4G0MA

Crystal structure of arabidopsis thaliana ago2 mid domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
b'SIVKHWAVLDFTASERFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein argonaute 2
publication title Arabidopsis Argonaute MID domains use their nucleotide specificity loop to sort small RNAs.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 43
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g0mA00
3JS5A 4Z4FA 2Q5CA 6CHYA 1XWWA 1JBEA 1ABFA 4KQCA 4TLLB 4XFKA 3LOPA 1Z26A 3H1FA 3H5IA 4WZZA 4G86A 1ABEA 4JB0A 3OM0A 3URMA 4JAVC 4W5TA 1A04A 2V0NA 3C3WA 3FMVA 3Q15C 1HEYA 2HJ9A 4MS4A 2FN9A 3O1IC 4EYKA 3QLUA 1D2AA 1NXWA 4YR7A 4S05A 3QEMA 4RK0A 4RK4A 1QQBA 1SXGA 1NXOA 1NXSA 3N0RA 4JA2A 3QLVC 4JOQA 2HQBA 2FVYA 2RGYA 4MS3B 1NXXA 4OATA 3CU5A 3H1EA 1JYFA 4F3TA 3F6PA 3B2NA 4IILA 3IP5A 2M1ZA 4KFCA 4QPJC 1E2BA 4HNQA 3I5AA 3LTEA 1ZESA 2JBAB 4PICA 4B09A 1DBQA 3RVRA 4KK3A 1TVMA 3DZDA 3GA5A 1D4ZA 4FE7A 5CNIA 2PL9A 1ZITA 4MR9A 1W25A 3RVOA 3QLVA 4O5AA 5T7BA 5JNSA 5JNTA 1EAYA 1TM2A 3O75A 3HO1A 4MRMB 3LMKA 3N0XA 3RQIA 1DBWA 2IKSA 3BILA 3N0WA 3ROFA 3CTPA 3DGFC 2OQRA 2RDMA 5ABPA 5DLEA 1JYEA 2MSLA 3OQNA 2W42A 2FEPA 1DC7A 5TE9A 3TX6A 4EYQA 3LUCA 2PKXA 3BBLA 4IGAA 1ZHHA 4L4UA 3KS9A 1ZAYA 4E7PA 3O74A 4LZLA 1NTRA 3OM1A 3N53A 3N75A 1Z13A 5KQGA 5JS1A 4MQEB 4MPTA 2QSJA 4EYGA 3OQMA 5IEBA 5CNMA 1USGA 1DRJA 1D5WA 1BA2A 1ZDMA 2GI4A 5TPZA 4D74A 1DP4A 2FMKA 2QXYA 4LDZA 4RK5A 2LIVA 3EQZA 1NXPA 3H5VA 2PUEA 1JDNA 5JNVA 1DBPA 1KRXA 2HQOA 3K9CA 2E4YA 5GOTA 2QVGA 7ABPA 2F8TA 3GBVA 4XLTA 2R25B 3KTOA 5EWJB 1D1QA 1YVUA 3T8YA 5TQ2B 4O1IA 3FFXA 4OTZA 2NT3A 1ZH4A 2RJNA 1ZGGA 2CWDA 1BVHA 3OLZA 5TQ0B 3DLHA 3T6KA 3Q9SA 2JCGA 1L5ZA 3CG4A 2IDMA 4P1ZA 1EFAA 2GBPA 3F6CA 3FFWA 2MSWA 4Z99A 3HEBA 4Z4GA 1PEAA 3G1WA 1GUBA 3SNKA 2E4UA 2PUFA 3I09A 1U8TA 1R8JA 4Z9AA 4FB4A 2QVCA 5C5CA 4XASA 5IBQA 3VNAA 4ETNA 4HNRA 1C0EA 3KCNA 1USKA 4MAAA 4WT7A 1APBA 1S8NA 2E4XA 2N9UA 4PYRA 4H3HB 2CD7A 2FTKE 1QO0A 1QPZA 2I6FA 1EHCA 4D6YA 3DLBA 3ROTA 2QZJA 4IMIB 5PNTA 3ILYA 5HM6A 3RVNA 4MR8A 2JBAA 3MF4A 5KC9A 4KREA 1VLZA 1JX6A 2R47A 3IDOA 5FBHA 4W5QA 3MM4A 2NT4A 3FFTA 4EVQA 4N41A 4GNRA 3JPWA 5B3JC 1H9CA 4Z4HA 1M2EA 2NZUG 3CLKA 2YHAA 2PE5A 3JVDA 2BGGA 4G0OA 4W5OA 5EWLB 1JFSA 1P6QA 4KRFA 3NNDA 4N76A 4EUKA 2VYCA 2IYNA 1LJUA 1SRRA 4KV7A 5DTEA 3HJFA 3Q7RA 4ML3A 4W5RA 3MQ4A 2L18A 1JLKA 3F7NA 3BREA 1EWVA 4Q6BA 3RVQA 5B3JA 3LKVA 4HNSA 4G0PA 3H5TA 4YCSA 3T38A 3IP6A 5HKOA 1JFVA 3R0JA 1GUDA 1RNLA 4XARA 3OLYA 3BRSA 3EGCA 3EDCA 3SM9A 1IIBA 1E6MA 4MR7A 3DBIA 4ZJPA 5FWYA 2PUBA 1QP0A 2WMYA 1JHZA 4DN6A 4G0XA 5C5EA 4OLAA 3CNBA 2IPMA 1JDPA 4EGSA 2XDYA 3KSMA 4IRXA 2JVJA 3OO1A 4LDAA 4RWEA 2PUGA 6ABPA 3JPYA 2VUHB 3LKBA 5IUJC 1BDHA 2IPNA 3IPCA 3QLUC 8ABPA 1LK0A 4MQFB 4MS1B 1P6UA 1E6LA 3EQ2A 2NUBA 3C3MA 4RXTA 3RH0A 2ID7A 3E61A 3LUDA 2OENG 2WY2D 1D1PA 2FKAA 3EAFA 4RKRA 2LPMA 4MLCA 3UUGA 3M9WA 4JP1A 3HDGA 4MLDA 4OLBA 1ISSA 4JB2A 5IX8A 2B4AA 3ILHA 3HS3A 1ZH2A 5IC5A 5TPZD 1WETA 3EULA 2F8SA 3Q41A 3DGEC 2LUOA 4Z4EA 1K68A 3NHZA 3CZ5A 4PE5B 1NY5A 1KGSA 1U04A 2QR3A 3H6HA 3QEKA 3HSYA 1CYEA 3HUTA 2B1JA 4TN5A 2GWRA 2FMHA 5JNRA 1JL3A 4KK4A 2HSGA 3KLNA 2KYRA 1YMVA 1KMIY 4UHKA 1MIHA 2FEKA 3A0RB 2PJUA 3T95A 1QNLA 5EWLA 5KI6A 1QKKA 5KWSA 3L49A 2L17A 3TB6A 1F51E 5BRJA 1KRWA 4Z4IA 2R48A 5FWXB 1TLFA 1EWTA 1W9HA 3N6VA 5TPWA 1DG9A 5HSGA 1K66A 4RK1A 1MAVA 2ZAYA 3HXMA 1Z18A 3CS3A 5BR1A 4RXUA 1Y1LA 4QICA 4P98A 2E4VA 3QELB 3RVKA 3C3KA 2WRZA 1YTUA 1T34A 4JASB 1VPWA 1Z2EA 4F06A 1QO0D 3LUKA 3CKMA 3OO0A 3H5OA 2FMIA 4F8JA 1PEYA 4RK6A 3LUGA 3VNBA 2FMFA 3O2SB 4G0YA 1LBIA 3MIZA 1M5UA 3CZCA 2ZWMA 3OLWA 1U2QA 1DCFA 1CHNA 4LE0A 1OXBB 4LE1A 2FN8A 3IP7A 2MYNA 3HVRA 1FFSA 4PZ0A 5BRAA 4YV7A 3M6MD 4MS4B 2VK2A 1BAPA 4IMJB 5CNKA 4YS6A 4MS3A 5EWMB 4Q7EA 3G85A 2PL1A 5IUKC 5ED4A 4KVFA 4NCBA 4Y9TA 4YWHA 3OQOA 2ID9A 3IP9A 5I4CA 4MYRA 2QV0A 5DKFA 4S04A 4FE4A 2P9HA 4O1HA 3HCWA 2E4ZA 3H75A 1LBHA 3RVSA 2J48A 3OMXA 4YP9A 3GL9A 1XHEA 1BDIA 3EODA 4MRMA 9ABPA 1VRVA 2FXIA 1M5TA 3FGZA 3KKEA 4N0PA 4G0MA 3MMNA 4TLMB 5FBKA 1ZY2A 4Q6WA 1L5YA 2O20A 3MA0A 1SXHA 3MYYA 1RXIA 1Z2DA 4ZYLA 1RZRA 2YHBA 1FQWA 1SD5A 5KQLA 4TMYA 2NZVG 4ZPJA 5JNUA 3TO5A 2A9PA 2FLKA 4MQEA 1DJMA 4F11A 3IPAA 5BQ3A 3L6UA 4LRQA 3LUJA 3LUHA 4F12A 1QMPA 5JS2A 4RZSA 5TQJA 3F73A 2CHFA 4N0QA 1GCAA 1UDRA 1JFTA 3GT7A 3HZHA 1A0OA 4RXMA 4HYEA 5EWJA 5E3JA 1JH9A 2CHEA 5TQ2A 4QYWA 4DQDA 4ZMRA 3A0UA 1AB6A 3CG0A 4RDCA 3UK0A 4YLEA 1YMUA 1E6KA 2AYXA 3W9SA 3OLVA 3Q7TA 3CHYA 2JK1A 3I42A 5TQ0A 3RVPA 3O2QB 5DCLA 4WXMA 1RXEA 2A9RA 1NXTA 3RVJA 4RV5A 2PUCA 1PNTA 3SAJA 3NNSA 1YS7A 4H60A 1FFGA 1DCKA 3QLTA 3KLOA 1YK0A 5IEJA 3CRNA 5IULC 2WWVD 5EWMA 3GRCA 2L2QA 3LUAA 3SG0A 4ETIA 2LP4Y 3FDFA 4NICA 4KNYA 2IPLA 2A9QA 3H1GA 1MB0A 2X7XA 3Q7SA 3A10A 4KMRA 1NATA 5T3YA 2MSKA 1J56A 4WXEA 1JWLA 3HV2A 3TMYA 2LBPA 4PEVA 2MYTA 1YIOA 4RS3A 3KYJB 4WUTA 5CNJA 3S99A 4E7OA 4Z9BA 4NQRA 5DGCA 4EVSA 2PMCA 1RPJA 3KHTA 1PHRA 1U0SY 1F4VA 3D02A 1USIA 4L85A 1M2FA 4LE2A 3M9XA 4EYOA 1U2PA 4MR8B 4XAQA 1I3CA 1MB3A 2GKGA 4RY8A 4H3KB 1EWKA 1NXVA 4EY3A 5KQPA 3QX9A 