4G0MA

Crystal structure of arabidopsis thaliana ago2 mid domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
SIVKHWAVLDFTASERFNKMPNDFVDNLIDRCWRLGMQMEAPIVYKTSRMETLSNGNAIEELLRSVIDEASRKHGGARPTLVLCAMSRKDDGYKTLKWIAETKLGLVTQCFLTGPATKGGDQYRANLALKMNAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Protein argonaute 2
publication title Arabidopsis Argonaute MID domains use their nucleotide specificity loop to sort small RNAs.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 43
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g0mA00
4ZYLA 1FQWA 4ZMRA 4Z99A 5IX8A 3O2QB 1P6QA 4GPAA 5IULC 4Z4FA 1PNRA 1USIA 1DG9A 2QR3A 1SRRA 1KGSA 2E4WA 1KRXA 2JK1A 2FMFA 2PE5A 2CD7A 5TPWA 3I42A 2JBAB 1JBEA 4KFCA 3BILA 4IF4A 3FMVA 1ZITA 4F06A 3KTOA 1VPWA 2FQXA 3KLOA 2PUCA 4XAQA 1EWVA 2N9UA 3DLBA 1DRJA 3O1JC 2JRLA 4YLEA 3FGZA 4MS3B 1LBIA 3JVDA 4WWHA 1K66A 1Y1LA 3Q7TA 4L85A 4MR7A 4D6YA 2ID7A 4EGSA 1C0EA 4NICA 1TM2A 3VNBA 1F51E 2MYNA 3OMXA 1DZ3A 4QYWA 4WZZA 3RVKA 3D8UA 2ZAYA 5HM6A 3H5WA 4RK4A 5EWJB 1QKKA 1VRVA 2LPMA 4F11A 1FFGA 3KHTA 4RZSA 1USKA 4WXEA 2M98A 4JP1A 1NXTA 4L4UA 5BRAA 2WWVD 4W5OA 4KREA 5FWYA 4MQFA 4O5AA 3OLWA 4W5QA 4MLCA 3RVSA 1EFAA 3Q41A 4MRMA 4IGAA 4YP9A 3OM0A 1Z13A 1DCMA 3NHZA 5B3JC 3SNKA 2CHFA 1ISRA 2IPMA 4N0QA 1ZAYA 1JWLA 1Z12A 1ISSA 4UHKA 5DKFA 5HKOA 3LUAA 1YVUA 3A3KA 4PE5B 5IUKC 4FB4A 1H9CA 4Z4IA 2X7XA 1MAVA 2TMYA 4MS1A 3F6CA 3IP9A 4RWEA 5IC5A 4GNRA 2FLWA 3OO0A 4Z9AA 2NUBA 3E61A 2B1JA 4KNYA 3EODA 3CS3A 5DTEA 2HQOA 3H6HA 3I45A 1NXOA 3LTEA 1SXGA 4DADA 1HEYA 4MR9A 1ABEA 3D02A 4O1IA 4YCSA 1PUXA 1D1PA 2QU7A 3R0JA 4P98A 1OXBB 1A0OA 5CNKA 4JB0A 2RDMA 2R48A 2RJNA 2WMYA 3IP7A 1Z15A 3UK0A 1W9HA 1DBWA 3GV0A 5TQ0A 4NQRA 3SY8A 3LUDA 1NXSA 2JCGA 1EAYA 2VUHB 3DGFC 4KK4A 3CTPA 1PNTA 2RGYA 1TLFA 4HYEA 4MQEB 5EWMB 4ZJPA 3NNDA 5KWSA 5F64A 2L19A 4TLMB 4LDZA 3KLNA 2P9HA 3OQMA 2IKSA 1E6MA 4EY3A 1DBPA 3OLYA 4D74A 1YMVA 2GI4A 1LK0A 4ML3A 4N41A 3T95A 1WETA 2MYPA 2PUGA 4RV5A 2LUOA 4P1ZA 5FBKA 5KQGA 4IRXA 4Y9TA 2FSPA 1YIOA 2JBAA 1BVHA 1Z17A 3I09A 2F8TA 2LIVA 4RK0A 3CRNA 2PMCA 1NTRA 3BRSA 3KCNA 3IP6A 3L6UA 1YK0A 3I5AA 4DQDA 2W42A 3NNNA 4DN6A 3RVMA 3EJWA 2L2QA 3HV2A 1T34A 3LUJA 5KC9A 1DC8A 3EQZA 3Q7SA 1XHFA 4MS3A 1ZVVA 2R4QA 3QLUA 2A9OA 4EYQA 2FEPA 3GRCA 2FKAA 2FTKE 3RVLA 5JNRA 3GBPA 3RVOA 1M5UA 1GUBA 1NXVA 3FFXA 5IBQA 3RVQA 3DLHA 2PJUA 1JHZA 1L5ZA 1NXPA 3LUCA 3K4HA 2PUEA 2MYUA 4Z9BA 1JFSA 3CZ5A 3HEBA 3QEMB 4PICA 1IIBA 5EWJA 3JY6A 5BR1A 4ETNA 4EVRA 2JVIA 3QELB 5E3JA 2PKXA 3N0RA 4RU1A 4EYOA 4YRZA 1JH9A 4G0OA 2GBPA 2YHBA 3ILHA 3KJXA 1RZRA 4W5NA 5JNTA 2FW0A 2CHEA 4CBVA 6CHYA 1RXEA 3RH0A 2MSKA 2AYZA 4QPJC 3H1FA 4W5TA 4KRFA 4QYMA 2PAFA 3OQNA 1Z2EA 1VLZA 1TJYA 5TPZA 3EDCA 1FFWA 1E6LA 3HSYA 1QPZA 2ZWMA 1YMUA 5KC8A 4RXMA 3QX9A 2A9PA 3C6QA 1D4ZA 5PNTA 2PL1A 2A9RA 2A9QA 2GKGA 2I6FA 3KSMA 1PEAA 2FQYA 3RVNA 4FE7A 5GOTA 3NBMA 1U04A 5CNMA 1URPA 2GWRA 3HCWA 3VNAA 1U0SY 2HJ9A 3GA5A 5FBHA 4Z4HA 1D5WA 4HNRA 3CG4A 2PL9A 3JPYA 2QXYA 5B3JA 1P6UA 1GCGA 1Z26A 1Z25A 3GL9A 4HNQA 2L18A 2PUDA 1UDRA 1P8AA 3EGCA 6ABPA 4MQEA 5EWMA 2QVGA 1PEYA 3HZHA 3JS5A 2WB4A 3FFTA 4ZPJA 1NXXA 5HQJA 2FLKA 2R47A 2QZJA 3H1GA 3P9YA 4G0YA 4JA2A 4KMRA 1ZY2A 4IMJB 3IPAA 3HM9A 3KYIB 5EWLB 4RXUA 2AYXA 4JASB 1D1QA 4G86A 4YV7A 1QNLA 4TN5A 3BRQA 3Q9SA 1BA2A 4MGEA 2FXIA 3T38A 1DCKA 1ZN2A 1DJMA 2E4ZA 5HSGA 2IPLA 4LE1A 3HXMA 4KVFA 1RZRD 2QV0A 4OBBA 1AB5A 1BAPA 4RKQA 5GQSA 4LZLA 4EVQA 2IDMA 4W5RA 1JDPA 4N76A 1ZGZA 2FMKA 3DZDA 2B4AA 3MM4A 1LJUA 2E4VA 1ZDMA 1U8TA 1Z18A 3HDGA 2QW1A 4Q7EA 3GWGA 1AB6A 3HO1A 1DP4A 1I3CA 2HSGA 5CNIA 3FFWA 5TPZD 3RVRA 3MMNA 3NNSA 3CKMA 2CWDA 4MS4B 3CHYA 1GUDA 3F6PA 5JS1A 2WJWA 3O1IC 3QEMA 3ROFA 3ILYA 3CLKA 5ABPA 3BREA 4G0PA 3OLZA 3QELA 2HPHA 4OATA 4EVSA 1FFSA 1M2EA 4YGXB 1QP7A 4RXTA 3N8IA 1RPJA 4IMIB 2VYCA 1LJLA 3GYBA 4RK7A 2FN9A 3W9SA 3RQIA 3LKBA 2E4XA 3O1HB 3H5LA 5JNUA 5C5EA 4Z0NA 2OENG 4B09A 2VUIB 4XXHA 3OQOA 3H1EA 4XASA 1TVMA 3QLVA 1YTUA 5FWXB 3HJFA 2F8SA 5T3YA 4QICA 2MYTA 1MIHA 2NT4A 4PEVA 3K9CA 1XHEA 4RS3A 5TQ2B 4G0MA 4H60A 2HQBA 1BDJA 1QQAA 4ZMSA 3HVRA 1JYEA 3NHMA 1CHNA 3SAJA 3SQNA 1APBA 8ABPA 3N53A 2JVKA 4IILA 4OTZA 4RY9A 3QX8A 1GCAA 4G0QA 4KK3A 4XFKA 2HQRA 3TX6A 2WJAA 4KV7A 3HDVA 2LBPA 3EQ2A 4KQCA 3OO1A 1MB0A 4OG2A 2FMHA 3LOPA 3H5IA 2NZVG 3QEKA 4G97A 3CFYA 3OM1A 2MSWA 3A10A 3OLVA 3FDFA 1ZGGA 3MYYA 3QLUC 1VKRA 3G85A 4KPYA 3M9WA 5IUJC 5JNVA 1CYEA 1M5TA 3JVIA 2DRIA 3CU5A 3EAFA 4EYKA 3IP5A 5CHYA 9ABPA 3CZCA 5EWLA 4PYRA 1JYFA 4G0XA 3ROTA 3SG0A 3M6MD 3LFTA 1F4VA 3H5VA 4JB2A 2FMIA 3B2NA 5JNSA 3HUUA 5ED4A 4YS6A 1W25A 2PUFA 4PZ0A 1EWKA 4XLTA 7ABPA 4JOQA 1R8JA 2R25B 2O20A 4RK1A 1YS7A 2H3HA 3H5TA 1A04A 2VK2A 3LUHA 3N0XA 4MR8B 3LKVA 4H3KB 4KZKA 1ZH2A 4Z4EA 2OQRA 2WRZA 1J56A 1LBHA 3N75A 1QO0A 1Z16A 2NZUG 1SD5A 4YO7A 3N6VA 2IYNA 5DCLA 3TB6A 3DGEC 4MS4A 4EUKA 1M2FA 3QK7A 2FN8A 3IPCA 1BDHA 5KQPA 5T7BA 3SM9A 1U2PA 4HNSA 5C5CA 4RKRA 4S04A 1JX6A 1NATA 5DLEA 3O2JA 1DC7A 2GX6A 1YK1A 4MPTA 4WT7A 1E2BA 2IPAB 3KS9A 4RK6A 2J48A 5KI6A 2E4YA 5IEBA 1D2AA 3C3KA 4LE0A 4RK5A 3RVPA 3MQ4A 4G0ZA 3LUKA 4Z4CA 4LX8A 3KG2A 2LP4Y 