3B2EA

Crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
349
structure length
307
Chain Sequence
LTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDLADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Get1 stabilizes an open dimer conformation of get3 ATPase by binding two distinct interfaces
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 95
structure length 307
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b2eA00
1N5KA 1C1YA 2HT6A 2IXGA 3JZAA 2FEOA 1S1MA 3OAAA 1E9FA 4UKDA 3VFDA 4RD3A 1AZSC 5DYIA 1A4RA 4R2HA 4B35A 5FOUA 3SC3A 2WSMA 4ZV4A 2KJQA 4EIWA 1G7CA 4BUJA 5SZJA 3MWYW 4X8MA 5KDOA 2VHCA 3FMOB 2ZEJA 3AF1A 3MSXA 4W5HA 4EAQA 3FPAA 3THXA 4LI0A 1GP2A 1LW7A 1MOZA 3C4JA 3KKQA 5F98A 4I1OA 3LBIA 4KXFB 4XOIA 5B2ZA 1M6NA 3VNVA 4JBWA 1QHSA 5FPHA 1JR6A 2A3RA 3V00A 3K09A 2GEUA 3OE7A 2IUSA 5FPSA 5CDFA 1WE2A 2FPMA 3RWMB 4JL8A 3AF2A 2AWOA 3QPUA 4M1TA 1HH4A 2XTMA 2OAQ1 4I99A 3QXXA 5IK2A 1KK0A 4TMVA 3WMGA 4BFWA 5KPJA 1OFIA 5CK4A 4IFBA 4OHZA 1KKMA 2GCNA 5G3YA 4NCIA 1FNMA 1EGAA 2XNDD 4V03A 4URZR 1E1QA 4K46A 4MRVA 3AF0A 3KXKA 3AGQA 3DM9B 5CDFE 3OIYA 1CJUC 1GITA 1OYWA 2NIPA 1IN5A 3IEUA 2OFXA 3L0PA 3K9HA 1E3MA 2JIZA 3KB1A 2HYDA 1G4AE 1IY1A 4MYUA 5H8WA 1OH8A 1GRRA 1R10A 3QEOA 4QRHA 4TL9A 4FD2A 1Z22A 2O8DB 2V9PA 2V54A 4US0R 1UBEA 1F48A 2I1VB 2OO7A 3I92A 2VPPA 2V4ZA 5JRZA 4A36A 4HLUA 2ZI9A 3WMFA 3ICEA 2PH1A 1E2FA 3THOA 2RGAA 2D74A 3CKLA 3FGNA 1W0JA 4YC7A 1W0JD 4QGFA 3WMEA 4G5OA 4LJ9A 1VHLA 4A2QA 8OHMA 4BRWA 1FNNA 2AKAB 2IBMA 3RS4A 2IXEA 4DJTA 4MUAA 3MGCA 1FX0A 2BMJA 3BE4A 2XOKA 3QBTA 1J99A 3D8BA 2ODBA 4QJ4A 5BN5A 4I1UA 1ZM7A 3LD9A 2GZDA 3LFUA 5D3MB 3AVVA 4DLSA 2D06A 3PEYA 3C41J 2BWJA 1US8B 3IILA 2J46A 5C4GB 2IC5A 1OXSC 421PA 4PR0A 1R0YA 1ZU4A 2DFKB 1MO3A 5KNBA 2ZS9A 5KO2A 3UKDA 1XXHA 3QKRB 4EPYA 2ZRFA 1Q21A 1NJGA 1G16A 2NO6A 3ETLA 1TTTA 3VR1A 4M22A 3VR6A 4BASA 2GXAA 2BMFA 4M9ZA 2JAQA 3UK6A 2QQ0A 1XWIA 2J5XA 2XXAB 1CJKC 2CVHA 4A0HA 1Z6YA 2C04A 1J8MF 4Q7KA 3TVDA 2ATXA 3RS3A 4DIEA 4GL2A 1TNDA 2BMDA 4DDUA 1WDTA 3C5HA 1ZP6A 1ZUIA 4LHWA 1XD2A 521PA 2V7QD 1E6CA 3PUWA 2CCKA 2V55B 5DLQC 1KAOA 2VBCA 3L43A 4UXHA 3ADDA 4O0MA 5DE3A 2CHGA 2NQ2C 2C95A 3B1XA 5CITA 4LDJA 1F6BA 2R65A 3GP8A 4TTRA 2NPFA 3T06B 2VSFA 4URXR 2ZR0A 4HSEA 3M6AA 1N25A 2ZROA 2ZUDA 1R2QA 2FFHA 3Q72A 3UATA 3SHWA 4W7SA 1E79D 2FV8A 4TLBA 2A78A 4PQRA 1MV5A 4WXPA 4DDWA 3ZQ6A 3PV0A 2W2XA 1L7VC 1NG1A 4DUGD 3LNCA 3U2QA 2WKQA 4IOLA 3IKJA 2IUTA 4ZI3A 1Q20A 3ONWA 2EQBA 1W4BA 1WCV1 2HJVA 5DH9A 2VLIA 4QFMA 1R0WA 2HXYA 5BN4A 2H7VA 4N3NA 4XWKA 2PZFA 1YZGA 3IO5A 4GOKA 3I5YA 5AUQA 3RRZA 3MWLA 4AC9A 1CJTC 4DSNA 4BFSA 4ARZA 2J0UA 5E95A 3GFTA 4BRUA 2CMKA 4OQXA 2F3TA 3PIRA 1Q3TA 4ZI2A 4ZIRB 2J7KA 3K0CA 4CZ2A 5AUPB 1G3QA 5DISB 4AYXA 4BFZA 3CZPA 1G19A 2OFOA 2X19A 1KNQA 3GJXC 1NG9A 3O47A 4ESVA 4BZXA 3KXIA 4ZKDA 3FOZA 3O8BA 4AK9A 4OI2A 2B7BA 3I72A 5E3HA 3EAQA 1K5DA 1OFTA 5GJVC 3VQTA 1U9IC 2GKSA 1W47A 3SJZA 3W3AA 3QI2A 4KFUA 4G01B 1JEDA 2CEAA 2FA9A 4BFTA 3THWB 3WYAA 1G9XA 1ZNZA 3X1DA 1OV4A 2PLRA 3Q3JB 3GLFE 4KO8A 4RCZA 1G291 4QBGB 2CK3D 5DIFA 4LJAA 1DARA 5SZKB 1DE0A 3B6EA 5CIQA 4CF7A 4DEXA 1A1VA 2XSZD 1XBTA 1UJ2A 1KGDA 3KDSE 3P20A 4NONA 1CR0A 4W5JA 4ON9A 4ACAA 1KIMA 4NH0A 3MJRA 4S2EA 2JJ2D 4C0QC 4D25A 1KI7A 2O8FB 2QM8A 3NTUA 5B64A 2IS6A 2EYQA 4FW9A 4O25A 4JL6A 2GJAA 1X3SA 2C03A 3VR3A 2CLCX 5TXGA 1JQLB 4B44A 1U98A 4R71A 2F55A 4LYHA 1G41A 5JHHB 1EXMA 5EUMA 4LJYA 2O8EB 1GL9B 3THYA 3TW4A 4F4CA 4LOAA 5FR2A 5JCPA 3ZD6A 4M2LA 4C30A 3AM1A 4ABYA 3RDPA 1T6NA 1F3OA 1G1MA 1GFIA 3A1TA 2VF7A 4OQMA 3U3OA 2NG1A 1E9DA 1ZM9A 4LBZA 2QE7D 5AWFC 4NCHA 2O8BB 3AP1A 4B6FA 3QKSA 4DSUA 4GI7A 4WZ6A 4OK5A 2ZJZA 1AZTA 1Q1ZA 5K8LA 2BJVA 2OE2A 2MSEB 5JBQA 3FWYA 4FCWA 4P4SA 2GEVA 1CXZA 2QPTA 3K0AB 2FX3A 3GLFA 3B1VA 2IS1A 4UNSA 3NC0C 1IN4A 2DYKA 1E9EA 2GK6A 1C4OA 2GXSA 2XJ4A 1CS4C 4Z1MD 1HQCA 1P60A 4GNKA 4DXAA 2Z4RA 4E09A 3SDZA 2OCYC 4POAA 4MA4A 2JLRA 2WOOA 2H57A 4D80A 4A2WA 821PA 2G88A 1KO1A 2CBZA 1NF3A 3GEHA 4V0OA 1NN0A 1G6HA 4RD1A 3A1VA 1NRJB 4XD7D 2Q0HA 4QGAA 2O8FA 1Z0DA 3ADCA 4LJ7A 2P67A 1BYUA 2R2AA 2DCUA 1RRGA 4CW7A 5KSZA 2GBLA 5TARA 1UFQA 3Q5EA 5C18A 1Z08A 4HAYA 4KITB 3UMSA 4OI4A 1YR8A 4IVRA 5TB5A 5KOYA 1W5SA 2R6AA 3AB3A 4D6PA 1TADA 4JVSB 3C8UA 3P32A 2G0NA 1U8YA 2ZJOA 5IT5A 4NYMQ 1A7JA 2PJRA 2OM2A 1RJ9A 3EZFA 2X77A 2ZYUX 4TMTA 4ERNA 3VKHA 4JLPA 2IYWA 4OKSA 2BBOA 5ELXA 3QKSB 1N0VC 1M7GA 5BQ5A 2O8BA 3V4RA 5GADl 4FMDB 3VNUA 2A30A 1Z6XA 2YKGA 3KQHA 3GLHA 3U61B 2VQSA 1TEVA 1U8ZA 2QMEA 2XGJA 4KLNA 4TL8A 2KBEA 3CPHA 1NMXA 1S3GA 3OEEA 3QOFA 2IYZA 3K8YA 4KV9A 2ZU0C 2DWQA 1D9ZA 3LY5A 3GJ4A 2QI9C 1UDXA 4TQUS 5GJWC 2PMKA 4JLVA 1NIPA 2AFHE 3GEEA 1IONA 1IY0A 2EFGA 3B5JA 4BLTA 1RRCA 4KFSA 3RABA 4KAXA 2ZSAA 2B8TA 1RRFA 3NDPA 4N1AA 1M34E 5JECA 4A8JB 4GOJA 3TKLA 2GVDC 3AF4A 3P4YA 3RVBA 1H8ED 5FTKA 1E2HA 4JVMA 5KYKA 1RE0A 1VCNA 3X2SA 3JZMA 4YXWA 2BIFA 1G20E 2CJWA 4Q4AB 2WJJA 4XJXA 2ZVPX 3TBKA 4C4PA 2J0QA 4BLSA 4QBIA 1QRAA 3U4QB 2Q3MA 1L2TA 2H5EA 5F2EA 1ZINA 3AKDA 2ZJ2A 3WP1B 2QBYA 3ZZUA 3FE2A 1QHXA 4JL5A 3ADBA 2QSYA 3B60A 