4G0MA

Crystal structure of arabidopsis thaliana ago2 mid domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
SIVKHWAVLDFTASERFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein argonaute 2
publication title Arabidopsis Argonaute MID domains use their nucleotide specificity loop to sort small RNAs.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 43
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g0mA00
1P6UA 1HEYA 5E3JA 2CHEA 4HNRA 4YWHA 5CNMA 3L49A 2QZJA 3H5TA 3N8IA 4Z4EA 3CG4A 5F64A 4D74A 3H6GA 1EWTA 4N76A 2IPNA 2FTKE 4HNSA 4EGSA 1USGA 4G97A 5TQJA 1W9HA 1M5TA 4IILA 3A10A 3LUCA 4KRFA 2JCGA 4MS4B 3O1HB 4MR9B 3LUDA 4IRXA 2PL1A 5EWJA 4WWHA 3K4HA 1DC8A 3HXMA 1QP4A 3F6PA 5TPZD 1QMPA 1VRVA 3O75A 1Y1LA 3LKVA 1TM2A 5DKFA 4LE0A 4ML3A 1APBA 1MB3A 3FFTA 3O2JA 4YS6A 2L2QA 3MIZA 4KQ9A 4OG2A 4B09A 2FMKA 2FQYA 3A0UA 3M6MD 4LDAA 3RQIA 3CKMA 2MYPA 2YHBA 3HSYA 4MS3B 2PUEA 2FLWA 1DG9A 1QO0A 4KK4A 3N6VA 4JASB 3OMWA 4GPAA 2DRIA 2RJOA 4LRQA 4MQEB 5JNUA 3VNAA 2LPMA 3ILYA 1U2QA 3O74A 4MPTA 1P6QA 4PE5B 1NXSA 3NNNA 5KC9A 3SG0A 4M88A 3NHZA 2WRZA 5KQMA 2VUIB 3I5AA 1DBPA 5I4CA 2R25B 3EQ2A 2B4AA 4TN5A 4IGAA 4UHKA 1BVHA 1CEYA 3H1EA 3BREA 1E6KA 4PYRA 4FE4A 2RJNA 1RXIA 2PMCA 1SXGA 2M1ZA 1SXIA 4F11A 1BDHA 2PLNA 4F8JA 2WY2D 5JNSA 1PHRA 2GX6A 2VUHB 4KREA 3I09A 1F51E 2CWDA 1XHEA 3Q7SA 2QU7A 4MRMB 5BR1A 4RK5A 5IUKC 1JWLA 1J56A 1KMIY 1DRJA 1QNLA 1ZAYA 1GUDA 2ZWMA 3MMNA 1ZGGA 3T38A 4ETIA 1UDRA 1LJUA 2A9PA 4MAAA 4N03A 1BAPA 3A0RB 3DBIA 4JP1A 1R8JA 3IPCA 5FBKA 2GKGA 2FMFA 2LUOA 4WZZA 4RK0A 3Q7TA 3SQNA 1KRWA 3GRCA 4MR8A 4RK7A 1FFWA 3UUGA 1A2OA 5T3YA 5FWXA 2MSKA 3BRSA 1M5UA 3QEMA 2VYCA 3JTEA 5TPWB 4KNYA 1Z2EA 2IOYA 5EWMB 5TQ2A 4XASA 5TQ0A 2PUAA 1P2FA 3Q41A 1IIBA 2V0NA 3T95A 1ZH2A 1L5ZA 4ZMSA 2E4WA 5JNWA 1PNRA 3CHYA 1RPJA 2A9RA 3S99A 3HO1A 4Q6BA 4RS3A 2BGGA 3EAFA 3KLNA 4OATA 1Z2DA 4JB0A 3SNKA 4N0QA 3VNBA 4TMYA 3JPWA 1VPWA 1QQBA 3ROFA 2JBAB 1FQWA 3JPYA 4RK4A 2PUGA 3TB6A 4XLTA 1XHFA 1U0SY 4RKQA 1M2EA 2FKAA 4Z99A 4QYMA 2O20A 3W9SA 4Z4HA 1YMUA 3OLZA 2L18A 4QICA 1DP4A 4KK3A 1I3CA 3H75A 3C3KA 1USIA 3LUFA 3RVNA 1U8TA 4EVRA 3OO0A 3RVPA 4JB2A 1EHCA 5KQPA 1YK0A 4YLEA 5KQGA 3JS5A 3MQ4A 3UKJA 1L5YA 1AB6A 1RZRD 4G0ZA 1QPZA 1NY5A 3HCWA 5CNJA 2NT3A 5IULC 1DC7A 2VK2A 4W5NA 4RXTA 1D1PA 3H5LA 4EYQA 4Z9AA 4RWEA 5EWLA 2NZUG 2FEKA 4P98A 1D4ZA 4Z0NA 3C6QA 1JYFA 3F6CA 4KPYA 3A3KA 1ZHHA 3HJFA 2WWVD 4D6YA 3EQZA 3H5VA 1BA2A 1YS6A 3EODA 4G0XA 4TLLB 4HYEA 3CG0A 2P9HA 5ED4A 1FSPA 1Z15A 1S8NA 3FFXA 2PUFA 4LDZA 4WXMA 1LBIA 4ZJPA 4Y9TA 4IMJB 2QW1A 2HJ9A 5TPZA 3JVDA 3C3MA 2PJUA 2FMIA 4OBBA 4EUKA 1DCMA 5KWSA 2FEWB 3LFTA 3OM1A 1FFSA 3NNDA 3KCNA 5C5CA 3HDGA 3KJXA 3QELA 1ZN2A 3RVQA 4OLBA 2FEPA 2QXYA 3HM9A 4WT7A 4W5TA 1E2BA 3GBPA 3MF4A 4G0PA 5IUNC 1TLFA 2H3HA 3IP6A 4GNRA 2QSJA 5EWJB 4XFKA 1YK1A 4D6XA 1P8AA 1K66A 4OLAA 2LBPA 2ZAYA 3OM0A 3LUHA 5HSGA 4Z9BA 3O1IC 3D8UA 3GBVA 4DN6A 3OO1A 4F06A 3KYJB 2H0AA 1U2PA 3CS3A 4MS1A 3DGEC 1SRRA 1LBHA 1A0OA 3N0RA 3H1GA 2MYNA 3RVOA 3IP7A 3MYYA 2NT4A 4FE7A 3LMKA 1YIOA 3T6KA 4PICA 5KQLA 1JDNA 2HQRA 3CU5A 4EYGA 4NICA 4RU1A 1SD5A 1SXHA 1A04A 4KV7A 1ZVVA 1USKA 4MQFA 1E6MA 4KVFA 5D2CA 3N0XA 2TMYA 1DRKA 2HSGA 2X7XA 4KQCA 4Q6WA 2FQWA 4N0PA 1JFTA 4RZSA 2MYUA 5FBHA 4MGEA 1XWWA 2IPLA 3N0WA 3QLUC 3RVSA 3CLKA 3RVJA 4F12A 4F3TA 3F7NA 5B3JC 5FWYA 3LUJA 1NATA 4ZMRA 3B2NA 3FFWA 3QX8A 5KC8A 4RY0A 1QQAA 1ABEA 1YS7A 2IDMA 4G86A 4OTZA 1RXEA 3GL9A 4MLCA 1FFGA 5BRAA 4W5QA 2J48A 4H3HB 3I42A 5BRJA 1ZDMA 3OQMA 5BQ3A 3ROTA 2QV0A 3MA0A 1F4VA 5HQJA 1Z25A 5T7BA 4N41A 3H5OA 3H5WA 3KG2A 1D5WA 2RDMA 1D1QA 1Z12A 1Z26A 3DZDA 1KGSA 1ZGZA 4UHJA 3TO5A 3HS3A 3OMXA 2PE5A 2GI4A 2E4YA 1BDJA 2LIVA 3Q9SA 4MLDA 2LP4Y 3ILHA 1EWVA 1URPA 1PEYA 4IMIB 2Q5CA 4YP9A 1OXKB 4MR8B 3EULA 3T8YA 1JBEA 6ABPA 1U04A 2F8SA 3M9WA 3HDVA 5FWXB 4XARA 5GOTA 4YR7A 5C5EA 2FLKA 5IBQA 4Z4IA 4RDCA 3GV0A 2R47A 3QEMB 2PL9A 2MSLA 2FQXA 2HQOA 5DLEA 2PUCA 4G0OA 3O2QB 1PNTA 5TQ2B 5TQ0B 3CTPA 3O2SB 1CHNA 4S05A 1ZITA 1K68A 3QLUA 4EVSA 4MR7A 3OQOA 1JX6A 3GYBA 1WETA 1GLGA 3Q15C 1C0EA 2JB9A 5B3JA 5DGCA 1JFVA 3LUKA 4YO7A 4EYOA 2IPAB 2AYZA 4KZKA 3OLXA 1PUXA 4W5RA 2OQRA 3QK7A 3KSMA 2F8TA 5JNRA 4NV3A 3GWGA 1W25A 3JY6A 5HKOA 4NCBA 1MIHA 1TJYA 8ABPA 3P9YA 4TLMB 3LUAA 1D2AA 3NHMA 4CBVA 3K9CA 3CFYA 3H5IA 1JFSA 3RVKA 3C97A 4ZPJA 1DCKA 1JYEA 3I45A 4EY3A 1ABFA 3F73A 1QP7A 4RXUA 4MS4A 3TD9A 2JK1A 3HV2A 4MR9A 2ID9A 3LKBA 4RY8A 1JDPA 4XAQA 6CHYA 5IC5A 3DLBA 4PEVA 1DZ3A 3N75A 3KHTA 2IPMA 3UK0A 3E61A 1EAYA 3G1WA 2HPHA 3RVRA 4ETNA 1ZH4A 3KYIB 4JOQA 4O1HA 3SY8A 3CZ5A 5DTEA 5EWLB 4FB4A 3HVRA 1DBQA 1Z18A 4G0MA 2E4UA 5HM6A 4MS3A 5JNTA 4N47A 1DBWA 2N9UA 1KRXA 4KFCA 1QP0A 9ABPA 1BDIA 2NUBA 3TMYA 3EGCA 1DCFA 2A9QA 4LX8A 4MQEA 2JRLA 2IYNA 2P4UA 2PKXA 2FXIA 1JLKA 5GQSA 1MB0A 1NXWA 4L4UA 2PAFA 2E4VA 1JL3A 1NTRA 3GA5A 5CHYA 3D02A 5IUJC 3QEKA 4PZ0A 2M98A 3JVIA 1NXVA 1OXBB 3QLVC 3IPAA 3EDCA 2B1JA 5ABPA 1QO0D 1TVMA 2HQBA 5IX8A 1C4WA 2ID7A 3OLYA 2PUBA 2E4XA 2FN8A 3FDFA 1E6LA 3QELB 4QYWA 3CRNA 1ZY2A 3KS9A 1AB5A 5JS2A 4YGXB 1LK0A 2E4ZA 4IF4A 3RVLA 2JVJA 4EVQA 4Z4CA 1PEAA 