3CNBA 1JFTA 2JB9A 3OLXA 3F73A 4S05A 4UHJA 3O21A 4Q6WA 3L49A 1USGA 3TMYA 2NT3A 1E6KA 4LE2A 3DBIA 3T8YA 3LUFA 3CG0A 4M88A 1U2QA 5TPWB 5FWXA 3QLTA 5BQ3A 3IDOA 1MVOA 4N0PA 3S99A 4F3TA 4E7OA 1DBQA 2MSLA 5TQJA 3HUTA 3H6GA 5TQ2A 4OLBA 3JPWA 3H75A 1ZESA 3H5OA 4LDAA 2BGGA 3HK2A 1C4WA 5KQLA 1SXHA 4ETMA 4RDCA 4LRQA 2P4UA 2RJOA 1BDIA 1GLGA 2QVCA 3BBLA 1SXIA 4N47A 5BRJA 4MR7B 1DRKA 1EHCA 2ID9A 1QP0A 1NXWA 2H0AA 3Q15C 3M9XA 1EWTA 3MF4A 4WUTA 2FEWB 4FE4A 1A2OA 1QO0D 4Z4GA 2IPNA 3A0RB 2FEKA 3O74A 2XDYA 3TD9A 4ETIA 3A0UA 1RNLA 2V0NA 3Q7RA 3RVJA 1NY5A 2JVJA 1OXKB 3O75A 4YWHA 4MLDA 3MA0A 3C3MA 4NCBA 1ZH4A 1ABFA 2L17A 2PLNA 3F7NA 4D6XA 1XWWA 3T6KA 1K68A 4WXMA 1MB3A 3O2SB 3E3MA 3C3WA 3C97A 4F8JA 3G1WA 5KQMA 5DGCA 5FWYB 4N03A 4MQFB 2WY2D 5TE9A 2E4UA 3JTEA 5JS2A 3TO5A 3URMA 4RSMA 4MRMB 4TLLB 1JL3A 2PUAA 3OMWA 5IEJA 1KRWA 1RXIA 4NV3A 5CNJA 1TMYA 4XARA 4EYGA 1ZHHA 1QQBA 2YHAA 4JAVC 4MAAA 1JFVA 3KYJB 2FQWA 1JF8A 3GBVA 3LMKA 3MIZA 2QSJA 1PHRA 4MR8A 4H3HB 4MS1B 4NCAA 5D2CA 1JLKA 3N0WA 1CEYA 2M1ZA 1KMIY 1QP4A 4YR7A 1QMPA 2Q5CA 4MR9B 3UUGA 2IOYA 3QLVC 1YS6A 4F12A 3EULA 5I4CA 3KKEA 1L5YA 4MYRA 1Z2DA 1DCFA 1P2FA 4E7PA 4RY8A 1B00A 2PUBA 3HS3A 1JDNA 2KYRA 3LUGA 5TQ0B 5IUNC 1FSPA 5JNWA 2FVYA 3UKJA 3GT7A 4Q6BA 1S8NA 4OLAA 4KQ9A 4RY0A 4O1HA 4TMYA
chains in the Genus database with same CATH superfamily
3QPVA 1AGPA 2XMBA 1QVWA 3AFIA 3PQEA 1C8KA 1C0PA 5DGIA 5IARA 3OD1A 3OJFA 5EINA 4TLCA 3IRVA 3F6RA 1K27A 4MVJA 1LXCA 3KQVA 1UZLA 3NHLA 3HNPA 1HYHA 2C4VA 1W88B 4MWOA 1U9YA 1YQGA 2VNAA 4XB6B 2BEUA 1UT8A 2X5OA 3SF8B 1KO1A 1UJ2A 1P1FA 2UYOA 4AT1A 5HQTA 3DZJA 5IAOA 1RJ9B 1A27A 1K3FA 1OAAA 3GFSA 1WUHS 3AEKA 3ED5A 1WSWA 4UU0A 4RZ2A 4MVJP 3DC2A 5IZCC 2BDUA 2GA8A 5FFNA 1KMNA 3R9XA 4RABA 2IXFA 1MMFB 2QT1A 3NGLA 2D59A 4IOMA 2Q62A 3RC9A 4CL3A 2ACEA 1NUSA 4US2R 4ZGGA 5J58A 2Q4BA 3SX4A 4N3AA 4LIPD 4YAUA 1N6RA 4X6UA 3NOVA 1W47A 4H18A 1DC3A 2QLTA 3RNOA 4D80A 3D8UA 1BXGA 5HM6A 2IK8A 4IY1A 3G0OA 4FOOA 1HDCA 2PSFA 1JDZA 4EL0A 1TQDA 2YJTD 4CM6A 2BEWA 5GVRA 4DJFC 3ZY5A 4F11A 1NRXA 4S1VA 1E2PA 2OMKA 5MDHA 3W1WA 2VF7A 3VMMA 1CX9B 1BYIA 1HETA 2IHBA 2V7BA 1QGUB 1U8CB 2JLCA 1RYEA 2PU5A 2X22A 2YMQA 3KYBA 4KLNA 4DC1A 1J0DA 2WWVD 1MKYA 4EHAA 1ISPA 2DKFA 3DTYA 5EERA 2AOWA 2BMFA 2XZPA 3R9IA 1Z0IA 1I1OA 3L1HA 2ECFA 1OLUA 4M8NE 1EFAA 3D2LA 3E9NA 4K6KA 2XZDA 2RI1A 2W00A 1GP2A 4F9TA 2QTMA 2XAAA 3TNLA 4DA4A 2Z8XA 3AFGA 3JQBA 3SNKA 2CHFA 1NYLA 3OTOB 2VJYA 1MZPA 5FNZA 4LOJA 3PXEA 5CJ2A 1D2HA 3EA4A 4QXPA 3O8BA 4MQ5A 1GLNA 2YXEA 2RC5A 2ON6A 3IP9A 2QG4A 1RI3A 2YMMA 4LTDA 3SSNA 4EI7A 1UKBA 4PQFA 2DUNA 4DFDA 3UYKA 4DTIA 2HQOA 1G8AA 1V3UA 3QI7A 3AKEA 1PVDA 5HOEA 2F8MA 3IVXA 2HREA 5BSHA 1J8QA 3M3PA 4YEDA 2V3CC 2R8BA 4PZEA 1NC3A 4UREA 3U81A 4S1OA 4N3BA 5B1YA 5LYJB 3Q12A 2QX9A 1E5QA 2CKMA 4YLYA 3BJMA 1IZYA 2H57A 2GF2A 3C4QA 1Y48E 5CD9A 4DB4A 2FPIB 4HDCA 1OTHA 1K6MA 2DYKA 4C01A 2HHLA 5DNWA 1ULBA 2F62A 2V58A 1ZOOA 2WJZB 3GMIA 2FMUA 1YR6A 5DN6A 1X6VA 1L5SA 2V8BA 1K4MA 1XVTA 3Q3IA 4LGYA 5KDOA 2P5SA 1P0CA 1T4DA 2IKSA 2SICE 2VQDA 3CISA 1A50B 4G25A 4ME6A 1CPYA 3ETDA 1SFRA 3WADA 4EY3A 3BG5A 2OGZA 1YMVA 2IIPA 4I5DA 4TRRA 1N5LA 3VQTA 2F3TA 4Q1CA 4A0GA 4Q3AA 3I8SA 3KB2A 4TROA 4ZD6A 3O93A 3OTIA 3ISTA 4IRXA 4KNVA 2VTDA 5F1YA 3JTMA 1OASA 2OAGA 3KU4A 5H3CA 4YYEA 1W88A 3AIKA 4KCGA 3SF8A 4CG1A 3GFTA 1NTRA 3A6KA 1RJ9A 3EFBA 4HPXB 4X64B 2YFKA 1Z74A 5ALIA 3AR2A 5MGBA 3THRA 3FB1A 2B7CA 4XDGA 2R8OA 5DCYA 4BO4A 1WBDA 4U6SA 2A9OA 1JHRA 4ZQFA 4NR0A 5CDYA 3GRCA 4OGGA 4PHTA 4DUGD 3MJEA 4GI1A 1M5UA 1QWOA 1NXVA 2OB2A 5CLIA 5K8JB 3K30A 3WG9A 3IFSA 3MXTA 3SX2A 2EP7A 3RKSA 1QS0B 3K2EA 1XROA 3FTNA 3IVRA 5CLLA 4Z9BA 3HEBA 1IIBA 1DZIA 2QMHA 3LY5A 1DX9A 2B8EA 3AF2A 2Q50A 4KKXB 1PR6A 1TUBB 4RJIA 3RE1A 1KR2A 3AFNA 3N0RA 4ND6A 3HXKA 1QTIA 1YFJA 3CWZA 1CBUA 3JQPA 2YHBA 4W1RA 5JJBA 1QGUA 2RIRA 3FGOA 3P4YA 5CA0F 4GZLA 3TZQA 3GFOA 4UOEA 2BDEA 4AY3A 2V59A 5JISA 3BORA 1OFUX 3PWZA 4W5NA 4ZEMA 1NW3A 3L7CA 4JOCA 4ZYLA 5AIBA 1AKWA 3K05A 2J0VA 5DTJA 2G07A 1Y8QB 1IUNA 1WW2A 1CYDA 3A4IA 4P34A 4QPJC 2Z6AA 1XD2B 1JLLB 1O8BA 1ZMTA 3RIMA 4KYIB 3O91A 4NBNA 5ENDA 4AJ2A 4AMYA 1G8KA 1PD1A 4R31A 2CHUA 3CEHA 1GEEA 1XA0A 3GLGE 4OQLA 2W9XA 2BF7A 1E79D 4X54A 4BLSA 3B1ZA 1X7DA 1G9SA 4CUJA 1MPXA 3BH0A 1NONA 3GJ6A 1V45E 3F67A 3RD5A 2MDTA 1NYTA 3LQQA 4CLEA 3ZD6A 4IDAA 3I6ZA 3EF0A 3T15A 5FPKA 3AVWA 3MVEA 2YYZA 1MO2A 3A3OA 3CV3A 2WWTA 4JOSA 4ZU6X 4MGIR 4JLDA 4EZBA 4MPRA 3CR8A 5LYJA 1T29A 1RKVA 3N0VA 2MSCB 4XIGS 1GDHA 4Z51A 2JLQA 4BUCA 4R84A 1UDRA 3LWDA 4CF6A 1YRLA 5LDDC 4N3NA 2FPIA 3KOYA 5LZ8A 1OZHA 3RO7A 2LTAA 2Z9CA 4P5DA 3M33A 2QUBA 3LU1A 2NU9B 3ZLUA 2AG5A 2W90A 3NRBA 4UTVA 3R7SA 2QZSA 2ZUWA 2R47A 3H1GA 5IHXA 1GM5A 2NV0A 2V4UA 3TSZA 2ZSDA 3VHXB 4IJWA 4A5OA 1IXZA 1C9JA 1CS0B 3AR6A 5IMSA 1DIAA 1LTQA 5EWLB 4C7XA 4KL8S 2HK6A 3WMFA 4IIXA 1EVYA 1WULS 2YRWA 4MWCA 5HDQA 5A4MS 3Q9SA 1T3LA 4EZEA 3F47A 4JJFA 2VSOA 3T38A 4E11A 1EB8A 1SOVA 4ZO6A 5G0VA 5KYWB 1Q7RA 2VP3A 4QQ8A 1OH5A 4G23A 2QB5A 1U9IC 3HP7A 4FGSA 2AEMA 1AZTA 4HKTA 4DZRA 2JJ2D 2FZLA 1P2UA 2CLFB 3E5MA 4I0WB 4C0LA 2X86A 4URFA 5GJBA 3FF1A 1AC5A 1W4CA 