4G0MA

Crystal structure of arabidopsis thaliana ago2 mid domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
SIVKHWAVLDFTASERFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein argonaute 2
publication title Arabidopsis Argonaute MID domains use their nucleotide specificity loop to sort small RNAs.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 43
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g0mA00
3DZDA 3O1IC 3FDFA 3QEKA 4MR8A 1EHCA 1JBEA 2FMFA 1XWWA 3T8YA 1EFAA 5HM6A 3CS3A 1Z2DA 4Z99A 4OLBA 4YGXB 3A0UA 2ZAYA 2CHFA 3SG0A 3OMXA 4ML3A 3RH0A 2FQYA 3ROTA 2FEPA 5E3JA 3H6GA 1YMVA 3RVLA 1JX6A 2B1JA 1YIOA 4RK0A 2R47A 1ZDMA 2FN9A 5IUJC 1GCGA 4W5TA 4WXEA 3Q7SA 4F3TA 3TO5A 3IPAA 3H6HA 4RY9A 1AB6A 1P6UA 2JVKA 1CHNA 3IP9A 4D6XA 3H1GA 1K66A 2IPNA 3LMKA 3HVRA 1VLZA 5IEBA 5TQ0A 5BQ3A 4G0MA 1YMUA 4MR9B 4RY8A 3HZHA 4Z4HA 3EGCA 4G86A 3SNKA 5HSGA 4ZJPA 2FQWA 5TPWB 3O1JC 4DADA 3OLXA 1Z13A 2GBPA 1KMIY 3QEMA 1JH9A 1MB3A 2VK2A 3OO1A 1M2FA 3I45A 3F6CA 4HNQA 3CZCA 3GWGA 4YP9A 1WETA 3D8UA 3O75A 3MIZA 1ABEA 3HEBA 2M98A 3R0JA 5JNVA 3CG4A 1ZGGA 4YO7A 3UKJA 4RK6A 3QELB 3EDCA 1NTRA 4G0YA 2I6FA 1PHRA 3GV0A 3RVNA 3TD9A 5TQJA 4RK1A 1BA2A 2PUCA 3M6MD 5IC5A 5KQLA 3T6KA 4MR8B 2WJAA 1PEAA 6ABPA 2JB9A 3JS5A 4RKQA 4ETMA 3ILYA 3N8IA 4TMYA 4JASB 4OBBA 1EWTA 4RXUA 4YWHA 5EWMA 2YHBA 3GA5A 3RVMA 3T95A 4Z4EA 3BBLA 2LP4Y 4MQEB 2XDYA 2R25B 1DCFA 1JLKA 4H60A 2QVGA 5GQSA 1JYFA 2GX6A 1TVMA 5KWSA 4FE7A 5IUKC 1T34A 4S04A 4KRFA 3Q7RA 3RVPA 4ETNA 2JCGA 1DC7A 3C3WA 4UHKA 4L4UA 1JL3A 2FKAA 2A9OA 3MF4A 3H75A 4IF4A 2CHEA 4MQFB 5JNWA 1TM2A 1XHEA 2MSWA 3QLTA 3OLZA 3RQIA 2LBPA 3LUCA 3LUGA 5TQ2B 2FSPA 3QX9A 4DN6A 1APBA 3L6UA 4EYQA 4KNYA 3KYIB 2F8SA 1J56A 4Z4GA 1DBWA 4XFKA 4RDCA 5TPZD 1P8AA 3OM1A 4EVQA 4ZMSA 4RU1A 5B3JA 2A9QA 4WT7A 3S99A 4W5NA 3OM0A 4PE5B 3DLBA 1GCAA 2WMYA 4M88A 3GBPA 5I4CA 4Y9TA 1W25A 4Z9BA 3OQMA 1DJMA 1NXWA 1D5WA 3H5LA 3EULA 1BDIA 3CZ5A 4RXTA 1RZRD 3QX8A 5TE9A 2VUHB 1NXSA 2NZUG 1KRWA 4L85A 4O1HA 4F11A 3KTOA 2FEWB 5TPWA 2F8TA 1U0SY 5BRAA 2JBAB 1SRRA 4RV5A 3Q9SA 1A2OA 4PICA 1YK0A 1PEYA 1QMPA 1SXIA 1Z17A 3G85A 2LIVA 4MS1A 4XXHA 2IOYA 3H5VA 1QO0D 3HDVA 4CBVA 5CNMA 4EGSA 4G0QA 1B00A 4NV3A 2FW0A 5EWMB 3BREA 3QELA 3H5TA 1RXEA 3CU5A 1ZN2A 3FMVA 4PZ0A 5TPZA 4IGAA 2A9RA 3MYYA 1QP7A 2WWVD 1MAVA 3LKBA 1I3CA 4H3HB 4LE2A 1D4ZA 1NATA 1Y1LA 5HKOA 3F6PA 2P9HA 1P6QA 1Z26A 3RVOA 4GNRA 3N0WA 2QZJA 1U8TA 1KGSA 4G0PA 3CG0A 2OQRA 5IX8A 4MQEA 1S8NA 4N47A 4OATA 2HPHA 5ABPA 1RZRA 2RJNA 3CFYA 1D2AA 3HV2A 4O1IA 3DLHA 2IYNA 4EYKA 5IEJA 1BVHA 1E2BA 1QNLA 3IP6A 3G1WA 4HNSA 2GKGA 5CNJA 5EWLB 1SXGA 1ZH4A 1LJLA 4G0OA 3HUTA 3N6VA 1F51E 3LTEA 1TJYA 2PUFA 4MQFA 4YS6A 3A10A 1MIHA 5C5EA 3C6QA 1QO0A 1USIA 2QSJA 3EQ2A 3BRQA 5TQ2A 1TLFA 5BRJA 3W9SA 4OTZA 4XLTA 1OXBB 1KRXA 1L5ZA 1FFGA 2H3HA 4MPTA 3CNBA 4RXMA 4Z9AA 1ZY2A 5ED4A 4KFCA 5T3YA 1ISRA 5CNKA 3EJWA 4QYMA 2PUAA 4KQ9A 5KQPA 3QK7A 4KV7A 1RXIA 3SAJA 4EYGA 2E4UA 3MQ4A 1ZESA 5GOTA 4MS1B 3JPYA 3MM4A 1URPA 2WB4A 1JDNA 4KK3A 3N0XA 3H1FA 4ZPJA 1D1PA 3LUFA 2FMHA 1M2EA 1U04A 2JBAA 2PUGA 3RVRA 1JFSA 4Z4IA 5JS2A 2RDMA 3HM9A 1PNTA 3MA0A 2FN8A 1AB5A 2HJ9A 4RKRA 3HO1A 3Q7TA 4D74A 4JP1A 3VNAA 1ZAYA 3HSYA 3KYJB 3NHMA 3DGFC 5PNTA 2N9UA 3EQZA 5IBQA 3I5AA 3O2QB 5B3JC 2B4AA 3LUHA 4NICA 1QP0A 3M9WA 4RY0A 2R48A 4Q7EA 4TLLB 1CEYA 2JVIA 2FMKA 3HK2A 2E4VA 4EY3A 3LFTA 4S05A 2E4ZA 3N0RA 1NXXA 4FE4A 4PYRA 1USKA 1YK1A 2FEKA 2ID9A 3JVIA 5KQGA 4FB4A 2L17A 2GWRA 4NCBA 9ABPA 1SXHA 3Q15C 4TLMB 3F7NA 3I09A 4JOQA 4W5OA 8ABPA 5FBKA 2E4YA 4YV7A 2NZVG 3HJFA 1EWVA 1SD5A 4G97A 4MGEA 3B2NA 3KHTA 4RK4A 3E3MA 3KG2A 1VPWA 4KK4A 4RK7A 4HNRA 5EWLA 2P4UA 4JAVC 1ZITA 3FFTA 3GYBA 1IIBA 1LK0A 3CTPA 4H3KB 1YTUA 4LRQA 4D6YA 3UUGA 2MSKA 2YHAA 3URMA 2PL1A 4G0ZA 1NY5A 4NCAA 1OXKB 3H5WA 3KSMA 1H9CA 2QR3A 1NXTA 2W42A 4KVFA 1JFVA 1JDPA 1NXOA 2OENG 3OLYA 1QKKA 3IDOA 4NQRA 1YS7A 1K68A 2MSLA 3C97A 3D02A 3DBIA 3O2SB 4KREA 2IKSA 1DZ3A 2QV0A 1QQAA 3O2JA 3TX6A 4PEVA 4KQCA 3TMYA 2PAFA 3KCNA 3LUAA 3JPWA 4Q6BA 4MS3A 4KPYA 2MYPA 4MRMB 2RGYA 4JB2A 1XHFA 3IP5A 2FXIA 4KZKA 4WUTA 4EYOA 2E4WA 3IP7A 1LBHA 1ZGZA 3QLVA 3GRCA 2FLWA 1A04A 4QPJC 1JHZA 1UDRA 2IPAB 3BILA 3CLKA 4RK5A 4EUKA 5EWJB 2L19A 1F4VA 2VYCA 3KLOA 5FWYB 4WZZA 4MYRA 5DGCA 1YVUA 1LBIA 4N41A 2ID7A 1P2FA 1QP4A 2PLNA 3OMWA 1M5TA 4Z4FA 2Q5CA 1JFTA 1YS6A 3JVDA 5FBHA 4IMJB 4YR7A 4ZMRA 3ILHA 4JB0A 1DBPA 3K4HA 3CKMA 2HQRA 2QU7A 4QYWA 1GUDA 2JK1A 1RPJA 1VRVA 4P1ZA 1BDHA 4MAAA 1DRKA 5DKFA 1E6MA 3ROFA 3HS3A 3LKVA 5JNTA 1DCMA 4MLDA 3GBVA 4RSMA 4LX8A 5JNSA 1FFWA 2PMCA 1DP4A 4N76A 4F06A 3HUUA 3NNNA 3QLUC 3RVSA 1W9HA 3K9CA 4MS4B 3O74A 3N75A 2FQXA 2H0AA 4TN5A 4G0XA 3L49A 5KC8A 2GI4A 4LE0A 1DCKA 4XAQA 4XASA 2FVYA 3JTEA 3RVJA 1EWKA 2WY2D 3OQNA 3LUDA 5JNRA 2ZWMA 5DCLA 2LUOA 5IUNC 3OLVA 3DGEC 1CYEA 1U2QA 4MS3B 2CWDA 3RVKA 2CD7A 2DRIA 3H5OA 1C4WA 5JS1A 2J48A 3HCWA 3KLNA 2PUBA 3LUJA 2TMYA 1Z2EA 2FLKA 2RJOA 3KKEA 3Q41A 4MR7B 1ABFA 1M5UA 4YCSA 1PUXA 5FWXB 3BRSA 1Z18A 1DG9A 3N53A 4XARA 1U2PA 4W5QA 2AYXA 4IILA 1C0EA 1Z15A 2QVCA 3QLUA 3OO0A 4HYEA 4DQDA 5F64A 1ISSA 1ZHHA 2HSGA 