4D9CA

Pmp bound form of salmonella typhimurium d-cysteine desulfhydrase obtained after co-crystallization with l-cycloserine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
328
structure length
328
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-Cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 117
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9cA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9cA02
4D99A 1UBSB 2CLKB 1FUYB 2EGUA 1OASA 3V7NA 3BM5A 2J9XB 2Q3DA 4D9EA 2CLIB 1QOQB 2ECQA 2ECOA 2RH9B 4ZU6X 5JISA 3L6RA 4IL5A 3X44A 2BHTA 4LMBA 5B1IA 4D8TA 2O2JA 1TZJA 1K7FB 4D9FA 1BKSB 1O58A 2DH6A 4D92A 1CW2B 1CX9B 1UIMA 2RHGB 2ZSJA 3IQIX 1PWEA 1WBJB 5B55A 5B53A 5DW0A 4F4FA 1V7CA 5I7AA 1UINA 1K8XB 4JBNA 4L0DA 1F2DA 1WKVA 1VE5A 1J0CA 4Y6GB 3HMKA 5E0KB 5CVCA 3VC3A 5I7WA 5JJCA 2CLFB 3PC3A 5DVZA 1J0AA 2ZR8A 1TZMA 1A50B 4D9NA 5D86A 2JC3A 4WX2B 4COOA 5IW8A 2ISQA 4LMAA 1TTPB 1A5AB 4XUGB 3IQHX 3TBHA 3SS9X 4QYSA 4D97A 1A5SB 1V71A 3AEXA 2TYSB 4ZQCB 3SS7X 1KL7A 3RR2A 2CLMB 2CLEB 2RKBA 2TRSB 5B1HA 2V03A 4D96A 1K3UB 5T6MA 4D8UA 1J0DA 3VSAA 3R0XA 4D9CA 4NU8X 4H27A 5BW6B 4JBLA 5D87A 2Q3BA 1J0BA 3IAUA 3FCAA 3L6CA 4OFXA 4L27A 4HN4B 4I1YA 5D85A 1C9DB 1KFJB 2CLOB 2GN2A 1TTQB 1VE1A 1E5XA 4HT3B 5KZMB 5B36A 1D6SA 1KFEB 4HPXB 1K7EB 4HO1X 3CEPB 5I6DA 2GN0A 2BHSA 1TYZA 1WDWB 4ZU1X 3DWIA 4OREX 2J9ZB 2PQMA 1K8ZB 4PCUA 3T4PA 5I7RA 2ZPUA 1FCJA 1TJPB 2C2GA 5IWCA 3DWGA 3PC2A 2GN1A 1KFBB 4KKXB 2TSYB 4L3VA 3SPXA 4D9KA 5I7HA 3VBEA 5EY5B 1VB3A 1C8VB 1X1QA 3VSCA 2CLHB 3PC4A 1K8YB 1TZ2A 4D9IA 3VSDA 1Z7YA 4L28A 3L6BA 5HBGA 1A5BB 5J5VA 5KINB 4D9BA 1RQXA 5CGQB 3AEYA 2C2BA 5B3AA 3R0ZA 3IQGX 1KFCB 1TDJA 3FGPA 4AECA 2CLLB 4D9GA 4AIRA 1K7XB 4D8WA 2O2EA 4D9MA 1BEUB 5J43A 5DBHX 5C3UA 2DH5A 2J9YB 2WSYB 1WTCA 5DW3A 3ZEIA 5I7OA 3DKIA 1P5JA 3X43A 1JBQA 1M54A 1QOPB 2D1FA 4NEGA 5D84A 1J0EA 4LI3X 1PWHA 1KFKB 2Q3CA 5IXJA 4HPJB 1C29B 1Y7LA 1Z7WA 1TZKA 2EFYA 5DBEX 1V8ZA 3PR2B
chains in the Genus database with same CATH superfamily
5JZVA 1YE8A 3KX2A 1UJ6A 4OI2A 4BECA 3OFVA 4RENA 1XK7A 5CW2A 4EIWA 2ATIA 3IULA 3KL2A 5JXIA 2HM7A 4YUYA 3QKRB 1GADO 2GJSA 4ZA2A 4ENTA 4G5SA 3S5UA 2JGMA 3I32A 4E6PA 2C4TA 2AB0A 1KKMA 4FYJA 3AF6A 3LLUA 7AT1A 2HK6A 3O8NA 2P9ZA 4J91A 4ZYVA 1KAQA 1NBMA 2ZRCA 1Z3IX 1JFVA 1U98A 2W6NA 4K9MA 1GG9A 1EK1A 4HVAA 1UZLA 4IIBA 1ZH4A 4JZKA 1Q22A 1RLOA 4NCJA 3Q87B 4MIYA 2WJJA 1G42A 1YONA 3DZJA 2NGRA 3Q2KA 3FTDA 4ZOEA 3OZRA 1AGNA 1KY4A 5AM0A 5IAGA 1BMDA 1LNQA 2DHRA 2WABA 4HDCA 4GNKA 3UK2A 4AB1A 2FFQA 2P9JA 1B93A 3AKEA 5TVGA 3BMNB 3BWDD 3L4BA 4RVDA 5LQDA 3W2TA 1H2HA 3TG8A 2HJ9A 2P8SA 2I9PA 4OHFA 4DBVO 5EHQA 4OHYA 3NBZC 3B52X 2G9ZA 3UBTA 1RVV1 1IOZA 3TRJA 1M34A 5ENZA 3IJPA 3LIPA 5HW0A 2OWEA 1P3JA 3LV8A 1RPAA 1F4PA 4L4YA 3UQYS 2P11A 1CUUA 3B78A 1ZKDA 4KI0A 4Z8XA 1UOOA 3BX1A 3QENA 4A0SA 3W3AH 2PR2A 1KDRA 5BT8A 4JFAA 1C9KA 1TD1A 2F3UA 4PRYA 1VE1A 1YA6A 1Z62A 3CF4G 1JLLA 4NOLA 3AF2A 1KFEB 3M6IA 1U5AA 2V7GA 3ZU6A 4DSNA 5LPNA 3E48A 1UODA 3HXQA 3ZHRA 1O6FA 1P81A 1QFZA 4NCKA 3FD8A 3ZDAA 5BVGB 2XRYA 1U8CB 4W5RA 3F7MA 3DLHA 5KUTA 2ZIVB 2XNSA 2VK4A 3DWIA 5EEGA 5ALUA 3AUTA 2GHTA 2PWZA 3I6QA 1NBHA 3FH0A 3G2MA 1L5FA 3OHSX 4PZYA 4TM7A 3WO1A 1QTNA 4E1AA 6REQB 2EEPA 3KV1A 5HOEA 3FNGA 3NNNA 2Q3MA 4DCOA 4N48A 1NPTO 4KKXB 1CT9A 1LU9A 1MTZA 2VQSA 4JYPA 4KQ6A 2I55A 1LKZA 2J33A 4KJZA 4NFLA 2GXAA 2BGLA 4H3VA 3HB5X 1V25A 1MLDA 4QU0A 1NLZA 3WK9A 1DMSA 4GPEA 4JB8A 1JG1A 1QJ4A 2JFWA 5HA5A 2H18A 1V4NA 3R74A 4ZDKA 2VRNA 1E3JA 1ZPDA 4KN8A 2A94A 1XZEA 4WH0A 1U6JA 1NXSA 4MTLA 4UQLA 5IUJC 3FGPA 1T25A 1M1YB 1RWBA 1YB4A 2WNHA 1NHGA 2Y66A 3KDPA 3HXPA 3WK8A 5FI0B 1D1PA 1YS4A 1JEOA 1JSRA 2Y0BA 3QWIA 3T38A 1Z6PA 3K70B 1Q5PA 2PLRA 4KXQA 3EVFA 4QDXA 4RMIA 3T5DA 1AUVA 2PVCA 2QROA 2QAGC 1Z4NA 1LF5A 4OB7A 4QATA 3WYBA 4AP5A 4EABA 1YOBA 1OZHA 2XVZA 2HXSA 3QNUA 4E11A 5BWBA 2Z56A 2V7QD 1NJFA 5LZ8A 1L7BA 4HWKA 5CVVA 3TAUA 2FDXA 3TPCA 4G0UA 3ONDA 1W0KD 1VKJA 1DIRA 1S4QA 2JLSA 3PQDA 4KO8A 4L74A 5L3SA 4JQYA 3PR2B 4NCXA 1ZP6A 2A9KA 3DO8A 2PGNA 2W98A 1CY0A 1XXHB 3ZU2A 4C0JA 4CKEA 4F9TA 5THXA 2QLJA 2R7NA 2GARA 2X8JA 3OJEA 1V8BA 4H7HA 5HIKA 1OBFO 4JVSB 3ORYA 1RXUA 3N6RA 4G5OA 4CMCA 3P1JA 1ST3A 4CR8A 1W0JD 4BZPA 1JDTA 1RYFA 1YK1A 4DXHA 5CDFE 1G21B 4YRSA 3IT1A 3QLUC 1Y4SA 1N2CA 3VAYA 3WMWA 1WXFA 1X7YA 4L51A 2IYSA 3GC6A 4OY3A 1KGDA 4YJFA 3GLHA 3RU3A 4DR1B 3VYUB 1CJCA 1PKEA 4TM8A 1OXVA 3L1HA 2X42A 1RJEA 2Z1NA 4M1OA 2C2WA 4MQ5A 4BFTA 1X7XA 3FWZA 1YBHA 4ZT3A 1FZTA 4G1EB 1R0CA 3HYNA 3PHHA 4PM4A 4TKUA 5ES3A 1Z4KA 3E7DA 2GA8A 2W0SA 3D8NA 2FEAA 3PDWA 2PZGA 4QNMA 4TLMB 3UUWA 3RIGA 4MUJA 2P9QA 2QSUA 3GFQA 4HRYA 4TOIA 2JIPA 1O3YA 2Q5QA 5L7WA 2PBLA 1GZ7A 2XDAA 4X54A 4CQJA 1EXDA 3TXYA 2ZBDA 4DVJA 1B8NA 1IXZA 1Q2UA 1M10A 3NWOA 3WZ2A 3BH0A 4E6EA 1E7SA 4XGQA 5ICEA 4YRCA 2Z0MA 1GXSA 1EWYA 3KQWA 4CM7A 5K09A 3RVRA 1ENYA 2Z2YA 2WJPA 1W34A 4Y1RA 5AIBA 4EW3A 2QLLA 2FOXA 4ARAA 4KLCA 2NYVA 3ZTWA 2RC5A 3H1AA 3HBNA 3N2LA 4D6PA 3ANYB 4N47A 5L7TA 2FWBA 2WKRA 4EB3A 1KBZA 5KYXA 2YFQA 1UJ2A 5TF0A 1PU2A 4CGYA 1YDHA 2IDKA 1RP7A 