1FSPA 1SXIA 3HDVA 2R4QA 4ETMA 3TD9A 1CEYA 2AYZA 1TMYA 2QW1A 4G0ZA 2FQXA 3QX8A 2FW0A 2GX6A 3O2JA 1ISRA 1DC8A 3SY8A 3HUUA 2IPAB 1PNRA 2E4WA 5HQJA 2QU7A 3KG2A 2M98A 2A9OA 2IOYA 5CHYA 2MYUA 1FFWA 4N03A 4YGXB 1Z25A 3JVIA 4RKQA 2WJWA 2PUAA 1PUXA 3E3MA 1YK1A 4KZKA 3D8UA 5F64A 5KC8A 4OBBA 1OXKB 3GYBA 1Z15A 1GCGA 3P9YA 4MR7B 5FWYB 4N47A 3GWGA 2PUDA 1Z16A 4DADA 4NV3A 4EVRA 4MQFA 3HM9A 4MS1A 3LFTA 1AB5A 1QP7A 4KPYA 2H3HA 3I45A 3KYIB 3N8IA 4OG2A 2FEWB 4RY0A 4IF4A 1RZRD 3QEMB 3JTEA 1YS6A 2FQWA 5KQMA 1QQAA 5IUNC 4UHJA 2FSPA 3OMWA 4NCAA 4YO7A 4Z4CA 3RVMA 2HQRA 1ZVVA 1DRKA 4KQ9A 3HK2A 3LUFA 4W5NA 3QK7A 1B00A 3CFYA 3NBMA 3SQNA 2L19A 1MVOA 3GBPA 2HPHA 3KJXA 3NNNA 4WWHA 4Z0NA 1A2OA 4M88A 4YRZA 4RY9A 3K4HA 2VUIB 2PLNA 5D2CA 3JY6A 3NHMA 1JF8A 4G97A 4G0QA 2PAFA 2TMYA 4MR9B 1ZN2A 3H6GA 1URPA 3GV0A 4LX8A 1DCMA 3OLXA 5JNWA 4GPAA 1ZGZA 3UKJA 4RSMA 3C97A 1BDJA 3O21A 2WB4A 2FLWA 2P4UA 4D6XA 1P2FA 5FWXA 1QP4A 1Z12A 2JB9A 2MYPA 4XXHA 1GLGA 3H5WA 5GQSA 2FQYA 2RJOA 2WJAA 3RVLA 3EJWA 3O1JC 3QELA 4QYMA 2JVKA 1LJLA 3H5LA 1C4WA 4RU1A 1XHFA 2H0AA 4RK7A 4ZMSA 1VKRA 3A3KA 3C6QA 5TPWB 1Z17A 2JRLA 4MGEA 1P8AA 4CBVA 1DZ3A 3BRQA 2DRIA 3O1HB 1TJYA 2JVIA
chains in the Genus database with same CATH superfamily
3JS5A 2HHJA 3NBKA 2W0SA 3DYBA 2F8MA 3REGA 2D06A 1AKRA 1KI1A 2YIDA 4FFNA 4LZOA 3WAJA 2ZBUA 3IR7A 4B17A 2Z9CA 5JXGA 5LL6P 1ZRHA 4E0BA 3IPXA 4FHGA 4RAOA 4LJLA 3IL2A 2I03A 1EK5A 5FI3A 3Q15C 3UIEA 2HJ9A 5IYZF 4MS4A 4R6WA 3T1YB 2P5YA 5TLSA 1NW9B 5LB4A 3K2EA 3DHVA 1VFPA 3ENWA 3Q3IA 1V16A 4I1YA 2I55A 5K5EA 1BRMA 5HS6A 2I22A 3KYBA 3V2IA 1VG9B 3N0RA 3U48A 4ZOEA 1YIAA 3HSSA 3KQPA 1QFSA 3KQVA 3VX3A 1SC3A 3LW8A 1M1XB 4CI9A 2CVFA 4UM9D 3BGWA 1FBTA 1BOFA 3R9WA 1X1SA 3SQXA 3VKHA 1JYFA 1WPXA 1ZM9A 2YH2A 5KCMA 4ECAA 4AZ3B 1S1MA 1W48A 1ZMXA 2JFBA 3HLYA 3SK0A 2NU6A 4O4HF 3ZZNA 3ZE7A 5ISMA 2VNIA 4GHWA 2GBIA 2DPLA 1I3OA 5E2AA 1UFQA 3TLXA 1A1VA 3O3CA 4YK7A 1C7RA 1QH9A 4H7HA 1UMCB 2ZYTX 4HTFA 4KMMA 2K6GA 5ALJA 2BUAA 3V4OA 3VHXA 1XCLA 3IAM1 1I10A 4LF4B 4RE5A 3BTUA 2CXOA 3BIWA 4U7WA 3TSAA 1XJ0A 3ISTA 3OH8A 1GPUA 3N0XA 3ZW8A 1X1DA 1D6MA 1NFQA 3EVBA 3L0SA 4L9AA 3FI0A 3N0WA 3RI3A 3EYAA 3ZWNA 1GPDG 5H80A 3RAFC 1JIXA 1NE7A 3DLTA 1PKXA 2OG1A 2MSLA 3U37A 3L4JA 1LLFA 5EN4A 1WXXA 1TQ2A 3FNQA 2GCIA 3DEYX 4R4JA 1GT6A 1GZUA 3IBFA 4NWIA 4WERA 4F96A 4UVHA 7MHTA 4PX9A 2C20A 4XI9A 4ADSG 5KQGA 3OM1A 4MPPA 1IBLB 5K3CA 2BMWA 4CLRA 1MAUA 4B35A 2AK3A 5LXTA 2HLPA 4F5YA 1IPFA 1B6RA 1E7WA 1EM8B 2ZAMA 1ZDMA 3HWRA 3AF5A 5TPZA 4LNUB 1DP4A 1C0PA 1Q14A 2PMKA 3ZR4B 4AQDA 1NF2A 2ZLBA 1KRXA 1OSNA 4M83A 4QHTA 1PYOA 1P0MA 1WCIB 1B6TA 1KI2A 1JS1X 5ITVA 3S7ZA 2AJCA 3IQFA 5EWJB 5K20A 2F9MA 2W6JA 1YC5A 1CUZA 2R79A 4X6UA 2I2XB 3BIOA 1WQ4A 1XEXA 1E9BA 2B0CA 3B89A 3KDAA 4EPTA 3BH6A 3KT6A 1XMJA 3PE4A 4MWBA 4P4GA 4V0MA 3T6KA 3DZCA 2IV3A 2QP4A 1SBCA 5FR1A 3MJSA 1GO2A 3FYUC 1JKJA 1XZLA 1ZN9A 1QH1A 3EMDA 2Z9BA 3F5MA 3GN2A 2KBFA 5FD8A 4RTPA 1U8TA 5LN1A 4I4IA 3WE7A 5EZQA 2C4KA 3I5UA 2POQX 3TPFA 4EW3A 3CWZA 3ZGOA 1ZD5A 1T2UA 3TRHA 1CQIA 4C3VA 1H1LB 2QNBA 2E7ZA 3IELA 1N6OA 3KVNA 1ZL0A 3T61A 5J43A 2ZWIA 2QZJA 3I72A 3VU8A 3FYUA 4H2DA 2XUFA 4Q4DA 3NIBA 4YI5A 3A2LA 4KJZA 4QXMA 5H3CA 1G55A 2CNKA 4UTVA 1UT6A 2PU5A 3IDOA 1E98A 3SF0A 1SVSA 4N18A 3UJ9A 5BUQA 4J75A 4YT5A 1I24A 2V9PA 3L79A 4EVQA 3U9TA 4BNDB 2X4LA 3FF1A 2B1IA 2CSUA 2PLWA 2W6NA 3JPWA 2CZCA 4ZAVA 4KKXB 2NZUG 2RGAA 2YXDA 4KFSA 3ESYA 2P3SA 2PA0A 5AICA 5G3ZA 4CMHA 3U9SA 1JEQB 3LHFA 3M5WA 3CN7A 3W5BA 2RGBA 3I0ZA 4O1MA 1UP6A 3SHQA 5CIYA 1JSRA 5LD2B 4TYYA 1P1KA 4EUKA 3NDRA 3V1YA 2KHZA 3MJCA 3KZCA 1IL0A 2X8BA 3VR4H 3WLOA 3ZPXA 2Z08A 3Q7PA 1RLMA 4DOMA 4W5RA 2DFPA 2FCAA 1X1TA 2PKEA 5GP1A 1VLLA 4J4HA 4II2A 1VBMA 2MJLA 4HX2A 4CLEA 4F6RA 1P2BA 3LY5A 4IIJB 4LJ4A 4UARA 1N2CA 3ZD6A 2CF5A 1A9XB 1SCNE 1T1JA 3B6EA 1E3EA 1NGSA 3L7AA 1BA3A 3MJHA 4NCNA 2FOXA 3L4BC 1RNLA 1QHYA 1XZAA 2EJTA 4EA8A 3C48A 2QY9A 3G5MA 3ND8A 3A6PC 4JLKA 4CLOB 3DLCA 5E7QA 4KO4S 5EMMA 1RWMA 1CUDA 1VQ1A 3CNBA 3E1SA 2FZ5A 3FHOA 3HJCA 4LECA 4OY3A 4C30A 1EZZA 3ZNQA 1D2EA 2ORED 2O2JA 3KSMA 4G07A 5IARA 4AJEA 1YDWA 2I7DA 1A9OA 4PHHA 1NMQA 3OO1A 4ALIA 5KYXB 1Z7GA 2VUHB 1IIRA 4OGLA 5D1NA 5J4KA 4HJXA 5TIIA 1ZD1A 3L4BA 1P7ZA 1QS0B 4HBZA 5DISB 5EHQA 3LX8A 1L7NA 1SWVA 1TM5E 1ZGAA 2Q1UA 4MYUA 4XOIA 1IC6A 1BYUA 2A14A 1WBJB 2GTPA 2ID7A 2OCGA 3RK0A 3ASZA 1FRQA 1U4OA 3IAS6 4PGFA 4URVR 1S4MA 1CUFA 1IZ0A 4ER0A 1HDYA 5E0OA 3VM6A 4NH4A 1KDZA 1TOAA 4PBSA 3WOHA 1EWYA 1R6BX 5KOJB 4E4YA 1NQAO 4RZIA 4KFTA 5G1OA 4GIBA 2WPDA 2ZT5A 4R1MA 3QVXA 4ZIRB 2CZGA 3EG9B 3LDAA 4YC7A 4H17A 1MFZA 3JAKB 1GPLA 5BXYA 1ODFA 3FCCA 1WETA 1XDZA 3K9NA 1N2IA 4PC1A 2O0JA 4YJFB 3QA3E 5BXQC 5K3BA 4BB0A 5JHHB 2V7PA 3TK1A 2LUOA 1NN0A 4ACBA 4Q19A 2IYTA 3HB1A 4Q7LA 5EP1A 4XQ0A 2XW6A 5DTRA 2PRYA 3KR1A 4AW9A 1MNQA 1NVMB 1CJVC 1J2YA 4LZAA 3UPDA 4Z7NB 2YN0A 3TBHA 3D6JA 2ZRNA 1Q1BA 1Y4SA 2KYRA 2ZAGA 2H3EA 5TT0A 4BKQA 2SKCA 2UYYA 3O8QB 1FYFA 2IS6A 1MT0A 2B4RO 3DSRA 3WV5A 4DSAA 4M7OA 2IVFA 5KVQA 2L17A 4NTZA 1L7RA 2HJVA 1OB2A 4HH4A 2R48A 3GCZA 1Q95A 2ZSKA 4LOAA 5AK3A 2IBSA 5E1OA 1I3KA 4BKUA 2ZBVA 1EJ2A 