 1RXEA 1E6MA 3QLVA 2PUDA 1D1PA 3F73A 3EDCA 4XAQA 1JDPA 1D2AA 1YK1A 3QX9A 4WWHA 4EYGA 5HSGA 1EFAA 4OLAA 2IYNA 1F4VA 4Z4HA 2CHFA 4OTZA 5KC9A 1Z17A 4MS4A 1BVHA 4L4UA 1SXGA 3CS3A 1Z13A 5BRJA 5C5EA 4NCAA 1USKA 1NY5A 2A9PA 2L17A 3JVIA 3GL9A 1XHFA 4O1IA 4RXTA 5I4CA 1QQAA 3H5OA 3ILYA 3RVLA 5DCLA 2IPAB 2FMFA 3H1FA 3TX6A 3HO1A 4EVSA 4FB4A 3H75A 4LRQA 3EGCA 4ML3A 1E6LA 3JPYA 5DTEA 3HV2A 4HNQA 3R0JA 3KCNA 4IF4A 1EWKA 5CNKA 4P98A 3RVSA 4XXHA 3T8YA 3BILA 4HNRA 2M98A 4EYKA 2F8TA 3CZ5A 3BRQA 3HVRA 3OMXA 4MRMB 2N9UA 4YS6A 5D2CA 1AB6A 1D4ZA 1SD5A 2FTKE 2FVYA 3CNBA 4YO7A 1B00A 3TB6A 1BAPA 3KJXA 4MS4B 4IMJB 2NZVG 2CHEA 3A10A 1SRRA 3BRSA 3IP7A 3H5VA 2PL9A 3C97A 3DZDA 3EULA 4MS1B 3VNAA 4Z4CA 1APBA 4W5QA 3SM9A 2HJ9A 3QELA 3NNSA 4RKQA 3OM0A 1BDIA 2PUFA 3N53A 3QEMA 5BQ3A 2WJAA 4EYOA 1QKKA 4JP1A 3ILHA 5EWJA 1ZH4A 5KQPA 3GV0A 4ZYLA 1QMPA 1U2PA 3C6QA 3CTPA 1JBEA 3HDGA 3SNKA 1JF8A 2RJOA 1XWWA 2FW0A 4N0PA 1DC8A 2MYUA 3I09A 1T34A 4KV7A 2ZWMA 5TPZD 3OQMA 2VK2A 3MYYA 3O1HB 1TM2A 4N0QA 5EWMB 2IPNA 2BGGA 2QR3A 2PUAA 1GCAA 4F06A 2R47A 2PAFA 3Q7SA 2YHBA 4HNSA 1Z15A 1Y1LA 2JK1A 3DGEC 1U2QA 3CU5A 3IPAA 3RVPA 2MSLA 3KTOA 3N75A 2VYCA 2WJWA 1NXTA 1PUXA 3HSYA 4RZSA 1CYEA 3O75A 1QP4A 2MYPA 1GLGA 2PUEA 3HUUA 4JB2A 2WB4A 3GWGA 5HQJA 3LUFA 1DBPA 4H3HB 3CZCA 2JRLA 1U8TA 4EYQA 3MQ4A 3IPCA 2CWDA 1QO0A 3OMWA 4PYRA 4MR8A 4W5RA 1M5UA 2A9OA 4MQEB 1BDHA 3QLTA 3FGZA 3HEBA 3SAJA 1OXBB 1YMVA 1A04A 1NXWA 2FEWB 3HZHA 3N0RA 4Y9TA 5IUJC 4KRFA 3I42A 4Z99A 1FFGA 1YS7A 3O74A 2E4YA 1MIHA 1ZGGA 3Q15C 5EWMA 5IUNC 2QXYA 4G0OA 3H5TA 3UUGA 1NXPA 1PNTA 2AYZA 2IKSA 4ETMA 1R8JA 2GX6A 2ZAYA 4MQEA 5KC8A 4KK3A 4NCBA 2ID9A 3O2JA 5KI6A 2QVGA 1VRVA 1W9HA 4Q6BA 4XFKA 3C3MA 3HUTA 1RZRA 4EVRA 3GA5A 5IULC 4RKRA 2HQRA 4Q7EA 2NZUG 1NXXA 3KYJB 1M2EA 1D5WA 2LBPA 5IUKC 2RDMA 3TD9A 2IOYA 3EAFA 5IEBA 1KRXA 4G86A 3H6GA 2DRIA 2PKXA 1K68A 1YS6A 3N0XA 4RY9A 4KFCA 3TMYA 5JNTA 2MSKA 4G0MA 1M2FA 1HEYA 4RY0A 3QLUA 4PEVA 2IPLA 5IC5A 4L85A 1RNLA 1RXIA 1Z18A 3G1WA 3JVDA 3MIZA 2MYTA 3HM9A 1RPJA 3OLXA 1MB3A 4WUTA 1UDRA 4MGEA 1DRJA 5FWXA 1KMIY 1TVMA 2Q5CA 3A0UA 3KLOA 3IP6A 5FWYB 3EQ2A 4EUKA 3OM1A 1QP0A 2JVKA 2RJNA 2NT3A 5BR1A 2OQRA
chains in the Genus database with same CATH superfamily
4TT3A 4OATA 1PFQA 4AM8A 5G4KB 5CBPB 3HMKA 3A4IA 1NY6A 3MIIA 5CB4A 2LGJA 3GJ0A 3WTCA 1FMTA 2QD3A 2QUAA 3WLLA 3GLGB 1T1JA 3E2MA 2LIVA 4ZC1A 3MT9A 2WHRA 2CHUA 5DHFA 5KNDA 2HJVA 2J09A 3NHJA 4D8UA 5H81A 1M0WA 2ANBA 3GN1A 1QLWA 5LYJF 3NALA 4FYWA 1C4WA 1P4GA 3SJUA 1F8GA 1X1DA 4D8VA 5KPDA 3TEFA 4E51A 3W0LB 2VAMA 4K6MA 1EI9A 5C5DA 3RAFC 1N6NA 3MZ0A 2WIGA 1OFHA 2W4MA 1KMMA 1Y1RA 4F46A 1WW3A 3D02A 1OREA 2VP0A 4F3TA 3E9QA 4FFBA 4JLKA 3KHTA 4J43A 5EI5A 5TMBA 5K0BA 3AYZB 3TWOA 4Y2RA 1JGTA 2W7TA 4E5UA 1ZMRA 4Z54A 4MS1A 5DV9A 2F9MA 2FDCA 2B9EA 5F51A 1JG3A 1FLDA 4DG5A 2FUG6 1P7WA 2Z1MA 4HYEA 1RR6A 3WWDA 4XWKA 1U1GA 3QEBZ 5CFPA 4PR3A 4OBWA 1CNMA 1X7YB 1DEXA 2GEFA 2A84A 3TFOA 4WJZA 3KT3A 3A2LA 1LBSA 2CB9A 3H2YA 1S1MA 3KVOA 4LBYA 3F4KA 3KXLA 4WFIA 3KEOA 4WXMA 4ZOLA 2OA0A 4C1BA 4EZBA 1RI4A 1UC8A 1R2QA 4IEFB 3E6AA 3L43A 1DNPA 2JEOA 2Q4TA 1L7BA 2XYGA 4K86A 5TARA 3UMCA 4C88A 3EPPA 5LZ5A 4XPIA 3RBAA 3UAZA 1TEHA 2CLSA 1N2CA 2D00A 2HN9A 2HSZA 1JDBB 1BGWA 5LB4A 4AJ1A 4AWXA 4JXXA 2JLCA 3UH1A 1GPKA 5DJ5A 1QCCA 3GD5A 4JEIA 1IHYA 4OQNA 4X1KA 4JQSA 5LJLA 1AN0A 1DJLA 4KH1A 4KJZA 4Q34A 1ZLYA 3HWSA 2VP4A 3PV0A 1D5CA 2W0MA 3HWRA 3TVTA 1JP7A 2ASEA 2EEPA 5CDYA 4IAOA 1WMAA 2GQ0A 4NK4A 5EJMA 1EM8B 3R6LA 3LKZA 4C0HA 1T36B 2ZI5A 4TQGA 3OCCA 1MQAA 1RZVA 1U65A 3H2BA 3L4JA 4FINA 4QU9A 2Y67A 4J75A 5D87A 3LY9A 5DTRA 5DRTA 2J7PD 3QZUA 1Y7HA 1RPNA 4WL0A 1BXZA 2OPHA 2AJCA 3LPDA 1QPZA 3MWKA 4QG7A 4QM6A 2NAFA 3W6OA 4NZYA 4Q7MB 4WDRA 4QFCA 1L7AA 1YS2X 4TMYA 1B15A 4YIKA 4EATA 3BE4A 1H3FA 2PKEA 3CGGA 3ZHBA 4EUNA 3U1VA 3DCIA 4CKZA 5A04A 3AFMA 3FWKA 1V26A 1NW4A 2V6FA 4R0VA 5D3QA 4B34A 3O7WA 4JHLA 3AF5A 2JZOA 4L72A 2JJ2D 4X24A 2JAQA 1GTMA 2C57A 2DY0A 2CXNA 4M46A 3SYTA 4CUKA 1SY7A 1U98A 3RUAA 4QXOA 1T8UA 1LWOA 4NMXB 9ATCA 2I6TA 4O4LF 4WCDA 5TQJA 3TD2A 4EMUA 1UK9A 1MRSA 3HCDA 4KUGA 1R0ZA 1A9XB 5KVSA 1OMOA 4Z1MD 2WMDA 3DWGA 3EEBA 5AKZA 4FXOA 5CIWA 4UU7A 4MV4A 1R4MA 4GD3Q 4Q82A 2QIOA 5DYTA 5AXAA 2X5XA 4JI4B 2OHFA 1XIVA 1AQUA 4G2TA 3D8UA 3KWLA 4X0EA 1BW9A 3UICA 1QHHB 2H7YA 4IQGA 1XKLA 3ACBA 2X1VA 3CX7A 3VR4D 4KMSA 3RWBA 4AYTA 1ETHA 1G7CA 2O0LA 5KTYA 4C22A 4JJ6A 5T4HA 1AKYA 1NAIA 4FGUA 4LYJA 5TMEA 4TKMA 3AB7A 1L5LA 2NU9B 1UM9A 3RHTA 3IOCA 1G3IA 1XXHE 1DUSA 5T3YA 4OKSA 3H8JA 1KAHA 4JLAA 1JQBA 4OBBA 3A7EA 1DKRA 2A59A 1H2ZA 1K4YA 1P0IA 1S8AA 