2MSKA 3DXYA 4UAJA 5BRAA 4E31A 1CRQA 1XLTC 5HIAA 1GPAA 4LVCA 3OT4A 4RK5A 3LPCA 1KQPA 2VPYA 2PMEA 3BHNA 4L2IA 3X2FA 5DLPA 5MFPA 2F3PA 1XD2A 5A3QA 1KPHA 1I36A 1OHHA 4IAOA 4R01A 4L5AA 4B3TB 4KO3S 2COUA 2LCQA 3TUIC 2QWXA 3IP6A 5H3LA 2VYND 3SIPA 4TTRA 2V74B 1KRHA 1ZSVA 2Q49A 1OLSA 4OJNA 5DDIP 5CB8A 1CRPA 5KNBH 1U8UA 1KSGA 2WAOA 1QV7A 4CTOA 3FPJA 3R5JA 1PP4A 1P9LA 5DTJA 5CDUA 3F46A 4FSDA 3R7LA 2YWFA 1JHUA 5FWXA 3SEFA 3AL2A 3W2FA 5CA1A 5KTRA 4KRFA 4NBVA 2Q1UA 2ZT8A 3A6EA 1YR8A 3B70A 3ZE7A 4OIMA 2O8DA 4RZSA 1E2BA 2HPAA 5BV2P 5HGJA 4LS3A 4Z3DA 4BC1A 1I8TA 2VNIA 1QPZA 3H9QA 4H08A 2NPFA 2EQAA 2PL5A 5IAOA 1PT9A 5IBRA 5LU8A 2Y76A 3QPBA 4TT8A 4A2PA 5AW2A 4HNHA 1GNRA 1RLMA 4Y1FA 3S6JA 1ISGA 2QQFA 2JK0A 1RAFA 2HF8A 2GKSA 4N3NA 1DJPA 3B6IA 3EB9A 3ECSA 3ST7A 1E2DA 4BFSA 4M8NE 1XWIA 4J9VA 4WFQA 2WPDA 4F06A 2VJPA 2XUJA 3ZWMA 4M22A 1RC0A 2HF9A 1B23P 3DXZA 3S8MA 3MQFA 4YMIA 5DCUA 3WBJA 2FSUA 1V11B 1G2PA 5CBKA 3C3CA 4C76A 1QR6A 3FR8A 2Z3WA 3QVKA 3UMMA 1TYBE 4E5KA 4XE5A 4DJJA 1SVNA 2GETA 3PL1A 4OV6B 2D3TA 4YVFA 1H6DA 3BERA 3GVIA 4UDYX 5HIJA 4MK4A 2B8TA 5AFSA 2MMCA 1SU4A 2IUSA 3NIDB 4PPNA 4XEUA 4PTLA 1FVOA 3VXKA 3II6X 1N4DA 2AWNA 3NJRA 1K9VF 2WB2A 3X1MA 4EVIA 1MABA 1NUPA 3W2HA 4DR3B 1DC3A 1SUIA 4Q3AA 4DYHA 2QR2A 3JS5A 2OZVA 2Z4TA 2QVGA 4NX2A 1PX2A 3KYCB 4Z4FA 1Y6QA 3HGTA 1XPJA 3JZFA 1XJWA 3GT0A 4J94A 2IIQA 2IDMA 2JD0A 3AZQA 2ZGVA 3LL7A 2UUBB 1L7RA 3F4LA 1SU8A 1WUTA 1A77A 1P75A 2JL1A 4QOJA 3SHWA 2CVPA 2FW7A 5AVYA 2H1SA 3WY9A 4LJ4A 1HZJA 4OYHA 5IT5A 1Z0FA 1QOZA 4NABA 4EITA 1O9GA 1BDIA 5LLDA 4HDNB 4KBYA 4UM7A 4V1CI 1FTQA 1XTUA 2JLAA 2PCJA 1ZK3A 2Q2OA 3IILA 2CVOA 3IEIA 2TRSB 3W6OA 3CVUA 1M0TA 2VHJA 1NE2A 2UU9B 4ND6A 4R2LA 3D2CA 2ZWIA 2ZJFA 2YDYA 2ID7A 5A4DA 4DV6B 4CG2A 2FJUA 3MJVA 1YJXA 5CHEA 3WNCA 1GKIA 2H1WA 1A69A 1HETA 4XM2A 4AWAA 3GXOA 3SDBA 4F85A 2X9GA 4NZZA 5CA1F 2E9SA 4FBLA 3HR7A 3DDHA 1APBA 4BXOA 4LFAB 1OWMA 5DULA 3M4ZA 2ZJOA 3IR5A 3PI6A 4QL3A 3STXA 2QY6A 2Q5JA 1P7PA 1ZBQA 4Z86A 3LLMA 2PV7A 1CFJA 5GONB 4DMMA 2EBWA 3ESQA 1VE3A 3N2ZB 3A58B 4EATA 3WQBA 1SBQA 1XTJA 3WYAA 3DHYA 1K8ZB 2JZNA 1HWYA 3IVGA 4PCUA 2J46A 4XVHA 1VMIA 3SM9A 3S2FA 1NY5A 3NAGA 4WVLA 5LB2A 1NG1A 1VLHA 3I8XA 4AAYA 5JNTA 2PGIA 3ZDXB 4E30A 2EARA 2ORYA 3M6XA 4DV0B 2P1ZA 2R1UA 3K5WA 4C08A 2P6UA 2HXGA 1LSUA 3GLQA 2A7XA 1LJ8A 4G5RA 1NNSA 4D0LB 3GBVA 2COEA 3HRIA 1QRTA 1Q2XA 1WQ3A 2G88A 3CKKA 2Z5GA 2Z8XA 1PUIA 2PUEA 4KZKA 2OA0A 1GT91 3BPSA 3A9SA 1SQ0A 4OSOA 2O0LA 4QYTA 4X24A 1BAPA 3W5VA 1AH2A 3RT1A 1GPMA 3D31A 2F4NA 1W85B 3U7RA 2G09A 1KVTA 1V2GA 4AC9A 1UBLS 1GILA 3ZEIA 2AC4A 2WJVA 1L6IA 2Q3HA 5HS6A 3U37A 3A1SA 1XHEA 3AIMA 2YWEA 4QUEA 5HM8A 3WRWA 5E8JA 4L6IA 1A5TA 4DTCA 1MVNA 4OLAA 3FCSB 3GQBB 3I01A 1FRNA 4PHTA 3A1WA 3AK4A 2MSNA 2A8YA 3I4CA 2GCOA 4HYEA 3SICE 2G8LA 5JIBA 1NDUA 3ZDBA 3SN6A 1OI7A 1RJ9A 1Z83A 1NIPA 1XRJA 4ZOAA 4OMCA 1MDFA 1Y8CA 4PC3A 3X3HA 4D9EA 1I9GA 2W6ZA 2V7TA 3CEMA 1VKRA 3HQ4O 2A9FA 3FVVA 3MINB 5EHIA 3SYLA 5IAAA 2F64A 3WGVA 5AVXA 4OEHA 1Z4LA 2QU8A 2YNMC 1E6WA 2ZXEA 3BZWA 3GDOA 4RX1A 3VZSA 4Y0NA 2ASEA 3PQ5A 2NYUA 4IDQA 3WL7A 2BZGA 2JANA 3QEJA 2B0JA 1KBQA 1X14A 2W6MA 1EG2A 1U9ZA 4EHDA 1EGMB 3O7MA 5IAJA 1G7RA 1C3OB 1SK8A 4D1YA 3PZBA 4B40A 1PG5A 1V7CA 3AUYA 4P35A 4E1BA 2G6BA 3CCFA 2GBLC 2PMKA 1BN7A 2AR7A 5BUZA 5C53B 5HP4A 4ZCRA 3OPNA 3VJMA 4YWHA 2HUPA 2VYVD 4FB5A 5IKPA 3G8YA 3WMRA 2H0RA 4K3VA 1WNTA 3W2EA 4IVRA 5LWHA 3U19A 4YJHA 1BRMA 4CCSA 2X1LA 1N2XA 2Z1MA 3EXHB 4BB6A 2CT8A 1TC2A 1QNLA 4HDRA 1JMYA 1ORVA 1V71A 4LMPA 5CH3A 5GMOA 1FDTA 1I4EB 1E6CA 4G01B 4Q4JA 4RY2A 4YDSA 4MV7A 5C34B 2HSEA 2QD1A 3MWDA 1T2FA 4MUNA 5SYAA 3S2SA 4NDNE 2Z9BA 1VIYA 4Z9BA 2BGUA 3K09C 4YRLA 1U5CA 4PGAA 1I3LA 3AVOA 5A3VA 2IA5A 2ZUEA 4AG5A 4HLUA 1TMKA 1B0ZA 3QU4A 2R48A 1M6VA 1E64A 2XYQA 2UYCA 1DBQA 2H2WA 1ZCZA 4KXVA 1JEYB 5I7FA 2C2ZA 1K0FA 4BP1A 4DXDA 1GYQA 3MJFA 4X1KA 1H1TA 3RHFA 4CKCA 1E1RA 1KEKA 1Z82A 1UANA 1P7YA 3R3JA 4DSAA 3WLQA 2Q4BA 4WZ6A 3PQCA 4WRRA 1U5BA 4LRSB 1Z0IA 2H6EA 2R6AA 3L7MA 5IVHA 3W34A 3F2IA 4GMKA 5F23A 3NC4A 1KJYA 2GWHA 3X1DA 4PNEA 2JGNA 3LU1A 4IGIA 3HUEA 1NSFA 5EUBA 4KIJA 1Z6TA 4NDAA 3G3EA 4UVGA 5CXSA 3HO1A 3SG0A 3ND6A 2CCKA 5HKKD 3UJBA 3UJ3X 4CV2A 5T4EA 3U40A 4A6EA 2VP2A 1VBFA 2PGXA 3TG2A 1DAIA 2CJXA 4FC6A 2QJOA 2FG5A 1RQXA 4KAAA 4UHHA 3JYHA 3Q8XB 1EGVB 3NCHA 3V1MA 3ZN2A 2OD2A 5IDQA 1EEHA 2GZ3A 5FJJA 2G36A 1GAJA 3MWYW 2NU7A 3J80A 1VRWA 5BOSB 3AGPA 3UV6A 4QASA 4OUDA 2XSZD 1RXIA 2F6RA 2Q3FA 2OHJA 3LOUA 3NTRA 5K3BA 3DMRA 4BEBA 3VA7A 2Q6LA 3HJUA 4CLHA 3RC3A 1Z68A 5LOVB 1Y6RA 1EJ6A 3PKJA 4YRIA 5J2TB 5BQ3A 2AFHA 4FX5A 1SVLA 3LIIA 3LQFA 5KTNA 3PDHA 4A73A 2APJA 3IUMA 2L0XA 1E4VA 1Z6ZA 2QTGA 2X4LA 4RWZA 5SZHB 3UJCA 1BE6A 5EEHA 3QK7A 4V0SA 3WRVA 1Z4OA 5JMWA 1Y82A 2XGJA 4DIKA 2EKZA 4Q1DA 3HVHA 1Z0UA 4LC9A 1KK1A 1XX6A 1ZHHA 4R81A 4RM2A 4S1OA 2I03A 1R37A 4ZALA 3O8QB 2WT4A 1QC5A 4OFBA 3UXEA 1K6IA 1KNXA 4AO6A 1YMQA 3KSUA 1ISIA 1P7VA 1U0JA 1FX1A 2JEYA 4GSKA 3HXLA 4MRMB 2QD5A 2R11A 2QTCA 5E3IA 4FB4A 4F0JA 3A37A 1KYIA 3EASA 1XQWA 2PEYA 2QORA 3E3LA 3FSGA 3R3WA 2NZUG 2RONA 4BX3A 3AEQA 3TI9A 