3B2EA

Crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
349
structure length
307
Chain Sequence
LTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDLADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Get1 stabilizes an open dimer conformation of get3 ATPase by binding two distinct interfaces
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 95
structure length 307
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b2eA00
2WWFA 1KYIA 4ARZB 2IYVA 1ZJ6A 2VQSA 3DZ8A 4MGZR 1Y3AA 4RCZA 1U81A 4Z8YA 3UIEA 3H0KA 2WMOB 3WNDA 4LX0A 5CB8A 1L8QA 3BERA 3JZMA 2AXNA 2OM2A 5SZKB 1MH1A 4N0EA 5FOUA 1WE2A 5K8UA 2IYLD 2WJYA 4MGYR 2W58A 4DLSA 4LJYA 2Z6VA 3GLHA 4TZ0A 1UBEA 1KK3A 4LRWA 2H18A 1TEVA 1NP6A 3B2EA 3DO6A 2FZLA 2QUZA 2ZI3A 3I4LA 3IBGA 2ATVA 1ZNWA 1QHHB 3BOSA 1DS6A 1W2GA 4OJKA 2W2TA 5CDFE 4TYWA 4Q66C 1E0AA 1WCV1 4RD2A 4EQ6B 2EFEB 4Q9IA 1R7RA 1EFRD 4JVLA 1ZP6A 2GBLC 2VLIA 3HYTA 4NCHA 3TAUA 3WMEA 1XD9A 1GNQA 2FSFA 4LUCA 4ZIRA 821PA 2J5XA 4HZIA 4HAVA 4XWAA 3T15A 1UAAA 1GVNB 2OT3B 4HUTA 4B33A 2YV5A 3CIOA 4LBVA 1QDEA 1P9WA 1NSTA 1TUEA 1UBFA 1D5CA 2QU8A 3C5HA 1ZM7A 4IXMA 4ZI3A 2A5DA 2WAXA 2EWVA 4Q7MB 4D80A 2QAJA 2CVFA 1FNMA 1IY1A 2Z43A 3SFZA 3K09A 3IPYA 3R20A 1XEWX 5LDDC 2QAGB 1GRQA 2AWNA 4D6PA 3SJZA 5B64A 2KB0A 1E1RA 1U8YA 1N6OA 4JYCA 4HLCA 3VTKA 5JEEA 2CCGA 2CEAA 4Q7KA 3HWSA 2JLRA 4Y0VA 5KPJA 1EFRA 2W0MA 4L15A 2V6JA 1G7RA 2RHDA 1NNEA 4TMKA 3CNOA 3BBPA 3SYLA 4US2R 2CK3A 3L0IB 4GL2A 1IN5A 3BJIC 4DLUA 4MGIR 5L3VA 3T1TA 1UKVY 2QORA 2E1RA 1TNDA 4IHQA 2QZ4A 4MITA 2ZI6A 3LBNA 1E9RA 3IIJA 1KI3A 2PCJA 3KKMA 5KYKA 1E94E 1WP9A 4Q48A 2V6IA 1GZSA 1NLZA 2D7DA 2VIIA 1I2DA 3LX5A 1XXHA 4XD7D 5HPYB 2EWWA 4XH9B 2ZS8A 2JLVA 1D8TA 2C03A 5J4KA 1K6MA 3BH0A 4OI2A 1Z47A 2G9NA 3FHCB 2IUUA 1VIYA 2R8RA 5TY0A 3QPVA 5BXQC 1G6OA 1UPTA 4G5QA 1HA3A 1YHNA 4OQLA 4TTQA 4AD8A 4CZ2A 4JBYA 2R6DA 4UJ5A 2QSYA 2D7CA 2P65A 4B2IA 2GXSA 3V00A 3K0CA 