2Z8XA 3AYXB 3MUNA 4I4IA 4BNDA 1MAVA 4E2FA 3G7SA 3FGOA 2QXUA 3LIIA 4LF7B 1KQPA 1J20A 1UPAA 2WABA 2ORWA 1QVAA 2RB5A 2F4VB 1ZICA 3F98A 2BFBB 2D1SA 2ISSD 2OZEA 2C3OA 4YLGA 1IM5A 1RWWA 2R65A 3UMYA 2QMUA 4B81A 4IS2A 5KS2A 1JBQA 2BGJA 1XA4A 2E18A 5JYDA 4PSCA 2P8SA 3IP5A 3OKAA 3QXCA 4MARA 1Q92A 4DMUB 2DQ4A 3LUCA 4TZ6A 1YB7A 5EVCA 1CUIA 4IUYA 2W6ZA 1S8OA 3KOXA 1N2ZA 3RC8A 2O8FA 2BRUA 1FYVA 1K6XA 1GOTA 1XMVA 2G9ZA 4OXNA 4QJ4A 5K3SA 5IKMA 2XCLA 1RJEA 2JVJA 4GU5A 4BLWA 2ZT8A 4M1SA 2K2WA 4I19A 4ZCQA 1VIAA 2E5FA 1W19A 5BORA 3ONWA 2YYZA 4KSCA 3UHFA 4MEAA 4XD7A 2OKCA 1R12A 3V1LA 3Q5EA 4FDVA 5F73A 2QX4A 5LZ8A 1LC0A 2HRQA 5A3JA 2PUBA 2V96A 3AEXA 2BGIA 2J4CA 5K20A 2B4KA 2XD9A 1RPZA 3RS3A 1KH1A 5K3CA 4HGYA 5EJ8A 4W7IA 3EMDA 3BDVA 6LDHA 4CEJB 2QGFA 1DCKA 2HA6A 3LX5A 2BH2A 4RF3A 1YZHA 2ZIVB 3KEQA 1ID8A 1XC7A 1NN3A 2L69A 1QANA 2GKGA 2XYHA 3W2EA 2C8JA 3I4FA 5JCZA 3C7KA 1FFXB 4EJMA 3F4LA 3O4JA 2Q1UA 4QASA 2UYQA 3G13A 4OJMX 1GGNA 1OLXB 4MPRA 1CUDA 4ZYVA 5HXAA 5EXSA 1IVYA 1GTVA 1XKQA 2OY0A 5ER9A 2R79A 1E0DA 1I13A 1YZ3A 3GT0A 4KZKA 4NHOA 1C7RA 1GQOA 2GS9A 2Q0QA 5JDCC 4ASUA 5AICA 5DULA 1KJQA 4NFYA 1Z28A 2P90A 4FLEA 3B5EA 4KAAA 4AZ3B 3OZVA 1JKJB 3B13B 3K6SA 2REXB 2BCEA 1C0IA 4XVCA 1SQSA 5AQEA 1PIWA 2JLSA 1WSWA 3IEIA 4J1SA 1IOLA 2VL7A 3ORSA 4EIWA 3V2GA 3O7MA 1CDOA 3W78A 1CQIA 5A4JA 1MOZA 5GOTA 2J8ZA 1XWIA 3FNIA 5KOJB 2FOIA 3WLOA 3B20A 5C81A 4DG8A 1PQWA 2F9LA 1Y6RA 2PU5A 4RHEA 1D3AA 1MX3A 1OFIA 2FFAA 4HQ6A 2X9GA 2XR1A 2QZJA 1NDUA 4ZN6A 3QTTA 3ZJ5A 4DWWA 4FI3C 2I2WA 4G5XA 4M60A 2VHYA 4RACA 1LZLA 1NATA 2HO5A 3ITDA 3Q7TA 2IX3A 4ZRMA 1ATIA 4JUAA 4PPYA 2PK3A 1L5HB 1M8FA 2NP7A 4JCCA 4H0CA 3WGGA 1N6RA 2Z4SA 1YR1A 4B2YA 4OHKA 1NMSA 5TRTA 3JARB 4JY7A 2L18A 1XLTC 4WKOA 4KAXA 5JG7A 2WIKA 3HVHA 2YV4A 2FGKA 4YAJA 3FI9A 3RANA 3K0HA 3S1AB 3G2KA 4CMAA 4F4CA 2Y2UA 3QEMB 3K9HA 5ERXA 2WJIA 1WABA 3E3OA 1X8XA 2R87A 2V6GA 1WP9A 5EPOA 4CLEA 3NTXA 2ZIAA 2I29A 3DE1X 1GG9A 2QTFA 3AILA 3BYZA 1JWAB 4FC6A 5DTQA 5EE3A 3RWOA 3ZXUB 3BTUA 5L51A 5L6MB 1EVKA 3DZGA 3P96A 1FXSA 5TT1A 2W4IA 1G4HA 5A4AA 1Z2NX 2F62A 4DCTA 1UP6A 3AG6A 1F4LA 1I33A 4FWTA 3HUEA 1ZFNA 2DFNA 3A58B 1G19A 2XKAA 3P2IA 2ONJA 2VHTA 5FF9A 4MB2A 4DT1B 2FP4B 1CJMA 1MXHA 4AS1A 2H16A 1BMFD 3Q10A 1JKMA 3FSJX 3K5HA 4NBKA 1JA1A 4ZEWA 4DBZA 4DS3A 5FL3A 5CB8A 5D6NA 1Z0SA 1F4VA 1NYRA 1ZUD1 1JKFA 1GJRA 1U31A 1KVTA 3REOA 4HL6A 5DWQA 4YK7A 4KH0A 1E7QA 1JAIA 2H1IA 4KACA 4WRRA 2F00A 3F4BA 3W7VA 4BWYA 3PL1A 2CUZA 3ZXXA 4NI5A 2L17A 4L7QA 2QRVB 1BCSA 4BGIA 1SHZA 4L3OA 1JB1A 3U44B 3OE5A 3UJ8A 3CO0S 3BHNA 3IUYA 1AU9A 3ILYA 5INTA 1IJEA 3P52A 4DOMA 4ZK6A 4FR2A 4J6FA 4LFAB 3VI4B 3KSRA 5HOEA 5M29A 4PV7A 3QE3A 4JC5A 3TM4A 2Q9CA 1YONA 1US8A 3UCXA 4BJ5A 2J9FB 3FMPB 3KFLA 3PDIB 3H3JA 3ORRA 4UPVA 5EKSA 3R0VA 3R7FA 4FX5A 2WT9A 2WI8A 3OE7A 1Y3BE 2EFEB 4IF4A 3RC3A 1SCJA 2NSLA 3GMSA 4HB0A 2B92A 1EH5A 1PGQA 3A9RA 3AI7A 3I6QA 3KXDA 4KXQA 3Q8KA 3LHKA 4N4AA 2ZI6A 4NRDA 2O8BB 4YJ2F 4EL0A 4X94A 2OORC 1T3GA 2PCJA 2O4UX 3FUWA 3LBFA 4PC2A 2X3YA 4QJ5A 4BP9A 4EJSA 1K4KA 5C5EA 3OEHA 3VTZA 4H3SA 3W5IA 3EOBI 2JIZA 3H86A 4C06A 4EA7A 1AQLA 4IVNA 3T54A 5AW2A 2AG6A 1KC1A 2GPBA 4L8YA 3SPXA 2D7JA 1QG6A 3IT3A 3NMUF 4EJSC 4C7BA 5K0JA 2VUUA 4UUOA 2QP4A 3QELA 2Y71A 3LY8A 4RELA 5IAKA 2I2XB 4IJQA 5AM5A 1MG0A 1FMFA 3UVEA 2DT5A 4DLVA 5AIBA 2F43B 2B99A 1X14A 3R8CA 4IDOA 1IIRA 1LW6E 2YV2A 5I47A 3BSSA 4GEKA 5ES4B 1JF8A 3CNLA 3G5TA 1IUPA 1OROA 5FOSA 4EGFA 1FA9A 1T0BA 3JZMA 5EIXA 2DPGA 3A11A 2CN1A 4GOOD 3DAOA 4IIBA 4N0QA 2WQ7A 1DX6A 1T1RA 3SSNA 1XRMA 3RKSA 2GEKA 4OHRA 3DVSX 4E70A 3OX2A 2R86A 5F33A 5JXIA 1XTQA 3HPRA 3A9UA 4FBGA 3VU3A 4PBRA 4Z7OB 1EHYA 1FX1A 2F3UA 3DGEC 3HKDB 1UJ5A 3DYIA 4Y6QA 2ACKA 2QPLA 4GEGA 3WWEA 3ZU5A 4AG3A 1F12A 1W96A 3T15A 1LDGA 1UJ6A 3AH8A 2IZZA 4JI2B 3KKKA 3WIDA 1A9YA 3L5OA 4XB6B 2FETA 3CLVA 3HUUA 1Q7GA 3IERA 3ZG6A 5IXSA 3ASZA 4RMGA 3UB3A 1IK4A 3WYEA 1JIKA 1CY1A 4XQ9A 5DE3A 1IUNA 4ZI3A 2V1XA 3DT9A 2O1WA 3NDIA 3I01M 1HOXA 3OUUA 1DV2A 3VSBA 5GGYA 4CDRA 3JYHA 4X63A 2ZJ1A 3OMWA 10MHA 4MR8A 2JIRA 1P74A 1YB2A 3BG5A 3KVYA 4HG2A 4JQCA 3SR4A 3SXUA 3UEOA 1G4AE 3LOUA 1L8LA 1Y9EA 3QLTA 3ZHZA 1K0FA 2QD1A 3U0BA 5EJAA 2HWKA 4M7OA 2KHZA 1CIVA 1GAWA 2HXSA 4JI0B 1T1GA 3Q1KA 1Z22A 3S2IA 4K46A 4COKA 2WJVA 1FE8A 1AD2A 3DPIA 3H5TA 1A9ZA 1HPLA 1PNTA 5FUXA 4ETMA 4ESOA 1E2NA 1WMEA 1PEDA 4LIPD 2VYQA 3FPHA 1EUDB 4MQEA 4QRHA 4PSAA 1S9HA 3FDZB 1X7DA 4L8LA 1CUFA 1FX0B 3MMXA 4HAUA 4F5WA 2ZETA 3LW8A 4CODB 4EVRA 1QF6A 4BVEA 1G0NA 4CKEB 1E3SA 1I7NA 3P27A 1JAXA 3ZD7A 2XCSB 2X9NA 4OXQA 1CP2A 4L0DA 1Y37A 1Z4QA 4U8GA 1W30A 1R6AA 