1C7EA 2XCTB 1H6CA 3T8YA 2VP4A 2YMLA 3MRSA 1FTSA 2DULA 3LCUA 2WIDA 3UEOA 1JL3A 1O1YA 3PSAA 4AT1A 3GT4A 4PHCA 2VQEB 2Z5VA 2QUZA 4EMTA 5I51A 2R6CA 5IULC 2FPXA 2NU9A 4KEAA 2IP2A 3L5OA 2B7BA 5GAJA 1ESMA 4YRPA 2E0IA 2JAHA 3SQDA 3DMFA 1PQPA 1AMNA 1T36A 2TYSB 2O4UX 4HLNA 4FN5A 4LV6A 4GI7A 4BJ1A 4QLBA 4KE7A 4L5BA 5HNKA 3WA7A 3AVQA 1GQSA 4I4TA 3RSQA 4HB4A 3F6EX 1COWA 3PWKA 5DYTA 1QO7A 3WGNA 1SNYA 4DXAA 5AP9A 1K63A 1OUMA 3DOOA 4RPGA 2CHVA 1LGYA 3F8WA 1HRDA 1VLJA 2JVIA 4L08A 4NV0A 2HRBA 3ZWNA 4EKNB 2O8BB 3JYOA 1CZNA 3VVMA 4CHTA 3U4GA 4KU4A 1SELA 1PEAA 3H5OA 3KQOA 3KV3O 4B0OA 4BV2A 1M6NA 1EDBA 2A35A 4WGFA 4R40A 1ZKMA 2EQBA 4KGVA 4P58A 2IYNA 2NPIA 2OAP1 2ORIA 5A4AA 1PDVA 1KYYA 2JFUA 3P2YA 3VPGA 2XUGA 1CIVA 4U7GA 3HKDA 2Q29A 1YRBA 2V6BA 4EPWA 3O2NA 3K0AA 1TVCA 1GQQA 2QMEA 3CIOA 2J9ZB 1XAGA 3KOYA 4K9RA 2GVZC 1N2OA 1WY7A 3NX4A 5AUPB 3M4XA 3MHPA 3RF6A 1P3Y1 4U00A 3VPSA 1NBOA 1CUAA 1KFBB 4IINA 3TUZC 4DC1A 4J3NA 2O3QA 4E2YA 1PZHA 1WUKS 1JZTA 2O7RA 4NYJQ 4EF4A 4DN6A 4BBJA 1VB3A 4RV9A 2X0EA 3EIQA 2WU0A 2NLOA 4NBTA 3PEVA 2YVUA 4UD2A 4B71A 3THYA 2H85A 2H29A 4KRYA 4D74A 5KINB 2DBRA 2I1VB 1OLUA 4Q00A 1I30A 1IQUA 2NO7A 4BVHA 3WGGA 2PHZA 5A5EA 1DAOA 1KO4A 1V96A 2BFCA 2QV0A 3L4EA 3OIVA 3RGWS 1DV2A 1EUCA 3RO7A 3TVTA 4BFZA 3P4UA 5CEJA 3JWEA 3KJFA 3PYMA 4J0KA 3N3BC 4AIIA 2B9VA 1UFOA 2X7JA 1E2UA 3TD2A 4IWYA 4RQAA 4XD2A 3T3OA 4EO4A 3D9QX 3C70A 5THQA 1HK7A 3H1PA 1IU9A 1PVVA 4IXWA 3V8RA 5DMXA 2NSHA 4E4YA 3O3OB 3DNMA 4ZCIA 1ZQ9A 2YVQA 4ONEA 1HV8A 1V95A 1XJQA 3BD6A 4FFNA 1GP2A 1N9ZA 4PICA 3RVQA 1TQ8A 3B1JA 3PEEA 2JDID 3KEQA 3NDBB 2GEJA 2CB9A 4Y7CA 1TGVA 1BMTA 2VC2B 4PQEA 3RSFA 1NLYA 3K6RA 4US1R 1RWNA 3DAGA 1ND5A 2Y1GA 1NT4A 3QQ5A 4MVJI 2Y99A 3LZDA 1LLUA 1N5JA 2C8JA 4YEDA 4DHWA 1MC1A 3K2BA 4DCSA 1I2CA 1UJNA 2QRGA 1LPPA 1DJLA 1H2BA 2UYOA 2Z5FA 1Q20A 3ZHBA 4UBIA 3OZDA 1V4VA 1N8TA 2PH3A 3FB1A 4I4TF 3NYWA 1K9SA 5E1DA 4KXYA 1LFAA 1KJJA 1IMOA 3LRPA 2C82A 5HSGA 3OJLA 5D7NA 1DEXA 2GRUA 3FBTA 4UZSA 1R9MA 2IKQA 3LQ1A 4YLGA 1FNSA 1EVJA 3DCJA 4HGYA 4NMXB 4DIFA 2CNWA 1JBEA 3E7PA 4IDHA 4IMPA 1Q84A 1Z73A 1G5IA 3CC8A 4H4CA 1G60A 4X7RA 2PZKA 3WIEA 1NVEA 3B6EA 2GFQA 3L7AA 3NKFA 3VPBA 1GKUB 1MJ5A 1FMCA 1ZOSA 3FM9A 3JQFA 1QYWA 2ZYUX 3A2MA 3DPUA 4J16A 4QGAA 2JCVA 3AOGA 5BYJA 3GX1A 2DBVO 1BXRA 1J0XO 4QGHA 1P1KA 4ZANA 3IFSA 2GJ9A 2YIJA 1HNWB 3PDCA 3ZWBA 1G291 4WN9A 3MUOA 2CL6X 4QO7A 2RK4A 4O2AB 2I67A 5DYNA 4MQ6A 2NXJA 2NO1A 5WRFA 1YD7A 5IM5A 1XEWY 3WMFA 3IP5A 2ZXFA 1SURA 3TZEA 4B76A 4ER5A 1EU1A 3PK0A 4O4LB 2ZVJA 2BMDA 1E1YA 4J2HA 4X6UA 3GJYA 2R1VB 4HQKA 3DBRA 1Z36A 2WSSA 3OA0A 2H2FA 5HK8A 1R4MA 2PLAA 5TT0A 2NZJA 5DYWA 3QYAA 3ZHQA 2N1MA 3T3HA 1NI4A 4RESA 4Q1CA 3O4VA 4LNAA 4YACA 4KWTA 1OA1A 3FCYA 1JAHA 1FDVA 4HQLA 3ZWOA 1QORA 3NHRA 1T9AA 4MYHA 3KXPA 1FB5A 1K06A 3WRXA 1DHTA 2AD1A 4CV0A 3KEOA 3K32A 3IODA 1RWOA 4EB8A 5A2QA 3FHLA 3WFZA 5EIEA 1MD9A 1XTTA 2WBLC 3DOHA 4ZI7B 5G0WA 3HVRA 1H1LB 5JMOA 2IEYA 3N0VA 3WDSA 1ZOIA 1WLYA 3CRW1 2BFAA 3IVCA 4F3TA 2FB9A 1NJ5A 3DF7A 4S0ZA 2QVYX 3EFOB 3JQ6A 3N0RA 4HFNA 4K9KA 3UAWA 1F8YA 1F8GA 4IIGA 5E38A 2WZBA 3TQRA 1PR0A 1T5DX 4GWKA 5FI3A 1WRBA 5EJFA 3WE7A 1KFKB 2ALJA 3HZZA 1XZNA 2VK2A 2D4HA 2Y8EA 2TMGA 2OLKA 3H2IA 3LRTA 1YR7A 4OB8A 3FPEA 3A26A 4GPIB 2FTKE 3ZGNA 3FJOA 3GT3A 3LUGA 2VAVA 3Q6NA 3QVOA 1GPYA 3FNIA 2B25A 3MOIA 3GLGB 1X80B 3QU5A 5CX1A 2KQUA 4R3UC 1HFEL 2J4FA 3DOEA 5DHUA 1ZUWA 3JALA 3O4HA 3WTBA 5IN4A 1XRPA 5DTMA 2G7ZA 3HYSA 3WIOA 1EIWA 2BZ0A 3GIWA 1WSWA 3D7MA 4HZUB 1NQVA 2DHDA 1UIMA 4IG4A 1PEKE 2O50A 1C1YA 2CFSA 5FLXA 4HH3C 1A8HA 3ANSA 3KLNA 4TMFA 5IBQA 1R6AA 1LBTA 1Z8DA 5E0KB 1ODSA 4BKMA 1GR0A 5EQTA 4YT8A 1M6WA 3H4IA 1E2HA 2EKQA 4AY4A 1T0PA 1ZBDA 4HC4A 1N2GA 2DFVA 4G09A 5JD3A 5BSTA 3WISA 4V0LA 1NVVR 4GMXA 4F5ZA 4GAEA 4WNIA 1G3UA 3DBHA 1HDRA 1DS6A 5ALQA 1L3BA 1Z47A 4HGPA 1UDAA 2HLNA 1Y3AA 4U9UA 2V03A 2QQEA 2XMCA 5COAA 4U7HA 2I8AA 4Q3KA 5KYTA 2UYHA 3K0EA 3Q8KA 1HQYE 5BSKA 3QBVA 4CQMD 1SXJC 1TXGA 2C9YA 4R16A 3K5PA 2BUAA 2JW5A 5F1OA 3NOVA 1GIAA 1Q11A 2JA2A 1X7WB 4ISCA 2BR4A 2EIHA 1X87A 1KJNA 1E3MA 2JJ2D 5A5FA 3ZCVA 1QZXA 2C4KA 1MORA 5DNWA 4QHYA 5JT1A 1QF7A 1S2OA 4C0QC 2RK3A 1TQ4A 4WCFB 4Q9JA 2QZJA 2XKBA 4ZDIA 1EDEA 3OHMA 4XWWA 1CYEA 4KFCA 2IFTA 1FW8A 5HRAA 4GVLA 4K3UA 1P4HA 4FNOA 5AOAA 3DBVO 2I71A 1AE1A 1HTWA 2WAAA 2VXOA 2F55A 4KQ1A 1W5EA 1PSWA 1U2RA 1WW2A 2PKRA 3F7TA 5A04A 4GKVA 4RLQA 5AKJA 5I7HA 3NDPA 2B61A 5ICGA 4HAVA 1QVAA 3T7JA 4BGEA 4QYMA 4UHDA 2VHCA 4Y7DA 3KAQA 5LBTA 2VJMB 4P54A 4DY6A 3JPWA 2XUFA 3MMSA 4FKZA 1UPAA 1LBSA 1I0ZA 4OKNA 4UHBA 3L6OO 4RGYA 5B4UA 2QSZA 1FVHA 4LGCA 1T15A 2FSFA 2GYWA 3IQEA 2C9OA 3JQ7B 4C7JA 2VHQA 3KDAA 4MR9A 3CPHA 4EZEA 3WB0A 1OLOA 1J33A 4D9MA 4DMLA 1O6ZA 1OFHA 1V5EA 3DNFA 3HG7A 3JQEA 2X3UA 3LX5A 4HPWA 1FFSA 4IRUB 4E13A 3LBHA 4E5YA 3PNOA 3RS8A 3SHVA 4BMYA 1OU4A 3KVRA 3OETA 4NEGA 3ZWAA 1KC3A 5L53A 3P20A 4YROA 4A03A 1CG6A 5LYJB 2PS1A 1M2OA 3L49A 1VLVA 3VDMA 1VGVA 1IY8A 3KALA 3BA6A 5HGXA 4EJ0A 4GKKB 5B53A 2C58A 3SQNA 2XWSA 2Z3ZA 1WZ2A 2X13A 5KS2A 3CJRA 1Z2OX 2HU2A 4RTPA 4L07A 3MAJA 4Q4HB 4AKTA 3EGEA 2CLIB 2ECQA 