2HJGA 4G5OA 4OK6A 1HUQA 1S9HA 5F9FA 4FCVA 1ZM4A 3QUSA 2C8VA 4O25A 2ORVA 2JDID 2ASEA 4TWZA 1X3SA 1XCPA 1SULA 1E1QD 1QHXA 5CK5A 2O8BA 3KQLA 4Q4LA 221PA 3VR4A 4Q19A 4XD7A 1E0KA 2R6AA 4WVFA 4C0SA 2ZRIA 1TF7A 2HT6A 3LO5A 2GVZC 4IDPA 1PVOA 1AGRA 4I81A 3H4MA 2NQ2C 2YKGA 3BRWD 2V3CC 2XTNA 4A15A 1R8QA 2PMDA 2GXUA 5KTYA 1ZC4A 2D62A 5JHHB 2H1LA 2ZSFA 3P4XA 3MMPA 5AJVB 3WBJA 4QM7A 1J8YF 4YDHB 3IO5A 4LJAA 4RVCA 3Q9LA 4C0LA 4CRWB 1M1YE 4NCJA 1IJEA 4XWKA 5EP2A 1CF4A 2FN4A 1OV4A 2PX0A 1Z0JA 1U98A 4TMWA 2R6GA 2W6ID 2WM9B 3PUYA 4E03A 2PZFA 2R62A 2GZAA 2ZANA 4IFBA 2OSBA 1G3UA 1G21E 1E1QA 1Z6TA 3C5CA 4BEBA 1NY5A 1WDTA 3I8SA 2CL6X 4FWTA 3A4LA 4FN5A 5DLQC 5C1BA 1WF3A 2BM1A 4ZI2A 4NYJR 4BEJA 1NVVQ 4ARZA 2DHRA 3HPQA 1LTQA 2P5TB 3HU1A 1GM5A 4IDQA 1GL7A 2Q3HA 3TH5A 1UEIA 3X1ZA 3FFBA 3BAFA 3A37A 1AIPA 3W90A 2CHGA 4A0RA 4GP6A 4Q4JA 2DWOA 2DR3A 2JEOA 1T3HA 3K8YA 4NYIR 5HKKD 2D2FA 2VP5A 2HF9A 2QPTA 1TX4B 2QA5A 4M4SA 3CZQA 1BS1A 2VSOA 1S96A 1VG8A 3SE0A 1ZU5A 1JR3A 2G1JA 2WIAA 4X8MA 4QBGB 4JT4A 3SU8A 4P33A 1GRNA 3EC2A 2A5FA 4LJ9A 5EE5B 5J5CA 3LFUA 4EQ6A 2RMKA 4BE7B 3NDPA 4US0R 5JCZA 1FP6A 5JRZA 3KJHA 1Z83A 1Z6YA 3CKLA 3DKVA 2N42A 4FI3C 3VU9A 4YONB 4FCTA 4YMSA 3HYRA 1SQ5A 4NMMA 4TN1A 4Q47A 3VHLB 2BMEA 4KHZA 4AY2A 1DAKA 2FSIA 3KKNA 2E87A 5LB4A 2REXB 2I1VB 1E2NA 2IL1A 4JT2A 2DY1A 5HKKA 2FE4A 4RD1A 5FBRB 3AF1A 2ZM5A 4CDGA 3NVAA 4JVMA 3EPJA 2RGDA 2YJTD 5CYOA 1J8MF 4EPYA 3GEHA 4JIMA 3PJRA 3GLHE 3SHFA 1P2TA 4JMPA 1CJMA 4P32A 4GZMA 1SVSA 1F48A 4JL5A 2P6NA 4NCIA 3Q72A 5KSZA 4JLVA 6Q21A 3KXIA 1IN7A 1VHLA 4EPRA 1XPRA 4B74A 1B23P 5JFGA 2F3TA 3DMNA 3AKEA 1PV4A 2GBLA 1HQCA 4I1SA 5BYJA 3DOFA 2RAPA 4GFDA 2AK2A 1Z0IA 3FFAA 2ZROA 2XXAA 2BJWA 2OESA 5EE9A 2ECKA 5FOXA 4WXRA 1UKYA 5AJZA 3B9QA 5C46F 4B6FA 1US8B 3FKSD 2IYXA 4A6XA 5DHAA 4DSOA 4DLWA 1OFUX 3N5CA 3ZD7A 4EJSC 2QP9X 1MO3A 2DCUA 2PZEA 3DPUA 3AF4A 4TMVA 1AS3A 1CR4A 5H8WA 3AVXA 4TYNA 4C2UA 1KZ7B 