2EW2A 2Z83A 3DZDA 1QM5A 2C8KA 2CLDX 1E2MA 1Y3CE 3HDGA 3N8DA 4YUWA 5ADHA 3PLAE 1WNFA 1CJTC 1A97A 1E8MA 1CY6A 2PEZA 2F7SA 1Y1SA 2R6FA 4MKXA 1U4SA 5GJCA 1RJGA 4WUVA 3WAGA 2AEJA 3GEIA 4MS4B 1YZVA 2XIQA 2WEKA 4LISA 1MAAA 1QS0A 3F6PA 1DXQA 2C0QA 2VK8A 3G6WA 5AM2A 1QZTA 1VA5A 3IBGA 2F17A 4LRTB 5HEKA 5GM1A 2ZSIA 3CLKA 3O3MB 3LQ2A 3OLZA 1TUBA 3UJDA 3FOBA 4IVRA 3TZ6A 1TTTA 4LYGA 3B6ZA 3ZQKA 3IQGX 4LYDA 5L95A 1HKUA 4MWBA 3QFTA 4ZEOA 1H1LB 4C0AC 1PG5A 3PYXA 3BMCB 2VDOB 3BGWA 2X9VA 1VLQA 1AQ6A 3QH4A 4IJVA 3LSTA 2QR2A 3DAYA 1XEXB 1F0KA 1OWOA 4I99A 1EFUA 1R4MB 5KTYA 3TM5A 1M8GA 3EMBA 1Y8QA 2W2KB 1JQ5A 1O7JA 1H0HA 1IE3A 1XD2A 2GF9A 1JLLA 2XA9A 5ALQA 4B09A 4DMCA 7AT1A 4DLLA 5A9TA 1E6CA 3QLVA 3PFFA 4HH4A 1P2GA 3TQQA 1I0ZA 5DHQA 3N8HA 1JALA 1FBTA 1JEDA 2I8CA 1XELA 4Q9NA 1EG7A 2YY7A 1KL7A 1EJ6A 3OSUA 3DL7A 5DNAA 3AH8A 5JXHA 1NVWQ 2BM0A 5KYVA 2CJYA 3LRXA 4HXGA 4HZGA 3M34A 4ZMSA 2ZUDA 3PQCA 3ORRA 4PRLA 4UDXX 3E0QA 1X94A 3SQNA 2PXXA 4BBAA 1AVTA 1APBA 3R6LA 1G6HA 2CYAA 2JD0A 4UAVA 3QX8A 1GCAA 1TKAA 1WR8A 3LT2A 1U2ZA 2B37A 3TX6A 3QNUA 4WV3A 1EHYA 5ALKA 9MHTA 4F4FA 1X0VA 3T7JA 1VKZA 4TV8B 3W7AA 1OWMA 4V0LA 6LDHA 5I7VA 1I9CA 3GLIE 2EFDB 1I1HA 4UHHA 2NU9A 1MOQA 3BSFA 5FWDA 5GOZA 2DKOA 4AZ0B 4URUR 2PGJA 4A2QA 5F77A 3K4PA 4P82A 1SHKA 1THZA 4NPAA 2FF7A 5EJ4A 3VJRA 3VHXA 2FFAA 5FI0B 1IUPA 5K2MA 5BR8B 2DWCA 3PWKA 1CS0A 3RVDA 2FCAA 3CZCA 4Q4DA 3VDQA 1XZHA 2P3SA 4LJ5A 2R68A 3EQ6A 3FCCA 1N2IA 3GEHA 3L7AA 5EWLA 4KOEC 3ZE1B 1RADA 5LCXA 1UFOA 3G5LA 4F9GA 4JB2A 2TMDA 4DR6B 2H1CA 3FTQA 4HWRA 1GYPA 3CW9A 1X1AA 5FWAA 4RZXA 5HM8A 5KYWA 3A26A 2AQKA 5ALFA 5LQKA 4WA7A 4OH7A 1UWLA 4X24A 3KWMA 4DYVA 4NCIA 4OL0A 1NFQA 1NHWA 4QT0A 3QIVA 2XOKA 4BO9A 1BEZA 3UMYA 5MGNA 5NLLA 3MTDA 3TGLA 2W4MA 4WK6A 3UMBA 1GL9B 2XUPA 2CVQA 5KEIA 1B6TA 1J9EA 1ZMXA 4JT9A 1KYYA 4PZYA 4TVOA 2WTNA 4LVUA 2CNLA 4I46A 4MWTA 4MS4A 4Y9RA 4FCWA 3WL6A 5JIBA 4TZ6A 2OT3B 3ODPA 5DP1A 2B1QA 2Y66A 5JD4A 2ONYA 2Y99A 4HNSA 1N5MA 4RF2A 3EOBI 5DT2A 1I5OA 3ZTTA 5I7AA 3O2JA 4N7JA 1DC7A 2GX6A 1E1RA 1NMQA 2YV2A 5CFNA 1ZRSA 2H0QA 2QP4A 1H1LA 4EM6A 3A1NA 3BMCA 3DO8A 4KXYA 1D8TA 1ZXXA 2YNMA 2D13A 4QGFA 4TYNA 3JZDA 5D3ZA 2AG8A 2JGDB 4B5KA 2X1HA 4RMJA 2DY1A 1XEXA 4HP8A 5T57A 3KG2A 3OFVA 1R4MA 2GN1A 2H18A 3ANSA 3KOUA 3LD9A 3QYPA 2Q3MA 5AKEA 5DISB 5JWOA 1S01A 3CEAA 3LA6A 3BKWA 2W2KA 4JI2B 3OJWA 2A33A 1QKJA 3TMYA 1Z28A 3X2SA 1LZKA 2YWDA 2JLRA 4U2BA 2O8FB 1UAGA 1O54A 5FNVF 4YC7A 5A4DA 4FLFA 3VZCA 1G4UR 2IYEA 4BV2A 4Y1RB 1WE2A 4TT3D 4P5PA 5BNWA 3F97A 4JLPA 1I7SB 4BKUA 3OZRA 1U7WA 4GYYA 3RAPR 1FP7A 4G4JA 3VDXA 1ZD8A 2C0CA 4UKDA 4RH1A 2GVDC 2YZKA 3VBEA 1NV8A 2ZVPX 1VI5A 2Y1WA 3J7AC 1O9GA 1BDIA 1Z08A 1NOIA 3D6NB 3U7FB 2R44A 3RRFA 1NQVA 2XE8A 1XTBA 5BRJA 4I4LA 3BRWA 3DE7X 3L0DA 4PBSA 4BO5A 1XGKA 5AI0A 4JDUA 3DUFB 1FEZA 1XG5A 3EMKA 3RS0A 1QTRA 2YWXA 2Z98A 3COWA 4IEFB 4KO4S 4TV8A 4ZQBA 1ZJZA 4E0BA 3PTLA 1QHHB 2PS9A 1AT1A 1DQSA 4AJIA 2FEKA 1XZFA 4O3FA 3TI7A 5KSWB 2NU6B 3EB9A 1RNLA 3M5WA 5AP9A 4AZ0A 2O8CB 4QTYA 2NZXA 4EW3A 5B1DA 1Y37A 5JCJD 1ABFA 2CCJA 3KQWA 3R3VA 4JK3A 4KQIA 2PZAA 4JC8A 1G0OA 1CJBA 1LDEA 3T6KA 4F5DA 3SJ7A 3SFZA 3TQFA 2J09A 2OG2A 2Y2UA 1VHWA 4R69A 1BGWA 4GSLA 4QOHA 4P4NA 2ZJBA 4LJ7A 1RYHA 1BX3A 1QF7A 5SICE 2HL6A 3ZGOA 1M34E 3S4YA 1LDYA 1Q2XA 4GI5A 5JEEA 4GVLA 1DQYA 2BGIA 2Y9PB 5SYNA 4JAVC 5HKBA 4Q1EA 3P0EA 4GMDA 4H9GA 4WGFA 4R4JA 1O5TA 3ZWVA 5CD1A 3TRJA 1DKUA 3CIFA 2HUPA 3TRIA 4CJXA 4D56A 3CO5A 1ZOIA 2M1ZA 3QKRB 1NVVQ 3PP8A 3NANA 4GGPA 5IS2A 1U0OC 4MUKA 2MINB 5ADWA 2KSQA 5L9AA 2WIAA 3CBQA 1Z2DA 1QIFA 5TMEA 5AW9A 3A9VA 3QJGA 1QH9A 2AV6A 4B6FA 4KDFA 1JKMA 2FX2A 3DEYX 4INZA 3WTBA 1J0EA 1GFWA 3MJCA 4KAJA 3AL3A 2PL3A 4AO7A 3QG1A 4QLOA 4I55B 3WQHA 1SC3A 2QJFA 4DLWA 2JGDA 2AR0A 1NJ1A 2WHXA 3G7NA 4HNTA 4R2MA 2QA5A 2Y71A 1LBSA 2Z1NA 4FN5A 4CHGA 5JJ5A 2Q3EA 3JRWA 2PH5A 1JLRA 3Q72A 5TC4A 4ZMBA 5DPMA 1LWNA 3G9UA 3OOJA 5HP4A 1R8QA 3QITA 1V4NA 2O8FA 4GKVA 4KQ2A 3WLOA 4CT0A 1KOLA 4RVCA 2IS4A 2BGJA 1VKOA 2FMTA 3CNOA 4Z4QA 1NBAA 2QLBA 3AF3A 4Y1RA 3SX0A 4ZVTA 3QU9A 5DVZA 4TVKA 2J5QA 3DMPA 1A2KC 2H5EA 1NUTA 1SC4A 3V1TC 4E5PA 4OA8A 5IFKA 2GAFA 2PUCA 4JJ7A 1XZJA 4ZEVA 4CETA 5BYJA 4RNDB 4Y6OA 4YREA 3AI3A 3RSFA 4BVHA 4G1EB 1IG0A 1V8FA 3CZPA 2FSVA 4GRDA 2O5VA 4UQLA 5EIXA 1XALA 3NMUF 1KY3A 1OKKD 4IBOA 2G9NA 2ZKLA 4L85A 2A2ZA 2ADMA 3NAGA 1D6JA 1P2SA 3H8JA 4FKBA 2EKBA 3DUFA 2OCKA 4O2BF 1ZH6A 2QAGC 4NTZA 3AWIA 3R0QA 1QHHA 2H0RA 1G2QA 2OFPA 5EWJB 3RIHA 4DIKA 1SH7A 2NU6A 2V74B 3GRYA 3HDHA 4DIDA 2O8CA 4YRCA 4F93B 3X1KA 1ZM2A 3UPDA 3C1AA 5T64A 3PJDA 1RLIA 4RANA 4MA0A 2P1RA 3FKJA 5BRAA 2V45A 3KKLA 1F2VA 4IQ8A 2NO0A 1QJ4A 1EE1A 3GT0A 4KXUA 4P0PB 5A0TA 1H2EA 3QE2A 2V1XA 2IV7A 3TJZA 1YQWA 4INPA 4ZPXA 1JDJA 3TZLA 2EU8A 1AUOA 1XMXA 2I0FA 1MHPA 1ORRA 2E18A 3BAFA 4B8WA 3PD7A 4BUZA 3C7DB 1R0ZA 3CEPB 3HY4A 3OJLA 2VCEA 1DEOA 5E2BA 2ZRAA 1STOA 1SUFA 5TGTA 3DONA 5EP4A 3OCXA 4EX7A 3BCUA 3NIGB 4CV0A 1U2DA 4BE9A 1CCWA 2HMYB 2ZYIA 4YWJA 2OILA 4JSYA 3R77A 4Z9AA 3ESBA 3E61A 2PRSA 3QKRA 1NXOA 4KXLA 1YJ8A 1E3IA 3RHFA 1HEYA 2WI8A 4G37A 2I2WA 2DVMA 3MTJA 2YBEA 4JH0A 5HG0A 5LUBA 5IDWA 1XPRA 2MINA 