1ZM2A 3BK7A 3MG9A 1DAGA 1Q1BA 1TUEA 5FBVB 5L3SB 1Q3HA 1XMJA 1S1CA 4B75A 3L0IB 4NCNA 4RJLA 2WV9A 3PENA 3HR7A 2H8KA 2JDIA 1GNQA 1E2EA 5A0FA 3K9LA 4Q18A 4Q4HA 3KJIA 1LY1A 3W3ZB 3LXXA 5FPTA 4A8JC 3LDAA 1MH1A 2XNDA 3QSYA 3CM0A 2ZRBA 2ASEA 1TQDA 2IK8A 3K0FA 1DBSA 2VHUA 4Y0VA 1SVSA 3X1XA 1TF7A 4A2PA 4AKIA 4PO8A 3BFXA 5G3ZA 1M7HA 4K8OA 4AG5A 1JR3E 2FJUA 4FIDA 2W58A 1E2PA 2NMVA 1JXMA 1UBGA 1G3RA 1KI9A 3CNOA 1XXHB 4U7DA 3DHWC 4PZZA 4WAUA 1IQPA 2WAYA 4GT1A 1SQ5A 4R2IA 4HB2A 3FYHA 4LV5B 4Q1AA 2B21A 5GJCA 3SZRA 4B48A 4TLEA 1Y63A 4R98A 1T3LA 4HUQA 4TQAA 3B7GA 1OXVA 2QNRA 3NH9A 4M1OA 4CEJA 1FZQA 1MRNA 4RZ3A 1D2MA 721PA 3IEVA 2ECKA 2J45A 2J9RA 3QKUA 2ZI4A 3CX6A 4DIDA 1VPLA 3DEFA 4TYQA 2VIIA 2X2FA 5KDLA 5HR5A 4O3MA 1CJMA 4IHQA 1BS1A 1OIVA 5G40A 1KY2A 1RW4A 1X8JA 1GDDA 2BCGY 3PEUA 4WVFA 3KKOA 4NBSA 4Q1BA 2CL6X 3BB4A 2R6DA 2G0TA 2XB4A 2PLFA 1K8RA 4B6EA 2IUUA 5EE1A 3GJ8A 3CF0A 4HB0A 4XVQA 3BB1A 3FTQA 5EP4A 2QAGA 2A5FA 2KSQA 3QVVA 3IPXA 1KYIA 1KTVA 3FHOA 3K9NA 5TVKA 4XD7A 5EP3A 1JJVA 1UEJA 1KZ7B 1FP7A 3BXZA 2DFLA 1Z06A 2BMEA 3B82A 2IW3A 3F0TA 1DAMA 2BVNA 2WPDD 5TMPA 1G21E 1S8FA 1LV7A 1XB2A 4DVGA 1UKVY 1KO8A 2BM1A 1T3SA 4OQLA 2UZ3A 4GZLA 3VU9B 4C2TA 1H8HD 1ZC4A 2NTYC 3LVRE 3ZVNA 3I1FA 3TE6A 2C99A 2CE2X 4TYPA 4UNNA 2ZS7A 1SXJE 1VCIA 4KLZA 4KSBA 2AD1A 5L3SA 4NYJR 3I8SA 4IDOA 1GIAA 1GSIA 1RJ9B 2VRWA 4Q21A 1XD2B 2RHMA 2YOGA 1H65A 1FMJA 4BLPA 2O52A 2C77A 2NZJA 3QF4B 3T12A 2YVUA 2PCLA 2WSSD 5AR1A 3VHLB 1OSNA 2PEZA 3CPJB 4Z8XA 4PQYA 1E2KA 4RFSA 4TL7A 3LW8A 4GSYA 4R7ZA 4B71A 5JJIA 3L0OA 2Z83A 4N0EA 4P0TA 1WB9A 2C8VA 1P61B 2B6HA 4MITA 4TLCA 1JECA 1NVVQ 2HDNB 2RGDA 3OFNA 4OK6A 3CUEF 3PCRB 1PUJA 221PA 3ECCA 4Q66C 4YMSA 3WYGA 2RGEA 4ASUA 5JEDA 4DEYA 1QVRA 3LLUA 2BJWA 4CVNA 2GTPA 3AVQA 2C9YA 2R6CA 1VYUA 2PZEA 1GOTA 4DB4A 1JALA 2JA1A 4LV8B 2F43B 5KUTA 2VSOA 2ZJ5A 1RYFA 4LWZA 4RZUA 1QG2A 4W5WA 2F1RA 4KVAA 5FBQB 5LPNA 1KI3A 3NIBA 4GOXA 1DAIA 1AKYA 2PX3A 2FGJA 2I1QA 2W6IA 1XZPA 2X8AA 4M9QA 1ZM3A 2ZUBA 3U6BA 4EKDA 2HT1A 3PEVA 2GJ9A 2WJVA 1M1YE 4P31A 5JJLA 1E2JA 1TF2A 1MR3F 2CVFA 4RVCA 2MSDB 2RCNA 3TJZA 5CLQA 5C46F 1OB2A 1W4RA 4C2UA 2E87A 4G3XA 4D4KA 2XZPA 3MUFA 3F3YA 1EFRD 2B92A 2OUKA 2HLDA 2WWIA 4G5SA 4B74A 2PL3A 5G53C 1DG1G 2N42A 3NEJA 4CDGA 1XFAA 1KI2A 2Q3HA 5M04A 2P6RA 1XDBA 2WZQA 2F1JA 3HU3A 3EIQA 3NH6A 3WBKA 1II9A 1XPOA 1IXSB 2WJYA 4YXWD 4LYJA 2VP4A 1KMQA 1PLKA 2YHSA 3KX2A 2ZI7A 2YZ2A 1XD9A 2CK3A 2GBLC 4JZKA 1X86B 4NMMA 2C98A 4P33A 4PAOA 1QHHB 4BQSA 1ZCBA 2BDTA 2XEXA 5EE9A 3W8RA 2X2EA 2WHXA 3AP2A 4MKGA 2HXSA 1O87A 1NKTA 1XD8A 3LH5A 1P73A 1WP9A 3ND8A 2OBLA 3DZDA 2F9MA 5L3QB 5BN3A 3HU1A 4GZMA 2JJ1D 4M9SA 1OKKD 3LV8A 5K8TA 2XAUA 1VDZA 3GPLA 2FEMA 3KQUA 1GAJA 1W4AA 2O0JA 1D6JA 3H4MA 4CEIA 3QY0A 1W7AA 2W0SA 1Z83A 1NVXQ 2CNWA 2ZRLA 4KCGA 1U81A 4CEIB 1EK0A 4V02A 5CJ2A 1ZM4A 1E96A 2DFTA 3EC1A 3PUVA 1HURA 3EZ7A 3CW2A 4N0DA 4PAQA 4FINA 2IYUA 4XSHA 4ARZB 2IYTA 1NVWQ 1QHNA 2WM9B 3FMPB 3I3SR 5DHFA 2XJ9A 5FR1A 2J87A 1HTWA 2BOVA 1Y3AA 2FFQA 3EASA 3U7EB 3K53A 1W2GA 4MKFA 3K70B 4YQFA 2AX4A 2QAGC 3OZXA 1JAIA 2O5VA 1Q44A 4PSAA 5J4LA 1XNJA 4P4TA 4Q5IA 3HP1A 4JT4A 2C78A 4MYCA 3X1ZA 4NCKA 2PJZA 2YWGA 3HR8A 3AP3A 4JMPA 4MGYR 3EZ9A 5FOTA 1V5WA 3ZLJA 5EZ5A 1Z63A 3NC1C 4DKXA 2R6GA 1U9IA 3AKYA 4F91B 3L8YA 5FOWA 5AUOB 3CR8A 5CLLA 4Q00A 3W9YA 4PTLA 1KDTA 3TSZA 4B73A 4A0FA 4DCVA 2J7PA 4PHHA 3KTAA 3KJGA 4EJSB 4DLRA 3EXAA 1KI4A 2HF8A 3DKVA 3CBQA 1DO2A 1JJ7A 2QU8A 4IKEA 2G83A 1Q12A 4V0ME 1Z6AA 1W0KD 1E0SA 2FFBA 2QA5A 2GJSA 1XXHE 1E1RD 1R8SA 4LJ5A 4OI1A 3W90A 3CH4B 4A9AA 4KHZA 4PANA 1GM5A 1ZUHA 2D3WA 4JYCA 5CM9C 4RY2A 3UMFA 2VTKA 1YU9A 2QTHA 2AFIE 1SHKA 3C5CA 2GA8A 2ODWA 3F8TA 4D0LB 3RC8A 3EZ2A 4CEHA 1RYHA 1ZNXA 4OJKA 2O8CA 4G5QA 5FOSA 3RRMA 1HA3A 1UKYA 3A37A 3EWSA 4IDNA 3SOPA 3TGPA 3U6KA 2GK7A 4GMXA 1SKYE 2ZRJA 4HAWA 4PZLA 2JLZA 2ZJ8A 2BKUA 4PPFA 1DEKA 3W5IA 3R8FA 2YYZA 2IF2A 1PZNA 3RSLA 4JT2A 4Q1DA 4TSFD 1YR7A 5CM8B 4PQFA 1ESMA 5FTMA 1E2QA 2AD5A 4XTCS 4BFVA 1ODFA 1PUIA 1US8A 3D7MA 2QAGB 3A1WA 4M1MA 3G5UA 3OFND 4JLDA 2QMUA 1GWNA 1VCMA 1KMHA 1KK3A 3H84A 2OSBA 3IIKA 2QGNA 2MMCA 3MLEA 1U0LA 3OEHA 3GEIA 1XEWX 3RRNA 4EPVA 1LVGA 4Z8YA 1EX7A 3SR0A 1SVOA 3CRRA 4DCNA 3IGFA 1H8EA 5FUXA 2IYXA 3NKVA 4WXRA 4GDFA 1COWD 4PO9A 4CEJB 4DUGA 4JJKA 3EPHA 3KJHA 1OT3A 3SBEA 2RGGA 2ORVA 3BD9A 4QBHA 1KO5A 1MT0A 3VU9A 2OEPA 2RGNC 3GJ6A 5JS8A 2CJWB 4Q4AA 1E4VA 2AL7A 2RGCA 2ZITA 1NMYA 3GJ3A 4QGGA 5LB2A 1QDEA 1P6XA 4JSYA 5TV2A 4QKQA 5FL7D 2QBYB 1CEEA 3K0SA 1IAQA 3C15C 1JAHA 4FMCB 4L8GA 5JLJA 1RFLA 3GMTA 1KJZA 1IM2A 2G77B 1J2JA 4US1R 2N46A 5E7IA 5IDVA 3U3RA 4XWOA 1PVOA 1MRSA 1GZSA 4WOPA 2H1LA 4RFVA 1NY5A 1XTJA 1N2CE 1UKZA 3AH8A 1G3UA 1NIJA 3BERA 4US2R 5AJZA 3KQNA 3QG1A 4A6XA 3SN6A 1KO4A 1E2MA 2A5DA 1IOZA 2QP3A 2IYYA 2YINC 4Q7JB 3TVTA 1II8A 1DAHA 2O0HA 4LJ8A 4KFTA 3GCGA 2FE4A 2ZQ5A 2R9VA 2WJIA 4G5GA 3DO6A 3UWOA 4TT3A 5LB4A 4LBWA 1UDWA 3TRFA 4Q1CA 4DZZA 4EFMA 2ZUCA 2IEYA 3U7HB 1U0HC 1OH5A 1CR4A 1QHIA 3RLFA 4II7A 4LK2A 2YOFA 4B47A 1A82A 3QXJA 4OQNA 3U3JA 5L3VA 1GL6A 3ZGXA 4WIAA 1W5TA 4LSGA 4HAZA 4M1WA 2ATVA 3GLIA 