4D9CA

Pmp bound form of salmonella typhimurium d-cysteine desulfhydrase obtained after co-crystallization with l-cycloserine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
328
structure length
328
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-Cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 117
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9cA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9cA02
4D99A 4D8TA 4HPJB 4D9IA 2ECOA 3VSAA 1E5XA 4ZQCB 5I7HA 4HN4B 2Q3BA 5I7WA 4IL5A 1C29B 1KFCB 1O58A 5B53A 4COOA 1K8YB 1BKSB 2Q3CA 2CLMB 2O2EA 2CLLB 3L6CA 4D8WA 5I7RA 5I7AA 1J0CA 1X1QA 3PC4A 1QOPB 2ECQA 4D8UA 2JC3A 5DBHX 1A50B 1VE5A 2J9ZB 5DVZA 3IQIX 2RKBA 2PQMA 1J0BA 3IQGX 1K8ZB 1RQXA 3AEYA 4I1YA 2CLEB 4Y6GB 1TZJA 1CX9B 2TRSB 3VBEA 2V03A 1K7EB 2EGUA 3BM5A 4D9KA 3R0XA 2CLOB 4NEGA 5T6MA 1TZ2A 3ZEIA 1PWHA 1WTCA 3IQHX 4QYSA 2RH9B 1Z7WA 4D9EA 5KZMB 1BEUB 1D6SA 4D9CA 5I7OA 5BW6B 4HO1X 5D84A 5B55A 4OFXA 3PC3A 1UIMA 1M54A 3SPXA 4AIRA 4D9GA 3FCAA 1C8VB 4D9MA 2TYSB 1CW2B 5JJCA 4L0DA 2TSYB 4L28A 3V7NA 4XUGB 1K8XB 4LMAA 1UINA 2BHSA 4OREX 1QOQB 2ZSJA 1WDWB 1TTPB 1TTQB 2ZPUA 1KL7A 3X43A 1J0DA 2ISQA 1V8ZA 1A5BB 3TBHA 2GN0A 3DKIA 2WSYB 5J5VA 1PWEA 3L6BA 4JBNA 4D92A 1P5JA 2J9XB 1F2DA 4L3VA 2GN1A 3L6RA 1FCJA 4F4FA 4HT3B 4D9FA 1WKVA 1TYZA 2CLKB 5HBGA 5JISA 3T4PA 1VB3A 5B3AA 4D97A 3SS9X 1J0EA 4H27A 2O2JA 5IW8A 4WX2B 4AECA 2CLIB 3SS7X 1A5AB 5IXJA 3DWGA 5D87A 1OASA 3VC3A 4D9BA 4ZU6X 1J0AA 1V71A 5D85A 2GN2A 5KINB 1Y7LA 5B36A 2C2BA 4JBLA 2DH6A 1TDJA 2CLFB 1A5SB 2D1FA 1K3UB 5CGQB 5DW3A 1KFBB 1FUYB 2DH5A 3HMKA 5EY5B 1TJPB 3CEPB 4D9NA 5IWCA 5J43A 3VSDA 2Q3DA 4HPXB 5D86A 1K7XB 1KFEB 5B1IA 3RR2A 3VSCA 3AEXA 5DW0A 4LI3X 5I6DA 1V7CA 3PC2A 1KFJB 1TZMA 4L27A 5E0KB 4D96A 4LMBA 3IAUA 2RHGB 1K7FB 1UBSB 4KKXB 4PCUA 3DWIA 1JBQA 5CVCA 1Z7YA 1VE1A 3FGPA 2C2GA 1C9DB 1KFKB 2BHTA 2CLHB 3X44A 5DBEX 2EFYA 4ZU1X 5C3UA 5B1HA 1WBJB 2ZR8A 3PR2B 4NU8X 2J9YB 3R0ZA 1TZKA
chains in the Genus database with same CATH superfamily
1BZYA 3JQ7A 4MJXA 1OBFO 4TKZA 1C9MA 1T15A 2AL7A 4IWXA 3ZBQA 3SMQA 1D2MA 1CB0A 1GPDG 2HSWA 3FY4A 1CUUA 3CLTD 1EINA 1E4OA 3DOOA 3QV2A 5IAJA 3WIUA 3CQ9A 3B9QA 1RCTE 1RJ9A 4WLOA 1PQPA 1U3UA 1Z74A 2RGEA 3KXLA 2QLNA 1QYCA 4PHHA 1VPWA 5DISB 4B6FA 3AEQA 1R5JA 3F9IA 4CUKA 4D3DA 5I8PA 4U2GA 5TJ9A 9GPBA 3A1NA 3K8QA 3FDJA 4IJUA 4WIAA 2MCFA 1CUSA 3LPNA 4RCVA 1U65A 2XVYA 4K86A 3OETA 4MA0A 2FOLA 2WIJA 3FXAA 2HBZA 5FHQA 4D2IA 4M2LA 4G1EB 3U5TA 1D6SA 1D1TA 1IXSB 2GBLC 2XADA 1C14A 1G8JA 5HUHA 5B55A 3C7CB 3AUTA 4LQ4A 4FGWA 4HPWA 4FWIB 1Q7CA 1G9TA 1WQ1R 5DWQA 3V48A 1VKZA 3O3OB 5KOYA 2R66A 3PXXA 5LMCA 1E1QA 2Q1SA 3UK2A 3MILA 3FNQA 1V5IA 5DZSA 3EQ8A 3LQQA 4KWCA 1GT91 4B3GA 5BWNA 4WADA 3B2EA 4WBNA 2J67A 5KJCA 1G2IA 2IYUA 2G36A 3OFJA 4D81A 2Q6IA 4B3SB 2VWPA 3I8OA 2GLUA 3SSOA 5IC5A 1V3VA 4UTPA 4K9DA 1HEUA 2XCTB 4YP5A 3VH2A 1H2ZA 1U1GA 1S02A 1Z7BA 3VPCA 3KPVA 4TYMA 4EW3A 1TCCA 4HUQA 3TD6A 4C05A 4EGQA 5ICEA 3CSSA 1H5UA 3AVQA 4EHLA 4LVNA 1DNPA 5J63A 4X6UA 5EN4A 2FR0A 1AXEA 3G1WA 4ZPJA 1Q0PA 3ZGYA 1BFUA 3DKVA 2WJAA 1X2EA 4IIXA 4MI1A 4B5KA 5CT5A 4RD3A 1O94D 1P1RA 4Y7CA 5JCJD 1L5FA 2C4NA 3G2OA 3UG6A 4BO3A 4BEJA 1KR5A 5LZ5A 2NUAB 2QD4A 3LCMA 3OZVA 4K2AA 4JJIA 1LLUA 1P19A 4QQ8A 1VGQA 4F9FA 2P5TB 3RT9A 3U6KA 1S2MA 3FOAA 1AKUA 1LV7A 2C3OA 4WI1A 1XJCA 1RPNA 1QU2A 3P52A 4HDNA 3EWNA 3ZU4A 1M6YA 3VC2A 1EHYA 1ZJJA 4WN9B 4ZYWA 3DBLB 1VIYA 2CUNA 2PXCA 3AW8A 2JH9A 1KSHA 1I32A 4G67A 3UAVA 2PQ6A 4WFJA 4ZVNA 3HVUA 4G9BA 4BXOA 4NH0A 4KQHA 4O4LB 4EHJA 3NASA 4X5OA 3PQ8A 2WPNA 2Z8XA 3E4DA 4HEHA 1DAKA 1CZKA 4BDSA 4IO1A 4A1OA 4HFRA 1COWA 2BHTA 3BZWA 4G25A 1O5IA 2PKCA 1QDLB 3KC2A 2NV0A 1EQ2A 2OBXA 3NX4A 3S1AB 4CWAA 1E60A 3NU1A 5FH9A 3G82C 3JQEA 1GZ7A 3OFSA 2R84A 2IIVA 2E4AA 3H97A 3KT0A 4O4LF 5G4KA 2Q2NA 1DXHA 2P9BA 5JALA 4KLRA 4MQMA 1GPUA 4IOMA 4RVNA 1AHNA 3MT7A 1ECPA 1VHLA 5A71A 1U0JA 2YJ5A 4CM8B 1VLVA 1Z33A 1OBCA 1JXMA 3H16A 2VKTA 4FGJA 5FNVB 4YCNA 4OX9Y 1JXQA 1QZTA 5JANA 1U28A 1Y6QA 3I6IA 4WV3A 5JBIA 3OKPA 1FDIA 4LYGA 1AURA 2ORYA 3HB4X 1FTSA 1GGHA 3IUEA 1L8OA 4XQGA 2IEDA 4BOYA 3UMYA 2H2GA 2VSOA 5HKKA 2F17A 1K5GA 2JCBA 3D6VA 3OI7A 1J20A 2Z2JA 4JQOA 1WUIS 4BCDA 3H17A 4F3RA 2IUTA 4IIUA 1ZU4A 4JSRA 4MVJE 3UHOA 2FK8A 4NEGA 1X7YB 1A9OA 1C1HA 1DZIA 1I2MA 5FNVF 5TE9A 3L7OA 1C30A 3V7WA 4E5MA 3I5YA 3EZXA 1CULC 1OWPA 4X20B 4P7JA 1VLZA 4U63A 5EERA 2XMQA 2VJOA 3EC7A 4PV7A 1VJCA 2ATXA 3FG9A 3KXDA 4IV5A 1RRFA 4K88A 3DDOA 2NU8A 1DAHA 3VH4A 3PUJA 2QK4A 5CJJA 1QG2A 1J39A 3QEAZ 1EUDA 3ENZA 1LS1A 3EC1A 3W5VA 2VXBA 2FUG1 3DBIA 5AM5A 1SCQA 1VP3A 2PSHA 3B89A 4YJDA 1IG3A 4IYRA 1U0OC 3WYFA 1N2HA 1NPYA 5B4UA 4K03A 4WECA 3ZWPA 3IBGA 3H0CA 3M81A 3M82A 4TQAA 5BURA 1M67A 4NH4A 2HHJA 1JS1X 2AZMA 3G5UA 3O2NA 4H1UA 3WKBA 3KSRA 3J81k 3OOWA 5BR1A 4DOMA 4YUYA 4UBOA 2GNAA 1ECBA 4YDHB 5EP1A 1NDHA 3M0EA 4GMDA 4NCKA 3UENA 1VCMA 3DTVA 3DE1X 2XJ4A 3I2GA 4OKNA 2AN3A 4UU8A 4X1KA 4RSRA 4UVIA 2FMFA 5H4HA 2CL5A 4LPKA 3V7UA 3A05A 4BLSA 1M2WA 3EQ2A 1XD9A 5CFZA 1LDBA 5IW8A 1NTRA 5LDHA 1YQEA 1JL3A 1XU7A 4GI5A 3VU9A 