3D43A 4U2EA 4QFDA 1ZNZA 3R20A 1E1NA 4KXYA 1GDDA 1GQ2A 5EJ9A 4FJ0A 2WJ4A 4Q7JB 4YP6A 1AGRA 2GF0A 2I4MA 3BXXA 5D3KA 3GEEA 2WPDD 4M2LA 2G1PA 4EUFA 2IPLA 1XZAA 1T4MA 5EXTA 2B8NA 2GD2A 5LYYA 1I01A 3K6SB 2FFRA 3HKCB 2JGMA 1PU2A 3LXRA 4KPGA 5F76A 5B12A 5I8WA 1PE0A 1GPYA 4LYAA 1QHYA 1SHUX 1E1LA 1SZJG 3IVGA 2NO7A 1XTZA 4ROSA 1UDRA 4UQOA 3U7JA 5JZOA 5A2GA 2VJKA 2D1YA 3DAYA 1LV7A 1W88B 3IILA 2PZ8A 2BFMA 1LUAA 1LW7A 2Z2YA 3VDNB 3VPAA 5LOVF 1C2TA 4FONA 1PFVA 2GCGA 2JI6A 3KYBA 4Y1FA 2ZT6A 5TEWA 3T9AA 3ZJYA 1G2PA 4FN4A 4A8JC 1R64A 4RXUA 5BR1A 3AQIA 3N7UA 4JP5A 2EIXA 2QVZX 3ELWA 3G9ZA 4FGSA 4L78A 5ELMA 5FTKA 1IONA 3GPCA 1KSFX 2OMEA 1BOOA 2C5FA 3HJTA 1DCMA 2H65A 1VDZA 1JHXA 1YDMA 3BRWD 1ZVJA 1PL7A 3EZXA 3RVRA 5HKAA 2ZUUA 1H2HA 2AL7A 2OB1A 2XMCA 4YJDA 5K3FB 5KNDD 2UUCB 1QZXA 5P21A 4PM4A 4DNPA 3NVKI 4R7ZA 1VLZA 4UBLA 4BZZA 3UXEA 2FN9A 4B6EA 2ZKLA 1BKSB 2C9ZA 2OD7A 4PPFA 1YR9A 2Q2OA 4G0PA 4Q3LA 3ECAA 4GP9A 3VRHA 2X0IA 3JTMA 1PYDA 2W8BA 3SX2A 4AJLA 2IYUA 2W6MA 4WGGA 1R0KA 3VUEA 5ARBA 2IYWA 1T9BA 3FFBA 4G0ZA 4ZMRA 4ZZ2A 1V3QE 5HRCA 3H2KA 2DHQA 4DZRA 1AQYA 3O8LA 4MKRA 4E2YA 4L5BA 3TCXB 3LWNA 2R8OA 1JG7A 1QZTA 1BDMA 2HJSA 2IW1A 4LYYA 2VZLA 2YHIA 4ONEA 3HYNA 1SIBE 1F17A 1FDIA 4S12A 5DP1A 1ZD3A 1RRPA 4PSUA 5JT1A 4UTPA 5KB3A 4YJGA 4FR0A 2GPSA 2Q6IA 3B9QA 3I2FA 4PCVA 3NANA 1MUUA 4I1VA 1ST2A 3T5BA 4LA4A 3OJOA 3IDZA 2BH9A 4ND8A 2WICA 4HQNA 1F20A 1DP4A 1O0SA 4CM5A 3IE1A 1IEXA 3IURA 1AMUA 2O6LA 2X2PA 2HLNA 1LRLA 4YRIA 2PKCA 3DLPX 1K5HA 2EX1A 2FQXA 4AMUA 3EIFA 2D0PB 4JROA 1VHJA 1O95D 2ZI7A 1UKYA 2NVBA 2WKRA 4CTJA 1KYYA 1EE1A 2V3CC 1XFDA 5EOVA 3OZWA 2RG1A 1YFJA 2J5XA 4IXDA 4CTMA 2XJ9A 4BNYA 2O2HA 3V1TC 2RKBA 3AG5A 3GLKA 4E94A 1CJKC 1YDHA 1ISJA 2ZDHA 3BK7A 4G8JA 5K03A 3NHLA 1E58A 2WD8A 4P8RA 3DBOB 3EQ7A 2IYLD 4JLMA 4UFNA 2X0EA 2XDQB 3H6HA 4JI7B 1J0AA 5BNWA 5K09A 2IUFA 1YFKA 3PFGA 4L95C 4II2A 3WGTA 2AXNA 2HA5A 2RKWA 4PZPA 1LRJA 3K8YA 1FU4A 1R9JA 2JARA 3LKDA 4NOLA 4S35A 1WM1A 5FL7A 2WHEA 1TU3A 2O7VA 5ULLA 4CG0A 4PG8A 1U3DA 4PW0A 4JWKA 4RKWA 3IEMA 2YMMA 1K0UA 1VBKA 2RC5A 4UM9D 4YDHB 3VISA 3ZWVA 3EDRA 3DFFA 1DKPA 1WUJS 3LCMA 1ENOA 1NF2A 3DZHA 1MCZA 3SMVA 4HN9A 2BF7A 2DWOA 4TS4A 5JQGF 2B7LA 2HREA 1AURA 2WDPA 3NHRA 3NI2A 1N1DA 1I5RA 3OLYA 4QARA 2QNRA 3SHQA 3DBLB 2B78A 2C9OA 3AZQA 4MA4A 3B1JA 3HVKA 1OYVA 2OO3A 2QD4A 2OC9A 1NBEA 2GBGA 5JU6A 4AC9A 2YRWA 2P9YA 2YWDA 1GXSB 3HE3A 3WLPA 5FFMA 3F1KA 3BSWA 4R2KA 4QSHA 1IEWA 3C74A 4ZU6X 3BD8A 3AF2A 3CE9A 1TMGE 3H11A 5D86A 5DEOA 3L93A 1NQOA 2WSMA 2QTBA 2W2OA 2XDWA 4GYJA 3PRKE 3E22B 5AI8A 2XQIA 4D3YA 1U99A 4LCJA 5JWOA 4DQDA 3UW3A 3AUFA 4OUDB 3HADA 3DS8A 1N9GB 2A9FA 3DZBA 1G6Q1 1W2WB 1RFLA 2WTAA 1MAHA 4UNPA 3DCJA 3UJ6A 4URVR 4P2BA 1NUPA 2GBIA 1LPBB 4RHFA 1QH0A 4KVFA 1EBUA 1CVRA 1A4RA 4CG1A 1FVXA 5K6RA 3BMNB 2P4HX 4F4FA 5AKXA 1I32A 2B0CA 4LJ4A 2P11A 1Z4IA 2BFCA 1DO2A 2DOKA 1W35A 3IE0A 4FMCF 2ZSIA 3NLLA 5JI2E 2BHNA 1Q0TA 2JZCA 3WO1A 4D1YA 3ZY4A 4OH1A 2XNDD 4GF5A 2AEFA 1M1UA 1A4UA 1FXWA 4X8LA 5DKFA 1JEQA 1X2EA 3F67A 3KPJA 4FOSA 3W5HA 1RI1A 1SCNE 3AF1A 4XYGA 1I9CA 3B6EA 4EHAA 3DMTA 2XODA 3JZDA 5BRAA 1TQHA 4A15A 5BW8A 4QUGA 2GAOA 1GPUA 1DIBA 3PA6A 1QDLB 1XXHB 1U81A 4QPCA 4UNQA 3BE8A 1UH5A 2FSFA 3Q7QA 4KR0A 4LY3A 4YDQA 2UU9B 4B3MB 4HTFB 5JW6A 2VCYA 3AVXA 1OFUX 2P91A 5E1BA 1JG1A 3ETDA 3OKFA 3SYMA 3YASA 4K9PA 1RXVA 5TNXA 3RC9A 4LHZA 5FOWA 4B45A 2X5KO 2JH9A 3FPKA 1JVSA 1EWQA 2IYRA 4BTLA 1PFGA 1E64A 2BMFA 2OBNA 2QYSA 2WLTA 2O7QA 3BCSA 3HCPA 4I6EA 5BR4A 1FDOA 1X94A 3MWJA 3T1YB 1XD9A 5HUJA 1UEIA 4M98A 2D06A 4EG4A 1EVZA 3DE2X 1OIVA 1LC3A 2YR0A 5FOXA 3L01A 4RLHA 1A7UA 1QQTA 5JCXA 2O54A 4AUNA 4NBSA 2VTBA 3K9LA 2CYBA 2NSYA 2VJOA 4H60A 1F0PA 4BNXA 3MCVA 3FN4A 4JCOA 4WXHA 4Q6WA 3RNOA 2QK4A 4URWR 3V3KA 1TF2A 1NBIA 2IJGX 4YJ3F 1EYZA 3GPBA 3MK31 2GXUA 1E7WA 4ZU1X 5LQKA 5EKXA 4M7WA 2YYAA 1ZU5A 1KK2A 3DEJA 3EZFA 2C95A 5C7YA 4REMA 4CMIB 1H8HA 3B7PA 3P9ZA 5LVAA 4A6EA 4EI8A 1CZNA 4GR9A 2JIQA 2BJHA 4EW6A 1G21A 2DFVA 1T91A 2MSEB 4WSOA 3U3ZA 5K05A 2G8NA 1P2FA 3D6FA 3RG2A 2WWHA 4L1KA 4MWBA 2JFYA 4M1QA 2PJUA 3FZEA 4BKUA 3M5PA 5ECWA 3EZGA 5IT9A 2QGNA 1G5IA 3VVMA 1AK2A 1QQ5A 3WGIA 1IEVA 2W6QA 1Q11A 2H4YA 1HLFA 1NUAA 2FKNA 2WT4A 3E5HA 1Q3TA 1EHIA 4R40A 3G0IA 4P54A 4AQYB 4KRYA 1VIVA 4QEZA 5DLYA 1KMHA 5DGTA 1JEAA 1TTQB 2C2MA 2OESA 3PFHA 4ISBA 2PDAA 3HCWA 4BKOA 2HQBA 2BTOA 3FOAA 3GNLA 4QUJA 2FKAA 5KOJA 2W00A 3JQ8A 4W5OA 4NV3A 3OLQA 5BR7A 3ILSA 2FUG1 4YUXA 2F7SA 2MYNA 5IVPA 4YNBA 3QX8A 2D1FA 1XU7A 2PPLA 3R09A 1IZ7A 1DCFA 4DBLE 1Q5PA 4MP3A 5HVNA 4PS1A 1ZJJA 1WHSB 4CIBA 1PZHA 2AOTB 2ECPA 1JDBC 