4DCJA 3U5ZB 2VTEA 3FYTA 2IWHA 4J3JA 4B6FA 4DWOA 3TNLA 1Z0SA 3BWEA 3JQAB 3U16A 3EG9B 3PKZA 1D9ZA 4L8YA 1BIFA 3JQBA 4Z4CA 3P9SA 3A6LA 3A27A 2GBFA 3KK0A 4IDEA 3T3EA 2JH9A 3TTXA 1Y8ZA 3VHXB 3VBCA 1CS0A 1F9EA 3KKNA 1XMVA 1RS0A 4Y1GA 1USKA 2FQYA 4M83A 2IC5A 3L1VA 1P6XA 1SVWA 2EJTA 1E4EA 4L5IA 4L0DA 1U9YA 2GEVA 4GZMA 2R00A 4G86A 4KJXA 1J90A 2VF7A 4C0XA 1AKMA 2CVHA 1GUAA 4B34A 1G1AA 3Q11A 3DE4X 3OCVA 1P2UA 4DDKA 2VNSA 4L50A 5AHXA 2IW3A 3IPAA 3M3PA 2DKFA 3GJZA 3L1JA 3I6YA 4GSLA 4XW2A 4YAEA 5EP3A 5F7OA 4N03A 4D25A 1RKVA 1YQTA 3DM9B 3PPYA 3UAGA 1U7UA 3C43A 1UWCA 2OE2A 1RMQA 3DUFA 3QEOA 4X8LA 3R7AA 4R0VA 1D7OA 4BY9E 3E58A 4KDCA 3U7JA 4P4NA 1ZL0A 2HJHA 3ZW8A 3DQPA 5AHRA 4R2HA 1JEQA 3PQ4A 4PHGA 4JJFA 3ZH2A 4YB8A 4OXIA 1W5FA 3IV9A 3P2JA 4RYLA 4JYMA 2VR1A 3WMGA 1TU0A 5BQFA 2EL9A 4BO6A 3D3WA 4L95C 5B36A 4BMZA 2A2ZA 1D6SA 3ZJUA 3NEPX 2G77B 3W7VA 1Z75A 4HO1X 1Z4IA 4ZVRA 3RLIA 1W2WB 2GF2A 3TIIA 1FRZA 5KEIA 3PFWO 3TO5A 1SOUA 1EGQA 5L40A 3W5BA 1EBBA 2LCFA 2Q9BA 3BMOB 1U6IA 1PQYA 1BFUA 2J7PD 2R8RA 2VUIB 4GPZA 4ER6A 3OUZA 4DR7B 3KR0A 1HY3A 1JNYA 5L3QB 1JQ5A 1Z0KA 3DWGA 3HCCA 1VHTA 3EUEA 5F7XA 1YU9A 4MWSA 3QMPA 5EJEA 4NCAA 1CC1S 2EDCA 4EH1A 4FOLA 2Q7OE 1NE7A 2BWJA 4GMDA 4IQFA 3JRWA 4XUEA 4BQQA 2VAWA 1DZ3A 3MPOA 1WZEA 3MWKA 1KO8A 1RIFA 3QPAA 4I9HA 4LYYA 1ECPA 1JKJA 4QYIA 3GWZA 3JD3A 4IHQA 3W1VA 1QU3A 3VYRB 3FPHA 1CUEA 2XMGA 4XIJA 5T64A 3VV3A 1TIKA 1E1LA 1FNBA 3V9AA 4B17A 3WRYC 4Z1OA 1YTUA 1CUWA 3UWOA 3BICA 1F6WA 1T9CA 2HA7A 5I9TA 3DVSX 3NP7A 4A9AA 1T3SA 3L06A 3PS9A 2JJYA 4RZ3A 1I7DA 2COKA 2C8KA 2V7PA 3B3QA 3DL4A 1Z6QA 1HO3A 2VH2A 3I8SA 4WLEA 1SD1A 5IUKC 3GEIA 3HCRA 1ZINA 4ZJPA 2NXWA 4EAQA 1PWHA 4ZO6A 4R9VA 4C04A 2JIBA 4OB6A 4YBZA 4E5DA 5BV1A 4YGYA 3SC4A 1HH4A 1L7NA 1DOAA 1PDWA 4YCSA 3RE1A 3WGQA 5DRYA 5DB4A 5SZKB 1TVKB 3PI7A 4DABA 1G7CA 4R3NA 5C46F 1E6KA 4ZAZA 3EWNA 3CF4A 4HNAB 4XGIA 2EEZA 5CFOA 1ODKA 1LDYA 2JGLA 3KR1A 3I92A 2BE7A 3ZVRA 4M2LA 1EESA 1RLJA 3KLBA 5KYWB 2XEDA 1JSLA 1OFIA 3LYUA 3EGDA 2QVXX 1IUKA 1FFBA 5AJZA 5JSZA 4AQ7A 3A3PA 2OO5A 1O54A 4NMLA 2WKPA 1YB6A 5KX5B 4C22A 2VUUA 3NVAA 2F4VB 2QBYA 1U0BB 3LLCA 1BMQA 3ICVA 2G9QA 1BHSA 1MX3A 1E6EA 2PZFA 3OX4A 4MLZA 4PRZA 3ZGXA 1Z18A 4GW3A 4M0FA 4BVBA 3ULKA 3VNAA 5EHGA 3EQZA 3ESRA 4RANA 1EWRA 1R5JA 4PPFA 4R1OA 2F7SA 1Q0SA 2ISCA 1UCFA 3GLFA 1U3DA 5C7YA 1CQJB 4HLDA 3NHFA 1DLJA 3U60B 2NO4A 4RORA 1P0FA 4H77A 4M54A 2BGMA 1UMDB 2JHCA 3I05A 1SXIA 3PPVA 1UPXA 3VOBA 1NYLA 5TB5A 3ZZ0A 1IC6A 1ZEJA 2PANA 3A05A 1J8QA 4UUAA 4QJ3A 3OZAA 1J8MF 3HVKA 5DHPA 5E1MA 1Q0ZA 4WFIA 821PA 5IP5A 3UPUA 2V96A 3ABQB 3G8AA 3M8KA 1A4RA 3S1AB 5AKLA 3IAUA 3NAMA 5GJCA 1J1UA 1V6AA 3UTDA 1PFWA 2YX1A 4PS0A 4JMLA 3CKMA 5KMGA 3S7ZA 3N7UA 4LTMA 2JLZA 4MAMA 4A16A 5AVOA 1ULSA 1Q17A 3B2QA 3F6RA 3M3DA 3SJCA 1RTKA 2R7KA 3I3SR 3PTZA 1IG0A 2GSWA 1J70A 3A9TA 3B1ZA 4NCIA 2BHSA 5J63A 4GR9A 3PB3A 2QTFA 1TUIA 5F51A 3WB2A 1J5EB 2XIQA 3EOAI 1C2TA 1FTYA 4LBVA 3GRAA 4UVDA 3SP1A 4KWIA 4UTRA 3HTXA 3E84A 3HJTA 2ZJAA 3PC2A 1C4KA 2YS6A 3EXEA 5JJKA 5AJYA 3BD8A 1PFGA 4TMYA 4BJ3A 1OH6A 5I7SA 4JLSA 3T0IA 3FVWA 1UK8A 4BMNA 4EHNA 1IY9A 1DFIA 1Y3HA 3SIXA 1L7DA 1LW6E 2CLHB 3STVA 3Q7RA 1FFAA 2CV1A 4LVNA 2FPPA 1NC1A 2QV7A 3NEJA 1PBNA 4O4HA 1FS4A 3HDJA 4ECAA 1XZQA 3LQYA 4HGNA 3W8FA 4W99A 2WM8A 3ZQKA 2PWPA 4J49A 2C7BA 2WD7B 1CF9A 3H5IA 4DMKA 2WP8J 1GAQA 4GE0A 3PF9A 2EF1A 4X6XA 1BTOA 2IV7A 4E14A 5DM70 5BVHA 1P9OA 3SBDA 4RHFA 1KMNA 2C7GA 2Y27A 2YH2A 4Q9KA 4CEIA 5ALGA 4C6SA 3B3FA 2JFHA 1ONPA 1BH6A 1WDLA 2H2HA 2H3EA 1G6HA 2XD4A 3BYZA 3TEJA 3VPCA 3IQWA 1FMJA 1W96A 4ME6A 5GJWC 3DMGA 3LAWA 1BEEA 3LDAA 4X0EA 2ZE7A 3A9WA 1FU4A 5ILGA 3IUSA 2H3HA 3ASVA 1N7GA 1N0WA 3TD9A 3BH6A 4XD7D 3HN2A 3L0BA 3VPAA 2OVBA 3PDUA 3CFYA 4EWLA 1F2UB 1VRCA 4LZWA 2AXQA 4UEJA 1XVLA 3B2EA 5E3JA 2BFFA 2HRQA 3CLTD 1KKUA 3HSKA 3N74A 2QQ5A 2YOFA 3DDSA 1U3VA 4U02A 3TINA 4C0KA 3GB9A 1PNVA 4HDKB 2IGBA 4RIIA 1T6ZA 3FPAA 2D0IA 4GXRA 2I3BA 4O4IA 4RKFA 3GLIA 3WNZA 1W581 4TTVA 1PAUA 2M6RA 4JIGA 1I3NA 3NH6A 3PICA 1Q77A 1FP7A 3BWYA 3PTAA 1Q1AA 5K6RA 1WPRA 4C6TA 1SHZA 2PZAA 1G9XA 1TA0A 5ALWA 3U13A 4D9NA 1P9NA 4PG6A 3RYHB 2V7XA 2X40A 3QXCA 2XUOA 4GBED 3H83A 1K86A 2OUKA 3EDQA 4OIFA 3IS3A 4RD6A 3R9XB 2SKDA 3WYEA 4AYWA 5ALMA 3U61B 3TGPA 2XWQA 5IJ9A 3UPDA 5B1HA 1NKVA 3INYA 3DVAA 3GEMA 3U4QB 5CAEA 2L82A 2QAGA 3GEDA 1RNLA 5EN4A 2J8ZA 2PBRA 4KQMA 4MW9A 5AKXA 4J2OA 4L8WB 4DJAA 2XKKA 3CVWA 3RTGA 1SOAA 4DR2B 1GPNA 4UXHA 4WERA 4ETWA 1OXMA 1T91A 5MHTA 5JU6A 4YNBA 2W71A 4IJUA 3S2YA 3ZHOA 3JVVA 2OO3A 4FYKA 4O4HF 3DAOA 3DYIA 2QT0A 2NWQA 3A6DA 2VQ3A 2P77A 3VR0A 4O08A 621PA 2V9ZA 5E7MA 1PNOA 5HPYB 4MB6A 4FUTA 3A10A 2XNKA 2H7XA 3BDVA 2G4LA 3CA8A 1SIWA 4RETA 1JFRA 4H6WA 3MCZA 4BPRA 2ZPUA 3DVRX 1D1QA 1WF3A 3DFKA 4ZVVA 4YUXA 5KCZA 1GA1A 3FVTA 1QWOA 2R8PA 1L5YA 4IEIA 4DIMA 1DPGA 1E5DA 3H2ZA 4UATA 1E9FA 4BVGA 1SKQA 1TIPA 1KAMA 2GX6A 2WSBA 3OCCA 4OHWA 4PO1A 1X7DA 4S1VA 3AWDA 1E1MA 1MTOA 2PG3A 3CWZA 4Q3DA 2UZ1A 1I7LA 1AMOA 3LWDA 3AW9A 1XUOA 1C3VA 1RRVA 3DKRA 3UWKA 1VPVA 3CX8A 4K81B 1BU8A 1FTWA 3GCDA 3IOEA 3G2NA 4PGGA 2CDNA 5SYMA 5EKTA 