4KACA 1EX9A 1TQ6A 3V55A 3BGOS 3K05A 3MJSA 3GEDA 1HSOA 2X2EA 3Q1KA 1ODCA 1DADA 4L7QA 2EZ4A 3GO4A 3I39X 5LZ4A 1J06A 3R7BA 2ZIFA 3DZIA 3NAGA 2NVBA 5KVVA 2WJYA 3ABOB 3HMKA 3DZJA 4FCTA 4OXXA 5ECDA 4MGKR 1S4MA 2XWPA 4IDFA 4M88A 4LNHA 4XM2A 3O4GA 5AI9A 1WCIA 5DWVA 3DYIA 3ZLTA 4LI3X 2GCOA 4HZIA 4MDHA 4E51A 1G7CA 1HG0A 3G2PA 1R5NA 5KYNA 1JQKA 4D96A 3CM0A 4Q82A 4B3HA 2OK8A 3KOYA 4RHXA 1FLVA 5C5EA 4RE5A 1EFHA 3ZGNA 4YS6A 4EP1A 4LZLA 4B4UA 1RWQA 1A04A 1ZUNB 3FFWA 5FBLB 1E2IA 2F3RA 3GEGA 1QTRA 1M8GA 4O4HA 4UM7A 5ECYA 5C5DA 3Q5DA 2HPZA 1R5OA 3DT6A 3VAAA 3I01M 3JWHA 1P4RA 4URZR 3E8XA 4CDMA 2ILVA 3CH7A 1X1BA 1IAVA 2DHDA 2HOQA 1YR1A 2X0KA 4LECA 4R51A 3ZS9A 4GG1A 4QAJA 3EXIA 2OSVA 1A50B 2H85A 1WCV1 4RA6A 2VH2A 1CNMA 2ZTMA 5HA5A 4F2DA 5KB3A 4L8FA 2MHCA 2O6HA 4NDZA 3EPRA 3EFOA 5ULLA 4DA4A 3V9AA 2ZIUB 1T5IA 6LDHA 1ZGCA 4DQDA 5JAQA 3QMMA 1C80A 1W5BA 4RD1A 3UWMA 3A0RB 4ER5A 5A5GA 1KI7A 2KPOA 2B30A 3FPBA 1ZIPA 2LD4A 1CYEA 1OAAA 1ID1A 4BJ1A 2E87A 2ERCA 2P77A 2ZWAA 5LL6P 3A4MA 3NH9A 4CMBA 4D42A 3M89A 4QTUB 4Y2RA 4Y18A 4QREA 2IYEA 4HGRA 3RC9A 5CJPA 4XVQA 2B6HA 3HXQA 3IQXA 4RVHA 1IQRA 2JJ2A 2ZZNA 2WF5A 2BFDB 5CCBA 1FXUA 1CY2A 4C01A 2OHOA 1Z08A 2BGTA 1UT5A 2BE9A 4LXGA 4Z9XA 2FF7A 3O4HA 4H6VA 5FORA 3TI9A 3TLYA 1XMOB 4MCIA 1W4BA 1W49A 3NTOA 5DXAA 3JQ6A 1TMKA 2AJ8A 3K73O 3HN7A 2I1WA 3DNPA 3LKZA 1SZDA 3LYHA 1KQOA 3BKWA 4F3YA 5CIQA 2G07A 1YDGA 3DA8A 1N0WA 3RVLA 5LYJB 2VHZA 3UUGA 2ISQA 5DTJA 2ZUWA 5FI0B 1SHTX 4K8RB 4DG5A 1AQIA 4XPIA 5GJWC 2V4UA 2QZJA 3QVJA 4D0SA 1TD9A 3ZH9B 2WE7A 2IA5A 5CM9C 1P5JA 1XRMA 2GI4A 5EJ7A 1ZW1A 3RADC 4M1EA 4E5DA 4UEWA 3ZE7A 3HBLA 1MJFA 4HT3B 2XBLA 3QY9A 4L0MA 3AR7A 3TDKA 3D6MA 4DLKA 4XARA 4YALA 5LYJF 2PSJA 2AXPA 2F6RA 3K09C 4MAMA 2C2MA 1N5JA 1GV0A 2J6BA 2FEWB 4R1MA 5C32A 2XF8A 1KEKA 4YONB 3ZLJA 4FGSA 5ELXA 3IHLA 3ZN2A 3ENVA 3BK1A 1WDMA 5JDIA 2Z3ZA 1HA3A 1FP6A 2GASA 3VHXA 4UZEA 2PKYX 2BZGA 5D85A 5IXYA 3R6TA 4HYTA 5TS2A 1Z6TA 1IBKB 4EVQA 1XT6A 4QIHA 2SKCA 4HTAA 2K87A 2V3VA 1X9GA 5JCXA 1U3TA 1G2PA 1T8RA 4I55A 3F5DA 5CG1A 4GHWA 1I2ZA 4RNDB 3ZWDA 1E4VA 4GYKA 4M3NA 4HHEA 2ZUCA 2YASA 1ECLA 1NBIA 3U40A 2NX2A 3ICVA 3Q87B 2CVZA 4P4NA 2NYUA 3DOFA 3JQ7B 3SVLA 3L82B 2ZEJA 3G9TA 1D2EA 2ST1A 1PJLA 1U90A 2Q5JA 3U3ZA 1BE6A 3NBFA 2BFBA 4L4SA 1A8SA 4X24A 5LBUA 2QTCA 3U7IA 2OZLA 5AHWA 2OTCA 2PH7A 1PSZA 4PINA 4B17A 1AV7A 1G291 1SBHA 1RJ9B 2M6SA 4KSYA 5U1PA 4ZEVA 2AJCA 2AIRA 5U9CA 5BQPA 1UBCA 1DHTA 1D4FA 3PQEA 1T5OA 1TAQA 1KO4A 2L19A 5ERGB 2RH5A 2GXSA 4PZEA 3GGGA 2O5EA 5HILA 5K5EA 2ASVA 4PQFA 1RKUA 1UBOS 4BCCA 4FYPA 2PXXA 2VSXA 3CEAA 3KJQA 3VKHA 3IR5A 4G0PA 4JT9A 2HB6A 3L46A 4AP6A 1NMQA 1ABBA 1UKEA 3U1TA 3KYJB 4ZN6A 1VMAA 4MP3A 4D4MA 2WUEA 3BL8A 2G04A 4HAOA 3GPIA 5E2IA 3T3IA 1Q84A 3FRJA 4ERNA 3LK7A 1Q77A 3PHLA 4LOHA 5LQJA 2HK7A 4PCAA 1DKLA 1M2FA 4R0NA 1DEKA 4KN9S 2FRXA 4X7BA 2OV1A 3QVWA 4RDIA 3R8CA 2PSSA 3BE4A 3H9BA 4UAVA 3T54A 1P8JA 3L07A 1YB4A 1D7AA 1SA0A 3VZQA 4GMXA 5D3KA 1PJ4A 2W8ZA 4WBNB 3IA7A 3RUDA 1IZZA 4OYRA 4IOLA 1ZGGA 3NGXA 4BMNA 3PNLA 4MRSA 1AS2A 4WUTA 2EVWX 1VZ2A 5FO1A 3RRBA 3VU1A 4F97A 3U4HA 4BKRA 1HWYA 1X1CA 4XUGB 4PG4A 2WSLA 4HUQB 5E7MA 1N2CE 2ZPTX 2ZBVA 2CMDA 3GCGA 3O83A 3UC9A 2JLBA 4WBNF 3EF0A 5KOHA 1XTPA 4BZZA 3HHEA 3LL7A 4Q16A 4PR3A 4ZHSA 1NFFA 4KUEA 2JFFA 3IVCA 1EFRD 1JG1A 3KT8A 3ZIAD 1A5BB 2I99A 5HMLA 3WB0A 3SZOA 1F2TB 4Q7JB 1VJGA 4J7XA 4ENVA 5IK2D 3R6WA 2Y6VA 4F4FA 4KRXA 4W82A 1DKUA 3CZPA 2YWHA 4LXHA 3GA0A 3KJIA 3KTDA 4CUZA 1Z5WA 1O0SA 1KETA 3COPA 3VHQA 4XXHA 1LPNA 2GCGA 3Q3CA 3ID6C 1SKMA 4OLHA 5AVRA 3QVUA 1FS5A 5CDFA 2JCGA 3P4XA 1M1XB 2ZVDA 4JI6B 4HDNB 2QGZA 1PDWA 2QNRA 2ZI5A 2PLFA 4QXAA 3DMFA 3LBFA 3CYFA 821PA 1SMKA 1I7NA 1V3UA 2PN1A 3D4NA 3GAZA 2PK3A 1W36B 4LKOA 2QYTA 1XE3A 1YL7A 3IMCA 3DMDA 3L8YA 5A6SA 5AW3A 3DCIA 2NQ2C 3OA0A 4H7KA 4ER3A 2H18A 4UCFA 4EO4A 3EMKA 3G2IA 1V7ZA 2Q6OA 3KTAB 4QXPA 4CKWA 1E32A 1V6CA 4CMHA 4LHVA 3GN1A 3D4PA 2BJVA 1PZEA 4HS9A 1F0KA 2NU7A 1Z4MA 3L02A 4K9RA 3UNXA 2JVKA 2QLMA 1IPHA 2WNHA 1ZD4A 3RBXA 2FPLA 3OKCA 1YZHA 5G4KB 1FZQA 2WA2A 5BN4A 1KY3A 3DMTA 4PEVA 3BULA 1FIUA 3RVBA 3DFIA 4G9GA 1HQCA 5SYMA 1B23P 3A3PA 4CMKA 1YQXA 3ZNNA 3H9GA 1T24A 4H15A 4BLTA 2ZYVX 4WOCA 2YUIA 4FJ0A 5C53B 4KKVA 1DJOA 2ALJA 2L2QA 3PKZA 4KR0A 1M0EA 3Q7IA 2X9VA 1YRWA 4YJGB 4BV8A 2BM9A 2EERA 5ANRB 4EK9A 4GKBA 3ICEA 3ONEA 1WOYA 1IN8A 4I3HA 3OIVA 1J9ZA 2PEZA 1J9GA 1W0KD 3K0HA 2OCPA 3G1UA 4GVPA 1L4EA 1EM6A 1DJMA 3LBYA 4XGRA 4YAWA 1C30B 2WKSA 1KS9A 2IYPA 2VQDA 5CX1A 3TZ6A 1XWIA 4P33A 4ZJYA 1S1CA 4UARA 3VISA 4CKEB 3ZDDA 4KFCA 4J43A 4YLGA 4ZJPA 3ZQKA 3R3WA 2P3QA 3DMYA 1Z22A 1VSUA 4L4XA 4JLSA 3DOIA 4LHEA 1FLNA 1XROA 4CG3A 4R9NA 5JSUA 2NU8B 1L8AA 3GA5A 3UM9A 1YJBA 3KT6A 2ZDGA 3A9SA 3NHFA 5EXEA 1EUDB 5B58T 3D6NB 3OSZA 4GQIA 1ZK1A 3NAZA 2IHUA 3CR7A 2QN6A 3O8OA 4Z6KA 2KLHA 3T7KA 3GGCA 2WWVD 4XIGS 3KUKA 3Q3JB 3VVLA 1CUDA 1HQYE 2Q0QA 2FJPA 5EKSA 1PNQA 5IUNC 3BB4A 3FCAA 3ICQB 2CHEA 2PZGA 4NWIA 5FOQA 4DSTA 3F5MA 1YS6A 1K08A 2REXB 3ABZA 4DV4B 1Q11A 5EWLB 1IJBA 3CUKA 3R75A 5FBVB 3DTVB 1FFGA 3KQQA 2DPLA 3MOSA 4OHPA 4UBLA 3JD3A 2C5EA 2IPAB 