4I50A 2JFGA 4KLRA 2JLVA 4BQRA 4PYNA 3KZVA 3AR8A 3U7EB 4EJSC 3RG2A 3IBSA 4C4SA 1MQ8B 4RULA 2HN9A 2FWRA 2ZRHA 1VM6A 3IP7A 4M36A 2G9RA 3UK0A 4BC1A 1KEKA 1N0VC 4K9LA 1TO6A 3QVOA 4DDWA 2FV8A 3LCVB 3UMMA 4I55A 2PT7A 1FFCA 4L73A 1A3CA 1QZUA 5TY0A 3GLFE 5J2UB 4X60A 5DHUA 2CL7X 1RXYA 2JL1A 4EY4A 4Z2AA 2WJPA 3OQMA 3U48A 1TM1E 4OGKA 4ZZ2A 1DQZA 3SKVA 3T34A 3WGTA 1P17A 2AKEA 2EL9A 5BT8A 4L9SA 2AXPA 2XSZA 1MW9X 4J1QA 3SLRA 5FPPA 2MYPA 2PUGA 3ELDA 4CODB 5A1TA 4C4ZA 2YWRA 2EBUA 3IEPA 4LY6A 3ZD9A 2RI6A 3U4MA 4PF1A 2WQZA 2PMCA 3NT2A 4KH0A 2AD5A 2LR0A 2Z2KA 3EJ6A 2JAWA 4MRNA 3MS2A 3WQSB 4C0SA 4CTMA 1YZHA 2GN0A 2C04A 3AR4A 2WUVA 4BWYA 1KHTA 1DC8A 3EQZA 1XHFA 3ME5A 3WLFA 3L4SO 3Q8MA 2RAVA 1FS5A 1MF7A 3H18A 3LS2A 5KOJB 5LUAA 3OZUA 1QFYA 2PBLA 3MTQA 3RVLA 1U0JA 1BKSB 2EBFX 1Y4AE 3JQAD 3DLTA 4HOYA 1ZZEA 4P7GA 1JHMA 3ABIA 1MQAA 3ZK9A 2Y1FA 3KPUA 4ACBA 4Y2TA 3VJLA 1ULSA 3WYNA 4DLZA 3AP1A 2NVUA 1JEAA 1KPIA 5EWJA 5JS6A 1I4DD 5T67A 4EVRA 2AG0A 1TVCA 2P3OA 2VDWB 2G6TA 5HW0A 2AWNA 3OTHA 4BV8A 1PUIA 1A9ZA 2XUKA 5TF4A 5LIPA 5DHFA 5IT5A 1QQ5A 2OM2A 3C74A 5H16A 2ZR7A 5B4UA 2H6EA 1E8DA 2V7QA 1E2EA 2WT4A 3ORSA 2NAPA 5G41A 1YRBA 2WP0A 3CN9A 5TEVA 1QFJA 5I5EA 1AQJA 1C8BA 2EC5A 3F6SA 1O1YA 3IAAA 4KDEA 2FPRA 4UFOA 4M2LA 3VKWA 1EVQA 1Z22A 2MSKA 4J2HA 3G7SA 4TX1A 4QYMA 1NPYA 4L15A 4LBWA 2VPIA 4JB3A 1XSEA 3PL1A 1NR7A 4F3YA 1FNNA 2Z2XA 3F4LA 1QAMA 1T5HX 3GFPA 2PR2A 1M0WA 4X6XA 2B4QA 2C77A 4OPMA 4QLAA 1UP6A 1BOOA 3EF1A 4U7JA 4JKOA 5PNTA 3VU0A 1NVDA 3T7TA 2C0PA 2IP2A 3ZOKA 2GEJA 2I7CA 1YE3A 3A27A 4RIIA 3LPLA 5F7OA 3LYUA 5CNMA 2VJDA 3L6DA 2AIRA 3WIOA 1UJNA 1ONBA 4IHAA 2PL9A 5SV2A 3T94A 3HVJA 3WL8A 4KIJA 4B6RA 1MEOA 3ZDRA 2HRQA 2WA2A 1LH0A 4D9IA 2O3SA 2CMGA 3MLAA 1DWPA 1FS4A 2OHXA 4UMDA 1EUYA 3OU2A 5FOVA 4C0QC 3JS5A 2FN7A 3D8BA 4OM8A 1USVA 5KINB 3L8HA 3IQIX 4ER5A 1VXRA 5DFAA 2JLSA 4PFQA 3KZMA 4ZPJA 1GSAA 3NXSA 2ZYGA 4G0YA 4Q7LA 4EB0A 5IT0A 2GZRA 2WYIA 4IX9A 1Y1TA 4EFNA 4PS0A 3PUKA 3ANYB 3CJRA 3AL0C 4BNUA 1FMFA 2BCGY 2C5AA 2VTBB 4H16A 1FJ2A 5EJ2A 1JAZA 1I0IA 3QW2A 3L9XA 3PR3A 1RLJA 3F9IA 1VGQA 2ANBA 1C8LA 3A1VA 4JLOA 4MDHA 4EG5A 5HSGA 3GLHB 4XVHA 3TINA 3V4SA 4FYWA 4M37A 2V96A 3X1JA 4XEHA 3OPYB 4HXFB 4OK5A 1HH4A 4XJSA 4E1BA 1XJ5A 5CURA 1WQ3A 4BNKA 3WO1A 5KVCA 1OTXA 1MVLA 2B4AA 3F6EX 4ER7A 4J0GA 1YS2X 4UAUA 2C84A 3UAZA 4B9EA 3GWGA 4I4CA 5KOJA 4O2RA 1TZMA 1GDDA 6REQB 2YYSA 2VYND 3JQDA 4FYVA 4KR2A 1PZNA 3CKMA 2WAXA 1ORTA 3N3AC 2XE6A 4FK8A 3K3PA 2W2PA 4YV2A 1V5GA 3QY9A 4K9NA 3EIEA 3UWMA 1ULTA 5CA0B 3ML1A 3W2IA 3PQ7A 3ISJA 2XBUA 3I4CA 5C51B 2VDWA 5M5BA 1IY2A 3CJTA 3FYUB 2HHAA 2ZWPA 1U8UA 4E4TA 4ZN6A 4YGXB 5E6SB 3HKDB 1LS1A 4D5EA 5C4IA 1MHTA 1FFHA 1RWPA 2I29A 3T9CA 3GYBA 4BX0A 5TJ9A 2BN4A 1UKVY 2KBFA 1TTPB 2JD2A 4P35A 4BFSA 3KKPA 3X1WA 2R0QC 1ZI9A 4AO8A 4E07A 1XZDA 2HLNA 2JIQA 2HMVA 3UT6A 3V4VB 4D92A 1Y5LA 1JIJA 2V54A 2ID8A 2P30A 4GQIA 1JT9A 3B53X 1RRFA 2GPJA 2V6JA 2J4CA 4N48A 4E6EA 3GHHA 3DM5A 2VHWA 3EISA 1VMAA 1IY8A 5TGDA 3OHPA 4D42A 5A2GA 3TDKA 1SU4A 3CLUD 4WNAB 3W79A 3FBGA 1G5QA 1VDMA 1YFZA 2DFPA 2QYHA 4YROA 2XWQA 4B2YA 2G5GX 4YDHB 3BD8A 1Q1BA 5FV4A 4WLFA 3RC8A 5H8WA 1LCIA 1TT7A 4WINA 3W05A 5GZ1A 1KZ9A 4XGKA 3LJKA 3UPUA 1XT6A 2P9QA 1X1SA 4RY9A 4N3GA 3GUHA 1XL0A 3RBVA 1X1DA 2F1HA 3W2EA 2O8DB 2FP4B 4DKXA 4I8XA 5TLSA 1SBYA 2FN4A 2V6BA 3D8HA 1Z2PX 3HI4A 1RMTA 1UDWA 3IEIA 3MFQA 2OLJA 3H5IA 3PLNA 1KMHB 2ZBVA 4L5BA 3DDWA 2P9CA 1I0LA 5IASA 4FPXA 2C5EA 2PTGA 4Q3DA 3O82A 2CHGA 3OM1A 2V5VA 2DFNA 2OVBA 4YUZA 3HNOA 3L77A 3P5SA 4GYWA 3VHQA 2IUEA 3Q2KA 4JL5A 2JIDA 2B1GA 1ULHA 1DE0A 3LVFO 3JVIA 4K87A 3EAFA 4AZ3B 1T9GS 1IXYA 3LI2A 4CG2A 3E81A 3A6GA 3KE8A 3L40A 2WKQA 1YIDA 1HRDA 4FM9A 2RGEA 1GPWB 1MZVA 3B7GA 1US8B 1P0MA 3GJTA 1HSZA 3I2GA 2QM3A 3B8EA 2H2AA 3H05A 3IULA 5JNSA 3HUUA 2VTBA 3F2IA 3TDMA 2ZWIA 1UIRA 3CNQS 1IUOA 1ZIOA 4IQFA 2EQAA 2FA9A 3GLHA 2E85A 4U00A 2GJ8A 2O8EB 5HF5A 4BDSA 4BPBA 1SOUA 3G8AA 2O20A 1Q12A 1IK4A 1N2JA 2H3HA 3R3SA 4LS3A 1T43A 1P5RA 4S1NA 4QUDA 2H4YA 3QM1A 3WYFA 1LW6E 4Z4EA 2YVLA 4NCHA 4P4UA 1X8XA 3W7VA 2KQUA 2NVOA 2XJ9A 4A8JC 2HDOA 1TIPA 4IPTA 5EJ5A 4MHSA 4PXYA 6REQA 2IZZA 2I87A 2AFHE 4YO7A 5TB5A 3PUIA 3ZDAA 3CKKA 3DS8A 3CVOA 3L1IA 1RQRA 4UE6A 2PQMA 1KA9H 3STTA 1P75A 1GAWA 3DA8A 5DHRA 5D5PA 3WBBA 2B30A 3KKNA 3AB8A 2W5UA 2X7HA 4LXYA 4PHGA 5CA0A 5IJ0B 1YVRA 1UZAA 1KQGA 2VP6A 3NOXA 3PVCA 1W4LA 2AKYA 2Y0PA 3FYUA 4H0FA 3L0YA 3A8TA 3OBBA 2O2GA 4OSPA 5E6SA 1E2BA 3HKDA 3BHIA 1BX0A 3GJXC 5B36A 3OFJA 3E5NA 5BQXA 2FPUA 3QF4B 5DNVA 4LYEA 2ALJA 3K0CA 4U9UA 1QRTA 2Q2VA 1ZP6A 1QTQA 3Q5EA 3W7BA 5AXBA 4IIJB 1GILA 2GVZC 3L0ZA 4BMDA 1IL0A 1IHXA 1ACMA 2HO5A 2X3YA 5DNEA 5A3VA 2WZQA 1J7JA 3O26A 4J4HA 4KJZA 4DANA 3QJYA 3G5AA 3R5TA 4AJNA 2CBZA 2QUZA 4RORA 4FR2A 1NKSA 4E7OA 1JG7A 1D09A 2OY0A 3G17A 4WNAA 2WK1A 4ZZ3A 2KW5A 1DG3A 5J9FA 3PBKA 1WHTB 1ZESA 2E87A 3LFHA 3H5OA 1HNWB 2QJRA 3DDNA 4HQNA 4WZBB 3HK2A 1B43A 3H4MA 1QV7A 2P4UA 1LDMA 4LRQA 1MC5A 5DJ5A 3UW3A 3W5HA 4H7IA 3EEBA 2B8WA 3QXHA 2EGHA 3TK1A 2P0YA 3WLPA 4E4YA 4M1QA 4O4IB 4PYJA 2O8DA 3V32A 2FP4A 4GOMD 4ZQHA 3TLYA 3WMGA 1CRWG 3X0DA 4YCAA 1QRDA 3T3PB 2OHOA 