4Z6KA 3UUFA 1UBNA 5AO9A 4EEXA 3FHOA 3BTSA 2O2CA 4MVJG 3DFFA 3KSZO 2CVQA 4BQRA 1XXHE 2XDQB 2QRLA 4YCNA 3D7SA 2O48X 3SJAA 4HB3A 5IG2A 4WE3A 1GZHB 3OICA 3OPYB 4D0NA 3HLKA 3L8GA 3AVUA 1GOTA 2GJ4A 4JJGA 4X62B 2CFTA 4GP7A 2P6NA 4YJ2B 1UBKS 3W4JA 4OP3A 3RVOA 2PUHA 5KSYA 1ZVJA 2FE4A 4O4IF 5KYYB 2ICAA 5B4VA 4RA6A 3HB4X 3QFTA 1N57A 2CLCX 5JEDA 5BN4A 2VDLB 3M1LA 2ZUCA 4PLVA 1DG3A 5ALIA 1Y1LA 5A6SA 3N2KB 2P69A 4MIEA 1UXKA 4TQ9A 3DEZA 4X1YB 2B5WA 4QNRA 2VDVE 5F1YA 1KZHA 1JG6A 1I3MA 1SCDA 4BTVA 2QN1A 1AZWA 3IUEA 3LQQA 4PIMA 4B43A 4KPFC 1WLSA 2DJ5A 4F5EA 2J3KA 3L6DA 1Z6YA 4A8JA 3E5HA 2WYHA 4KLRA 3UB2A 5BR4A 1Q16A 1EXNA 5EMKA 2GZ2A 2GBIA 5B37A 5DPMA 4Z4HA 1NUQA 3N8IA 2IXGA 3ZKWB 2D1TA 2I66A 3LXXA 3SMVA 3EBOA 1TD9A 4Q7QA 1NVUQ 2D8AA 2KLHA 1L4BA 2P9FA 3ZZNA 4HBZA 3DAPA 3DC2A 1JIQA 1DEHA 3EA4A 4OJMX 5C5DA 4X7PA 5EP1A 3L7OA 1IPEA 4QO8A 2F3SA 2G1JA 2C9ZA 2XUIA 4WXHA 3D6FA 2OXFA 1X1EA 2Q5EA 1K66A 2RHCA 3UH0A 4UULA 5J4YA 4X1OA 4KV7A 1PUJA 2EJUA 1U65A 3A2LA 4NCHA 1WBBA 1G2IA 4D96A 1WUHS 3INGA 3PFHA 2V8BA 1N5KA 4X5OA 1B8PA 1R4NB 2QRVA 2W7TA 2B21A 4K87A 4NH0A 3CKLA 1RI2A 2PX8A 4HEQA 2QLTA 4GYKA 4HX9A 3WQQA 3KZNA 1U8EA 2TS1A 4XUDA 3N1UA 3CRZA 1T8SA 3B1XA 3WDKA 1TLFA 1Q95A 2ZRMA 3LZCA 1LTQA 3I2JA 3L1KA 3PR3A 5B12A 2IOFK 3I3OA 2D7DA 2GPBA 4V38A 3BGSA 1Y4ZA 2OD9A 5BYAA 1RWXA 3IVAA 2NW6A 3X1YA 2C59A 3CISA 2ZS7A 3I5XA 4IO0A 5CXXA 1IWPB 1F38A 3CUWA 1BXZA 3T0FA 3IEVA 5EE1A 2NVUB 1UWVA 2H16A 1L3CA 4AFNA 4QQFA 1MO4A 2JFFA 1F1BA 4Q9DA 4TL6A 4LWPA 4LE2A 4BASA 3KKPA 3WLFA 3CNHA 1OLXB 3G8CA 1BCRA 4W8OA 4WKOA 5IFLA 3KYDA 1SVSA 3EEQA 4Q5IA 3ZE9A 1VE7A 2Q4EA 4AUKA 1PSDA 1QMPA 1T1SA 1XCJA 2ZANA 1G16A 3IBSA 4HBGA 2O3RA 2B5VA 4TXJA 4PX2A 4JHXA 2B8EA 1QRAA 3E27A 4MCHA 4ND2A 3RUCA 4D3ZA 2HW8A 1OX4B 4BKPA 4HYQA 2C83A 4NYMR 3NAZA 1ZM7A 1E0AA 2PCLA 3ROFA 2CFOA 4PGFA 4LDAA 3A04A 4RHTA 4C4TA 2ZJZA 2FMIA 4AZVA 1NR5A 3K9GA 1CE8A 3WL6A 1H0SA 1ZI6A 2CHFA 3NASA 4QLAA 3PXGA 4KTTE 2FSVA 2RCYA 1S8OA 1QANA 4FDMA 1QOPB 4I4CA 5IVPA 1WXGA 3WNBA 3RJZA 4Q66C 1DX6A 1K4KA 2FWMX 4LJAA 4DS3A 4INAA 3ABIA 2DETA 3FOAA 5JEEA 1B00A 2UXCB 4LXXA 2QUBA 5EVCA 2WWGA 2X22A 5CEFA 4KPYA 4M0DA 2G17A 3VO2A 4EPVA 4ENWA 2Y3IA 4HEA6 5K0ZA 3FBGA 4P53A 3BT7A 1UJBA 4C14A 5AUQA 3ZIAD 1WHTA 1VPEA 3U0VA 4Z54A 3ETLA 1GCUA 4R69A 4GRDA 2BJHA 2O5RA 4P4SB 4TLLB 2FPOA 2E4ZA 4EGCB 1D03A 4LHSA 1U80A 5J2UB 4Z2YA 5CNJA 1KP3A 5GADl 3U7EB 3ZU3A 4E88A 1T10A 5AICA 4W5TA 2OLJA 3OFJA 1BQ4A 2OOKA 3OFNA 2HUNA 2QRHA 4OGLA 4V3CA 4Z9XA 2GD6A 3WWZA 5K6AC 4ARSA 3SXJA 3F9RA 4YDRA 1J0CA 4K8OA 2F8SA 1PS9A 2YQ5A 4RWEA 2H1HA 3DD1A 4H31A 4OOEA 4L4UA 1NMSA 3WL3A 5EXTA 4I66A 2Y0CA 2QAIA 4DRYA 3BHJA 1XIVA 5LD2B 2HU8A 2A1UA 3EUWA 1PWYE 1XI2A 4ETNA 1GL9B 5CD9A 3PC8A 3O91A 4KR0A 2BIFA 2CXOA 2H8KA 4GXQA 3WLTA 5IAEA 1R0WA 1Q14A 3VNQA 2PKCA 1NQ5A 3FN4A 3SZ3A 5DOZA 3AETB 2XF2A 3JPYA 2FAXA 2W9XA 4REQA 2ZYWX 4WK0B 4I5GA 1XYVA 1H0KA 4QEDA 4JQZA 1PS8A 2FZWA 2VLBA 5GV8A 1ZN7A 2CLDX 2YUIA 3OQIB 5HILA 1U0EA 1VJTA 1FS6A 2P5TB 5HOQA 2JEOA 2A59A 2FDCA 2OM6A 3M5CA 3PNSA 3HN6A 4NS1A 4ZIRB 3QVSA 5J4LA 4ZEMA 3L6EA 1RYBA 2EWMA 2HT6A 3LHKA 3U2QA 5AI6A 1PD0A 1QYIA 4I46A 4OJQA 1HFJA 4B3CA 4C4OA 4CMIA 3UT5B 1PTJC 3I61A 4ROSA 3ZS8A 1AF7A 1V3QE 4TV9B 4K6OA 4HH0A 2YNMA 2GKGA 2QHXA 2C2OA 1IY0A 2RB4A 1OROA 3O75A 3RYFB 5KOHB 1XZFA 4MVXA 2CUNA 1EFPA 1XZLA 1L4MA 3K0KA 2V55B 3OF2A 4NZYA 1YHZA 4YP9A 3FYSA 3R3VA 4MRPA 1YZTA 3KC2A 4TLBA 5EQDA 4MKFA 1N4AA 3STUA 3U44B 4K6FA 3M34A 3PFNA 3A32A 2J6HA 3CRRA 2X0NA 2DR0A 1P0MA 3DR3A 3N3AC 3TMKA 3C7AA 3I2GA 3FFBA 1MU0A 1Y5MA 2PFKA 2ZETA 2A88A 5B3KA 1JAXA 3OWXA 4L73A 2YMQA 5C8YB 2VDNB 1M2WA 1CEQA 2VBGA 3KWFA 4RY0A 1N33B 5H59A 3A3KA 3FPGA 1XP5A 4DIBA 2XE8A 1SMKA 5LIPA 4LKRA 2GRJA 1XF9A 5FX2A 1JMVA 1T6XA 1CRWG 1Q7RA 3K09A 5EXXA 2EQ5A 3PDIB 4MGZR 2FG7C 2B7LA 3C3MA 2H59A 4KN5A 4WNYA 3I01M 5FLKA 2XLBA 3BN3A 3T3IA 2UDPA 2OLEA 1B1CA 3HU2A 3NANA 1IJFA 3V33A 4EGSA 2YWDA 4XPIA 3TQIA 1T8RA 3EYAA 5HE8A 4MS3B 4RPLA 2LDXA 5JCPA 2F67A 3M6UA 3P9YA 5FOQA 4S04A 3W5SA 3AF0A 5TXGA 3KSAC 1FL9A 3K9FC 2Y9PB 1KSJA 1ZH6A 4YXWA 4TWBA 1TB4A 5LDGA 3TB4A 1SH7A 2IU3A 2Y6UA 4M1YA 4MQEB 3FWYA 3S99A 2ZITA 2IPNA 1K6XA 5CDTA 5K3FB 1BWSA 4M8SA 1L2TA 2INGX 2Y1CA 2PWBA 3N8DA 3JVEA 4LVOA 4WAUA 4MUMA 2UVPB 2NZVG 1OTXA 2R8ZA 4M1WA 2BLNA 1MC8A 1IY2A 1OXSC 2AFVA 2R44A 3KVNA 3LUFA 3OFSA 4M98A 2VH1A 1M0EA 4RYDA 4QLOA 5KQRA 3RSSA 5A5DA 4BLVA 1F2DA 3UKDA 5TS2A 4ZAWA 3K5HA 5L95A 5CPFA 3KVOA 2IUUA 4DQKA 4EGJA 1UOQA 3FUTA 4LHXA 2B37A 3C2QA 3CZ5A 4YLYA 5A7FA 3VJRA 1SC9A 1KU0A 3B1FA 1XA0A 1E61A 3JTMA 1IEVA 5M3BA 2AUNA 1Z7EA 2H07A 2VBCA 2WIGA 3KJGA 3TB6A 2JATA 4J0HA 5AD1A 2QXTA 2R66A 2PT7A 2ZSBA 3SS7X 2GVNA 2XNJA 4WY5A 1ES9A 5CBPA 1YFJA 1B8UA 3W3AA 2Z95A 5LQRA 1EWKA 3SYKA 3MQ4A 3BSWA 3R1IA 3LGSA 4KAFA 2AEMA 4KVAA 3ZKAA 1M3SA 2I2CA 1N92A 3RC7A 5DNDA 4YRBA 2I5PO 2HAEA 1THTA 2HGSA 4XIIA 1RRCA 4JJ8A 4BAZA 4UTVA 5EZSA 1M72A 4IFTA 3UH1A 4DSOA 2OL4A 4LCEA 3OJXA 4GM4A 1U0OC 4L1KA 4WASA 3VR6A 4M9UA 4JLOA 4MA5A 3B7PA 4TRRA 3FMGA 3L0IB 4QUAA 4R4JA 3BFXA 3S68A 3SLGA 3B1YA 3WTCA 2XMSA 4X71A 3MJSA 