1NN5A 4TLDA 5DN6A 2Q21A 5TV2A 4OI4A 1Q1QA 4KVAA 4NU0A 5FPSA 2EYUA 2C2HA 3O8BA 1T4GA 5IK2A 4D4KA 2HUPA 3EIQA 3FMPB 2ZPTX 1T3LA 3QXSA 4URWR 5SZJA 1QG4A 1A82A 2IS1A 2GEUA 2WWWA 5TB5A 3SJBA 2CXXA 1ZW6A 2NZ8A 3MCAA 1HE8B 1R4AA 3DM9B 4I1VA 1DAHA 1N5LA 4UXIA 3ZS8A 2WKPA 4IXNA 1E9EA 1I4LD 2XNDD 3FKSA 1KK0A 3ND8A 4F4CA 2ZS9A 3GLIB 2BCGY 1FQKA 3B1WA 3PV0A 1GOTA 2IT1A 5KNDA 1HY3A 2XSZD 2ZJZA 3O8RA 2FNAA 4BLSA 3ZD6A 2OCAA 1C9KA 2WKRA 1XD8A 1VYVA 1XP8A 3QG5A 4U7DA 1CULC 3T5DA 5BN5A 1IY0A 3NBFA 3QVVA 1YR9A 1KO4A 2NO0A 5IHPA 3EA0A 4WXPA 1NVUQ 2JJ2D 5LB2A 2HV8A 4NCKA 1M34E 1KJZA 3R7WB 4DIDA 3QKUA 2XZLA 4HAXA 4LJ4A 1JNYA 4ESHA 2ZJAA 4JSYA 2WICA 1VCOA 1RKBA 3C15C 1RRGA 4ZDKA 2PH1A 1AS0A 2XNDA 1NIPA 2G83A 1GP2A 2C95A 4ITRC 4ZO4A 2IYRA 1MABB 1P62B 2PBRA 2VEDA 2XSZA 3UPUA 2GF0A 3OESA 3U3RA 4PX9A 1J2JA 4DEYA 1F5NA 3GFOA 2O8FB 3KJGA 4QC2A 3RWMB 1JR6A 1YVDA 2CL7X 3FHTA 4B3XA 4IEIA 2FPKA 3PUXA 3SHWA 3QKRB 2WSMA 3CH4B 4LV8B 3KL4A 3LA6A 3CB4A 3CRVA 1XX6A 1JAHA 5DH9A 2VP2A 5KU1A 1KSFX 4JLOA 3VMFA 4JL8A 4HLQB 5IRCD 1IHUA 1XTQA 1WMSA 4C7OB 4Q9HA 3LBIA 3AM1A 1E3MA 1Z2CA 4OQXA 2J46A 2ZU6A 3P20A 2BEJA 4IFEA 4XSGA 1GWNA 4OI1A 4A2QA 3HU2A 1XTRA 4E09A 3EPLA 2B8WA 5CK4A 2N1BA 2ZJYA 2BBWA 4GOJA 1DAEA 1YZKA 2QGZA 4LHWA 2OBMA 4U02A 3EIHA 4HLDA 5A4JA 3WP1B 1J70A 4R7ZA 5AJYA 1XTSA 3KXKA 4EFNA 1Z63A 3EA5A 4IEEA 2Z4SA 1A7JA 2A2ZA 3QJYA 3GLGA 4TZ6A 3MFYA 3VKHA 1G5RA 1OIXA 2ZETA 3OEED 1HH4A 4JLMA 1JR3E 2FA9A 2QMUA 3QBVA 3PFIA 2IA5A 5GJVC 3RDPA 3WRYC 3C4JA 4F4JA 1VKJA 3CM0A 3AVPA 2EFCB 4F92B 2C78A 2GNOA 3CPEA 2HF8A 2WJJA 5P21A 4Q1EA 1ZRHA 5FUWA 2CVHA 3D7MA 4TLEA 5BN4A 4Z8XA 2X8AA 4OHZA 1YRBA 2CHQA 4M1TA 4B3FX 2OXCA 1SXJC 2ZRPA 2PLFA 2GDJA 4JVSB 4DLVA 3AEZA 1US8A 4PC6A 1RIFA 3RS0A 4DLTA 2FV8A 1R6BX 2QN6A 2VP6A 4MRPA 5CIWA 1G41A 4OHVA 4HAYA 3RRYA 2AFHE 1R0WA 2W2VA 2AX4A 2A30A 2WOJA 2VSXA 3A1VA 1L4UA 1SVLA 4RZUA 5GJCA 1U0JA 4FCWA 1BYIA 1FMJA 1FTNA 4JKYA 