1KMHA 1EDZA 2EG9A 2XEDA 3GLSA 3OZFA 4R2KA 4X84A 5IT9A 3CRW1 1AUPA 2AZMA 5EHNA 4LHXA 2OBFA 1J1IA 2VHZA 4ALKA 1J1ZA 4RCYA 3PWSA 3RSGA 2MR6A 4DMKA 4Q7KA 1V8DA 3CGWA 2OYCA 4YRKA 4GL2A 4RPKA 4UTOA 1GGNA 4FEYA 3L46A 4AZ3A 1XLTC 5L4SA 3FETA 4MYSA 1NLMA 2C9MA 1K68A 5ETJA 5JLJA 2GUWA 3EVFA 3SVTA 3E3MA 2W8ZA 1Z0AA 1SVKA 4IIVA 3RLFA 5DGCA 3SE7A 1AMOA 3PQ6A 2O59A 2ZI6A 2QLLA 1US8A 2NOAA 2BHSA 1U2RA 3UM9A 3ZCTA 2O2EA 2AOVA 1VLMA 3F8SA 4TLLB 1CUUA 1Q84A 2NZ8A 2O7VA 3GC6A 2MU1A 4LJ8A 3RBXA 3AERB 5HZHA 2XQJA 1UXHA 3A1EA 4AX8A 1YZFA 4DCSA 4JNCA 2EWMA 1XJQA 2EEPA 1U8YA 3VNQA 4CMEC 2O8EA 1E7YA 2H08A 3HB0A 4Q4HB 5AXDA 4CHTA 1JFVA 1DFGA 3DVAB 1VYUA 3UOWA 2DERA 4B7UA 2QSJA 1TK3A 3G88A 4H3HB 4GM1A 5FHQA 3RF6A 1RP1A 3BYZA 2IUTA 3KHUA 1VYHA 2JJMA 4PTLA 4JP3A 3HPRA 1HXHA 4IDPA 3VR5A 4L5CA 3RANA 5FI1B 4AJ9A 1S9HA 2YFHA 3NJ4A 2HRDA 1V4VA 3QW4B 4KAAA 3RUFA 4HL6A 4RHXA 1TFUA 4JUFA 5B58C 3TSWA 2M6SA 2CNDA 4IQ0A 5CFZA 1KYWA 1R6TA 2XUJA 4M0PA 4F12A 3ICOA 5JAPA 1EQAA 1X3SA 5JW6A 3KKEA 5IJ0A 4AS2A 2IBSA 1FDVA 1PQYA 3QV2A 4LJAA 4LBZA 3I30X 1EAMA 1X1TA 1YJXA 2BEJA 2IKQA 3R0IA 4XYGA 3P2JA 3BT7A 2YR0A 3IR7A 5K01A 5KSOA 1ZICA 2VJNA 1WZNA 3IUYA 1JQBA 4W5JA 1RSZA 5DNUA 3P9QA 4IJ6A 3HABA 3QF4A 4RY0A 5KSPA 4G0WA 4A36A 1BC5A 1SBZA 2A4MA 2J0QA 1Y63A 5FNVB 1I3LA 2QY6A 4IIJA 4TKLA 5AHKA 1C3EA 4G89A 1EGAA 3QWBA 2AMFA 3CUWA 1G0NA 4LF5B 2C95A 1VL1A 3WQQA 5KVVA 3P4UA 3I01A 5DGDA 3BJIC 2GZ2A 4J16A 4LY0A 4UHFA 1S2NA 2YY6A 3I6QA 3DLIA 2N3ZA 3WYAA 2ZBUA 3GCZA 3MWJA 1U98A 5LZ2A 5DK6A 1WHTA 1XRMA 1PFKA 2PO5A 5FORA 1EWVA 1PS8A 3ET4A 3WQBA 4WZBA 4CMBA 1I3NA 1NT4A 4TZKA 4C07A 4DWOA 2OXEA 2JGEA 5F7JA 1DI0A 2V6MA 4J03A 3UJ8A 4PCVA 4MPJA 5EMNA 4Q9KA 3VH4A 4DQLA 1QU3A 1K66A 3GEEA 4WA8A 3S2IA 2GRAA 5LZ9A 1YONA 4O4IA 1ZSVA 2B92A 2CDAA 5EEHA 3GNQA 4OJKA 1EGHA 2PAAA 4D0NA 4UPVA 1PKEA 5LN1A 2AFIE 1L1EA 4PVDA 3RVKA 3NP7A 3UTDA 4EJ0A 2XXJA 4I2VA 4HB3A 1LLCA 1OIWA 4FJ2A 4PS1A 4J1TC 5J4LA 3PQ8A 3QMWA 1ZU4A 1JV2B 4X7MA 1XRLA 4L76A 1E6EA 2J9FB 3KYDB 3L8MA 4DRZA 1MB4A 3H0EA 4ED9A 5ERYA 4QNRA 1T10A 1ZRMA 1AS3A 2D0PB 4MMXB 5COAA 1BROA 3QPWA 3T5AA 3IAFA 4X20B 2A6PA 4KIWA 4ZEXA 5BY2A 5LKAA 1T8RA 1DTSA 4DDVA 1H6AA 1RLUA 2V9CA 1DCMA 2WWWA 3DBLB 3IP8A 5DSZA 5EXTA 4A10A 2NZWA 4X71A 3AERA 4CM4B 4UPEA 2G0AA 1W5AA 4E14A 4BRWA 4B81A 1Q92A 4JGIA 2G1JA 1H4TA 4Q4HA 3OU6A 4J0QA 3DVAA 1H6CA 5TIIA 1SCKA 4TTVA 1ODFA 4GMFA 3VV2A 1F20A 3GHYA 2QTRA 3FDXA 4GX2A 4LMBA 4OHMA 3PI7A 1IUKA 2GJ9A 3OO0A 4ZODA 1NXQA 3FW1A 4C7BA 3C48A 4KE8A 3L0IB 4EELA 3I45A 3LTEA 3CLTC 1UBMS 3RUPA 3ZGZA 3H2SA 4KFSA 5A05A 3U0VA 4NF2A 4AP9A 5GONF 3K9GA 3E9CA 4QGBA 1F06A 4BX3A 1NGSA 1O97D 1KYVA 2ISQA 2WVAA 3C7CB 3QLJA 4KBGA 4JSRA 4MAFA 4GVXA 5HMLA 3WKCA 3FZQA 4AN1A 1Z5GA 3ZHTA 2WMYA 2G5TA 3UB2A 3UJPA 2P1ZA 3OEED 3UAXA 3GV0A 3CZ9A 4L5YA 2ATVA 2GQ0A 5CDSA 1BVUA 5JCZA 4MLPA 1BRMA 3UWSA 1B1AA 1DDOA 3TIFA 3AO0B 3VPDA 3HV0A 5ES4B 5L6MB 3A6JA 1Z07A 2UZIR 2XI4A 5K8UA 3IIJA 2CVPA 3QWHA 1G2OA 1HMPA 2WIJA 4K40A 4YJ2F 1RC0A 1E6MA 1B42A 1WUJS 2GAOA 1M67A 3C8ZA 3EXAA 3KR2A 4GRAA 3EIFA 5FNVA 3SMVA 5EAIA 2V9ZA 2QZ4A 2J0SA 4DYHA 4FTWA 1XKTA 3ZCXA 1WETA 4BATA 1FDTA 5IMBA 4CCYB 1KK3A 5KQGA 4AUMA 1YO6A 2V7EA 3OG9A 2WKWA 2IHZA 2NO9A 2Z4RA 3CMMA 2VHVA 3I3SR 4GQAA 4YRLA 1ZGBA 1ZN9A 4NKRA 1KVRA 1UANA 1W5FA 4QELA 4RS4A 3NHWA 1XBTA 1XRNA 2I33A 3A4TA 4BMSA 4MVCA 1PJSA 1U1IA 4B80A 1SM4A 4YI5A 1O6ZA 2GHRA 3ZJ5A 3HU2A 2SKEA 5KC9A 3T35A 2OHHA 2CV1A 4RETA 4PSDA 1W36D 2AHOA 3GF4A 4XWGA 3QLUA 3HBFA 4OFBA 2POCA 3SZOA 3WMXA 3L0PA 3UXEA 4BO0A 2FEAA 4UVDA 4IVNA 2FTKE 2A0FA 2NIPA 3I1JA 1PT5A 3R7NA 1IIRA 3JXEA 2QPLA 4JENA 2QX7A 3ZU4A 1P33A 4BGDA 1FUEA 3MTEA 4F2GA 5LP1A 2PU7A 2RCNA 2PZEA 3MCAA 1EDEA 3SQDA 1BEEA 1TO2E 3QELB 1N2XA 3ESRA 4YRBA 1GZ7A 1Y8RB 4G0OA 4AROA 2J9FA 3KYDA 3RS3A 1CEEA 5CYPA 3G89A 1L2TA 1SC1A 2EERA 3B13B 4PCLA 3B38A 4TGLA 4KVGA 1NURA 2A14A 5SZKB 3WL7A 3TIXB 2WNHA 4X20A 1N6NA 4HAYA 3DMTA 2XYRA 4RL6A 1EQ2A 1ZD4A 3LZCA 1GT91 2EHDA 2X6QA 3DBLA 4MWDA 1HG0A 4V0ME 5L3ZA 1OFHA 3TQSA 4CM4A 1CJSA 1D2EA 1KMMA 1CY0A 4QC2A 3UCEA 3I2JA 2G7MC 1B3RA 3CPJB 4UHEA 3T52A 4DM3A 1F38A 2FR8C 2ZWAA 3HSYA 4QHYA 2G6BA 3RCBA 3G0BA 3RFUA 3TEFA 1QPZA 4X7BA 5DM4A 1L5NA 1RHMA 5KC8A 3GPIA 5GTDA 1CNFA 2DF8A 3GCGA 3ENVA 3G1UA 3NWOA 2E4AA 2CXNA 2Q99A 3ZNQA 1P0IA 4KTTE 5KZMB 1ZLXA 4ZC8A 3P9XA 3NBMA 2GARA 2PBZA 1XLVA 2EZUA 1MJNA 2RH4A 3HR8A 5CT5A 2VEOA 2HJ9A 3K0BA 4JMLA 1O96B 1L3CA 1QIHA 2PQ0A 3A7DA 1P6UA 5JDCA 1XZNA 2JH3A 2OCLA 2XR1A 3F0TA 2A9KA 2WB4A 1F2TB 1QIJA 1LSOA 3OM9A 4IEEA 1EFRD 4BP3A 2X0NA 2ZIEA 1GT6A 5EFZA 2ADOA 2C3PA 5EE5B 2HD4A 5BMVB 2E37A 3FAZA 1D04A 1I33A 2LNDA 5JH7B 3ZWKA 4OREX 2AYXA 5DE3A 3GY0A 1LDGA 1OR8A 4MEAA 4RD4A 1GSHA 4CCYA 1IAVA 2NZJA 3NEAA 4GMGA 3ELBA 4K0RA 3ZXYA 1ZCBA 2ODTX 2P2LA 3HFRA 3UFBA 4BKOA 4MVJH 3RSHA 1E9SA 5M34A 2IXBA 4DTCA 2JI7A 4HS9A 1T2AA 4D8VA 4AQYB 3ZWDA 5LPNA 1TUIA 4L75A 3CRMA 4JFRA 3VHLB 1IOVA 3NKVA 4U2GA 4AYXA 1PGOA 3NBQA 4H3VA 3R6DA 4Q7EA 3FFAA 2AFRA 5T8KC 4MW0A 4LRXA 3L8FA 4TVBA 1THMA 2V0GA 1IONA 3V34A 3FD8A 4AL4A 1AO3A 1MAUA 2PD3A 1YA8A 1L1QA 4F8YA 4DUPA 2BTOA 1M6HA 4B1FA 1I94B 2ZJFA 