1L5QA 3DFMA 4OU4A 3PE6A 4X1KB 2HWWA 2OEPA 3CWZA 3OUTA 4X45A 4MW5A 1I1NA 1O5OA 2W42A 3I58A 3PXGA 1JV2B 3IDOA 1P7YA 4MUKA 4GZ6A 1RQ7A 4QYTA 4FI3F 3QYPA 1YUBA 3OT4A 1FFXA 2Z4TA 3RH0A 4PYQA 4R9SA 1QUFA 1KY4A 5BNWA 4XYMA 4GDMA 1CP2A 2DFDA 2VNKA 4B33A 4KBGA 1P5ZB 3DLHA 5KWIA 1MJNA 4B81A 1TYEB 4Z9AA 4QA9A 3C85A 4Q0MA 5F21A 3M6FA 3F96A 1MQ9A 1W96A 1N78A 5FYQA 3A3YA 4P7KA 1IY9A 1DIBA 4PIPA 4KN8A 4YJ3A 2CMFA 4BJ6A 3QPCA 4WVFA 2AHOA 4Q19A 1KOLA 1WCIB 4LZJA 1TFUA 1DEOA 3FPFA 3RTBA 1YS2X 2GCOB 5LPNA 1MO5A 3H5OA 3RYCA 3NKLA 2QMQA 4BQEA 1PR4A 1WHTA 2ZBQA 1G1MA 3QVVA 4RLQA 1GQOA 3FI0A 3GU3A 4M1OA 2XNCA 3UJBA 1NULA 5BWCA 3AJ8A 4N1AA 2QAGC 1ZC3A 2HPVA 2QL5A 2XNDA 1ZW6A 4LRTB 3SDSA 1GVHA 4CYMA 4UPEA 3G1TA 1OXVA 3FUXA 2EKQA 3BIWA 4ZC1A 3T06B 3VKFA 2PKWA 1XNGA 1I2DA 4BKPA 4JLPA 4CF7A 3QM1A 4R6WA 2PD3A 4O4HB 2XGGA 1BDJA 3AKYA 2O0MA 3GRKA 4OQNA 1CTQA 2QRUA 3BMNB 5ALLA 4CIVA 5L3VA 1E5DA 1U4OA 3OU2A 1GV1A 4N8DA 1X1AA 2XKJE 3RUPA 4L08A 4AY4A 1J2RA 5DK6A 1YB7A 3R3HA 5C9ZA 3DR3A 3F6CA 2OD9A 3TSYA 2M6KA 4GPD1 4DV2B 2WJ3A 3M8KA 3EXIB 2BRUA 3TEMA 3SE0A 2XE4A 4BIIA 3ENNA 4GXNA 1L7OA 2QT0A 4OL0A 1O57A 4P35A 4PRZA 4RA6B 5DKFA 5MN6A 1N3LA 2IV2X 5B12A 1DMSA 3LQKA 1AZTA 1W48A 3BJEA 3EFOB 3HXTA 3CTPA 1HDCA 1XG5A 2D8MA 1GP2A 3B1ZA 3KLMX 1XQ9A 2VHTA 3OQ6A 4D82A 4KIUA 4YV1A 4BVKA 3PR1A 3QVTA 3ORFA 4H1HA 2YY5A 5AM3A 4R2WA 2PGNA 1I3NA 2P6NA 3HI4A 3PVSA 4QYXA 2AW3A 2WTMA 1UBMS 3EIWA 1NNI1 2DSTA 3P45A 5AKZA 1J49A 5EE5B 5EZYA 5ES3A 2AE1A 4X71A 2PGLA 1ULUA 1X39A 5BNTA 3VKGA 1SUCA 5SZKB 4G0NA 1U3WA 3N59A 5B2ZA 4TMKA 4L8YA 3RVOA 3C5HA 2IQIA 1MTOA 1E79A 3BA1A 1PW7A 5K0JA 1N33B 2RGGA 4JA2A 5FTJA 3P0RA 4XFDA 1HL3A 4DIUA 4AS2A 4MRMA 2IYOA 3H7IA 7REQA 4RVFA 2GBIA 2EKDA 1V0JA 3B51X 3LW7A 3DNMA 4P4SA 3SBXA 3UPDA 3UQYS 2YUTA 1Z5PA 2PXAA 1UFQA 2JLAA 4AS3A 2E9SA 3CUVA 2OXEA 4BN0A 3R44A 4UTNA 1H4VB 1NIJA 2WINI 5JJCA 1M6WA 2O8NA 4XPIB 3Q7TA 3BHMA 4OXYA 1DV1A 3OLYA 3WZ2A 3ET4A 5AJYA 1B8VA 2ODTX 3L5OA 3K0FA 1Q74A 3VYSB 1PSDA 3RWBA 2ONCA 2VHYA 2YV2A 4AMVA 4U7GA 1S1MA 2G28A 2G9RA 4JL5A 4U2DA 3LKBA 4M8IA 2ZIXA 4JOQA 2RH4A 2YFHA 5T4FA 3WDLA 4JXZA 2HCBA 1EI9A 2O9JA 4BMXA 1PJ8A 5HDQA 2PZ8A 2UAGA 1KI6A 4HLCA 4NBUA 1MC4A 5B4VA 2X40A 4K9OA 2ZB3A 4II3A 1TTTA 3VHXB 3SHOA 3TFWA 5CFQA 4WESB 4G0VA 4K6OA 4NPHA 2ZJ5A 5J9FA 4DWWA 3MJVA 2XE8A 4N9WA 4BU0A 2D7CA 3OTGA 4FHDA 2ATCA 1ZXXA 5ALUA 2VK2A 2P3SA 3O2JA 4H7HA 1GGMA 4I55B 1VXOA 4RKWA 1FX0A 4ME6A 1QSGA 2PH5A 1G5HA 2WHEA 3HRHA 3STXA 2Q99A 4ZO9A 1JQBA 2JIQA 4RBNA 3BMCA 4D98A 4G36A 4QDTA 3BGWA 1DFHA 3GP3A 4GR4A 5CLLA 1YNSA 1W29A 4B3FX 5JXHA 1AV6A 2O7SA 2L0XA 2ZJ2A 2O3QA 1QM5A 2RHMA 3SX2A 2WZBA 3THSA 2BTEA 1H94A 2BFBB 2UXDB 4XWOA 5TJHA 2VK4A 2VDQB 4GPAA 1CQIA 1OZHA 3OH8A 1C4OA 2UZ3A 3UATA 5J5AA 1QHHA 2NVWA 3CA8A 1N6HA 3EXG1 5KTYA 3UBTA 1HR0B 2EQAA 2Q8NA 4EJ2A 5JU6A 3L05A 3NMUF 4IINA 1FYDA 3SJAA 5BNIA 4QBKA 5EIBC 4CTNA 1BNCA 4G5FA 3OZIA 1MJGA 2HSGA 3EZFA 4Q1EA 2VPZA 4OL9A 1YQWA 1MHTA 1P0CA 3P2JA 3VR6A 2VBFA 1F8GA 5TGDA 5EXTA 3Q2OA 3C5VA 4ZODA 4XDYA 2RC5A 1U0RA 4A0FA 2AMLA 4BGUA 1W4CA 3KOZA 3LC1O 1LPOA 1JT9A 1N9GA 2KBFA 2Y1XA 4POAA 3Q7EA 4B40A 1K92A 5IRCD 1ACLA 4IQFA 4MIKA 1KFCB 2QUZA 3C1TA 3FUCA 4XEHA 2QUKA 4KB5A 5E3HA 4CGZA 2VPTA 1X15A 3ETCA 2J6HA 5J5CA 1VTKA 5CFRA 2Q6LA 3N8KA 4JC8A 3FUWA 2OBNA 2NYAA 2GXUA 3LLVA 5IN4A 1EE2A 2LPMA 2P0YA 2I3GA 3GLIA 1SXJA 2ACWA 3L7LA 2H1FA 2DLDA 3SC6A 3OFND 2YZ2A 3A1EA 3KZKA 3LVQE 4XM1A 1EK5A 1SA0B 1YB5A 3L1IA 4FOPA 4EHFA 5CEEA 3GRCA 5CIYA 3BJMA 3G9ZA 4Q1BA 5T3YA 2J0QA 2DWCA 1T2EA 2GBFA 4Q7EA 2FZLA 2CXNA 2W2LD 3W2TA 4C88A 3RS3A 1GDHA 1W85A 4BKQA 3MJRA 2AMFA 2F43A 3PPVA 3A1UA 4JQSA 1YQDA 2JZCA 3DPUA 3LX5A 4TXMA 4CJXA 2I67A 2VDRB 2O54A 4C7KA 3OJCA 3PD1A 1SIWA 1BDBA 2GBCA 1WW8A 2XCOA 4Q4CA 5HWSA 5A0TA 1Z83A 1H2YA 2P6PA 3C1OA 4RZUA 1EP2B 4MWTA 1UJ4A 2G09A 4M8SA 4HDMA 1V7QA 3NVAA 2DT8A 4FDTA 1PZHA 1ODFA 4J6FA 5LDGA 4W5NA 3IS3A 3CVYA 4MKXA 1NW3A 1K8XB 3QE0A 2Q3LA 1LXCA 4EUNA 1VCIA 3FPAA 5DXJA 2QD2A 5AKKA 2P8JA 1O4WA 3ETEA 1HF3A 3WA7A 2WYUA 4BS9A 1T0BA 1AC5A 4A6PA 4PXYA 4QDXA 6YASA 5KHOC 1XQXA 2EEPA 2VOJA 3EXHC 1WQ4A 1Z2DA 1XLTC 2HFJA 1Z0DA 2NZ2A 3JWGA 1CETA 4KMRA 1MAHA 5GV8A 1ONPA 2A14A 1UAAA 3BF7A 1GYQA 3C24A 4C6HA 5LD2C 4Z7NB 4YT5A 4YK7A 1O9GA 3WHPA 2ZKIA 4AY3A 1QHNA 3EVNA 5HRUA 3O82A 3SU8A 5BQ5A 1E1YA 1VJ5A 3AOGA 5F5NA 3QWAA 1T9AA 4TMZA 2PMDA 3GVCA 4WOKA 4FW8A 1KSGA 2I5PO 2DULA 2CHQA 5EKDA 2ZUDA 4ROTA 4WJZA 5DN6A 5A6SB 1L5OA 1W581 3HBFA 2DPGA 4R41A 4F5ZA 4JLKA 5B7QA 3SKYA 1DUSA 1Z6QA 5BSVA 4GPEA 2XMRA 1OASA 1MEOA 3TUJC 4CKWB 4MP6A 1M0WA 4BBZA 2AEJA 2NU7B 4HP8A 4WINA 2HDWA 3U44A 3BOSA 2HM7A 1LBHA 1KQ3A 5EJ9A 4MZXA 3TQOA 1IUKA 1JAZA 2QDXA 3F78A 5BN4B 4D5GA 5AQ1A 1VGVA 4E5VA 2FMHA 2P9TA 3A8TA 4HDCA 3NR2A 1NFQA 3PJFA 5JS1A 4N5IX 1DFIA 4N01A 3HYRA 1Y8QA 1Z8NA 5HF6A 5FBZA 5JSHA 2O3RA 2F64A 4QGFA 1JEJA 4A8HA 3SKVA 2P2CA 2HSJA 2Z6VA 2O8DA 3FKQA 4X91A 1YZUA 2CSXA 2IYFA 1KJWA 3BRSA 4PYRA 1C9DB 3MEQA 3D8TA 3OZRA 2F67A 2CF5A 4AMZA 1NM5A 5LMUB 3UEOA 4PGHA 1FX1A 1CY0A 4RCZA 1KOJA 1M1YA 5A3VA 1C0IA 1C9EA 5DMHA 1D0IA 2ZRHA 1PKXA 