5A7HA 2FUKA 2QVXX 2V7XA 4OUDB 5ALQA 5JH7B 1J0BA 4RXUA 4X00A 1WMEA 2JI7A 4HDKA 4QICA 4M49A 2Q7DA 5I7HA 3OFNA 4ND8B 2CCGA 3LW7A 4ZAWA 2ZKLA 4ISBA 1XB2A 5BSUA 1BYIA 5I7VA 4M7PA 2VCYA 2ILVA 2H1CA 3K1JA 3IBCA 1GQRA 4CIYA 4GRAA 3OCUA 1U9YA 4P83A 1SCDA 1V2GA 3V9AA 3X2FA 3W9UA 1YCFA 5UKDA 3JQ7A 5AJZA 2K7ZA 2DFLA 1GQQA 3CR3C 5DULA 1BU8A 1KF0A 1W5FA 3KQQA 4GPZA 3BICA 5B57C 3HVRA 4MDFA 3C15C 1KETA 5FNVF 4DY6A 1KFJB 3HKBB 4RIIA 3QV1A 2BGLA 4C4RA 4TUYA 3EXG1 3BT7A 1XTVA 5KYNA 4MS3A 1S0UA 3KM0A 2I7CA 1PP4A 3QKIA 4OMDA 4Z9FA 5IH7A 2WU3A 4RSRA 5JJIA 1XU9A 3SOPA 1Y3IA 3P0RA 4MGYR 4Y9TA 5ER6A 3H19A 1FDVA 3V1NA 2OGZA 4CW7A 3DHNA 5AVRA 1UADA 4DHEA 2HWXA 2VYQA 5FTKA 4TWIA 2PZ8A 3MJVA 3UOWA 3YASA 1GITA 4YRCA 1LBHA 2QN9A 2YWHA 3IQZA 3RVSA 2HZ7A 4R2KA 5P21A 4PLHA 3II6X 5EYPB 4J0DA 2MSNA 2NSJA 3OX4A 5ES4B 3UHJA 3UAYA 3PXCX 1L5FA 1P77A 3ZDAA 2GN4A 3GZNA 3KAKA 1AZSC 5EFZA 1B3RA 4R1TA 2HK6A 1LBQA 1R0XA 3ESXA 4WCFC 5LUBA 1DTEA 3EVTA 4PYLA 3S27A 3VR4A 2UZ0A 3PBKA 5HBRA 5EJ9A 4NARA 4IFEA 4L6CA 3NUGA 3I2HA 2XRFA 2VPTA 4CMEC 4UUMA 2A33A 2AN4A 2QTCA 3HU1A 5FWDA 2CYAA 4H35A 3O8OA 1XD2A 5JANA 3EZ9A 4UNIA 1QGUB 1GQYA 3HA5A 1AKVA 5IC6A 4U2BA 5BW4A 1EGHA 1VHDA 1MGOA 4IXNA 4WCFA 4F12A 4NZPA 5JAPA 1DDIA 1ZJJA 2R87A 3HI4A 3MWGA 5CGZA 3B36A 4POAA 1ZOSA 1NBHA 3TW4A 4CMEA 1UKEA 1QYIA 2WMOB 3DHWC 3MILA 2GILA 1QE0A 1PJRA 4AKTA 1X8JA 4QU9A 1UH5A 2HH9A 4DQDA 3OOWA 4NFYA 4H7DA 1FXUA 4JT9A 5AD1A 1P73A 3UJNA 2P69A 1SMKA 5KNBD 4ND5A 1M66A 3KETA 1SFRA 1W8IA 2P9YA 3A8TA 3OSZA 4DWOA 4DSOA 4EA9A 3MN1A 1FFCA 4ZOLA 1XD9A 3OEYA 1EGVB 3IX7A 2BI4A 3AV3A 1NJGA 2YXNA 2QUJA 4M36A 5FI5A 5BSMA 1VCIA 3ZOZA 1BN7A 3T41A 3OPYB 1UC5B 1YZQA 1YHNA 2F1KA 2W71A 2VEDA 1RTKA 3ONFA 3R1IA 2E6KA 2GF2A 1SY7A 1CVLA 1P0PA 3D43A 3D4OA 4DSTA 8AT1A 1E1DA 1OUMA 2W4MA 1QYCA 3TB4A 3G2MA 5IULC 1WR8A 4GS5A 1E4VA 4RSGA 3INNA 3BHJA 4BMYA 1O3YA 3BC1A 1CT9A 3IPLA 3PYMA 4DWJA 1OYYA 1PZHA 3K20A 3PXEA 3TMYA 3H11A 3I6ZA 3CLVA 4ARZA 2G06A 1GZ6A 4H7FA 4HRAA 4HGPA 3ZBUA 4A92A 4HLUC 5JS7A 3RARA 1ZXXA 2JJMA 2I1VB 5H4GA 1P7PA 4HGYA 1RLOA 4Q93A 5JSYA 2GFHA 2AZ4A 1V3TA 1ZIXA 3W9YA 4B4DA 4BLTA 2OT3B 1G5TA 2P0YA 2Z4SA 1NLUA 2Q5IA 4E51A 5KCZA 1BFUA 1J8FA 1G4HA 221PA 4ZVKA 4OB6A 2B3DA 3OKCA 3DDCA 2OQ2A 4EIWA 1XT6A 4BU0A 2HB6A 3CLSC 3IHKA 3OOSA 4J2HA 3HBLA 4CTOA 1UK6A 4EY3A 4N8SA 3CUKA 4CIDA 4HLUA 2D59A 2PVCA 3OKFA 2PANA 2HBYA 2QW1A 3EPKA 3O38A 3QX8A 4L07A 3BJZA 2Y93A 3ZCQA 4FN4A 1AQJA 1FFDA 3C24A 2I78A 2Y1WA 2ODNA 4M7WA 3HVJA 4URYR 1C3OB 2C9BA 2AJBA 1VPWA 2AX4A 1UMKA 3NUZA 3P4XA 2D7DA 2VNKA 3SIWA 4U8GA 4ZI5A 4BVJA 4N03A 2YYSA 4KQIA 3VSBA 1VB5A 3QKSB 2JEOA 5A71A 4DANA 3LQ4A 3LZDA 5L6MB 2O4CA 4TTQA 2DLNA 3CVOA 3O3OB 3PUXA 2WHXA 4ACAA 3BRWA 3IMKA 3LUPA 4TTVA 1B41A 1KI6A 2EGGA 4J3JA 2LNDA 3EGVA 4Q1BA 4ALKA 3U56A 1NRIA 1XZGA 3A9SA 1VLHA 3EEIA 4UMFA 5I5GA 3FPLA 1GCGA 1LS6A 4O2RA 4UATA 4H6XA 3WIUA 4U2FA 4AMBA 3MWFA 1FDWA 1CY0A 4NJMB 2PKQO 2IK8A 1TKRA 2WHQA 4RUKA 1QZ3A 2I3AA 4YCJA 3OF2A 4I4TB 1SA0A 3WLHA 3OOYA 4L8VA 4ABYA 3IEVA 1U99A 2TSYB 2DWUA 3RSSA 4KPYA 1P62B 4AKEA 3L6BA 4YJGB 1YRQA 3PUJA 4F1WA 1N2JA 2ZRAA 5CX1A 3WL6A 3C1AA 3IT0A 1WY7A 5A06A 3QEMB 5B4VA 4DJJA 3AM5A 2ZJ2A 1C1DB 2CLFB 4J6EA 1WCYA 3F6YA 1MAHA 1EDZA 1SM4A 4QO8A 2VA9A 3PI6A 1KA9H 5LP6F 1PR0A 1J8VA 2PXXA 4HLNA 4NBNA 5BQXA 4N01A 3WAKA 1PT5A 3IAM6 4WN9A 5K4GA 4AB1A 3HY6A 1BCSB 3Q3HA 2A67A 1GA6A 4RESA 4B46A 3IBYA 5H8WA 4MEBA 4L1KA 3CT4A 2VWQA 2G77B 4FMDF 4M88A 3ZGVA 5LMCA 3O4VA 4RTSA 1H1TA 5DHRA 3AUFA 5BNZA 5TEWA 2ZJBA 4J49A 4G0QA 4WZAE 1L4KA 1TADA 2HMUA 4U6QA 3AERB 2OP1A 3B6KA 1KKMA 5LYJF 3TLCA 1VXOA 1KQ3A 1YVRA 3RJZA 1U2EA 3QIAA 3KXKA 1JWAB 5IXYA 1BDJA 3Q6NA 2G8LA 3O8DA 3AZQA 4MKZA 4NPCA 2K4MA 3PK0A 4ENWA 4TMKA 2ENUA 4JJ6A 4TXJA 4C0JA 4YPVA 3KKKA 1C7IA 1T6BY 3R5FA 4EKGA 2FQ1A 2PWZA 5IVPA 3SKXA 1G0OA 4XIIA 2QXTA 5FFMA 2BMFA 4M22A 1RC8A 3H2BA 1AQYA 1CRZA 2QT9A 2Z1MA 3ISJA 2J3IA 3KEFA 3QNUA 2XAUA 1ZZGA 4MW4A 4QUAA 3WNDA 1KR5A 2OBFA 2W2TA 2M1XA 1O4VA 5EZSA 3FDXA 4JX9A 2PIDA 2NUAB 1JQDA 4WE3A 2C7VA 3GGOA 4BO0A 1MZVA 3H4MA 1LWNA 3UOGA 4GGOA 5G1NA 2PT9A 3WG9A 3EMBA 3R6TA 4J29A 4P7BA 4CBVA 4M9XA 4DLNA 5LZ7A 2OL4A 3CEHA 3PUIA 1DO8A 2II6A 3DUWA 2QRKA 2X9LA 3TEJA 3R6GA 3PTAA 2ZBGA 1LPSA 1Z62A 1ZU4A 3VSEA 5GY7A 3ZGNA 1QFJA 3LGXA 2YOGA 3DTYA 5DNVA 1A8PA 1BDMA 1IQRA 4JLJA 4W5TA 4CEIB 2Q0HA 4C14A 4RJKA 2JLUA 2GA8A 4TPKA 1NG1A 4Y2SA 4YAFA 3BD6A 4O8ZA 3X2SA 1QPBA 4KOAA 3L7LA 2XHZA 3D4IA 5ARCA 2GCOB 2QOEA 2YS6A 3MCTA 1T5DX 2XSZA 3B53X 3SS9X 3TZBA 3A2NA 5L51A 2WHPA 2Z04A 3R44A 4DABA 1P4SA 1FX1A 3UICA 1QJCA 1UJCA 1E32A 1I8TA 3B8EA 1KI9A 1ORWA 3AP1A 3MK31 5DM60 3M89A 3TW8B 2XVZA 4MWEA 3AR8A 1FTGA 4PGHA 1C1XB 4C4TA 3UHFA 2FW6A 3F6PA 3QI7A 2M1ZA 2H4FA 3OU2A 2X3FA 1QCZA 1D2MA 2FZVA 1T15A 2EYQA 3GLHB 2Z3VA 3DW1X 2FPIA 4EJ0A 3H2KA 1D4ZA 2Z3ZA 2XWJI 3U1VA 1M7BA 3RYCA 3AJAA 1W25A 4QQ8A 5F23A 4GQAA 3STYA 4ITRC 5JNSA 2MSEB 4GLFA 1CDDA 1UK7A 1VPDA 3FSJX 3VYSB 3LX4A 3WADA 4CN8A 4BNIA 4ZDIA 3LMKA 4YMHA 1J25A 4XJSA 3ZVRA 2VHYA 2YZ2A 3FY4A 4M0UA 4BP9A 1TYEB 3C4QA 1MRZA 3ROFA 1IVNA 1RAIA 3G79A 3RYFB 3S0JA 4M1YA 5KYUB 