2QR3A 3CZCA 3FGZA 3O1JC 4Z4FA 3DLHA 2WJAA 3EJWA 1VLZA 4MYRA 2R4QA 4P1ZA 1Z17A 3BILA 4RV5A 3MM4A 2KYRA 4H3KB 5CNKA 4ETMA 1M2FA 2NZVG 2OENG 3C3WA 3IDOA 4LZLA 4MRMA 1JHZA 3R0JA 2W42A 1CYEA 5PNTA 1LJLA 3RVMA 3SM9A 2PUDA 4MS1B 3QX9A 4G0QA 4Z4GA 4W5OA 1GUBA 4O5AA 4RK1A 3OQNA 4NCAA 1NXXA 3KTOA 4KMRA 1QKKA 1NXPA 2MYTA 3N53A 1H9CA 4WUTA 2CD7A 1GCGA 4YCSA 1JF8A 1ISSA 5TPWA 3HEBA 1YMVA 3QLVA 1MAVA 2JVIA 5EWMA 2YHAA 1EWKA 2WB4A 2WJWA 3OLWA 1Z16A 2L19A 3SAJA 2GWRA 4XXHA 4O1IA 4RKRA 4MQFB 3H6HA 3LOPA 4H60A 2JVKA 4G0YA 4DADA 5JS1A 3NNSA 3IP5A 4L85A 2QVGA 2MSWA 5FWYB 2JBAA 2R48A 4HNQA 5KI6A 3HK2A 2I6FA 1ISRA 3QLTA 4ZYLA 4E7OA 3G85A 4YRZA 3DGFC 3FMVA 1GCAA 1TMYA 3LUGA 2WMYA 4DQDA 2GBPA 4JAVC 4EYKA 1MVOA 2RGYA 2IKSA 2FSPA 2XDYA 3OLVA 3M9XA 4LE1A 1VKRA 3E3MA 1NXTA 5IEJA 2FN9A 3CNBA 2A9OA 4QPJC 5TE9A 3HZHA 2AYXA 4RK6A 4RSMA 1YTUA 3TX6A 5IEBA 4Q7EA 2CHFA 1RZRA 2FMHA 3BRQA 1EFAA 4NQRA 1YVUA 3LTEA 4LE2A 2QVCA 2L17A 7ABPA 3Q7RA 1Z13A 3BBLA 4YV7A 2FW0A 2FVYA 1DJMA 4MR7B 4RY9A 4RXMA 1T34A 3RH0A 3KLOA 5JNVA 1JH9A 3H1FA 5DCLA 4S04A 3L6UA 3IP9A 5CNIA 3KKEA 3NBMA 1ZESA 1B00A 4WXEA 3HUUA 3HUTA 4E7PA 1NXOA 4JA2A 3URMA 3O21A 1RNLA 3GT7A
chains in the Genus database with same CATH superfamily
3OICA 3T41A 1A8SA 3WMGA 2K6GA 1CLUA 4MVJI 4GMXA 2ZUTA 3T7KA 5JW6A 2C58A 2CXTA 2CJPA 4X1KB 4YDRA 3KAPA 4DKXA 3WSWA 2NU7A 4YI3A 2FSFA 2JFOA 2ZRIA 2HCTA 3DMTA 3ZXUB 3BCUA 4EO9A 2J1LA 1JT2A 3N8KA 4TRRA 3TINA 1JMVA 1E1LA 2PLAA 3I76A 1CRPA 1O0SA 4ZRMA 1SY7A 1O6CA 1XVAA 4OHVA 3EXFA 1DG3A 3EXG1 5F35A 2ZS7A 5J2UA 2CHQA 1B26A 5F7ZA 4ZGBA 4ZTBA 3U56A 4CMBA 3AXTA 2GARA 2QTFA 2HLPA 3DL0A 1RXSA 1S2LA 4PFSA 5LIRA 3FB4A 3FPLA 4RY2A 1XG5A 1APBA 5GM2A 4I1OA 4PG4A 4CG1A 1I1OA 3MJVA 4L76A 3PUHA 2BEWB 2ZYSA 3NOOA 1PRYA 2JLAA 1GPUA 4L16A 2CNWA 3DD5A 1CZNA 5DYTA 1WPQA 3VM6A 4ZYYA 2YHBA 1C9YA 1AUXA 3U7QA 2PUEA 3VYSB 2GVNA 3SVZA 2GJ9A 2IUFA 1XAHA 3TRFA 3FB1A 2BMFA 2GF2A 2YUIA 3AF2A 1GQ2A 3BE5A 3I34X 4Q34A 3H1TA 1JWAB 4RLFA 5JBNA 1UZMA 3DMGA 3NC0C 2YMPA 3PFKA 2F67A 5AW9A 1BFDA 4CQMD 3M70A 4C2AA 2VSQA 3KB8A 3BIXA 5DTMA 1KO5A 2GS9A 4ZVOA 1DHRA 4UUMA 3FHOA 2HJRA 5FBWB 5DBIA 4UUNA 3INTA 1CP2A 5D7NA 3V7NA 1X2EA 3NNNA 2D0DA 3LECA 4KVZA 4I14A 4IAOA 3SG0A 5HMLA 4KAAA 2HA3A 3V33A 3PPVA 4XUGB 4DXHA 3A27A 3D7NA 4BU0A 4Y6QA 5DXFA 3R6DA 1DBPA 1QIIA 1XK6A 3PNMA 4RJIA 3DLIA 1E7SA 2VOJA 3DAYA 4E2FA 1YQGA 1ZH8A 3KPVA 2QAIA 4HQ6A 5DSXA 1ZI6A 2DWOA 3KTFA 4R8KA 5CDTA 5IKEA 2AA3A 5EXSA 3TTXA 4J4BA 2G6BA 3FHLA 4QBKA 1XEAA 4XFJA 1XXLA 3WWYA 2J0VA 3I01A 2EEPA 1S89A 4BATA 4NWIA 4ZT6A 4F04A 2QM8A 1U3WA 2MSNA 3BH7A 3NOVA 1X7WB 3HKBB 3QUTA 4Q19A 2C7QA 4KREA 1PG2A 1N6LA 3FSGD 3N2NA 1N25A 1FFBA 1IYZA 3G8YA 4ZDKA 1SVLA 6PFKA 2XTNA 2A30A 1GPJA 2ZYTX 4RK5A 4B43A 1Y1TA 1QE3A 4AY2A 3MRVA 4NE9A 4XX0A 2K4MA 2HL6A 3EVZA 2VQSA 3CUYA 4IIHA 4PZYA 1AURA 3UJ7A 5AXDA 4WK2B 5HHTA 5JRJA 5JYCA 5JJIA 2UVPA 3AVPA 4HTFA 2HMSA 2BHTA 3PNVA 3IDFA 3EEOA 2KWIA 3IT3A 4IQ8A 1QSGA 2VYCA 2WJYA 3CINA 3MMSA 3BTUA 5E6RB 5IZ4A 1UXOA 2AN9A 4QU9A 4FMCF 3WK8A 3AI1A 1D7OA 4Y9SA 2MINB 3PJGA 5DI3A 3VOTA 4EA8A 4F0JA 5F3WB 1H1DA 3DZHA 3F6EX 2Q7OE 1LBTA 5REQB 3V4ZA 2BJWA 1PNRA 4HGQA 1UJ2A 3CHYA 4MQLA 3IJRA 2XMSA 1JU3A 1BRMA 4QEKA 2YVKA 9ATCA 3E22A 2R6DA 4UTOA 4ZP1A 4URYR 4A23A 1JEQB 4ETNA 3AV3A 1XPUA 4AT1A 3KLNA 3CEHA 4OATA 2QQEA 4GLFA 4PSUA 5D3KA 2WWGA 2VP9A 4QXPA 3ZIUA 1RP1A 5E9AA 1XPJA 2P3SA 3L4BA 4XB6B 1V25A 4LBZA 3SC4A 4C01A 1C5KA 4ZVSA 3TB6A 4C0WA 1N5MA 3Q7IA 3WGGA 2XQKA 4Z4HA 4KR7A 4IGFA 2WYOA 3PITA 4I2NA 2X14A 3AKEA 2C98A 2BLLA 3QVUA 4BEVA 4W8OA 4UASA 1NMQA 1Q1QA 2EHJA 3HL4A 4QNNA 4R31A 3AVQA 3CF0A 3IPXA 4O4HB 2I87A 2I7TA 2VIIA 4KUHA 5U4QA 3PDCA 1IJEA 3IHTA 2BLNA 4J0EA 4J3NA 2Q45A 4DDKA 4CI9A 4YT2A 4K9OA 5KQGA 4LWQA 4F2DA 3I2KA 4DUPA 1X8JA 3EC1A 2NACA 3N86A 1RC0A 1XWFA 5HIIA 4TRMA 4AN0A 1Z08A 3HXQA 1ML4A 4HRAA 2ZUUA 1MHPA 2J41A 4WZBA 4WXYB 4IVNA 3UOWA 1FQJA 4FT2A 5DCWA 4B75A 1HGXA 1DAIA 4ENPA 4Y2QA 4Z0NA 1QV7A 1XZFA 2JIDA 3CUUA 3FBGA 5K3BA 1KARA 3SMVA 2VJNA 1SVUA 1ZK3A 1IBSA 3MT0A 1UBLS 3PGKA 3VX4A 1ACLA 4NE2A 4LPKA 3H16A 4K6OA 1JIVA 4IDPA 1CV2A 5ED0A 4WLFA 1T9KA 4L02A 4BMSA 1XZAA 1RI5A 2I2BA 1V1MB 3D8TA 4CKWA 1JR3A 2AHRA 5EEHA 1Y0BA 1IRXA 5AW8A 4Y2RA 1FSPA 1W76A 3KZ1E 2WZDA 1WB5A 2X86A 4NZMA 4QWWA 2DHQA 1CQJA 4LAFA 5JARA 2PS1A 4B17A 4RTNA 2QNRA 1E3JA 2QS9A 1NMYA 1H0KA 4IRUB 3GNTA 2HN9A 4NV0A 3DZFA 4Q3DA 1MH1A 1ZCAA 4MVJE 5L3SB 3N2GB 4ZHSA 2ZB2A 2V6JA 2O3UA 1B23P 4ZO4A 1OC2A 1L5NA 2GHTA 3IDAA 1IUNA 1QGDA 2AFHA 4K2AA 4RVFA 3RIMA 1PL8A 2IDKA 5HX7A 221PA 3GJRA 1PSZA 2PBRA 3R4CA 1NQTA 2Y2UA 4R8VA 4MKIA 4UDXX 3VPSA 3ZR4B 4E5VA 1E2UA 3M34A 3SIXA 3A9TA 1UBNA 2QSJA 2GA9A 5AICA 4MK4A 2PANA 4KN5A 1F0PA 1FYVA 4IDEA 2GZ3A 5ELMA 5CLQA 5HR5A 3SYLA 4MV7A 2JJYA 1VE1A 2ONCA 5L40A 3WL5A 2ODEA 4RZHA 1U80A 4MVJH 1B14A 3WS7A 1NIJA 1SC6A 4GBJA 4AMZA 1X1EA 1V0JA 1CZRA 3P2EA 3H1GA 3MJRA 3TNDA 1ESZA 3DB2A 5EJFA 3WLAA 4E88A 1RBMA 2YXDA 5I8WA 1A7JA 2ZSIA 1JDNA 4F71A 3MWFA 1Z35A 3QI2A 4JP2A 4EYGA 1F48A 3HYNA 3KT0A 4EL5A 3ZH2A 1E6CA 2COUA 4FHCA 2JG3A 1AZLA 3Q5EA 1ZVVA 2XUOA 3ETHA 3AVOA 