4Y6LA 2EGUA 4DM7A 1I4OA 5BQFA 2RGXA 4ESHA 1I7DA 3ZWYA 3O3MB 2UYYA 1NW5A 3QLVC 4J7UA 4UQPA 1XXLA 3FD8A 4DN6A 2VPZA 3AFGA 3FPBA 4YONB 5KCMA 3TIVA 1QTIA 3U5ZB 3CM0A 1MR3F 2HKIA 5ALXA 1RMYA 1DBIA 2ZRKA 4PYKA 4A2CA 4NAUA 1EHCA 2Q5EA 4HQLA 5AJHA 1Z47A 3FHJA 4MDHA 2PUTA 2FFBA 3GZJA 1NVBA 2X5OA 3KZCA 5KVQA 1I3MA 1JHYA 3PGLA 1MO5A 2B4TO 4MP8A 2QL5A 2B7CA 1NSYA 4TRMA 1PKXA 4E5SA 2J0SA 5JADA 1W8DA 3GGOA 1DC5A 1KHTA 3HP7A 3I6BA 2HNKA 5JYBA 3G88A 4OTZA 3TSCA 3TECE 4LXHA 3GP8A 1Q19A 5AI9A 1X13A 5BWCA 1Y1PA 4GR5A 3PVZA 3V4FA 2OECA 3KXPA 4CMIA 2BKLA 1FP4B 4N5HX 2BBOA 2P3LA 3AWIA 2NUTB 2Z56A 3NRJA 1NW9B 4Q1AA 2PPVA 1DRWA 4JL6A 3RV4A 3NOXA 5B1YA 4DYVA 3KKZA 1XTVA 1M1YE 1L5QA 2VDPB 3JQQA 4GX0A 1H2EA 3CMCO 2GCOB 1MEJA 3M70A 2JL1A 1TQ8A 3COYA 1NR5A 1NWCA 3NYRA 3HMQA 3L1VA 1MORA 2PWBA 5K3AA 2QQ5A 4L57A 2AOXA 2HSJA 1CJBA 1Y3DE 2VBFA 3HDHA 3NIFB 1FS6A 1TUBB 3GJTA 1R9NA 3ZW7A 3FTEA 1CS0A 1I30A 1AY0A 5DDIP 4M4SA 4KX3A 3T8YA 3OFJA 4OU4A 2Z8ZA 3PNKA 1EGVB 1XRJA 4H7FA 4ZI2A 2ARKA 3EUWA 3PE4A 3WGQA 4BFLA 1C30B 2AVNA 4ZXFA 2FTKE 3AO0B 3K8OE 2JS7A 1M5RA 1WXQA 3KKNA 4EO4A 3ANSA 2ZB4A 3W90A 3ZVNA 4IV5A 1QU2A 2VP9A 2UKDA 4UM7A 3G2HA 5AKKA 2BEKA 5CCBA 1A82A 1T26A 1RAGA 2DGDA 3KQSA 4UDNA 5AD1A 5IM4A 3WYAA 5FUQA 2GVNA 1U6JA 5E4FA 1I4WA 1JSXA 3UGTA 4FCTA 1N2SA 3A26A 2JCYA 3COWA 4FZRA 4HMQA 3U31A 3VDQA 2NVWA 1N36B 3UHPA 1T8YA 5IXJA 4LNHA 2VZ8A 2O1SA 5FA6A 4TKLA 2XMQA 2RH9B 4JJKA 5ESRA 4GMGA 2J6BA 5FTNA 4W9MC 1R1DA 2FUKA 2NSHA 1G2QA 4LDRA 1NMZA 2AFIA 1WTCA 5AHOA 4BO9A 4N3AA 5EJFA 4MV3A 2NTEA 4JXZA 1SPXA 2G82A 3MFQA 4LRYA 4DV3B 2FZEA 3FVVA 4NBRA 1LS6A 1X80A 2XCQA 4BMNA 4UUBA 4YJKA 4BUZA 2GUGA 3LCUA 3RTEA 3PXBA 4GBED 1WPGA 3JQ7B 1FP4A 1VLQA 2YUIA 2P3SA 4L4SA 1J5PA 1P7CA 2PAFA 3AP1A 1M6HA 3JQ9C 1B41A 1X9GA 1ESEA 1E2PA 1UJCA 2X8JB 3RDPA 1ZXLA 2FE4A 5F78A 1E4EB 2PRIA 4Z4GA 1L6IA 4LECA 3GI1A 2BN4A 2H85A 4MUGA 1RS0A 3RU9A 4J7XA 2A6PA 5C7OO 4MV6A 3SZRA 4M87A 3B5IA 3U40A 3V4LA 5ECDA 3LUFA 4N0DA 4D02A 3E7DA 1I3KA 1C1DA 3R0QA 4H3HB 4MVJA 1N0IA 3HBLA 3BD6A 4H6WA 3R74A 2ODAA 4KUEA 1E1QA 4A5OA 1ZZGA 4GOJA 4EYQA 2O0JA 1DADA 4BN4A 4V0NA 1BDHA 2A9OA 1KZ6A 1XB2A 1TD1A 1ZU4A 4KQMA 1SXQA 5BUSA 3JYOA 3CR3C 2Y66A 4BX3A 1PWXA 1M34B 1NW8A 2NZWA 2YY6A 4F0JA 4EKIA 2OGSA 3IHTA 1SD2A 4MX8A 4QUIA 3RYHB 3UMFA 4JI5B 4EKNB 4EPRA 3GU3A 1O3YA 1QJCA 3DZIA 1RRFA 3UG6A 4MXDA 1G7RA 1TECE 1D0IA 1XAGA 2H1CA 3BWDD 1WUTA 5C8VA 4FJ2A 4FDUA 4S0XA 2PR7A 1UBHS 4CL0A 4MP6A 1RQLA 4RTRA 4CNBA 4RPKA 5COAA 1KDVA 4OYLA 4O0LA 3RRBA 1IN6A 1KZ4A 4XYBA 1ZD9A 3EWAA 2D7DA 3PCRB 2IOYA 3LLVA 1V9CA 2B82A 2A3RA 4GVXA 4P33A 4V1CA 2V0CA 2DRIA 3GAFA 4LSGA 1GUYA 1QRDA 1I2MA 3F5FA 4FJ1A 4BVLA 1U9IC 4Q9DA 3MQFA 3UK2A 4BEJA 4IY1A 1CUAA 3OQBA 1M2FA 3ESDA 3OA2A 3OPYB 5EQTA 3BAZA 4FBMA 2AQKA 1L2TA 3PTLA 3GIDA 4ZQIA 1K3UB 2BI4A 3NWBA 4Y30A 5JASA 1RCTE 1U4OA 2HADA 4JV5B 1LLFA 3AOGA 3U13A 5L6LB 4AKIA 1J9GA 2W2XA 1U6KA 3P4XA 1KXJA 5ILGA 2XUIA 5BQPA 3INRA 3JYQA 1OQAA 1E96A 5JANA 4HLDA 2X14A 2ZQYA 1JHOA 1GEGA 4GSKA 3EXG1 5B1DA 3I0NA 3L1HA 3IP6A 3M89A 1K6JA 1MNQA 1H6BA 3P9SA 3QVXA 3OFNA 1HSZA 2PH3A 4JA0A 5AJUA 2CJPA 1L4MA 2AZMA 3DEIA 4PS0A 5E3IA 3WKEA 3OEEA 1X8LA 2OQRA 2XEXA 4MNTA 1KJJA 5IH7A 2ZJYA 3ZGVA 2AUTA 3WYFA 3CIFA 1GQQA 1P2SA 1IE3A 4K6GA 4LGVA 5BSUA 1BE0A 3RS8A 3DL7A 4KEAA 1KR5A 3SXPA 5DNDA 5F7OA 3P0JA 1IBRA 1QAMA 1U4SA 1XLUA 4BO1A 3LQYA 3C3JA 4REOA 1E0SA 4DGQA 3CKMA 4R6XA 4R1QA 3KSMA 3V32A 1DFGA 3ZWMA 1H23A 1JFSA 4ZD6A 2I67A 3I6MA 4KQKA 3ZQUA 3OCUA 3KJEA 4DMFA 2WAYA 1UINA 2AN1A 4OHMA 5KWEA 1L5FA 1XN1A 3CONA 4FHDA 4GBMA 1Z6ZA 2VQFB 2BEUB 3I1JA 4O6VA 4F5DA 4L0CA 3PWKA 5C8YF 2DCUA 1EJ0A 4FCWA 5AKLA 4TL9A 2XUDA 3MBIA 5FDFA 3EMVA 2NSDA 1VZ2A 1G3RA 3O1JC 3QV2A 1O95A 3GIWA 1NSTA 5G1NA 2OCKA 4LXUA 1DZIA 3RSZA 4L6AA 2H00A 1L1FA 3PNLA 4PX9A 5TQ2A 5K0GA 4F9EA 2LUOA 4TXMA 1A8HA 1EDEA 4X7RA 1ZY2A 3D0OA 3ZGOA 1DTEA 1WBBA 3GXBA 1OA1A 1E1KA 1V11A 2A7XA 1XTIA 1YZYA 4B3JA 5JFGA 1A9OA 1EG7A 2HYDA 2ZJBA 2RAVA 4IG4A 1Y9AA 1T9DA 4JITA 4GI7A 3I5AA 4RHTA 1O5TA 1XRQA 4UAGA 2QUKA 4BKPA 3RU7A 1HWYA 4TYMA 3GN2A 5HJEA 4C20A 2I7CA 2O3RA 3RODA 1H9AA 4EMSA 4BNKA 3MJHA 5JAOA 1TAQA 2B2XA 2POCA 3M6MD 4RENA 4TVBA 5HQ3A 2CLIB 4KJXA 4UDXX 2ZI3A 3IEPA 1M8JA 1GPNA 1OI2A 2AXQA 2J3QA 2J3MA 4QQRA 4Y3UA 5BP7A 4HBZA 3TTTA 3ZQ6A 1JJBA 3SC6A 4R31A 3OM9A 5B3JA 4LF4B 1M2JA 6REQB 3C4JA 1EM8A 2H9AA 2Y1WA 4U7PB 5EIFA 4MIOA 1PYOA 1AK1A 1QHSA 2Q3HA 3BGOS 2G9UA 1GFWA 1SU6A 3AMVA 1F48A 2GJAA 1Q50A 3G2MA 5FYDA 2PM8A 4WV3A 2P9JA 4U39A 4ZT2A 2OCBA 3PJFA 4YWJA 3UKJA 4JOQA 2BMEA 1FU8A 4RL6A 5AI4A 5IJWA 4N3NA 4KMRA 2BPOA 