3RRMA 3NM4A 2F00A 4E1VA 3FJYA 2H08A 1ZAKA 3E7FA 3ZBTA 3JQRA 1F2TA 5B2FA 4QDJA 1HFKA 3TTTA 4TS1A 5CFZA 3LLMA 3HVHA 5JQGF 1C3EA 5LMNB 4IDGA 3R9KA 2J0UA 2TYSB 1B0ZA 1OXVA 3FHLA 3ZZMA 1E0KA 3TL6A 4HO1X 1E59A 5B30A 1E1NA 4FK8A 4CMIA 4E3ZA 2QDKA 3MNFA 4O4IB 1JDBC 2OV6A 2F3RA 4PQEA 3W5UA 1RYMA 3GI1A 5G4KB 5KNLA 3VDRA 4OJTA 1KI7A 1KZHA 1VPLA 3IIKA 1GRRA 3BMNA 3ENNA 3VPDA 4ZCRA 3WRVA 3K9CA 3NOOA 4LTNA 5GJWC 1NYTA 3CLTC 3FOFC 4INAA 3BD9A 2H5LA 2AOVA 2J3JA 4RLSA 3RUCA 3S3TA 3KL4A 4FEAA 5ERYA 1YZ3A 2Q3LA 1DJQA 5LYYA 3A9RA 3DV9A 1RQRA 4M7RA 3PD7A 1RZUA 4MQ6A 4QRDA 5DHAA 1X7DA 4L8WB 5GM2A 1GKIA 4YRAA 1IN1A 1IBRA 1TPYA 4EFDA 1F17A 3D6AA 1FP2A 4R3WA 1N1EA 1L5ZA 4JR1A 3QVOA 4KR0A 2C99A 3H9UA 4Z99A 2MSWA 3C98A 2ECFA 3NG1A 4NU8X 7YASA 2B3TA 1FMJA 2O7NA 2XTAA 2DZDA 4QXPA 5AI9A 4ETNA 1R5BA 3V8NA 1ZD2P 3VU0A 4ZICA 1YTLA 1JVNA 1C0LA 2PJDA 1XTSA 1ND5A 2PGIA 3BWYA 1J07A 4ID9A 4Q3KA 4A2PA 3HFJA 2O6HA 2UVPA 2O07A 2Q5HA 2VJBA 2SKDA 2XWPA 1QUEA 3LWDA 4MGKR 4EZEA 4P0QB 3CCCA 1EP3B 3RR2A 3TJRA 3CLUD 3PG5A 4NBWA 4EGCB 3MD9A 5KC9A 3VH2A 1VLZA 2EG5A 1EBFA 3DMFA 3HYSA 1OX6A 3M3PA 3ENZA 4KUHA 5CFNA 4W8OA 1KE2A 1ZJWA 4B79A 1QG4A 5DSXA 4ZGWA 3BJRA 3ZV3A 3GZTB 4G23A 4QGBA 3ZU6A 5EY5B 1CNMA 2DHCA 3G0IA 4FHCA 3DBLB 2PWBA 5B1HA 5DSTA 1R64A 1IXKA 4G0OA 4W5OA 2WFZA 1U90A 2WG0A 3LWZA 4AZ0A 4DL9A 4ERXA 1U0FA 2C59A 3ZDQA 3AY0A 3L18A 1DG1G 1T9DA 2R7NA 1LJ8A 1NW6A 2FWAA 2V3WA 1SAYA 3BK2A 4KWHA 3IB6A 2N1BA 3BREA 3QIVA 5LOVA 4HWOA 5E4JA 5J2UF 3HUFA 2QN7A 4DYVA 2Q9AA 3ABZA 3TRDA 4CDNA 5LKAA 1I2DA 2X23A 2N1MA 3OLQA 1FLNA 3IQHX 2VC2B 5GGYA 1ZBQA 1KJIA 2ERXA 4TV8F 2AJDA 3EDYA 3H99A 1KFEB 4UBIA 4V0NA 3K71B 2FG5A 3OURA 1JAXA 4FMCF 4ZJPA 3MUNA 4DM4A 1QP0A 4MRVA 1G21E 1THTA 5J4VA 1H4QA 4DN6A 4EO7A 4NVRA 1W94A 3KB8A 4V0KA 4CEJA 4TWJA 2IP4A 5L7WA 3TF5A 4QFCA 3OESA 5TT1A 1D6JA 4J1SA 4CM7A 3LKBA 1NVXQ 4QRHA 5EJAA 2RHMA 1OFTA 1ABBA 3JV7A 4GXTA 2ZR9A 5HGXA 1NJ2A 3USES 1OLSA 1VHLA 1E18A 1T8UA 2H1FA 1E6LA 3KX2A 3PGMA 3KQSA 4JN6B 3C8UA 4XPZA 2Z3WA 4MUBA 3MRVA 2GAAA 3MRSA 3QMWA 5HEKA 5AW5A 1W85B 4GZ5A 4K2AA 2WP0A 5EIEA 3VA7A 1TC1A 3VAYA 1SHKA 4KIWA 1QTQA 3HUEA 1NP3A 5IDWA 1OH5A 3HDGA 2FJUA 1J6UA 1VIAA 2QORA 5ENVA 2I34A 1M54A 1N5OX 2QE7D 2ZUCA 2BFCB 3G8CA 2XODA 2J5QA 4XDGA 3RSOA 2JAWA 4IIGA 2B4AA 3L8HA 2H9YA 2B94A 1JZSA 1PQYA 3BF7A 2GTHA 3C3YA 3HCCA 4GR9A 3W5DA 1DKMA 1DO2A 1N2SA 1XA4A 3QOXA 4PE5B 5FO1A 1OZAA 1SN7A 4TL7A 3VPSA 1CBUA 3L7YA 2CNNA 4G5RA 3TOXA 4Q9NA 3WO1A 1U0BB 2HSDA 1P39A 2CZQA 3SX4A 5JC8A 5DMXA 3U60B 1KMIY 5BRNA 1B4DA 3FMGA 2Y0PA 5BURA 1B0AA 1Z0DA 1X7XB 1LNQA 2JJ8A 2JHAA 1UINA 4MW6A 4PCUA 5EWLA 3DQZA 3I2JA 3TM5A 3S28A 3NDPA 3F96A 3PQFA 1M8GA 4ND4A 4WXPA 4K0RA 4YUZA 4Y2VA 2EWWA 4RH0A 5HSGA 3STVA 5GV8A 3AVUA 3QBVA 3C1TA 3SZUA 1Z18A 3TAUA 3T9EA 1I5EA 2XB4A 4X71A 1U8ZA 4ES6A 2ODQA 3I8SA 2ZXUA 2XBUA 4EJSB 1AGPA 2WNIA 2NTVA 4M53A 3EF1A 3UJ7A 5BWCA 4MB0A 1G5RA 3VO9A 1LC0A 1TE2A 1U3UA 4MUFA 3C3JA 1JQ3A 3M7IA 3D3JA 3SSNA 3X1YA 2XKAA 4XGNA 3IOEA 2EKDA 2EX0A 3MELA 2QG4A 3VHRA 2J30A 3Q8WA 3R40A 2FPGB 3LCJA 1B43A 4P36A 3GO4A 4DSZA 3TCXB 4UCWA 1XZPA 3AEUA 4AECA 1SCIA 3E5MA 4TT8A 5FYDA 4X8LA 3E03A 1G98A 2J9ZB 3P9NA 5LBTA 5I7SA 4TYWA 1AJEA 2XTJA 3ZBQA 3M6MD 2AOXA 2QJOA 5CNKA 1PCXA 3N1UA 3WLEA 1T2FA 1A8HA 2P2LA 2ZSFA 2P2YA 3RIEA 1GFZA 1N2XA 1Z9BA 4C0KA 4AQ7A 4QWMA 1WPGA 1ZHFA 2AW3A 4TM7A 5EUBA 4BMZA 1E9EA 4X61A 5GONF 1Y1PA 1GXSB 1VE6A 2FFAA 2IEIA 3G0DA 3HACA 1KWGA 6GPBA 2FEMA 3AWIA 4PLZA 4JDUA 4IX9A 4RTQA 3HGTA 2Z83A 3D5TA 3MFQA 1E66A 1YAJA 1EVKA 2RG7A 1L1RA 2XPCA 3WDSA 5JO9A 2FWMX 4N5HX 4OQPA 2MCFA 1NJSA 4KYIB 2CK3A 1SCQA 1IHPA 3N86A 4P93A 4QUJA 5CXQA 2A4MA 2EG9A 3I9NA 3NTOA 5T64A 4C0QC 1XSEA 3E5NA 3KKEA 4EYSA 2FFJA 4WTOA 4C76A 3GJ4A 1QLHA 1NN1A 1V25A 5IABA 2C04A 1ZY2A 1XXLA 1L5YA 5AKJA 2O5CA 1N1GA 3VUEA 2X5OA 1W93A 3QPCA 3IKJA 4D25A 2Q3JA 1DEOA 1RW4A 3A4NA 1BE0A 1SZJG 2YHBA 3G02A 4B2PA 4LSMA 1TO2E 1VE1A 1WW2A 4DLBA 4H7EA 1NW7A 1W4AA 4FB5A 2DQKA 3FDIA 2FW1A 5JD4A 2HBQA 1XNJA 5JO0A 1U0TA 2A9VA 2ESRA 3ENQA 5LQMA 2AZDA 3HYLA 3WIBA 2XUKA 2MWMA 4OQQA 1E8MA 1QIDA 1VSBA 2P6OA 2VAMA 3D54D 3W9BA 1IUOA 1TCVA 4N0QA 4FGSA 5CT4A 1YB1A 5EGNA 5CEJA 4F46A 5MDHA 4QARA 1YQ9A 4WKOA 1S9DA 3ZQJA 3FPHA 3IIMA 1I5OA 3S1AA 4GECA 2CHEA 4L50A 3VMFA 4ZMRA 1JH9A 2QEQA 4XWWA 3QXHA 2GSWA 5KYYA 5HKKA 2C5LA 1JJAA 3D6FA 3OLVA 4A7PA 1M0EA 1SOVA 4OYHA 2GEUA 1I80A 1UWKA 4L9RA 4X44A 4EGFA 4YJ2A 5CT9A 2XBMA 1SR8A 4TMWA 2G82A 4LC0A 2I2WA 1N2ZA 4CCAA 1Z08A 3GFRA 2WVAA 1O57A 1PSZA 4B7UA 1MORA 2WSYB 3U7QB 1FFGA 1BHSA 3CH4B 3KTFA 3O6VA 3FDJA 5FPYA 2H1OA 1ZM2A 3O9ZA 2VBFA 4FFLA 3SOZA 4A2CA 5KHLB 3KWMA 1UJ4A 2XYQA 3CEPB 4S24A 4LV5B 1XNRB 1A5SB 1NATA 1V37A 1GADO 2ONKA 3GOHA 4PEVA 4ARVA 1LDMA 1Q15A 3GH3A 1G8HA 3KYJB 3QXJA 4JOBA 3L4KA 2O0HA 1I9GA 2Q1SA 4AI6A 2EKQA 3PUKA 3VDXA 2QYSA 1ESEA 1IY1A 2JZCA 1FYVA 4J3FA 4QDUA 3HFRA 5BR8B 4IJ5A 4Q4HB 5EJIA 1Y8ZA 1HRKA 5LDGA 2AD5A 2GPNA 3KKOA 1U5BB 1F2DA 4GOOD 4MUMA 3B5IA 2R6DA 2RC6A 1ZKDA 1XMSA 4AKIA 4WESA 3BWVA 1MG0A 1U8FO 3OE4A 4M1ZA 4DC9A 2PAAA 2BLLA 5L40A 3L4SO 3HDVA 2EFJA 2HJSA 1SUBA 4BIIA 4DE5A 1TVCA 