2JASA 2YC2C 1ZIOA 4GP6A 1V43A 2DWPA 3IPYA 4LGMA 1W36C 3OIUA 2Q6TA 4LV6A 3QVUA 1SGWA 2ZRCA 2JATA 1Z0JA 1OFHA 1P4SA 2VHTA 5EE0A 1IHUA 1HUQA 1XZQA 2CCGA 4QXAA 4G0NA 1NN3A 3Q7PA 1NSTA 1Q57A 4Q48A 1G7RA 3QXSA 3CH5A 4HLQB 2YC4C 4DLXA 1HE1C 5TDHA 2QTFA 1E98A 4O2RA 1N3BA 5DI3B 2J1LA 1MO5A 1E1QD 3R7WA 1FPMA 4PHGA 3FMFA 4DLTA 1NN1A 2OBNA 3FKQA 2QENA 1VECA 2CLDX 4RZ2A 3B85A 1J70A 1OKKA 4LBVA 4RKEA 4Y0AA 4QGHA 2F1IA 2VP0A 2EFHB 2JGNA 2JJ2A 1GKUB 1YZNA 2FMXA 3B2EA 1NKSA 3MWJA 5JI3E 3GFOA 4P4UA 3D3QA 1BKDR 1BOFA 2JLQA 1R5BA 1KAGA 1CKEA 1S9DA 4XVRA 4DSOA 4F7WA 1E9BA 4WZBE 3TQCA 2ZI6A 4FWTA 1N5JA 1ANKA 5JJKA 3H86A 2GCOB 4NPHA 1M2OB 1YVDA 1G8PA 1KDRA 2HYIC 3PG5A 2IWHA 5C1BA 5EJEA 3R9XA 3NBXX 2V6JA 1OLOA 4O2LA 3RWOA 1W0KA 2W0MA 3BOSA 3EARA 1RPZA 1OHHD 4F38A 2ORWA 3THXB 4HB3A 3ZS8A 2FZ4A 4TYNA 4QHYA 1G18A 2BEKA 1AJEA 3TAUA 2RMKA 5FUVA 3HU2A 4URVR 5B58C 4UQOA 3GJ5A 4X8LA 1P2TA 4OHVA 1N6RA 4KYIB 4Q9IA 1G8GA 4NDZA 1XJQA 2QQEA 4NL4H 1D5CA 1RIFA 1IXRC 4C0BA 1KSJA 2RHDA 1ZJ6A 2P6NA 1W44A 3B8HA 1FTSA 1R0ZA 1VG1A 2FU5C 3LO5A 3EC2A 4HDCA 3K0AA 2NO1A 1W48A 1XTKA 1HE8B 2OAP1 2REXB 2IYRA 4JVLA 4EDHA 1P62B 5BYJA 2ZS8A 1M8PA 5LD2C 3AVXA 3SFVA 3CB4A 1YHNA 2ZREA 4RSGA 2G9NA 3HYRA 5FOXA 2D7DA 5DYGA 1ETUA 2QP4A 5HE9A 1MKYA 1EFUA 3BJIC 4XTRA 5JI2E 2G1KA 3SJAA 5J4HA 5KHOC 4EQ6B 1I4DD 2H16A 1R0XA 5AJWA 1SKQA 1AGPA 2Q9BA 1TF5A 2WSSA 4NTZA 4MH0R 4Z51A 5JCZA 3W5JA 1R4AA 2ZSBA 3LLMA 2KBFA 3FDIA 5EXSA 4ZIRA 1DAKA 1LS1A 4JLMA 4Q4JB 4BLRA 2Q3FA 4A82A 4R9UC 4IVQA 3RSOA 1YZUA 2C9CA 2JLUA 1XCGB 1E9CA 4D82A 4TL6A 4HLUC 2FSIA 4MQBA 3PJRA 3A1SA 3K0EA 3BFVA 1E0KA 3BC1A 4DWJA 2VF8A 1P2VA 3BBPA 1AIPA 5DN6A 3C16C 5DN6D 2D2FA 3HWSA 3LQRA 1ZYUA 2QTVB 4HATA 4B33A 1ZW6A 4IXMA 3CNNA 1G3MA 3WYFA 2AXPA 5J47A 1KNXA 1A2BA 1HT1E 4HZUA 2IYLD 3BS4A 1T5IA 4YMUA 5FTNA 1RRPA 4PC7A 3EA0A 1K6MA 2ANBA 1XTIA 3CONA 3KL4A 4RD6A 3ZVMA 1KSGA 3GLIB 5DGXA 1YR6A 3PUZA 3ASZA 3SE0A 4EQ6A 2WMNB 3OE7D 5EUQB 4LZZA 1ONBA 4EJSA 1BH2A 1D8TA 4WZAE 1JPNA 1LS6A 1FW6A 3TR0A 2QE7A 4I81A 2ERXA 5JRJA 1KOFA 1SVWA 2IT1A 2MSCB 2NZ8A 1T9HA 2ZRDA 3AKEA 3E2IA 4TT3D 3T5DA 1P7CA 3IO3A 3CRQA 5CB8A 2AN9A 2ERYA 4OI0A 3CO5A 3VMFA 1FTNA 1KDOA 3VR5A 4LUCA 5FH9A 5IF9A 2W2VA 2FN4A 3BORA 1NP6A 4BEJA 4ZCMA 3A6PC 1SVKA 3C7KA 2IXFA 3NWJA 3AUXA 1Z07A 1DO0A 4Z1MA 1W36B 1DPFA 4C0SA 2OZEA 4GFDA 5FBWB 3Q85A 1M7BA 4F4JA 1F5NA 2JJ1A 2ZRMA 2REBA 3TLXA 1DVRA 2JJ8A 2ZVQX 2HCJB 2Z4SA 1Z28A 3WHKA 3THWA 1ZVQA 1WF3A 4QJ5A 4HLCA 3LXRA 4GP7A 1IJFA 1QVAA 4Q19A 2ANCA 1G5PA 5LDDC 3EW9A 4BECA 4URWR 1VG0B 3H0KA 2PMDA 2IA5A 3G82C 3IDQA 4MGIR 2GESA 3A4LA 2ZE7A 2GCOA 3P27A 2PT7A 3TSOA 3V9PA 1AQUA 1EFHA 1KMHB 1YQTA 1LF0A 4TMZA 3WNBA 2VYFA 3Q7QA 4XIGS 4IOJA 3RANA 1KI8A 3JVUA 1OF1A 2RB4A 1DOAA 3MFYA 3BIFA 3MMPA 4JLKA 3S1AA 5C2JB 1R8QA 1VCOA 3ICQB 2P3SA 3ZDQA 3GJ7A 4QJ3A 2V3CC 3QF7A 2WIAA 4QHTA 4JJZA 1AS2A 3T1TA 1L8QA 3EA5A 2ZAMA 1T91A 4M8NE 2YNMA 3V4FA 1AS0A 5HKKD 1EWQA 3P4XA 1L4UA 5DI3A 5KSPA 5G41A 4OL0A 3DVLA 1NI3A 4F92B 5FPKA 1EX6A 3P26A 1II8B 1TU3A 2H17A 2VEDA 5EQTA 2UKDA 3LRPA 4DSTA 4TZ0A 2C96A 2IYQA 4C3ZA 5BWMA 1H8HA 2OCPA 3DZ8A 1WQ1R 5CB6A 2GILA 1E1RA 2ZJYA 3K0CC 3LX5A 4Q9LA 2A5GA 4C7OA 5L3RA 3R20A 4TZ6A 3M4YA 3N70A 4P32A 1Z3IX 4GBMA 2QN6A 2AXNA 2FSHA 1AN0A 3IQWA 1YR9A 3CRMA 4JYBA 5CYOA 2ZRIA 5JWRA 3K70D 3MAAC 4ZDIA 1W1WA 3N2IA 1P75A 5F3WB 1G7SA 1KK1A 4AY2A 3A8TA 4PC1A 3QJYA 4PSVA 5EXXA 1DELA 3UWKA 4IFEA 2VHJA 3ND9A 3U4QA 1B23P 2GVZC 1ZBDA 3UMRA 4MUBA 2GZAA 1UKEA 1XJCA 4FI3C 4Q47A 5JSZA 2JLYA 4D0NA 2Q9AA 1ZD9A 1QBKC 4CT5A 1J90A 4MRRA 4KFRA 2EW1A 4U00A 2O8EA 3RS7A 1WA5A 2O0KA 4B3BA 4IDQA 3TMKA 1T0JB 5D3QA 5HCIA 1JBKA 2LKCA 4QM6A 1PLLA 4AURA 4YONB 5JFGA 3U7GA 5DO9A 4L9SA 3RS0A 3SNHA 4MRSA 3LA6A 5E4FA 1CJVC 4AKEA 2YWFA 1CRQA 1GNPA 3TH5A 4BFUA 3A36A 1R7RA 2F3RA 4TLDA 4JVNA 1N6IA 4YDSA 4C0HA 1GRQA 5BW8A 4TQ9A 5FTJA 3OAAD 3BB3A 1E94E 1YJ5A 2FSGA 4J0QA 3SBDA 4B34A 2PT5A 5A5GA 2FPLA 5DSZA 1ZNYA 3HYTA 2ZSEA 4F93B 1Q22A 4IRUB 4KBFA 4HAXA 1IY2A 5L3QA 4NYJQ 4C0JA 3EPLA 2IL1A 1FQKA 4CT4B 3C14C 2WWWA 1YE8A 3PITA 2IYVA 1FP6A 4DB2A 4RD0A 1QF9A 3PXGA 2CXXA 2OHFA 4AWXA 2YWHA 3CR7A 2J0UB 3ADKA 1HQYE 1KY3A 1YZLA 4B3CA 2XXAA 2GXUA 2NPIA 2GHIA 3T5GA 4B2IA 3E1SA 2VH5R 1TQ6A 2KE5A 4S35A 1Q1QA 3TNFA 2ZETA 4D26A 2XX3A 1DG3A 3WRXC 1GL7A 1W36D 2BBWA 4PSKA 1CU1A 1EFTA 2BHRA 2HJGA 1SVMA 2UVQA 1SULA 4JIMA 4PAMA 4W9MC 3CIOA 3BH0A 4FMCF 5EE5B 2FOLA 2W6JD 2YWEA 5H70A 1Z6TA 3T35A 1WBDA 4PPQA 2P5TB 3D31A 2EWWA 2AK3A 5BXQC 3QPVA 3K0FB 1GNRA 4KI0A 4JLOA 2Z6VA 1DADA 1Z2CA 1XEXB 2DPXA 1NL3A 3B1ZA 4H1VA 4MKIA 4YMWA 1GILA 5K8UA 2BM0A 4Q03A 5KNDA 4EPXA 2ODEA 3T1VA 2WTUA 5IK2D 4B3DA 2VA8A 2QY9A 3NDBB 3FFAA 1EFCA 3OF5A 2D4HA 4EPWA 3RYTC 2ZSFA 2AK2A 2NO0A 5J40A 5CIWA 3A4MA 1AK2A 4BWYA 2P5SA 3VKWA 3SS8A 1I4TD 4UXJA 1HT2E 4BFYA 5AUNB 1XCMA 4QM7A 1KI6B 2I3BA 3SJCA 2JIZD 3T15A 4JBXA 3J81k 3THYB 1NLFA 4XH9B 1NN5A 2WJGA 5L8VA 1E2NA 5KSOA 4LRWA 1G17A 1L4YA 2F1HA 4MYHA 4Q7LA 4Z54A 2IX3A 3DMNA 4FMDF 1VYVA 4Q9KA 4MDFA 4AD8A 5KNCA 1DAFA 5K8IA 2GF9A 4A15A 2ZYWX 4B2LA 3QXCA 5KPDA 1R6BX 5H68A 5AJVB 2EVWX 