2C1ZA 2BFPA 2UUCB 4NI5A 2BMWA 4EKEA 3HKCA 3WK5A 4GOMD 3MUFA 3L84A 4PQRA 3TVYA 1ZRMA 3W5AA 4ZREA 2GK3A 4AN1A 2W0MA 4CMAA 3PKIA 1TF2A 4TKLA 1C81A 1CUZA 2PYIA 4M9ZA 1QPBA 4L8GA 3WJAA 4IH4A 2D2VA 2Z57A 1YCDA 2PSFA 3P26A 1PX0A 3DG9A 1PK9A 1DQNA 2XVYA 4W5HA 5DNCA 2BDUA 2Q7XA 1QCCA 1XF1A 1Q6ZA 5AKKA 1NPDA 2WY2D 3DCIA 3CX6A 3QBEA 1TYCA 1MB2A 1CIPA 4XWAA 3R7WB 4AY5A 1NQXA 1E5VA 4UAVA 4X20B 1O96A 4D4IA 2VJNA 4R51A 2C4NA 4PFKA 3SXUB 3LTNC 1H5NA 4ND8B 4G84A 1RQ2A 2R5NA 3QVTA 2Z1DA 1IN4A 4ZGGA 2RGDA 3JQAD 4YRMA 2VT3A 2ZRKA 1VB5A 4NFYA 4F8EA 4PYMA 4Z5XA 3IKMB 3V4ZA 5FPSA 4JENA 2IEZA 3ZDDA 1RAIA 4KFSA 4B4UA 2IYAA 2ZUUA 5L4NA 1QS0A 5CCBA 3HHPA 2KM1A 5BN3A 5AK0A 1UP6A 4OO3A 2RMKA 2WWHA 2WHPB 4QD3A 3GRYA 4KBFA 4LMBA 1RJDA 3H4MA 4XR9A 2DU8A 1VSVA 4LJ5A 3WLSA 4ITUA 2D3WA 4UE3S 4MI9A 2FXVA 3DWEX 4NE2A 4L4SA 4XFJA 4GMFA 2C20A 4YO7A 4F04A 4N76A 3LFTA 5K0LA 4O1MA 5DCYA 4P2BA 3L07A 2ZDGA 4A1OA 5TQ0A 2NU6B 4TROA 1W4LA 3WK4A 4QUJA 2PMBA 1E1CB 3BRCA 1NNI1 2ZWAA 1YRAA 4WOCA 4YP1A 1MB4A 3L5KA 4L57A 3TQHA 1DBSA 5LCXA 3FOEC 1E58A 3X0DA 3GJSA 2HN9A 5DH9A 4XVCA 1QF9A 2PZ8A 1JR3E 4ZK2A 3QPWA 4NBNA 3ROXA 3ZVKA 2RHBA 2C04A 3L8FA 3SHFA 1FBTA 4S2UA 2C0CA 1ADYA 1ZUNB 4J1NA 5HUJA 1B7GO 2DXIA 1AKNA 1YT5A 2FR0A 4XYGA 2F43A 3PRYA 4HAWA 4HB0A 4N5IX 7GPBA 1VJDA 1UK6A 2L42A 3FUCA 1WVGA 3WSTA 4BL5A 4JWKA 2BR3A 2WJHA 1L5VA 2ZVQX 1LJUA 1II8A 4YI3A 1NJ8A 2C1XA 2Q1TA 3A0RB 1ESCA 2WIAA 2PZMA 4F9FA 2R1ZA 3OJ0A 4A8TA 3HJFA 3O94A 4FKBA 2FLWA 4HOYA 1SUFA 4S35A 4XH9B 5AVRA 3W1WA 4ZEVA 1L5HA 4GMGA 4URVR 3IDSA 4ZAVA 4MCAA 4XYBA 1PT7A 4O8ZA 4GRIA 1SUDA 1PJ3A 4L5CA 4MW1A 2NZWA 1P5HA 4YALA 5KNBA 4QXAA 1ICEA 2O3TA 4WXYB 1OH8A 5JQGA 3O03A 4BVLA 2LWIA 5BPHA 1M34B 3JZDA 4DWJA 1QSGA 5AHKA 5TMBA 3G0GA 1RXSA 3JQ9A 1GL6A 2IHNA 3ERCA 3OKAA 2GYUA 4JI1B 1L4GA 2O3SA 4FILA 4NMHA 1DG1G 3KXIA 2F3QA 3DT6A 1W5BA 2VTDA 1Q0HA 3F6BX 3TEFA 1QIFA 4DUGA 5JECA 1IFXA 1TQDA 4RO0A 5FNVA 4C29A 3DH0A 2NVBA 2EX4A 3IDZA 4YJGB 1XV5A 1RPZA 3F6PA 1BEUB 3KHKA 1P17A 4FFSA 4EGFA 5JTTA 2CNWD 3M89A 4DM7A 1SWWA 1D0VA 2OESA 3N6VA 1AC5A 2ZT6A 4CGZA 5A9SB 2J0UA 4ILEA 2JBAB 3HKBA 4GLLA 3AVWA 5BPFA 1NP3A 3DV9A 4XTCS 1N6OA 4NAVA 3T5GA 4XCXA 3DYVA 1H3NA 2ZE5A 4TT3A 3RG2A 1N34B 1NNEA 1U1IA 1V7ZA 3DBOB 3IKVA 5LFAA 4TVKA 4ZT4A 1YVRA 3ZUGA 4BN5A 2XT0A 3Q3GE 3WWYA 4DAOA 5LKRA 2V4ZA 5LMUB 2W6OA 4CKBB 1C5KA 2AFRA 3GEPA 3FDZB 3GUZA 1EX9A 2J30A 3C4QA 3LW8A 5F2EA 2VDRB 1FA9A 2XNDA 4A0RA 3SFZA 2NV2B 2YHBA 3M4YA 3PUWA 1VPDA 3MILA 3M3HA 3H9CA 2VJDA 3DJFA 1A2OA 4RA9A 5F73A 4RNDB 1CQPA 3RLFA 3B1VA 1KAGA 4I50B 3R2JA 1W5SA 4K2HA 1EVEA 4DLPA 4MUFA 4B4WA 1NSYA 1U31A 2AKAB 4KRGA 3OESA 3T7AA 1Q7GA 3W2IA 2PT6A 3OZXA 2BONA 5L3SB 1IAVA 1YI1A 3FFAA 1THZA 2VL7A 4M9CA 4WNCA 1TAUA 2ZUWA 4MW4A 4DV4B 2IYOA 4OHOA 2YRXA 1DARA 1MKYA 5LMNB 4TV8A 2X8JB 3O93A 1MAVA 2HMUA 5D7BA 5EHXA 2D2EA 1I94B 4BO7A 1SVUA 1E9BA 2WAMA 3WICA 2BM1A 1Y8RA 1HDGO 2H63A 1LBQA 5KC9A 3TGLA 4FUQA 3PJGA 3EXFB 2I3GA 3V32A 5JQGF 5G02A 3N39C 4A23A 4PFSA 3MJDA 4DCNA 3D4IA 3PEUA 4JBLA 3OEEA 3N7TA 2HSJA 2QRKA 3W2GA 4M0KA 5F3RA 4AF7A 5KJ6A 3GFFA 1U7DA 1VPWA 1OZGA 3BDIA 3B82A 4P36A 3AEUA 3MG9A 4S12A 2W4QA 4XUCA 1IN6A 4F72A 2IHZA 5CIQA 1TAHA 1U11A 2YWGA 3G9XA 1RI3A 2P3QA 1GN8A 3S5JA 4BE9A 5FNVF 4XB1A 4C2TA 3D3QA 1MP0A 3IVMA 5KVQA 4DTIA 1T4GA 1O7JA 1FBNA 5DASA 5K3OA 3DL7A 2GD0A 4W1QA 3O84A 3R7NA 1ZX1A 2MYNA 5D2CA 4G5XA 5F21A 1MHPA 4C3OB 2H11A 1GRRA 3FUXA 3GV0A 1N2BA 4XDZA 3SPXA 1T9KA 3GJ4A 4L6AA 1GXSB 4KO2S 4P84A 1G5QA 3DLAA 2RGXA 1VJRA 2WA2A 3N8HA 4X61A 2G1PA 2YDXA 4Y1RB 2FSHA 2JIRA 4M4SA 2VHTA 3HR8A 1GPUA 2QLNA 3QLEA 4X1IB 3S7TA 1VRVA 3V8EA 4DY4A 3IOBA 4YAOA 2W43A 4CKWB 1YHYA 2WE8A 1A5ZA 3CH6A 2IQIA 5LQKA 5FWAA 2NU8B 2FUG1 2IY8A 1S6YA 4IILA 4POOA 5MN5A 1A8SA 2AK2A 1TZBA 3UENA 2WWTA 1XZPA 4C0HA 1A9XA 1GUBA 1JEJA 5ALZA 3OPMA 2B2XA 1Q74A 4KK3A 1DV1A 2PWAA 2P75A 1XMPA 4CM4B 4C3VA 4P08A 1F2TA 3MB5A 4UNIA 1CY6A 6AT1A 1DXYA 1GPWB 1DAGA 1NRIA 4EKGA 3DV0A 1Y7PA 3JQGA 1OFUA 2I6UA 1SXJA 2YHSA 5G0SA 3HWX1 3OE7D 1FMTA 1SFRA 1SHLA 4DPLA 3O4FA 3NDJA 4YRAA 1D2HA 1PLLA 5FWXB 3MT8A 2R85A 2Z83A 3QF7A 2RH9B 4L9AA 3REQB 1EWTA 1QVVA 4R8KA 4TV8F 1O0CA 3KPVA 3ZXUB 2XVXA 1R0XA 3ZW7A 2CXNA 2FUKA 2PD4A 3G82C 3H0KA 5ALSA 3RCBA 5JSQA 1DWUA 1JECA 5AESA 3E22A 3KL4A 2WHEA 2PGAA 4FEAA 5JCJA 4YUZA 4U3JA 5C1BA 4UE6A 1TJ4A 3ROKA 5FAXA 3V8MA 2I78A 2NSDA 1MG0A 3QPCA 3HL0A 1EZ1A 2PS9A 2PRSA 4UNPA 5FHRA 1PZFA 3E05A 2PA3A 4FGKA 3H5WA 2AC7A 4QG7A 2FSPA 1CUIA 3I83A 4RF2A 2LV8A 3V4VB 4KTVE 3WGYA 4OL0A 1NVVQ 2IF0A 1ACJA 5BWCA 2YZNA 1E2IA 4C3ZA 6LDHA 5LMZA 3P97A 2BGNA 4LIPD 3RIXA 5K8VA 5AJXA 2O2IA 1SUSA 3FAKA 4R1UA 5ALOA 5HZHA 1R6DA 2P7HA 2PLNA 3CLKA 4H2DA 3VGJA 5BUCA 3JQQA 3LUAA 1JAYA 3RTBA 2HO4A 1MGPA 4ZQCB 2AHRA 5JATA 4GEGA 5KVCA 1R12A 1JYFA 2ZREA 4AZ3B 4K6CA 4YT2A 2YV5A 2QX4A 5C80A 3KEFA 4QQ8A 5D87A 3LKDA 1ULHA 3C8ZA 2GZSA 4RSRA 4U7PB 2IV3A 3R8CA 2X15A 5B3JC 4OX9B 1KZ9A 1YJ8A 2FMKA 1Z6AA 5IJWA 5C8DA 1QNFA 4G97A 1DTSA 2CNDA 3TM5A 4NYIR 2BDTA 3PQ6A 1CR2A 2OO7A 4TZKA 4IPTA 2P2CA 2ZT7A 1NLMA 4EG3A 4JB2A 1OC2A 2PD3A 1BX0A 1QTIA 1B3BA 