1MNAA 1WU8A 1SVMA 3B3FA 4HAYA 2CDAA 1U7OA 3H4TA 1M6WA 2WNSA 5H9WA 1NHWA 3HJHA 4A0GA 2YHIB 1FFAA 2PMEA 2G0NA 1IDN1 3LC2O 5AKEA 2OC9A 1KP3A 3ODPA 1J2JA 5F3RA 5JLAA 3PWKA 1WOMA 4Q4AA 3AVYA 3AR9A 4H31A 3QWIA 4UD2A 1OX5A 4EARA 3SQLA 5L3RA 1OJLA 1SCBA 1EFVB 5FR2A 1U4NA 1OWLA 1BOOA 1ZEJA 4WACA 1H5UA 5IBRA 2PYDA 2GZMA 4FHZA 1O6FA 2VOJA 2D74A 2AL7A 3ROGA 4UUAA 1RPNA 3QUCA 2GFIA 1VE3A 1O89A 5C2JB 4J8PA 5FWYB 2ZE6A 4B2LA 4LHEA 1E9RA 1VBNA 1KYQA 2AWNA 3NWBA 3O31A 4F92B 3EIFA 3SEAA 2O2DA 2PT5A 3ZGXA 1PQPA 3A58B 2DHQA 3VNQA 1OWOA 4YQFA 2YWRA 3M6IA 4L02A 4FW9A 1ODJA 5AOBA 1H66A 2C77A 3I01A 3LYLA 3H8JA 1DAHA 4AXBA 2I4RA 2I9PA 1SCAA 1E2LA 1MLDA 3IALA 1KYYA 3KQMA 2V7EA 3NONA 4NBKA 5A9TA 3WKEA 4ZVOA 3HWSA 2JANA 3GROA 4NRDA 3NMUF 1CNFA 3WICA 3DOUA 4TWBA 3FGPA 4HBGA 1IY9A 3EVEA 1Z7BA 2J33A 3CH5A 4ZQCB 3A2KA 3LUFA 1GLVA 4XX1A 2OBNA 5F1YA 2BE9A 1PV2A 1WB9A 3TXXA 2DAPA 3M4JA 3ZNPA 1XZKA 2XMRA 4JLOA 2BHTA 3QTBA 4KXQA 4A6XA 4C78A 3KHKA 1L5NA 3W6NA 5HTOA 1AHPA 2NPOA 2TMYA 4BO9A 3RWMB 3ZOKA 5C1PA 3Q9UA 5U4XA 3PS9A 2AN3A 5AOAA 1URPA 2J3QA 3AKDA 4NXMB 1JUDA 3ZX4A 3DEAA 3OLXA 5A1TA 3LPAA 1SB8A 5DWQA 2R7MA 3MVEA 4PCLA 2DMRA 4A9AA 4DNXA 3PR3A 3MPUA 3QOWA 5FWXA 1T4MA 2VBGA 4YAOA 4CN9A 4YT4A 3DL4A 4I5GA 2AG8A 3ZD8A 3B1VA 3NBFA 4AZWA 4CDRA 3C7DB 5GQSA 1W19A 1V8OA 4BFSA 4RA9B 2E37A 5DIZA 4X45A 4ZV7A 1KJ8A 5IDQA 5INTA 1U9ZA 3AESB 1QCYA 3IVGA 2PN1A 2VP3A 5D7NA 4B6SA 4QUHA 4MRAA 5ALOA 4L4SA 2X8JA 5CR9A 1CUSA 4RU1A 4UEQA 4TRMA 4YAKA 2XUGA 1LVGA 2DJIA 3ORSA 3CINA 3QQPA 1Q7BA 1K8ZB 1OU4A 1HQCA 2C31A 1TTHA 4GFDA 4HMQA 3CO0S 1G3IA 2GHTA 2B61A 1OROA 4O4JB 4Z4FA 2EZTA 4DA8A 1MC5A 3BE6A 3OU6A 1FUKA 1TQDA 4H1UA 2QZZA 2ZATA 4BVFA 1CETA 1T5SA 1BE6A 1V3QE 3B12A 3P97A 3SZRA 3SFZA 4HT3B 3H5IA 3ROXA 5A5DA 1WMFA 1N6NA 3LY7A 1ABEA 2HIMA 1L9XA 3PNSA 2OPHA 2F3TA 3DKIA 3OVMA 4HXFB 2AHRA 3DDZX 1PJ8A 3F4KA 2ZJOA 2DWQA 3ZDEA 1GTMA 3DDWA 3FNIA 2J7KA 3IOMA 1QDUA 4D3ZA 4RK4A 5B1SA 5BORA 4C6TA 3IDSA 2ECPA 1YO6A 1UFRA 2JFZA 2OHXA 2YVLA 4XFDA 4ZANA 5BOVA 2E2WA 4JOQA 2GA9A 3FR8A 4UTPA 5CDYA 3PXDA 2QTTA 1WA5A 4X94A 4ZEWA 3H1EA 3NJ8A 1JHMA 2JFUA 1E92A 3PD1A 3JQ9C 1TT5A 5DVZA 3PLNA 4BGDA 3SKYA 2Q3FA 2ZCJA 2JAXA 2ZFUA 3MCAA 2BGTA 1GTG1 1UPCA 5DJ5A 1CJKC 1I32A 4GOLD 1A8SA 3KLBA 3WWCA 1IOWA 5HE9A 3EWSA 1FVFA 1XMVA 5FJJA 5B1EA 2Y05A 1JU3A 4G0UA 1WXEA 1GAEO 1EDDA 1Y7PA 4K9KA 4CE6A 4PG8A 1T8TA 1EM6A 2BKUA 4U3JB 3IA7A 3UW1A 5IF3A 1GTL1 4GR5A 3JQ9A 5EXEA 1W7AA 1X7YB 2DBRA 4U4AA 3MBOA 3E84A 3IMGA 4C4XA 5BT8A 2VHVA 1MEOA 1OTYA 3QF4B 3BXPA 2JGKA 3IP3A 4ME6A 3S1LA 3OTGA 4Y6RA 1DC7A 1B2RA 1CZNA 2BMVA 2R6ZA 4I46A 4WD3A 5FEMA 3DMRA 3H9CA 4MV1A 1UP7A 2NYAA 5HBGA 1MOQA 4NHOA 4OH1A 5FBWB 1ESCA 5DBGA 2PFSA 2PGOA 2P3OA 2C0QA 3MUFA 3DBHB 1A9SA 3N7AA 2XCTB 4PM4A 5DT9A 5DHPA 4D74A 4D46A 5K0BA 1X3LA 3QLJA 1EDBA 3MGBA 3VMMA 4M8IA 3N2KA 4O59O 4W1SA 5JSHA 1XRLA 4CJXA 5G3YA 5C4IA 1G64A 1T0IA 4KXWA 5KHAA 1QV6A 4CR8A 5LQAA 2AFIB 3CPEA 3WQRA 1H5NA 5ENZA 5BYBA 3TJZA 2P3QA 3T8YA 2C2MA 3AF4A 2OCDA 1PJ3A 3JQFC 3K35A 1NOKA 4MCHA 4RVGA 1IZ8A 4F6CA 4WBNA 2PX4A 3VSCA 3NOVA 5HVNA 4A15A 1W34A 4V0OA 3T3IA 4MARA 2JARA 2CL6X 2JCGA 3EW7A 3LG2A 1O1YA 4HS9A 4ZAXA 1TA4A 3H9QA 1T36B 3FFWA 1OBFO 2B7LA 1HQYE 3P9RA 4MUNA 1PEAA 4KODA 5DN6A 5HF8A 4QASA 5HF5A 3HCEA 4Z1MA 3K1TA 4EHLA 3JQFA 4L74A 3F9RA 1QCCA 2DFNA 2QQEA 3T5TA 1BKYA 1GGFA 3VNAA 1CR6A 4UBOA 3PHCA 4D9GA 1SOWA 4ZGGA 4EMBA 1BS1A 3DE2X 3JD3A 3DFZA 1P9WA 5A05A 4L27A 3SYNA 5B1YA 3F4LA 3O73A 3EEYA 4RV4A 3LY8A 4BMVA 3K0FB 3HU3A 4FIZA 3DBRA 4OU5A 2YBDA 4D5EA 4E70A 2XKKA 4HPXB 4P7GA 1C0KA 2NQ8A 3UYKA 2YJZA 2VF7A 2XA2A 3F1LA 2O0KA 2QNRA 1E7MA 1E6EA 3H2JA 2BP7A 3W5HA 1L4LA 4U2EA 4HC4A 3L9XA 1R6DA 2NVBA 3G9QA 2C9YA 2GH1A 3H13A 4I9HA 4Q24A 5L3SA 2B4YA 3PJDA 2X6RA 3KAPA 3DL7A 3ND6A 5B3JC 2YIMA 2NAFA 3L84A 1E1CB 1O95C 2GKOA 2JHPA 4XR9A 2V6BA 2EIHA 3ZN2A 3GEEA 5K0ZA 1DQRA 4FDAA 4I8DA 2HA5A 4J7XA 2QRVB 2QRGA 4DLXA 1MC4A 1MW9X 1ENZA 3CTMA 1QX3A 2BFBA 4F5WA 3I53A 1H2XA 3BJEA 4DQUA 5B3AA 2WSSD 4DGQA 5HX7A 1A97A 5A4FS 1GQOA 2JLCA 1ZJYA 1JG4A 2ZAOA 4RTRA 3M4NA 5B3JA 1P2VA 1BJRE 1CDOA 4G0PA 1O95A 4L2IA 3VRHA 1CLEA 4UM9B 3NHRA 2PFKA 4QBFA 1N9ZA 4Z86A 1NNI1 1UM9A 1OXXK 2AX3A 1DEXA 1MX3A 4PPFA 1ZD9A 4N3NA 5JCJA 4YV0A 3U4MA 2PUBA 1RDFA 1XVVA 2NSHA 1X14A 3FPEA 4QRIA 3OQ1A 4UCQA 3SX0A 2R85A 5ES3A 1EHIA 4G5GA 2QAIA 4R40A 3DCNA 5JVDA 3FCUB 3WYAA 5K8VA 3TG8A 2AR0A 2G9QA 2BJVA 1R00A 1ZJZA 3DB1A 4RPJA 4CIBA 1WPRA 1MKYA 1Z34A 5EMNA 4LRWA 1G42A 5LQKA 4RWEA 2XH8A 5JW6A 1BDHA 5IUJC 2JA1A 3HKEA 1XXHA 4WDRA 5HUJA 2C98A 4QFMA 2NV0A 3AEQA 1JHDA 4NPHA 2YV2A 4NYMR 4LCBA 2RHTA 2WV9A 2AOTB 3NH6A 5IVIA 3U39A 2QJFA 4E4RA 1XRSB 2V6JA 5L95A 4F3NA 4JLNA 3D81A 1T2NA 5JHGB 2PSSA 4GMKA 1FPQA 1OHHD 4PSVA 1FDSA 2ZZNA 4FHEA 4KIFA 2XOXA 1GNPA 2COKA 1RJ9A 4QUEA 3FUWA 2OM2A 1L8QA 2XNDD 4RJJA 4US0R 3TUIC 5J4YA 5IXJA 3EXIB 2L42A 5DRTA 3OEWA 2X2PA 3THXB 2DCUA 1FRVA 5KSWB 2PLAA 5C7IO 2X2EA 2DEUA 1SHZA 3GEIA 3EXHC 4LQDA 3ZHXA 1X9HA 1Z6QA 1K68A 3QX7A 3R5TA 1XROA 4S1PA 1Z6AA 5JATA 2ORIA 1JQKA 3ZLBA 3W04A 1YZKA 2H31A 3V55A 1W29A 2CLSA 3BDAA 4PIVA 3EFEA 3IDAA 