3DPUA 1EG7A 2ZE5A 2G1JA 2GCPA 2Z43A 2CL7X 3EZ6A 4EJSC 4TSFA 3LWNA 3R9IA 2YOHA 1SVIA 4LHYA 1I2DA 2CDNA 3O8DA 2ONKA 1NNEA 2XITA 4JBYA 1PV4A 2GEDA 2NO7A 1TX4B 3VR2A 5FFMA 1XPRA 1UPTA 1Q0UA 3IHLA 5EZ6B 1OJLA 2D62A 2GF0A 2QMHA 1LB1B 1TMKA 5DHAA 4JLJA 5LBIA 3SYKA 4C0KA 2V1XA 4HUQB 1N6HA 2WWYA 5DI9A 4D81A 2QT0A 5HZHA 4V0LA 3FMIA 3MJHA 5GVRA 3ZVLA 4A0GA 2ZRKA 3OIVA 4PZYA 1RVDA 4PPGA 3AVTA 4PO1A 4DCSA 3AVOA 3ZIAD 1AM4D 2H92A 2JLXA 1DS6A 3CRW1 4AG6A 2GZHA 1X1SA 1ZD1A 2RGBA 2FZLA 4UJ5A 4A1FA 1U99A 4CIDA 3AVYA 5FBLB 1E79A 1YKSA 3QKTA 5EP1A 4EPTA 1XP8A 3FKSD 4I4LA 4URUR 4Q7MB 4AKHA 1FL9A 2ZAOA 1W49A 1Q1EA 2EFCB 4V0MA 2MMGA 4DCUA 4RD4A 2RGNA 5JZVA 1KKLA 3HDTA 5JWHA 2W6ID 2PBRA 1G8FA 1COWA 2CLSA 2F9LA 3DOFA 4RCYA 4P3YA 5SZHB 3NBZC 4OHXA 2DHRA 2GAAA 4PC6A 4E03A 1II0A 3KXLA 4NYMR 1AKEA 1VIYA 1XRJA 2H18A 1CR2A 4TMKA 3KZ1E 3R9WA 3LAWA 5H1YA 5FUWA 1TQ2A 1JQJC 4IOKA 2P2LA 1ZAKA 2ZRHA 2JEOA 2J0SA 1QZXA 4U02A 3CRVA 1Z8FA 3MCAA 1XEWY 2QPAA 4X8HA 3I5XA 1Z0FA 3PQCA 5FOVA 1QG4A 1KHTA 2ZM5A 2JLWA 3F5FA 5FL3A 3LVQE 1G8HA 2ZE8A 3WY9A 3ZJYA 2FGKA 2QP9X 4HYYA 4B3GA 1R5OA 3DOEA 1R5NA 4LBYA 1U0JA 3RC3A 1E32A 1WXQA 2BV3A 5KU1A 3U44B 2EU8A 4MRPA 3E70C 3PUYA 4M0LA 4E5UA 4DBLC 2OXCA 4M53A 4LHZA 1LNZA 1PLJA 4DRZA 1U2RA 1TL7C 1TU4A 2FF7A 2PZGA 3IBYA 2QORA 1TAGA 1KI1A 3TR5A 3QPWA 4PPNA 1NY6A 2VL7A 4C0AC 1NLYA 4YDHB 2GWHA 4H1UA 1X1RA 4NYIQ 3BH6A 4IW3B 4RFSB 4NKRA 2WMOB 4BE7B 1S96A 2K5UA 3QF4A 2OCAA 3UANA 3ZH9B 2W6JA 1G6OA 3L82B 1F2UB 2A2ZA 2LCFA 2FPKA 3NBYC 2J7PD 3PVSA 2XB2A 1I2MA 2ZI3A 2OG2A 3GLIE 4HDOB 2VP2A 2XOKD 4ZCIA 2JCSA 1P9NA 3ZVRA 2CE7A 4PC3A 1N5IA 3TW8B 3TUIC 3REGA 1BYIA 1WMSA 4BZPA 1KJWA 4FXPA 4BLQA 3KTAB 5EP2A 3EIEA 3I8XA 3KUDA 3SI7A 4EFNA 2J59A 1OPXA 4JKYA 4KBGA 1BMFA 4YMTA 5HPYB 3AQ4A 4Q02A 3WRYC 3FHTA 4NU0A 1S4QA 1N0WA 621PA 1GTVA 3UPUA 1BIFA 5F9HA 3SYNA 5GJBA 1SHZA 4AYWA 1E9AA 3B9QA 2V6IA 3NVAA 1ZCAA 1M74A 1ZUNB 3I61A 4HDQB 2QRZA 1LTQA 2ORIA 1E99A 3D6TB 4M4SA 4QC2A 4M1YA 4LPKA 4BEBA 3IUYA 2SHKA 2IWRA 4L15A 1F60A 1ZD8A 3X1YA 4A92A 5KDDA 3G0HA 4LYFA 1OB5A 5HE8A 5F9FA 1CF4A 1XTRA 3MD0A 2G3YA 2CHQA 2R62A 2EWVA 1N0UA 3I32A 3LX8A 4P4SB 3PR1A 1OH7A 2IHYA 3M1IA 2ZIAA 4ZDWA 2C2HA 3ZS9A 2W00A 4ITRC 1BO6A 1LFDB 1SXJA 4OK3A 2GDJA 2IF0A 2QT1A 3GLFB 4E22A 1ZMXA 2WWHA 3B1WA 2R6FA 3TAHA 2KI5A 1XEFA 3DDCA 4V0KA 3UXMA 2P6UA 3H2YA 4MKHA 3A58B 3GLGE 4I1SA 4MGKR 1CIPA 1N6KA 1E2DA 3CX8A 4URYR 1HY3A 1OH6A 5JEEA 1QHYA 2FG5A 3Q9LA 2A9KA 2QL6A 1FUUA 2OBMA 4BLOA 3ZQJA 3VX4A 3BWDD 5HKKA 1T8TA 2IEZA 1UBCA 2GRJA 3B13B 3I4LA 4GPTA 1PJRA 2FFAA 1SKYB 1XMSA 4IOMA 3ZIAA 5JWOA 5P21A 4HLDA 4FCVA 2REOA 3OEED 4GMDA 4KSCA 2JLVA 4KYUA 2GAOA 5KTYA 3SFZA 3H1TA 3QBVA 3RHFA 1ZRHA 3GFPA 4QBFA 4L5BA 4LJ4A 3ZD7A 4JLAA 3E5HA 2Y8EA 4D0GA 1Z0IA 3EPJA 5LD2B 4KVGA 2N1BA 5HTKA 4BPBA 1RKBA 4Q1EA 4IDPA 2V1UA 4CRWB 4K81B 1N6NA 4IEEA 3GLHB 1NBME 2W83A 1N6LA 4KODA 3JVVA 1OFUX 5D3MA 3I73A 2IS2A 3GLGA 5J4VA 1IJEA 4LX0A 4UXIA 5J4YA 5IRCD 3W8NA 4BFXA 3K70C 2TMKA 1XX6A 3U7FB 3B78A 4ASUD 2OT3B 3IHWA 1Z47A 3LBNA 4HZIA 3AUYA 5AK0A 3A4NA 1KO7A 4B3FX 4C7OB 4TN1A 3SQWA 3NG1A 4EPRA 1XMIA 3KJEA 4DDTA 3KKPA 3PFIA 3ZYCA 1JR3D 2ZSDA 1EFRA 1JI0A 3ZZ0A 5J5CA 4FMBB 2XZLA 2QEQA 3EWAA 1YRAA 3WNCA 2WVJA 2VHQA 4ZDJA 1E2LA 3CNLA 1N6PA 1Z5ZA 3L8ZA 3U3KA 1KJYA 1CR1A 1P2UA 4A0RA 1NSFA 2P0EA 1KI6A 3TUJC 3CX7A 1XCPA 1W2HA 4NYIR 2QZ4A 3R7WB 2A5JA 4LYAA 4IEIA 4DLUA 1Z29A 2ZR9A 4TYWA 2PCJA 4IXNA 1D2EA 3W34A 4NE2A 4XSGA 4B32A 1FX0B 1B0UA 1CTQA 4RD2A 3DKPA 4JS0A 4D2IA 2WOJA 3KB2A 3K1JA 4FWIB 1JXOA 1HV8A 4Q9JA 3W6OA 3AVWA 1OW3B 3KFVA 2CNWD 1K5GA 1GKYA 1JNYA 1E2GA 3KKNA 3PUXA 1MO6A 4G1UC 3CWZA 2Q21A 2ZR7A 4LJ6A 1G5RA 3R8CA 2ODNA 3KUCA 4OBEA 1NLZA 3KFXA 1CBUA 4DC9A 1D2NA 1UM8A 2QG6A 3SHFA 4TYYA 2XSZA 3ZZTA 1C9KA 3KKMA 1TUIA 4UNQA 5HZKA 3PEWA 1YZQA 5EXTA 4JLNA 3TIFA 2J0VA 1BMFD 2FSFA 1FUKA 4QG7A 4A4DA 1UAAA 2WJHA 3QIAA 1P9RA 3EG5A 3BAFA 2ZI5A 4DLVA 2PEYA 4OJQA 1OE0A 3QXHA 3TK1A 2GJKA 1HEIA 3QUSA 4QNRA 4C0LA 5JHGB 4BGDA 2EYUA 2ZTSA 1NMZA 3MWKA 4LHVA 4ZPXA 3KQKA 3NBFA 4ESHA 3TUZC 1AA9A 4GRAA 3VHXA 1GUAA 1YZKA 2X1VA 2J3EA 1G8YA 2UZIR 1DAEA 1KSFX 3GD7A 4TMXA 4U5XA 1OXXK 4YMVA 4B43A 4CYMA 1G3IA 5KSYA 2ZRNA 5E7JA 2XTNA 5BYKA 2HEIA 3SEAA 2NO9A 4HEJA 4D4MA 3OHMA 3RS5A 5FUYA 4LY6A 4QHSA 2BBTA 2BEJA 2B8WA 3CWQA 5B30A 1SXJB 3AEZA 1NVUQ 4IVPA 1GVNB 3VR4A 2FWRA 4NHOA 4DCTA 2R8RA 2GETA 4G5RA 1E9SA 3RS2A 4EUNA 4L16A 1ZC3A 1T8UA 2WWGA 5ANRB 1X8LA 1T0HB 1UBFA 1UEIA 4XWAA 5CJPA 1P72A 2CL0X 1FMLA 4DHEA 3DM5A 5FI0B 2GNOA 3EX7C 3A1UA 4UJ3A 2BKEA 3OESA 4X8OA 4ZO4A 4I1VA 4ZKEA 1ZIPA 2OXRA 1OXUA 1RZ3A 2PX0A 3O8RA 2OCBA 4PXAA 2D7CA 4PX9A 1F2TB 1E0AA 1HYQA 1CRPA 4UNPA 4LPSA 3AVUA 2B7CA 1DTSA 5AJYA 2FDCA 4CEHB 2HLDD 121PA 1P5ZB 2HF9A 4WA7A 4OHYA 4QNMA 2WKPA 2Z5FA 4M21A 1Z0KA 3AKCA 3FFBA 3U3MA 1KDPA 1EWRA 3IQXA 2V7QA 4M9XA 1CP2A 1S9HA 1W4CA 1WRBA 2RKOA 4HUTA 5JMTA 2YV5A 3O8CA 1SVLA 3L0SA 4EFLA 3MRSA 1IN8A 4Q4HB 1VMAA 4WW0A 3QG5A 3WXMA 1G5TA 4OHWA 3P1JA 3BRWD 2XNSA 3QQ5A 2IHBA 2ZJBA 1XEXA 4AKGA 1ELOA 3K9GA 4D4JA 4TWZA 3NEYA 4PFSA 2NOAA 2FNAA 3SQXA 2QAJA 4PHFA 2YJTD 