2QW1A 3FFWA 1LJUA 3H5IA 4O5AA 3A0RB 4MRMA 4KMRA 1HEYA 1BDJA 2MYTA 4F8JA 1TMYA 4Z0NA 2KYRA 4YRZA 2V0NA 3T38A 1DC8A 1VKRA 2IPLA 2HQBA 4N03A 4YLEA 3SQNA 1E6LA 3E61A 3KS9A 3C3KA 3LOPA 3LUKA 4RS3A 4OLAA 1NXPA 3CHYA 1DBQA 1JWLA 5EWJA 3HDGA 4LDZA 5FWYA 1FQWA 3F73A 4QICA 2L2QA 2PL9A 2IPMA 7ABPA 2PKXA 2FMIA 4E7PA 1EAYA 5KC9A 3OLWA 5IULC 4OG2A 4EVRA 4MLCA 3OQOA 3IPCA 2L18A 1PNRA 5KI6A 3NNDA 4RWEA 4B09A 1A0OA 1Z25A 3KJXA 2R4QA 4P98A 4GPAA 2M1ZA 3FFXA 4E7OA 3P9YA 4LDAA 2NUBA 2WJWA 4LE1A 3EAFA 1GLGA 2BGGA 1DRJA 2AYZA 1QQBA 2NT4A 3QLVC 3GT7A 5HQJA 2PE5A 1QPZA 5CNIA 2JVJA 1USGA 2FTKE 3FGZA 2QXYA 3H1EA 3MMNA 4ZYLA 3NBMA 4MS4A 1E6KA 4IMIB 5TQ0B 4N0PA 1RNLA 5CHYA 1BAPA 4ETIA 3UK0A 5DTEA 1NXVA 2PUDA 1ZH2A 4F12A 4RZSA 2E4XA 5JNUA 3VNBA 1R8JA 3EODA 3O21A 3QEMB 2WRZA 3JY6A 4LZLA 1Z12A 2PUEA 5T7BA 5KQMA 2VUIB 1L5YA 2JRLA 1FFSA 2X7XA 1JF8A 4JA2A 4EVSA 3O1HB 4W5RA 3NNSA 4MR9A 1ZVVA 4MR7A 5FWXA 4N0QA 3NHZA 3RVQA 5BR1A 4WXMA 5DLEA 2LPMA 3C3MA 3TB6A 2NT3A 1GUBA 1MB0A 2IDMA 2PJUA 4Z4CA 4WWHA 1Z16A 4Q6WA 4IRXA 3GL9A 5D2CA 2HQOA 3HXMA 1D1QA 4UHJA 1FSPA 1JYEA 5C5CA 2A9PA 2MYNA 3SM9A 1MVOA 3I42A 3SY8A 3CRNA 3A3KA 3M9XA 6CHYA 2MYUA 2O20A
chains in the Genus database with same CATH superfamily
4UC0A 2WHYA 2WU8A 3V9PA 3H99A 3KFXA 4TQ9A 3WK6A 1S2GA 4MA4A 3R7SA 1E2JA 4DYVA 5IVHA 2J3QA 1IY1A 4IHKA 2DPGA 3GLRA 5FJJA 1Q12A 1XZEA 3QUAA 3SYKA 1CQXA 1QFMA 4Z99A 2WIGA 1USUA 1JQJC 3F67A 5BR4A 3CY6A 4H7EA 5DTRA 3RD5A 1OB5A 1AK1A 1TA4A 1T9DA 2PBZA 3X1KA 4OHCA 3PRHA 5EUMA 4ZVKA 4IPTA 4RK0A 2R47A 3BHJA 3COVA 5DO9A 5KMGB 3R6GA 4PGHA 2H4HA 3GAMA 3N58A 1HWYA 4UTOA 1CHNA 4DY6A 1V96A 1BCRA 1VHDA 4WOPA 5D51S 2VDPB 2O8EB 1K66A 1TU3A 1ZIDA 2C0CA 3IP3A 4Q00A 2IYWA 3HMKA 2IDZA 4KXYA 4YRRA 4Z0TA 4D4IA 3P9RA 4IDHA 4LF4B 4QRDA 1XZFA 3Q7QA 4GYYA 2ZI4A 4Z4HA 1TCVA 3P20A 3PKJA 2DU8A 3TE7A 5HSGA 1PT8A 4IDDA 2G06A 4OLHA 1PJ8A 3FTQA 3FOEC 2PWAA 3OLXA 2PWYA 3UVEA 1ODKA 2P7HA 2XTAA 3B60A 2PGOA 4S2EA 2GD6A 1M66A 3B6ZA 4ZQHA 4ZAXA 4YUVA 2QIOA 4BP1A 1XZHA 2O8VA 4EEXA 1B0ZA 4A91A 1VIDA 1M8PA 3MTDA 3DWGA 4Q19A 3BDAA 2ETXA 5B2EA 3HDHA 2Z5LA 1O96A 3SDSA 1E4VA 1QE3A 3E2PA 3VBEA 1OA1A 4DDKA 5JW6A 4LOHA 4S1OA 2AZ4A 4ZAYA 1V8DA 4LI0A 1I4OA 2Z8XA 3CRZA 1KIAA 4XPIA 5K3EA 3COZA 3IHTA 1J21A 4JP2A 3KAQA 4R40A 1QHIA 1J7JA 1CF9A 1DEHA 1TE2A 2FSIA 1L6IA 1YS9A 2ZAMA 3A1UA 2IZ7A 3F6SA 3WKDA 2Q5OA 3AL0C 2YQ4A 3WGNA 4JLDA 3KJHA 4W7SA 5J40A 2D06A 1G1AA 3PQ7A 2VPWA 4S3MA 3RVMA 3T95A 1RCTE 3C39A 3NHKA 4KMSA 4OK5A 1ZUIA 3ADDA 4DZZA 1N2CE 1NQVA 4NBWA 3L0PA 2FSFA 2Y1GA 4MB6A 2AFVA 3HH8A 3QXXA 3GA0A 1NVVQ 3DD1A 4O4HF 3TNJA 2ZWIA 2FUEA 2K7FA 5IUKC 2XYQA 2HDWA 3COPA 4IVQA 4JEUA 1Z6TA 4PQFA 1I10A 2ECPA 1BKYA 4RF5A 4CL0A 1OA0A 1NBHA 4BN5A 3QLTA 4RH0A 1H2EA 3OLZA 5EMNA 1BXKA 1KK1A 2H57A 1GPNA 3GOQA 1JPNA 2N1MA 3RWOA 4R1LA 2JFOA 2QMQA 4RD6A 1HSOA 3LM8A 1YDFA 4CLRB 5IF9A 4FFLA 5JCPA 1B74A 2XTZA 1W52X 1P1CA 3E1GA 4JL5A 4R1TA 4WT7A 4EKNB 2QHXA 5EQFA 3GJTA 4WKGA 3WRYC 5HW0A 1V6AA 3H87A 1QGAA 4OHPA 2CXNA 2O3UA 4Q1BA 2HWUA 3TQQA 1W25A 3WDMA 4AKTA 1EQ2A 4P7JA 4UPDA 5TX7A 2AMYA 1K3UB 5CT4A 3S2YA 3AVQA 4HNUA 1NXSA 1CVLA 1PT6A 1G2QA 1ZXLA 2VQSA 2DLDA 1ZEJA 1MNQA 2GEDA 3IILA 4LDJA 2C59A 3R5JA 2OECA 4KAXA 3ESDA 1N8NA 3NXKA 2JFXA 3T5MA 1BOOA 4AC9A 1CJSA 3Q3VA 1S9HA 1E2LA 3W1EA 1ULAA 2Q0QA 4ERXA 5C7YA 4YAKA 4FYVA 1S7GA 4N7MA 4HNAA 2X15A 2AFIE 1Y3CE 5DYNA 2VDRB 3IUMA 5COAA 5E95A 4BV3A 4EGSA 1ONOA 4BB0A 2I1WA 2ZI3A 3NBFA 1XEFA 2O2YA 3FM9A 1CT9A 1MO4A 3AM5A 4NBSA 1QLWA 2QSZA 2XJ9A 4BGDA 1UPFA 3EDOA 4DIFA 2J3LA 1UM9A 3QM1A 2BF7A 1DJPA 3S8EA 1RQXA 4XYEA 4LJ7A 2NAPA 4YDSA 5JASA 4QHTA 1NASA 1PL0A 3F6EX 3JQ7A 4HD8A 4G0PA 1GPWB 2J6IA 4XWGA 2I3GA 3A6JA 2GFIA 3WLRA 4LHYA 4OATA 2HPHA 4II3A 4E5PA 2PX6A 1GSAA 1VM6A 3AY6A 3IBYA 4O1IA 1C9NA 2IEGA 3MTBA 2UV8A 3CSUA 3P1JA 4TVKA 3SS8A 3ZTWA 5BUQA 2O54A 4B3SB 3KPUA 2FSVA 4CG2A 2C2HA 1OXXK 5CFOA 1XRQA 2GZAA 3U7FB 1ODSA 3A27A 1JHQA 5TF0A 1RHUA 4R9NA 4GKBA 3C6QA 1QFZA 1X0XA 1G5QA 4M7WA 3BCHA 1GITA 4QXQA 3GCXA 5JG7A 1OGJA 2DR3A 3JASA 3KZ1E 1MQ9A 2R97A 2KI5A 2PS0A 1W6RA 2C2MA 2JLRA 2QRMA 4QOJA 1A7UA 1F9AA 2WUWE 1T2UA 3EAQA 1GAXA 4UU0A 3KDSE 2VCYA 5CNKA 2D1FA 1K5HA 2P6OA 3BZBA 4DJDC 3SOPA 5DCUA 2RHTA 5KQPA 1CUZA 3AKZA 3CF6R 3GMSA 3L9WA 4K1XA 2KJQA 3ZOKA 4B7ZA 4ZGBA 2AGVA 3EOZA 4G8DA 4YJHA 4RJJA 3T1NA 3U4MA 3M6IA 1L4UA 5JAQA 4JUIA 2Y71A 1V43A 2C07A 4DR7B 3KUDA 5P8WA 2GRAA 1N9ZA 4KJZA 3RT7A 4FDUA 3L7IA 1O94D 3RYIB 1SCNE 5BWOA 1QIGA 2R8OA 3OZ7A 3NHLA 3OVMA 3FMFA 5CX4A 1FFYA 4YQZA 3UK7A 5GINE 1QRTA 4G63A 3KQNA 2Q7DA 1PJ2A 1UBGA 3AIOA 4XYLA 1YQXA 4KI7A 2P67A 4KG7A 4QZVA 3KT3A 1CR6A 2F3SA 1P0QA 4HFJA 4EKYA 2QM8A 3V1YA 3BB3A 4YQEA 5DZSA 1XA3A 2RGAA 1XZAA 3GOHA 2B4AA 2ZAIA 4GPBA 5AVTA 2C5FA 3MS2A 4JD5A 2VQEB 5IDXA 2YXEA 3D7KA 1KFBB 4X24A 2F62A 4OHOA 4L8YA 2XUPA 2LW7A 3IEKA 2OQIA 3MW8A 3PDCA 1E4EA 4GOOD 4X8MA 3PYLA 1LTKA 1NXXA 5DHPA 4K26A 1I3KA 4TZTA 1RYZA 3L8ZA 3ZHBA 1Z33A 1H42A 3IPYA 3UMSA 4BVHA 3W5UA 4MWZA 4BE7B 1SXHA 3NOOA 2RI0A 1QG6A 3DMGA 3I09A 5M3BA 1IZ8A 3JCZA 4FMCF 4DGQA 3BJRA 3M6VA 4XVHA 3ZCRA 3OQPA 2QB5A 4WTOA 1U1EA 