5HFJA 4AJHA 2X9LA 3KR9A 2WTUA 1Q50A 2C4MA 2Z9DA 1ISHA 1ZESA 3JD0A 1GSHA 1UKYA 3K8ZA 4L0MA 4MCJA 2UZAA 3G02A 1A4UA 2OC4A 3ENNA 2M6KA 2CJYA 2FRXA 4V24A 1RRFA 2GLTA 4ICIA 3OM8A 4R5HA 4D57A 2IH5A 4IG9A 5KPDA 3OT1A 1RXEA 1X8LA 3BXGA 3GVHA 3Q3IA 3KQLA 1LTKA 1CF4A 1IDOA 4I1UA 1Q0PA 2J0QA 4H0FA 3UO8B 1QHYA 5ALPA 4BC0A 4HAXA 4F6RB 2ASVA 2OAEA 2QUHA 4XVRA 1H8EA 2Q0SA 3UHOA 5B4TA 3WGLA 4OGGA 2HZBA 4HB2A 4Q1AA 1IL0A 1GNSA 3C3XA 3GJ3A 4W4TA 4YDHB 4C4SA 4D41A 1IB0A 4FFMA 4YK7A 3I5YA 2R1TB 4I4LA 2AKEA 5DN6A 3Q3JB 4B45A 1AQJA 5AH0A 2QP4A 1KMIY 4Y18A 4C0SA 2HHAA 2HDWA 3IA7A 4RF5A 4ZEXA 5T41A 3AL0C 5GJBA 2D6FA 3AG6A 5FQNA 5LU9A 4II7A 3WGHA 4B09A 2QYSA 5JS7A 2AOXA 1P29A 2YXDA 3TNDA 3VNRA 1GGKA 3GJ5A 3HNOA 4RHYA 4CCAA 3LPNA 2CGEA 1OR8A 3F7OA 4MNTA 1G59A 1QV6A 1T9GS 4AUNA 4CM1A 1U8XX 3BBLA 3QNMA 4EGAA 4W63A 1YJQA 2QN9A 2QZ9A 5DT9A 1WXWA 2FETA 3MD9A 4LY0A 2M6SA 4BU0A 2F2TA 4CU2A 1XZGA 4D4JA 2JCSA 2I7DA 2ATEA 1JHMA 4XRRA 2JAPA 3ZDZB 3SLKA 1U2GA 1E62A 2NPOA 3IA2A 5BWNA 2PK3A 1W9HA 1P62B 3EF3A 2VXYA 1VL1A 5HUQA 4Y9RA 1NN3A 4HS4A 3STTA 3Q3EA 1VM6A 5IKMA 2PXAA 4OAQA 5I7AA 3RUHA 2AN9A 4R8RA 3ZX4A 4US2R 1K8XB 4CLOA 2E85A 2Y9MB 3KT3A 3DWFA 2VSXA 4UFNA 2GCOB 2HSZA 3A14A 2PJRA 3EGCA 5IEBA 3KM0A 4BQSA 3K31A 3GRRA 3V97A 4UCWA 5IS2A 2WKWA 4FMBB 1NW5A 2A3RA 5H81A 5GPBA 7YASA 1XFDA 4B3BA 1WPXA 3HJGA 4AURA 2RARA 4V02A 4Z4QA 2J67A 4Q05A 3AG5A 3DVQX 4P80A 1MEJA 1N3YA 5FJIA 2X0FA 2DSTA 2RKBA 3IAS6 4HNTA 2QKYA 1B74A 1YL6A 2QM8A 3GLTA 3UGJA 1KBOA 5F98A 1FJ2A 2XMDA 5EINA 4EJFA 3UPTA 3AUKA 5M2QA 4UPVA 5KDOA 4R9UC 1ECBA 1CNEA 4MJLA 3GRUA 1H3EA 1UM9B 4YAJA 421PA 1MF7A 2VRCA 1NYRA 5C31A 1VMKA 3M2PA 3ZX5A 1ZLXA 1RAAA 1X94A 5D85A 3VYVA 4UVIA 3PHJA 2V58A 5REQB 5EYPA 3EF0A 3RIMA 2ATXA 5CUQA 4ZODA 2DUUA 4BKUA 3QJGA 5AW7A 3QEBZ 1JDPA 2WEKA 2WVGA 1XR3A 1JJBA 4D7AA 1O87A 4L9WA 4NQZA 5HR5A 2F1KA 1G19A 5K3CA 3SE7A 4FOPA 5T5QA 2Q6VA 1XA4A 3LCCA 2BMJA 4OK6A 1KJWA 2IHTA 2C5HA 4HDRB 4OSEA 3SSOA 5JROA 4QGGA 3VSBA 4Y2YA 3DAHA 3OQBA 2DLNA 2VJQA 2FW9A 2ZSIA 4I1IA 5EUMA 1Z34A 2VYCA 2R65A 4F5WA 4F4DA 1V41E 3U3RA 1DAMA 4F3CA 4ZVKA 5JI3E 3QMMA 4M0MA 2BISA 2M2IA 3N53A 5DLDA 4HGQA 4XSVA 5JZOA 1TEXA 4YFVA 3K72B 5BN5A 5FP0A 4BZQA 2PDAA 3EQ7A 3C98A 5C51B 5J5VA 2H7YA 2GPNA 1VGRA 3P9CA 4LXHA 2CXHA 2GHRA 2FPLA 4MA0A 4N6NA 5K3EA 4RTSA 2P6PA 3FROA 1J1IA 3NBKA 1G8FA 3OBBA 1E5QA 4GPBA 4CKCB 3JZIA 5EGNA 4PN3A 3GU3A 3HB9A 3RUPA 5KVVA 4CG1A 3USZA 2XB2A 1Z4QA 3UHAA 2G83A 1BHJA 1PHRA 2D7CA 2QEQA 4LYAA 3IYLW 4FLFA 1STOA 4RV4A 4Q4CA 4UMDA 4Z4GA 1KIFA 3SC2A 2DWOA 2X77A 3KQSA 4C2AA 2RDMA 3FNBA 4J07A 5AKEA 2GF0A 4X9XA 1Y1QA 3AHGA 4V0ME 2H4ZA 1KEVA 5CDHA 5IZCC 5CVJA 1GT6A 1A97A 1XE3A 4MWBA 4LQ4A 3MGCA 3IP7A 3UATA 1GUFA 5DSTA 5K8IA 2GNAA 2K87A 4EY3A 5DI3A 1G9SA 1PYGA 4A8PA 5JISA 1X1RA 3IEPA 1G20A 3P8ZA 2PYDA 3FG9A 1UXIA 3C8UA 4KQWA 2BKEA 2PAFA 3NYIA 2NACA 2XUPA 1ZW1A 3DFZA 5BWMA 1DJMA 3S8EA 4HNGA 1KI1A 4LJSA 1GV0A 2D0PB 3GMTA 4RADA 4ZARA 1C9YA 3W0LB 1TCCA 1QP0A 3EGXB 1RWWA 3UCFA 1Y5NA 4QXMA 1ZN2A 3IUPA 1OFVA 1PL7A 2JCBA 2QR5A 3QUQA 4FLEA 5AM3A 1M8FA 3IB3A 3NATA 1HXHA 1TVMA 1GA6A 3HM2A 3FTEA 3RRMA 2R84A 3WC4A 5I7WA 3S81A 1UBMS 2ZAOA 4ID3A 3ZLTA 5KVAA 2I4MA 3MMXA 1DAPA 2OFPA 3I42A 5I8PA 3O92A 4QHTA 4GPD1 1ZD5A 5KQSA 5BQOA 2V45A 5JRZA 2ZE8A 1A5AB 2R7AA 3PHGA 3T7CA 3HBFA 3NBUA 2P9EA 1TA4A 1EFHA 3DDUA 3E3NA 4NULA 4U2CA 4D46A 4AZTA 1JSXA 4MVJA 3GGJA 4CN8A 1ZA2A 4PO8A 2YYSA 1E2JA 1N7HA 2J87A 2WUDA 1DB3A 1DRKA 1NLFA 1R6UA 1UZMA 3A1FA 3SX2A 3DVLA 4L3WA 3KOOA 1V7QA 1IJEA 2GAJA 3NHLA 3LRXA 2FPUA 3SYTA 3EN0A 2C7RA 4BNKA 1YR1A 1TJ5A 4O02B 3SQOA 3SK0A 4F71A 1FU8A 5KSPA 1ORRA 2XJ9A 2D7JA 2UXBB 2FPGB 3AEQB 1OPRA 2J9GA 1KFJB 3CUUA 1TTQB 3AOEA 3OLWA 4YS6A 4V2UA 4CG3A 4DADA 5KYUB 1PNTA 3C6ZA 4TL7A 5TJ9A 4ZVOA 2YZKA 1Y8QB 2RHJA 2X1VA 1DMRA 2PT5A 1Y7TA 1CS4C 4TS1A 1GDHA 1GNTA 4Y3UA 4AX4A 5ED4A 1IEQA 5CYOA 4QSMA 1XRQA 1GU7A 3LFUA 4BX2A 1QIIA 2EZ4A 2EIXA 1V9SA 2VHWA 4L3OA 4RKEA 2GB4A 4S3MA 4QXPA 1ZO8A 3T4PA 4NARA 3AEKA 3ZXYA 4I4TB 4CODB 4FGJA 4HX2A 3QE9Y 3EX7C 1C3EA 1E7RA 1K3FA 2R60A 3AERA 4CEJA 1OIWA 3THRA 1R4ZA 1OAOA 1N6NA 3ESYA 4DIUA 4M49A 5CGQB 4B81A 3EQ6A 4ABTA 2AUTA 5DP1A 1KFCB 4IIJB 1NY6A 1VJ0A 1KR5A 2EFHB 3ICOA 1D8TA 1GFWA 3FCOA 1GZ5A 5AI5A 4CTMA 4NHEA 4ENQA 5IBPA 3AVXA 4BVKA 2WV7A 1MFPA 2OFWA 4I3FA 4Q9NA 1B3RA 4MVWA 4Y9SA 4YH1A 4B2LA 2RK6A 2OZLA 2O5CA 4UUMA 3K0AB 1H22A 1C1DA 4IZ6A 2HDHA 2GCEA 1P5JA 3IT3A 1ID8A 2WIBA 2JFBA 4GSYA 1XZBA 5U1PA 1GTSA 3JZMA 4LHYA 2BSAA 3L4JA 4CPDA 2Q3CA 4JSRA 5EIWA 1AA9A 1M1ZA 3CVJA 3ER9A 3ABOB 3K9BA 2VP5A 4H7DA 3UWSA 1EUYA 1RZVA 4E5SA 2QPAA 3ED5A 4BNDB 3PXXA 5IM4A 3WAKA 4RAOA 2ZRGA 2MINB 1JT9A 1CVIA 5AW6A 4HRAA 4RTJA 2YVKA 1R15A 3DDZX 1WNFA 1TCBA 1FYDA 2BMFA 4LX8A 2AMFA 5H1YA 3SMQA 3UMYA 1EGHA 4MVJF 4D92A 3I9MA 4Y0VA 2GR9A 1H8HD 4RY9A 1XZKA 2CWWA 4OXXA 4G1FA 4AMZA 1C3LA 4IOJA 3C97A 3CGGA 4BLPA 4WZAA 1KDOA 4QX6A 2IH2A 1QR2A 2CXUA 1NYTA 1COZA 2DE0X 3D64A 3N87A 2RAPA 1SBYA 2P90A 1WA5A 2H2IA 2W2KA 3PXAA 1WVIA 1M9NA 3HADA 2EP7A 4K9SA 1QX4A 4QVGA 3EIOA 4AJPA 5JZMA 4NENA 3AILA 4TXMA 2GFIA 