4KR0A 4QKQA 3LLMA 3RTDA 3UTCA 1I13A 3B6KA 4D9CA 4MGHA 5EUCA 3TOCA 5KYYB 4RIFA 3W90A 1O95D 3E4CA 1DRKA 3SXUA 1TPYA 1N5LA 2MYUA 1XBTA 2KE5A 2I3GA 3QLUC 3MLEA 5ALFA 3PEFA 4QJIA 4Z7NB 1FK8A 3ZCTA 1RQNA 2CLLB 2Q49A 4ME6A 3TTSA 2DVMA 4D8VA 1NL3A 2Q6OA 3I9MA 5KC8A 1UJNA 2J6HA 2X8LA 4YT4A 1AHPA 2FF7A 2F9MA 1GKKA 3KLMX 3B9RA 2ZVPX 3ROZA 3GLHA 1FYDA 1FNNA 1UKEA 1XL1A 3DXFA 4F4DA 1EQUA 2RGCA 3I42A 3A9UA 5BSHA 2FK7A 3GGSA 4MB6A 2QT1A 2IS2A 2COKA 2F8MA 5T7BA 4HVAA 4X62B 1KFBB 3PNOA 1Y1QA 4O02B 2BGWA 2QUAA 3EWNA 3UM9A 4EI7A 5DX1A 3V4PB 1KDTA 4CIDA 4BPBA 5CT6A 1QG0A 3H11B 4QQFA 4QJ5A 1HLDA 4KIJA 2Y66A 1IZ8A 2P4QA 3HWRA 5IK2A 3T5DA 1FPQA 1R74A 1FVXA 1US8B 3NH6A 5IM5A 1QAOA 3ZWMA 1Z29A 2FSIA 4YMTA 1L5KA 2DQ4A 2H2GA 2VR1A 4PZZA 4TMVA 1WMSA 5I9IA 3VR4D 4Q3EA 3W4KA 3CTPA 1TKCA 2ZYHA 2F4NA 2G63A 4S05A 2QTNA 4JLUA 3E2MA 3BQMB 3B8HA 4HZIA 3Q3IA 4GVLA 2ZJ6A 5G0VA 2BFDB 2D13A 2QMOA 4J43A 2LCFA 4UOEA 2ZTSA 1JIJA 3K20A 4IUCS 2IPAB 3WMEA 1CERA 3RG2A 1L5GB 5H70A 4O2BF 2FHPA 2G82A 3LQ1A 1NE7A 3K2QA 2HLNA 4IDCA 1NYTA 3HBAA 3O4FA 4Q03A 1FFCA 4RLHA 3ZDXB 1GPBA 4X1KA 4N7MA 1V95A 2PT9A 1EFTA 5H3HA 4EHFA 1IBCA 3KLBA 3HXLA 4W1QA 4CRWB 4D7AA 1GAJA 1VTKA 1W6RA 4EP1A 2JLVA 2Y8EA 4LSZA 2BFEB 3A1WA 3BAZA 2BUAA 1Q0HA 3COSA 4I4NA 5YASA 1ABFA 1WQ1R 1MV5A 3QPBA 5K0BA 5LUAA 4OXQA 4US1R 2DTXA 4Q9LA 1TKAA 3DAPA 3L0SA 2J45A 3UJCA 2BW0A 2M32A 2VF7A 1GPAA 3B5IA 3BOSA 4CV0A 2BE7A 2XMDA 3DLBA 4BPRA 3ZK9A 3DYVA 3EIWA 1IZ9A 3KHTA 1DWQA 1B8PA 5J5AA 2NU6B 2WM2A 1JR2A 2BEWA 4A8PA 3CZ5A 2CFTA 4G0MA 3TSOA 2E4UA 2Q1YA 1L4YA 3EYAA 2PS3A 3KAKA 4RLQA 5HS4A 2RG1A 2N9UA 4E2YA 3P0HA 1R88A 3RRBA 5IABA 4HYYA 2LVBA 2P2GA 4L7VA 4MJXA 4GP7A 3WLHA 1X1DA 1YC2A 2BDEA 4FKZA 4FFWA 5AI6A 1G4HA 2OP1A 4EATA 3NWEA 3RD5A 1U28A 2P4UA 3DMYA 3I04A 4FDMA 5EQDA 5FWAA 3ZKWB 1MB0A 2YICA 1NZDA 2IW1A 5KOHB 3V34A 2FXVA 2XCOA 1L4BA 2EJUA 3I6QA 1Q3TA 4INPA 2ZTLA 3RARA 2B9EA 1A76A 2IEDA 1HDEA 1M7HA 4Q48A 1YAJA 4LZOA 1NXVA 2HIAA 5CYPA 4BN0A 1U81A 1JIIA 3ZYZA 2QYTA 4Z53A 4XIFA 5DU2A 3OLQA 4Z6KA 2WNIA 2A5LA 1RI2A 2PVCA 4ENTA 1GKLA 5E1BA 3AONB 4YGXB 2C4TA 1PDVA 3LFUA 2A0KA 1Y9JA 3EWIA 4M0FA 2ANBA 4JSTA 3VV3A 4M46A 1X7WA 3HKBA 4R5MA 3VZPA 5JXJA 4QYSA 2VCYA 3G1TA 1CUZA 1JE0A 3BILA 2TMGA 1Q0TA 2IH5A 4RV5A 5TVKA 4WV3A 1AT1A 3FPGA 4D0NA 2X6TA 1H4QA 3FMOB 4KIUA 3G0IA 1YRHA 2W42A 3AEKB 1ABBA 4C03A 5C7IO 3HGMA 5ALZA 4K6FA 1EP9A 4CMCA 3R6TA 1G20B 4OSOA 5AK3A 2VSOA 2PUDA 1WXDA 1AQIA 1SK8A 2BY4A 4EO7A 4DPKA 5A5FA 1FL9A 1NXXA 2FUEA 3CC8A 1DSSG 1QKKA 3QY0A 3RRNA 5KNBD 3HH8A 1PFGA 1B0UA 3PUKA 2JLXA 2EFHB 4LMPA 4L0MA 1DI0A 1JXOA 2Q4DA 4LDQA 1VJDA 3IEXA 5E6RA 2VHEA 3U4GA 4AB1A 5AM5A 3A4TA 1XA3A 2P77A 3DV9A 3ZZNA 1AKMA 3ECAA 2MINA 2Q2OA 4QTZA 1BU8A 1N9KA 3WNZA 4R1LA 5REQA 4PX9A 5E6SB 5KVQA 3MS4A 1WXFA 1Q16A 5F76A 4ZWNA 1WSBA 4G1VA 5DEIA 4CMIB 4DAEA 1IH8A 1CU1A 1YB2A 1QGED 4BE7B 1JEQA 1F2DA 3L8MA 1A88A 4QPNA 3C70A 3KZOA 4ND7A 4OP3A 2W83A 3VZBA 4A8HA 4DADA 5JS1A 1K7XB 1SXJD 4BO8A 4YMVA 3CPJB 3LGXA 2WUEA 4CT5A 5KOYA 1RIIA 2CLCX 3O8BA 5FWYB 2AKYA 5EPUA 4RPHA 2QUBA 1KZHA 3ETEA 1JFLA 1IZYA 2HA7A 1SIWA 4KO3S 2OPBA 3FETA 3GRPA 5DDIP 1TL7C 4GS5A 1XFAA 4YJHB 4YRCA 1W19A 2K5UA 5DP2A 4O4HA 4QG3A 621PA 2R62A 1KIAA 2BMWA 4JI8B 1N1MA 1T5SA 4AZSA 1YFZA 2P9ZA 3W8FA 5IPFA 3M9XA 5CIWA 3ZE6A 4ZCTA 1L1RA 4E1AA 2HF2A 3KVRA 5I3CA 4E2ZA 4NG5A 2WIDA 1I0IA 2RBEA 1I9GA 3OJFA 4MO2A 4ZMBA 2F90A 3OTQA 1EE9A 3GAMA 4RQUA 2JLWA 3OZSA 1KZ1A 1SK9A 5DGXA 5EQTA 3ODPA 3DXXA 3BWVA 1TCVA 1D07A 4MJ3A 4EKIA 2AWNA 4B3HA 1TYBE 5HRUA 4Y30A 3SC6A 2E6UX 3EG9B 1ZG3A 2GZMA 1I3KA 3RBZA 2CLOB 1CZKA 2F55A 1V1MA 1FTQA 1MORA 1VL2A 2OV2A 2FR8C 3J81A 1DAFA 4S04A 3H84A 5BPHA 4M1QA 1NVDA 1XKLA 2VTBB 3FZYA 3RFFA 1YB4A 1XLTA 1GJRA 1XN1A 3M6WA 4JVNA 1S3FA 4OSPA 1KEPA 5AM3A 2HU8A 1Z2NX 4OYYA 1VYTA 5CAEB 5L3SA 3N2GA 1R7RA 2J5BA 2EJWA 1IY1A 3P8ZA 1C7ZA 4J1NA 3ERCA 1H5UA 2BBOA 2OOSA 1V3VA 3MUEA 1MB9A 2ZB3A 2ZI9A 3FY4A 4L6IA 3DEAA 3G59A 2QLJA 1NFQA 3QKUA 4D3XA 2BTQB 3TEJA 2X9VA 1SOUA 2QG4A 3ZHVA 1LGYA 3LUCA 3HYLA 3IEKA 3LUDA 4IRXA 1A8IA 3BMCB 1YJQA 4L73A 3KBBA 1UDAA 4TSFA 1R6AA 3Q8LA 2KS6A 2JKYA 2IOQA 4JY7A 3CWQA 1VYVA 3TR6A 3KJEA 2RH5A 2IZ0A 3NHRA 4HPXB 4Z8YA 2IEZA 2WM3A 2IYEA 4JX8A 3DULA 5CPFA 3BD8A 4QA9A 1P7VA 3K6RA 3A0UA 3R6LA 1L4UA 1E79D 3CY6A 4PYQA 3HSYA 1Z56C 4X00A 5I9LA 2HKIA 1HLFA 2IZ1A 2YV3A 4WSOA 4L0DA 2WFMA 4LOLA 2ORED 2OXCA 1NVKA 2PUJA 4ZT7A 1OYVA 4KQMA 4X9XA 4RZUA 2BHRA 4RPLA 3ILYA 1ZP6A 3BH6A 3OC0A 4QO7A 4J9UE 1ECJA 1H2WA 3V7FA 4FOSA 4MV8A 3R7WB 4HVCA 4D81A 3HN7A 3OURA 2EW1A 1B41A 4PNZA 2VLBA 1E6EA 1G0OA 3ZC3A 1CUGA 5KYYA 3V8EA 2FGKA 4BNDB 1VCOA 2HX1A 3JVUA 3WAKA 1S8FA 1XTQA 3R7BA 1QYDA 4DCSA 3K70C 4CL8A 3FPKA 4G23A 4UHKA 4COKA 3H4IA 1P2DA 3WLTA 5TQVA 4KVAA 5E4YA 1E6KA 3CIOA 2QROA 1K5PA 1R0LA 1U6KA 2BHLA 4KJXA 4YT8A 5JV5A 3PUWA 2AJBA 4QU5A 5TDHA 3RBAA 1N7JA 4H0FA 1MO2A 3QX7A 3R5SA 3RS2A 4BNWA 1QVAA 5DM60 2ZR0A 1C7RA 1N9ZA 3E4DA 3L7YA 3QPWA 5AM1A 3U1VA 3DQZA 4OXXA 4FI3C 2EBWA 4XYMA 3H1AA 2CWDA 1CW2B 4N8EA 4RMJA 4X93A 3L46A 4ATNA 4MZDA 1M72A 3OP4A 2W6QA 1IAVA 3EQ8A 4TXHA 2IH4A 3TBHA 5ES3A 3H11A 