5A3RA 4QATA 2YL2A 2Z2YA 4RH1A 4BNWA 5CX1B 5KYVA 1GDDA 1ND5A 1XVTA 5ITVA 1JEQA 4A26A 3PT9A 1ZNZA 2ZIZA 2DUMA 3KQOA 2QY9A 5KYYA 3M6VA 2JLYA 2O2DA 1X6VA 3RTEA 3ASUA 1RHMA 2O3SA 3OY2A 4OEHA 1ULTA 2ADOA 3GFTA 2HJWA 1HZJA 3ZXUB 4BNGA 2WJJA 1Q44A 2H0RA 5EL0A 5C31A 2WUDA 4LY9A 3TG2A 3GVIA 1JRLA 3K9GA 4DDKA 2B98A 2VWGA 4OLAA 3JYNA 4GYYA 1TVMA 1G38A 4FYVA 1EFPA 3OJWA 3HJGA 3JW8A 1L5HA 3GUZA 2DAPA 3KYCA 1L4BA 3GARA 4LZAA 2RGYA 4MPRA 2AKYA 2QQFA 2DPYA 2XBUA 4JKOA 1NF9A 1DT3A 2QYHA 2JIZA 1NW5A 4OOEA 4JYZA 3FIUA 4RJIA 5B1SA 5KDLA 5BW6B 3HDJA 5J4KA 4RH0A 4E2YA 4JGGA 4QUKA 3DPSA 1YSCA 4Q48A 4W5WA 5E6UA 2B99A 5D6NA 3K9FC 2XE7A 4DLBA 2WW8A 4RFLA 5B3LA 4KJZA 2C3PA 3QJ5A 1ZL2A 2ZRCA 3LZ6A 4YP7A 2PIDA 3HPQA 3T1YB 3HGMA 4XJXA 1PR1A 3T6KA 2MR6A 2PMWB 3FGNA 4Y8VA 1QHSA 3B9RA 4EHIA 2WE8A 1KJ8A 2MSWA 3EEFA 3WKAA 3ZTTA 1FFXB 1LX7A 1QE5A 4CDGA 1HMPA 2AB0A 1QORA 1G3UA 3SX4A 4JYBA 5EPUA 1N7JA 1P62B 1XCJA 2P4EA 1K98A 2R1TA 2QORA 2H11A 2H8GA 1CUZA 1G5PA 2C2XA 3PP8A 5KNDA 1OU4A 1CZHA 3EOZA 2VR1A 4Q34A 4YJ3B 3BGDA 1A7UA 1KJZA 1UK7A 5JAOA 3TDNA 3GDFA 5I48A 3ZG6A 4P93A 3TF5A 3F9RA 4OFZA 1XGKA 3RYCB 3DTYA 2QTZA 4CLRA 3D2BA 4UBMA 1GFWA 1O03A 2EGGA 2OC4A 3NIFB 1OIVA 3L2OB 4Q12A 3ZZTA 2F9FA 4RENA 4ALJA 1JBEA 2JKVA 1YR3A 2J30A 3GLUA 3T95A 4DT1B 1CJUC 5AUOB 4YJ3F 4ZTBA 1QXSA 1T0UA 3FSGD 4M54A 2H06A 2O20A 1TK3A 1YKFA 2OBFA 3AJEA 3IVMA 1N6RA 3KQNA 3B6KA 4KNVA 1RHJA 1C7ZA 1BTOA 3K92A 4OH7A 1M1UA 1T2DA 2BHNA 4AF8A 5IZCA 4DM4A 3I9OA 4G89A 4ZYVA 1JDTA 1Y3FE 4LRQA 3BE5A 4BBPA 4DZRA 2A9PA 1OD6A 2DZDA 2P62A 1Y42X 5C8YA 2ABWA 2OBMA 6CHYA 1OH7A 1V7CA 1MV8A 4ED9A 2W0SA 4D3YA 2HH9A 1B6SA 3K8ZA 1SOUA 2HGZA 2ASEA 4XGQA 3QEBZ 5FO0A 5CD1A 1H8HA 3Q8LA 4FDMA 1GCUA 1NONA 3DWIA 4PLZA 5B6IA 5K0SA 4D4JA 2L82A 4FFSA 1YB6A 2E3JA 1BWPA 2NNWB 1Q91A 4UM8B 2GF9A 1VZ3A 3IE0A 3GRAA 5HIMA 3T61A 3QU5A 3JTEA 4MRPA 3DXFA 3SYKA 1OKKD 1X87A 1DI0A 2BI8A 4IGFA 2LDXA 4KK3A 5H68A 5J4VA 2IZ5A 4JOBA 5DBGA 1N6LA 1XDSA 1ZHHA 2FXIA 1I5RA 5EZYB 2E82A 4OUKX 4DIFA 1K5PA 4MVJG 2A0FA 1KEEB 1AQNA 4HH1A 3K9CA 4ZVTA 4BX8A 3P19A 1RZ3A 1J9EA 2PKQP 3GDOA 4CQLB 4PAWA 5CVEA 4KSCA 3E7FA 5JNRA 3IRVA 3JX9A 2Z09A 4M9CA 2DFNA 4P0PB 1NWCA 1GCAA 3C3YA 3Q41A 1I36A 4RHTA 3RARA 1ORVA 1ICEA 2TRSB 4OATA 7REQB 1W88A 4PSVA 1JQ5A 4P4SB 5JQGA 3H1AA 4QZVA 2X5XA 1IVNA 3KKMA 4I50A 2BGMA 3VGJA 3S8EA 1UMBA 1L7XA 1E66A 3PUZA 3ZWAA 4X8LA 4UOQA 2R7LA 3H11A 3ZEIA 2FDCA 1L3CA 2HN9A 4X1IA 3ZC3A 4QPJC 4JS0A 3FDFA 4MIOA 2H08A 3GA7A 2ZBFA 3U0VA 4ZVSA 4WXPA 1YOVA 4D02A 4RYLA 4E5YA 5JMTA 4XQEA 4JU8A 2FEKA 3BD8A 3QOWA 1G20E 3KWFA 4OFXA 3VOBA 1U2QA 3K0FB 2OCIA 1NRWA 2FFBA 3PQFA 2YVAA 3JQAB 2Y2UA 3HXPA 3I04A 3T0GA 1DIAA 3IC5A 3V8RA 3I61A 4H3SA 2H00A 4RE6A 2H1OA 2RSLA 2XQKA 2ZAOA 4YQFA 1PLLA 1FL9A 2AGVA 1QG6A 4QXOA 5JAHA 1QOQB 5COQA 1CEXA 1QIDA 1LY1A 3IVXA 5FWDA 1DQNA 4IIBA 4B5LA 1KI6B 1RQRA 2ERYA 4MYSA 5FPYA 1NRIA 1K4MA 1J0DA 1RPTA 3PEEA 4MQEB 3KSDO 3IBSA 5AW2A 1KS2A 3RGWS 5IF3A 1KSFX 1THGA 2ZCJA 3ZE1B 1BHSA 4DDHA 2V7UA 2DERA 2WZQA 5AXAA 4RTQA 2Y8EA 1SCJA 1AF7A 2CNWA 2JJYA 1ZJWA 3GAMA 3U0BA 3JV7A 5SZJA 3OQMA 1FX0B 2BONA 5NULA 2HPAA 3VNAA 1OVGA 2GAOA 3N28A 4B3IA 3M49A 4IIEA 4PYLA 3BMCB 2V3CC 1RI4A 4J3JA 3USZA 1PQWA 2JFYA 3D4IA 1ZGJA 3KVOA 1T91A 2CFTA 3Q11A 3ROPA 3DEYX 4LWZA 1KMNA 2UZ0A 1EXDA 2W9XA 3K4HA 3ISJA 3NPMA 4PYNA 4HWTA 3E27A 4IPTA 4W5JA 3A1FA 4J94A 1E62A 2IYTA 1CQIB 1QIKA 3CLKA 4UCQA 2Q3JA 2OZPA 3I9JA 4BLQA 3KLOA 4ND4A 3A1WA 5LVAA 4XAQA 1T8WA 3FYHA 2DX7A 3SVTA 2UYOA 3G0IA 4TWBA 4L6IA 5BSKA 3VH1A 2BCEA 4WKBA 2Y1WA 4LCEA 3KCQA 2W4QA 2G08A 1K27A 1RTTA 2C3UA 2NZUG 3CKLA 3FNRA 1J8DA 3PE3A 1RI1A 3O8LA 4MRAA 5DHUA 1E2DA 1UQTA 1X0XA 4L5CA 3AY7A 1XQYA 5TMBA 3KZXA 4P92A 1Z34A 4QLOA 4A8TA 2C92A 4EY3A 3QRWA 4XX1A 3GV0A 1DS6A 1KF0A 3BDVA 1WZ2A 5JI3E 4B6GA 1EAYA 2G67A 3HL0A 1IN6A 1L5ZA 1N9GB 4IGKA 4YCBA 3TX2A 3I2KA 4ON9A 3QLTA 2JHAA 2VZLA 5KAMA 1JG6A 3T5PA 1TB4A 1SD2A 1X8LA 2LBPA 3ZHUA 4BNLA 4MTCA 2AMVA 2XLBA 1HL7A 2V45A 4J1QA 4NNJA 2EBFX 5TQ0A 2OAQ1 3PI6A 3H1EA 5B7NA 3QVSA 4O4JB 2F59A 5I7HA 3GLIB 1K3FA 4HN4B 1M6VA 3V6MA 3ZOZA 1NY6A 2IHKA 1PNTA 1K0UA 1H2AS 1K8YB 1KU0A 1XI2A 3RS5A 4OQFA 2CEAA 4YRRA 4EFNA 2NO4A 1V95A 1PFUA 5DH9A 1GUZA 2HMUA 3TLZA 2I91A 2F43B 3LQ2A 4O4JF 3HZOA 3H2HA 2FEMA 1DL5A 2BGIA 1J22A 4HYEA 3A2LA 1INLA 3L8HA 7ABPA 1R1DA 1TGVA 2X3FA 5JD4A 1G42A 2B4KA 4LXUA 2I65A 4LX8A 1TIPA 3RU7A 2FW1A 6AT1A 2C7QA 3IH5A 1OFVA 1P1CA 1WZUA 4DGQA 1DGQA 5JBQA 3PNMA 1L6IA 4F96A 1G60A 2N9UA 3PRYA 1UT6A 3QLVA 3U37A 5JSFA 1F8YA 3A25A 3YASA 1T2CA 3SIPA 2FFJA 5D5QA 3AG5A 5DNWA 3ESQA 1O94A 5FWXA 4ENWA 2ICAA 4GWKA 1O3YA 2JGFA 3ETNA 4RHFA 5EFOA 4I9UA 4KVZA 1JIUA 2VCEA 1VL2A 2ZITA 3NW9A 1YRHA 2R6AA 3QEMA 1C7EA 3PEFA 2QJRA 1JG3A 4EEKA 1DDIA 2X9NA 2WVAA 4Q6WA 3J7AC 1B2RA 4NNPA 3W6UA 3CVWA 1KYYA 1P0MA 2ZE5A 3ONFA 4RKFA 4XZ3A 1E0AA 1PD1A 3MUEA 3WDMA 1B8NA 5KC9A 1ZIYA 1WXFA 2QRLA 4QXQA 3F0TA 3KS9A 2GMWA 4BRWA 1IL0A 1M8JA 5IUJC 1GXSA 1CZOA 2IEZA 1GR1A 3DAFA 2YN4A 3HC7A 4DTCA 4UDNA 1NVUQ 2HHLA 3QEJA 4CV1A 4GO1A 1E9VA 1XEFA 4MPPA 4NS4A 2FPGA 3FZYA 1G5QA 2PYIA 2H0AA 2R1ZA 