3BFKA 2JDID 3UIEA 3HPQA 3I62A 1TPZA 4B2PA 4DLWA 3SU8A 1FQJA 3CF6R 3VX3A 1KZGB 4TLAA 3RRYA 4LC0A 3B9PA 3CLVA 3CF2A 1FOEB 2KWIA 2DWOA 2O8DA 1XF9A 1ESNA 1U94A 1VKJA 3W6PA 3SYLA 1AQYA 4NCJA 1G7TA 4DDVA 5AJXA 3RAPR 3DMDA 3BH7A 4OYHA 1ZNWA 1VYTA 1XU4A 5FI1B 2O8CB 3TQFA 2E9SA 1FFHA 3QNUA 2EFDB 1D9XA 2VO1A 3WP0A 2DFNA 2WWFA 5A4JA 3VTKA 1Z6GA 2WWXA 5E7MA 2AHOA 1IN7A 4ACBA 1IBRA 3CPEA 1WBBA 2OESA 2ZYVX 4Q9HA 3EIHA 6Q21A 1CULC 1XMVA 1MABB 1E0JA 2HUPA 2WAXA 2ZRGA 4D4LA 5DNYB 3N5CA 2BBSA 4KJZA 2I4IA 2AWNA 2FH5B 1F2UA 3M0EA 4MRNA 4RZXA 1AS3A 4UNRA 2C9OA 1UADA 1U90A 1ZU5A 2RH5A 4XVUA 1IXZA 3IIMA 2BCJQ 1X8KA 4LC1A 5IHPA 3L2OB 2P65A 2NGRA 1XJ0A 2CCJA 3WNDA 1J7KA 3HPRA 2ZE6A 4HZUB 3QEJA 1N6OA 1EESA 1QHGA 3EPKA 1YRBA 1LF5A 1Z2AA 1S3SA 4HB4A 1MO4A 2QGZA 4FCTA 2QSZA 5CYPA 3U60B 2L0XA 1RC8A 4WBSA 2GXQA 5FPYA 2VSXA 4RKFA 4Q4JA 3T61A 4HAVA 2AKYA 3QENA 2IS4A 2Q9CA 1TEXA 3U44A 3REFA 3S1AB 4HI0E 1VHTA 2BC9A 3AV0B 4AI6A 1IN6A 2ZJAA 4ILEA 4IDHA 3QE0A 4ZCLA 3GQBA 3K09C 1G64A 1VTKA 3Q5DA 5HCNA 2OFWA 1SZPA 1E9RA 2QMOA 2VP9A 2QROA 2QM7A 3VAAA 4ZDKA 2KB0A 2RGXA 1XTSA 3WHLA 5EE3A 4F4IA 1SXJD 4L9WA 2WPDA 2HV8A 2WKRA 4AYTA 4B76A 4Q4LA 3AGPA 1A5TA 3OIWA 1N5LA 4NZYA 3VKGA 1OHHA 1MABA 2OLJA 5GVSA 1XPUA 2RAPA 2HCBA 2DBYA 3W6NA 2AR7A 1T3HA 2D2EA 1E4YA 1OYYA 2Z0MA 2ZRAA 4JKIA 2XTZA 1OIXA 3NHBA 5CK5A 5SZIA 3T1QA 3UG6A 4DLYA 4QL3A 1JPJA 1JB1A 4PHTA 3FHCB 3WBJA 4A6PA 3RNLA 4IJMA 2XZOA 1GKIA 2LWIA 2WBLC 1TQ4A 4FN5A 2ZU6A 3GLHE 3LW7A 3NXSA 2DB3A 2WIBA 1QHHA 2OILA 2VP5A 1VG9B 3AVPA 4HAUA 5JS7A 3U5ZB 4AIIA 2F6RA 3X1WA 1Z0AA 3UG7A 1I4LD 3N2EA 4A8JA 4JSTA 2C5LA 4M1SA 3TSWA 4KU4A 4MYTA 1P3JA 4H9GA 1E69A 1T5LA 5EXPA 5JSZB 5TY0A 1JEEA 4TTPA 5FTLA 1F2TA 1KK2A 2WICA 3IBGA 1E2IA 4NP6A 2ONJA 1G4UR 5FBRB 4PC2A 2ZANA 3IIJA 2A7QA 2OV2A 3HJNA 4TTQA 1T4GA 4L4UA 3T34A 2ZRPA 2QPOA 2IYSA 3OEHD 1P2SA 1GRNA 1NBMD 1OXTA 2A5YB 1AGRA 3NHAA 2VP6A 4Q01A 2EFEB 3CZQA 1S2MA 5J4KA 2ZYTX 1OIWA 2W2TA 1YZTA 1NBMA 4TMWA 3SJBA 4CGZA 1O3YA 2J41A 4DT1B 3B1YA 4M1KA 4B3XA 1VG8A 2E1RA 2LKDA 5UKDA 3FVQA 4OQFA 2DR3A 4Q1FA 3T1OA 4DT1A 2QRNA 3KQLA 2V8OA 1CLUA 3GLGB 5FL7A 2DY1A 2OLKA 1X6VA 4BZQA 4YLGA 3AF3A 2F7SA 4E07A 4C9BA 4LCBA 1J8YF 4DLZA 2G6BA 4MDEA 3LQQA 2R44A 1KSHA 2ZXUA 4MGZR 2QUZA 3BGWA 2GJ8A 2JLSA 4JLBA 1XTQA 1P9WA 1SXJC 5C4MA 3FKSA 2ZPTX 3ASYA 1W46A 1UF9A 2F43A 3FB4A 1U8AA 1VIAA 2CHVA 1NVVR 4QOSA 4LHXA 1GG2A 1S0UA 3LBHA 3QKRA 5B57C 3GJ0A 1A2KC 3Q8XB 4V0NA 1JR3A 3DL0A 1NJFA
chains in the Genus database with same CATH superfamily
2OCXA 3U9LA 5JNWA 1FLVA 2IXGA 2YJZA 2FEOA 2BFAA 2MSNA 3NX4A 5LCXA 3B6ZA 2YWBA 2HK7A 3R3YA 5NLLA 3TR6A 3VZQA 4O2AA 3Q9UA 2X14A 1JDBC 1M10A 4BO1A 4J1QA 2ZJ6A 2RJ3A 3FJYA 3PHLA 3SC3A 2JAXA 3FUCA 3DFUA 1RWOA 2HSDA 4ZV4A 3OPVA 4BUJA 1K7SN 1KFEB 1ZCFA 3HABA 3OTQA 3SIPA 2ZEJA 4BUCA 4DV6B 2QE6A 4N4AA 3FPAA 3THXA 3G2JA 2A86A 3HL4A 5EJIA 2RH4A 3GPCA 1D2GA 3KKQA 4C6TA 5A06A 3AJEA 2VJLA 2W22A 1J39A 4L0CA 4WINA 5B1YA 2I29A 2ACKA 4KXFB 1GQRA 1OR8A 1C9JA 2Y1XA 4S04A 4FOLA 4GQBA 4UZFA 4BWGA 2ZB8A 3HJTA 1XXLA 2GEUA 2CXNA 4RLQA 1BN7A 3PHGA 5JS2A 5CDFA 4DLNA 1FSSA 4JSRA 1PS9A 2D1SA 1AXEA 2R8OA 1RQLA 5TC4A 1VPEA 1Q5PA 4V2IA 3W3AD 6ABPA 1CDDA 3QXXA 5IK2A 3WMGA 2V5VA 1KKMA 2ZBFA 1XVUA 4LHSA 4NCIA 2CL5A 4YCSA 1CFZA 4WZAA 3E3NA 2FFRA 3C1AA 2C5SA 3OIDA 1ORTA 3VO1A 2GRUA 4MRVA 4C07A 1J6UA 2LRHA 5JAZA 3OIYA 3HCCA 1GITA 1OYWA 2NIPA 5EVJA 4JN6B 1IN5A 1NR1A 5EFZA 5BSWA 3NETA 4D3YA 2ZT6A 3M5CA 1V5FA 2EKDA 2YZGA 4EATA 3Q2KA 2WY2D 2YYAA 4QOJA 2JIZA 3GGSA 1BWRA 4B8ZA 1E3MA 4BMVA 1P7PA 2X13A 3EW7A 4A0SA 1MMFB 4RFLA 4TL9A 4FD2A 2VDWA 3HG7A 5IKOA 5KTOA 4ARIA 2I1VB 1H2YA 2XPCA 3S2GA 2IPMA 3N0RA 3F4KA 2V4ZA 4I50A 5JRZA 3FYSA 2ZB7A 3OZDA 1DKPA 5DPMA 3SIXA 4FOSA 3CKLA 1FSPA 1MA0A 4BMPB 1PWZA 3WNVA 4QD3A 4K03A 1JLMA 2P62A 1JEQA 3SYMA 2X9NA 1D4OA 4IILA 4BRWA 1CZUA 2FHPA 1E77A 4MWZA 3UJHA 3BTOA 3CXRA 4G36A 3RS4A 3V6MA 5A6SA 4ZO7A 5EYPA 1EVEA 2BMJA 1DDGA 3DCNA 2BH2A 1J99A 2FF5A 3ZX5A 1DXQA 3K2BA 1BVRA 3EAGA 1JRLA 4GW3A 1V6CA 3MELA 3KBBA 3ET5A 5EG5A 4LY0A 4UU7A 2VXYA 2XWQA 2D06A 4CR6A 1Q2XA 1UMDB 1MGOA 1JQ5A 5JDCC 2GN4A 3OBBA 2VDNB 1US8B 3IILA 5C4GB 2AOUB 5L4SA 4E2FA 1OXSC 5CYFA 3SXJA 1Y3IA 4KBYA 3J80A 3VBCA 421PA 4RMHA 2YVKA 4PR0A 3EDQA 4EO4A 4JX9A 1N7IA 1R0YA 5I9IA 1ZU4A 3QELA 4QUGA 2FCAA 5IBRA 4DGQA 2DLCX 2XUZA 3KZMA 3FCEA 3JQ8A 4RAQA 3GNQA 1NJGA 1G16A 3QITA 3DYIA 4B3SB 2Z3VA 4S05A 4Y9UA 3CZ4A 4M22A 4KHPB 5IN5A 1BE8A 1MUUA 2BMFA 3SSNA 1I5EA 1E60A 1FBNA 4C22A 5DK6A 1HX7A 1G21A 2RIRA 2J5XA 5C8YF 1XDWA 1PJ8A 2D2IA 1AY0A 2CVHA 4YRLA 5E8JA 2VWHA 2C5BA 3OKCA 3PFHA 1DRWA 1J8MF 3OZCA 1TE2A 2ATXA 4MR7B 3ZDEA 2I1LA 4UUNA 4MXDA 4V2UA 1DFHA 1ADCA 1WD5A 5DFAA 4DYVA 4F3KA 3F6SA 5KOJA 4Y9TA 4DDUA 1M2VA 5HF6A 1WXFA 3LLSA 3VU8A 4EL5A 2QTRA 2DHQA 3RAJA 1IQ0A 2QIPA 2PYDA 2V7QD 4N82A 5DBGA 1W34A 3G8CA 4JR0A 3BMCA 3CU5A 3RVKA 1AUOA 5DLQC 4YYZA 4RY0A 1GDTA 2VBCA 3NT2A 2AOVA 2REQB 3BMCB 3I9NA 3L6DA 3SZGA 2ECFA 2IQIA 3TSYA 4D0RA 4JC8A 4DNPA 3NGXA 4ESOA 2CHGA 1Q1NA 2IIQA 3V8NA 2EGGA 3H2JA 5I9NA 3TNDA 5SY9A 2QMQA 3LYHA 3NV7A 3ODGA 5CNIA 