1A4RA 1CZKA 4IIDA 4RPHA 4UM5A 3EBLA 1WDTA 1V95A 2VRCD 1S96A 2NM0A 3ILYA 3TTWA 4DA6A 1Y5IA 2D8AA 3HL0A 3TLJA 4GRIA 5CR9A 3QELA 2FSFA 4XLZA 2OFOA 2BZ1A 1RJDA 2ZAMA 1QCDA 4AJ1A 1Y8RA 5KYTA 5KREA 4F6RB 1TNDA 2XD4A 5K0TA 3GFGA 5T3UA 2LE0A 2VWPA 2OHIA 2Z5LA 3T9FA 1JHYA 3BFVA 1E4YA 1GPDG 4JBXA 1ZGCA 221PA 1W48A 3FNRA 2PVCA 3JW8A 4D26A 1K8RA 4RKEA 4G65A 3ZZ0A 4FQ8A 1OWNA 2I5PO 2J6BA 1SBHA 2PANA 2W2XA 4QBFA 4TMTA 4V0RA 5JNUA 1PE0A 1Q20A 2VUIB 2ZIVB 1I2AA 3FB4A 4IEIA 4HUQA 1VIVA 3QWFA 1XFAA 2A94A 4TS1A 3K1TA 5FPHA 3UMCA 1Q1EA 4KR9A 1WQ4A 3DM9B 4KWIA 3VISA 3UV3A 3W77A 1SG6A 5HE9A 4HPJB 2GSDA 3SFTA 2Q7DA 5JZSA 3PDJA 4H60A 5BSWA 4XCVA 4Q1FA 5JC1A 1G38A 1C7FA 1C7JA 2H7VA 3K5IA 3PNYA 1P7CA 4RSGA 1EWRA 5FEMA 2OLKA 4A9AA 3FOCA 2RFLA 1N2SA 2ZS7A 4BKPA 2QSUA 4HDAA 4OTZA 4D3XA 4N39A 3G6KA 2PKQO 4D1YA 2BWJA 1HYGA 1O96A 3LP6A 3NV9A 1XLUA 1HE3A 4DJEC 3ADBA 1ND5A 2E0IA 2ZROA 1N2CE 2J07A 3IAM6 4TL9A 1N6PA 3DV2A 1DO2A 1Q6YA 4NCXA 4ND8B 4S2UA 3VOBA 2MIIA 1JKIA 1XCBA 4HWKA 3VZBA 5I9BA 3RPEA 3DE5X 3OLVA 4HH3C 1A8IA 1F2TA 3D59A 4WNIA 3ESCA 1UFQA 1YRQA 3T5BA 2HPVA 2UUPA 2Q3HA 1N3YA 1POWA 1BQ4A 1O94D 1Q7GA 1GKIA 1Z4PX 1Z5NA 3FPFA 1FP2A 3KQTA 4Y7DA 5JAQA 3VPGA 5BMVA 3VNUA 3BHJA 2C2MA 3AI2A 3LBYA 2C03A 3QOYA 4G0XA 5AXCA 5DGHA 4B4DA 1C4KA 4JIGA 4BRSA 3M6MD 4NYJQ 3EA0A 3BS4A 1UBOS 5JATA 1WKVA 3W9YA 4HRAA 1MGOA 5C7YA 2XB4A 1CY4A 1UEJA 1F2DA 1WZIA 2VIIA 3G5UA 1RYBA 1G2IA 3ROMA 5GADl 4XLTA 2GNOA 1W29A 1UKZA 1EINA 3I8XA 5ARDA 2GZ3A 3L4BC 1A9RA 1Q0SA 4M0MA 1BWRA 2N0SA 1A04A 3NYWA 3SZMA 4B46A 4OB7A 1JE0A 1KQ3A 1VSQA 2IV3A 2DQZA 1NQUA 1Q74A 1IHPA 3R1IA 2GN6A 2H3EA 2PKWA 2IYNA 3R3HA 1K5DA 1OA0A 1Z5PA 1BSVA 1T5SA 3VTFA 4BZQA 1X92A 3WDSA 4K9MA 3IHWA 1C2YA 1U0HC 1AZWA 4LGMA 4AY4A 3O4IA 1K3TA 1M6WA 2VN8A 1JX6A 4Q48A 4NZMA 4JLAA 1F8FA 3J80A 4Q82A 4Q66C 4J0KA 4RW0A 5E8JA 2PGDA 2VF4X 1N5DA 3BFKA 3BRCA 1T1EA 3HGQA 2ISSD 4R1UA 5TJHA 2XDWA 4KFUA 5FOUA 3V1YA 4F6RA 2NPOA 4RWZA 4PAWA 4MJ7A 4PV7A 3B5JA 1D2AA 1N6OA 1OD6A 2JBWA 2H7CA 2H06A 3A05A 1CDZA 3OCUA 3T7SA 1QGZA 2FK8A 2AG6A 4KVZA 2I7XA 3PK0A 4Q7JB 3LY9A 4S05A 5L3SB 4ZQIA 2ASEA 1UBLS 1USGA 1D1TA 3D4NA 4COOA 1C50A 5GP1A 4FZRA 2J3MA 1M5RA 5CITA 2DUUA 4ZIRB 1QUEA 5BN3B 2QT9A 1A72A 1H0KA 3FZGA 2OP1A 2GM3A 1DAIA 2H2HA 2XADA 4Y9DA 5LQJA 2VG8A 3E9RA 1B7GO 1UFVA 2NV6A 1E0AA 4LHVA 4UULA 3UJ9A 1KO8A 3CPEA 2PMEA 5ES3A 1PTJA 3R3ZA 2GKOA 3RC3A 4GDFA 1RT9A 1T0PA 2OSVA 3RFXA 2GGSA 2FFHA 4L8VA 2ILVA 3U49A 5ILQA 1R6AA 2PH1A 1W6RA 2FMXA 5AK3A 4AN0A 4BVJA 5KJFA 2Z56A 2QE6A 1N6HA 3CX4A 4PU0A 5GGYA 5A4IS 1RWVA 4FT4A 4YV1A 1EHCA 1XDGA 3LBIA 4IP0A 3PB3A 5BR4A 4MP6A 2JLWA 2H0AA 2ZU0C 4M8LA 1JIKA 4RPJA 1PFYA 4ND8A 1XDZA 4XVCA 1A2OA 1NLZA 4TTIA 4F84A 5K0FA 3PV0A 3ESAA 1VJ5A 4AYTA 3NEYA 4RL4A 4URZR 1FFAA 3ZTYA 4K6MA 1OXKB 3IO5A 3O75A 3BIWA 2IWRA 5I7RA 3HN2A 1IJBA 1BCRB 1OC4A 2XPCA 3FSRA 4MB0A 3V9AA 1JR2A 2QW8A 4BAUA 4ASUA 1MC4A 4OHRA 3AXTA 1YJAA 4MUAA 4PO1A 1RCFA 2BM9A 3WA7A 3B9PA 3E23A 2WLTA 1NPTO 4WOKA 4X93A 2X3UA 1WUKS 4PC7A 4WECA 2GBLC 1IRXA 4X41A 3MJTA 5L40A 1C9NA 3GW8A 4ND4A 1IOZA 4B3FX 4CM5A 3AJ8A 1KWGA 2PUAA 3BMNB 4UNSA 1JF8A 1YQEA 2FZGA 2NV2B 2WYVA 4ACAA 2KPOA 3WYDA 2NXEA 4MHTA 3QTTA 5HR5A 4PX9A 1NUQA 1S02A 1CEYA 3ZX5A 3M1AA 5G1OA 4LRYA 1WVGA 4ZV7A 1U8FO 4FGJA 2O3JA 4JLKA 2ZE6A 1QYDA 2IOYA 3VC2A 1MJGA 2BKUA 5G4LA 1J42A 3TRDA 4I9HA 3GGJA 1V3TA 4D43A 4YCMA 4TTPA 2GZAA 2IT1A 5I4CA 1F0YA 3GEMA 3DZHA 2W22A 3F5SA 4QARA 3WWYA 1YZGA 4WJZA 4CM8B 3JWGA 5JNWA 3ZVNA 4JJKA 4E5UA 4WGGA 1S8NA 4RQBA 3SMQA 4KQ9A 2B3DA 2YH2A 2XODA 4NU8X 4UQOA 421PA 3EXHC 2QLFA 1KIAA 2OSBA 3O4HA 1EXDA 5FFFA 2I2BA 1P6QA 4CWAA 1E1QA 4G84A 2GLTA 1K5GA 1XTVA 2OCGA 4AMGA 5H9WA 5L3SA 3D6HA 3STUA 3SZUA 3U09A 1KRXA 2JK1A 2XMQA 4N5NA 4ZIRA 1SKMA 1TE2A 4XUEA 5BN3A 2GFIA 3IMFA 4M0KA 2QRGA 2HF8A 5ICFA 5AJVB 5TGZA 3RTEA 4AURA 4Y3UA 4E2YA 4DPKA 4PIPA 4AVYA 1OXXK 2GBCA 1CQWA 3PRHA 4HC4A 4MRRA 4ZOCA 2BGTA 4PR0A 1EWQA 1R00A 1RAGA 1Q22A 1A76A 3DVQX 4IO1A 3TNYA 3WWDA 3A9CA 2A0KA 2YCLA 3A1WA 3V2HA 4NZYA 4TMVA 3T9BA 4Z3DA 5LP6F 1VSTA 1VZ2A 1O6GA 4WKCA 5HZGA 4QUAA 4B3MB 2GEBA 4Z5XA 3HXPA 4R71A 2C2KA 3TW0A 3PSHA 3ANLA 5IT4A 1S3FA 1BFUA 4IJUA 1J20A 3F98A 4MYDA 1ECBA 5FQNA 5GMOA 5K09A 4YRQA 4CE6A 1Q2UA 2VJKA 2W6IA 3CRVA 3DOUA 4CIAA 5HCUA 3IUMA 5D86A 4P80A 3K72B 3MILA 3PA8A 1J4AA 4R9UC 2PWBA 3NETA 1M0SA 1RIFA 2IYPA 1BCRA 1MG5A 2R8PA 4JP1A 4MV0A 4HAOA 1LVGA 3IBTA 1FA9A 4N4AA 4YALA 5DSTA 1C41A 3F6YA 3Q0TA 5CLJA 1FJGB 1E3MA 1CETA 2XLCA 5AJWA 1Q0UA 4PZAA 5K8VA 1PT6A 3Q6NA 4PZZA 2VUUA 4CTNA 3U4GA 2WF9A 4TS4A 3VBCA 4FWBA 3VPFA 4U63A 1B41A 1SXJD 3W90A 5AVTA 1NE7A 3QE4A 5IKEA 5B3JC 1I5EA 1ZWKA 1U2GC 3GVCA 5CLGA 3S2FA 4OFZA 1P1IA 3BMNA 3KEGA 1T3SA 3EQ9A 4UHKA 3F71A 5C1BA 5HKOA 4IZ6A 1XTQA 2HPZA 3KIPA 4M9QA 4MVWA 3RYHB 4KR3A 2GFHA 2QI9F 1AF4A 1MXFA 1WSBA 1ZWLA 2CFOA 4LOHA 2HU5A 2X7XA 4LXTA 3NRCA 2RGNC 1ZM7A 1GZDA 2FFQA 4GAEA 4J0CA 5BWNA 2FF5A 2XOKD 2NLOA 2AQHA 1FU8A 2YINC 1EKXA 5DTEA 3RLIA 1EBFA 4E3ZA 4OAQA 1JAYA 4ND5A 4GBJA 2V3VA 2HNAA 1R8XA 4NBUA 3AQIA 1Q16A 2WFMA 3GRVA 3CN7A 3OCYA 2PKEA 3PSAA 4P5EA 3SHQA 4A27A 4CNBA 4E5SA 3A6PC 