2OBLA 4C0XA 3EGIA 4DCNA 2C2GA 1G6OA 1VHLA 3FNFA 3IMEA 5FTNA 1G8YA 1BHQ1 1B43A 1V5WA 1YXMA 1US8A 2H1HA 4NMLA 1NNEA 1JNXX 4CEHB 1A2OA 1A1SA 4UQOA 5EE1A 4B3JA 2G9RA 1GQYA 1Z6GA 2WA2A 4C7JA 2AX3A 1RWNA 4RJLA 5DGHA 3QXGA 1VCIA 4K8RB 1XJ5A 4GKJB 3WWDA 3VJRA 4J3FA 3E1KA 3EY4A 5SY4A 1ARZA 4UZFA 3QA3E 4Y7CA 3K5PA 5CM8B 1UP7A 1UBSB 1ZH2A 3GEDA 3L8YA 1UUFA 2C7OA 2BFDA 3UC5A 4CU5A 3ACBA 3FMFA 4KRYA 2GHQA 4MUEA 3UAWA 3ESXA 1AHNA 3KKKA 3VVLA 4OXIA 1TYZA 1C2YA 4OQXA 5D00A 5DVZA 3EZYA 3TIGA 1AS3A 1GNQA 1P4SA 2WFAA 2ZP1A 1Y82A 3K0BA 1U8FO 4XJSA 4GOJA 2QRNA 4MYSA 1M2JA 4X84A 2X8AA 3IUPA 3R6GA 4D1YA 2HTFA 2QRMA 2HQSA 1E9SA 3PI7A 4MUIA 2IL1A 4DRZA 3LYHA 3ZYCA 1ZBQA 5EKUA 1L3CA 2FW1A 4QICA 4D9KA 1A9XB 4IX9A 2OCGA 5LJLA 1JZTA 2KMLA 2ATXA 2IF0A 3SFTA 4DPMA 4KQ6A 1VI2A 1DS6A 1NI4B 3A9SA 121PA 1TF5A 5EIOA 5AW5A 2GPNA 4IXMA 4ZEXA 3RVPA 5IS2A 3C4JA 1NU6A 4BB0A 1H3EA 1QLWA 1YK0A 3CR8A 2VUTA 3HPRA 3NAQA 1WOMA 3G6WA 3DZKA 3ROGA 3K8YA 4KRXA 3WMFA 1QPZA 1Z73A 1CUAA 3SQMA 2WAXA 3QWAA 3O4RA 1Y5LA 3GO4A 2NU6A 3LP8A 3QFCA 4TQAA 1QLHA 5H4GA 2WWYA 1ZIPA 1I5EA 1I4LD 4KXQA 4XYLA 5FWDA 2Y0PA 4ZT5A 2VNJA 1RRKA 1AY0A 2YC4C 4IXTA 2PR7A 4KWEA 1EI9A 1NOIA 1OZGA 4QODA 2KB0A 4B73A 5IDYA 1ZHHA 1WCXA 2DR3A 5I3ZA 4G0XA 3EC7A 1W59A 3X1MA 3R77A 1LBQA 4NCKA 3ZKWA 1IHDA 1TM5E 2WI8A 3PTLA 1VXRA 4HGPA 4UE6A 5KOHA 2ZDQA 4B4WA 1UBGA 4X64B 4FOOA 4V1CB 4RM2A 3F71A 3IP1A 4XD7A 5CB8A 4GUDA 1H8HD 1MXHA 1R4AA 2O2DA 1DRWA 3BRWA 2Z56A 3CKKA 4FDTA 2JCBA 4I1SA 4V0QA 3T4PA 3WWOA 3ZY4A 2ROQA 2ZUFA 1DUVG 2A33A 4DIOA 3G7SA 3U44B 3PU6A 2JFFA 3H04A 1JAHA 1B0ZA 4UHHA 1ZMRA 1PJZA 4HG2A 2XHEA 4R8SA 3WKCA 2WHEA 3WLIA 1FE8A 2G36A 5K0SA 1J0CA 4TZKA 1JIUA 2O19A 2ZB4A 3R20A 5HA5A 2PYZA 1TNDA 1K66A 3D8RA 3KBOA 4DA8A 2H9AA 3IP8A 3N5KA 4UBMA 2XB6A 3PKJA 3AEKA 1LWNA 1EPUA 1H9AA 3E81A 4PTZA 4KACA 3HUEA 3U49A 1G20A 5JXHA 5CD1A 1W9MA 4NDZA 3EEIA 4F46A 3UV6A 4NFYA 2ZBGA 3U60B 2AR9A 5KYGA 3Q1LA 3K0HA 4JT4A 2VF5X 1IMJA 4TLDA 4AZVA 1YQWA 1OXSC 1MJ5A 4RU1A 4HX5A 3HACA 1YVPA 3IXQA 5DMXA 1L4EA 4Y1RB 2VJMB 4EB8A 1OOEA 1ORVA 4OKNA 5E6SA 3CCCA 1E6MA 1XMOB 2ZJ1A 4CMIA 3G9ZA 3COPA 3DWGA 2QK4A 3EZGA 3NP7A 5G3ZA 3VUEA 2RKOA 3RS5A 3CMMA 4QM6A 3O93A 4JXKA 1CRWG 1PI3A 3CLKA 421PA 3ISVA 3AILA 5FWYA 4HNHA 1JPJA 2C4WA 2Q27A 1U7TA 3NHAA 2PJRA 1U8AA 1TAHA 2AG1A 3DYBA 4JJAA 1U3FA 4XQEA 1VLQA 2I6GA 2Q3JA 4Y0AA 3M6VA 1P5FA 2FG5A 5ALIA 3H19A 4XQ0A 5TY0A 4YPVA 4YJHA 5BRJA 5IT5A 3DZIA 2HRCA 1EVIA 4PYKA 1A4RA 1M8GA 1Y5RA 1D2CA 2PY6A 3RIGA 3W5HA 1Z12A 2BZSA 4UHJA 4E6EA 2GI4A 5BUQA 4MH0R 2YCLA 1R6TA 3KQPA 4N6GA 4NXNB 1E1DA 2QL6A 3INGA 3OQBA 3G2PA 4UCXA 3W7VA 1HDZA 2Q5CA 4U7TB 2BMJA 3N0VA 1T29A 3HDYA 4EFLA 3MJDA 1N2CE 1X77A 2YTZA 1AKYA 2FJ0A 1FSZA 1YZUA 3F8SA 2R47A 2VJCA 2IY7A 3NBFA 2MSLA 4QOSA 3F8WA 1Z6TA 3GHHA 3EG9A 1GU0A 3K70B 1I30A 2V7XA 3QLUA 2PSEA 3VSBA 4EVSA 2Z6VA 5C7LO 3Q15C 1C0EA 1GU7A 3L7KA 2IXEA 3L8DA 4GICA 5BW8A 2VHUA 1J8FA 4EYOA 2QORA 1AMOA 1E6WA 2VTBA 2CUTA 1N9GB 2I55A 2HADA 1Z7YA 4K88A 4MDHA 1E5VA 4A03A 4A92A 2QZZA 3WHIA 4Q1BA 2SECE 3WMXA 2DCUA 3EVEA 5BQFA 2VFAA 5CAEA 1V7CA 4UNQA 1CFJA 1ZOLA 3JAKB 3HA2A 1DMRA 4MVJM 5FUXA 4D9JA 2YY5A 1Z0KA 2HW8A 2J85A 4K1XA 3CISA 3DO8A 3KUDA 1D2AA 3K9CA 4GMFA 4G5SA 2WU0A 1G2PA 5EHQA 3SLGA 1D6NA 1QH8B 1V9LA 4URWR 2BTQA 5TF0A 1JV2B 4I7EA 4I1PA 3SIRA 1UM9A 5KCMA 1LSJA 2P9BA 1KAHA 2Q4TA 3BMCA 1VLMA 4YCAA 3F5FA 4B6SA 4UNNA 1EVJA 1DX9A 4G0WA 3AI3A 2ZSKA 3A6JA 1WB6A 3X1YA 5AMXA 3UJAA 4DIKA 1DJPA 5J4YA 2A78A 5HJ2A 4KR3A 4YALA 1B15A 1I8TA 2R6ZA 5DGTA 2QP9X 4L4RA 1I3MA 4QG7A 5FI1B 1HRKA 2VPWA 2O2GA 1HDCA 5BSVA 4G25A 5IM4A 4L9SA 3V6MA 5KOIA 5A3VA 3D8NA 1CCWA 4CIXA 1IULA 2ZIZA 3S40A 4IFBA 1KERA 3HCFA 3ZY2A 2P6OA 4HOYA 4PO8A 3NR2A 3T1OA 3UHAA 4GDFA 1PLJA 2AJCA 3Q9NA 1BS9A 4K46A 1MEEA 1LF5A 1E0KA 2PZKA 1AGPA 1XRLA 3DBLB 1T13A 3FJYA 2V8BA 2HGZA 3R7WA 4UDYX 4CMGA 1TUGA 4Z9YA 1C9EA 4BGVA 2CMDA 2IYLD 4M54A 4Y2VA 2X4IA 4HLDA 3VJKA 5IASA 4OB8A 4PYNA 5TIIA 3QEKA 4PZ0A 4W82A 4BNDA 4J49A 1E3WB 3U7GA 1F2UB 5ECDA 4KUGA 1NF2A 2TMDA 2JA2A 3X1KA 1H2XA 2X2FA 4L9RA 5JYDA 2LNDA 3FDFA 2NUTB 3AEQB 1WQ4A 2Z98A 4PX2A 4AK9A 3Q2OA 2JVJA 2P0YA 1U0LA 5K6TA 1PEAA 1CK4A 3AF5A 3BICA 4C7KA 3FPSA 1ZSNA 1VLZA 3IR7A 1JHUA 1SQGA 4P1ZA 4E31A 1I6KA 2D8AA 2J5KA 2RH4A 3QBEA 4EY5A 1RTTA 2B0JA 2R4TA 3L6CA 4XDYA 2C96A 5EEGA 1I7QB 2B1RA 3OFSA 4AKHA 4DJFC 3KQTA 4MOWA 1JVNA 1GHTA 1C81A 2CXQA 1Y37A 1Y4AE 2Q9BA 3QFTA 2ISQA 1MIOB 4KCGA 3EBLA 4W5WA 4AJLA 3NJ4A 3ASYA 1PNQA 2BFPA 1NV9A 4ZTZB 1KSHA 3TDKA 1XTKA 4TMZA 4XE5A 4XPIB 5LXTB 2X0EA 4WK6A 5ER6A 4BKPA 1BQ3A 3T1YB 4MI9A 4YECA 2OAQ1 1BYUA 4ZAVA 3RK1A 5IXYA 4CEHA 4RWZA 1BIFA 1C0PA 2D2XA 1P17A 5JMTA 3OCCA 3LCCA 1LC0A 2SICE 1XZNA 2V59A 3T54A 5LNK1 1U4NA 1DOHA 1VYUA 1RHUA 2RAUA 2WSMA 2X4GA 3KD2A 5EC8A 3M4YA 4HQRA 1P1JA 2L19A 3U48A 5JBIA 5K4HA 1QRTA 3FYHA 4BQSA 1L6RA 1MN6A 1GSOA 4OMDA 5DNAA 2B2NA 3TB4A 1HQYE 2MSEB 3LZCA 3EXIB 4GR4A 3ZWDA 4LOAA 5CX1B 3R75A 4CLEA 1X42A 4MRNA 1QX4A 4WVLA 1R8QA 2IIVA 2YRWA 4L85A 4PYOA 2LCIA 2XRFA 1Y5IA 2QVGA 4QUEA 4A1FA 2OMKA 2GN8A 4D3SA 3ZBQA 4ERXA 3QVSA 3EGWA 5EHNA 1M6EX 3LBFA 1E60A 