3F7TA 3OQVA 3VJMA 1YFLA 5GP1A 4UU7A 2IFTA 3AYXB 4QUEA 4JAVC 2H4YA 4CKBB 5BMOA 6PFKA 2FZCA 2ZR0A 1NWHA 2AR7A 2GYYA 3EE6A 5JANA 5DLQC 3DWFA 2MCFA 2AL7A 4G85A 2NOAA 3LPAA 1BGWA 3LDHA 4KPUA 4Y2JA 1R88A 5AXDA 2HADA 3COYA 1MG5A 1G4AE 1N2XA 1RC1A 1IZ0A 4OKNA 5B6JA 5KYYB 3BFKA 1NXTA 2W42A 4RH3A 1JDPA 4LZAA 5FI0B 4LXXA 4FKBA 4TL9A 3KXIA 3ZVRA 4WLFA 3ZD6A 3DBIA 4MVJI 5JI2E 1YASA 2XQGA 2JHGA 1DOAA 5LR6A 1TUBA 4MUIA 2B83A 4IVRA 1AKYA 2ZWVA 3FJYA 4LHSA 4RM3A 5MGBA 5F2OA 5LQMA 1D5CA 2Q49A 4LK3A 2MYPA 2WVJA 4UDXX 4TYMA 2WAOA 2FSVC 1SA0A 1CBUA 4NCXA 2CXUA 2P1RA 2FUNB 2V58A 5CJ2A 4W7IA 3UY4A 2ZW9A 3LZ6A 4IUBS 2JD2A 3ZHCA 1X0VA 2GCGA 5DI9A 5L7TA 4BVGA 1JHZA 2GPBA 4XE5A 3I6YA 2EJCA 2W2KA 2J5BA 1V6CA 5DBOA 3UN1A 2L19A 1XPOA 3WL3A 1P62B 1XGKA 2VHYA 3ROQA 5BR7A 1I2ZA 3D5TA 1GZ4A 2BLNA 1LWNA 1UXKA 1NVXQ 2AJTA 3FBTA 4HYYA 4LDPA 2ODBA 5FPYA 4YPOA 3C4JA 2WIKA 3OMWA 2YFHA 1DU4A 1QWOA 3SJUA 3RUAA 1JJIA 5JH7F 4EHJA 1BH2A 2ZRPA 4C4YA 3IXMA 1DBPA 2D4AA 1IHOA 5KS2A 1VMEA 5IM5A 5AJZA 1LPAB 2XE8A 4RMJA 5J4LA 1T9BA 1SCDA 3K4PA 4S1NA 1U65A 3R75A 3MJCA 1E0SA 3ORRA 2GF9A 3DHEA 4LWZA 5IKOA 4DLNA 5FV4A 3CSDA 1TMGE 1D2RA 2V6JA 1UZLA 3ELBA 3GBVA 4I9GA 1BW9A 1J1ZA 4O4HA 5JNSA 3TQRA 1SULA 4JC8A 3EUWA 4Q9AA 5HCUA 5CCEA 1QCCA 1WVGA 3CEHA 3DXZA 4QJBA 1FQKA 2G77B 2D1QA 4GOKA 3AVYA 3X1MA 4YUXA 3A9UA 3UXEA 4UAGA 5IAEA 3DMRA 1KC3A 3FPHA 3RVJA 4JJ6A 1UT8A 1B6GA 2P2NA 2ZBFA 3IE2A 3IKTA 4BNNA 1H5QA 5AIAA 1G59A 1W94A 1QG2A 2QSUA 4M46A 4DNQA 3B51X 3QRWA 3UJBA 1W49A 2R4TA 2VBCA 2ECKA 5E4JA 2C31A 4M0EA 2VKTA 1JH8A 1I0LA 4MV6A 3UJDA 2PU5A 1J8QA 4QQ8A 5FADA 4O33A 4DCCA 3H6KA 2PUBA 2HK7A 2JFGA 2O4UX 2PL5A 3JYNA 2MJLA 3U0VA 4C01A 3AGPA 4C78A 4QXOA 3BRSA 2HD4A 3GLKA 4FEAA 2HI0A 1L7PA 5ALWA 2Z3WA 2CDRA 5I45A 3G5LA 5LDDC 4PR3A 1DV1A 4DLUA 4FHGA 5JD3A 3TNFA 3I6BA 4FJ1A 2AF4C 3IPRA 4FR2A 3FNHA 2QT1A 3NXSA 4MJXA 4D42A 5BSGA 3T1TA 1XI2A 2ZROA 1TMYA 5B7GA 1SMKA 4K81B 4AIIA 4JUBA 4O29A 1KMCA 3W79A 4BO4A 1DC8A 2IPLA 1TOAA 2VCEA 4R41A 2M6KA 1T3TA 3I8SA 3CURA 1K8QA 1O97D 3MINB 5FBRB 2DERA 3CHYA 1RP1A 2ZIAA 3SBOA 1JWLA 2P40A 3W8FA 5G0VA 5I4IA 1PR9A 2IXGA 4DLKA 4C7MA 2UU9B 3SYTA 1JEJA 5EL0A 2FSHA 3A37A 1KU0A 3I34X 1CRLA 2RGNA 5DEIA 4DMCA 4HVAA 5HCNA 4JT4A 4CFYA 1Y80A 2XB9A 1Y5LA 4Q4DA 1SCIA 4H0CA 4XDYA 3OLWA 5KYNA 4Z9YA 1JZSA 1Z7YA 3CKKA 1XO1A 1KEZA 2MDTA 4L15A 1ZM4A 4DJAA 3UMRA 3LT4A 1PG0A 3DFZA 4GPAA 2AR9A 1D8TA 4AROA 4GE3A 2NUBA 1DXQA 3A4NA 4BTEA 3AR2A 5ENDA 3H2ZA 3UPTA 1GLGA 3JX9A 1SUIA 2HM7A 4E2XA 1TIPA 2WNHA 3VXKA 4JBNA 3Q1KA 2E82A 4KGDA 4ARCA 3JZAA 2LZ0A 3HCRA 3KVNA 2R6JA 1C7EA 3A4VA 3QKWA 3TZCA 4J9VA 4MZDA 4PV7A 4AYXA 4CWAA 3GEPA 4CU5A 4OYYA 1CRQA 1MXHA 2Z3VA 1YTLA 3ZKWA 4E51A 2BFEB 5HKAA 4DFDA 2EHJA 4RD2A 3R09A 3U3MA 2QTTA 5BSRA 5BSKA 2VDVE 1WABA 3IV9A 5DTEA 4N9WA 3R24A 1G3QA 4PVDA 1I2BA 1N5JA 1R8JA 3EUAA 5AW9A 3ZGXA 2ZYIA 4EB6A 2PUEA 2ZJZA 4KDCA 4D7AA 2QORA 1O2DA 1IBCA 2C4NA 4TMFA 2FVXA 4W1PA 3S70A 1P0CA 1VKJA 2WVHA 3PS9A 4D5EA 2X7XA 2H2HA 1YFJA 1KZGB 5I8ZA 1FP4A 4WH0A 1PJQA 1QGZA 1U7PA 3DZFA 3OKCA 4MR7A 4D8XA 5KYKA 3CRVA 3NRJA 4P83A 1KPGA 1Y6QA 1DV2A 1QYDA 4PXSA 4DCTA 2XB6A 1XQ1A 2BFPA 2GJ4A 2M1XA 1T5LA 3PK0A 2FDXA 5FUXA 1ESNA 1VOTA 4GVPA 5DSXA 3V1NA 5C7OO 1NRIA 4CV0A 4QUBA 4B0OA 2FU5C 1IC6A 1YSCA 3EVEA 2WM2A 1U6IA 4FYJA 2Z95A 4DLLA 3OZVA 5GPBA 5CVUA 2P3SA 3TOCA 5FCDA 1DKNA 2HEGA 3R3XA 3F6RA 1DJNA 1HE5A 2JAPA 3U9TA 5K0BA 3DQPA 5EJ2A 2VDJA 2HA0A 1YD7A 3VR5H 2XTNA 2XDWA 4CG3A 1WZ2A 3C3YA 4KUGA 3IQGX 1B8OA 3SNHA 1Y3AA 4JB8A 2IHYA 1W30A 2DTXA 1QRRA 4PGMA 2YOGA 1NN3A 4JNKA 1R0CA 3A1FA 1C9MA 4OXNA 2EX0A 3ZVMA 4KAAA 1HX7A 1F2DA 3IB6A 3X43A 1XU9A 5CFLA 4UTNA 1QAQA 2IPOA 2BM9A 1JIKA 4JJGA 5G41A 1GYRA 2PL3A 1L5LA 3GJ7A 4GT1A 4I1VA 3BWBA 4M87A 3TOZA 2XNDD 1QLJA 3VDMA 2XMCA 2NXJA 3DE0X 3V8MA 1P9RA 1YB1A 4J43A 5EZYB 4G3XA 2YINC 4CM3A 1EFDN 3S2FA 1CP3A 1BMTA 2JFFA 3OZAA 2Z30A 4ASUD 1SKAA 3AR9A 4MH0R 4NKRA 1QMGA 1ZW6A 4FD3A 2R6HA 4F5DA 1Z2PX 3LRXA 3UUEA 1VLZA 5HG0A 1RYMA 5BQ3A 2GJKA 2XOEA 4CDMA 4F8EA 2O1WA 3QV2A 4XDGA 3ND5A 4X3PA 1MJGM 1SUFA 1DBVO 5HGJA 4YDQA 1W29A 3PQCA 2I1VB 3E5RA 3DHVA 4CM6A 5EMJA 3VISA 1J8DA 3IYLW 5BQFA 5KDOA 2QRGA 3EWAA 4GP6A 4PLHA 1C14A 1WD7A 1RWKA 1F2UB 5JS7A 4H15A 3EVAA 4Q16A 1YZYA 1MPXA 3CBGA 2RD2A 1LLQA 2QX7A 5C2JB 1MFPA 3GEEA 3HL4A 4YUZA 2Q0SA 4BJ3A 2PXCA 3DEKA 2G9VA 4AT1A 4HGNA 3WNDA 4JBHA 3T1VA 1BO6A 5AW0A 4LHXA 1JIXA 3AG6A 2XMBA 4KFRA 4O4LA 3WDLA 4I0WB 1UAYA 2PSJA 3GV0A 2ZE5A 4ISCA 5F1PA 3VR4D 1X6VA 1RJGA 2XNDA 4K6HA 1TFRA 3QYFA 4YP6A 3MUOA 1OHHD 3TZLA 3S1AB 2PS9A 2W11A 4LC1A 1SY7A 4ASUA 1Y9AA 4L73A 1QQTA 3F7MA 1N3IA 4EJSA 4ZI7B 4JJ8A 4RKQA 1F2TA 1NQWA 3KWFA 3Q72A 4K9QA 5CTAA 4E0BA 1Q0TA 5AI8A 3A06A 3GN1A 1FDWA 3PD0A 1O97C 2HLDD 5FV7A 2ZZKA 3UQZA 3S2SA 3E7FA 1ORDA 4TT8A 5CLGA 1QDUA 3NGMA 4MV4A 1JLKA 3SQOA 5CFRA 4DV1B 2NXWA 3C2QA 4IHAA 4R0VA 4NS4A 1N8TA 1U0LA 4URFA 5CLLA 3BJIC 4MROA 5A05A 4GPD1 3Q7RA 1EJ2A 3PHGA 1MDFA 1ZXBA 1KO4A 3A9SA 3PNVA 1ADCA 4B6SA 3MF4A 3H75A 1E99A 3BGSA 4HADA 5JH7A 1ICIA 2BR5A 3CINA 4Q4AA 2JC3A 1Z5ZA 1CR2A 2FPUA 3LUCA 2BEKA 5KSPA 4BTVA 1BGVA 4LRWA 1RLMA 