4K3UA 4KXVA 4RFSB 3ZKAA 3QBTA 3ZNNA 5K45A 2X3UA 1U2DC 5EHIA 2BCGY 2OCPA 2SECE 4B7CA 5K2OA 4C0AC 2W2VA 2VIIA 3V1KA 2N75A 3ABSB 1VLQA 2IL1A 1OGIA 1Z4MA 2C8VA 1UXGA 2OV4A 2QSYA 3CH7A 1SBZA 3L49A 1TTPB 3NXKA 4V3CA 5TF0A 4Z4IA 2YMPA 1J99A 2ADMA 1E1LA 1HI9A 2FEXA 1K63A 2OSVA 4JR0A 1NPDA 2H5IA 2ZQZA 1XTBA 4PAMA 1C50A 1U2DA 4PTYA 1Y1LA 3JRNA 4XGQA 3LRPA 4B3HA 1AF7A 5KYWB 1L3BA 3H9GA 4AG3A 2MR6A 1CB7A 1B3BA 2RKWA 2GCPA 3MHPA 3BE8A 3G6WA 5MN5A 1T10A 2GKSA 4NIMA 3ABIA 3J80A 3VNBA 3M6XA 4S1NA 1HDGO 1AS2A 5B6JA 1AQNA 2JG3A 1KP2A 2JFFA 4I9UA 2VT3A 4Q5IA 3ZD9A 3PQ7A 2CV2A 3WP0A 5CCDA 1J9EA 2UXCB 4ALNA 1E6CA 4C06A 3C16C 2YWXA 3U3JA 5CT6A 1HT3A 1VKZA 3HPQA 1UXOA 5CDFA 1CRQA 4P4SB 3HSKA 1XIVA 1JR3A 1FSFA 1P5ZB 3KSRA 4KI0A 3EGXB 4BO8A 4XVQA 5AVSA 4OI0A 1E0SA 1KEVA 3QGMA 4MHOA 2HF8A 3VKVA 4DDHA 2FB9A 1NUAA 2P6UA 2FPKA 4R7GA 1IBSA 2JS7A 5KVCA 4WLEA 3GZ4A 3RC9A 2KLBA 3H3XA 3L6CA 2ZEJA 1NLMA 4KLCA 3GAMA 4DV4B 1NF3A 1QLJA 1SC9A 2ZJ5A 4NCBA 1MMFB 4AY5A 1KXJA 5DOVA 3A11A 1RQXA 1OXMA 2CLHB 2IOHA 4MUGA 3V4FA 4BLWA 1EVZA 1GNTA 5BW5A 1B1AA 1I7PA 1NBME 4M86A 3GBSA 1UXKA 2VYNA 2IIBA 2IY8A 5FUXA 3BB4A 1L5HB 3JR7A 1MAAA 5ALVA 3NAMA 1M2OA 3GJ8A 1UMCA 1Y7TA 3Q7IA 5BQPA 1NHGA 1RRPA 3GRUA 4ENUA 3WV4A 5A5GA 2BOVA 1W8DA 3CSSA 3M70A 3QFSA 1V4VA 5L3VA 2ARKA 4AN0A 4I81A 5BMVF 5EINA 2V6IA 4JL5A 3QVGB 4AJ4A 1GRVA 4KQJA 3TLYA 3QUAA 5KWJA 1EJ6A 1FXWF 3IAHA 4UBKA 2ZB3A 3L7IA 3MA0A 4GKKB 3SIXA 3FD8A 2Z56A 4RZ2A 4LF8B 1TT7A 5CFOA 3FYDA 1HOXA 2P79A 1RP1A 1W0JD 3ROKA 5LJLA 2NZVG 2Q27A 4OGGA 5D00A 2QZSA 3F6SA 5FKJA 3KZXA 1CQJB 1RRFA 4Q9KA 1EM8A 1RQNA 2IYZA 3BFXA 2XCLA 3T4XA 1R1DA 3QPDA 4LNUA 1ZRMA 5AUPB 5L7TA 4EOGA 5T3UA 3ODGA 3D6VA 4MQUA 4DIUA 3DT8A 4C21A 1P0CA 3DXXA 1GCAA 1UDRA 1WCIA 1Z3IX 2G5CA 3H2HA 3IV6A 1QQ6A 4II7A 3PI7A 3MGKA 1U1CA 2I6TA 4PR0A 5DW3A 3PZRA 2HDWA 5EWJA 2E48A 2MSCB 4UCXA 5LA6A 3INTA 4GKBA 3A0UA 2FZCA 4RMGA 3E7DA 3AFOA 4Q7MB 4IS2A 5G40A 2AYXA 3BH7A 5HA5A 3ZCVA 1KI4A 1UJMA 1R6XA 2FETA 1QAQA 1Z37A 1TZ2A 3O2QB 1QSGA 5I48A 3NVMB 4XWYA 1STOA 3UATA 4J4TA 3N76A 4CIVA 3M6FA 3OZGA 3V2GA 1KJZA 4JJAA 4JEHA 4PS0A 3CUSA 4WCDA 2JKYA 1AS3A 4FOOA 4EPYA 3I01M 4KO8A 4PQYA 3S7TA 3FJOA 4QJBA 4Y1FA 4F9FA 1H1LA 4IZHA 5ICGA 1G17A 3GRCA 2ZJYA 3IXQA 2NZ2A 1MJNA 5I3ZA 2YC2C 1FU8A 4UJ3A 4BEBA 4MO2A 3ZGYA 2CGEA 3NJ4A 4IXWA 1BW9B 5YASA 3ORFA 1M0TA 3NUQA 5DCUA 4NHEA 4CUKA 5LD2C 2BHSA 2DR3A 2IX9A 4LY9A 3JWEA 3HN2A 5CYPA 1PHRA 1PWXA 2PKYX 2P2DA 3AX6A 3FHCB 3FSGD 4L85A 1BQ3A 2WYVA 4QOSA 4DCMA 1C9YA 2BE7A 4BNDA 3RB8A 2EZ4A 3KKZA 1LA2A 1V5WA 3AF3A 4M38A 2NUPB 2VLIA 4EJ2A 2RD2A 1F2UB 3WGMA 5CRIA 2GPJA 1XPJA 1JEQA 3I8XA 2UUCB 3BDVA 3X1JA 4ZYVA 3GEDA 1ID8A 3I05A 4CT5A 1MAWA 1YB6A 2P0EA 5JPIA 4H3KB 5SYAA 3W79A 1R50A 3B7PA 5HP4A 2WAXA 2F55A 4B3XA 1EINA 3ZHTA 1JYSA 5GMOA 4P2GA 1SNYA 5M5BA 1Z4IA 2ZSBA 2DWPA 4ZU3A 3I6MA 5EMHA 2C9ZA 1OIXA 3CIFA 3MRTA 2FW0A 1PNVA 2JGEA 2JRCA 2FYTA 2JLSA 3G8AA 4IIJA 1DC8A 5SICE 1XZQA 2V58A 4INOA 3ZQ4A 4EG4A 4ZVPA 2G5TA 4YRLA 4NZ9A 3RU3A 4B1FA 2Z6UA 1GZ5A 2YXEA 2V54A 2G7ZA 4MMYB 3IILA 4A0RA 5IJZA 4M0KA 5AW9A 2AZTA 4BUZA 4HQFA 1FVXA 4DIKA 5JECA 1Z47A 4D1YA 1OAAA 4Y2YA 3VU9B 1R5JA 2WJWA 4CLOA 4KLRA 1G19A 4B45A 2WTNA 2PYIA 3DE4X 3ILSA 2GBCA 1VECA 3KKNA 4NH0A 2JAHA 2TMKA 3PTLA 4BGUA 2P65A 3AHDA 5JADA 2F1HA 3GDFA 4PNZA 1NUHA 1KP9A 5JFGA 1WUJS 1XTIA 3CRRA 1J2TA 1IHOA 3LSTA 3P9XA 2YV4A 3PNKA 4U9IS 3TQTA 4CPDA 4D57A 2HJHA 4JYAB 3LQ1A 3ICQB 1BROA 3LFTA 3S2IA 2VPPA 3WK4A 3U2QA 1I1OA 1GDTA 1JRLA 3UWMA 3T1VA 4KIUA 1XTQA 4RY0A 1QQ5A 5KWIA 1Y3HA 2O59A 4J0FA 1SUPA 4QOHA 1YS6A 2QRMA 4R1LA 3WGQA 5K8UA 3ZY4A 2O19A 5KOJA 4K86A 4PPNA 4ZIRA 3EG9A 2NP6A 2AKEA 3JAKA 2AI1A 3QFHA 4JVOA 4IHJF 4WKNA 4DZZA 4E5PA 4UOZA 1RQGA 1ZIOA 1TYBE 4YJFA 5THXA 3D2BA 3RO7A 3B70A 4DC1A 2BKAA 3B6IA 2GCNA 4AY4A 1CRLA 5LU8A 2X5JO 1EFRD 4OXIA 1PL7A 4XPIB 1NN3A 2J9RA 3L40A 4P22A 3AQ4A 3IB3A 2VT7A 2OXRA 4V02A 1CTQA 5CCBA 3GUCA 1U0RA 3L2OB 4CODB 3O8QA 2GD0A 4GO1A 3E6AA 1MT3A 2XRZA 1ZI9A 1OV6A 5JPDA 3O3MB 3KOMA 3RREA 1CR0A 3NYWA 3DYVA 1P2FA 3EISA 2ZRCA 2JB9A 4DQLA 2C8LA 5NULA 1YONA 3EH2A 4OUDA 3DMTC 5JH7A 4OP3A 4EDFA 3MTJA 1N92A 2GN6A 4O2AB 3VKGA 3F5QA 2X7HA 4ND8A 1KU0A 1N2GA 4CL8A 2FE4A 2KJQA 4XWAA 3SS7X 3H1AA 4YUYA 4RK7A 2CVZA 1XKLA 1YI8A 1CUBA 2WSMA 3K1ZA 3NKLA 4XD2A 4BE4A 4J0CA 3WLMA 1V48A 1IM5A 5F4ZA 3B48A 2C4WA 1SUSA 2CXTA 2PR7A 3TIIA 3LO5A 1XJ5A 1GG9A 4MWTA 4DSUA 3DMTA 2ST1A 3DFMA 4G24A 1TJYA 3D6UA 2PGXA 2ONJA 3RVOA 3ZGZA 5H68A 5AKIA 2GYWA 3PXUA 4V1CI 2OM6A 2QHXA 2HSWA 2X9GA 1XCGB 1ZOIA 5CB6A 2BM9A 5CEEA 5JAHA 2DVMA 3QBJA 1IY0A 2AC7A 3LKDA 1IEVA 2CNOA 2B8WA 5DLPA 3T7CA 3P9SA 3VR5D 1WDKA 3EZ2A 3INGA 3RIXA 2XMBA 3BZUA 4ZYWA 2R3SA 1WVGA 3A1SA 1RLTA 4DLZA 2QM3A 2X22A 5JR3A 3IAFA 4L22A 5KJEA 1I33A 3MTIA 1I7QB 1X0VA 5B55A 2ZE8A 3N2GA 4FSHA 3HU2A 1CK4A 3IP8A 5L3QB 4YROA 4TSKA 1PFGA 1GT91 2YQ5A 1SBHA 4O4LF 2PQ6A 3SLRA 3FYSA 5ECGC 3TQCA 1P7YA 3KT3A 5FPQA 2LRHA 1R8QA 1I6WA 4EUFA 5IJ0B 2ONCA 4CMKA 1TVMA 3I2GA 4M6WB 3FOZA 4JBYA 1W4BA 2C2KA 3ESDA 3JQGA 1KQFA 3NASA 2XMGA 3NEJA 5JRJA 2Z95A 1EAYA 4R69A 1X42A 3OD1A 1V47A 3VR6D 3ZW7A 