4IYJA 3S7ZA 2FCRA 5LZ7A 3SHFA 2I6FA 4CIWA 3CSDA 5SICE 5ITVA 2I2FA 3EEYA 4DSUA 1RPZA 4C6TB 3GLKA 3F9RA 3AESB 5F3DA 3FTPA 3RC1A 3SHOA 2N47A 2R68A 2XB8A 4RTPA 4KR6A 4V39A 3OUUA 4EOGA 1NI4A 2JBWA 1E2KA 4DQDA 4HXFB 2JGAA 3L40A 2OD7A 2JS7A 3PD7A 2W71A 3R9WA 1J25A 3MBIA 4I81A 2NP6A 3I2IA 2NO7A 1YA6A 4PGGA 3V7YA 1VG1A 3KJFA 3O8LA 5IEJA 2PD6A 4P4TA 5GONF 4CQJA 1AN9A 1B1AA 2W2PA 5EZ5A 1NUHA 3OX4A 4UHFA 4YJ3B 3SYNA 2UUOA 3KSBC 1DFHA 1NURA 1OMOA 1Z0SA 1ND5A 4Z2AA 5JZ9A 3GN2A 4M83A 3WAJA 1JALA 3VC7A 4NATA 4DBVO 2IGBA 4BO9A 4ZXPA 2WP8J 3ZK8A 5GM1A 1QHFA 1FIUA 3HMQA 4G56A 1TTTA 2FZGA 1XKQA 3CURA 3R0VA 4FK8A 4N3NA 2ORYA 2VATA 3D3QA 3HUTA 1CR1A 1N7IA 4V1CA 4GL4A 4JA2A 4EKYA 4TS4A 4B7UA 1RNLA 1WUTA 2YV2A 3OZWA 5M04A 3C3JA 3DV2A 2GN0A 3NVMB 4KN6A 1Z75A 3AETB 3EF0A 3BXHA 1QYWA 1PG5A 1P2SA 2P8SA 4YRMA 3RIYA 3VO2A 1I6WA 2AUNA 1Z8FA 1QZTA 4KQEA 4B2YA 3U44A 4QOJA 1SUAA 2IU0A 1TMKA 3F67A 4Y6GB 1U6IA 1QG6A 3GAZA 1D09A 1J21A 1OT5A 1PEKE 1WUHS 1JQEA 3KZKA 4I9UA 4IILA 1QP8A 3D6VA 4LQCA 4N5MA 3TJZA 2E5FA 2JCGA 2ZJ2A 4JIMA 1N2HA 1BE1A 4B33A 4CV3A 5L9AA 4O0MA 1WUIS 1D6MA 1KH2A 1SOWA 3FBWA 2Z3ZA 1II9A 5KU7A 3KSRA 2XA9A 4TM7A 5ALPA 2JIMA 3TZHA 2ZIEA 1MB3A 4I5IA 3WHKA 1MOPA 1XVTA 5KEIA 3OIDA 4IQGA 3ZV5A 3OKCA 3I9KA 5B6PA 2VUUA 2MYPA 1FQKA 3GIWA 3H4TA 3MTGA 4PZCA 4A7PA 4Y2JA 3VAYA 4M8LA 4HZUB 1UADA 3T9AA 1XVUA 2HPVA 3RS4A 4KKXB 1C0KA 2OO3A 4F2HA 2O8EB 2AUTA 5BURA 2WJVA 1MVLA 4LRQA 1OGIA 1HMYA 4WBNF 4D2IA 4OQPA 1JHOA 2XRMA 1JMKC 2CZCA 1PYGA 3C7CB 2H2AA 4BVBA 2GYWA 1GTVA 2QD1A 1A9OA 2VJMA 4JUCA 4QYTA 2I1VB 3OZIA 4FQ7A 5B2ZA 3ZY3A 1OFUA 4YCLA 3DT6A 2XNDD 5EFZA 1E1YA 1PJCA 3L0PA 4BKOA 1LLCA 3K9FC 4DV2B 3PNLA 4R1PA 2QZPA 4LRYA 1J9GA 1PNVA 4DV4B 3EWAA 3JQAD 3E82A 3JTMA 4OHPA 2RJNA 4HLUC 1RXIA 3L4SO 4MUMA 4EPYA 1USUA 2Y05A 4NU0A 1WCV1 3ZIAD 4EPTA 3A2KA 2WWRA 2P6PA 3TQQA 2RGBA 3QLEA 5H68A 3CVVA 4L5IA 3VJMA 5FBZA 1PHRA 2XUZA 3FX2A 4YAGA 5HYVA 4G4GA 2NQ2C 4YRLA 3K16A 1Q7TA 3D6NB 1HZZC 2RHGB 4KU4A 2N75A 1F8GA 1IK4A 1PNOA 2OD2A 5AKKA 3VR2D 3HY3A 1LK7A 4LWZA 1ZHOA 1DEOA 5ADHA 5HJEA 1TZMA 3MMNA 1YS9A 1XMXA 3E70C 4QJ4A 1XLVA 4N03A 1MQ9A 2OG2A 4ND6A 1U99A 5G0SA 2C9BA 4KLCA 5JPIA 5FADA 5DT9A 3U17A 1CUUA 1XDBA 2IV2X 3GCXA 2QRZA 5TMBA 1FNDA 3QBVA 2GPWA 1M5UA 5EJ8A 2ZYGA 1NUQA 1VGRA 1GZ7A 4KNYA 5C8YA 2VYQA 3C5HA 2IHNA 1F6BA 3G2NA 3BJMA 1H85A 1D8AA 3ZWYA 2V0NA 4LF4B 1U9YA 4MQBA 2E4WA 2PEZA 4ZMSA 4R0MA 5JNWA 4E51A 2OHOA 4CKEB 1ZRMA 1UXHA 1M10A 4J94A 3RYIB 5KOJB 2M2IA 3DCYA 3EUAA 1P0IA 1N9GA 1PSWA 1NBME 3KOOA 4JB0A 1VLJA 1QGOA 4TMYA 4ZK6A 4KOEC 1T1GA 3ILSA 2IDJA 4MV9A 3JAKA 3JPYA 4DSTA 1HPLA 2WIBA 3Q8WA 4NF2A 3MTBA 4IF6A 4QO8A 3OG9A 1E3LA 1P2BA 2DECA 3PGVA 3L1VA 4Z99A 3W9SA 4AX8A 1J09A 1YVRA 2O20A 2BMEA 4UW9A 2DR2A 3L4KA 1QO9A 2L18A 5HRAA 3M5PA 1QH8A 3RKSA 3T7AA 3VQTA 1CJUC 5FUBA 2ATCA 5FORA 3LUFA 3N9IA 3E84A 3K9QO 5K3CA 1N3LA 4EVRA 2WUGA 4MQMA 4BC0A 2GAAA 1M74A 3BD9A 4DMUB 3BSSA 4MRRA 4OD0A 5FHRA 4DHEA 1L5YA 4GLOA 4ITUA 3AVXA 1QPGA 5I7EA 4BJHB 1SQ0A 3SOPA 4MW4A 4C6RA 4FHEA 4GECA 1GSHA 1VG9B 2OZEA 3QBTA 1Y80A 1N2EA 4LDNA 5THXA 9MHTA 2YR0A 1PK8A 1E77A 4KSYA 2FWAA 4P98A 4QQKA 2AXQA 3W5DA 1RE0A 2YJGA 4OM8A 4NBTA 1NAIA 2ZWPA 5KPDA 3GWZA 4HFJA 4NJEB 2ZDHA 5E4JA 5ETJA 1BFUA 2DWQA 2PMBA 3D4NA 1PR1A 1BA2A 3EOBI 2Q0HA 1E58A 4TLLB 1SKYE 3U4MA 4LCBA 5BR8B 4IGKA 3PQDA 2PZBA 4UPVA 3DBLA 2D5LA 3FFXA 3THXB 2CK3D 2YVQA 5IDVA 1WB9A 1F8FA 1M0TA 5IW8A 2PUFA 3UYLA 1H1TA 4HWPA 5KTPA 4LGMA 1RWQA 3W8RA 3KNZA 1D4FA 1FCJA 2C31A 3NLLA 4LV6A 4O4JF 3WQRA 1JHMA 1DJQA 4MGZR 1CIVA 3RRJA 1CWUA 1E3WA 3SC3A 1F2UA 2ZLBA 3RC3A 1GNRA 4DDUA 1JBKA 3HO8A 5ARBA 1CRLA 2CNOA 1Q1NA 1XZLA 2ZT7A 1GTL1 3KCNA 3SJCA 3ZTYA 1Y8RB 4LDJA 1ZRHA 1ODSA 1FMJA 2QV7A 3AEQA 4MV4A 1J5XA 3MOSA 1GYPA 2NUTA 5C53B 1SXQA 2QXYA 4QDOA 3U37A 3WISA 4AUNA 3GNSA 3MF4A 3STWA 1P39A 5PGMA 3RT7A 1OF1A 3I23A 5IU6A 4GNRA 4EW1A 1OUMA 2WK1A 2XXBA 4QFBA 1KDVA 1RBQA 3PHLA 4KPFC 3NT5A 3WIUA 4KR2A 3FHJA 4E5NA 3DJFA 2EWVA 2E21A 2P2ZA 1I2BA 4LV5B 1FSSA 2V74B 4QTXA 5KMGB 3R2JA 4CMHA 1M2VB 1OFGA 1YASA 2FWNA 9LDBA 1MIOA 1ATIA 4QPDA 1E1NA 5JCJD 2G0AA 1CPYA 4IG4A 3GDFA 1NJ6A 4N6NA 4PYLA 5E8JA 4XPIA 4Z1MA 5LXTA 2YKGA 4NK4A 2P2YA 5FI5A 2H2WA 2I71A 3RVOA 2AG6A 4J7UA 2XUPA 4CM5A 4YREA 1N0WA 2GEBA 3EF1A 3C48A 2CMHA 5G1OA 3V42A 4ZZ1A 4AQ7A 2R1TB 2E4AA 3IJPA 4GXQA 4NICA 1RYDA 4R2LA 4H6VA 1P5RA 2QZSA 1SCNE 2OB2A 2VNAA 1T6BY 3R7FA 1J1IA 4IV0A 3UFXB 2X5NA 4YRSA 3HBMA 2OWEA 3HO6A 1CY1A 1RI3A 2NQ8A 5D2CA 4ON9A 4JK3A 3WA7A 2O5VA 3G2KA 4F9GA 3EXIA 4TTPA 2Q1UA 3ZXYA 4F3YA 2HMUA 3DFKA 3FNGA 3GEIA 2C77A 2UKDA 3PXCX 3OEHD 4MGEA 5CX1A 3I9LA 4LTDA 3R74A 1Y5MA 1BHSA 3EIUA 5A7HA 4GE3A 4KE7A 3H8JA 2ADOA 5DLYA 1W1IA 5CB0A 1NATA 1R0SA 3HU2A 1H65A 1ZA1A 3B2NA 3QX8A 4IQFA 1TCUA 1EG2A 1SHTX 5HF6A 3MPOA 5GIOE 1I51A 2NO0A 3NRCA 2NW6A 4MQUA 2PNJA 4N0MA 4C6TA 4W5QA 1R6XA 3AESA 1PW5A 3I8XA 3OCVA 2HJVA 5M2QA 3H3JA 1MJNA 1NAHA 5CM2Z 4ZO7A 1DEXA 4ZQIA 5CIYA 2IUYA 2HWUA 2YWHA 4IW3B 5FI0B 1PX2A 3ZW9A 3KKQA 1QU3A 1UJ4A 3QWBA 5AJUA 1O97D 2ZVDA 3EXG2 4ZODA 1WKBA 4NBWA 1IDOA 2PL3A 1EFPB 4A5SA 4O2AB 3CRQA 1COWD 3T99A 