4CUZA 2WSLA 3R6TA 2FPOA 3N3BC 4M8IA 4RFVA 4XIIA 5EE5B 4YTEA 3U7JA 3VA7A 1RFGE 1EM8A 2GM3A 2HBRA 4DUPA 5HX7A 4EVQA 4E4TA 1M1NA 3HDQA 1EP9A 1O0CA 2C61A 1EIZA 1Y5MA 3VR4A 2QPAA 4BMVA 4LSMA 1YMQA 1GZDA 4J07A 3DMYA 1J2TA 3LGAA 5ALMA 1W85B 3G2JA 2ARKA 1L9XA 2IITA 2JEYA 4QO7A 2PX8A 4YUYA 5A4AA 2AKYA 1EK0A 3SC2A 4YRQA 1QLHA 3VR2D 2BEVB 2RHWA 2PZEA 3H65A 2I2FA 3HCCA 4LJKA 4D2IA 2RJ3A 1J5PA 3C1OA 1P77A 2HLDA 2NQ8A 2ODEA 4E5DA 1OZGA 1QWSA 5LQAA 2QLBA 4K8RB 1ZMRA 1Y3BE 2FUKA 5TPWA 1MG0A 3S44A 2A1UB 3IESA 4B46A 1SRRA 1XQ6A 3GLTA 2Q7XA 2EL9A 2O7SA 2QUZA 2QZ4A 5D5PA 5ALIA 3TW0A 1QMPA 4EB8A 5K8UA 4OMCA 4YC7A 3R2JA 2IX3A 4NPCA 1Z5WA 2RSLA 4MGYR 5BWNA 1Y1KE 1S2LA 1NMXA 3RRNA 2JFVA 4EHBA 4Z7JA 2B7BA 1OBOA 2VLIA 4HAWA 5HIAA 1ATZA 1C3VA 1VJ0A 2PT5A 3QVMA 3IVGA 3ZCUA 3TR6A 5EWMB 5TY0A 5A6VA 1AVTA 2H7XA 3OZRA 2AC4A 2P9BA 3K0FB 3L41A 3QELA 1OBFO 3QNUA 3H5TA 4FFVA 1A1SA 1FNNA 1RXEA 2OWDA 3R76A 4A2CA 1P4JA 3WIDA 4LVUA 4HPJB 4IH4A 4XWKA 4IGAA 3SMVA 3SS7X 1I3CA 3OTIA 5BUZA 2DUUA 3MGKA 5HKOA 1WOYA 3GZTB 1SUAA 1OAAA 4GQAA 4LHWA 1P6QA 4EOGA 4TVOA 1RTTA 3NP7A 3ZC3A 4E5KA 4F3NA 4FKZA 5K7SA 2C8JA 2K7ZA 3R20A 1H2XA 3BAFA 3W7VA 2G9QA 2XUIA 3O91A 3MCZA 2Z4RA 5ALXA 3BM5A 1IFXA 3FUCA 2O8NA 2R00A 3LP8A 3CVYA 2ZR8A 1XEXB 2O3RA 3LNTA 1MO6A 1YL6A 4JJEA 3CRQA 3HDJA 1LJLA 4G67A 1J33A 1JU9A 2XKAA 4MQFA 4YS6A 1GRRA 1Q14A 5CM8B 2D0OB 2PDAA 5JJ5A 2FXVA 1C1XB 2OD7A 5EKUA 3W9SA 4C2BA 1OXBB 3FLAA 3ETLA 3ST7A 1FIUA 1XD9A 5IH7A 4XTCS 1P72A 2HHHB 3DVQX 4RXMA 3D8HA 4F2HA 5DOVA 4NBTA 4U39A 3TEJA 3K9LA 5K8IA 4RIGA 5ILQA 4G1EB 4P0TA 5LNK1 2OUIA 3DT9A 3SE7A 1XTPA 4B6JA 3PFCA 4DM3A 5LPNA 1YI8A 1FA9A 4JC0A 5E6UA 5J2TB 3FDIA 3MK31 4BV2A 3T7RA 5GOTA 4QG7A 2REQA 3SGLA 1Y8QB 1Q83A 2BCEA 1DAIA 2GXAA 2XBUA 4UNPA 3VPFA 2NUPB 2XNHA 3MM4A 3GR6A 5EHQA 2AXNA 2D59A 2FPPB 1PGJA 3LIIA 3N0XA 4PZDA 4EPRA 1MOQA 2QRHA 5DCYA 3U0BA 2B5WA 3DOHA 2II6A 3IE0A 4D57A 2JBAA 4K8OA 3RVRA 3AVPA 1N7IA 3T0FA 2FLVA 3FHLA 4G9GA 2RDMA 4PSUA 1GPAA 3TPCA 3X2FA 5CLQA 3KSAC 1T6ZA 2DF8A 1MABA 4W5HA 4WFQA 4EG3A 3K70B 3ZW8A 3AVOA 2H5LA 4CM4B 3HU3A 1NN5A 4F2DA 2C83A 4JJZA 2OM2A 4QU9A 4WK6A 3L7MA 1G4HA 3EBPA 4LRXA 1PNQA 1ZIYA 3VZRA 1IOZA 1JTVA 5HJEA 2V7VA 2IKQA 2OKCA 1CZNA 1DIHA 2AOWA 1JWBB 1VJCA 1W0CA 3IRUA 4KP7A 4R01A 3IJEB 4MWBA 3ZDFA 3ZWNA 1CULC 1OAKA 5A9TA 2VWPA 3FVRA 2Z9DA 2I71A 2XW6A 3HJRA 4KIJA 5G3ZA 3V34A 4EGJA 1B16A 5DJ5A 4PYRA 1GPKA 1ONSA 1USKA 3DCYA 3DE4X 3GFGA 4JT2A 3EH2A 4KEAA 3KEMA 4KN8A 4H1VA 3UANA 3V3TA 4DCGA 4DWJA 3OESA 4HQRA 4RPKA 3QBTA 3I1FA 1TF5A 1UF9A 2EATA 3Q15C 4BNKA 2G5CA 4JOQA 2C9YA 2WIAA 4RJLA 2IA5A 2EYQA 4H1TA 1T5HX 4IJUA 5DNVA 4NMXB 4F5YA 4PLGA 3WP0A 3GZ4A 2WFMA 4R05A 1SD5A 3UC9A 3ZG6A 3B1KA 3RAFC 4B7XA 1IVSA 1N5MA 4GG1A 1M6EX 3NAMA 1H0SA 1XSEA 2GEUA 3GLHE 4PC2A 2IPXA 3ZBPA 4ESHA 5FUMA 5JZVA 4XWWA 3BH0A 4HB3A 1KO7A 3C1UA 3ICWA 4EHLA 2NZ2A 2GF0A 2OV1A 4LRUA 3TDNA 4A4DA 3HGQA 4FEGA 1Z2CA 3PP8A 4LRQA 5MN6A 1OLXA 2G40A 4D0NA 4FU0A 1VJ5A 3MGGA 3STVA 3E2MA 1IM8A 1WHSB 4GGMX 4GX1A 1DRWA 1DKPA 3NFYA 1AK9A 3AH8A 4ZAZA 1JU3A 3KSMA 3CWZA 1C9KA 4W5JA 1EB8A 2QR3A 1VHTA 4JOSA 1UXGA 5CFPA 4A92A 4RHCA 1LNZA 3M4YA 1BC5A 3DF7A 3O2SB 3QIVA 2J0VA 2UVDA 3Q7EA 4GBED 4XB2A 1O9BA 2F3UA 2H4XA 4MW9A 2X19A 4LG1A 1W4BA 3D3KA 5HZHA 4GP7A 1NA5A 2G1UA 1XD2A 1V7PC 2F1KA 3W2FA 2HDHA 1V7CA 3C8ZA 1RMYA 2XYGA 3AUKA 4PRLA 1O1YA 2G88A 3VQTA 3EDRA 4XRRA 4TPKA 1B8NA 3N2YA 4QA9A 1A2QA 2FXIA 4L4RA 4ZEOA 4TWRA 4IW3B 5HKBA 5H9VA 4X1KA 1PZHA 4QPJC 4FIZA 3U9SA 3D5QA 3THRA 4G0NA 1V1MB 4RZHA 5REQA 1UDRA 1H3FA 3JD0A 4NOLA 3FCXA 4ZCIA 5I7VA 3I64A 4L9WA 3KB1A 1WJGA 4E2ZA 1T4CA 1I0ZA 2B8TA 2PK3A 4H0NA 4WZZA 3IAAA 2WQZA 4QBTA 1LBIA 4U63A 2ID7A 3BGIA 4HRVA 3K71B 2JGDA 1A9OA 2P0AA 2XR1A 3RSHA 1FTQA 4MXDA 4RFLA 7AT1A 1P2TA 1T25A 1T3GA 2BGUA 3V7UA 1HO3A 2C82A 4YJ2B 2Y1CA 3Q11A 5GADl 1T6YA 2IZ1A 2PMWB 1OI2A 1U2DA 3Q5DA 5E8RA 5FUVA 4Y1RB 1E20A 5KUTA 2CL5A 5JSFA 1WMEA 1GQRA 1KYVA 2NG1A 3D7RA 3LOUA 4D44A 5JECA 2QM0A 3M5WA 2YZ7A 3R41A 1JFLA 3PCTA 2RGCA 3NBQA 4IQ8A 3LC1O 3NPMA 2EX1A 1P60A 3KPWA 5JYDA 5KYXA 1WB6A 4A5SA 4NC9A 5B1HA 5EA2A 1TQ8A 4ALIA 1OY1A 2IEIA 3F5FA 4HUTA 3JYLA 2OXTA 4HTFA 4EAQA 1ZCAA 2HNBA 3SKVA 2V1UA 1U2ZA 3ZWYA 3HN7A 4M54A 4TN5A 4ZJZA 1WMFA 5JLAA 5K09A 2V4ZA 3GQVA 4M0PA 2AX3A 4ME6A 2YRWA 2ZBEA 5FPQA 3ZWMA 2WWFA 2J3HA 9LDTA 5ITZB 3DGEC 2BTQB 1LPPA 3EC2A 3RVKA 3TLKA 5D1HA 3EPKA 1R4AA 4PHTA 4IDFA 3L0YA 4QOFA 1YOVA 4D1YA 3GJSA 1TEVA 2FE4A 2JDID 2NO7A 2HBYA 1EWYA 1WUIS 2PRSA 3N86A 3Q41A 4PPYA 4JBWA 5A1JA 1ZVQA 4YCSA 4BQRA 5HQTA 3KQHA 4BWGA 1AX9A 3AZPA 2YMLA 1ETUA 3GAAA 4QDOA 3BK2A 1C0EA 1SUWA 1XRMA 4L6AA 1FU4A 4NEQA 4BQSA 4W5WA 4XIYA 5AKLA 4PZAA 5A4KA 3LPMA 1IDOA 5H3HA 5EE0A 1S2IA 1GZUA 4Q9LA 3A9WA 4OSOA 5LWHA 2IELA 2Y0CA 1J2UA 4IIEA 2KYRA 3OU2A 3CNQS 1GPLA 3GCGA 4LVOA 4O4IF 3T1QA 4KB5A 2A84A 1J39A 3C3PA 2HLPA 3LBHA 1XD8A 3C3KA 3ASVA 5HWSA 4M60A 2O8FB 5DH9A 5HDBB 2PX3A 3RWMB 3SHVA 1HF3A 4RIHA 3VHXB 4CEHA 1TTPB 3V4VB 1CHDA 3R4VA 5ALTA 4J3NA 2G0NA 1Y33E 3LNCA 3O8QB 5H81A 2WB2A 1RAHA 2ZE6A 5HOQA 4MB0A 3QMMA 1EM6A 1T9CA 2FMIA 2PH1A 3C8DA 3E18A 4LPSA 4ONEA 