1WQ3A 1I9CA 2ZULA 4C4PA 1UZMA 3RYTC 4DCJA 1QGUA 5TNXA 4TM8A 4OQFA 3DDOA 4PC7A 3FKSD 3SXUB 4EQ6B 4Q4CA 1NNSA 1KYXA 3JVVA 4BEJA 4K6OA 1Q0RA 5L6LB 2GBLC 1UOQA 3EZXA 5ENDA 5TF4A 1RRVA 4EF6A 4YYZA 4H0NA 5CUQA 4QTTB 1LW7A 3BBLA 4X90A 3UCFA 4GMHA 2DM6A 4GSYA 4IQFA 5C4GB 2AOUB 4U7FA 3CONA 5JS1A 1CR2A 4FILA 2QAGB 3I64A 3JQ6A 3JQ8B 3PDJA 1P1RA 3BGOS 3IULA 1X1CA 3TTSA 2IT1A 2QXYA 5E1MA 4PHFA 2GBLA 3S2UA 4ZZ0A 2WMDA 3KTAB 3H5VA 4YMVA 1ZA1A 1KZGB 4BCBA 1MC1A 3EGDB 4R2LA 3U6KA 1LH0A 5JRDS 1W44A 2OILA 2PY6A 1SC6A 2QVGA 1OU0A 1B1CA 3P2IA 4FXPA 5HJ7A 4AY2A 1XEFA 2XNJA 1BCRA 3EDMA 3KSZO 3CLHA 3BULA 3ICVA 3L5KA 4UQPA 4KP7A 4OQXA 4X1OA 5P8WA 2CD9A 1YZHA 1EKXA 2FPUA 2NT3A 2OO3A 2WA2A 2YVKA 3MTEA 3I4LA 7ADHA 2HR1A 2PBFA 4EB0A 5B4UA 5K0TA 5JC1A 1I51A 1VP9A 4XCVA 3U61B 1WDWB 1P4AA 5KB3A 3DZKA 3ZQUA 4Z4GA 4EO4A 2VDJA 2ASEA 2E4UA 2Q41A 1PLJA 2VHJA 3AFNA 3SQDA 2WYOA 3PC8C 2HZBA 4XQGA 4WI1A 3G7NA 3HDJA 1R6UA 1USKA 4WT7A 5JMPA 3Q3GE 4GPIB 2N9UA 1JHAA 3C6ZA 3LQKA 4N0DA 3EFBA 2CD7A 5BN3B 1KY2A 1VKHA 2PEYA 3OFKA 4W9NC 1COWA 1JJBA 1EHCA 2I6FA 5FBVB 3W7BA 4B3RB 4WFQA 4DDTA 1T26A 5D5PA 3TGLA 4D0NA 3KTDA 2EL7A 3DE1X 4L08A 2Z8XA 4U9UA 3GN1A 3D4NA 3WZLA 3PC8A 1E69A 2BM1A 4MITA 4OKNA 4DXAA 3N74A 1ODCA 5EZYF 1ZD3A 3ADBA 2HMAA 2C3YA 1E2DA 1YWGO 4QULA 2CHQA 4MGHA 2FH5B 4W9NA 2UZ1A 3OE5A 2I8LA 2YVAA 4I3GA 2VDQB 2OA0A 4AX4A 1O0CA 1SZPA 5KYGA 5E1DA 1N2BA 4G5HA 2VATA 1JFSA 5I01A 1Q0UA 2UVDA 4DREA 1QE3A 4RANA 4V0LA 1FS6A 4ERNA 4KRFA 8MHTA 4KYVA 5AIAA 1ISGA 1W47A 3GRRA 3OOEA 4KV7A 4URWR 3UFXA 5KSOA 4QVIA 3G7UA 5CYOA 4BATA 1WRBA 5ED0A 3ETDA 3FMPB 1O6GA 2VI5A 3QKSA 1YUNA 1F38A 3ZXIA 1F0PA 1UR5A 4QLOA 3W2FA 2BH2A 3H5TA 3ZHYA 5E95A 1RM5A 1BWQA 1JPNA 1WPQA 3RFUA 1K92A 1Q1EA 1LF5A 1TKCA 1GUDA 2JGDB 2GESA 1A5AB 3CZ9A 3NYQA 4IV0A 4QPCA 4RZ3A 4EY8A 3OLYA 3BRSA 4E5NA 1IIBA 1DC6A 4GG1A 3WSVA 5DK6A 1G20A 1AC5A 4NJMA 4TMVA 2WJGA 3NC0C 1L7OA 2MDTA 2VTKA 1JTFA 4NDZA 5EERA 5C9ZA 2P9FA 5H70A 4OB7A 1QRAA 1YJ8A 4RVDA 3AEZA 4YJGA 2E21A 4K46A 1OX4B 4LDAA 3UXEA 3VR0A 1B23P 4EY5A 1C1DA 3RNOA 2ZQ5A 1DU4A 2VJAA 4DJDC 2XDQB 3C6MA 1A9YA 3EQ2A 3UV7A 3C3MA 1SD1A 1N0HA 3NWOA 3RH0A 3VR2D 5LZ2A 5KIAA 1BCSA 3A6DA 3LUDA 5EJFA 4XJXA 3D4PA 5K99A 4RA6B 1PGJA 4DR6B 4LZNA 2NO9A 3LGAA 2QM8A 3FUTA 4JP1A 2XVMA 3WI7A 4BMPB 3B6ZA 1ISSA 1B26A 3D3QA 1GNQA 1G8SA 1G8KA 1KKLA 1KSHA 1P5HA 2FZGA 7GPBA 1H2WA 4MIOA 1SBQA 3GP3A 2Q0QA 3P5BA 2Q49A 1U0GA 3AERA 1ETUA 1L5SA 1MXFA 1OZ0A 3I1YA 3EPLA 4FC7A 3T06B 2PX8A 1DLJA 4AJLA 1ZX1A 4D41A 1U3VA 2OHJA 2CW5A 3CZ5A 2HLDD 1L4HA 4YAIA 3S55A 2OBYA 2NSDA 2JKZA 2XMPA 2C1EA 4FT4A 4TROA 2B1JA 4NU5A 3L9WA 2ALJA 4CM3A 1EP2B 1TMOA 3DO5A 1JKMA 2I33A 1YMQA 4MVJE 4CCWA 2PUVA 2FZWA 3TZ6A 1MIHA 2P6MA 3ABQB 1E99A 4C07A 4UEKA 3SZ3A 4EHBA 3RV4A 2O14A 1QR2A 2HGSA 1NXQA 4OBWA 3SBEA 5C8VA 1QV9A 4XFJA 3EVDA 1KRWA 1TLFA 2H2HA 4KPUA 4IDQA 1NLYA 3PYXA 3V7WA 2O7VA 1JQLB 3SC6A 4OX9Y 1FX0B 5GPBA 4DCVA 3ND9A 1H6AA 1U8YA 2J6HA 5AR1A 4P98A 3OM8A 5FTJA 4RAQA 4IV5A 4XB1A 4EMSA 1Q7CA 3SNHA 4KPGA 4LTMA 1BE1A 4GBMA 4HFRA 2QTHA 4A03A 3DD1A 1KZ4A 5JAMA 4MKGA 1A88A 1PEYA 4BQOA 2VLBA 1YI1A 3OPQA 4BFZA 4MCAA 2NZJA 3MMZA 2H11A 2H06A 3I76A 3UMVA 4F9TA 2VXCA 3OLWA 3VDQA 5M29A 3GPBA 1LRJA 3PC2A 1PR6A 2O7RA 2WYHA 4LE0A 2IE0A 4EB8A 3KU4A 1OXBB 3NLLA 4X20B 2JK0A 4A4DA 1F60A 4XYGA 2GCOA 3UB3A 4A6PA 4JNKA 5KDOA 2H59A 4C3ZA 2WPNA 5TJ9A 2QW0X 3M5CA 3R7BA 2ZJ3A 5BNIA 4FCTA 3UZUA 1JU4A 3UXYA 3FPFA 3CM0A 1MIOA 1NW4A 3TW8A 4E12A 1ILWA 4TXHA 4YS6A 4OQDA 1EUDB 1C1XA 1D6NA 2C1XA 3A04A 3D0OA 3HN7A 2C61A 3KPWA 3HNRA 2XLBA 4FDMA 2VWHA 3A9VA 1P5RA 4GWKA 4RPIA 5IUKC 3WDKA 4B47A 1S3IA 2PUHA 1DKRA 1TYCA 1R2QA 1YQQA 2HFKA 1VG0B 3CURA 3FCAA 3GARA 4IIVA 4R1SA 2PGAA 1ZSYA 3MMXA 1OOEA 2E4ZA 5DB4A 2VUTA 2OD9A 3OZVA 1GUAA 3WLNA 1JDSA 2JFWA 2OGSA 4Z8YA 1ORDA 4WK0B 4GM4A 1DEHA 3DTNA 4P86A 5ERGB 3WNVA 5A9SB 2HPAA 3N2EA 1JBKA 4PPYA 1AMNA 4O2BF 3MMSA 1LB1B 1QVWA 3RYFA 1SIBE 2F3PA 1QGZA 2J6IA 1EH5A 3MUEA 5KYUA 2DTDA 1M1YB 2VJDA 1QGED 1U0NA 5HKBA 2F59A 4CKEB 1FXSA 3T1OA 5ALGA 5KOHB 3T3HA 1DX4A 3NHBA 5TGDA 1RZRA 1EP9A 1VSTA 2IXFA 2PLRA 2X4IA 1WJGA 3SBOA 1U02A 1DVRA 1L7DA 1YB7A 3AIKA 4KWIA 3BEOA 5J47A 3KV3O 5JCPA 1ZEMA 2ERCA 4BNNA 1EXVA 4WFKA 2C4MA 1GGHA 4O4IA 5D5QA 1ADYA 3KEOA 6Q21A 2NWQA 3OX2A 5ALXA 1RZ3A 1NX6A 3ZU3A 1JIQA 3ZY2A 2QL6A 4KGVA 2BFEB 2C78A 5LQJA 1Z5UA 5HIIA 3PEYA 1ECBA 1OLUB 2VDOB 2QTGA 1NOIA 4QO7A 3OLCX 3PNLA 1QP4A 1P31A 4KTVE 4W1QA 4PQRA 3LCVB 1IG3A 4EI2A 1E77A 2ZRJA 5HKLA 1YL6A 3AVQA 3WP1B 4LFCB 5F9FA 1KOFA 5EQDA 1M1NA 1J9ZA 3LS2A 3H2SA 1GJRA 2RH5A 3L77A 5G4LA 5J1SB 4LWOA 2JPDA 4H3VA 1KEEB 3AF2A 1FW8A 5TMDA 1FQOA 4TZ6A 3SHOA 3CE6A 5TC4A 3K92A 4JYPA 3UK1A 3H0CA 5CXXA 1GPWB 1ZU5A 4FS8A 2QIPA 3ZUGA 1ZWKA 2IEGA 2J9YB 3MB5A 4FBGA 2YXBA 2NPFA 2WD9A 3U9LA 1VJTA 4HN9A 4A0FA 1E7QA 4OLHA 1N78A 4FWIB 1QGYA 2FUNB 1E79D 3A10A 4OHXA 5KWVA 3B2EA 4BNFA 3HV2A 4OYLA 1V8PA 5IS2A 1X8LA 3GJ3A 2HXSA 3SZLA 4F72A 4OGKA 4JEIA 5KHOC 2GR9A 1P1IA 1F4VA 1N0VC 2D7JA 2W11A 1M73E 1J8DA 3KD3A 4BVLA 4EITA 4H77A 3BERA 2EP5A 2VJKA 5T4FA 3M9XA 3QKWA 1KK0A 5AVKA 2HHCA 4F2DA 2OWDA 4HB4A 