1PWHA 1F6BA 3DS8A 2XQJA 1ES9A 3O31A 2I6XA 1NW8A 4B80A 1JX6A 4F6LA 3CKMA 3RC9A 3N58A 3PKJA 3T06B 3ILXA 1QPGA 4EARA 5DOZA 2ZR0A 3U49A 3KCNA 2ZROA 2F3UA 4YT5A 5AVQA 3C6QA 2JARA 5HFJA 1UKAA 5KVQA 4C76A 5IFKA 2YXPX 2P77A 3PC7A 1E79D 3ICWA 1K63A 1WZCA 4WXPA 1RU3A 4GICA 2P2GA 4ZOCA 2YQ5A 2W2XA 5HJEA 2HTFA 1Z4QA 2OHXA 2YW2A 2J4DA 4UAUA 4ZMBA 4BE4A 1ORIA 3GLKA 1ML4A 3JQ8B 1I4EB 3AUFA 1C2TA 1RLJA 3D81A 2PIAA 3IELA 4QA9A 1SXIA 3NBUA 4NXNB 3F49S 1AMUA 1ZH0A 3M34A 2L19A 4LZPA 2C4MA 1U02A 1Z4OA 5C8YA 2YNMC 4AWAA 1OAOC 4J2HA 2H7VA 4MMZB 3UJ6A 3I5YA 5ARCA 3G0OA 2VYVD 1X87A 2GD1O 1CJTC 4DSNA 1KYTA 1V96A 3GFTA 5IAAA 1U2SA 3JYLA 3PIRA 1Q3TA 1N7GA 4KPUB 3BL5A 5EHGA 4C4AA 3K0CA 4CZ2A 5LNK6 1YQQA 4AYXA 3CKKA 3ITEA 3CZPA 2QR5A 3GJXC 1NG9A 3PXBA 3IERA 3A1FA 4LOIA 3KXIA 5CNJA 4E6EA 1WLSA 2VDKB 2VDUE 4HOYA 4BVKA 4OI2A 4OHUA 2D8AA 1I24A 4B31A 1OFTA 3EEYA 5GJVC 3VQTA 2GKSA 2ID7A 3P0RA 3QI2A 3GLSA 4GI1A 2XCOA 1I5OA 2CEAA 2FA9A 1NQ5A 3C85A 3WYAA 3K4QA 1BWSA 1H1LB 3TL3A 1ZNZA 2V7WA 2M1ZA 1N8TA 3GLFE 4HYEA 1E3WB 5TPWB 5A4DA 1ZI9A 3FRIA 1DDOA 4CM9A 4GM4A 3B6EA 5AVZA 1EP2B 3SK0A 1UJ2A 1KGDA 4WCDA 1HT0A 4W5JA 4EW3A 3QEAZ 2GN8A 4N7JA 1IXKA 4DPKA 1KIMA 3OQBA 7GPBA 3MJRA 2YZKA 4S2EA 1B00A 3NTUA 3OTGA 5TLSA 4WOCA 1XUOA 1PSWA 4FW9A 1AE1A 2HRZA 1PFVA 2Q07A 3M8KA 4JL6A 5KJCA 4LN1A 5TXGA 4XM1A 4W5NA 5FTWA 3I9V1 3HKBB 1EINA 4I5GA 4QASA 4RDHA 4H6VA 3L0ZA 4LYHA 1NPTO 5DYNA 1EXMA 3GDGA 1ZK4A 4M7RA 2EKBA 1GL9B 3W8EA 4DOMA 1K92A 2GO7A 3TW4A 4BAUA 5FR2A 5JCPA 4QOIA 4RM2A 4C30A 3AXTA 2IKSA 3GELA 4TPKA 1D04A 1F3OA 2WILA 4QEDA 2EF1A 4QO7A 3RDPA 2VF7A 2Z3ZA 3VU3A 1CUEA 4J0EA 1CY8A 2X23A 4IV5A 4QDJA 1E9DA 1TKRA 1ZM9A 1NW7A 4LBZA 4JNKA 1TIKA 1KS9A 1RWBA 4E5MA 2ZJZA 4AW9A 2OE2A 5H4HA 6CHYA 1SU8A 1EWYA 3B3JA 2BUAA 1CZLA 1LZLA 4B84A 5KYWB 5CLGA 3CEAA 1JPUA 3JQ9A 4HCJA 3RHTA 1OZGA 2QPTA 2Q27A 3HVRA 2C3OA 3NC0C 2DYKA 1E9EA 1XELA 2DF8A 1C4OA 1WG8A 4Z1MD 1CS4C 3E23A 3ZCVA 2J6IA 1P60A 4DXAA 3JVIA 4MUFA 1JVBA 3QWFA 3DBRA 3I5UA 4RENA 3RTCA 3VV2A 4POAA 4RTLA 1EWTA 2G88A 1U6IA 2NMVA 2CBZA 1NF3A 3ADPA 5KWJA 2N3ZA 3PFFA 4KE6A 4GWLA 1NRJB 4QWMA 2L18A 5JJCA 3EVBA 4QGAA 3O0TA 1PGQA 3ADCA 1BWPA 3FOWA 2IXDA 2P67A 3GYGA 4LJ7A 4XJTA 4BMYA 1SUBA 3ORQA 4REMA 4QOHA 3WK6A 1XU7A 4UE2A 3MINA 1ZY2A 1MAHA 1V37A 2OHVA 4ZALA 1FSZA 1OOEA 1YR8A 4J16C 1W5SA 2YN2A 5LXTF 4D6PA 4MI1A 1TADA 3IDSA 4N65A 1QX4A 1S8NA 4NRDA 4ALJA 3T9BA 3P32A 5B7GA 3L1UA 3PU6A 2EW2A 1A7JA 2MWMA 4UNIA 3EZFA 2X77A 1TM2A 3EH1A 1FXUA 4K6MA 1E63A 2ZYUX 3CN9A 1GCAA 1BHO1 3VKHA 1JW9B 4GBED 1JILA 5ELXA 3VISA 3Q6MA 4MV1A 1VL5A 5BQ5A 3WTCA 3PEFA 4EMBA 1WVMA 3QKIA 2ZBPA 1P5HA 1PD0A 4UDXX 1ZGZA 5B1HA 3O95A 3DDUA 4NSNA 1YE3A 3VNUA 3GZ4A 2XY4A 3I9LA 4F86A 1SCBA 2HIAA 3IALA 4R69A 2C4NA 1QH9A 1YZHA 5CRIA 3P45A 1TEVA 2QMEA 1LBSA 1Y80A 2WT8A 4EO7A 5B4UA 2XGJA 4X5OA 5H5JA 4OY3A 4YECA 4U2KA 4F06A 4D96A 1DCFA 1PVVA 1C1XB 3O73A 4KV9A 4ED9A 2ZIUB 2P5UA 4MS4B 5DB4A 4WCFA 2QI9C 2SECE 3TDKA 5BXYA 1RQ7A 1NIPA 1AUPA 3GEEA 3T7SA 4DTIA 4DSAA 1U0BB 2B4KA 4LNUA 3ESZA 1OCEA 3RABA 3C7DB 3PHBE 2UV8A 1M34E 4GNRA 4A8JB 1MT3A 4GOJA 4AX4A 3N76A 5E6UB 3S5JA 1O94A 1VKOA 1R8XA 2WQ6A 3N7AA 4K9MA 1X77A 3K9FC 1QU2A 4CV1A 4R9VA 3TLZA 5KYKA 1PDWA 1VCNA 3F9CA 3R3UA 2H2GA 2X5NA 5JCJA 5ICCA 2IP4A 4ESEA 2FP4B 4RVNA 1HLDA 4YXWA 4XJXA 4A10A 1GXSA 5ALNA 1DIAA 1TCUA 2GM9A 2NSHA 2NZ2A 3RSZA 3GFVA 4BLSA 4LI0A 2H5EA 4W9NA 1XTUA 4BB6A 1PYOA 2NQ8A 3AKDA 4Y2YA 3ZWOA 1DMSA 3FE2A 1P2BA 2I66A 1LI4A 2P78A 3B60A 2PRKA 4WLOA 1A5ZA 1DAGA 1Q1BA 5GONA 5F7OA 5L3SB 4L3WA 4BUZA 3N86A 5C7LO 1S1CA 1Q77A 2XA9A 3OZ7A 4MAFA 3SQDA 3L0IB 4IS2A 2IIPA 4RMIA 2WV9A 4RJLA 5B6JA 3P9RA 4UATA 4GEKA 4RTMA 4ZOLA 2QX9A 1GNQA 3WVNA 4AUEA 2FQQA 4EVSA 4EGQA 1RAFA 4FYPA 4H08A 4JUFA 2QRHA 1U8TA 3A6ZA 5FPTA 1W5AA 3UAZA 2PR2A 1MH1A 3GVIA 2P3LA 4AM8A 4DWOA 4F2HA 1BXGB 1DBSA 4Y0VA 4A2PA 4ALLA 1GTSA 3DDZX 3FF4A 1AZWA 5G3ZA 5TQ2B 2AC2A 1T15A 1IHPA 4WK6A 4XB2A 4AG5A 2QTBA 4QSMA 3LUJA 3PDIA 4FIDA 5D87A 3PVCA 3H0CA 3GEMA 4I4TA 2OZKA 4I3HA 1G66A 2F3PA 1KI9A 2HDWA 1YMQA 4K3VA 3BX1A 4WAUA 4FFVA 5HRCA 1VSTA 3DMPA 3I6MA 3P9NA 5FI3A 2NUBA 1ULHA 3O9ZA 3QU4A 4N3CA 3VBEA 4BVEA 3KQSA 3BHIA 4QBTA 4Q1AA 1A4XA 4Q6WA 4R54A 4B48A 2WNSA 3P8ZA 3W5UA 4R98A 3KWLA 1ONNA 4BNYA 4TQAA 3FR7A 1ZLXA 2NO5A 3FPKA 1KRXA 2YJ5A 3X3HA 1BDJA 4ARBA 4C6HA 4XQGA 4JBHA 4X41A 4B3TB 4X62B 1LQUA 3L79A 1LPNA 1G38A 2J45A 3HSYA 4FHFA 4LYGA 3CMMA 3QP9A 3T7CA 4BJ6A 2AZTA 3CX6A 2RHRA 5BV2P 3C1UA 4L9AA 2EXXA 1VPLA 3T9DA 1PWEA 2O2CA 4D5EA 3GNSA 3KOZA 1CJMA 4BNXA 2IHUA 1UXJA 4JNCA 4KIUA 1QQAA 1XV5A 2BCGY 2NYUA 1RQXA 3PEUA 3N8DA 1KYQA 4FFWA 3USCS 3KKOA 3WLJA 3L6OO 4D3DA 1C1DB 3RSSA 1P2GA 4Q1BA 4M7OA 3U7QA 1A7AA 1K7EB 2LXNA 3DDHA 2CL6X 3BB4A 1ZMBA 3CVWA 1WKBA 5A9TA 2IUUA 2WUFA 3GY0A 4ZOQI 1ZPDA 4HB0A 4JQOA 5GZ1A 1CUCA 5HS6A 3BB1A 3FTQA 3PXXA 2I99A 2QAGA 4MVWA 2KSQA 2OXEA 2J31A 3E9DA 1HDOA 1JQEA 3QVVA 1T1JA 1I01A 1A72A 2D1YA 3K9NA 4MVJI 1Y3BE 1PEAA 4W7IA 1ICEA 1OU0A 1P4JA 1OI2A 4PZCA 2UXCB 3MYRA 2I7VA 1TJ5A 1KZ7B 4C05A 2MYNA 3T7EA 2BMEA 3V2HA 1NRIA 3BJEA 3HXPA 3B82A 1A96A 2IW3A 4WZBA 