3A4MA 3IMCA 1QK4A 1VGQA 4G4IA 4I9HA 3UZUA 4ATNA 1C3OA 4PLYA 1Y98A 2FI1A 1ILEA 3O8OA 5DCYA 3GLFA 2YWFA 3LL4A 1P4RA 4GNRA 1YR3A 2O2XA 1PNRA 3NBZC 5L3QA 1CQXA 1IXRC 1H2XA 3OQIB 4HHEA 4Z4IA 4P3XA 3KLBA 1PHPA 1H1TA 4GMHA 4AY2A 2FA9A 1PFUA 4J07A 4U4AA 1AQIA 5LP6F 4YRZA 1DKUA 5GPBA 2J5KA 2QYTA 5F9MA 5BVHA 3SX4A 4S2EA 3PGXA 1PDWA 3NIBA 4TXNA 4UUAA 3T5CA 4MAAA 1JMVA 2JBAA 2RGWA 3RTCA 1Z2PX 4KQEA 5L4NA 2GJ4A 2GERA 1DS6A 4I1IA 3UGKA 4BMCA 1D2HA 1VLLA 2IY8A 4BNNA 1IN8A 2HXGA 3H9CA 2Q1TA 3JD2A 3K0FA 4QGBA 3ZE7A 1QTNA 2FR0A 2WB2A 4IHJB 4KQIA 3UC5A 5JNLA 3QX3A 1POXA 1YKGA 3H9JA 1E8DA 1A5ZA 1V7CA 3ADKA 4Q9JA 3TW0A 3WHPA 2AQHA 3ZBUA 2Z2JA 1BJRE 4MQBA 1B74A 1Q7EA 4PYMA 4UTXA 5FTWA 5TPWA 4ICIA 3HEAA 5CYPA 2IXBA 4L4RA 5HK8A 2ZW9A 3HRKA 1QTQA 4IUCS 1NKSA 4M38A 1CUHA 1E4YA 1HYHA 2PBFA 3NHSA 4F4UA 2ETXA 4LMRA 2KYRA 1Q21A 1W88A 3KJHA 3S2FA 2FZ4A 3JWPA 4HXGA 4YXWA 2MHCA 3TFQA 1NVWQ 1K8ZB 3SHFA 4ZTUB 1SCBA 2Q1YA 3D7KA 4MUFA 2QRGA 3DOOA 1R6UA 1GV0A 4N47A 4KPUB 2Y05A 1J8QA 4AXBA 3AY3A 1UPFA 3Q9UA 3T3NA 1C1XB 3A32A 1MD9A 1STOA 1N2OA 1OYWA 2BFBA 2C5SA 3W5VA 1H2WA 4BFUA 1E9BA 3ZDDA 4CLOA 4LF6B 2UVQA 3Q6MA 4H4DA 3D6JA 3KUDA 4JBHA 2HWUA 4MV9A 4X1KB 4ZO6A 1IZYA 3RYFB 3T3GA 4CCAA 3OOJA 1YASA 3REGA 5ITSA 1IATA 4XD7D 4MVJM 2EWWA 3T52A 1Z5ZA 4DR4B 2VHWA 3EY9A 1QYIA 1SR8A 2WZQA 4ZT4A 1BQ4A 3NDJA 2K4MA 1MAAA 1RYMA 1XJ0A 2CXTA 2VYND 3LUAA 1ADCA 1TGVA 2CCKA 2DVMA 4QHSA 4F60A 4CGYA 5JY6A 1FXUA 4H59A 4KGZA 1F5SA 2PH7A 2PS0A 4RNCA 1RM4A 1WU8A 4TWIA 3A1UA 1QE0A 4IBOA 1Z4NA 4CT4B 1G1AA 4D56A 3A9CA 3K4HA 4IIJF 1L5WA 1GTZA 1NJFA 1OBVA 3QOWA 4L5CA 3KYCB 3F0TA 1N5LA 1T2NA 2VP2A 4N1AA 3PC7A 2IDJA 2PXXA 1QGUB 2OHHA 2CSXA 2NP6A 2HDNB 2ATIA 3P9PA 2VF7A 1UZUA 1C3EA 2YZNA 1M2VB 3AXTA 1AF4A 4OPMA 4HFNA 4EY6A 2D0DA 2IHNA 4N03A 1DEKA 2R4TA 2BGNA 1D8TA 2REOA 3VSCA 1C7EA 2FF5A 2H0AA 1GRNA 1FFDA 1J22A 3NYIA 4GPBA 3CSUA 2G0TA 4HGQA 3M4NA 3DE7X 1W34A 1KNXA 1XZPA 2AJTA 2XYRA 5LDDC 4DQUA 4HY3A 1COZA 1M0SA 1RHMA 1RC1A 4EFNA 2FRXA 5ALOA 2FU5C 1HNWB 4H6XA 1U90A 3FOWA 4B3DA 2NU6A 4A1FA 3EW9A 4FEAA 4RK1A 1DWOA 1E6UA 4X1YA 1MOQA 2H4FA 2V5UA 2DFPA 3KKOA 1W4AA 2EW2A 2ZPUA 2WFAA 4NP6A 5FLYA 3SEZA 2OPBA 3PQDA 4Z4EA 2GN8A 2JH3A 3SF8A 2GH1A 4C4YA 1CUJA 5JOQA 5I3ZA 5BV1A 1X9HA 4BMDA 2WTBA 3W06A 3TIFA 4FSXA 3RSGA 3ROQA 4AMGA 3KKPA 3SQNA 5IFKA 3QE4A 2V7PA 3JVUA 4U9HS 4YMWA 1AIPA 1SH7A 1F8YA 4IQ0A 3BTOA 4B4UA 1FSPA 3D8NA 4IRXA 1URPA 1Y3AA 2JJ2A 3F74A 3K30A 4PTZA 1QAQA 2XECA 2QJTA 1TAUA 1HTTA 4HT3B 4TL8A 4CKYA 4GPAA 3DVLA 1WL8A 3ES9A 4G3XA 4HJRA 2HBYA 3HL0A 2QMEA 1GCGA 4G0YA 5AOBA 5LMZA 5IS2A 2B94A 2WT8A 3EJ6A 4NJEA 1TJYA 4IFTA 5FUYA 5DRYA 3LX6A 2XGJA 2J4FA 4KDFA 4MGZR 3S1AA 4P6VF 4CDGA 5HP4A 3QU5A 4CIDA 3F7NA 4DIMA 2C3UA 1V7ZA 3VNVA 5LNK1 5J23A 3U19A 4TOIA 6ABPA 2YJNA 2UZ4A 4NFHA 2ZSHA 1IOVA 4GO1A 4RD1A 3G8YA 2ZWOA 1RM5A 1ZMTA 4RH0A 4Z3KA 4V24A 3EUFA 5DLDA 2FSIA 3QBTA 5E6UB 3C24A 5ALTA 3ZGYA 2PL1A 2WF7A 1P5ZB 1H0RA 2JLQA 1H0HA 3AR3A 2G0AA 1MT0A 3E61A 2IBMA 4G1MB 2ZYWX 4Q4AA 1JMYA 2BVNA 2HMVA 2UZ1B 4PG7A 2PMFA 4RZ3A 4XARA 2O7RA 5IJXA 1M2OA 1XAHA 2W2MA 4OD0A 1JZSA 1WXWA 3U7GA 3CH6A 2QTLA 4MMZB 1HURA 1OB5A 4D98A 5KNDH 1IBCA 3IQWA 3PJRA 2I2FA 3D31A 5IBQA 2ZUSA 4NJMB 4YCDA 3ONVA 4ERXA 4ZVQA 4XVHA 3H9EO 4JLNA 4YR9A 3GLFB 2ZCJA 3HU5A 3MMZA 2BTEA 2PIAA 4PNZA 3BOSA 4RJJA 2QZ9A 3R77A 4ZC8A 5DHRA 3MAGA 4WCFC 4GPD1 4D8TA 2IYNA 5BSRA 2ZROA 5HFAA 4RS4A 4X8OA 4D3XA 1OLXA 3HY6A 3I34X 3Q9NA 5BRJA 1LK5A 5BWNA 2EKLA 2F59A 5AOVA 4C08A 2A9PA 5DSZA 3NKLA 2HIGA 2SICE 4Q66C 3BERA 5L3ZA 5E38A 2BFDB 4RIHA 3ST7A 1LRKA 1UL1X 3ZI4A 1ZM7A 1KDOA 2P6MA 2MSNA 1IMOA 1JEQB 1QHXA 4I4TF 3ER8A 2CK3D 4DLZA 3DE6X 3PX7A 4YEDA 2XV1A 4L02A 1P4HA 4F6LA 5BSTA 3UHAA 2ECKA 4ZEOA 3WNBA 4NMLA 2C98A 2GN9A 3HCRA 4ZO8A 1D7AA 5EIBC 5DNYB 3NYQA 1NXQA 4DXHA 2JBHA 2VSOA 3NRBA 5LKRA 1W48A 1HEIA 3AETA 5JCOC 3A6HA 1H93A 2JHGA 3K1YA 4ITVA 2PH1A 3M33A 4YV1A 1DT5A 2BGWA 4M0LA 4ZOLB 1TCVA 3QGMA 2O2CA 4IDEA 4M1YA 2HI0A 3NR2A 4V02A 3PQ2A 2G5PA 3WL5A 5AVSA 3IKLA 5D2CA 1DGQA 2FVYA 4WPGA 1W5FA 1UJMA 4V0QA 3LHDA 1GUZA 3DTVB 3DE3X 2GBFA 3KJXA 3U7QA 1XTPA 4P92A 4Y6PA 2NZVG 2IXDA 1QV7A 1WXDA 1SOMA 4IDGA 3EULA 4LQLA 4M9UA 2B8TA 2PYDA 3AEQB 3RKUA 3NWOA 4XWGA 3HY4A 3R6DA 3T7CA 4AN1A 5F5XA 2PGIA 1DSSG 2QYOA 3IOEA 4J4HA 4PQRA 1QOZA 3NV7A 2JGKA 3KOMA 4I5EA 2C77A 4B7UA 5K0CA 1PJSA 3LP5A 1N25A 4YAIA 4JYMA 4TT8A 1HQDA 5IVHA 2R00A 1SZCA 2EWVA 1QGOA 3OEHD 1ZYUA 2J46A 2R62A 2NX2A 3V80A 1XWWA 1G16A 4Z2AA 3I1FA 1NOKA 1N6PA 3O84A 1ZA1A 1P80A 3NIGB 4RPIA 4C0WA 2FP3A 1DFIA 2WYHA 3OZEA 4MUEA 4D8XA 2IU3A 3QXHA 4J29A 5H9WA 