2Z09A 5IN5A 4X95A 1RHQA 3BFKA 5KPJA 3ADCA 3FVVA 1PKEA 2GZ2A 3V1UA 1XRNA 1Z6XA 4FYVA 4W9MC 1ESNA 5EQFA 4WADA 4ND3A 3T7KA 2B82A 1EWKA 1NXVA 3HMKA 1ECCA 2IYRA 4MGIR 1DAGA 1ZIPA 3K94A 4WPGA 4INPA 3ZJYA 1CS4C 1CRWG 2DUNA 2GTIA 2F8LA 2G1JA 4IH4A 3UMSA 1EXWA 2Q3EA 3PWSA 5CM8B 1QFXA 1ZCFA 3GHYA 3RIGA 3VR3D 3BDIA 5LNK6 3LT4A 1PWZA 3HYTA 4U6SA 3RRZA 2JI4A 3MAGA 5H9VA 5CFRA 5FPKA 5HZGA 4HN2A 5HCIA 1EUYA 1RWPA 4UPEA 1HNZB 2Q2OA 1Z25A 2OAQ1 2CVQA 2I6XA 3LQRA 5AW6A 4M1KA 4TVOA 1FTYA 2BI8A 4FSDA 2OLKA 4GYYA 4WFIA 3BYZA 2NXNA 4MKHA 4K0KB 2JFVA 2JZNA 4IQ0A 4ZRMA 3GYBA 4QG7A 1WMAA 2QPAA 5FH9A 3IXLA 5F3WB 1I2CA 2UDPA 2P4SA 4YY3B 3L8CA 2DBVO 4MPJA 4HF7A 1LVHA 2ZJ8A 4LSWA 2JH9A 2MINB 4AY6A 2H3HA 2IITA 1PJSA 1BMTA 3N8IA 1JU9A 1W85A 3DNPA 4JC0A 3U1BA 1AK1A 1USUA 5JBQA 4LCEA 1UZAA 4NE9A 4KXXA 1JSXA 5TMEA 3VVMA 5EHZA 5KNDH 1SOAA 1YQTA 3MZ0A 3MS2A 2BFCA 2W6PA 3PPYA 4BKMA 4J0IA 4TLDA 1A4UA 2WZCA 4V2UA 1UZUA 1GQFA 1XLWA 4G0WA 3T7SA 4N6GA 1WABA 4NMWA 1G5QA 4P4UA 3NNNA 2QPOA 2IODA 1DIOB 2BFMA 4WV3A 2NYRA 4JI7B 3J7AC 1RHUA 3AXTA 5G1PA 3JY6A 1JF8A 3ABRB 5KVAA 2C92A 3EOBI 4RM2A 4ER6A 3ANSA 2HYDA 2V7TA 4B8YA 2XWQA 3GGGA 2LTAA 4LXUA 5L4SA 2FSVA 3LT2A 2QQ0A 3WLTA 1W36B 4RMJA 4BCDA 2ZCVA 2WYIA 1QVVA 4EJSC 2P75A 1X7XA 1UPUA 4JVMA 1FTQA 1ZH8A 1UWVA 2Z2ZA 5F1OA 1DT5A 1YQDA 5E6SB 2K5UA 5I9TA 3OPMA 4R8RA 4X54A 1LLUA 1U6KA 1LSOA 3I2IA 2H1VA 2RH4A 2QM7A 5K51A 4M9RA 1RYYA 1U65A 2CLLB 3NDIA 4QSMA 2VP6A 3BXEA 3MJRA 3NTXA 3ZYZA 1II8B 2NW6A 5I9SA 4ZOAA 4J0QA 1H2BA 3TZKA 3WNBA 4EJSA 1C4WA 4TSFD 4ZI7A 2CV1A 1XHFA 3NCHA 2BV3A 3HHPA 1QRTA 2ZVPX 2HT1A 1Z17A 3LOUA 4G5YA 3UCXA 3NKFA 4WEOA 1JG6A 3PGXA 3QXCA 4IP0A 1M67A 4QUKA 5BPHA 5CLLA 1HDCA 4D8YA 2OCIA 3LFHA 1VL0A 3HCRA 4ESEA 1QU3A 1KJYA 1Y8RB 1MV8A 1UDWA 2C3OA 3C41J 4GGPA 3PEWA 1L5WA 4X7BA 1HXHA 4IFBA 4GLLA 1PUJA 4OXKA 4UHEA 2Q6TA 2CNLA 4I50F 4IUBS 2A2ZA 3BTVA 4TWAA 3PSHA 4G86A 4JB0A 3ETCA 2EP8A 1B8UA 3OD5A 3OM0A 3VISA 1Q44A 1HNNA 5F7JA 5U1PA 2XOKA 5IK2D 4EAAA 4EY6A 3OC0A 5JQWA 4KXNA 5BVGB 4EPXA 4EHJA 2VSYA 2HK8A 1VHTA 1NBOA 2X5NA 3OZTA 4IMRA 2O2HA 5JWRA 4E5YA 2VHCA 1NXOA 2UZ3A 1P29A 1PX0A 4RDIA 1PSDA 1QF7A 1YL5A 3O7WA 1C7ZA 2ZROA 3MCVA 3IUMA 4DQ0A 4QTXA 2H16A 1T1IA 2P7HA 4AN1A 2HMVA 2XGGA 1DZIA 5ERXA 4DMFA 5LKRA 3VNVA 1NNUA 3PR2B 1P3DA 3L1UA 3UY4A 1NE2A 3SSMA 5DNUA 1QYVA 2I29A 1SGWA 2BKXA 4BNJA 4FTWA 1KGDA 1V8FA 3QUTA 3RNLA 3I5AA 3VXKA 1E2BA 1VE7A 2PS0A 4RTMA 5AJVB 4BNZA 5JMOA 5KSZA 2WJ6A 2BISA 2PL9A 2EKBA 2RAPA 4DLVA 1Q2XA 2XYGA 2XBLA 3ASVA 3CEAA 1FMLA 4GLJA 4KMSA 5TS2A 4ER5A 3ONEA 1ILEA 4FZRA 1M8KA 1X38A 1DDOA 1X9IA 1RQPA 2V7UA 1EE2A 4J2TA 2W83A 1DTWB 4BVGA 3EUEA 5CW2A 3OQNA 2F43B 2W42A 2A92A 4KSBA 3H04A 4BQIA 1VHWA 2ZOSA 2GRUA 3HKCB 3HV0A 3SKVA 1RJDA 5JD3A 2VWPA 1OW3B 5L9AA 3KSBC 1EX9A 1SUFA 3V3TA 3FTPA 4YCMA 2BFFB 4A82A 4ZCIA 3O47A 1K2VN 4GKJB 4ZMBA 4MQEB 4DKJA 3HWX1 4PIPA 1KBZA 4EHDA 1PJBA 3O0DA 4I1OA 2YINC 3KUDA 3SBXA 2WM2A 1PQWA 2X14A 3WL5A 3ZVLA 5CG1A 4EB3A 5E7JA 2IYUA 4RK5A 1OH8A 2SHKA 1MVLA 3UN1A 3LDHA 1JDNA 3OWOA 1D4AA 1DBPA 1VDZA 3EFHA 2D8MA 3G0OA 5ARBA 5JNVA 4GVXA 4O4HB 2R84A 2P41A 3GBVA 4KE8A 1Q74A 2X1HA 3KFLA 4AJKA 4Z3OA 4BJ1A 3IJPA 4EENA 3JARB 4FNOA 4DG5A 4UTRA 2AFHA 2HPZA 4ABTA 2FPWA 4MMXB 5JDIC 4NX2A 4AAYA 3U7QA 4XD7D 1HO3A 2RJNA 2Q5OA 4OHPA 1NBAA 1OJ7A 1V8ZA 4MWGA 5TQ0B 3QTLA 1KORA 1EUQA 4I1IA 5EEHA 1YC2A 4H1HA 4J0GA 1EFAA 2IKQA 4AICA 1TM7E 2O4UX 1S9HA 4TL9A 3SMVA 1GUBA 2F2TA 3ZIDA 3RRJA 4ENQA 2G07A 4BVEA 4Z7JA 4BBAA 4P3KA 3ICCA 5BQOA 1PTJC 1EX1A 2XMQA 3U81A 4XWTA 4YT2A 2H9AA 1DEAA 3GC6A 5JDIA 5LWHA 4C7BA 3SR0A 1R9NA 3TBKA 4NE2A 3W2EA 3UMBA 4CG1A 3E82A 4MKIA 3TRJA 1XK6A 2EKPA 3WGTA 2BRUC 4CQMD 1WIWA 3DEZA 4IMIB 4Q4HA 3GLFA 2JBAA 4P4NA 2P6RA 1U5BA 4ZQHA 1JX6A 3FOWA 5EIBD 5D84A 3ER8A 1PTJA 3MM4A 1B93A 5LDDC 1REQB 4MW5A 1E5XA 4FLFA 1ZP6A 4GM1A 1OI3A 3O94A 4ZGBA 4PYIA 2JI8A 3WFJA 2CT8A 1XAGA 4D82A 4Z4HA 5DGDA 5LQDA 2X8LA 2BRUA 1YL7A 4L4ZA 2PM8A 2GPAA 1QLWA 3QHQA 3QVTA 1CQZA 2PV7A 1WZIA 2Q2VA 3DG9A 3OM9A 1ZR2A 2VK1A 2YHIA 1QO7A 2A35A 3V4SA 4AO8A 3NNDA 3MYRA 1U8CB 1FW6A 4WL0A 2KW5A 4G2TA 1DUSA 3C3CA 4UU1A 5EUQB 3SQMA 1DS6A 3CUUA 1A2KC 3GFVA 1MX1A 2YMMA 3C3AA 4B7AA 1V41E 1Z0SA 1E1RA 4CR6A 1EWVA 4AKHA 3BMCB 1TU4A 3M3HA 3WK5A 3TH5A 4NBVA 1EFVA 1NKTA 4IEIA 5EE5B 4ZV9A 1ZGHA 3HXTA 3ZHCA 3FWNA 4J4BA 1YB5A 3IQXA 4CCYB 4DEYA 2QU8A 4FI3F 4G1VA 3P0EA 2VSOA 1ANKA 4MPDA 4OA5A 2ZUTA 4B87A 3QMMA 4C43A 4QU0A 2QB5A 3LLCA 3EGCA 5K8CA 2D1FA 1JJVA 2NZ8A 3D64A 1I14A 3KWFA 5EKDA 1KAMA 3W1WA 3ZU5A 2H7CA 3KCQA 4MX8A 4DVGA 2YFHA 2PTGA 3E8MA 5JJLA 1RHKA 3JQQA 2W2OA 3N7UA 1DHRA 4D3FA 4OLAA 3PT9A 5C52B 2G8NA 3QVLA 3V6LA 4OGFA 1TD1A 5DCYA 1IAVA 2OCLA 1EGAA 2QVBA 1TUIA 4QDKA 6YASA 2XITA 1N3LA 2Q4BA 5AVWA 5GM1A 3UWDA 3ZUPA 1CZOA 2CDBA 4N39A 4B74A 4MQFB 1O4WA 4A2QA 1GILA 1D8TA 4Q18A 1NASA 1ECPA 2ADFA 3PF8A 5LZ5A 3AV0B 3TN7A 4LTDA 5CCXA 1H0KA 1OTXA 3L46A 4KOEC 1W6RA 3DKVA 1D1PA 4JJGA 3EAFA 4MWOA 1Q0SA 1NNEA 1UF9A 2XE7A 5K3SA 2EWVA 3RS8A 2B35A 3EC1A 1PDOA 4IZ6A 4B0PA 4WOKA 2BEUA 3E7WA 1IE3A 2J41A 3W3AA 4BKPA 1A8IA 5IC5A 3HS3A 3V2HA 2FR0A 3FBTA 5DXAA