5HE8A 1ONBA 5C32A 5KC9A 2JDIA 4KXXA 1DAEA 1Y3HA 4MLCA 5DASA 2ACEA 1EX1A 4NYJR 2HYDA 3ADBA 5KYGA 3ZLUA 4EELA 2XMQA 4DLWA 1DI0A 2JEZA 4FEYA 5E8JA 2OV4A 3Q2OA 1QVWA 3HN6A 2RAPA 2AN5A 1UDXA 2AYZA 3INGA 3RLIA 1NVDA 1FP6A 2PGLA 1TCAA 4FCWA 1W1WA 3NDIA 5KX5B 2XQJA 1YV9A 2E6UX 4PCAA 2I6QA 4PTYA 4HWSA 4R3WA 4RLFA 2PE5A 4MGZR 4V0NA 3IKVA 4W99A 4X63A 4L50A 4V0QA 1VE9A 4KNWA 3T99A 4RVCA 4OLJA 5TQ0B 4QRIA 3V7YA 2AG5A 1TA0A 1PFVA 1FJGB 5KMGA 4LX0A 4NX2A 3REQA 2PUDA 4D0RA 1UWCA 5KTNA 2UYOA 1JQ3A 4FMBB 3MOGA 5E0KB 4QGSA 2WJZB 3HJBA 2C57A 3ZU6A 5LNK6 1J9GA 5FPHA 1P4HA 4GI7A 2R84A 4EENA 4BO1A 4D0SA 1W36D 2ORWA 1I7QB 4HGZA 1QE0A 1C0IA 4F3CA 5IK2D 1OJ7A 1PGPA 3J80A 3Q9LA 2P1ZA 2IS1A 5F98A 2OCYC 1KYQA 4ON9A 3KZOA 2XHEA 4EJFA 3HEAA 5PGMA 2I2WA 2WR8A 4BU1A 4CKEA 2GCIA 1S3SA 4JH0A 4LSGA 5D3MA 7YASA 4UARA 4WZAB 2R6FA 5JPCA 1MB0A 2PJUA 1ZNYA 4I6EA 5B53A 1T8RA 3ZUPA 5HKLA 4DZTA 2ZREA 3D8BA 4DWVA 3JYQA 4WCVA 3JWHA 4YCJA 5DGIA 1EUYA 1A97A 5AKHA 4LFCB 3WO0A 4D97A 3DDCA 2QBYA 5D2CA 3TLEA 2AW3A 3JWJA 2QMYA 3PX3A 1TYZA 1HI9A 2AE2A 1WOMA 1UBSB 2I22A 2ZT8A 3FI0A 3BCUA 4QNRA 4ERNA 3ZQJA 2AJCA 3V7NA 4ZQIA 1XRPA 1L8QA 2Z2JA 4L22A 5KYWA 4GO1A 4LF6B 3MXOA 4BLUA 3PCXA 2PH3A 2I3AA 1U7ZA 5C81A 4GSKA 1QGED 4OK3A 3WK5A 1EDZA 3LRTA 1MRZA 4LYEA 3BTSA 1LB1B 2B92A 2W8BA 2CC2A 2XMPA 1TGVA 2PLRA 3LG2A 4MV8A 4NSNA 4OP2A 2ZM5A 4X1IA 2GAAA 3V97A 3PJDA 3HP7A 4KI0A 3WGKA 4BKRA 4BX3A 5DWQA 4EFNA 4ML3A 1WDKA 1OXSC 4DM7A 1XU4A 2W6CX 5LJLA 4XFDA 1TM4E 4HLUC 3RROA 3TZ6A 4B9EA 3LAWA 4IOLA 3OEED 4XM0A 1LF0A 1TQ6A 1YZKA 2NU8B 1XUOA 3PFNA 4M99A 3A6KA 5LUAA 1M2VA 4MVJH 3FVVA 3RUCA 1PT9A 4JZYA 1I3LA 1V39A 3EFBA 1X80A 1DIBA 4P5EA 4TZKA 5M2QA 1PNOA 3THYA 4FWIB 3ME5A 1LNSA 2WJ4A 1OOEA 1H66A 4L3WA 2PA3A 5JU6A 5FD8A 1IBSA 1CR4A 1OLUB 2ZRQA 5EAIA 1HA3A 1Y7IA 2ZRIA 1YE8A 3QKRB 1NOIA 2RAVA 4ZVNA 4RHTA 3HB9A 4G01B 4MR9B 3WADA 3S1LA 2VDWA 3R5HA 4B3CA 4AUNA 1ZBDA 4E4YA 3KIPA 4ZOLF 2E18A 1G0OA 3OIYA 1N5RA 4CKEB 4F4HA 2HZBA 4RKFA 1Z4LA 3H9EO 1PJAA 3GEGA 1GNPA 5DGHA 3OD5A 4C7JA 3VTFA 3NTOA 4YPFA 3O31A 4MJ3A 4MCAA 3QG5A 4LFAB 3A6LA 2BCGY 2DUNA 1V9LA 1TC1A 1R6XA 2EP7A 3EZ7A 4W82A 4O3FA 3VX3A 4ZV4A 5CDHA 5FFFA 1QIIA 4YP7A 1Q7GA 2QVLA 4G37A 2PUHA 5KCMA 1X7YA 2ZRGA 1QU3A 2QLLA 2HLHA 2OUKA 1TT5B 1Y9EA 5KOJB 2C8VA 3RR2A 4B82A 3C85A 1Z9BA 4FJ2A 3OEEA 1S3GA 1VXOA 3TD9A 1WBBA 4BFWA 1U0TA 4OOFA 5BN1A 4CF5A 1WPQA 4G2TA 1TT7A 4CLEA 4PG7A 3BXHA 1D3AA 3PTAA 2QR5A 4AKIA 1KGDA 1SOUA 1X77A 3M6MD 3NTVA 1E8NA 4E12A 3KZNA 3NBUA 1TW2A 3TTYA 1ZISA 1R3DA 1XROA 2A67A 4TLDA 2ZUEA 3KSZO 3EARA 1IE3A 4JLPA 5F5LA 5DI3B 1A9SA 1KKMA 4FFSA 4MQEB 3SYLA 2IE0A 4MTLA 4TKVB 4EHHA 3GUYA 5AI0A 2B78A 1FSSA 3FIUA 5GQSA 3R7WB 4JI4B 1AN9A 1ZKMA 3TNLA 2HSEA 2WP8J 3LHIA 4QOIA 5KWSA 4IGFA 2Z09A 3WGLA 1P9LA 5D00A 5LQKA 4DLSA 3SXPA 2WWTA 3LUBA 5KCZA 2DFTA 3IMEA 4KU4A 3L05A 1E6CA 2PD4A 4FOOA 4WZBA 2JAXA 3UT5B 621PA 4V0OA 5EY5B 1YBFA 3WP1B 2QTGA 1TMKA 3T12A 4D02A 1TKRA 3SSOA 2ERCA 1XXHA 2PQ6A 3DR5A 3OTGA 4NHEA 5CDFE 1B1AA 4C5AA 3PPIA 1GTJ1 5DFAA 3KR9A 2QMHA 2V7WA 1R8QA 2F1JA 1DUSA 4JODA 4HWGA 1E4OA 1GCAA 1KDTA 4YJ3B 2O8BB 4ZFNA 1IG3A 4AMGA 4M88A 3V1MA 4WERA 3OF3A 1GPUA 1OBVA 2DCMA 1WXIA 1V71A 3WLLA 2BTEA 5DISB 3RG2A 3EGDA 2NUTA 2Z98A 3CZMA 4QU0A 2AA3A 4CQMD 1Z0UA 1DPGA 3SQDA 2VUHB 4RPJA 4QEDA 5AW6A 4L85A 1R0SA 4F46A 1KDYA 2XDQB 4FFPA 1Z6AA 5A7GA 2O7RA 1PR2A 5L3VA 4L9RA 3VRHA 4TMWA 2O2JA 2PUTA 4TN1A 2BMAA 5HQ3B 2C5EA 4KO3S 1S3FA 4M36A 2D74A 3AR8A 4XXHA 3IAXA 2WPDD 1KFCB 1KSHA 1DBRA 1SXJB 1VLHA 1WW3A 4R3UC 4BGVA 4C2UA 2IIBA 3BB4A 4RVSA 4IXDA 2FRDA 4WFIA 3DLPX 3IVCA 5DTQA 2WT4A 4BC0A 4CQNA 1UC9A 3KQPA 2FW0A 3SKXA 1HFKA 4INZA 2Y05A 2YVAA 1EKXA 3F6YA 4ECEA 4GDFA 5KDLA 4B8YA 1B0PA 1NAIA 2FOLA 2R5WA 2R79A 2DQKA 3Q3JB 4FHCA 3BD9A 2NTEA 2J31A 1WF3A 4N3AA 5LDHA 1EDOA 1N3LA 2YHIB 4HO1X 1E0JA 4H3VA 5FYDA 3RVOA 3IEVA 3W5CA 3N0WA 1O0SA 1E2IA 3C3EA 4HDKB 4JLMA 4O4IA 2DKFA 3LGXA 3GDGA 3BJEA 4BPBA 3QX3A 1G8AA 3BL8A 1QQ7A 5DSZA 4DA9A 4LRYA 3X1YA 4CQMA 4WZBE 3B6JA 2NP6A 1UJ5A 3X44A 1G8HA 1NBME 3DLIA 3R7FA 5BW6B 3Q40A 3I9MA 3OQHA 2QVXX 3EYAA 2FKNA 3CLVA 3B7PA 4RVGA 3LHDA 3HNOA 2CNLA 3RSSA 5IZCA 3K9HA 5JY6A 3HXLA 5HCIA 4XVCA 4URXR 1G21B 3NBYC 3ETHA 5JS6A 3CVXA 1KK3A 1H4QA 4R2XA 4BVLA 4ZTUB 1TYAE 4M38A 3OE1A 2F55A 5HM8A 3VZPA 3Q3GE 2H2WA 4EPVA 3GDWA 2WUDA 4OQ4A 1E69A 1JJVA 2AJDA 1ZSYA 3HVJA 4CKBA 5KJEA 5JJBA 3EXHB 2QRLA 5IVDA 2VT6A 1RYHA 3NIFB 5JVDB 4BCCA 4Q37A 3U62A 5A2GA 5CH5A 4C4SA 3DTNA 2Q6TA 1CCWA 2JBWA 3F71A 2XQIA 5HE9A 2PSFA 4AZVA 1Y6RA 1T13A 1XTZA 2CEAA 3E0QA 1OZAA 3EFHA 3EG9A 3GEBA 2A3NA 2QSYA 2ZSEA 3GZJA 3I76A 1C9DB 4NAHA 1ZGCA 3V1LA 5M04A 4FBGA 5CUQA 1HETA 2GFHA 2WB4A 3DKKA 3HJTA 4KK3A 4OXQA 4Z1MD 3CUYA 4ZPJA 5LN1A 1D1PA 2TSYB 2XAAA 4JU9A 4TTAA 2DHCA 3L93A 5FNZA 4ZC8A 3SYMA 3TUZC 2WHEA 4Z4IA 3TI7A 2WU1A 3H8WA 4XYBA 1JEQB 2O5EA 2AVNA 13PKA 3QYPA 1RLIA 1W2GA 4QUJA 5IT5A 1OWPA 4R2MA 2KX7A 4DSUA 4XYGA 3F8TA 2WHQA 3HSSA 3IBTA 3IO3A 1ECFA 4ODIA 3U1BA 3BIXA 2QZ9A 4C5CA 3KETA 2VJDA 3AF3A 1HRDA 5ARCA 4DT1A 4WA7A 2QM3A 4E13A 5AVUA 3L82B 1DIOB 3KR0A 4PRZA 1KYYA 4L6CA 2QX8A 2RGGA 