4R54A 4Y9TA 2ZJZA 3A06A 4PLGA 1KQNA 1ZITA 4JT2A 3ZU2A 1ZRNA 5U4XA 3K5HA 2C2HA 3E03A 3B3AA 2CNNA 3W6OA 2AG0A 5IBRA 3WRYA 5JV5A 3U44B 3D8NA 3Q8XB 3O95A 4KO8A 4UPDA 3Q40A 1F9AA 5HOEA 4DNOA 3EVDA 2B94A 3ORQA 2Q8PA 3JQ9A 3A7EA 2ZKLA 5FJJA 2QI9F 4IHQA 5K2MA 4R3WA 5DNCA 1R9MA 3KE9A 5K8LA 4QVIA 1NVKA 4RSHA 4MITA 3IDSA 1GO2A 1Y8QB 5AICA 2G5PA 2I2BA 3KALA 3QWBA 4NMMA 2YWGA 5I8ZA 3SC2A 2P6MA 3VJMA 4IX9A 2QXYA 3D3QA 4FEGA 2P5YA 5K05A 4OUDA 3PSAA 4DJAA 2QVXX 5D86A 1UFVA 2WILA 4LZOA 3UF0A 1BH2A 4PN7A 5DBIA 4F92B 3IUSA 1USIA 2OGWA 4YLEA 1AZLA 1F5NA 4MVJD 4HKTA 2R8ZA 3BMOA 1M1YB 3M6UA 1XTKA 3CMMA 4FU0A 3N8DA 5IT4A 2EWMA 3EE6A 3SNHA 5K0EA 5ALQA 4U2CA 3MRXA 3RHFA 1FLAA 4Z3DA 5J4YA 1Z7YA 3CNBA 4LXTA 1KXJA 4LWQA 4U8HA 1P74A 1JEQB 5DM0A 2DT5A 1SKBA 2I1LA 2OG2A 1BH6A 1NQXA 2ZYAA 4NY1A 5KYYB 3KQHA 5JSYA 1WSDA 3K94A 4V0SA 1J6UA 2DM6A 3H42B 2Y1FA 2IF0A 4BIMA 4Z2AA 1OA0A 4I08A 1MAWA 3E9CA 1Y9DA 1WU7A 2JIDA 4UHJA 4WK6A 2HTEA 2WHYA 1SAYA 3INTA 3HU1A 4ISCA 4P2BA 4Y2SA 3W9BA 3CSDA 4N9QA 4F71A 2D4AA 2A8YA 4GFDA 4UU0A 4BZPA 5BVGA 4Q1FA 2GUWA 4ZT7A 1PJRA 3PUWA 4C3VA 1SOMA 1EFPB 2ZYIA 1L5HB 1Y8RA 2WU0A 2B35A 2ID4A 1WW2A 1U0FA 3KYCB 1HFWA 1YR8A 4X62B 2V96A 3EFEA 3PTAA 4ER0A 3MWKA 4RC9A 1ULHA 5E0KB 1R2QA 3D3NA 4WMLA 1LBSA 1P6QA 2I3ZA 2B5WA 3HB5X 4B73A 2ZJAA 2PQ2A 4ZCLA 2IGBA 3BK2A 1TEXA 2GJ8A 4ML3A 1FP4A 5E6UB 3A6ZA 3O73A 3KU4A 1Z4KA 2BBWA 3Q2IA 3O84A 5L7WA 1RXCA 4HX5A 1B3BA 1M2GA 1RQNA 3ILVA 4IF6A 3NUQA 4TWZA 4ZANA 1HTBA 3UJ8A 1XD8A 2EW1A 3F2IA 2QLFA 3R2JA 3HADA 3REQA 2WTUA 3F6SA 4J6EA 1H0SA 4E31A 3Q3HA 4TX1A 1YK0A 4BEBA 3KV1A 1IM8A 1KQPA 4NMWA 2A5GA 3E61A 3ZDCA 2AA3A 2QN1A 1R4NA 1PQ4A 1M6NA 2XWSA 4MKIA 2Q49A 3QKRA 4GM1A 4XUDA 2R1TB 2EQ5A 3VYTB 1LZLA 3BFJA 3ZWOA 1M6HA 1JIJA 2FUCA 2H2DA 4GS5A 4QQKA 3S99A 4CKBA 4NBSA 1E4EA 2AI3A 4G1BA 5DHAA 4WCDA 5DNVA 5FUQA 1W75A 1TQDA 2VXOA 5EGSA 3TRIA 3ZV6A 4CXMA 5F9HA 1YA6A 2COUA 1CLUA 1CJTC 1TYBE 2HQBA 2IELA 5H9WA 4TVSA 2A0UA 3H8VA 3WSTA 4CLRB 4B3RB 2XMCA 4G56A 3QLJA 5TC4A 5BPHA 2ZRPA 4CIDA 3AIMA 1ULBA 5BQXA 2XUZA 3LT2A 4A8PA 2AWNA 3KSZO 4E5KA 2RBEA 1UZLA 2RGWA 3V4SA 4BFSA 4FSXA 3L6EA 2GN4A 2H4HA 3W6PA 2PV0A 1L1RA 1C41A 1GPNA 4C89A 3P9IA 1PV2A 3GRYA 3U4AA 1K86A 2OA0A 3LFTA 1BX3A 3L06A 1TQ2A 1E3SA 2AFIA 1E9CA 1DO8A 1ZESA 1Z7EA 3FOCA 4HMPA 4MB2A 2XTMA 5C8YB 5E9WA 4ZK2A 4OQQA 2C2BA 4PWYA 2JFVA 4I5IA 5DM1A 2C42A 2BMEA 1FPQA 3U4QA 1GL9B 1J23A 2PV7A 1BHO1 3FBGA 2WM9B 1C2TA 4OK3A 3GYBA 3LC0A 2QG9A 1HDEA 5ESDA 5BXYA 5KDOA 3IV6A 2UUCB 1LDGA 1CF9A 2I4IA 3EIXA 3L7CA 5K0FA 4PIVA 3KKLA 5LXTA 1Z68A 3C8HA 1MQSA 4E07A 5DCYA 1KYWA 4PQEA 3TZLA 4Y2TA 1YIAA 1NVVQ 3TRFA 5TVGA 4DAOA 1TO1E 1KK3A 4L95C 3PLAE 1TL7C 2I2FA 4DUGD 5FPTA 3UJPA 4DPKA 1Z26A 2HBYA 4G5HA 4MDEA 3OLZA 1Z0IA 5COBA 3UCXA 1M76A 2JFHA 1R0BA 3JWJA 3VZBA 2QP9X 1B7GO 1XF1A 4GWGA 5JQGB 3NVMB 3W8FA 4TKVB 2PX4A 2D06A 4BECA 1FJGB 4I50B 1GLGA 2Q3EA 4ZXFA 1UMBB 3FFBA 4BTEA 3P71T 1YCHA 3WIBA 2P75A 3N8GA 4D43A 2I7TA 4L15A 3H11B 3HBAA 2Y9PB 1GN9A 4X1IB 1LKZA 2IXBA 3S6JA 1S01A 5TT0A 1NPTO 3UWSA 4X92A 1C3EA 3P9QA 2H1RA 2B34A 3ENQA 4CETA 1Z5OA 4BVJA 5DYTA 2P8SA 1YCFA 1MXHA 1NXQA 1VDZA 2VTKA 5BSMA 5JQGF 5KU1A 3TBKA 3WGVA 4HWRA 2H17A 4EKDA 4MQ4A 2HUPA 4I50F 1U2DC 3WLFA 4K7JA 1E9AA 1QMGA 4P3OA 5G2OA 4D4KA 3A6FA 4BN5A 1L5LA 2ZSEA 3U61B 4G97A 5DRYA 3CX6A 1WUKS 4G0OA 2Z08A 5I7OA 4OVKA 5I7EA 1CDZA 3GIDA 3EA4A 1BVUA 2RJOA 3A27A 1EJ2A 5KJ6A 3AVYA 2WKRA 1B42A 1QG0A 2AV6A 1DCKA 1C4WA 2VQSA 3C87A 2CZCA 1JIIA 3DLIA 1SUWA 4MHOA 4JLUA 4KRYA 1KAEA 2AMYA 4PPQA 4RX1A 4DSAA 1VLMA 4JQCA 1PUIA 1A9PA 4IQ8A 3E9QA 4CKCB 1ZI9A 4F84A 2Q1UA 1XYYA 1Z4JA 3GCWA 3NRBA 3LC7O 3G2QA 2QT9A 4HAIA 1WEKA 2C2WA 3V1TC 3LP5A 3RRNA 3STUA 4CN8A 3VTZA 3T5MA 2FG7C 1U7TA 4EABA 4KVAA 4LGYA 3DKIA 2YX1A 3GEBA 4QUIA 1KVUA 3GFGA 2PGOA 4UZSA 4L22A 2HC9A 4CNQA 5JY1A 4J7CA 1FQWA 4A5OA 1RRPA 5A0FA 1L5RA 2BISA 4C14A 3T3EA 5DNUA 2QF7A 4MB6A 3RIMA 4TUYB 3M5WA 1TUGA 1M2EA 2XNHA 4H1VA 5D8DA 2Y0EA 1EVLA 5EIBD 4AG3A 1EWKA 4EELA 3RC2A 2ID8A 2OT3B 1KNXA 1RHRA 3F98A 2GM5A 4ND7A 4BWVA 1Y34E 3A14A 3NHAA 3NV7A 1LLFA 5K09A 1FU8A 5CK4A 1SQ6A 1WMDA 4R05A 1XTIA 4EI7A 1N32B 5KINB 2VJQA 4TUYF 3LUDA 3L9XA 3ANMA 3KJHA 1RBQA 1GAEO 2FLKA 1IM5A 3O2QB 1E1CA 3ZY6A 3V4LA 1CY7A 5TMPA 4JXXA 3SQOA 3TMAA 4LXXA 4TT3D 1YOBA 4DSOA 4S12A 7MDHA 1XN4A 1PU2A 1N2ZA 2Q3DA 5B7PA 2WC1A 2C95A 3IOEA 3VSCA 1SCBA 3RABA 1Z0SA 2D7JA 3CURA 3KJXA 4Q01A 1MAUA 4PYOA 5TQ0B 4WXRA 3MT9A 5HXAA 2NO1A 4OFBA 3IP9A 3PUIA 1QGOA 1T8TA 3IXQA 5JCZA 1U7ZA 2VP2A 4RLFA 1XMIA 3LDAA 4P58A 1AKTA 1M6VB 1NQAO 3GJSA 5EPEA 4RV4A 4I4TA 2GJKA 4FXOA 1TVEA 1VYUA 1PL8A 1YZLA 5TEVA 5HKBA 3CCFA 2CL0X 2GN8A 3ZVNA 1E6CA 1E64A 1USVA 4HAZA 221PA 1YMQA 3IUMA 3TW4A 1X8XA 4H4DA 4IXWA 3ND8A 4E03A 1JE1A 2CXSA 2GEKA 3AVTA 5AVYA 2FW9A 2ID9A 1T0JB 2HIGA 3CLVA 4P54A 3CJTA 1FUEA 2JBAB 5C8DA 2QENA 1FSZA 3UK0A 1DRWA 4YP1A 3NDIA 3TXAA 4YUZA 1BXKA 4I1YA 1TM5E 5DT2A 2Q62A 2YFKA 3UHAA 5KHAA 3DD5A 3LS2A 2ZVQX 2BW0A 4FCWA 3DB2A 3ZIAA 2W90A 3QPVA 5KTTA 1VHWA 2JJ8A 2W48A 3MB8A 2J3EA 4GQAA 3P2OA 5FWXB 1Q3HA 4O1HA 3I76A 2RBGA 4FOLA 1ESCA 