5IDXA 4F06A 1U7DA 3T9BA 2C8KA 3BH0A 1FFBA 1X92A 3KVVA 3FF1A 3UNXA 3DO6A 4OQMA 5THKA 3WWZA 4LJKA 4I1PA 1JG2A 1HE5A 4FR5A 1B8VA 2MSLA 1Z35A 4XWYA 4H15A 4R4JA 4D0RA 3EIOA 5AVUA 4KCGA 1E2EA 1TCCA 4UULA 4PX5A 4C6RA 3QUQA 3I5XA 3DQPA 2B21A 4PC1A 4TYYA 1RWKA 4M8NE 2ZXFA 4KQWA 1OH8A 1KMHB 3A9WA 2IELA 3ZTTA 3T9CA 2G8LA 4TYWA 2HX1A 3UJ7A 1S01A 2DERA 4R2XA 4UFOA 4PBTA 1I94B 2R7AA 3Q3HA 2FEXA 3D1LA 1PTJC 2CWDA 1EZZA 4HR7A 2Y4OA 3AVTA 4BX9A 4RSRA 4MQEB 2XUZA 1KMCA 1PNVA 1LX6A 2VRBA 1JJAA 1A04A 1B0PA 4Y9TA 1FL9A 3PEUA 4B7ZA 3W6PA 1YJ8A 4C4XA 3EQ6A 1VGRA 4I50F 2Q99A 4G9GA 3I5MA 3KXKA 1MIHA 3UXYA 1VSUA 2DH6A 2QSUA 3DAFA 5EWMA 4C7KA 4EQ6A 3ADDA 5JS6A 3PQ8A 5LDHA 3L6RA 1P4JA 4HDRA 2RK4A 1IZZA 4HQFA 3GJ8A 4FFDA 4DA9A 4EPTA 2XZOA 2IYEA 1I3OA 2CDRA 2YHUA 3HH8A 3FB4A 1GGKA 3KZ1E 4Y67A 4BEBA 4N6OA 4XFKA 2WAAA 5SV2A 2FJ0A 2XWJI 2CNWD 4HWRA 3EWSA 3DPSA 4J91A 4R51A 1Z6AA 4YT5A 3PHHA 4KWTA 4DUGA 2ZVQX 3PXGA 2QSZA 3FCYA 3RROA 3GJ7A 2XYQA 2IXAA 3HXQA 1JEDA 4N01A 4QOSA 1U2GC 5DM70 3LBHA 2O07A 3GEDA 3TMYA 4RVHA 4D0GA 3DZFA 5I9LA 3U4QB 1E60A 5G4KA 2R6JA 3UAOA 1Y80A 5CBPA 2ODBA 3FDJA 1VFNA 4LYHA 3MTQA 4XM0A 2HMYB 2CD9A 5SZHB 2GPWA 4R81A 3G1WA 1SCIA 5HF8A 1ADGA 2DY1A 3WAKA 1NVFA 3ORQA 1OAOA 3K5WA 1XCPA 3L7JA 3MXTA 5A62A 1XRNA 3Q0IA 1DRJA 5C32A 5C46F 3NEAA 4QO8A 2XUJA 3M3DA 4DR2B 3C15C 1Z0DA 1UF9A 1V0JA 1DRVA 2Q6LA 2XDAA 4D3FA 3UH0A 4CTNA 5EXPA 3GXOA 5K3FA 2WSYB 3FKQA 2VUTA 5ITWA 4DR5B 3KLNA 1U1DA 4R83A 1A8PA 2J7PA 3GVIA 1KAMA 1ZCBA 4A6PA 1NVVR 1Y6JA 4G1VA 3GGCA 3GR6A 4O4HA 3ZY2A 1QG0A 4IOKA 2EF0A 4MRSA 2Y92A 1PDOA 4IOMA 3ZGLA 4CFZA 3EQ9A 1F3OA 5REQB 4GGOA 4URUR 5KTSA 4DAEA 5TLSA 1N3IA 5AJYA 1B0AA 3VOAA 2R00C 2WDZA 3VU9B 1FCJA 2PHZA 3KD2A 5CT5A 4PANA 3B36A 1NNEA 2HC9A 3EEQA 1ACMA 1OU0A 3E9ZA 3F1LA 3FUXA 3X1XA 1QQ6A 3ZNOA 4M6WA 3MGBA 5AHRA 3HNOA 1IDN1 3LO8A 3N5CA 1PRYA 3WFJA 1N78A 1HDZA 3IL2A 1B43A 2P2GA 2NYUA 3PEFA 4RIFA 2LZ0A 4BO5A 4OVKA 2G25A 3U7EB 2FQWA 3BSFA 4E4TA 5JV5A 3WP0A 1ZH0A 1ZESA 1L5ZA 4N3BA 3O21A 3GUVA 4ZVLA 5DSXA 4DWOA 4ETIA 3PNSA 3TLBA 2ZDGA 2H6EA 4TSRA 5ELLA 1N75A 1G5HA 1CTQA 1R5OA 3HB1A 3IPRA 3SOZA 2WMNB 5JNRA 1NOIA 3SIWA 4R8RA 2X7HA 3JWIA 4EELA 1OGIA 2PMCA 4TKZA 3LDAA 2AFHB 1YA4A 1QHHA 1LSSA 5AM0A 4K05A 4NEGA 4GKBA 3PWZA 3T35A 3CLTD 3LF2A 1P33A 3GJYA 2WUVA 3LUBA 4IVPA 4NC9A 4M3NA 2H51A 1PUJA 3LC7O 5FUWA 5KHOC 5TGZA 1IZ8A 2GJ9A 2NU9A 3V9AA 2AHRA 1GGJA 4AJ2A 4CM7A 2A4KA 2A92A 4MWTA 5JD5A 4N40A 5D3ZA 4N54A 2GM5A 3H6KA 4JSYA 3AF6A 1Q12A 3EGVA 1UJNA 1C3LA 2WUWE 1M83A 1W1UA 3D3JA 1E7MA 1Z4KA 1NKVA 3K2BA 1L4FA 4I3FA 1C9EA 2I54A 4QAQA 5LA6B 3UV6A 1A7JA 1WTAA 3DDHA 4ZI7F 1XZBA 1OXXK 4EHKA 1Z5NA 1F5NA 1KP2A 2FEAA 1FZQA 5B55A 1P4AA 3DCYA 4WY5A 4O4HB 3RT7A 3TZKA 3T3MB 2I7DA 3ZCUA 2AZTA 2JFXA 1L1QA 3D0QA 1ZJYA 3JS5A 5HF6A 1GD1O 3RNLA 3V46A 5DFAA 3THYA 2PA3A 1ZWLA 2BZ0A 1V9SA 1VSQA 2ZT5A 3SHTA 3FB1A 4QTXA 3RRJA 3QVVA 2B61A 2GEDA 4RSMA 5I9TA 4H7KA 3EF3A 1QH8B 1G6KA 5CG2A 1KRWA 1N3BA 5MN5A 4JI8B 1L6RA 3MELA 4B3FX 2F90A 3C45A 1TE2A 3D64A 4Y2HA 4Q5IA 3MOGA 3Q7EA 2HPZA 3G89A 1VIMA 1OW3B 2CL6X 4R68A 4QHYA 3RAEC 4OK3A 3IYLW 2VJBA 1RWBA 2DBQA 4XCQA 3IJ5A 3ZBPA 4ECAA 4N49A 1G3MA 1K6EA 2C00A 4TWZA 4WMLA 8ADHA 1FQKA 2GZ2A 1WV0A 4C29A 1WCIA 1CKEA 4XLLA 3OQIA 2IXFA 3EEFA 1B0ZA 2WSIA 4QOJA 5C8YA 4XW2A 2F2TA 1Z74A 3EHEA 4RVUA 3BWXA 3CNOA 3SQDA 3OOYA 5DMXA 1DVRA 2X9QA 3QHAA 1IBSA 2FDXA 3H7IA 4GKAA 1QYDA 4WNCA 3CLSC 2CGEA 4OKNA 4LRSB 4QGAA 1LU9A 1ZLXA 1RSZA 1SHJA 2PT6A 4RD4A 4RFSA 3U3XA 3H9UA 3X1JA 3VQTA 4F96A 1A2OA 5EJ4A 4D7AA 5FPSA 1Z73A 5FI0B 1CJSA 3R9WA 3QTLA 1RLOA 4K7JA 5B6PA 2VDNB 2AYXA 3I9OA 3MGGA 3IBCA 5A4MS 2D1QA 2WBLC 4O08A 4BJ1A 2XBLA 3LKBA 2HRZA 3N39C 4E33A 2CXOA 4FIZA 1N8NA 2IZ1A 2MOKA 4ON9A 3G0HA 3IP9A 4RZHA 3ADBA 3G9UA 4MDEA 1N9KA 3FLBA 1KY4A 2R84A 1GPJA 4QYWA 4UHEA 5BMVA 4JA2A 5I9NA 2WFMA 2YNMC 1TYZA 3DMYA 3Q3CA 5CT6A 4H6PA 4ZZ0A 2VDUE 3DG9A 4Z0TA 1AKTA 1AHPA 1T2DA 2HWXA 1J99A 1RI2A 1EVQA 1H2AS 4ZAYA 4UBMA 4K28A 1FLNA 1P19A 1N0UA 4ILEA 1EP2B 3L7NA 2ADFA 1GZ6A 4AROA 1TEXA 1FY2A 3K31A 5JNUA 2FZLA 3H2GA 1PR3A 1QK3A 2C5AA 4YUAA 3CA8A 2XRMA 1QB8A 3ESXA 1WNTA 2FXVA 2OHJA 5IHXA 1ZL2A 3WKBA 4WLOA 2UXBB 2VF5X 3TPCA 5JROA 4A8JB 1PV4A 4B74A 1LBEA 3CRNA 3ELDA 1OAAA 5KOIA 4NYMQ 3MC1A 1SEPA 2I3GA 3OFVA 4UHKA 1CRLA 4XASA 1O5OA 3U0VA 4BTEA 2ZUBA 3ZR4B 1DHRA 1EP9A 1Z75A 4MWCA 1ONNA 1Z33A 2O2IA 5BWOA 2Y1DA 2QLTA 1N1MA 4C2UA 4OI4A 4L07A 4JGBA 1I7QB 1ONPA 1T1IA 1PNOA 1JI3A 2GXSA 2VNHA 1M76A 1EEHA 1JHMA 1RJGA 3EODA 3EWIA 3U4IA 2OCPA 1WMDA 1WCWA 3K1JA 4FNMA 3WSVA 4Q24A 1B8OA 2XCOA 2YN2A 1SCDA 4I4TA 6CHYA 