4OYLA 2JVIA 5KZMB 2HSDA 3NVAA 3CPJB 3FUVA 3SKYA 5MDHA 1FU7A 4L02A 3U6BA 1N3BA 4HDOB 3EMKA 4OBEA 5F1KA 4XCXA 2R1VB 3OQOA 4GQBA 4JOCA 4HN4B 4F8YA 5ELXA 3F4KA 4ZEXA 1OWLA 3UMMA 3FKJA 1NQAO 4NDZA 2KMLA 1X1AA 1H6AA 2L17A 3SBXA 2GD2A 3TTUA 1TIKA 5BUCA 5K9ZA 2Q5IA 3IAS6 3O03A 4FHZA 3AGQA 4W5OA 4U3JB 3ZD7A 3CLRC 1XLWA 1GJRA 4Z1MA 3SZLA 8ABPA 4FGZA 1TVKA 2Y2UA 4MYUA 1QHHB 1RPTA 4MLZA 4RPGA 3KHTA 3E3MA 1HMPA 3T7KA 1ZHFA 1F0NA 3A4IA 1NPTO 3FF4A 3FFTA 1XMJA 5AKJA 4ZA2A 2FRDC 3GP3A 3V4PB 1GARA 1CG6A 1ZMTA 2QOEA 4RQTA 3A6ZA 2WOOA 1BRTA 1CY6A 1K6XA 3DP7A 4REQA 1S01A 4Q4CA 4FI3F 1A2KC 3G89A 2OZLB 3PHBE 2NZJA 5HS4A 1AUQA 1MD9A 1NVTA 2HUNA 2E5LB 1HDXA 2D2XA 3MCWA 1Z0FA 3QPAA 2EKZA 1QH1B 1HE1C 3CE6A 4NDNE 5B7QA 3W77A 9MHTA 4KQ1A 1SNYA 3IVRA 1Y81A 4MUNA 5FPKA 2G3YA 4JKIA 1NXOA 3AL3A 1N2OA 3JQ6A 4G24A 4PN3A 2XCSB 2FRXA 2HMUA 3ETGA 3HA5A 1JXOA 3FG9A 3IDOA 3OIWA 4GR4A 4DOMA 3AEKB 3FYUA 4JC4A 3LBNA 1EYZA 5CXSA 3L46A 3NAGA 4GRIA 5T57A 4XJVA 2P75A 4MUJA 4PEVA 4KPFC 4HGPA 4LTNA 3QLJA 3L6RA 3LUAA 3CW2A 4KFTA 1V8FA 1FOEB 3IT0A 1B6RA 2I9PA 2VATA 4IIXA 3UMBA 4MRMB 2X77A 3GB9A 1L7MA 3A8TA 4X62B 2R4UA 3CVVA 1E1NA 3T1HB 1EVEA 2HSJA 2Q0HA 4M1MA 2QQ5A 3M6FA 5FTWA 2VP6A 4K2HA 2JASA 3I73A 3BMCB 4KHZA 2YV4A 4P4TA 1U0FA 4PCLA 3QHQA 3LXRA 4YP5A 5DNEA 3O9ZA 2QNRA 2ZBVA 1HTBA 3B70A 2CNNA 3MJFA 4A2QA 4D8TA 1F4VA 2BGIA 2Z9CA 3CXRA 4IFTA 5JO9A 3ZV7A 3TD6A 2ZRBA 4C0AC 2V7QD 3C6XA 2ZIUB 1DKUA 2GRUA 4DQLA 1E7WA 3SDZA 3I9OA 4H7DA 5KTKA 3ZY2A 1QSGA 4N41A 1OX4A 2SHKA 4JMLA 4A36A 3NHFA 4AJNA 1VL6A 4XJXA 4BMCA 3E48A 2GBCA 3GZNA 2X8LA 4AJ2A 2PPLA 3AP2A 4GI5A 4Q6BA 1I24A 4QX6A 5CGQB 1CUIA 1JHMA 1CC1S 4M1WA 3JQRA 1SVWA 4LF5B 2BHNA 1RPJA 1GU1A 4HQKA 2Q9UA 1J22A 3ZDYB 5F9FA 3HS3A 2FA9A 2H1HA 1X94A 2J3IA 1FX0B 2HJWA 1T29A 4V0MA 3TTXA 4FW8A 4C3ZA 1KDVA 3PWSA 3F3MA 3J7TA 1GQ2A 2QVBA 2VO1A 3R0IA 1QZXA 1RKQA 3W4KA 1V1RA 1P5FA 2BP7A 3QLUC 1CIJA 4INPA 5DLPA 3UHAA 1PFKA 1W9HA 5P21A 3U7RA 1EFLA 3FNBA 2FPGB 2JJQA 4UPEA 5JD6A 2GI4A 2PJDA 3LY5A 1QANA 4LE0A 3TTSA 2I4LA 3ORSA 1AHIA 3F98A 3JTEA 2QZPA 4XAQA 3ZWOA 1EWKA 4EZIA 1NJSA 3SX0A 3LUDA 5EXPA 3GD5A 2OZPA 3RPEA 1AKMA 2P9YA 1JEYA 2HNKA 2V7QA 5JS1A 4R8RA 3HA3A 1JAZA 2GXUA 1VP9A 3HCWA 2C2KA 4KL8S 4TTQA 2IYUA 3S8YA 1WP4A 1HH4A 1I94B 4C1BA 2TMYA 1EXWA 1HYHA 2J5RA 2G04A 2A0YA 4U6QA 1ZLYA 4CM8A 1E64A 1SHLA 1UMCB 2CXOA 1DG9A 2XA9A 3A7EA 3S2EA 2GN6A 2BELA 4KIWA 3WBBA 1CJBA 4DANA 1PL6A 4BLWA 2CCKA 4MA5A 3KJQA 2Z6AA 4TSFD 2BJHA 3A0RB 3LQ1A 3LRPA 1J49A 3VPXA 2H0RA 4BO5A 4OFBA 5ESXA 4EQ6B 2Z1MA 1GGNA 2PVCA 1CR0A 1G16A 1T10A 2AUMA 3H9UA 4RHEA 1A95A 3CMMA 4Q47A 2BM1A 1E2NA 2XOXA 4N03A 1YZGA 3P5BA 1O6FA 4YLEA 3UH1A 1E1LA 1EXDA 1TM5E 2DBRA 4BCDA 3CRW1 1IBMB 3H11A 3HDGA 5EWJA 2DQSA 4BXOA 2R9VA 1QFYA 1I6MA 4E88A 4YMHA 1NJ2A 2PS3A 1JKJA 3X2EA 2WYWA 3LDAA 3TFWA 2HBQA 4D4HA 3FYUC 3SWWA 1P5ZB 2A5LA 4FFMA 4E7PA 1DKRA 4IV8A 1VPEA 4ZD6A 3BJZA 4V0ME 5E1MA 5HRAA 3IB3A 4GM0A 1L4YA 1C80A 1DXYA 3G0HA 3U3KA 4P98A 3FOZA 1P9NA 1V9CA 4MARA 2GYVA 4P08A 4PG4A 4X6UA 3RS7A 2R7AA 2JI4A 3EOBI 1Y34E 3PJRA 2VP2A 1DRJA 3P4YA 4E6PA 1NR5A 2YS7A 3GVIA 2NSYA 2G1KA 4D9HA 5ES3A 4OI0A 1B6TA 5JC1A 1KI1A 3DKPA 5ILGA 1T3ZA 2FTKE 2E2WA 4FYYA 1J5EB 4J4TA 2RG1A 2DR0A 2CE7A 2O2IA 4JFRA 2DHDA 4UTPA 1ODFA 2WHPB 1VL8A 3AY3A 4J2HA 4N0PA 2QX9A 4JSRA 3ON5A 4C4OA 3T1YB 3OWOA 1G63A 2YN0A 3MJRA 1TRHA 2QTCA 2C5HA 3LQQA 1B0AA 1LDBA 3MQFA 1ZH2A 3NM6B 1BXRB 4CTKA 2X7HA 2E4XA 3PJFA 5IJ0A 3F2VA 3KQUA 4DG8A 2HA3A 5FLKA 3VPGA 4P80A 1QYRA 5EVCA 4B4DA 2H06A 3BWVA 1EZ4A 2H6EA 2C3OA 2JRLA 3OPVA 5F5XA 1CS0B 3WSTA 3AHHA 3JRNA 2G80A 4HB0A 4YHBA 4RC9A 1IY0A 1HDOA 2Q2NA 5D87A 1X42A 3GFRA 2GN8A 3E9RA 4TYYA 7MDHA 2EQ5A 4RA6B 3B13B 1K06A 1TJ3A 1EGVB 2GCPA 3H4VA 2X23A 1VFNA 2QRQA 2ZJ0A 2ZPTX 3G7SA 3ZNOA 3OUTA 4Z4CA 2IDMA 1OSNA 2ATCA 3H4IA 4X8HA 3ZHVA 4RS4A 3WYCA 4UOEA 1ZFNA 5CH3A 1CSEE 3VU9B 4IIBA 4GI2A 1POXA 3RJMA 3IULA 4I19A 2GPYA 3HO8A 3V48A 1R4NA 1KZ6A 3K3PA 3MG9A 1A4XA 2VHUA 4RWZA 1M2OB 1QBKC 4TM7A 4XD2A 1VE3A 4ESVA 4OSEA 4LF9B 3U7HB 1F6DA 1VC2A 2D0IA 4FMDF 1K97A 4PQEA 3VHQA 3EFOA 2IT1A 4YJ2F 3D2CA 3LQFA 4TRJA 4LCJA 4WXHA 3OU7A 1FSFA 1ACLA 1NUAA 3NWJA 3O83A 3HQ4O 1H2RS 1J0BA 3U4IA 1B42A 1L5HA 3TZBA 3MJTA 1QVAA 2P9TA 3OMXA 3MJDA 4L4YA 2YJ4A 1LTQA 2JFYA 2Y27A 3NJRA 2B1JA 2UVPB 5FX2A 4C0WA 3B7WA 5IUJC 2C77A 4OGFA 4MI3A 5JROA 2ZU6A 3FCOA 4K88A 3TO5A 3QTTA 1Q1GA 1HURA 2ZIFA 2BONA 3OA2A 2AKEA 1U1IA 2I67A 2ORED 2GSDA 3IP9A 4RMNA 1YTUA 1U2RA 4GVLA 4MW2A 1K9SA 4CV2A 1IJFA 2JAHA 3AETB 1OR8A 4IDAA 4RSHA 5TT1A 4MVYA 4NNPA 1JMVA 3LP5A 1AY0A 2VDOB 5KNCH 2VSQA 3WGVA 1VJ1A 3EASA 1BS9A 1ZS9A 2PSEA 2D5CA 3WDKA 1UFOA 1A7KA 1QRDA 3DWEX 2YW2A 4JI0B 3HKDA 3LYAA 2I2DA 2OM6A 3NOXA 3Q5GA 4UBNA 4WX2B 4XQCA 1M2FA 4D4LA 2CJYA 4CL2A 1CW2B 3VX4A 5LLTA 3E03A 1GGVA 1V41E 3RARA 5ECDA 1ACMA 4D8VA 2B2NA 2DFVA 2NU6A 4LRTB 3GFSA 1E9RA 3KYBA 3QWBA 4KCGA 1JZQA 4PWZA 4X6YA 5HTKA 3HEBA 3AI2A 3CCCA 3CIFA 1U94A 4FGKA 4DR1B 1ZGGA 1D1SA 5B3KA 3RU9A 1RBYA 3L4KA 5KKAA 4LXUA 2WUGA 4F2PA 4COKA 1IAVA 1NLUA 1TZ2A 2R60A 5AK6A 2CLDX 2F43A 5B2ZA 4BATA 4OQLA 3RSLA 3WGGA 2VI5A 4F0JA 