5IK2A 2ONJA 4EPTA 2ZUBA 3QEMB 5B6PA 5BORA 4F7WA 1NW8A 3L6DA 4YC7A 3D8UA 4ZEWA 3B1KA 1YK1A 2HMYB 3IX7A 3ESCA 5IH3A 1EQAA 3UJ7A 1IWBB 1IB6A 2WHQA 4FR5A 1SUAA 3PSHA 5K4AA 1DIOB 1OWLA 5EJ8A 4I81A 2XLCA 1G3IA 4KUGA 4AIRA 5BWMA 1QZZA 4ZVVA 2OCKA 1E3DA 5E7QA 2VK8A 2XA2A 5AESA 4OI4A 5ALWA 1JLLB 4LOJA 4N8SA 1OXBB 4YCLA 2YQ4A 2FPGB 2LV8A 2P9YA 2Z6UA 3WP0A 3X2EA 4KR2A 4C4PA 1Q1AA 3BCSA 1YRYE 2F8MA 2OZVA 5MHTA 1AB6A 1P33A 1VA5A 2A0XA 3NC0C 4XPZA 1AZWA 5KWJA 3QPAA 3WNVA 4HAVA 4YRDA 5J47A 4PLPA 4J0KA 1EGVB 1ZUHA 3A4VA 4F04A 1HI9A 1NVVR 1Y4SA 2JFUA 3ADPA 2P0AA 4JJ6A 4RK5A 3WIDA 3WNDA 1CKEA 4AULA 3H84A 1KWGA 3G0OA 4S1OA 1E2QA 3A6PC 2VJNA 4ETWA 5FPKA 3IUBA 1EFVA 2GZRA 4X9XA 3R0VA 3AHIA 3HUUA 3JD0A 4WX2B 3SC2B 3SYTA 3SHQA 5I01A 4L07A 2BKAA 3MMPA 4EMUA 6ADHA 2OKCA 3DFUA 3ZHXA 5CM2Z 5EIOA 2Y0CA 3AVVA 1P2TA 4R71A 4H3KB 3RTGA 5KNDH 1O8BA 5LIRA 4KQWA 4LG1A 1NRXA 4XD7D 5H8WA 1WJGA 2RAVA 2OLEA 3RTAA 3KDSE 4DCSA 3BMOB 3GJXC 4HEQA 4L72A 1E3QA 1W0KA 3IIMA 3VUFA 4CM9D 2EJUA 4NZYA 3LL4A 3RAPR 1YBAA 3B78A 4XYLA 1BWRA 1TLFA 2II6A 2PBFA 2VRWA 3KO8A 1OXTA 4PRLA 3QW2A 3QWHA 4FIZA 5FWYA 4NXMB 2WJWA 1BD4A 1HY3A 5BN1A 2FRVA 3MWYW 2O0LA 5GZ1A 1JDVA 3SYNA 4NXNB 3I0ZA 2BFCA 2X5OA 5T6BA 1DEHA 5I51A 2V6MA 3WGQA 4IOJA 4M9SA 3QHPA 3WBKA 2YZKA 2HDOA 1WBJB 2Q6KA 5LQSA 4S24A 3GBSA 4GP6A 1RJDA 3HY6A 1WETA 1WF3A 1YB1A 3WV4A 1Y8RB 4KGXA 5MF6A 1E5XA 5A2QA 3LT5A 4ITVA 5TXGA 3HB9A 4EFLA 2VPPA 2VNIA 4TRRA 1G8HA 2YWJA 5M04A 2CLMB 1XEWX 2C8KA 4NV1A 4EGCB 1QO9A 4II7A 1SVUA 3AYXB 3MOIA 3GQBA 1CRWG 3Q72A 1JEAA 5H80A 1Q0RA 2P79A 4NTZA 1OW3B 4DY4A 1CUGA 3C3PA 3T9FA 4TMYA 5BQOA 1UBJS 2FAXA 1V8DA 4Z54A 1EKXA 3MTIA 4N7MA 1R74A 1LW6E 4FTWA 5JAIA 1EBUA 1YI0A 3MQ4A 3OM8A 4V24A 3REQB 3LFUA 4FN4A 3OX3A 4M0PA 4RF3A 4DQ0A 5BXQC 1ESNA 1SBYA 2GJSA 4DVJA 4NU8X 2PT6A 3P94A 2AW5A 3FYSA 4MLDA 4O63O 4ZMBA 1M7GA 5BR8B 3HKEA 5GAJA 1QHFA 1R4NB 1T9BA 4UBIA 2DMRA 3T15A 2IOQA 3QKRB 1NBEA 2XF2A 1MG0A 1NW6A 1ZVMA 2ZQYA 4XCXA 3BQMB 2G5GX 3KAJA 1FMJA 4CPDA 3CEJA 4FW9A 1VP9A 4MDYA 2Q8QA 4OCZA 4P31A 2M32A 5KYUA 1A76A 1Z39A 5IHPA 1RM3A 3JCZA 4B8ZA 4J0FA 3VBCA 4I5FA 3SWWA 1ZWLA 3IR7A 2XH8A 1ZA1A 5AXDA 1GUDA 4GYJA 4E88A 1WP9A 3NFYA 3QVMA 1MGOA 3EZ2A 1G1AA 1DXYA 3C41J 3QI7A 1JZTA 1VC2A 3R40A 4NS1A 4AUNA 1NR5A 3ODGA 3WZMA 5E2AA 1BRTA 2HMTA 2WNSA 4YUWA 1JGTA 1O4VA 2CB9A 4UTOA 4PCVA 3P97A 4L5YA 4CM7A 1RAAA 5B5SA 3GP5A 4CR7A 1AX9A 5LA6A 4DC1A 4Y6SA 3CNHA 1Z2NX 4OQPA 1E6WA 4LE1A 3ZI7A 1ONNA 1XXHE 4X66B 4O4IA 4JB8A 4MLZA 3REFA 8ATCA 1F8XA 4FIDA 4GKJB 1MH9A 4B3XA 4IJ6A 3IV7A 4Y7DA 5A9SA 1XRLA 4LGVA 6REQA 2NSJA 3WK5A 1GSHA 2QV0A 4DJDC 4LWOA 2R6ZA 4H0NA 1SIOA 3JQFA 4RF2A 5HCIA 2J1LA 3LQFA 3W77A 2AN1A 4E94A 3R5JA 4DBLE 4EY4A 2FKAA 3CJQA 2WTAA 1Q0ZA 2NSHA 2QVBA 3AI1A 2OO3A 4NMHA 4A10A 2IOFK 4WFIA 4UXIA 3TKLA 3FDIA 4EA7A 5JRJA 2F48A 1G4UR 2OQ2A 1FSFA 3FTDA 1TJPB 4IJWA 2JJMA 2QRPA 5K2OA 2PMFA 5DNDA 4DV7B 2EF0A 3C97A 1YS4A 2CNKA 1XMPA 2XA9A 1J70A 13PKA 2Y27A 4BMOB 3BRWD 3HGQA 2DWPA 1LB1B 1JFFA 2Q41A 3I32A 1IXRC 4ODIA 4JI2B 1G19A 1O7JA 4QRIA 1DO0A 1H2XA 1VL8A 4Q39A 5AW4A 3GK3A 2P9QA 4N76A 2XKBA 4FONA 3LC2O 4O59O 1N5RA 3C70A 4TROA 3I62A 2YJ6A 4IWYA 2QN7A 3KFVA 1MB0A 2ZB8A 1QCYA 1KAGA 2VDOB 4OQLA 4XDZA 5G0VA 3WWZA 2QM3A 4F4UA 1M10A 3QWFA 4L50A 3H83A 5GONA 2VPXA 1VKRA 1HO3A 3A1SA 1SB8A 4J91A 4XDGA 4ZQCB 3JD4A 2NT4A 3LDHA 3MW8A 4KGVA 3WK8A 4CV0A 5LFAA 2PUDA 3ZU6A 4G01B 4PC2A 2EWWA 4RM2A 4GLLA 3NYQA 4N6GA 3HFRA 2OR3A 3IKMB 5AUQA 2IQ5A 2BEVA 3VDRA 5K9ZA 2POQX 3B7PA 1AKVA 3D3WA 4C0AC 2Y1GA 3DMGA 5P8WA 1HNWB 4FFVA 3MGBA 1T5HX 5AHOA 4YQYA 1UMCA 2ZUTA 4ACBA 5JXGA 2FSUA 3PLRA 3IOMA 1L7VC 3IJ5A 4H0CA 5DGIA 1RVV1 3QX3A 5CPFA 1R8JA 4S35A 3RIXA 3AESA 2QTAA 2Q5OA 2RHCA 1GU1A 5HJEA 4PO3X 2GPYA 2J33A 5IDQA 2WSMA 3MCZA 3G5LA 4DSNA 4ZYUA 5JFTA 4LBZA 1QS0B 4HGYA 4UUOA 4F5YA 4NZZA 4JI4B 4RDHA 1HLDA 4ID9A 5H0IA 3HB7A 3GZTB 1MIHA 4UUAA 1UPCA 3OOSA 3BIJA 3CJRA 1QQBA 1ODLA 4A8JC 2A9JA 3ZHOA 5ERYA 1O87A 1U8XX 3PQCA 4IY1A 1W0CA 3X1XA 4IDNA 1FSPA 2FEOA 1AK1A 2RHRA 5IJ9A 4I46A 5HFAA 4IH9A 5DHSA 1A7KA 1L3IA 1IXYA 1CJCA 1UZAA 2C94A 2VOEA 4CCSA 3OTWA 3OTHA 3KWMA 1RYMA 2PWAA 3WC4A 5KNBD 4JB0A 1Z0FA 4NCIA 1ZC4A 3WGNA 2JFNA 3ETJA 2X8WA 4ZARA 4YCCA 1QYIA 4JOSA 4NFYA 4JITA 1NFRA 2R2AA 1ZH0A 1JSZA 4BRSA 1XNRB 1XCLA 4S1PA 3A3NA 3L1VA 1GVNB 3BN3A 2ECPA 4OHWA 2OXIA 2O5VA 1UC4B 2BGNA 4C7VA 1UWLA 2EFCB 4IILA 3L9WA 3MXTA 2BIFA 3OO0A 4I8DA 5DX1A 3ZIDA 1A4RA 3HYNA 2DXIA 2W5UA 1E1CB 3E3AA 4XQ0A 2I6GA 1OXMA 4B7UA 3VXKA 2OMKA 2IL1A 4NAHA 2GBLA 2O50A 1TCUA 2JVIA 4KNWA 1VMDA 4KQKA 1ZLXA 4GOKA 2PL1A 4DLVA 1NLUA 1T6BY 1DUIA 3F71A 2OG1A 2P6UA 3MTEA 4QQRA 4TMTA 4AVYA 1VJRA 2RGNC 1U1FA 1UCFA 2W2NA 2WQZA 3RUCA 3USCS 3VZPA 3CCBA 1YC2A 2AKAB 2F62A 3ESDA 1BCSA 1AMNA 1P2GA 5AT1A 4I4TB 4P5PA 1VJTA 1BGWA 3OFNA 4GI7A 4RPKA 2DFKB 4UM5A 4ZCTA 3BERA 5BMVA 1UP7A 1KRWA 3EVGA 4TM7A 1U8YA 3OJFA 4V0KA 3MM4A 3LCUA 2YYSA 1CJSA 1IDN1 2G71A 2W2LA 1CZRA 2X2FA 1LUAA 3CPHA 3EBPA 5BT8A 2Q9AA 5BUCA 3BZUA 3OPYA 4LYJA 5EPOA 3PD7A 2ZI9A 3BFVA 1JHAA 3RFXA 3VTAA 3TMKA 4I4TF 1C7JA 1ZL0A 4G4JA 4LJ8A 