1QRAA 1ZXXA 4PC2A 1K3UB 3ZE7A 1XMQB 2G08A 4OHOA 1LPBB 3TLAA 3FNQA 1A9ZA 2ONKA 4YJ3A 5AW1A 2SKCA 3PHJA 4IDDA 1LJ8A 1K4KA 1W0JD 2IOHA 1KU0A 3GV0A 3QEMB 3S55A 3KQKA 2BDUA 5FQOA 2C2BA 3ANNA 2J46A 3GUUA 1EK6A 1ZITA 1DOAA 4D4IA 4E5MA 3I05A 3D7RA 1O77A 5AKXA 4FKBA 4UNRA 1W5FA 3SZMA 5CCXA 3THRA 3RC8A 2ZJZA 4G4JA 1HYQA 1IBLB 3KJGA 1D1SA 1GUYA 1KI7A 3BDAA 3DW3X 2UVQA 3FOWA 3GEHA 3LCMA 3OLXA 4JQZA 1VHJA 5ICEA 3QMPA 1HE2A 4KGVA 2G1JA 3OEWA 3NPAA 4YTEA 4NCBA 1XF9A 3AETA 3ON5A 3SBOA 5D01A 1L4NA 2PSSA 4LVNA 2V54A 4QRIA 1C2TA 2GDJA 4Y9DA 2VDKB 4HQ0A 4BAGA 4RVGA 3O4JA 1DKNA 1G63A 1YL6A 1O08A 1TIPA 3TYXA 2ZZNA 3LQQA 3OF3A 1AV6A 4Y0NA 1SBHA 1P1KA 2JK1A 3LKBA 4Q3NA 1L7MA 2G25A 3WFJA 4F96A 1BS1A 6CHYA 2RAFA 4FW9A 3GGPA 4TWBA 1PKXA 2VDNB 3AR3A 4AROA 3UH0A 2XWPA 4FWBA 4ZOCA 1Q1EA 3FCCA 5B7NA 4CTNA 2FPGA 4JDUA 1EJ2A 3E15A 1PD1A 2WIKA 4X8OA 5DCYA 2QN8A 3MTJA 5HFAA 3RHSA 4C5BA 3ENQA 2O5EA 3QF4B 3L84A 3LY9A 3PT5A 1KDZA 3CJQA 3P27A 3WLEA 2IXGA 1ORDA 3JX9A 2A57A 1CUFA 1KO8A 1FPMA 1CY0A 2H31A 1KBZA 2I03A 2P11A 3K92A 3Q40A 9ABPA 1D1TA 4Q02A 3TMYA 4KBYA 5TRTA 2O8EA 4KQ2A 4G65A 1O96B 2V7WA 3A1UA 5KNDA 5CTAA 1RXWA 3ZQUA 2ZTVA 2P62A 3N2KB 3OOEA 2V4MA 3NAGA 1BEUB 4EQZA 1UBOS 2ZGVA 4M9CA 2IHTA 1OTHA 3AH8A 3HCAA 4EJ6A 2NTEA 3BIFA 3D02A 4EG4A 1ECLA 2CNWD 1OI2A 2G5PA 4HBZA 1TJ4A 1SG0A 2DE0X 3O7WA 1OE0A 4YO8A 4KMOA 3UHPA 1IQUA 1LLQA 2V58A 5FPYA 2DU8A 2ZBVA 4JI5B 3KT8A 5IAAA 2VCHA 5KQSA 3QELB 4UEJA 1E6LA 2GVDC 4NOJA 4KDRA 2GOYA 3GQVA 1I4TD 4KFSA 2JBHA 1XUOA 5FAKA 4V03A 1DKLA 4N9QA 3TIIA 1JB9A 1FW6A 3AYZB 2E1RA 3DSRA 3QW2A 1WM1A 2LGJA 2IYZA 2HNBA 2D8MA 1XL0A 5AI8A 3I6ZA 2H17A 2Q8NA 2NZVG 5DYIA 2ZXFA 3O8OB 3MPUA 1IB0A 4G67A 3E03A 2VAMA 2YOGA 3STHA 2O8BB 3N05A 4G5GA 3C74A 3SZGA 4EPXA 5AW4A 3HUDA 4Q47A 3RVMA 4BWGA 5DN6A 3SBXA 1P72A 1T2FA 4RKWA 1KVRA 3OQNA 1KH3A 3KTOA 1AF4A 1YC5A 3F7TA 4PCLA 1YDMA 4TLEA 1T26A 5B2FA 1JEJA 1OY1A 3AIIA 3M2PA 4V3BA 3FYCA 1FNMA 3K9LA 4GGPA 1PBTA 1UJMA 4X44A 5K20A 1AJEA 2JHAA 5I9BA 1AKNA 1NMEA 1Q1BA 3LYLA 2C29D 3QNUA 4GRAA 4PSDA 2WJWA 4RLSA 3GA7A 5A6SB 4BNZA 5E3HA 2XCSB 1DIRA 1SD2A 5HWSA 5IZCC 1NPTO 5LBIA 2NLOA 5EESA 2GTPA 1RAAA 3NHYA 2EDCA 1E7QA 2CCJA 2XF8A 4J8PA 4CKEA 3L07A 3NUGA 3RYIA 5KOJA 3VYRB 4V38A 5LCXA 1SWWA 1LI7A 1EFKA 3IODA 4MO9A 2HGSA 2BD0A 3GLQA 4GOND 4KQJA 3HR7A 3ICOA 3T5BA 1C8VB 2Q41A 4FZ3A 3W5SA 5KI6A 3PD0A 3RWMB 1TF7A 3SJBA 3OFNA 3PDUA 3QOXA 1R6DA 4FYIA 4P7GA 1SRQA 4XQ9A 5AKIA 5IFLA 1I7LA 3GLIE 3MINB 3P1JA 1T9GR 1ZAKA 2YBDA 3ENWA 3BXPA 2JW5A 1KEZA 4H15A 2H85A 3FBTA 1TMYA 3PV0A 3ZOZA 2WMYA 2GK7A 2ZTMA 3D7LA 2B25A 1IXSB 1NN1A 2JZCA 2BFFB 5M34A 2MMCA 4I5DA 4COOA 2RGYA 2VBGA 3V55A 4FILA 1ZBDA 3HWSA 5G4KB 4L1KA 1T1IA 3CNBA 4AJ1A 1WUJS 4QBGB 3IC5A 2UZ3A 3QSGA 5B64A 3PB3A 3FJ1A 3FUCA 2VAPA 2GJ4A 3MG9A 3QYJA 2CHFA 1VI5A 3BRQA 1W0KD 5EVJA 2JGDB 4AMUA 2OKGA 3BZBA 5TV2A 5K03A 2GHIA 3QI7A 5JAQA 2WKSA 4LE2A 2GPTA 4R1NA 4J29A 4OI4A 4EY8A 4NJEA 1TU0A 4KIGA 3A28A 2B8WA 4MR7B 1WPXA 1ZU4A 2IHUA 4RY9A 3N2YA 5HIMA 5JASA 2B1GA 1OBCA 4DW8A 2JLUA 3DG9A 4C7VA 5FBLB 5CNIA 1IM2A 4BIMA 1SZPA 3THXA 4UAUA 4WXEA 2DPHA 4DLWA 2HTEA 3BEDA 3SN6A 2R0QC 5LP1A 3VMMA 3GJQA 2F3PA 4FXOA 2IHBA 5KNCH 3LAWA 5IDQA 5FHQA 1P6UA 2YINC 3N8HA 3O82A 1P2VA 3L92A 5CNMA 3L49A 2O5RA 1MB4A 1N6PA 2QZJA 2R8RA 3C5WP 3R76A 2POCA 3SP1A 3EPPA 1A8HA 1Y8RA 1FRQA 1QKIA 3NUQA 2PH7A 3G79A 4IBOA 1IDN1 3ZHRA 4HNSA 4K87A 2G83A 1Q2XA 2HU7A 5F4BA 4GW3A 4YJKA 5EZYB 3TS1A 1K63A 2H1WA 4HADA 4D82A 3EUWA 3Q1KA 2GAIA 3O4IA 1MTZA 3P2YA 1U0OC 2PCJA 4MWSA 3ZGXA 5AQ1A 2VBCA 4YDQA 4X7PA 3L6RA 5AOAA 2XE7A 3JD4A 5KMGA 5EHGA 3T7RA 4OU5A 3ETNA 3GEBA 1CE8B 1M2VA 1NF9A 4ML3A 3ROPA 2JIRA 5E7MA 1FYWA 3VR5H 3GPIA 1RM5A 1K0FA 2ZCUA 3EQ7A 2RGWA 4FHGA 4IIVA 2NPOA 2QLTA 4LGCA 4Q7MB 2FQYA 1POWA 2GD0A 3KKPA 3FUUA 3KPWA 4I50F 4B71A 3LE8A 4MJ7A 1DXQA 1H6CA 1VKJA 2HK6A 2DAPA 3WLMA 4OHXA 4F6CA 5CFRA 4LXTA 4FLMA 1JDSA 2GFHA 2WU1A 3F90A 4HUQB 2OBMA 3TE6A 4CG3A 3D2BA 3O74A 2R1TA 1NSFA 1NULA 1P6QA 1KFKB 1LQTA 2DH6A 3LRXA 4B3TB 3M49A 4XSVA 3ZUGA 2QJOA 1PYOA 1QX3A 2KJQA 2MMGA 1TQ8A 3NHWA 3QUCA 3QXCA 3NJ8A 2PJDA 3EIQA 4I3FA 1ZU5A 2INGX 4OXKA 3UFXA 4DBLC 5B36A 5KJCA 3ITEA 3AR8A 5EG5A 5I4CA 5EIAA 5F5XA 2AQHA 5BORA 4CFYA 4A91A 2BHSA 3GY0A 3ODGA 1T3GA 1Q84A 5DEOA 3BZWA 1NW3A 2DH5A 1IWOA 3AEXA 3WKDA 2HBQA 4BTEA 3R3VA 1K86A 1VECA 3JQQA 2QLLA 3SM3A 2R6CA 2HSJA 2ZRMA 3B12A 4XEUA 1RHKA 4F4HA 3KB1A 3MJSA 2WY2D 4GWKA 4DZTA 1Q0SA 2V45A 4S1PA 1BE0A 4DA9A 3EVBA 2GZRA 4RCZA 5EKDA 3CGWA 2F7SA 4MVJA 2IXAA 5JY1A 3AR9A 3NYWA 3P96A 4LCEA 4YV0A 5BR1A 5FEMA 4FMBB 5DHTA 1KQFA 5HIJA 1NC1A 2Z2JA 2MU1A 1EFPA 4MAAA 1Q44A 4DV6B 4I9FA 1P1FA 3WNQA 4O2AA 4JWKA 4YCNA 3E9NA 4DV3B 1BE6A 1BN7A 1R27A 1J5PA 1E69A 3A4LA 3L43A 3SFZA 3V1KA 4R1QA 1ORIA 3DPIA 4GMKA 2HY7A 3WIBA 2AV6A 2QF7A 4V24A 2Z2YA 2CJXA 1KJ8A 3FUVA 3IBGA 3MELA 4M0LA 4ZOAA 4NEGA 1GN8A 3QEMA 3B6EA 1LDBA 3STYA 3V2HA 1U2ZA 4Z49A 1ML3A 1K08A 2BC9A 3F96A 5BUZA 4HAUA 4Y1GA 3Q41A 2G1KA 4PQFA 1GPNA 1SFRA 4UVDA 1AQYA 2IUTA 4S1WA 1O6ZA 4OMUA 4EF5A 3EPKA 1BGWA 1TEVA 1YACA 3I6MA 1M3SA 1G42A 2AMFA 4HLUA 4KL8S 4DM3A 1JQ3A 