2WK1A 6GPBA 1OKKD 4FGJA 3R7NA 2FLWA 4MUXA 3CPJB 1LNZA 4EGQA 5LWQA 1ESZA 1EE2A 1ZMOA 1MJGA 2H52A 3AUJB 3IVRA 2HRRA 1QBKC 4UE3S 4TQ9A 4J0IA 1IN7A 3O95A 1E9RA 1Y8QA 4EDHA 1PK9A 2C94A 3VDMA 1ZITA 2VAWA 2IZOA 2VTVA 2Q3CA 4DY6A 4HV4A 4XGQA 1BKDR 2VQ6A 2ERYA 1OJ7A 2W83A 3O93A 3QP9A 4UW9A 3U4MA 4UNRA 3VR1A 3ASYA 1N4AA 1OR8A 3K0SA 3AK4A 4AIRA 3EARA 1X38A 2R5FA 1Z08A 2P9EA 4IZHA 1VHQA 1RCFA 2GJ8A 5AVJA 1Q84A 3D1VA 1P2UA 1RZUA 4DPKA 4IH1A 1B3BA 3VAZA 3OJFA 1S4MA 3OHPA 2CV0A 1GUDA 3ND6A 3R5FA 1GSHA 1ZC3A 5E4TA 4RANA 1CUVA 1GL6A 1HDRA 2GD1O 4ZMBA 2WHPA 2HF8A 5G0WA 5KTOA 1C7ZA 4LVCA 4E7PA 1CWUA 3PEWA 4MJ7A 1J2YA 2VQ3A 3QJYA 3T38A 1NASA 1CEXA 3V1KA 4CF3A 2J67A 1HTBA 1WDLA 1QVZA 2BGTA 1PTJA 1I51A 1CK4A 2ZJZA 1Z29A 3ML1A 5J3JA 4RK0A 5LKAA 3GX1A 3T7KA 4MLDA 3UWMA 4ALMA 1XZIA 5JYEA 1JSZA 3T3DA 2ET6A 2E55A 3HB7A 3OHMA 1CJUC 5ILQA 3PZBA 4GQAA 1RLMA 2YRXA 1VKOA 3FJ1A 1H6DA 2QP9X 5SZIA 2V3WA 4ZOAA 3WIBA 2F4NA 1R7RA 4QQNA 3W79A 3ZWOA 3D8HA 1ZMXA 3FNHA 1HNZB 1QIKA 1T10A 1GZSA 3ND7A 3WIEA 1HQKA 4Z4FA 1WHSA 2AZXA 2BE7A 3K5IA 2WG2A 2Q0SA 3KAPA 4OFBA 3TSOA 5I5EA 1RYYA 4G01B 3L8YA 1L5GB 1UMDA 1YI8A 3I8XA 3A3YA 1MJ5A 1XLVA 3DLAA 2YL2A 1F6WA 1R8QA 2H54A 2HU8A 3A1TA 5HIIA 3RE1A 1G66A 2IHZA 2R4QA 3VVCA 2FLVA 2OM2A 4BN0A 3EXFB 4Z5XA 1N7JA 1OYYA 2YC4C 2NXWA 3FLEA 4IJWA 3SM3A 4OLBA 2LV8A 2NXEA 1OWPA 4JJ4A 5B1HA 2VKQA 3L8EA 1A95A 1GXSA 3W1EA 4D9EA 3NPMA 1I0IA 2CWWA 2O23A 1BTOA 3HNPA 5BPHA 2CNBA 3IDSA 3SSAA 4B8ZA 4QREA 4U7JA 5FFFA 4E6PA 4R2LA 3JASA 1HM5A 3TNLA 3NJ4A 5J63A 5JWHA 3L4KA 3WJAA 4I36A 2Q5LA 5ALNA 2J32A 3F90A 3X1MA 1PR1A 2OMKA 3DWIA 4BNWA 3SCZA 3WKAA 3TNDA 2CXHA 1ENPA 3ZDRA 5C4MA 1G0OA 3INYA 3KT0A 3ONDA 3BT7A 3ABOB 3A0RB 4HRYA 4B6SA 4OMDA 1N6IA 4WGFA 4DRXA 4KR6A 1N5RA 4OB6A 2VF4X 1VMIA 1VIDA 1JZQA 3I37X 1CIPA 2VT2A 5LB2A 4P22A 1N9ZA 3F73A 4MCJA 4WASA 3RO7A 1JDPA 1D2AA 3H19A 4WWHA 4EYGA 1KEZA 2FPPB 3QWFA 3X1WA 1KOJA 2O2ZA 2B5VA 3LJKA 3TTYA 2JCXA 4DMHA 4US2R 1BFKA 3O3NB 4MW7A 1D09A 3VSAA 3SYKA 1V8OA 2DUJA 5ESXA 1MTZA 2ORVA 4ZU3A 1J0BA 1X1EA 3KQUA 5E9WA 5I4CA 2GRUA 2IV7A 2DTXA 3PFKA 3IIKA 8LDHA 4GQIA 3DHYA 2YCLA 1K6IA 3QYFA 5BOVA 4D57A 3TRFA 3HZRA 3CW8X 3OCZA 3VZSA 1K9VF 2IDKA 4NG4A 4KR7A 1KI6A 2V7UA 4LCBA 1Q22A 4PLHA 1JFRA 3L02A 3IT0A 4J90A 4YQFA 1HO3A 1Q14A 1U9JA 2R66A 3FNGA 4NE7A 1L4KA 4WNYA 4DYDA 3EXEA 3L7AA 3MSCA 1FFYA 3HDTA 4IIXA 1SBTA 3TE6A 3AT1A 2ABWA 1NM5A 4DXAA 4P98A 1PVDA 3LXUX 4B75A 3KZNA 4HAWA 3UO8B 1JNYA 2CE2X 3LY5A 1J24A 2GZRA 4N0MA 4WNAB 4ENSA 3CISA 5MGBA 1A2QA 4TTTS 2VXCA 5E9QA 3F5DA 5CT4A 5ALIA 5FLEX 3S70A 1TTTA 3JD4A 1QFYA 3GHYA 3FFAA 2QLFA 3MTEA 3H5VA 3G2LA 4NATA 5F35A 4QBKA 4X8HA 4W5QA 4M9QA 1CRZA 2P62A 4NYIR 1R37A 1W5BA 3C48A 3HVIA 1PT9A 4RPCA 4EY4A 1SIWA 4LBVA 2ZAMA 4J1TA 1LBTA 3PSHA 1F9EA 5ICFA 1GADO 5J5CA 5KHLB 3U7RA 2YVQA 1BW9B 3C6QA 3CTPA 1TCAA 3SNKA 1UUFA 3C3PA 2IP4A 4Z2YA 1ISFA 3ETHA 4AMYA 3ZZ1A 3A2NA 4WACA 3TVDA 2POQX 4JJAA 5IANA 1H3NA 4B6FA 4C21A 5I7UA 3CXUA 1WXGA 4YIHA 1TM7E 2BEVA 5J2TA 3IBGA 4ZCLA 1X19A 4FHZA 5AJXA 3Q7SA 5H02A 1TA4A 4KXVA 2VZ0A 4UHFA 3V5NA 2D3TA 3CVXA 1VCOA 2BFNA 2IHUA 2Q5FA 2QPOA 5FPTA 5HUHA 4YJHA 3CBGA 1I80A 3N75A 4HZUA 3CO5A 3V4PB 4HTAA 4JX9A 1VG8A 3Q12A 1E8MA 1G64A 2BI7A 2QLNA 3AESB 4XI9A 2ZBFA 3VUFA 1WXXA 3BF7A 4F1WA 5HQJA 1N5MA 3DOEA 2JEZA 2QA5A 2Z2ZA 4LPSA 2C7BA 2HMUA 2JAHA 3WFIA 3MB5A 3Q7PA 2L0XA 4BAZA 2EYUA 1QJ4A 1UOOA 4KMOA 2WU3A 1O6CA 1R5JA 2UUAB 2X8AA 2AR7A 4KXUA 4CU5A 4JZYA 1M1YB 2BC9A 4IIGA 5KTRA 4X85A 1YMVA 3SEFA 1CNFA 1MC4A 3L0BA 3VR2D 2QTTA 2ERXA 3N0RA 2DM6A 2QQEA 1VHWA 1QC5A 2HGZA 4EG8A 2I78A 2WWRA 2QGZA 1Z8HA 2DLCX 2BHRA 3HHEA 3EXHA 4E2WA 2WJ6A 4TUYA 1W5SA 1G2OA 4Q3OA 2B2CA 1R8JA 2J5BA 1G20B 1YACA 2G1KA 3PQ5A 3RJZA 5LXTA 1W9HA 2I99A 3CYFA 3LNCA 3M6IA 4QTZA 4BAUA 3JWEA 1FMJA 4DLPA 3U3OA 4YFVA 4JB8A 1Z06A 3FVWA 1KYWA 2W93A 1S2GA 2HZ7A 4RORA 3V8MA 4DIEA 2PGAA 4M76B 5IUKC 1QIEA 2B25A 4UQLA 3I72A 4XSVA 3UT6A 1JU3A 3K09C 3K1AA 4QOGA 4QUBA 2VPIA 4V0KA 1BX3A 3OPVA 1UDCA 1NSFA 4HO1X 3W2IA 1MO4A 1P62B 1YRBA 2ODNA 4RY0A 5EJIA 3VHLB 4XYEA 1X1RA 3HGQA 4OKIA 5EIOA 2OR3A 1RNLA 3KV3O 4MVJE 4G24A 1OKKA 2PA0A 2IZ5A 1I6KA 4CMEA 2XE4A 3WXMA 5IF3A 4O33A 2YS7A 4GXTA 5HM8A 1CDEA 4BPBA 5FA8A 1B6RA 2C99A 5D3MB 3LVFO 4IM7A 1DQPA 3N8GA 2WWYA 4FMPA 4LN1A 3RUDA 3Q8MA 2JGAA 1I3LA 4HEQA 1KZ7B 3O8CA 2BKUA 5DNEA 3IOBA 1XO1A 1IAQA 3MFYA 2VDWA 4U7GA 1T9AA 3QNMA 3DAHA 1TKCA 2FW7A 4MQ4A 4YRBA 5FX2A 2OAGA 4OJTA 4D9MA 2X2FA 4FNGA 1DLIA 1U2DA 1Y6QA 3ZV6A 4O2RA 4OP1A 3RREA 4AO6A 3MWFA 1IPHA 4B40A 4HVAA 4DTCA 4ZI7A 2QL7A 4P7BA 5L95A 2QKYA 1FW6A 1UMDB 3OC0A 3ROKA 