4NG4A 2R4TA 4TS9A 5EUMA 5JCJA 4WNCA 1N92A 5AW7A 1GYPA 2P35A 3NTUA 4Y2YA 4ZVRA 2QZPA 3MF4A 3ZXSA 3W1EA 4M99A 1LDEA 4RIHA 1W25A 2Z30A 4AJKA 5AVUA 3OG9A 5H83A 3HDGA 3OZCA 2WBLC 1RBMA 2NO5A 3BIXA 3BBPA 1DBWA 1BAPA 3LX8A 3WO0A 3DB1A 2ZJ0A 4LFBB 3RODA 1OV6A 4L4YA 3HBNA 4OSEA 3IB6A 5AK4A 3WADA 1RI3A 2ZJBA 3CW9A 3HNPA 4G1CA 2QUJA 3U1BA 3BVPA 1O6GA 4JEIA 1PL0A 2JI7A 2VP4A 2Z5LA 5D00A 2W2XA 4C7MA 1ZNQO 4H08A 4C0BA 4D9JA 3FTEA 1S2IA 1ZH6A 2FJ0A 1Q1ZA 2VUHB 3GH3A 4KO4S 4P4LA 4UVDA 1TUIA 2ZBUA 4MS4A 4S2EA 3M3DA 4HDSA 4UZFA 4EHAA 1RBYA 3Q3IA 4DDTA 4GT1A 4EH1A 1UDRA 4LJ7A 1RQPA 3IAM6 4HUTA 1N5IA 3W2HA 1N57A 1FLDA 3VOTA 3JD2A 3WBBA 5K20A 3SLRA 3KM0A 3UG7A 1OFUA 4IDEA 5I9NA 1W76A 3PC3A 4GI3A 1JIXA 3IE1A 4LWPA 2WG2A 2AQIA 3MT0A 5CLGA 4EHHA 1YKSA 4X6YA 2EP7A 2QJOA 1GIAA 1QB7A 3FAKA 4XUEA 4A6EA 3P26A 5KYXA 2BR3A 2PRIA 3F7NA 5JD3A 4EJFA 2E0IA 3AKEA 3Q7SA 3P9RA 3ZQ4A 4P84A 1A8QA 3O91A 3AIKA 3OQVA 4KK4A 1BMTA 4R69A 2QTWB 1EFVB 3ES9A 5CBPA 3KK0A 5ICFA 5F51A 1KGSA 2HA0A 5LWHA 2H5IA 4BB9A 3UJNA 5GJCA 1SXJE 1Y4AE 1T8SA 1EK2A 2AXEA 4M89A 2ZT8A 3CCCA 3BTVA 2C97A 4MQUA 5EAIA 3IILA 4K05A 3ENWA 1ECJA 3C5CA 4HNUA 4RTSA 1RAGA 1PGNA 3BEDA 2BMDA 3BXZA 5GY7A 3T7JA 2PMEA 1U0TA 1H3FA 2JGEA 2RHLA 4BO2A 4OO3A 3WL7A 4DA8A 2XRZA 3PB3A 2OWEA 4KYIB 5CVTA 1V37A 1Z6AA 3TLEA 5A3JA 2GARA 3GEEA 4RACA 1B00A 1FRQA 1OQAA 1TJNA 2DPXA 4TZTA 4YAJA 4R0VA 3IHWA 3E5RA 1PL6A 3QLEA 5FWYB 2O8VA 2NYVA 4EW6A 3WGUA 1V35A 3IAS6 5BQ3A 1NI5A 3K8YA 4WZAA 1IH8A 3VPHA 4RFSB 1RXUA 3KYIB 4WA7A 4E2ZA 1KJQA 2HQ1A 3SZMA 2ZIVB 1HLFA 4A2PA 4RKYA 4DA9A 2ZT6A 3Q10A 4IKPA 3CINA 4MUEA 1VG8A 3P2YA 5EJMA 3HCCA 1ZPDA 4I14A 3C39A 2DG2A 4XYEA 4GD3Q 5EIWA 1FUKA 1VGRA 3OAAD 3A4LA 4ZYTA 1NU8A 3FUTA 1A5ZA 4H7EA 4DWVA 4YT8A 4B3DA 1M2NA 2ZSAA 4LA4A 4S3MA 4NCAA 3DO8A 4BV3A 2RAPA 3RU3A 4PSDA 1OJ7A 3KR9A 2R7AA 3ZTYA 5B4TA 3KLPX 3IP7A 5FEUA 1R6UA 4ND2A 5DSZA 5LR6A 4CM3A 5M2QA 1GDTA 4FMBB 3GQBB 3WTBA 1RHUA 3LW8A 1EA7A 1MFPA 2VT3A 4LYFA 1VYVA 1TFRA 4EG1A 3G02A 1VL6A 3NGMA 5GPBA 1JQAA 3FNFA 3W2FA 3K6KA 5JS7A 5HP4A 1GFSA 1TM4E 2FMTA 4UD2A 2EJBA 3W5DA 3WDKA 5FTKA 2QJTA 4ZZ1A 4LMRA 4Q47A 1T0IA 1Q7BA 1YR2A 2GO7A 2JASA 2Q1TA 1MG5A 2JAUA 3NZEA 4DREA 2CNLA 1J0BA 1XVIA 2FDXA 2JPDA 4PLHA 3UJ9A 4KQ9A 4YRGA 5CFOA 1NI4B 1OZ0A 3E0QA 3HKEB 4WZBE 3RLFA 1ZK0A 2ISCA 3O3MB 1H8ED 4U6QA 4DNFA 1NOIA 4FKZA 4IXNA 3QKIA 5KYUB 4OXRA 4HAXA 4OB8A 4QELA 4ESHA 1F5SA 3E3LA 5GTDA 4DR4B 4MYDA 2OZEA 5JLAA 1CDDA 1ISIA 1G7SA 3E9ZA 3ROQA 2ATEA 4PNEA 1I9CA 2BFWA 1DKNA 2ZETA 5LUBA 3UFXA 4Q4DA 2DVMA 4JD5A 3EZGA 3C8ZA 4I6EA 4DS3A 4QOGA 5ADHA 1X2BA 3N3BC 3E1SA 5DBOA 1Z63A 4DLLA 3WLTA 2V8OA 3GLFA 1BU8A 5ISMA 3IAEA 2H3EA 4URHA 1ZMXA 4GNRA 5LA6B 4FQ8A 5DFAA 3PUXA 3FSGA 2PD6A 5DDIP 2JAHA 2DEUA 4XWKA 2XOEA 5FL7D 5JUWA 1LBEA 4O4IB 1O95C 4N8EA 1NR7A 9LDBA 3W5CA 4B6RA 1ESMA 2Q5CA 1JHMA 2P9CA 1I7LA 1L7AA 3ZDBA 1W1UA 3KVVA 1E0SA 2NXWA 3B53X 3LYAA 5A9SB 4Z9FA 1VFNA 3B60A 4MJ7A 4OMUA 5ALDA 1KSJA 1UPUA 5DLYA 2Z43A 5LA6F 3E35A 2W6ID 3Q8KA 4WCVA 3DP9A 5EE3A 4DMRA 1FJXA 1N6PA 2J5RA 3D2AA 4CV2A 1LC0A 4DLPA 4O4IF 3TOZA 1JQDA 4XR9A 2DETA 2O19A 2J5KA 3R3XA 4W8GA 3K30A 3HXMA 3OQPA 2VN8A 3MINA 1E89A 2IP1A 4POOA 1AMOA 3NCTA 4MVCA 4HG2A 1N25A 3OZAA 4G5QA 4DBLC 2WHPA 1LLCA 1TKAA 2IYSA 3DAOA 4N5MA 1CUEA 1C9JA 1R0SA 4Q9AA 2Q4BA 5DE3A 2QRJA 4OM8A 3V4VB 1OKKA 2BGKA 4JI1B 4KFSA 4JYAB 4JJZA 3E2IA 2AC7A 3BHJA 3K9QO 2O0JA 4DQVA 1VRVA 1FVOA 3HCNA 3WJ2A 1M2KA 4BNTA 3DUFA 1PFKA 2R62A 3QP9A 5JOQA 1OA1A 4MINA 2G1JA 2PAAA 1Y7LA 4JEHA 4CMJA 4EEZA 3QG5A 2UVPB 1EXNA 2F1IA 1N8SA 3IQZA 1U94A 1AK9A 4KR9A 1JFFB 3KEMA 1DRUA 2ZRDA 4Z4GA 3ICOA 2AR9A 1S7GA 3M34A 5ENZA 1FQJA 4CF4A 3AR3A 1J99A 2CNOA 3RD5A 3Q9SA 5EJGA 2DC1A 5EJ4A 2NPOA 1PK9A 4UULA 3LZCA 3AHHA 2QL6A 4RMHA 4IIDA 2I6QA 1TE2A 2VHWA 1T3HA 2XRYA 3QKSA 5GONB 2C54A 3TLGB 1BS2A 4D8XA 1OX4A 4N54A 5DYYA 4DFDA 4EYSA 4F4DA 5IKEA 4UJ5A 1QJ4A 3SZGA 1KFKB 4Q3KA 3R77A 2GLTA 1Y7IA 1SCUA 2WB4A 2QVCA 3IXLA 1K2VN 2C4WA 1CR6A 3HDQA 3I12A 3RS7A 4BYMA 1QGED 1P2VA 3KQYA 4B8WA 3D3WB 1QUEA 1D8AA 2H1LA 3E9MA 4E32A 2X0NA 5HQTA 3RAEC 1KAHA 1WA5A 1ZUWA 2F3SA 2ZSUA 1UMCB 2M9MA 2YIJA 3FCEA 3K09A 1XCOA 3KUDA 5DWDA 5LLSA 1ZKMA 1ZD3A 4LVUA 1KI2A 2Q9CA 1YKGA 2WMNB 4HAWA 4D8WA 2NXCA 3CW2A 4OHYA 3ZHCA 4N39A 3WNCA 1XZGA 3AESB 1K7YA 5IVKA 2DHEA 5FEMA 4M21A 2PQMA 3PDUA 3D2LA 3M6LA 1JB1A 1Z6GA 3T1OA 5CDGA 4EA6A 2R00C 3RF6A 4REQA 3I2YX 1FYFA 3ZVLA 5BVHA 2VF7A 2FMUA 3QU4A 1L8XA 3NHWA 3R7FA 3C2QA 5J40A 5K3DA 1RXYA 1W5EA 1E0JA 4HH4A 2D3WA 3NJ4A 1FA9A 1GITA 3VR3D 3ZE0B 4EYOA 2YW9A 1JR4A 1VG9B 3GLTA 3ONNA 3DVRX 2XWBF 3G0CA 4GBMA 4IW3B 2I2CA 4Q3LA 5JT1A 4CI9A 4FHGA 3PA6A 2IYLD 4G41A 3U1VA 4JL6A 1ZK4A 4RQTA 1X94A 2BP7A 3SBDA 3KHKA 3ONWA 5D84A 1WMAA 1CNFA 3F74A 3BGSA 5FOXA 2VJKA 4H6XA 1SD5A 3WB1A 2C8JA 4AB1A 1LVGA 5KSZA 2BGGA 2V65A 1PS0A 3BWYA 1ZSNA 1CW2B 2G5TA 3WWYA 3JQRA 4ZAXA 3U16A 1TK2A 3EPHA 3GJYA 1SU4A 4HNVA 3COWA 4QRDA 4Q7QA 1X3SA 2QMUA 1JX6A 1W94A 2PZJA 1EX6A 2V0CA 1M1ZA 2ZVJA 3PIRA 4LHZA 1OLSB 3C3BA 4DLYA 4XH9B 3WMGA 4OH1A 4MKRA 2IXGA 5IFLA 1WBDA 1B6RA 1J8YF 3EGDA 4H7PA 3CUEF 