4RWZA 3F0TA 2WPDD 3QUBA 3FOFC 4KPEC 2O8NA 4KR2A 1E7MA 1EK6A 3V4PB 2X1LA 4EYEA 4DVGA 3DL7A 1N2OA 2BM1A 2H54A 1T3SA 1AGYA 3NOXA 1A9YA 4DRXA 4YT8A 5JC8A 4EELA 1G2IA 4JB8A 4GZLA 4JBLA 2PWZA 3BDIA 1GZDA 1H6DA 1IM5A 1WSBA 3N2KB 3OJCA 4EHLA 1G9SA 1H8HD 3LVRE 3ZVNA 2AIRA 2C99A 4EG3A 4IJ6A 2Q5FA 2Q4DA 1FMFA 1EP1B 4FEYA 1VCIA 3TD6A 3AUSA 1XQWA 3D6AA 4QYSA 3LPLA 2ZLBA 4NYJR 5P8WA 2HQ1A 3W2EA 2HRDA 2VRWA 1N92A 3H83A 4Q21A 3O4HA 3HFRA 3PGA1 4NMLA 2YOGA 3WJ2A 4JP2A 2Y1WA 2YUIA 3WGVA 1C0LA 1FMJA 2HW8A 2JD1A 2NZJA 4JXKA 3BMQA 1G20B 3T12A 2YVUA 4XIFA 5E4JA 4IQ8A 3CPJB 1DTWB 2Y27A 3F5SA 3ICPA 1E2KA 1RLTA 3AIKA 2HK6A 4GSYA 4A5SA 4B71A 5B3JC 5JJIA 2GAFA 1BVHA 3L0OA 1SUCA 2Z83A 3AR8A 4P0TA 1F8FA 5DCLA 1WB9A 1DCMA 1X7XB 2ZYAA 1MLDA 4MITA 1EFVB 2H9YA 2HDNB 1NVVQ 3MAJA 1FJGB 3CUEF 3PCRB 1EXVA 3ECCA 4K05A 2ZUTA 5LMCA 1LDMA 2WW8A 2JGJA 4NARA 3BXHA 3ANMA 3CZ9A 3PC2A 3ASUA 3N0VA 5IABA 2PH3A 2BJWA 2FPRA 2GTPA 1XALA 1YH3A 5AOCA 1ST3A 1VYUA 1GOTA 2HJ9A 2VQ3A 2AN5A 3ZHZA 5JQGB 5BT8A 2AN4A 3ONNA 2RGYA 3Q7SA 4AZVA 4XFDA 2ZJ5A 1RYFA 3NHLA 4W7HA 4DJJA 5FBQB 5K0FA 4G9BA 4GE3A 1AKYA 2EG5A 4N3GA 3MWFA 5EMLA 2FGJA 3KWFA 4K6FA 3RC7A 4D5GA 3JAWB 5IH3A 3PE6A 3EZNA 1ZONA 2ZUBA 3EMKA 4G4IA 5GZ6A 3ZV6A 3HGMA 4EKDA 4P7FA 4RV4A 3FCYA 3GGCA 4JI8B 4ZI5A 5JJLA 3F6YA 3OP1A 2CVFA 4GUAA 2DKOA 4HN9A 3KE9A 1HXHA 2IODA 3D8SA 4FT2A 1QJCA 4I1RA 2W42A 1TCVA 1L3IA 1QKKA 2XZPA 4EK9A 4GZ3A 3W0LB 1XNHA 3GMDA 3ISJA 1Y8ZA 4TM7A 1A97A 3C6BA 1U0RA 2B92A 2V3VA 3GPIA 1DFIA 2IUFA 2XCQA 3GCZA 1BCSB 4KKVA 4N8EA 5G53C 1P1JA 4BN5A 5U4XA 4CDGA 1KI2A 1XDBA 2WZQA 4IIFA 5ICFA 3TO5A 4KR9A 2H59A 3WBKA 5ICMA 3NASA 1CUSA 4YJ2F 2Y9PB 4JC0A 1P7ZA 5K0TA 1XPOA 2B5OA 4LYJA 1TKCA 1KMQA 5DHSA 4NECA 4XWYA 3H5AA 1PZFA 4MIOA 1GQQA 2HBZA 3CZ5A 2SCUA 1ZK0A 4TSRA 3GRYA 2CN1A 3HYLA 2A84A 4H27A 2C98A 4X91A 4P33A 5LA6F 5LOVA 1RM4A 4R8VA 5DM1A 4BQSA 1ZCBA 2GN9A 2XEXA 3H9BA 2IYFA 3NHZA 2X2EA 3JQGB 1ZUD1 2R60A 3AP2A 3E5MA 3QUCA 4II2A 3OX4A 3SZMA 3ZTWA 1XL0A 4BQIA 1P44A 3WGUA 3IP3A 4EB6B 1JYSA 4PZDA 3R5KA 3U5TA 3ND8A 3PNLA 3JZFA 1N2ZA 4XXHA 3TLGB 1GAQA 5BN3A 5DM60 2IXAA 3HU1A 4HX9A 1WCXA 2JJ1D 4XIJA 2K4MA 3WKBA 2D7JA 5FUQA 1PR4A 3LV8A 1A77A 4L7VA 2ZP1A 4BMXA 1VDZA 2GJ4A 3ESDA 5EERA 1GAJA 1FP4B 1D6JA 2B30A 3BVPA 4G0QA 2EOAA 3QY0A 1WXXA 1W7AA 3N8NA 1U81A 2CJPA 2XKJE 5ICGA 2JG3A 3TQTA 3ZV5A 4E51A 2DFTA 3DCIA 3IX7A 3MT7A 3R6DA 4ZZ2A 1XKQA 4H7IA 2OPBA 3TRJA 3NYQA 4PAQA 5BV1A 5K9ZA 2IYUA 4AULA 2JH3A 4XSHA 5EJ5A 4ZYYA 4GM0A 3ET4A 2R5FA 1UQTA 3ZWQA 1LNQA 5T3UA 2WM9B 2ZJ7A 4AXBA 3I3SR 5DHFA 2IHTA 2R4UA 4B4WA 1EM6A 1UKBA 3GDWA 1A8HA 2BOVA 2FFQA 2TRSB 2XGMA 2FR0A 3EASA 3U7EB 4EJ6A 1W2GA 4HH4A 4RVHA 1ZN9A 4Q24A 1ULUA 2QAGC 2GPWA 1FFWA 2FG6C 3PLNA 2AQKA 4PSAA 4E4TA 1N2BA 1J06A 2GFQA 4LVOA 1AZLA 2G1UA 2I2BA 4Q5IA 3HP1A 4BQQA 4JT4A 5BOSB 1T0UA 1EXWA 3X1ZA 1I2ZA 3GT0A 3HR8A 4PGMA 3C2QA 5J5VA 5C3UA 3NKLA 2BDUA 2OQIA 2CWDA 3OICA 4OKIA 5BSUA 3H6HA 3NC1C 2BHLA 2G7MC 4MHOA 5CHEA 4ZQEA 3RF7A 5FOWA 5AUOB 3CR8A 4Z4CA 4KQIA 1T8YA 1T0IA 2GK4A 3TSZA 4AU1A 2QJOA 1PFUA 3V1NA 1GU1A 3HDHA 3KTAA 3KJGA 3QVGA 4J0IA 4WZAB 2YQZA 3LOUA 4YJKA 3ELDA 4CIWA 1MHTA 1KI4A 2DJ5A 5CGZA 2YUTA 3CBQA 1DO2A 1JJ7A 2JK1A 1DQYA 1FRZA 1F2VA 4YJGB 4DQDA 1U0SY 1M0WA 5L3ZA 5KINB 1K66A 4GKKB 2YFYA 1M8GA 3QMMA 1W0KD 3EVDA 2B1JA 1KAMA 5HZMA 1OAKA 2BJHA 1W0CA 1E0SA 3N6VA 5LQMA 3WK9A 1QZ3A 2OXFA 3LK7A 2P8SA 1EK1A 1R8SA 1Z82A 2NAPA 3QV1A 1QOPB 1I4WA 4KHZA 4PANA 3T3NA 5AKIA 2QD3A 4JYCA 1M2VB 4G1EB 5CM9C 1XPJA 1XZKA 4RY2A 3GQBB 4EKNB 3ZHUA 2AFIE 1SHKA 2DHEA 2GA8A 3C5CA 3DKRA 1IVYA 4N0MA 1MC1A 1GN9A 2HCRA 4FC6A 5FB3A 3H5IA 3C5WP 1DFGA 3BE6A 2O8CA 3T3IA 2CFSA 2WZDA 3H19A 4LMPA 5CTAA 4INOA 5A5FA 3EWSA 1OWOA 4IDNA 3SOPA 5CR9A 4QXRA 4KQWA 3WLAA 1ZOSA 3LT0A 4RK7A 4U6SA 2FDRA 3L06A 5H0IA 1UDCA 1DEKA 2BL4A 3TFWA 3AWDA 3W5IA 5GMOA 4H1WA 1QQ6A 3OWOA 1CRWG 5ALEA 3AFHA 3GA7A 3C3MA 5FTMA 1K7CA 4JBIA 3RBVA 5AW1A 4XTCS 2GWRA 1US8A 3GT3A 1YS9A 5DYTA 4Z0HO 1YI8A 4TRNA 3QH4A 1H6CA 3AHGA 3G5UA 5THKA 4XE5A 3PT9A 2BUCA 4N7MA 4INJA 1L9XA 4KOEC 3S99A 1G8JA 1WHSA 4YB8A 1FU8A 1NRXA 3HA7A 3PPIA 3NFYA 2OSBA 1NX9A 3KR2A 2QGNA 1KC1A 3A0RB 1U0LA 3OEHA 3QLEA 3EXEA 3GEIA 4B45A 3RRNA 1U9JA 2DLDA 1LVGA 3KWMA 3IKLA 2YZNA 4LYYA 1VMEA 2CJXA 1H8EA 1OBFO 1X7YB 2CNLA 4YAFA 2IYXA 5BSFA 4GDFA 2YJ6A 4PO9A 2XAAA 4PGFA 4DUGA 1ORDA 3B38A 1OT3A 4GI2A 2P75A 3Q2OA 2ZKLA 2IYNA 3A1CA 2NXCA 3GH3A 4QBHA 1KO5A 1TW3A 2VCHA 2B1GA 4GH5A 4LE0A 4J3NA 3VU9A 1E4VA 1EK5A 3KZXA 5LB2A 4PYJA 3KZNA 3LGSA 2VAVA 5F64A 1AF4A 2V97A 2ZCUA 2N47A 1Y42X 2PX5A 2A4KA 1T4BA 2VPWA 4IF4A 4PINA 2NTNA 1IAQA 2AJTA 1JAHA 2H4ZA 3CF4A 5EKTA 5JLJA 5KOJB 1ZCJA 1JIIA 1PR0A 3S2YA 4YCDA 2G77B 1MPTA 1XWWA 1AF7A 1J2JA 2BFDA 5E7IA 5TS3A 4EBFA 5HTOA 3UMGA 3U4AA 1GZSA 5FCDA 2H1LA 2QLTA 1UBSB 1L7AA 2R1VB 2VJNA 1J5XA 3S8YA 1WTAA 1UKZA 2I7XA 2Q1UA 2I65A 1R37A 3V4ZA 3ZXXA 3GLVA 5B2EA 4ZU1X 3W5SA 2COUA 2DPYA 1V3VA 1IOZA 5TS2A 3FNHA 2XHEA 4X3PA 2A94A 2FPGA 2HA3A 3WNQA 2ZIFA 5JBIA 3GCGA 4I9GA 3OE5A 4IDEA 3SG0A 3ZGYA 5TEVA 3UWDA 3R3WA 2I9KA 3QW4B 4LBWA 5CPBA 4ZCQA 2F59A 3QA3E 