4FNAA 3KM0A 2XUGA 4FDUA 1RJ9B 1CZHA 2ZYRA 3BSWA 3ZQKA 1BKYA 1EA5A 1T5BA 3DM9B 1VKZA 1F2TB 1V9CA 5KX5F 1PFYA 2R11A 2ODQA 3B6ZA 1HZZA 1TZKA 3V7WA 3ZCRA 5DK4A 4QYMA 1RRMA 3THOA 3ZD7A 3QE3A 5FTMA 3WX0A 1P3Y1 2WJJA 3Q9LA 1DP4A 1F2VA 4QC2A 3V4VB 4N65A 1YWGO 3WMRA 4PG5A 1HNWB 1MRZA 3V1LA 1OSNA 1U8TA 1WF6A 1NW5A 2VCEA 2Z6AA 4K81B 1EHCA 3C0KA 4XWKA 2C9DA 3BD7A 5CFPA 2FF5A 3JS5A 1V4NA 2Q2QA 1XDZA 4JJ6A 5CK4A 4FBMA 3ZW8A 2P9GA 5A71A 3VNRA 3TUJC 4J2HA 1Q83A 1TC1A 1CULC 1HOTA 1NY5A 1JLMA 1H4TA 1KNXA 1ZPDA 3PIRA 3O73A 1GZUA 3UWOA 4RSHA 5GV8A 2PKWA 3ZX4A 1XOIA 1BROA 3O1LA 3AYXB 3QF4A 2R66A 4JELA 5CLLA 4OUDB 2XE4A 2ZATA 4XTRA 4KPYA 1G6HA 2B5OA 3MCWA 4PM4A 3QUSA 4WKPA 1ST2A 3AVWA 2C3UA 4QUBA 2Q6VA 2D1FA 1O96A 1NASA 4CLRB 5A0TA 1QTIA 3VDMA 3GEEA 1GLNA 1MX5A 3N2KA 2F3UA 3GIDA 4LDZA 4Q37A 1LBIA 2CV1A 5FBQB 5FXMA 3X2EA 2I6SA 1TCAA 4QHYA 4X5OA 2CBZA 4KO8A 5DWDA 5A3JA 5BR4A 4F84A 2NVWA 3VDNB 1NPYA 3UMGA 1JQLB 1Q14A 3P9CA 3TIFA 4UEWA 2YQ4A 4MEJA 3ZPXA 3QELA 1ODTC 2AEJA 1QQ5A 2BFWA 4TUYF 3LDFA 4YC7A 1N2IA 2FEPA 2BGJA 3H9JA 3LOQA 2BMDA 1RM3A 2Q3BA 5BR7A 1BWSA 4X65B 4BVLA 2QD3A 4R7ZA 5BN3B 3U81A 3PCXA 4J2TA 1G3MA 4CEIB 1AD2A 4EZEA 3Q4GA 2DT5A 2QX8A 4M1MA 2Y1EA 3UAXA 1JS1X 4Y6RA 1IRIA 5CG1A 1P81A 1JFRA 5EKSA 4DYDA 4LZZA 3O8OA 2BFNA 1TA4A 2O8BA 3OPMA 4ILEA 3W2HA 5KVVA 1ISGA 3PI6A 4NH4A 3LWBA 1QH0A 4WJZA 3U1BA 5JOQA 4MAMA 1Z07A 3LDHA 1LW7A 1YUBA 4OX9Y 1WXWA 1A0OA 3HXPA 3G68A 1UK9A 5KKAA 1U3VA 2NT4A 2BGNA 2QTAA 5AVTA 1SZJG 8AT1A 3JQ7B 2XMCA 5SZIA 4C3VA 4BS9A 1FVFA 1AN0A 2HMYB 5DH9A 1CJBA 5BOSB 2XGOA 4C0SA 2F1OA 4UTZA 2NPFA 3T7EA 5A6SA 3OIFA 4JGGA 5CXQA 1RM0A 3NVAA 5DN9A 4IZ6A 5EMKA 5JWHA 2WJGA 4PLGA 3SEZA 3RC2A 1PR9A 3VYUB 2QTBA 4KGXA 1W5SA 1P73A 2OSBA 4HXEB 5LN1A 1I4WA 1FLVA 4CN9A 2YDXA 4EBBA 1Z0ZA 4F2PA 4H1WA 5A5GA 4AYXA 5LLTA 2ZJ5A 1CJSA 5HIKA 4G9GA 3AY0A 4LVOA 2IY9A 4B6PA 3U3DA 3RM3A 2XUJA 1D4AA 3LPMA 1YI1A 1M0EA 1GL9B 4NL4H 4WRRA 2YNMD 4OQZA 1GZDA 3ED1A 3LSTA 4XOIA 1XTRA 2EKQA 2GAFA 3QE0A 4I1YA 1N5KA 5D87A 5AD1A 1FFGA 4I6JA 4RD3A 3MINA 4BJ6A 3G13A 4AJKA 1UT8A 4JBYA 4M99A 5BQ3A 1EDBA 3RYCA 4UREA 2V55B 2BFFA 3NTQA 3SOZA 4LQDA 2PVSA 4FOPA 4RACA 4AN1A 1KQGA 3FSRA 5TLSA 3KQLA 1WBDA 5G4KA 3RODA 1GCOA 3DT9A 3N28A 3CBQA 4RD4A 2C92A 2PWAA 4MLDA 1NFFA 3A4YA 1W5TA 1G3RA 4D43A 4MGIR 2V3WA 4CCYB 1URPA 1E9EA 1USWA 4OIFA 2PRYA 2H52A 3QWFA 1P1CA 1C0IA 4D9NA 2JGDA 2A1TR 3MBOA 1ENOA 3HYCA 3IAFA 3FPBA 3I9V1 3LX5A 3NBAA 3PRKE 2ZBUA 2FSSA 3HI6A 4QFMA 2DY0A 2CXRA 1Y34E 2W2QA 1ZD9A 5TQ2B 1P60A 2VSYA 4C22A 5F2EA 1ENZA 1UJBA 5ESDA 2VPXA 4MR7A 2QRJA 3F5MA 4XFDA 2GRUA 4ER6A 1MPXA 1X7DA 1AH2A 4DLTA 1M6YA 1HFEL 1Y3HA 1P18A 1TTQB 3MGGA 4IVQA 2QRQA 3GEMA 4HAWA 2IRWA 5FOSA 1QTNA 1VHWA 3EMVA 4Z8XA 1ONOA 1AS0A 1WULS 4S1TA 1SUBA 1TD1A 1PUXA 1IHOA 3DNFA 1KAEA 3PGXA 4Y18A 3S3TA 3VPCA 4D3ZA 4NV3A 2IJGX 4BRSA 3OT5A 1OIVA 4BKMA 4XLZA 3WLNA 2XUAA 3A4IA 1ZGAA 4PPQA 1GP2A 3FFAA 1V2GA 4YPOA 3AEYA 3CFYA 1QWSA 3P9ZA 1B2LA 1M54A 2HBYA 3HB1A 4RDHA 3TJRA 2XGMA 4DR1B 4NCIA 3N2ZB 5EZYA 3MWYW 2UUAB 4HDQB 4JJZA 4NAVA 3VBCA 2RD2A 1G7CA 1Y7PA 1SC3A 1NJSA 4LJYA 1BXKA 4J75A 1BMTA 4CLXA 4TZ0A 1K7SN 4HLCA 4CIVA 1NF8A 4INOA 1CE8A 2YIVX 3OPYI 4D4GA 5BSEA 1EA7A 3LUPA 5AM0A 2AQIA 5G0WA 4ENWA 5EWLB 5HP4A 2XDQB 1Z18A 5HM6A 1RRFA 2QXUA 3SE7A 4IGEA 3EAQA 2EJBA 3LQKA 1QJCA 2D06A 3BA1A 3R7SA 3TRHA 4OA8A 4HUQA 2ZR9A 2WJ4A 3SKXA 4IDOA 2ASEA 5DNVA 1XZCA 3GDOA 2FW6A 5GQSA 1ITZA 5GZ3A 2D7DA 1A72A 3A6ZA 4RMHA 1XA0A 2PO7A 3PE3A 5JISA 1Z22A 4Q4CA 4LS3A 4OUKX 3ESAA 1MUUA 3GA5A 4DARA 1SURA 1TYCA 5K3SA 2JLCA 3TRKA 1TCCA 1FTNA 1ZK1A 4C20A 2WWTA 4L74A 1ULZA 4PBTA 4LC0A 5IH3A 1IATA 2ZRHA 5KBYA 1P4GA 4UAVA 2V1UA 3Q11A 1T9DA 2QI9F 2OTCA 4S3MA 4X85A 4QOIA 2C9CA 3OPXA 2ZRLA 1U0RA 2DWPA 1E9VA 4IKEA 2PGDA 3KX2A 3S29A 5BVGB 3CEJA 2GBGA 1G5HA 2QR3A 3AXSA 3ED5A 3I4FA 2F1IA 3M83A 2OXTA 1P1IA 4AIIA 2IXFA 3TKAA 1U9IA 2DHCA 1VIYA 2R4QA 3DHEA 3A6KA 4WFJA 3SGLA 3OJCA 4AZTA 2FPUA 2VPYA 4GXRA 4P34A 4Q16A 5DULA 4BWYA 5LYYA 3R0JA 2WINI 2GASA 4D96A 4E6PA 3BDVA 3MMPA 4CDMA 1E3MA 5EHIA 2J67A 3KSDO 5FO0A 3WP1B 4BIIA 4LHXA 4AS2A 5CDYA 2IPXA 3AZOA 4A9AA 3UB4A 4Z51A 3OPVA 1DV1A 1E64A 3G8AA 3W5JA 4RPIA 3ZZUA 5LR6A 1JFFB 2YJ3A 2PFKA 4WUTA 1P9RA 5IKMA 4I19A 5IP5A 3ZVKA 4OHYA 2QTWB 3OA2A 4IMPA 5FYDA 2YHAA 4XRRA 2Y0DA 5SYMA 4GDMA 3ANLA 1B74A 3WIOA 5LZ8A 1J97A 2BCGY 1R00A 3RYTC 4ALKA 1AKVA 5LP6C 1MKYA 4MQFB 1GYRA 4R4JA 3I62A 1QG2A 2IOFA 5GJVC 4F5WA 3BGIA 3CEPB 4REQB 4G0YA 4X8HA 5BW5A 4JT9A 1J23A 4CU2A 5HIAA 5T4HA 1RJ9A 2NO6A 1YO6A 2OV8A 3DVAB 3F3SA 5H3CA 3ZXXA 3WRXC 3PLAE 5IVIA 1F2TA 3AQ4A 5AJZA 4RULA 3F1KA 5K8CA 3V8NA 3TDMA 3HJTA 1UPCA 4BZXA 5BY2A 4EEXA 4OHMA 4ZYLA 4NS4A 3WL3A 2HM7A 2BBWA 4DC9A 3QMWA 4AY5A 3I52A 1PIWA 3AGQA 3UKDA 4F92B 4C89A 1Q21A 1AV7A 2PHZA 3NEAA 2BSXA 5HPYB 2W2OA 2DJ5A 1ZVJA 2GK6A 2R7NA 3FRJA 1NP3A 2FPMA 4A2CA 3E3MA 4JVSB 5AI9A 4FX5A 5DM2A 5JJ5A 3QXXA 5TE9A 1T0UA 3HZHA 1SHJA 2BGLA 2ZG6A 3KJIA 4GEKA 3REGA 4Q7EA 4BQFA 4AS3A 4DC1A 4JV5B 2JFHA 4BNMA 2ZJ8A 4F85A 3BERA 4R9VA 5IZCA 4OUDA 2O50A 2BEVB 3HEMA 3G5TA 1QVWA 4RNCA 4RYDA 1LPNA 1VIAA 4O4IF 4TWRA 