5J5VA 4NKRA 2A5LA 2G9UA 4KQ1A 4MR7A 3W7BA 1JI0A 4JJEA 5T7BA 2ANCA 3MJ4A 1M34B 4M53A 4EJ0A 3J80A 1S8NA 3UJCA 3WVNA 3ZDFA 3BMXA 1VECA 2BSXA 2J3KA 2O7RA 3RW9A 4YXWD 5KNCH 4KG7A 2HJRA 1J0EA 4FDUA 2DCUA 4HR7A 1SBNE 1XZNA 1WPQA 2QL7A 1DAEA 2VAPA 2AI2A 2FZKA 3NEYA 5IULC 4JLMA 1V16A 2J09A 2E1RA 1GUAA 2YMLA 4URXR 3JYHA 3LQRA 5JAUA 1BCSB 3UAYA 3OJ0A 5DULA 3ZJTA 2ZIEA 3IV9A 3OSUA 1COZA 2CJWB 2YVQA 4KYTA 4B1FA 5BMVB 1NG1A 3CNLA 3PFFA 3ORYA 3UJ6A 2XQVA 4CQMB 2VDUE 4TV9A 2AG1A 4B48A 1ISJA 2K6GA 3OPYB 3SF0A 5A0VA 2FUNB 1I4LD 3O38A 3UT6A 4UKDA 2ZBRA 4Y2VA 3CW8X 3EW9A 3QA9A 2J9GA 5TDHA 3HXKA 4WKCA 1TZMA 5BMVF 2SECE 5T67A 4MLPA 1ZUIA 3PPWA 3AX6A 1DG3A 3GUCA 4BJ3A 3JZFA 3GWGA 4PCUA 3QMPA 1A8IA 3OX1A 1MB2A 1MQ8B 1FSGA 2NLOA 2RHTA 3I6ZA 3LWDA 3OWXA 3QBTA 1KU6A 2QX8A 3EVCA 2Z8YA 1Q0LA 1XJ5A 2XD4A 3JRXA 1IN4A 4U2EA 3NGLA 3PNSA 4W1PA 4LV6A 1GKKA 4CEIA 1GTJ1 4HX2A 2O7NA 2R60A 4D9IA 1FW6A 1I7SB 3GVHA 5K3CA 2VF2A 1A2OA 4RU1A 5AW8A 3U6BA 2GYWA 1XDGA 4L1KA 4P7BA 4WW0A 3CKMA 2JEZA 5F12A 1IY0A 2BBOA 5IVHA 3HU2A 2R5NA 1YASA 1OBVA 3BWVA 4PHFA 1WL8A 2RKBA 4BC1A 4UNNA 4B35A 2BFEA 4MS4B 2HU5A 4XWWA 1I3LA 4OP3A 2VUTA 3L4SO 4MO9A 4Q7MB 1EWRA 4UHBA 1E77A 1WDTA 1HLGA 2Q2QA 3ND7A 4MHSA 2VDWA 4MJLA 4ZO8A 1MN6A 1AZSC 2P4SA 2BCJQ 4AKIA 2CLOB 4FZRA 1JDZA 1CUYA 3N7UA 2P5SA 1LDNA 3O31A 5HHTA 3OMXA 2QL9A 2AXNA 1VLQA 2FTKE 3BTUA 1VE7A 5HF9A 4D0NA 5KYXB 2WICA 1MAVA 1TT5A 1EVZA 1R18A 4OKIA 3I9MA 4Y0NA 3R9XA 1UZMA 4BRUA 1OX5A 3UK7A 4UVGA 1ZVKA 1U9IA 3UY4A 4J16C 1QFMA 3P5BA 2GPTA 2UXBB 2AF3C 2DKNA 2IFTA 3IQFA 1ST2A 1KPGA 1WDLA 3R41A 1XCPA 2Y92A 1Y82A 2Y1DA 3EJ6A 4QUGA 1Z2OX 3SN6A 5CBPB 1P8AA 3SP1A 4BLOA 3ZR4B 1DRVA 3LLUA 4ZCRA 1NBOA 1E6MA 1QH8A 3B6JA 4Q5IA 5BSEA 4EMTA 3BWBA 3S8MA 3C1AA 3OT5A 1HE4A 2GETA 3CFYA 4QE3A 2FPRA 3GH1A 1G8SA 5IDYA 3AOEC 1SKQA 1ENOA 2YRXA 4JY7A 1UKVY 4TKLA 3GJQA 1QHYA 4M1MA 5CM8B 1KZ9A 2ZWMA 3CPEA 3OD1A 2VCHA 4XB2A 4FR2A 4NYIQ 5F7OA 4L3VA 4MVJA 2OHGA 3JZDA 2BBTA 1YQQA 3JALA 3M6AA 4LIPD 1R6DA 3H75A 4IMPA 1XEXA 1LPMA 4K9SA 5FXMA 3T5DA 4JMLA 5LP6C 3SFZA 3SXUB 4D97A 1OSNA 1UBFA 4BKUA 1Z6YA 4IIYA 1T4DA 3RCBA 3B5JA 3PWSA 4QFDA 5F1OA 3UT5A 4YGYA 4AJIA 4WZAB 1QDUA 4O2BB 1W35A 4RF4A 4PGFA 4KVGA 1ZI6A 4MGYR 4WCFC 3ETHA 2IT1A 1YH3A 3VI4B 4HGQA 2IS2A 4CFZA 4I1VA 1P60A 1LPSA 4IUBS 2WSIA 4NAUA 1JNYA 4QFBA 5JYCA 2WYOA 3IT3A 1DC7A 5KOJB 3HACA 1SKAA 1N6OA 2PM8A 3LNTA 2EL7A 3TAHA 4O2BF 5HTOA 2IEBA 4GXQA 3CLSC 4XGIA 2NVUB 2WP8J 1S8AA 4M9ZA 5A3SA 4AJ9A 4ZO7A 1PW5A 3Q7RA 5FPPA 5HEKA 4BFVA 2WV7A 3SSNA 3TL6A 2O3TA 3KPUA 1Q83A 2AZTA 4FYMA 4Q02A 3LWBA 3UICA 3FPLA 1IBCA 4PZDA 3EDMA 3NYRA 1ODJA 1OFGA 1SRRA 4R1OA 3KR2A 4GSLA 1N7HA 5DXFA 5JARA 4WNYA 2UZAA 3OESA 4HLUA 3NVDA 1WXWA 2B25A 4RVOA 5B1HA 5JNUA 1NJ8A 1FXWA 1JIVA 4HWKA 3R23A 4F11A 3ZD7A 2QTMA 5HF8A 1R15A 2H1SA 3K2BA 4J8PA 4IDAA 3SR3A 2C4KA 1NF3A 2FWPA 3MBIA 5KQRA 1R66A 1P0IA 3IVRA 3KKEA 1E58A 4QGHA 4B2YA 1SUFA 3LY8A 3WNZA 5EJIA 3IAFA 4AKEA 1YQGA 4RPCA 4LNUA 4AXBA 1RLUA 5AVSA 1UL1X 2FJUA 1F7UA 1X1TA 1KJ9A 1RQXA 1SQ0A 3FNBA 5EE0A 4JI0B 4NEQA 3UFXB 3RFFA 1IEWA 5REQA 3WMRA 1PG0A 1XKQA 2G88A 2GLXA 4EF6A 2CVPA 3AT1A 3K9WA 3R5SA 4KAAA 4WK4B 2G82A 2QAGA 2CYAA 3O7MA 4B84A 5BQFA 1U8UA 2IODA 4GEKA 1UEXC 5M7EA 2ZR0A 1PR9A 2Q46A 3EVBA 2E5FA 5HM6A 3TXYA 3BWDD 2JAXA 5EHQA 5IZ4A 3O1LA 3EQ6A 3B20A 1TX4B 4U7DA 1W4LA 1YWGO 3DV9A 4AMGA 2PFKA 1TJ5A 3JVDA 2GEBA 4LXYA 4X1OA 3RBAA 5M34A 4YUVA 3U5ZB 1TPZA 5B1YA 3EW7A 5CH5A 1M54A 4F5DA 4S04A 5JO9A 4E21A 2XNKA 4LVOA 5E8RA 4BNJA 1G8FA 2NTEA 3OMLA 4HNHA 2UZ4A 2BKUA 4H9GA 2PT7A 3D54D 3N2IA 7ADHA 4FFOA 4HQFA 2QRHA 2XDYA 4M0KA 4D3XA 2QX7A 2A86A 3A6JA 1BX1A 2W43A 4OJTA 3U9TA 3MINB 3T9EA 2AX4A 4G37A 2NPFA 2NZ8A 5K4HA 5L3QB 4MCHA 1GA1A 1SVKA 4H18A 4DILA 5IJ0B 3SE7A 1R0RE 2H16A 4G86A 4V0ME 1UWVA 3GFVA 3BAFA 1Y4DE 3NOVA 3OPNA 5AR1A 4E5NA 4L74A 4QUJA 5EQFA 4C5CA 5JAZA 1HPLA 4LDZA 3JSXA 4MUIA 4NSNA 5AKLA 5FLKA 3GROA 3N8NA 2QWXA 3TZHA 1QQ5A 1GG9A 2Y2VA 2APJA 1LLQA 1XCMA 2OCBA 3TL2A 3ZE8A 4C4AA 1RWNA 2BVNA 1NMYA 4Q9HA 3U3KA 4DUGA 3N86A 1GTL1 2ENWA 3KVNA 3AC0A 1LDMA 2X86A 3M5CA 1EM8A 4IEEA 1WLYA 4OI2A 5LB2A 3EPKA 1Q0HA 4LRUA 5L53A 2ZM5A 3JQBC 2FRDC 1R0YA 2R8PA 2X3YA 1H22A 3TOSA 3O47A 1X77A 5EMHA 4Z8XA 3OPMA 3WI7A 4AQYB 4M1YA 4UE2A 1ZVQA 5HFJA 3FHLA 4DYHA 2QN8A 1SN7A 4UBJA 4B83A 2WFAA 1K3UB 3QKSB 1R8SA 1Z75A 2VHVA 3P9NA 4XDHA 4BX2A 2HCRA 5KVCA 3H2YA 5KCMA 4WY2A 1GYRA 4J75A 2H2HA 2MT9A 5SYAA 3MHTA 3L0SA 3PD0A 1Z06A 4PO8A 2AFHB 5ITSA 2OYSA 1SCUB 5AJTA 2OYRA 3V33A 2V7PA 4URUR 1GADO 4C7BA 3RC7A 3BA6A 3IDFA 1QQAA 1C3VA 2C7GA 1LF0A 3GZNA 4RMIA 3BXHA 3TM5A 3UGTA 3KHSA 1GGJA 2VDJA 2IPNA 3DBHA 2OHVA 4EFDA 4JZKA 2H4WA 5CEJA 2B7CA 3ADBA 3HK2A 1E2MA 2BMFA 4LBYA 4GZ3A 4AUMA 1C3JA 4GNKA 2O59A 1BXRA 2COKA 4NE7A 5JZVA 2NP6A 4XE5A 3RYHA 2CZGA 5CXQA 1JPVA 1KK0A 1O89A 4KE8A 3D7SA 3COZA 4REQB 4IVRA 1E2JA 1Z47A 4JR1A 4JYPA 3TZCA 4UU1A 3EEBA 3O93A 2H7XA 2AOXA 1CEQA 4NEHB 3A3OA 4TTVA 4LISA 1ETHA 3LRTA 1B43A 4AY2A 4YJ2A 2OV3A 5AI4A 2GCNA 3HLTA 3DMNA 4IGIA 3ZZUA 1GKYA 4L4ZA 1JLMA 3FSEA 1F17A 3VSEA 3GEMA 3N2GB 1IK6A 3H4VA 3BWXA