5AKEA 5FFNA 4JR0A 1NSFA 1H2YA 4UEOA 2ODQA 3V4ZA 2BMWA 3ND6A 1FFAA 3UB4A 4M1QA 3U60B 1LXCA 1EWTA 3VR5D 1NI4B 5EWMA 2RHRA 1M54A 2J09A 3BBLA 5IAJA 3LTNC 1PYGA 2I8CA 2OGWA 4G5OA 1VLQA 1RMQA 1RYFA 3PJEA 5LP6F 5ECYA 1Z2NX 1O9HA 2QTWB 3VUFA 2BI7A 4FXOA 3VYTB 1FZTA 2ZUWA 1I7LA 1XU7A 4H16A 5I01A 1MW8X 2AD1A 3HKCA 4FE7A 3V80A 4GZ3A 3DEAA 1N5DA 4HXFB 4MUGA 3RVPA 2O8DB 2PGIA 7REQA 3EK2A 3HR4A 2BMVA 3PEEA 5JO0A 4Q1EA 4NNJA 2A5JA 2YRFA 5JNWA 5CDSA 2DBQA 1AV7A 1TC2A 3LUGA 1O6CA 1SRQA 4DMKA 4ITUA 3HYRA 5L3ZA 1N4AA 4DRZA 3R9XB 2WD9A 4X6XA 4OHUA 2QJWA 3Q6IA 4MMYB 3KP1A 4S24A 1YXMA 3AUSA 4NYIR 3DYVA 1HEUA 2EW8A 3MCTA 2A9QA 1EBFA 3QNWA 3RUEA 3OM0A 4MUAA 3PZRA 2WE8A 5AVYA 1EBBA 4NVRA 5D6NA 1ZNXA 2VDKB 2BI8A 3CX4A 1X7ZB 3GFPA 4Q1CA 1RXVA 5CU7A 5IP5A 4BLPA 2Q2WA 1PF7E 1RQPA 1U81A 2JA2A 3AW9A 2C4HA 2VTEA 1TXGA 1Y3IA 1LDGA 4Y2HA 3VR5A 3CNOA 2HCRA 3PGA1 4QQKA 1V37A 1CY0A 3CX7A 2EW2A 1RM5A 3ACDA 3FOAA 4Y3UA 5J5CA 4F11A 4RTKA 4B3TB 3QJ5A 4XGNA 1WF6A 3GPBA 3KSUA 1A1VA 4F91B 1RCFA 1JHPA 2IHVA 3GGCA 1Y7HA 2YV3A 3UT6A 3GPIA 1NBEA 1P0PA 3DAOA 4OQDA 3O7WA 1NG1A 1XPRA 2V74B 3EZLA 2V0CA 3TXAA 4Y7DA 4CMEA 3TPFA 2OV2A 3IVMA 4L3OA 1B00A 2OLJA 4LK2A 1GSHA 2GM5A 4W8OA 1WX1A 2P1DA 1DC4A 2VEOA 1LBSA 1FMLA 1NV8A 2FV8A 4KKVA 1YQ9A 2J4FA 4OQNA 3T7EA 4HDSA 4NABA 2A9RA 5JT1A 1QKJA 3VM6A 3PFHA 3K6JA 1DCTA 2AXPA 1JR3A 4P34A 2K2QB 4ROTA 3V5NA 1VSBA 4HB2A 1Y1LA 4KWTA 3NHJA 1AA9A 4E5NA 1OVGA 4ZT7A 3ZJVA 3AZQA 3HXPA 3L1KA 4NU0A 1K1EA 2P2SA 4P33A 3GMTA 4X97A 3IPLA 4FI3C 3NRBA 2VAMA 1ZA2A 4I55B 1K5PA 2V55B 3SXJA 2GZ2A 2PZBA 5A02A 3VYSB 5L3QB 3ELWA 3ILXA 2J67A 3NTXA 3DPSA 2IYNA 4EYKA 1R6BX 4I08A 4JLOA 1E2BA 4MMXB 2ZTHA 2FWIA 5TS2A 2HIMA 4HNSA 3TK1A 2C9DA 3DXYA 1QG4A 1G18A 3CZAA 3R3JA 4JX8A 4X54A 1Z3IX 4XEUA 2P41A 4H31A 5FULA 3SD7A 4G0OA 2HA6A 3W9YA 5I51A 3BE6A 4EG5A 1TZBA 3I58A 4PNZA 1RZ3A 3QOWA 3X1XA 2ADFA 5KNDH 3F78A 4UU1A 4ER0A 3WGHA 5C5EA 4TWZA 3GLFB 5TQ2A 4N7JA 2PR7A 1FDVA 4B3GA 4XLTA 2J08A 4LHZA 2NYRA 5CYGA 1XRSB 1F06A 1FC0A 4NULA 4RL4A 4TRNA 3QXJA 4FSDA 2CV1A 2ZCUA 3CX8A 4HGRA 3WHLA 1Z35A 4FDMA 4N18A 3O93A 2C7GA 1VZ3A 4HRYA 1DG1G 4B2LA 2G82A 1U2EA 4OYRA 1I3OA 4IVNA 4C6TB 3SAJA 4JI5B 1C7ZA 4QJ5A 3GGSA 6YASA 2I7TA 5MFPA 3AUUA 2Q0XA 2VJQA 3E1KA 4FX2A 2FFHA 4I7EA 3MWDB 1DFIA 1AIPA 1SWWA 4JXJA 1NJ6A 4NZ9A 4U7HA 4BGUA 1BTOA 1FLNA 2GPAA 1Z8FA 3AR3A 4QPPA 1M1UA 1CY4A 3FDZA 4A7PA 2BFDB 4R1NA 4DHWA 4AWXA 4IDEA 2B8NA 2OO3A 1JFSA 3SDBA 1ES9A 5J23A 5GIOE 4X7MA 4DXAA 1HM5A 5EP2A 1P33A 4RFSA 4BU0A 3I8XA 4NU8X 5CM2Z 1KZHA 4HWKA 3HO1A 1V8ZA 4UXHA 4YECA 4R0NA 2IK8A 1U0JA 2XGMA 4YFYA 5D3KA 1JR3E 3OHSX 5B55A 2PGNA 4EG4A 4B4VA 1YAHA 1ZWKA 4PLVA 3TGPA 4JSYA 2EKBA 2P8JA 4G5FA 2HDOA 4RIIA 4RKWA 2PBLA 1QAMA 3IL2A 3WQQA 4LCBA 1V1MA 4G1VA 2BE7A 3FTPA 5EESA 4DR4B 1N5OX 3FWYA 1CJMA 4P3KA 4PYKA 3TZHA 4RVDA 1IN1A 2XA2A 5KVVA 3WGYA 3WMWA 2O1XA 5BVGA 5DYIA 1DTEA 3HCOA 3L0CA 2O48X 1XALA 3RFFA 3TTTA 2HMSA 3ESZA 4UM9D 5TB5A 3IVAA 2WIDA 3S7TA 1EFPA 1EWVA 1GAJA 2NSHA 2CLOB 4G97A 1LDMA 4U00A 3SM3A 3X3HA 4YJ2A 2VJMB 3SCZA 4RK7A 5EJ6A 4CMEC 1OH7A 3L1HA 2PX0A 4N6GA 5H3CA 4V1CI 1PJZA 4YCDA 4BO3A 2CLLB 4MEJA 1TPZA 1X1CA 2NW6A 3IS3A 3KM0A 2QY9A 5A9RA 3DDOA 3V8PA 4YIHA 3HKEA 5BW4A 5K0TA 1G8YA 3KAJA 2JCVA 3GQBA 1NY6A 1M34B 1OXKB 3MD9A 3RRFA 2IW3A 2AD5A 2OQ2A 3BS4A 4Y2XA 3TD2A 3ZGYA 1O4VA 2XQFA 5KVCA 2ISCA 2ZKIA 4Y98A 4HEJA 3O4GA 1VP3A 5ERYA 4TKUB 1RXYA 3OZFA 5KU1A 1S9DA 1YC5A 4HJRA 4UEKA 1MV5A 3U40A 4F6CA 2JRCA 1ZK3A 3RABA 1AQYA 3WFZA 1B2LA 2OBXA 1G3IA 3Q4GA 4KDEA 1QCYA 4KGXA 4XLZA 4PFSA 1AKEA 2WFLA 3WFJA 3VR6H 3BE4A 3VV2A 3B52X 1CE8B 5EHIA 1E6EA 3VJLA 2ATXA 4F85A 4O3MA 2G0TA 1XHFA 4U9HS 2ZYUX 3UMCA 2BUBA 1R12A 1IXYA 2Y1XA 3HV0A 8AT1A 2A6PA 1ZVMA 1QE5A 3I9V6 2ET6A 4Z86A 2DP4E 1IRIA 1SUEA 4C4TA 1EZ1A 5DGCA 4MYRA 2CYBA 1JJBA 2XKJE 4O0LA 4IIFA 3X1DA 3ROMA 1W4RA 3NIWA 4BDTA 2JI8A 4L4ZA 1E0DA 4W63A 1RWNA 1F5SA 3DUFB 4A0HA 3OFSA 1PFWA 4DL9A 4MJLA 3FETA 2ADMA 4EARA 3E8XA 5IRCD 2W2NA 1VRCA 5BURA 1SBQA 2GUWA 1CZOA 3WA7A 2AMFA 2PKWA 3GG9A 3GGGA 4UFPA 1E3IA 2DTDA 3ICOA 4TV8B 2PKQP 3ONNA 3VHXA 3WLOA 6ADHA 3PHIA 3AEYA 1YUMA 1HRKA 4CDRA 2E5WA 5AVVA 2HH9A 2WYOA 5LP6A 2AC7A 2ACWA 5C1IA 1GQOA 5TT0A 1AD2A 2RH8A 4NECA 4CLXA 1R0YA 1VE1A 1ODTC 4DV7B 1P7VA 4IFBA 5FWNA 3BG5A 3AF2A 1MIOA 3T4PA 4BNZA 2IHKA 3EISA 3HU1A 4UU8A 4G81A 3O74A 4MRRA 5CJJA 3ZQ4A 1K0FA 1T8TA 4AN0A 4BWYA 1VIMA 1IUOA 1U8XX 1ZO8A 4CT5A 3K9WA 2UZ1A 5CVJA 3VC2A 3OY2A 1EUDA 1XZNA 1YA4A 3K0BA 2WTAA 5JUWA 3OLVA 4Y30A 2NVBA 1N1DA 4Y0AA 4MS3B 3RTCA 1NVKA 3T9CA 4EPYA 2OVFA 3I5XA 4H6PA 1LK5A 4M2LA 4E3WA 5IASA 3M6UA 2AUNA 1H93A 2Z04A 1ZSNA 2JLAA 1EGAA 1G8FA 2W6PA 2VPPA 4I6JA 1V2GA 1VCIA 3S68A 1RMTA 4J4HA 2H3EA 4Q3DA 5I9IA 1GADO 2I0FA 1ZRSA 3M6LA 4V2UA 2DBZA 2CLMB 4MVJF 1KSGA 3R7NA 4XDHA 1VI2A 2C8KA 1ZJ6A 3I0MA 3I04A 5DYTA 5IT9A 4MV7A 3OMLA 5TEVA 1R5OA 4EA9A 2CJWA 1IUKA 5AVZA 3IQFA 1KVRA 2PO5A 3ITEA 5LXTF 3DEZA 4OAQA 1C50A 1LJUA 3WGOA 2X1MA 4RUKA 4QL3A 3TDKA 1BVYF 1KEUA 3AFGA 4YRZA 4AJ4A 2HF8A 3KBOA 3ANMA 5EI5A 1A3CA 2ATVA 1QF6A 5ALEA 4BKQA 4KR2A 5DX1A 1Y6JA 4EUEA 3LD9A 1ZCJA 3FNQA 4OJTA 