3QMVA 4H0CA 3WMWA 4DZZA 1T1IA 2IEYA 2J5QA 1YBHA 4RZSA 1RJFA 3P2OA 1TI7A 3G9TA 4C08A 1RTKA 1JE1A 1JSXA 2C5FA 4P7GA 3C39A 4AJIA 5KNBD 5EJ7A 2OORC 4RPLA 4HJXA 2NXNA 4ND8A 4LSGA 5AJTA 4M1WA 1OI4A 2GT1A 4G26A 2JASA 4GP6A 5FWAA 5KTTA 1GCGA 3IPYA 5BORA 3LA8A 3FJOA 3C3DA 4XGNA 1LA2A 2P2NA 1NAHA 3AY0A 2XB8A 3FG9A 4IGEA 4RPGA 4DNFA 1L8OA 1KDYA 4D7AA 1NVFA 1SGWA 2AS0A 2ZRCA 4H7EA 3WSVA 4QYIB 1KPGA 3DDWA 1C9EA 4GI3A 5CNKA 3G5MA 2PUBA 2Y4NA 1RABA 3KC2A 2ZSHA 4F56A 1HUQA 3I9MA 4QXAA 4QYIA 4I08A 4DPMA 4ETWA 1PQPA 1I4OA 1NSTA 1Q57A 2A8YA 5CA0A 5DM2A 4R2LA 3CHYA 1I6MA 1SKMA 4PSUA 4RBNA 4WLNA 5EN4A 2WU0A 4RNDB 2FSVC 2B2CA 3A2NA 5TDHA 4F4HA 2QTFA 3H9GA 3T9EA 1CUHA 1MO5A 2OTCA 1E1QD 4UPEA 3WGZA 1E5QA 3HCDA 4MCIA 4DLKA 4PHGA 5KYTA 3L5OA 3OTHA 2WHRA 3FWPA 3WFZA 3C3JA 4RZ2A 1N1EA 3RUHA 4ZGBA 1OKKA 1XGKA 4EZEA 4KXQA 5CX1A 4QGHA 5EHZA 2VP0A 1R0LA 1VLHA 3A6HA 1SOWA 5K6AC 1H1LA 2XD4A 1N2GA 2H4FA 2HR1A 2HA2A 4IF6A 1WOMA 1KC3A 2DRIA 3A3PA 3ZH2A 1S9DA 1KAGA 1CKEA 4XVRA 1HSOA 1TM4E 4A16A 3WSTA 2ZI6A 5JC1A 1ANKA 3HBLA 3E9ZA 3UB3A 3H86A 1V4VA 1HWYA 4G0UA 1M2OB 1OWNA 1G8PA 1FDWA 4G0YA 4UBJA 3GLRA 4BNTA 4HY3A 2IWHA 5C1BA 4A8TA 1VB5A 1OLOA 1NUSA 3Q15C 3F5DA 3TX2A 4RMNA 2Z9CA 5EGNA 4RTKA 2MYPA 5T4HA 4L0DA 3INRA 3BOSA 1Q6ZA 1GSOA 5IP5A 1R66A 4ZYTA 2VYQA 2XGOA 2DUNA 4E5SA 3KO8A 4YS6A 1EPUA 2NN3C 1MAVA 2OHOA 3BE8A 2N75A 1CUYA 2WAOA 3P9YA 4JYZA 4ZODA 3ZS8A 2FZ4A 2XT6A 1EE2A 3EIXA 2IYOA 3MCUA 1G18A 1RAIA 2BEKA 3R3SA 1AJEA 2RMKA 5AHRA 4FFOA 3HU2A 4EY3A 3PGLA 2VDMB 5B58C 1ZISA 1Z5WA 3I34X 1P2TA 2AG6A 1K3UB 4OHVA 5HJ2A 1N6RA 3W6ZA 4DA6A 3E3LA 4OLBA 1G8GA 4XDYA 4DQKA 1NU8A 3RROA 1O5OA 4NL4H 3D2BA 1MN6A 3FDZB 3ZHBA 1D5CA 1PE0A 4HUJA 4C0BA 2YFQA 3RR2A 2BTOA 5A3JA 1KSJA 4CODB 4OVKA 2QMZA 4O4LF 4URXR 2P6NA 3G02A 1WDKA 4IQ0A 3WRWA 4E5VA 2FU5C 3LPMA 5B5SA 3SBXA 3KSUA 3VOTA 4XQEA 2EERA 1QPBA 3EGXB 2OAP1 2REXB 2C2KA 3VC7A 1QX3A 1K27A 4BLUA 2YV2A 4UU1A 4ZYLA 1M8PA 3L6RA 4M9UA 3LP8A 5E0KB 5EHIA 1YHNA 1K98A 2ZREA 5CA1F 2DJIA 3TDNA 2G9NA 2GBFA 5FOXA 3OZWA 2PUJA 2C9ZA 1ZGGA 4ZT5A 4KNYA 5HE9A 1MKYA 1H5UA 1EFUA 1SRRA 3QFSA 4YO7A 4CKEA 1KARA 5KHOC 2CMFA 2OGUA 4EQ6B 2OAEA 4J0HA 3ISVA 5KQGA 1TK9A 2W2MA 1R0XA 4KPFC 3LXMA 2JFZA 3CLTC 1TF5A 2WSSA 3ESXA 3KKKA 1QFZA 1WY7A 4NTZA 4DADA 1X1DA 4MH0R 2UYHA 1EI9A 3PRJA 5JCZA 2APJA 1Z8HA 3FRHA 2ZSBA 4O1IA 2OYRA 2KBFA 3CRNA 3A6GA 3FDIA 4LYDA 4JLMA 5EXSA 2H0AA 2XDQA 1BG6A 2Q4BA 2VCEA 3MCWA 4Q4JB 1DMRA 3K5PA 3GDFA 1F0YA 3BD6A 3WLOA 2FWIA 3WKCA 4BLRA 1CQXA 2XOXA 3QK7A 4R9UC 4IVQA 1YZUA 3EBLA 4JROA 1XCGB 4P08A 4R2WA 4XYEA 5G4KA 2BEWB 5AXDA 1DRUA 1P6UA 5EPOA 1YUBA 5I01A 1XHFA 1QAOA 4QYTA 2FSIA 3EULA 3N8GA 2PZAA 5I7HA 5J2TA 2WUWE 1U3WA 1YJXA 1E0KA 4LIPD 3EQ9A 4DWJA 1GTL1 1A95A 2VF8A 3BBPA 3WIUA 6AT1A 3PE3A 1QV6A 3DMRA 1IY9A 4KL8S 1Y7TA 3IR5A 3PDIB 2QTVB 4F9EA 4HATA 3KYDA 4HH3C 4PRZA 4TXJA 1QH0A 4PZEA 1TQHA 4WWHA 4A6DA 5TQ2A 4B33A 4UAGA 1HNXB 2XYRA 2E5LB 2XKAA 1I7PA 3LT4A 4HZUA 1DOZA 4NXMB 3BS4A 1T5IA 2H5LA 2PSFA 4XW2A 3OLQA 5G0UA 5HQJA 3AI7A 1SBNE 4ZEXA 4ZQHA 3EA0A 1DC3A 1K6MA 1CUZA 1JKFA 1E7SA 2L42A 3R3VA 4MW6A 5DBIA 2VN8A 4U3JB 5G0VA 4C6SA 4RD6A 3IP6A 3A2MA 3PR3A 4UEWA 5FEMA 2SKEA 5TGTA 1NNLA 5DGXA 4JJ7A 1QF6A 1SN7A 5EXEA 1HQDA 3WLTA 3I2IA 3SE0A 3OE7D 4MZDA 3DW1X 3K35A 3S40A 2ODQA 4Y2PA 3RIYA 3AOGA 4JI3B 1O6CA 3E4CA 1BH2A 4M89A 3ZHQA 1D8TA 4WZAE 3JQAD 1JPNA 1LS6A 3JD1A 1S3IA 3TR0A 1BCRB 4MUKA 4NBWA 5EHNA 5JCOC 2G4LA 2NZ8A 3AKEA 3ITKA 3L1HA 1T9HA 3T5DA 2O5CA 3FSGA 4CWAA 2AN9A 2ERYA 2I6QA 3PXCX 4L7QA 4TTTS 2FP4A 1ENYA 2ZUUA 2VWQA 3FETA 1D2CA 3U31A 4LUCA 3TOSA 4M7WA 3HB0A 1DJPA 5FH9A 5IF9A 2FN4A 3NAZA 4BEJA 5F4ZA 1EQUA 1FNSA 1DI0A 1EM8B 1SVKA 3C7KA 1RSZA 1HDIA 4PCAA 1YUNA 2XGSA 4MS3A 5I7FA 5JADA 2FEWB 1DPFA 2O1WA 4BKQA 1TYAE 5EA2A 5K0SA 4F4JA 4OIFA 2A9RA 2BZ0A 2ZRMA 1TZJA 3HJBA 4FGSA 1DVRA 2QR2A 2HCJB 2FSPA 3L4EA 2YIVX 2B2XA 2O3JA 3THWA 3TI9A 3CUSA 3LCRA 4QJ5A 4GP9A 4D9MA 1VYHA 5EAIA 1ZNQO 2B82A 4O4IF 4RV5A 5J2TF 3KU1A 4Q19A 4KEAA 3RJTA 2NX2A 2YDXA 1MB2A 3TKAA 3WL6A 3LCJA 4ONEA 2HXGA 1C8BA 2H1OA 3ENZA 2A35A 4B9AA 1Y9AA 5AI9A 1SQ6A 3E3MA 1YULA 4OKNA 3G82C 1JGTA 3LQ1A 4OFBA 5HOQA 2FLWA 3PC3A 4PX5A 2FCRA 5TEWA 5GAJA 4QVKA 3V9PA 2JCVA 1AQUA 3A27A 3MJSA 4XIGS 1BTOA 1QYDA 3I6IA 1KI8A 3OM0A 1UT8A 1BN6A 3JVUA 5FAXA 3ICQB 3PFCA 1XMPA 2RBKA 2Y0DA 2P3SA 5A9RA 1PYDA 4AKSA 4ZP1A 4RNCA 1TAQA 5BUSA 4Y0NA 1YNSA 5I7UA 1B6TA 3AEQA 2XMQA 3EC7A 5T7BA 3FMGA 3PHCA 5IUKC 4KXLA 4Z3KA 2QB5A 5LM3A 1X1EA 3VO9A 4IFTA 3LHSA 3N07A 4EZBA 1SIUA 1PTJC 3SR0A 1HETA 3C3BA 3DV0B 2Y0EA 1J33A 5EHQA 4P1ZA 5K8CA 1TO6A 5AK4A 1WQ3A 1JIKA 1VBMA 1NI3A 2R4TA 4K9PA 4RDIA 4F92B 3C3XA 3P26A 5FPKA 1QOZA 2Z09A 1G8AA 2GZRA 1Q0ZA 1IRXA 2IGBA 2OENG 3FTCA 5IZCA 1WUIS 1FU4A 4P3KA 2FZKA 4YIKA 1XKLA 1A3CA 4Q3DA 3VR2D 4ZI7F 3HVKA 4C3ZA 1X7XA 2QVYX 1EBUA 1NP3A 2WJ4A 3U7QB 4KO3S 4CTJA 1WQ1R 3R7FA 2GILA 3M3HA 4WFJA 3N9IA 3LX5A 4MWOA 2POCA 4C7OA 4XIIA 1P1RA 3WK4A 4YAUA 1YQGA 3M4YA 3N70A 3TW8A 4DHWA 2CUZA 1PL0A 4P32A 4OSOA 1LPAB 2QN6A 3GZNB 5LQJA 2RE8A 5A0TA 5L4LA 2CDCA 2FSHA 3LYAA 4W4TA 3R44A 5JWRA 5CYOA 3IA2A