2VYVD 2UXBB 1K7CA 5AVXA 3DAGA 3LVRE 4CLRA 2FE1A 1Q74A 1TI7A 1VP3A 2WHRA 3BWDD 3PPXA 4JLNA 5AOBA 3K09C 2YOFA 3GROA 1QQ7A 5AOVA 2JLRA 3DOCA 2G7ZA 3IP9A 1KYXA 3KKEA 5T41A 4EG0A 2GM4A 2DBRA 2YHSA 3OY7A 5FNZA 3IJEB 5AVVA 3E9EA 3AI7A 3KR1A 3NTVA 3LCVB 3PQ2A 3GT3A 2FFJA 3NORA 3SZ3A 4YYEA 2ZIXB 1U0HC 3HRKA 1DTEA 1DIHA 2ZS8A 1HEYA 3KAQA 4ZREA 3AB7A 5AVUA 4PBRA 4WHMA 5D84A 2Y1KA 1FNSA 1PLLA 3MWJA 3OA0A 2Y0CA 5P8WA 4FUQA 4Z7QB 4OOFA 5EVCA 2HRQA 2JEZA 1JTEA 2B21A 1BKDR 1ZGBA 4LXYA 3PHIA 5EJGA 1HZJA 1GGMA 3KDAA 1LPSA 3GJXC 3WWEA 1USGA 5HF9A 4EGSA 5KVAA 4GZ6A 3H9UA 3K1AB 1X38A 2PPLA 4FMDF 4NCJA 2ZVJA 3GD5A 1WXXA 4IFIA 4QBIA 4HT3B 5BN3A 1A95A 4CEIA 4N3BA 2PL1A 2O8VA 3NDPA 2WTBA 3DNMA 1JAXA 3OF5A 1PT6A 3TQOA 2OBNA 1GAQA 4KQKA 4XD7D 1C4XA 3EN0A 4JOCA 3IILA 2B4QA 4PF1A 5A4MS 5IJWA 3O90A 2OL4A 1QR2A 3E9CA 3U6KA 2ZYAA 2I6TA 4YCDA 4DPLA 4ARCA 4U2EA 4CR7A 1ICIA 2LW7A 2NVBA 3A11A 4I5GA 2C97A 4LMAA 4WNAB 4QNMA 1W44A 3UGJA 1MCZA 1WMAA 3M4NA 2OR3A 5KZMB 2J7PD 5DNDA 1JLRA 4KIFA 2FLWA 4JHXA 1FLNA 2GM5A 1QO0A 4FCWA 4JLMA 3ZCQA 1L7PA 3UY4A 2G04A 3FM9A 5KTSA 3E8XA 1OB5A 2RK6A 2DKFA 1JHRA 4GPAA 4Q15A 1RQPA 2PRZA 1LS6A 1RQ2A 3JQ7A 4IXDA 4HNUA 1Y6JA 3RSCA 1ZCZA 2C3YA 5FCDA 5BOSA 3L7JA 3L5KA 3TVYA 3W7AA 4R5HA 1S7GA 1QC5B 2P9QA 2A92A 1DDIA 4CF7A 4BO6A 5IKOA 4RE6A 4DKJA 3L7BA 1JJAA 5CYFA 2NTYC 4TSKA 2WLTA 4DM4A 5MDHA 2BFOA 2VRCA 4M98A 1N0HA 5HJ7A 1ORTA 3PC6A 5CEFA 3DHWC 3K9HA 3BWYA 3DCJA 1X3LA 1CEYA 2IYQA 3TQTA 3AHFA 3SQLA 1IG3A 1NOKA 1PV1A 3GOHA 4QARA 3L9WA 1T8TA 2BEUB 2VAVA 1VL8A 4QGHA 4CLOB 5JJKA 3L02A 4F5EA 3L4EA 1L7BA 2VDOB 2WICA 1WV0A 4UUPA 5TMEA 1M2HA 1U1GA 3BDIA 3WC4A 5HUQA 3DV0B 3RV4A 4TKMA 2EKZA 3Q7SA 1O5IA 4NSNA 4WKOA 2D2VA 3R24A 3R7NA 5F23A 3V97A 2H9IA 3RYHB 1NSYA 2GGSA 3IMGA 1Z36A 2HFJA 2VF4X 3I1FA 3KU1A 4ZKDA 1CJKC 3QKWA 1UDRA 4ETIA 3DF7A 1RABA 2FW8A 2H65A 2J5QA 2ZI5A 3GI1A 1FXWF 3ROEA 4CCYA 3MUOA 4EG3A 4YAIA 2XZPA 3SQNA 3GRCA 1I2CA 3H2GA 2GD6A 4IUBS 4N4AA 3P0RA 5ALSA 1E1QD 4ZYZA 3JAMA 2MSKA 3E1SA 4J4HA 3V2UA 1UK7A 5B4UA 1EDEA 5FFMA 5J4VA 1WA5A 1RFGE 1FJGB 1AMNA 3PNYA 5DW3A 1Z5NA 5TQ2A 3ZWKA 1GKYA 1ZS9A 4P4LA 3OBBA 3TIVA 2BRUC 1ID8A 4OHZA 2JATA 3RUPA 2GCGA 1KJYA 1RVV1 4ZQFA 4LF6B 3N7TA 4Y6OA 3B38A 2E49A 2RC5A 3A04A 3VU8A 4PVCA 5FKJA 3TLXA 2CVHA 2C5SA 5CDFA 5B7GA 2QVXX 2ZWIA 4FIDA 2DERA 2RHDA 1P3DA 2CFOA 4NY1A 4HRVA 1NR1A 2FJUA 3SMQA 5JQGB 3DP9A 1PDOA 4NNJA 1M2EA 3QOFA 5D85A 1B73A 2GK3A 1YMUA 4HLNA 2IEGA 2C3PA 4O29A 2O1EA 3HVHA 1KJQA 2EDAA 3G0DA 3MT8A 1R0KA 2GA8A 4GH5A 4J0JA 2Y1FA 5SY9A 2NTVA 3TIXB 4DEXA 1UC8A 3GRVA 1M1UA 2ZUEA 4JC5A 2BJVA 1M6WA 2DUWA 3CVOA 3SSAA 4BP3A 4MUNA 1CFZA 3MTIA 4EY6A 1A9QA 2QRGA 3C3DA 3HU3A 1N1GA 4X41A 3VOSA 1L4MA 1YBVA 4G26A 1DT3A 1G5IA 3RUAA 4H9GA 2OLEA 2X77A 2NT3A 3H7AA 2C2OA 3HCWA 2ZSBA 3N39C 3SX2A 4BNJA 5CBPB 3PK0A 2EXXA 1PQ4A 3D1VA 3EXHB 4FW8A 5EWLA 2NZUG 3ANTA 3VNUA 2XDQA 3V4SA 1JHQA 4X3OA 1CY2A 3CE6A 1CF2O 5IC4A 5LP6B 3GRZA 3QFRA 3ICQB 1QIKA 4LJ5A 4EKGA 5BQXA 1WCYA 2IEIA 3GG9A 1BE8A 3GXBA 1PT7A 4B8YA 2WWVD 2ZWVA 3KJNA 3NKFA 1CTQA 5AP9A 4MSUA 4AJJA 4RQBA 4BV3A 3D5QA 4G0VA 4JI7B 1D6JA 2QB5A 3KYBA 1W2GA 2WT8A 4MRSA 5DLPA 5ED4A 5E38A 1GT91 4QBFA 3M5WA 2C0QA 4RABA 4DLNA 5M5BA 5J2UF 1IN1A 5B1YA 5EMHA 2QW0X 5G1NA 5C9ZA 2FZ5A 2WHPB 5H80A 1YA8A 3LF2A 3NDBB 1NN5A 2IU3A 2QY6A 3GRFA 2R6AA 2HPZA 1FP2A 4AY4A 4DSNA 4EUKA 1RC1A 1Y63A 5AUQA 4Q82A 3FPHA 3ZZ1A 4FB5A 3NNDA 1ZUD1 5K99A 1TXGA 2PMKA 3HDGA 1XEXB 4F1JA 4D8TA 1BFKA 5L95A 1ATZA 1ONNA 5BWMA 4M0KA 1ESEA 5BVGA 5E9WA 3CNQS 3AP2A 4CV2A 3DDZX 3AOEC 2VJDA 5EWJB 4MROA 4Z0HO 1X9GA 1PFQA 4MUHA 1PUIA 4PC6A 4F4IA 1OZ0A 2AN5A 3U4DA 3ZS8A 1LC3A 1NVAA 3RLFA 1T4CB 2MR6A 2YWFA 3OWXA 4H4CA 4MVYA 3U39A 1DX6A 2G1UA 3NUZA 4YMWA 2YMLA 4UM9B 1FP1D 4INZA 2JIPA 1ADCA 1GITA 4JBIA 4JSYA 4UM5A 5J1SB 1HYGA 3NH9A 2XV1A 4LIPD 4R1MA 1SRRA 3GOQA 3T9EA 2ORIA 5M7EA 4N7RA 3VU0A 3ZHYA 1EVYA 2MYNA 1I94B 1JFFA 2LRHA 4HN2A 3OE4A 3RTAA 2ZZMA 2R2AA 3P0EA 2JZOA 1UOPA 3P9IA 4LF7B 1LPOA 3JQBC 3EYWA 1E9DA 3H4MA 3PS9A 3WZMA 4DIDA 3TQCA 1UEXC 1K75A 3NBKA 2XPCA 4EG1A 1DDGA 2VG8A 3HYSA 2O52A 1K3FA 3ORSA 4KSBA 1P5JA 5F1YA 2RARA 1E96A 1UKYA 4MQFA 4ZI7B 3T12A 1WXHA 4E5KA 4DLRA 4REQA 1GGHA 1RDFA 3EZXA 4JGIA 4PLPA 2DT8A 4BN4A 4LK2A 2D7CA 3DVAA 3GFTA 4BCDA 1ZONA 1OW3B 1H6BA 3DAOA 5KTRA 1ZJWA 4DJ5X 2Z5VA 3B9QA 1I1NA 5LQAA 1E7MA 3RSFA 4WMLA 1FSGA 4RY0A 1O6GA 3NHLA 3EAGA 3EX7C 3N58A 2GTHA 1RXEA 2HNAA 2I0FA 4M76B 1CUVA 1BH6A 3WRWA 2IX3A 1ZDMA 5JD3A 3QYFA 4AJIA 2QZ9A 4BYMA 1TB4A 3RVBA 3O9VA 2PGLA 3I2YX 2VRNA 3E8SA 3SKYA 3FWPA 3EVNA 1FQOA 1A2BA 3F5SA 3QE2A 4OP2A 3EISA 5DBHX 1KSGA 1I80A 4NEHB 4B4KA 4KBFA 3W79A 2KLHA 1NWHA 1GQOA 2F8SA 2JDIA 1KTIA 4A0GA 4DR4B 1J0AA 2ZW9A 1P9NA 4NMHA 5LL6P 3CA8A 4MWEA 4PPNA 3IR5A 4Z4IA 1U1EA 1JA9A 1J7KA 2BEVA 2CFIA 3NTLA 4QXOA 4DMGA 4YXWD 2AFRA 5CB4B 1VM6A 3VKHA 1AQJA 3P20A 1M2WA 1YV9A 5KS2A 4DLLA 1WETA 1X13A 1TLTA 3Q98A 2O2ZA 3GJ8A 4J03A 5CFOA 2H4YA 3NRBA 2R6GA 3V5NA 5BN4B 4CHTA 2FPSA 1Z3IX 2ZIXA 1M7BA 4MV1A 3G0HA 4JD5A 3CQ9A 5DRTA 5H82A 3X1XA 4CGZA 3BMXA 2OHJA 3IOMA 4KJZA 4QVIA 3ZNOA 4FFOA 4IEIA 3QU4A 5ECYA