1WUJS 5HK8A 1WCXA 5CB4B 1RXSA 4TM8A 1B1CA 3CZRA 2XMZA 4P92A 2PX4A 3VGPA 1QP7A 4R6XA 4XQ0A 4B87A 4LPKA 3IDFA 2REBA 4WLUA 2L69A 1VYHA 1SC3A 2XMRA 4XEHA 3NNDA 3WB1A 2XMSA 4OH1A 1VG1A 2UUAB 2Z4TA 4N3CA 5HIIA 4GW3A 4P3YA 5FP0A 4MICA 3FCAA 2Q4BA 1QQBA 1X2BA 2XX3A 1D7AA 2PH7A 2A8YA 2DSTA 5KTOA 2I62A 2ZITA 2J46A 1NVFA 3C5WP 3F2IA 1RAIA 1F3OA 4TKMA 4ZCLA 5SICE 3I4FA 4XJSA 4ZYLA 4EW1A 2COUA 2P6UA 1E6KA 2NWQA 1FZQA 3JSAA 2PZGA 4QTXA 1K3FA 1MQ8B 2OXRA 2NU8A 3SE0A 5CLIA 3AW8A 5EZQA 4HSEA 3UWOA 2JJ2D 4WNIA 2BKXA 1HDRA 1O6BA 4L3VA 5J3JA 3HBMA 2VTDA 3PLRA 3WYEA 2GJ9A 1WDMA 2WWXA 2C78A 1YJ5A 3O8DA 4KWHA 4RENA 1VXRA 5HNKA 1EDBA 4KOAA 4PZPA 1KEEB 2CHVA 3Q10A 4MR9A 2UYQA 3UK1A 2DBYA 1G8PA 1UMKA 1SQGA 2X5JO 3I6IA 1HOTA 2QD2A 1IZYA 2C4TA 1P2SA 2JGJA 4ZV7A 5LP6C 2GHQA 5SYAA 2A33A 4U7DA 2X4IA 4UHCA 4E21A 4OKIA 2UYYA 1GUBA 2QQ0A 2UVQA 3NHAA 1WBJB 5TGTA 4AJOA 1Q17A 2Y1DA 5FOTA 1XQ9A 4Z49A 3VSDA 4I9NA 4HUQB 4WZAE 4F04A 2GBGA 4FHFA 3S6JA 3SR4A 1WSAA 5SYNA 4B4UA 1MAUA 5ICFA 4D4MA 4DYHA 2D4HA 4Y2PA 4BNDA 1V0JA 1P91A 4S1WA 2QYTA 5JQGF 1DOZA 1UMDB 2X40A 2H92A 3M4ZA 1KFKB 1HZZA 2I76A 2R1UA 3FUUA 5F5NA 2JFPA 1OYYA 3TLZA 4HQNA 3P96A 1CZKA 2JJ2A 4L0DA 3C4VA 2O0JA 3COJA 2YUIA 4N49A 1E0AA 4P4NA 3I53A 4TLCA 4U9IS 2PRKA 1QPBA 1C4KA 1N6KA 2Z2XA 4CCSA 2I9KA 5CLJA 1M83A 3CS3A 1MO3A 1XCJA 2EFGA 2PN1A 3H8VA 3P0HA 1T5SA 4MRAA 1JG6A 2BM8A 3NHSA 3SIRA 1VZ2A 5A4IS 4PG5A 1P18A 3C6YA 1FSGA 3DDUA 4F3TA 4JYPA 4J91A 3UO8B 1AB6A 5KBYA 3DZBA 1SJ9A 1WW2A 3OCYA 3PNPA 4WADA 1LBEA 4WY2A 1JI3A 3WAGA 3C74A 3C3CA 3K0EA 5EXTA 4ZMBA 2G7ZA 4R1OA 2PY6A 4ARSA 3B1FA 3ZI0A 1U9CA 3AZOA 2MTBA 1GKYA 2BFBA 2VOJA 3BRWD 2JLCA 2FN3A 3HZHA 2YZKA 4I3FA 5GONB 4G86A 1BYUA 3LE8A 4TQGA 5FAXA 2P9GA 4Y6SA 1PLLA 2P69A 2VNIA 5FOVA 3SIWA 3LC2O 3MJ4A 3PHLA 3BMOA 4DADA 5AW7A 4DV4B 2TMDA 3KVYA 1HLDA 1OBCA 3IAM6 3PFFA 3UJNA 1P1FA 3IIIA 1E1DA 4DILA 1ZD8A 3FNIA 4J0GA 4EF6A 3F6CA 3OBBA 4COOA 3L0SA 5J47A 4R8KA 4D4KA 1COZA 1Q1ZA 3SHWA 2XGGA 3CH6A 3IELA 3MIZA 2WYIA 5CITA 4JQOA 4JT9A 4OX9Y 2WHXA 3FIJA 2Z5FA 3R6LA 4HH1A 5K03A 4IXTA 1K86A 2XCUA 3BGVA 3CRMA 2Y0BA 4QFCA 4LF7B 4RK6A 1AXRA 4JYBA 1GAEO 4BYMA 4FNAA 4LHVA 2OILA 3PRKE 2B0JA 3E53A 1UZUA 1U3CA 4RK1A 3D3QA 4QT4A 5AKZA 1PDWA 3N59A 4P7KA 1GNSA 1SXJA 3A25A 4I5IA 2WJAA 1PJCA 3WWOA 4R0MA 3A28A 3WOVA 4HFNA 5K51A 3DEFA 4LC9A 3VV3A 1SO8A 4II2A 4Z51A 4U6NA 4B9AA 1FSZA 4NENB 5JSQA 3BRWA 2XDYA 4Q4HA 3OCUA 3SOZA 2F1IA 1PR6A 1L4EA 5FFMA 1DKQA 2QVGA 2QG6A 3K0AB 1UOQA 2O2SA 2VHWA 2P11A 4WN9B 2PIDA 2WVAA 1XMSA 2YHIA 1K98A 1QXSA 2XITA 4MITA 1N75A 3K6SB 1DC7A 3L4BA 4CCYB 4DGSA 5C1BA 3CUVA 4JI8B 2EEPA 2B4RO 4HDKA 4HH0A 5H83A 1YVPA 2MSWA 5COBA 5EEGA 5EGSA 3RQIA 2HR1A 1CUBA 3A6EA 1AOXA 4BUZA 4MVJD 2JIMA 2OE2A 3BD7A 2XA1A 4R9VA 1N6HA 4RF2A 3AERB 4EYQA 4J0EA 4TS9A 4AJ9A 4XSHA 3TG8A 3KKQA 5DNWA 4UOQA 4S2UA 4PC1A 1L5MA 4YJGB 2BGMA 1Z2AA 3W8DA 1N5IA 1U2GA 3MMPA 2C3PA 5THKA 3GF4A 1U6KA 2VRWA 2ZVDA 1DOHA 3DV0A 3OT4A 4NNOA 1HZZC 2RC5A 4KQJA 4C0JA 3H5LA 2ONCA 3K1TA 1T91A 2VSNA 1JA0A 3QX8A 3GIDA 4GH5A 3IUPA 1KRWA 4P3OA 5KAPA 1FLAA 2X2PA 3R7AA 3ZNQA 4R6WA 3NT5A 2GLTA 3WGJA 2DWOA 4Y7CA 1TYBE 4PICA 2UZ3A 2WZCA 4EG6A 1M74A 1NNLA 3HP4A 2ZJYA 4G07A 1ZG3A 4JV5B 4RSGA 3QIAA 1V7QA 1N2IA 3DDHA 4UMDA 3BTOA 3HPRA 3SPXA 2H1VA 4YA6A 3GNTA 2E48A 4ZK6A 1BE6A 2VDQB 3MILA 5FTNA 1M5RA 3VSEA 1ESDA 2DKOA 1SXJE 5KSZA 2ZJ8A 4WK4B 4K5QA 2ZJBA 3AHJA 4J75A 1K4MA 4MVJA 2OXCA 4PINA 1F8FA 3VGJA 4MUBA 3HXQA 1WCYA 4ARUA 4BVEA 3D4IA 1OV4A 3AJRA 2DLNA 2EKQA 4PBRA 1OF1A 4U7TB 5EIAA 3H2HA 3ZPXA 1HT3A 5JQWA 1WXGA 4X93A 1S1MA 2QT0A 1NATA 1PAUA 4G1UC 1TAUA 3IBCA 1DSSG 2CVQA 5FIUA 1A8PA 1Y8RA 1Z26A 4GD3Q 3LT1A 3EZYA 4Y2RA 3ISTA 5IVKA 3EVTA 1RVDA 1U8TA 1ZK2A 2YY6A 3Q5EA 3G2IA 2XJ4A 1S8NA 5ESRA 1B3BA 3HCFA 3M2PA 3ANYB 3BERA 2WYHA 4FNGA 3L79A 1XF9A 3DLHA 4M55A 1PDOA 3G1TA 2DWUA 2VZLA 1BVHA 2VBFA 521PA 3RBZA 2AZMA 1XRLA 2JFBA 2QJTA 1R9GA 3PSAA 1C81A 2VK4A 2QQEA 1D4OA 2ZJ1A 1S8OA 5CEJA 3TOVA 1QGOA 3NP9A 4K9DA 2H5IA 5LVAA 2FZGA 5ALOA 3SXUA 4IIGA 5DNCA 4EJMA 2RIPA 1E79D 1G21E 3FKQA 3VDRA 2IDJA 2R5NA 3TW4A 2BC9A 3SEAA 3CNBA 5DM0A 3DR3A 4US2R 4KHPB 1SXJC 4BLTA 1DDGA 4Q9DA 4F3RA 3UICA 4I50B 4MW6A 3LFHA 1IK6A 3ZWVA 4GLJA 1TFUA 1WLSA 2D2EA 3EJWA 4J0IA 4MUKA 1D8AA 1QTRA 2AC2A 3PFWO 4QYMA 3QK7A 4L8LA 2WM3A 3I5YA 5FJIA 1Y6ZA 2QP3A 1BVUA 1DMSA 1L5WA 1AKVA 4XIJA 2Y1FA 1ZRHA 4MRNA 2J07A 1EMDA 1Y6FA 3O4RA 4C0LA 3H1FA 2Q5HA 5CGZA 2F3TA 1E89A 1MAWA 4S1VA 4AULA 1MKYA 3QU5A 3UH0A 1E60A 3L4BC 5C3MA 3TSOA 3T7CA 4MVJE 5BR8B 2PZMA 1NTOA 3Q7IA 4V3CA 1KMQA 3V8BA 4TWJA 1AB5A 5DTIA 1EINA 4IUCS 1AXEA 4DC9A 4EB3A 3PC8A 3JRWA 1Z4NA 3QWAA 3QVVA 4HDQB 3DGFC 4LJ5A 5PNTA 4EHKA 5AVSA 1EFKA 1S1CA 2YICA 2VH1A 2W2VA 2NO0A 2WKQA 1LFAA 2AVDA 1E79A 1XA0A 3QF7A 3VKHA 3LC0A 1F14A 1U2GC 2O07A 4TLLB 2J7PD 2ZYSA 3CN7A 1NW6A 4G5HA 4PXAA 4AX8A 3U4QA 3BMCA 1A8HA 4IFEA 5EYPA 1STOA 1YE5A 4UVIA 4B3XA 5LWQA 4U0JA 4E22A 1JDBB 3TL2A 1ORHA 4QC2A 3BMQB 1M72A 1WXWA 1RBQA 1QQ5A 4U7GA 3EZNA 2Q9AA 4PYLA 2W0SA 1JAYA 5JQGA 2WP0A 1QP8A 3NUGA 1RPZA 5BMVB 3DBHB 1FRFS 1UT5A 1CNMA 1H2HA 1FQOA 2B30A 4QAJA 3GELA