1OY1A 1FUEA 521PA 2EX0A 2HW8A 3L04A 3MTDA 3R4VA 2HLPA 4OLFA 1IDOA 2PJZA 3CUVA 4FW8A 3T12A 2XH8A 3ABSB 1Z39A 1VYUA 2OHXA 2OXIA 1F38A 1HE2A 3EQZA 3WSWA 5B7GA 2V9ZA 3G0DA 3HI6A 5AW5A 5C52B 1Q1NA 1Q20A 1T6XA 1Y34E 3BD7A 4MRPA 4F04A 4G89A 5FUMA 1I7PA 1E1CA 2QB5A 4RTSA 1KE1A 4RQTA 3TYXA 3INNA 1FRVA 3NAZA 4AUKA 1WCIB 4H7IA 4RF5A 4L6CA 1B2LA 3CLUC 4J9UE 1DOHA 2CVPA 2PVPA 3TAHA 2H2WA 3RUIA 4NFSA 2OYRA 4DPMA 5A0FA 3BD9A 1IXSB 4BJHB 3KVRA 1OXUA 1YS9A 2PGXA 1X8JA 2E49A 1L7PA 2JKVA 2YFHA 1PVOA 3QK7A 2EBWA 3WYBA 2PZBA 3C3KA 1T2CA 1YBFA 4BVGA 3C6YA 3QE0A 4IDNA 1MPXA 2OV8A 1P45A 4ZPJA 1YZLA 3PUJA 3VXKA 1Z6YA 5AW6A 1N77A 4XRRA 1XQYA 3C3CA 2PKYX 1QZUA 2O3JA 4WJLA 2AMFA 5JCJA 4L08A 3IEVA 3NM5A 1EJBA 3K94A 4MRAA 3B3QA 4MYHA 3BXPA 3KBBA 3OBBA 1O57A 2H3EA 4G4SP 4GQBA 5H4HA 3VZDA 2I55A 2OEPA 4D4GA 3C1AA 2TRSB 3RASA 1M10A 4HOYA 3RG8A 3T0GA 4ALNA 1ZW6A 5H5JA 3OO0A 2AFHA 1CY4A 4LVNA 1XZMA 5IT0A 3V7NA 2GHIA 2QM3A 4IPTA 3IBSA 3G2NA 4JUBA 5DGDA 1ZH2A 2B36A 1LI5A 3LW7A 3NBKA 3O8RA 2ZEJA 3DOFA 3HCOA 5AI0A 3UA4A 3WHLA 2BKEA 4INJA 2PBLA 4L3WA 3S2ZA 4OBEA 3WQHA 4FCCA 1SVNA 2XI4A 3UFBA 5DYYA 2FGJA 2WP8J 2PQ2A 4B8WA 4FFLA 4TLBA 2JLUA 1N2IA 1XQ1A 4TS1A 4CKXA 4ERNA 4EW2A 3JQFA 3ZVLA 1MB0A 1RLUA 1YRYE 1Z25A 4X8MA 3TNYA 4G0NA 2HPHA 4F12A 1FNDA 2H2DA 2WIBA 1ND5A 4DV7B 1FDSA 2VRCA 3HKEA 4EFLA 4IZIA 5J2TF 1N7HA 2NYAA 5I8PA 2J9GA 2PKRA 3NGXA 5GMOA 4J0JA 4WKGA 2XBUA 4CG2A 2ZT7A 3M8KA 4IFEA 3KS9A 2F43A 2QJRA 5TF4A 1HETA 2QRLA 2HPVA 2DPLA 3OLVA 5ECGC 4IXWA 1XF1A 2COUA 1U3GA 3X1ZA 1GQFA 2ENUA 3MWGA 4DSOA 4YMTA 2UZ1A 1AS2A 2EDAA 2XKBA 2A9RA 3E53A 3LOQA 1N2EA 2EGGA 3CUYA 4MV8A 4UZFA 4FDLA 4I9NA 4DCUA 1R0RE 1U28A 1R6VA 2AEJA 3P0EA 2JATA 2B1IA 3BMNA 3PGKA 3Q41A 4K40A 4O2BB 3TO5A 3CNQS 4WCVA 2ZIFA 3DW3X 5AK3A 5H4GA 5DSTA 3A1CA 1AV6A 1NU6A 4BLRA 1BA2A 3CLTC 4JVOA 1WXFA 1QH9A 3N2LA 1OJLA 3JAWA 4C6TB 4TMFA 5IM4F 4KQ2A 1SXHA 3O1IC 3HBMA 4KVGA 4GZMA 1CXZA 4ND5A 3HRIA 5CXQA 4IIHA 1YVDA 1RQ2A 2A9KA 4CL3A 3N76A 1ORDA 4RDHA 2BSXA 1LS1A 2X6TA 4JQYA 1DKMA 2NZ2A 3DR5A 4IIVA 1NVXQ 2XXJA 4OX9Y 3B48A 4MW0A 1N92A 2B5OA 2WM3A 3TZHA 1R4AA 4WFKA 3Q4GA 4BC1A 1MRNA 2FWMX 1PBTA 1T25A 5KAMA 4PY2A 3ZTYA 2DQSA 2BP7A 2E5WA 3C7TA 3EGXA 4O1HA 3FTPA 4NQRA 4KN6A 3OOEA 1UBUS 2E4XA 1KU6A 4J7CA 2WE8A 4QYIB 1P9LA 1S3SA 3DFMA 3RS5A 2GEBA 3RTAA 2A35A 4NK5A 3CZ4A 1T5TA 3BAFA 3KR1A 4LJ5A 1BGXT 2ID7A 1P1BA 2ZSJA 2D5AA 3B85A 3EC1A 4JKIA 2B4AA 4QAJA 2PZGA 3TFWA 4F85A 1E7YA 4QM7A 1ZM3A 4RA9B 1NZJA 4WXYB 2QQ0A 5CGQB 1FJ2A 2X58A 3CCCA 4CDMA 3UT5A 4EPYA 1MA0A 4P81A 4WBNA 1YZKA 3PFCA 1CUUA 3JD0A 4G67A 3N2GB 4HC4A 3GNQA 4PZYA 4RF4A 1ZK2A 1HZJA 3LQQA 5GONB 1EUZA 1XKXA 5ICCA 1T0PA 2SKEA 4WZAB 4UCQA 3DULA 2FG7C 3BVPA 4RYDA 1JQ5A 3RFFA 1SC1A 3JTEA 3RSSA 3TXYA 1P2DA 1T3LA 3FWNA 1KEVA 4IILA 5AHKA 4QJ3A 2VBCA 5KYXB 2IZ6A 2WPNA 1O0CA 1GUBA 1A5BB 221PA 4JEHA 3BEDA 3D5EA 1ESMA 5GIPE 2GBPA 3EOZA 2GCNA 5ITZB 3IBFA 3I23A 4D4IA 3ONEA 1D4OA 5KYUB 3NWPA 4DVJA 4WA7A 1ACLA 4ZKDA 1PD0A 2XVMA 4IIEA 2ZB8A 4XUEA 5AQ1A 5ICMA 1XX6A 2VJLA 4BLQA 1JIXA 5DF1A 3N2EA 3NHWA 2G9QA 3CWZA 1VL8A 2XY4A 3D4OA 2VDVE 4IIDA 1DEOA 4ER0A 3AY7A 4FYKA 1YC5A 1YDEA 3FRHA 3IV7A 2AK3A 5EZ5A 3TI9A 2ILVA 1XCGB 1H5NA 1N9GA 1XFAA 2JEYA 3WP1B 2Q28A 3C1TA 3J81k 1HE4A 1XV5A 3KWMA 5J9FA 1U3UA 5CEJA 3U4HA 3EG9A 2XZLA 3B52X 5I7SA 1NBAA 3G7UA 3RRZA 1B8UA 4EFKA 5TPZA 3GRKA 3UUEA 4YGXB 2B35A 2WVAA 1UJBA 3T6KA 2D3WA 4M9RA 1N34B 1VXRA 3HO8A 2M6RA 2W2KB 3WTBA 3TSYA 1IJFA 2QQGA 4M1KA 3ZJUA 2PH5A 5DMHA 3L8DA 3BFXA 1UFKA 4L4ZA 2CMKA 2FG5A 4L3VA 3OBIA 4Q4HA 5K45A 2ZYTX 2VT6A 4H31A 1F8FA 2V7TA 5EZSA 3N87A 4Q39A 3E15A 3RVOA 3CV3A 2YFQA 3RSLA 3U80A 2GAFA 1SBCA 3FCOA 4F5YA 2B8EA 2PV0A 5A6SA 1KYIA 2EAUA 5DXJA 1QH1B 1ONBA 2QE7A 4A2QA 5KX5F 1YQQA 3MD0A 4JBXA 2J3JA 4W1RA 3S40A 1NNSA 3SR3A 2G63A 3WGZA 1VPWA 4PG5A 2X7XA 3ESQA 1I2DA 2OCIA 4ZQEA 4BB5A 2ZUTA 3AR7A 4EECA 4KU4A 3CHYA 2DWPA 4PZDA 4TRRA 3SBDA 4I3GA 3E8XA 4CDNA 3PQ7A 2FEPA 3LP8A 3WY9A 1TZ2A 4Q05A 3MXOA 4RTKA 2C7QA 5G1OA 4KOAA 2FSPA 3N5KA 3HDVA 3W3AH 1GP2A 3C14C 5CK5A 4ARZA 5KU1A 1Q0PA 5A5VA 1ZO8A 2XAUA 3WX0A 1QUEA 1JDNA 1GRVA 1JQJC 2W22A 3LWBA 5F64A 3NRCA 2YIDA 3I9V6 5JPIA 2EG5A 3HV0A 1TOAA 3TR6A 5KDOA 3GUZA 4JVSB 3AU9A 3G9XA 1XTUA 5CPFA 2Q8NA 4DLTA 1ZJ6A 4YUWA 3QF7A 3RUEA 2LNDA 1K7FB 3OCWA 3ZUPA 2AS0A 3C1UA 1EP3B 5HKOA 2JGLA 4CETA 3ZE8A 2HHAA 4MVCA 1F4PA 5AM3A 1VBNA 2WWXA 3QLVA 5BN3B 4RPJA 3BK1A 3KZMA 4Q3NA 4MLPA 2CVOA 1CF4A 4CM6A 4QYSA 4PAGA 5AJVB 2XB2A 2BEUA 1M6NA 5KX5A 4V0MA 1Y82A 2CF5A 5IT4A 2HFJA 1JALA 1DLJA 1THMA 3TRKA 1WP4A 2WWTA 4HZIA 5EPUA 3U6KA 1IB0A 3LG2A