1J9EA 2HWYA 5T67A 2HMSA 5H02A 4QELA 1AY0A 1UC4B 2CBZA 3LBYA 2HMWA 2IZ7A 1X2BA 3M33A 4DEXA 1C1HA 1NFFA 2PTGA 2OCGA 1LSOA 1RE0A 3GPBA 2J08A 3QF4A 4KYIB 1PF7E 2XYVA 3F1KA 5FD8A 1Y42X 3AY6A 4GU5A 1NW4A 2ZR0A 3TD6A 4CQNA 3WNQA 1E8DA 2HTEA 4ZHQA 1HG1A 4CM3A 1BRTA 1UBTS 1JTVA 3L40A 4RPHA 2O59A 1POXA 1AK9A 4EEZA 2FMTA 1KE1A 2DLDA 1ZM4A 3ORRA 4UTXA 3Q8LA 2AVNA 5DGXA 4K88A 1K92A 1TOAA 4DCGA 4DQLA 1RHKA 3AU8A 3I5AA 2CSUA 2H08A 4L7QA 1ZCBA 1SM4A 1QAOA 4JBXA 4NBKA 3TAHA 3R8FA 3W79A 4RK0A 5KKNB 1TADA 3AFMA 1R9GA 5TC4A 2BEUA 4Y2XA 3AESB 5LP6B 1OWPA 1TJPB 3KLPX 3K9CA 2ZBQA 5IX8A 3GGDA 4TTSA 1AKVA 4MPRA 3C1TA 2PLWA 1KI8A 1YR3A 4Y2SA 1WSBA 2AQHA 3T7KA 4Q7JB 1Z4MA 3OTIA 1YJBA 4P0TA 3LKVA 3CLTC 3KZCA 4O2RA 3PD7A 2G0AA 4KG7A 5IJ0B 5LXTA 3D0RA 5IM4F 5KB3A 3RHTA 3AVYA 1H05A 3UUEA 4JLPA 2Q21A 3QG1A 4HWPA 5DX0A 3WMXA 3JU3A 3EWAA 3CRMA 4PZDA 3IUNA 3TTWA 4NR0A 1ZITA 5DNUA 4ATNA 1I4WA 5IZ4A 3HP7A 1EUDA 1XPOA 2IYEA 1QK3A 1WMFA 4Q3LA 4Y9DA 2IS4A 1R4MB 1KR2A 2F9LA 2Z4RA 1IHOA 3KHUA 5BW5A 3ZOKA 1HDEA 2IBMA 2X6TA 1W1WA 2XRFA 1FSFA 1A76A 2ZYRA 3PIIA 4JP3A 2FP4A 3PUKA 5EA2A 1E0DA 4HQRA 4WPGA 4B3DA 1JF8A 3FY4A 3MM4A 3ZNOA 4BV3A 3TLJA 3FOCA 3NDIA 1JFTA 2FRVA 3W06A 3VU0A 4EA6A 4EJSC 5BUQA 4CG0A 2ZT5A 2C07A 2ZU6A 4QPJC 3RJ5A 4D42A 1IXYA 2IELA 4E70A 1VIAA 1GGFA 2W6ID 4IKOA 1L4YA 4RIHA 2Z6UA 2V7QA 1W1IA 3KHSA 2OYRA 3VOAA 5K0GA 3I39X 5EZ5A 2Y92A 2I3AA 1ZM2A 3EBPA 4DV1B 2OUIA 3EGOA 1E2MA 1V37A 4K9OA 3D6HA 4QJ4A 3HDYA 5DRTA 4E12A 1XZIA 2HA0A 3OEHD 3G2KA 3HM9A 3VZCA 2PX2A 4Q18A 5J3JA 1N5IA 2I2DA 2XUDA 3I9V6 3O8RA 4FEGA 2F3RA 3N0WA 1BVYF 5E2AA 4BJ5A 2GEBA 1RHMA 2PYZA 3TS1A 4ZHQF 1UFRA 2PUWA 3AHEA 4KK4A 4M99A 4WLVA 4YC7A 1W0JA 4LFBB 1DQPA 2BEWA 2CLFB 2FZKA 1VHWA 2XQGA 5L3RA 1IZ0A 1NASA 2KMLA 1J0AA 4GX1A 1KDYA 3ZI0A 2DFDA 2FEMA 3IMEA 3MJTA 2FFBA 3KTAB 1IHYA 4BDSA 5AM4A 4U2GA 4DQDA 3TWOA 3IQHX 3EPJA 1NGSA 1UPBA 2JF0A 4HL6A 3VDXA 1DDGA 3A3NA 1M2JA 2I2AA 1PQUA 4D97A 3JALB 2CCGA 3NW9A 4R8MA 5FBVB 1KL7A 2O14A 3R5TA 4O8CA 1JAZA 3VFDA 2OZKA 2Z3VA 2YCLA 1UJ5A 4FFVA 2I9KA 3U48A 4XLZA 3E9ZA 3NT5A 1C7QA 3QOYA 3HA3A 3DO5A 1PJ8A 4EPXA 4HNQA 2C31A 2C3YA 1XDGA 3O0DA 5CFZA 3W6UA 1F4VA 3CEAA 1CNMA 3M9XA 3AUXA 1U1FA 3RFTA 2VBIA 1NBWB 1WIWA 2Z08A 4FYYA 1D5WA 2WTAA 3DYBA 1SCIA 3RS9A 1IVNA 1QG4A 3FNRA 1TUBB 1UOPA 1OTHA 5LXTF 3DT8A 3LT5A 3G2HA 3U49A 4MR7B 4HVTA 4GHWA 4UW9A 1F20A 2O2SA 2W11A 2XDYA 3ISJA 4CDMA 3ILSA 3P4YA 2IY7A 3OQPA 3QX8A 4RHCA 5G2OA 4B6SA 1JWAB 2PUTA 4JI0B 1WMEA 5TMEA 1C4WA 1IXKA 5EPEA 3UV7A 1QQTA 3NNSA 1U1EA 3MRXA 1T6BY 2NXCA 4OHRA 4CETA 5JZ9A 4ARIA 4J1TC 5ADUS 4CEHB 4JU8A 4MI3A 4A91A 3AIIA 4XWKA 2JJQA 4E1VA 1CTQA 1OYOA 4WMLA 3K1TA 4EHIA 4EVSA 5K6AA 1DQYA 1FMLA 3AX6A 3BB1A 4X63A 3ZBUA 3EZXA 4MUAA 3PGKA 1TZ2A 1UDCA 4KQKA 3A4LA 3NONA 4I5EA 2AOUA 3ZI4A 1OA0A 3CWCA 3NBYC 3PX3A 1ISPA 4NYMQ 4RK1A 1T43A 1OF1A 2BM8A 3TLBA 1JG7A 4LE0A 1KSFX 3WFJA 5BRJA 1W29A 1I2ZA 3KKKA 5EFZA 5FB3A 2VYNA 4U1RA 1W25A 4G9GA 4CNBA 3OZ7A 1JWLA 4U5XA 1M1UA 5HQTA 1UEJA 3LCVB 4KFUA 4J0CA 4E07A 4MUIA 1LWNA 2W8BB 5ALHA 5CVUA 3KLMX 4E94A 2JIZA 4BHTA 4WLOA 1ORIA 3BAZA 1GITA 4C0BA 3HACA 4MP3A 3ADOA 2CMHA 3SBOA 1EVZA 3GT7A 4MA4A 1ECLA 3WLNA 1Y7HA 4EFDA 1U2PA 2EGGA 2OY0A 2P40A 3DDNA 3EW7A 2V7EA 2VCYA 2WOJA 2JZOA 2EGUA 4PO3X 4DQUA 4B8ZA 1P0PA 2HU5A 2W2PA 1JJAA 1Q7TA 5CB4B 3NQ41 3QHPA 2HWUA 4MLPA 1X1SA 4AY6A 3L6RA 1PTJA 1REQB 1M0SA 3Q7PA 2XCOA 4R8SA 1S3FA 4TWZA 4LVUA 2AOTB 3D0QA 3NAQA 5E4FA 5JMPA 1K2VN 3IOYA 4MO2A 4KBGA 4ZCQA 1ZJ5A 3WJ2A 4GG1A 4MP6A 1S9DA 1X77A 1QHHB 4NOKA 4RPCA 3NIBA 3CR7A 3G7SA 3RDPA 4B74A 5MGNA 2AG5A 1SPBS 2R7MA 3I4FA 4IIVA 4IO1A 4OGFA 5T4FA 1SQ6A 4AJ9A 1C9EA 4ZWNA 4BRZA 3W6ZA 1NT2A 2O2ZA 4IH1A 3ZW9A 2XWBF 1A8UA 3L8YA 3TLMA 4NL4H 1GQOA 5EXSA 2J45A 4D4MA 3SJBA 1FP4A 5E3HA 1VL0A 2XHEA 3HA5A 4KXWA 2AMLA 2X6RA 2E18A 4W7IA 1YKFA 4DWWA 5HMLA 2CEAA 2MWMA 5AQEA 3BWXA 4K9LA 3KTFA 3NIGB 4HDSA 2AYZA 4FYIA 1QAMA 3LY9A 3SFTA 3PIDA 4IJKA 2RHOA 4UNRA 1SQ5A 2JGDB 5J9FA 3ZJYA 1SVKA 5CCEA 2H1VA 5FPKA 5AYVA 2P9CA 2AC2A 2ZDQA 2R8BA 3P2EA 5AWFC 1RRMA 3TSWA 3WADA 4LDPA 4TSRA 1M2VA 1OYVA 2B4QA 4K6MA 3ON5A 5FUMA 4MPPA 1LC3A 4C05A 2PMCA 5IC4A 1E3WB 1GPBA 5A3SA 1PFVA 1E4EB 3QFFA 3ZD8A 2I4IA 3O4RA 4C4XA 2D54A 5DSZA 1OAKA 1R3DA 4QEKA 1YRYE 4BNGA 1MJGM 2H1FA 2JI9A 5ICSA 1Y9AA 4DA8A 2DRIA 3C8DA 3OO0A 1IK6A 1QGZA 3LM8A 3MLEA 4GYYA 1XEXA 5FWDA 1PIWA 2F1JA 5I3CA 3CHYA 2EWVA 5H3CA 2IBSA 2EP8A 4RK7A 1H5QA 4MOWA 4NZMA 5ITVA 4WKPA 2JGAA 1TJNA 2FY8A 5CA0A 5JWHA 3NKLA 1VLLA 5JANA 1MA3A 3NGLA 2ZYDA 5JNLA 3NJ8A 3R75A 4YXWD 4Q12A 4KSYA 2CE7A 3BKXA 3RKSA 1QB8A 2ONYA 1ATZA 1GZSA 2GN8A 1JHYA 4L3VA 4PC7A 2NNLD 3OT5A 4QUKA 3H3XA 4HYTA 5G0UA 1QH8B 5AOVA 3COJA 1J5XA 3PQ3A 4XYMA 1ILWA 3ECCA 4GWGA 1NTRA 3OEWA 4NHOA 2C92A 4TUYA 4XEHA 3R9KA 3WWEA 2CMKA 4BB0A 1D2EA 1I51A 1X13A 2BKUA 2HK9A 3EVGA 2GCPA 5ERGB 4E3ZA 4OQYA 3WNDA 2UYGA 3I2KA 4U6NA 4F8YA 1R66A 2Y1EA 3EZLA 3QX7A 3BCUA 3RADC 4PYRA 3CM0A 4AIRA 5KTTA 2O8EB 4B48A 4NBLA 1F9AA 1K88A 3Q8WA 2YJ6A 1BWPA 3JAKB 1LK7A 4KV9A 1NMEA 2WJ6A 3CO5A 3NYQA 2NG1A 3A6HA 5F12A 3WK7A 3ACDA 3VX3A 2NO5A <