1IEXA 4R1LA 1KGDA 3L7BA 5AW7A 3A9TA 1PZEA 3C6BA 4O1MA 2OKGA 3H87A 1V7PC 2A88A 1O08A 4S1PA 4CKWB 5JOQA 5AHWA 2ZZKA 2Y8EA 4CM8A 1XTRA 2CZCA 4MKIA 1MO5A 2BKXA 2VATA 3GRZA 3VVMA 4XQEA 2HIAA 2HJGA 3P97A 1JA0A 1KEVA 1Z37A 3ZUPA 1E1RD 3D2BA 1CVIA 3DE3X 5FPQA 5BYKA 3AONB 4G9EA 3L6CA 2B7LA 2ZVDA 4LC1A 3DOJA 1C7QA 1U4NA 2LCFA 4MRVA 3N2EA 5JVDB 4ZZ1A 5IDQA 2K4MA 3M4YA 1PGPA 2YWJA 3X1MA 5KWEA 1JDTA 4LNUB 4FLMA 1BVHA 2ZR8A 2I34A 4LBVA 2Q2WA 1DBIA 5E95A 1CJKC 4YCJA 3K6KA 1V9LA 2C57A 3IHLA 4RMNA 4DQDA 1JG2A 1GGKA 3NNNA 1GPJA 3TB4A 3OZEA 1P4JA 3AVQA 3FTFA 2AJ8A 3ECAA 1OV4A 3ADCA 2I1LA 2Z2YA 1KZHA 1E98A 3DFIA 5DX1A 5DX0A 3O5AA 4OKNA 3R3YA 2XT9A 3IUQA 5JNRA 1ZGAA 3VKVA 3ID6C 1OY1A 4D3FA 3I4FA 5H02A 2PWPA 1J70A 3AM5A 4MPDA 2X0FA 1AX9A 3AFMA 3L6OO 4UU7A 5FADA 2PK3A 3B3JA 4W1PA 3BRWD 1YTLA 2B6HA 2CL5A 3LQFA 5ISMA 2H1OA 2V5AA 4BPRA 4IGEA 5JSKA 1NMSA 2EDAA 4RCZA 1XB2A 4PGFA 4BFTA 4BMNA 2NUAB 3BCHA 4OGLA 5E1OA 1U7ZA 4XIYA 3L8ZA 1D8AA 4Y2JA 4V1CI 5HWSA 3RSQA 5AM5A 4A2PA 1RZRA 1VJRA 4LWOA 4E31A 4FNMA 2O2SA 2PFGA 1U7TA 3AVOA 3M7IA 4YK7A 3U7QB 2P9ZA 2X23A 5JNTA 3HO6A 2CHEA 1LVHA 2P9FA 1HSOA 1AGXA 1SZDA 3THOA 1VHTA 4RHEA 2HK9A 1OZ0A 4X1IB 1MOPA 5AK0A 4ZOQI 3U7IA 1RLTA 2JFFA 3B20A 5IZCA 4MJ3A 4NJMB 3IDZA 4BJ5A 1UFKA 4H1TA 1HE2A 4WCFC 3UJCA 1OXVA 3RYHA 4AECA 1G18A 2CB9A 1NDHA 1M1ZA 3OOHA 2VC2B 3GUUA 4AC9A 1RU3A 5C31A 2NVWA 2O2HA 3V8NA 2A9RA 1WMAA 5J63A 4GWGA 3D0QA 3HVUA 5IKOA 2AVNA 4U7PB 4JV5B 3E2MA 1F8UA 3NPMA 2ZRGA 4EGQA 5CVCA 1R1DA 4M9ZA 4Q3KA 2ETXA 5K6RA 1V3VA 4DHEA 3IV6A 3VZQA 4DBLE 2DUWA 5J1SB 1II9A 4JEIA 3EC7A 1GCGA 4RADA 4WXHA 4YRZA 3B3GA 1FXWF 2JJQA 4FU0A 4LY9A 3TLXA 1M8KA 3IT1A 2BBTA 3OC0A 3ZJ4A 4EQ6B 4CKWA 2G4LA 1BMTA 2OAEA 1EK2A 3WNBA 4ENRA 4A2CA 1NYRA 1A88A 1E94E 4JGBA 5FD8A 5JADA 1HRKA 1VE5A 2VDQB 3QUTA 3A6HA 3AOGA 4LRWA 3ZQ6A 3FFTA 1W581 1HM5A 1ZY2A 4IMJB 4HWTA 2FWNA 2BKLA 4MQLA 5JVDA 3JVEA 3RK4A 1E0KA 4IFBA 1K63A 4YH1A 1YE5A 5E8RA 2QLJA 3UXHA 1E3LA 3BC1A 4JASB 5KCMA 4N8SA 1Q7CA 1TQ4A 4Q12A 4TN5A 1YFLA 4AP5A 1V39A 4K9QA 2XCQA 4LNUA 1S2IA 2GZSA 1W19A 1X7XB 4MULA 3RUEA 3GAAA 4UOZA 4F1KA 1HE8B 4R1TA 5YASA 1AB5A 2EATA 3AW9A 1YR3A 3AJAA 4W5RA 4Z7JA 1SZCA 4Q9IA 4DR7B 4YY3B 2Z6VA 4J7CA 1W1IA 3MM4A 2ZIUB 1AB6A 3MHTA 1TPYA 3LHSA 5DHTA 3ORHA 3VC3A 4CV2A 2PGOA 4DNPA 3G5TA 2AYYA 4QPNA 1GUZA 1YA6A 1KFEB 1E0JA 3HVKA 5BRNA 3TSYA 3VHRA 1UPFA 1FPMA 2IYTA 1W46A 1PI3A 4IMRA 3ROFA 3F96A 2SCUB 2ZBDA 4YAOA 5C34B 4ZQEA 2HRBA 4KKVA 1C9KA 1U3WA 1GITA 3K9QO 2NUAA 3RYIA 2M1XA 1FOEB 4B4WA 1B3BA 4CTOA 4DV5B 1U1DA 2HKIA 2WC1A 5TXGA 3DAHA 5BXYA 4TWBA 4D0LB 1A5BB 1N9KA 4EHLA 4F6LA 1FMLA 1NBEA 5EIBC 3W2GA 5IDYA 1C1DB 2NSYA 1FUKA 2CJWB 3OZ7A 1KYXA 4TS3A 2I7DA 3U7QA 3HMQA 2XF2A 4CUZA 3L43A 4CEJB 1JMKC 4WOBA 3LPNA 3OFND 4XASA 3OQOA 3ZCVA 3CYFA 3MAAC 3TNJA 5I7SA 1W0KD 1SELA 4NJMA 4QA9A 1GPH1 1CJCA 3HJFA 2QPOA 4QICA 4DKJA 2QKYA 3UC9A 4J2OA 3KD2A 5JBQA 2JFQA 2QN8A 2HZBA 4HADA 4W9RA 1R0WA 1X19A 3FYTA 3HUEA 621PA 2BJVA 1KAHA 4MUMA 4NU0A 3MS4A 4X66B 1MABB 3U80A 3SAJA 2G77B 1U0GA 2DPXA 3MAGA 4G2TA 4PNPA 3SS8A 2SKDA 4RGYA 3U1TA 4R2XA 4IILA 4QPDA 2HSZA 4QX6A 4K6CA 2ZUBA 5D5HA 1X87A 5DGTA 2LD4A 4Z9XA 4Z3KA 3NTVA 1GUFA 2JHFA 3KB1A 4IFTA 1KYQA 2JLBA 2W6NA 5FA8A 3WGKA 5CG2A 4PLZA 2B98A 4R1OA 1R3DA 4F6CA 3A3PA 3UAGA 4C22A 2F3PA 4EQ6A 1W44A 2Q07A 1P9NA 4FR0A 4HDOB 1ZK3A 3UUFA 1LQUA 1W6UA 1Y3FE 5IANA 1H1DA 5AJTA 4CKXA 3E35A 4OQXA 2F9MA 3ZLTA 3M9WA 3QU5A 3J81k 1M5TA 3VPBA 1W2HA 2DRIA 3BIXA 2AK3A 3U3MA 1T9BA 3S28A 1E2UA 2W2TA 1UBRS 2C2YA 3FCUB 5IU6A 2HSDA 4G5XA 5IJZA 1G8MA 3G7UA 4LOLA 4QOEA 4HATA 1QK4A 3D7LA 1WMBA 4IIYA 4D3YA 1DWOA 3SIXA 1EI9A 1Q14A 2WA1A 2F90A 1H5UA 3ABQB 4EVIA 4ATNA 1X7XA 3F78A 4OXNA 2OCXA 2WIFA 3MQFA 1GN8A 4R81A 5KJ6A 2PUFA 3IO3A 1II0A 1N25A 2ZXFA 2P2CA 1VHJA 2QAIA 4E21A 2G82A 3T3GA 2VK2A 4JVOA 3M3DA 2WSBA 4JYCA 2OQRA 1XMPA 3SXUB 1AKQA 2GJ4A 3G59A 5CM2Z 2X8JB 5EC8A 3NWBA 5CK5A 4PANA 5LJIA 1MX3A 2RH9B 1WXEA 1L4FA 3GP5A 4OF4A 5D8DA 4FNOA 3TB6A 4YV0A 3DGEC 3ENKA 4ZO7A 1MA3A 3QPUA 4XM2A 4KGXA 4NAHA 2V8OA 2DCUA 4E5MA 5KQPA 2SCUA 1S2DA 5LVAA 3KSUA 4KGDA 1G8FA 1L4BA 1G9XA 2W6OA 3ANNA 3GJRA 3IOEA 5TR9A 6ADHA 3NDIA 1NVGA 4OP1A 4N3CA 2DBZA 4RFSB 1XPOA 2IPAB 5LQDA 4U5QA 4R7GA 5HBGA 2MCFA 1RACA 3D0KA 1C1DA 1FP1D 1HT1E 2NG1A 2CJWA 5DN9A 2E5FA 2P8SA 2B61A 4CEJA 3WLHA 5AVJA 3O90A 3OE7A 3NJ8A 4IZOA 5EIFA 4LHEA 1HMYA 1BHSA 2JAPA 4TWAA 3U7JA 3T8YA 1Z5ZA 1A4IA 4C5AA 1NJ6A 2HCBA 3SQLA 2A9VA 3UCFA 3LP5A 3Q3JB 4BP9A 4H17A 4F3TA 3LNTA 1TK2A 1JG4A 1U0BB 1XAGA 2Q2OA 4U9HS 3RREA 4S1TA 4URXR 1G1AA 3SZRA 1SXHA 2TRSB 4J0EA 4WACA 2J33A 3O4JA 3ER8A 1MABA 3AY3A 2QYOA 3RNLA 3LSYA 5IXSA 2QVCA 4EA7A 5AO9A 4FGUA 3D1VA 1WBBA 1W96A 1LX7A 3GLUA 1DRKA 1V43A 4NONA 4CCWA 4AO6A 2QRJA 1G42A 3MMPA 3F49S 3U3XA 4D8UA 1TI7A 3EA5A 3GG9A 3O03A 1KJWA 4KE7A 1GN9A 1YU6A 3VOSA 3ZCSA 5HF9A 4GQBA 3K0HA 4CZ2A 2GHTA 4YAKA 4B32A 2PKQP 1GVHA 1FRFS 3KHSA 3T3OA 4DUZB 3PNVA 3WL3A 2YV5A 5JJCA 3PKJA 5BVGB 3DZGA 2NADA 1KSGA 4DVJA 3S81A 5E3IA 3OX4A 3KWLA 4HGYA 3QTBA 4D57A 3PGA1 1RXUA 2AJLI 1GZ4A 3HFJA 4YRRA 5I45A 2O50A 4LCEA 2M2IA 1ECLA 5B1SA 4NJOA 3S2GA 4JBHA 1QHIA 4MRPA 4DLNA 1A8PA 1VCHA 2ZRIA 3EW9A 2P9GA 3OP1A 4U3JB 4G5QA 4ESHA 4FP9A 3UWDA 3M49A 3PNOA 3M3HA 5BV2P 1DC6A 1TD9A 2YHAA 2O0JA 1AURA 3O92A 3OQHA 1U1FA 1KYZA 1Y1RA 3SLGA 1R8YA 4W1QA 3V8PA 5BWCA 2Z8YM 4NEGA 2WKPA 1N7HA 2W6CX 2EJBA 2XYPA 3K5PA 4H35A 4NCAA 3SXUA 1GG8A 2H4HA 2X8JA 2UZ0A 3OUUA 1JLKA 2GEKA 4DIEA 4EHIA 3BSWA 4OYYA 1CP3A 1N0UA 2ZT7A 2QTCA 4QYTA 1QZ3A 1ZNWA 3UUGA 2WOOA 4J0DA 2H2WA 1NASA 3QLVC 3V1LA 4DLXA 3OCVA 2PO7A 1THTA 3T0GA 4DDKA 5DMXA 1O9HA 4EUHA 5U1PA 1SQSA 4AXXA 1YH3A 2RSLA 2J5XA 3BWCA 2IW1A 4LHSA 5CG1A 2BUCA 2WDZA 3DXXA 5LNK1 4ZVLA 2G63A 4DJ5X 2JJ1A 4TV9B 5DW3A 1O0SA 2I1WA 2X13A 1L7NA 4BMZA 5KYKA 1VPLA 3EIWA 4Q7MB 4BKQA 2Y1XA 2ZB2A 1GLVA 4P08A 1UMKA 4AG5A 3NB0A 3E3OA 2M6RA 4D7AA 3ZK8A 5CW1A 4ZOBA 4DM4A 1USIA 1KGSA 1LPPA 2QZ9A 2HA7A 2IRWA 5E9AA 2CE7A 3IKLA 5L51A 1ODSA 3WB2A 2ZI9A 1FMTA 1V7ZA 3I42A 3B9RA 1CUWA 3FOAA 2HA2A 3AEZA 4QPZA 1E69A 4Q9HA 2HM7A 1XU4A 3DCYA 3U62A 2Z6QA 4MARA 2O1WA 5CAEB 1QQ7A 1XN1A 2FQXA 2P35A 4YX9A 4OHBA 3DH0A 4RFVA 1Y3IA 1V26A 3NCHA 4Y2HA 1PNOA 1JS1X 1JWBB 4RH0A 2PMBA 3BM5A 3D4LA 4YO8A 2PUVA 2GN9A 1SD1A 1BDMA 5KTKA 2J6IA 2C4HA 4FOLA 3RYIB 3RQSA 3PHLA 1QHFA 4C05A 5IC4A 5EKDA 3UB4A 3DFUA 4DSTA 4FMPA 5KNCA 5L4NA 1C80A 1IZ7A 1K8YB 1S2MA 2B4TO 3L06A 3L8GA 3D6VA 4RK4A 1X13A 4PHHA 5BSMA 4E6PA 3OT5A 1J33A 1GEGA 3E4CA 1YC5A 4FI3F 3UT0A 2JASA 1MJHA 2IOFK 4ZO9A 1OREA 5ADVA 5BVGA 2VI5A 3OQIB 3EASA 3Q8WA 3KL2A 4MUXA 4N01A 1NP3A 2FHPA 2QL5A 3AC0A 1S7CA 1TLTA 4Y6RA 3TJRA 4HF7A 1V6SA 1E4VA 1GNLA 3EZNA 3TEMA 4GMHA 1ILEA 3W04A 4Q7QA 4K26A 5DYNA 4CKBB 3OLWA 2H5IA 1YBVA 3WISA 1NBHA 5AJHA 5HUQA 2CNOA 1RM0A 4U3JA 5HIIA 1FYXA 4E08A 1SCUB 1ZJWA 2ZBFA 2HT1A 4WOJA 4EHKA 3RTDA 1M6NA 3BQ9A 1Z12A 5DKFA 1U31A 2D2VA 3DVSX 3Q3EA 2YNMC 4RH3A 5E38A 3UZUA 4LEIA 4OAOA 2HR1A 1AKEA 1C0LA 1MAVA 1V4BA 2FZKA 3H2JA 4DM7A 1QYXA 3DL4A 3VGPA 2EARA 4GWKA 2QAGB 5BUZA 3EODA 1PEKE 3HA5A 1UDXA 3SHVA 1T1IA 1SXGA 4GXNA 4X0EA 4V0OA 3WLAA 3U7HB 3FPKA 4HR7A 1SC9A 4QXMA 5C8YA 5LQMA 1QHSA 3NOOA 3RTGA 2CXTA 4CLRB 3ND8A 3UGKA 4XA8A 4M9UA 1PDVA 2OWDA 3EVBA 4CLDA 3CZAA 1KC3A 3ZR4B 1GJRA 5B1IA 2C9BA 5EQJB 5B7PA 4B3RB 4TV9A 4WLUA 2J9ZB 1RI4A 2RHHA 3B9QA 3GEBA 3OKPA 4I19A 3BOSA 4EAAA 5FPYA 4ZOLB 2A5LA 1HLGA 2Z9BA 2P9HA 1NVMB 3T5DA 2G5PA 5AVRA 3O9ZA 2O5EA 3ZE0B 2CSUA 4EHDA 1SURA 4RMIA 1LC0A 4M9CA 4ZTUB 4W5WA 5ITZB 3A2KA 5JRDS 2ZYHA 4KUGA 2VZ0A 4B35A 4CMAA 1GGHA 1K89A 3KJZA 3M6FA 4O4LB 5JMTA 4C2AA 3HBAA 1N2BA 1F6WA 4FHCA 3BSYA 1VP9A 2FZEA 3C87A 3FCEA 4MQBA 4RQUA 4PC1A 3QFCA 5CAEA 4A1FA 1UDAA 5EZ6B 2X14A 4K88A 4NRDA 4DN6A 5EPUA 4HXYA 2OO7A 2ZT5A 3IRUA 1KDZA 4B76A 1LGYA 1DU4A 1Y6RA 1XCOA 1Z4MA 1GOTA 4IXDA 1KKUA 5K8TA 3R9WA 5BT9A 4IIEA 4ZAZA 4ZU1X 2CN1A 3EGVA 1WZCA 2WV9A 2HAEA 3NTQA 1Y4ZA 1NVBA 3I6YA 2X5XA 5U9CA 4RACA 2JARA 3S3TA 2ZIZA 2V7WA 3L04A 3LUCA 2RKOA 1EGVB 1T3TA 3MK31 4HBGA 1TA0A 4NSNA 5GZ6A 2R7AA 3QU7A 3ZBQA 4CM7A 3M4NA 4TKMA 2VF2A 3M1YA 3GT3A 3A3YA 4HSEA 1X2BA 2OB1A 3JQCA 1ISFA 4YJHB 1R9GA 1FTNA 1ZH0A 3GLKA 1JR3E 2Y3IA 3HMKA 4K6HA 5K03A 1JH9A 3OQIA 3PS9A 2XB2A 4MI1A 4MV5A 2Z57A 3LA8A 1LS6A 1A7JA 5CCEA 1AKUA 1VIAA 2QHXA 3GG2A 2O2CA 1R5BA 4MP8A 5FL3A 4P3PA 4B71A 4CU2A 3B9BA 5A3JA 2RG7A 3FIUA 3DJYA 3WGHA 4CKBA 5LWHA 4N5MA 3RODA 4CMJA 1B15A 3HACA 1A9QA 1G16A 1RXEA 1CT9A 4KBYA 4NOKA 1PX2A 1SCUA 3AUUA 2IXEA 1OQAA 2GEVA 1G63A 2N1BA 3IUSA 1FLAA 2UYHA 4KC0A 2JCBA 3V7YA 2YHUA 1UK7A 4WH0A 4QXQA 1A96A 1B93A 4A3SA 2PGIA 1JFRA 3UMFA 1PYOA 2AE2A 4OJQA 4LGVA 2FX5A 4K9SA 4ARBA 4J1NA 2E48A 2QAGA 4LV5B 2ZGVA 2QN1A 3KSMA 3I9JA 3KT8A 6Q21A 1G7TA 4U2CA 5AKKA 4QL3A 4FVTA 3VR5H 1Q77A 3VR5D 3DZBA 3RS5A 5BSEA 1SUIA 4DXHA 2OZLB 1ZGJA 4W8GA 2CJFA 4DSAA 4CLRA 2PZKA 4L6AA 1DXYA 2OHFA 3C1OA 3TBHA 3TL3A 4WN9B 4C6RA 1FDIA 4UHBA 4GSKA 5DNDA 4CL2A 4LOIA 4ABTA 3JAWA 2IU6A 3C8UA 4RM2A 4JI8B 1R10A 4NYIQ 2BJHA 3QSGA 1YJCA 5DYTA 5BSGA 2IGTA 1YZKA 4ZOLA 3FHJA 4Y8VA 1WIWA 1U6IA 2FSVC 2ZJ2A 4RHCA 2UZ1B 1RABA 3V8RA 1JQEA 1XHLA 3DVLA 4NCJA 3SQMA 5ITZA 1L6RA 1MN6A 1P1CA 2OBMA 2VBFA 1WXXA 2BFEB 5K0SA 1XXLA 3PVSA 3RUCA 1JR4A 1F4LA 3FPGA 1VPVA 1J8VA 2PKCA 4O4LA 4UC0A 4UFNA 2DWUA 4KX3A 1IEQA 3THWB 4C1BA 4OBBA 4Q05A 3E9DA 4RKQA 5BQPA 2VHUA 2C94A 1L9KA 2DPLA 2JGFA 2OG1A 1EP2B 2VDJA 2YIJA 4PZ9A 1HTTA 3JQRA 5HJ7A 1KQFA 4NMLA 3QA3E 4DB2A 3IV9A 5CCXA 1E3JA 1MEJA 4QU5A 4P92A 4B79A 3B1JA 4C2BA 1DP4A 1G9TA 2DC1A 3M6WA 2Q0SA 3NNSA 3ZHXA 2Q2QA 4OJYA 1EA5A 1E18A 5C3UA 1REQB 3IC5A 1WZUA 2IY8A 1NVEA 1K8ZB 2ZANA 4H6XA 1TQ8A 2DT5A 3NU1A 1DKMA 3UOAB 1E4OA 3J81A 3O1IC 3ZV5A 1CQXA 3QA9A 1CZUA 3G0GA 3PXXA 1P4SA 5HIJA 5HRUA 1U2DC 1GFZA 4UEKA 1KWKA 1RPNA 4YJHA 5G40A 3T4UA 4DCTA 4NAUA 2PYIA 3O4VA 5EVJA 3UH1A 3TMAA 4RXTA 3N8IA 5EL0A 1R15A 3B7WA 4D9CA 2HXGA 1RPJA 2ONJA 1AJEA 4UMFA 1VLVA 2HH9A 2FK7A 4BDTA 1I7QB 2Z6UA 3F5FA 2GD2A 2M6KA 3LZ6A 3VPSA 4BP8A 3LHDA 5J1TB 1GNSA 3AHHA 4ZA2A 4FW8A 3BXPA 1IBCA 3DOFA 1UAYA 1WMDA 1Z39A 1TC1A 1KJYA 3H5LA 3PFBA 2WHQA 2Z9DA 4UBJA 2ANCA 5D84A 4MVJE 3C70A 3A9RA 1ADYA 4D8XA 2P6PA 2IEBA 4HQRA 4C0KA 2AVDA 3C4VA 4LDQA 1VLLA 4QWWA 2AUNA 4AWXA 2FSUA 3MLEA 2VT6A 3KOMA 3PZBA 4UTXA 3UV6A 4ZALA 3ONFA 3I1YA