2NPFA 2OCYC 1XB2A 2RHMA 5AUNB 3SBDA 2WTUA 2XEXA 3ZGXA 4DSTA 4MUAA 4PANA 4WW0A 3TKLA 1VHTA 3W9YA 2P6RA 1N0UA 1SVMA 3ZZTA 5DIFA 1JQJC 1TU3A 1X86B 3ZQJA 5L3SB 1SGWA 2GA8A 1W0KD 2VHJA 2XGJA 1LS6A 4BLTA 2R65A 3WXMA 1YRAA 4GPTA 3TR0A 2OEPA 1SXJB 3CPJB 3UMRA 3OIYA 2EFDB 3K0SA 2UZ3A 4CVNA 8OHMA 1SKQA 4GRAA 4KSCA 3QEOA 1XJQA 2OUKA 3FMFA 2CL0X 3DM5A 3K9HA 1W4AA 4BUJA 2AWOA 1Z5ZA 4EJSA 1JPJA 3D6TB 1XD2A 3NDBB 2B6HA 3THOA 1VYUA 1OFIA 2ZSBA 1P7CA 1LF0A 2RKOA 5FPTA 1GDDA 2FSHA 4EPWA 5EXTA 3OIVA 2GJKA 3PIRA 1T3SA 2XTMA 1DBSA 4A2PA 4DT1A 3CNLA 3R7WA 2JLYA 3I3SR 2F1JA 3R8CA 1Y63A 1VG9B 2H92A 1WBDA 1FNNA 3THWB 4UNNA 2O8DB 2WWIA 3U60B 1QHNA 2J59A 1OXVA 3SR0A 3PEYA 1R0YA 1HEIA 1S2MA 2ZR9A 4AG6A 1F2UA 1SVIA 1E2JA 4DLXA 1MABA 4V0KA 2YHSA 4DDVA 4LJ5A 4CF7A 2HCBA 1UDXA 2VHTA 2ANBA 3BIFA 3LLUA 4NH0A 4EIWA 1FX0A 2YC4C 1VYTA 2O8FA 3CRQA 2JLSA 1KKMA 3B82A 4CEHA 1KMHA 1WXQA 3IEUA 4GMDA 3QKSA 1ZCBA 2RGNC 3QKRA 4Q1FA 3CH5A 2VSFA 3TJZA 2OFWA 2BCJQ 2FEMA 4ZCLA 5CYPA 4XJXA 2RGXA 1GFIA 3CWQA 1W46A 2QRNA 2RH5A 2IF0A 1WQ1R 1G8GA 2BMFA 4QHSA 2GJ8A 2QMEA 3NIBA 2KJQA 1NBMA 2X1VA 4Q7LA 1XXHB 1ODFA 3AKDA 2B92A 2MMCA 2EU8A 2ZYTX 1XPUA 2FGJA 5JSZB 3BS4A 2FDCA 1MOZA 1DARA 2VHUA 1LNZA 1W0JA 2YWGA 4BQSA 5G41A 3VFDA 3E5HA 4BFZA 2VH5R 1M7GA 1PJRA 1E9BA 1F3OA 1XF9A 3NG1A 3GCGA 4QGAA 3VNVA 3K9LA 4OBEA 4CW7A 2F55A 4MRNA 4TTRA 4QJ5A 3TVTA 2IYYA 4AYWA 2JCSA 4QG7A 1J7KA 2OXRA 5FBWB 1E4VA 4AKEA 3K0FA 4LC0A 5FPKA 2ZS7A 4IOLA 3BE4A 1EG7A 1AZTA 5L8VA 2IS2A 3LNCA 1KI7A 3W8NA 1OKKA 3AGPA 4PSKA 4DXAA 5FTLA 3EAQA 1YZGA 2OLKA 3LW8A 1G8HA 3RS7A 2ZRCA 2JJ8A 1ZM3A 1OLOA 2ZRNA 4TYYA 2IYZA 2FH5B 4GNKA 3NHBA 3RWOA 3B7GA 2XOKA 1LF5A 2C04A 1QVRA 2NZJA 4JBWA 3LDAA 3U7EB 4EFLA 3N2EA 1MRNA 4DCSA 4TQ9A 4QGFA 4CEIA 1XMVA 2OAP1 1R0XA 4TLCA 5JMTA 1OH5A 2OZEA 4RJLA 3GLGE 4E5UA 1JXOA 2QNRA 3DEFA 2QG6A 4OQMA 4PHTA 4TLAA 1OYWA 4B76A 4D81A 2ZI9A 2RCNA 3B1XA 1T91A 1ZUIA 3EX7C 1A1VA 3T35A 1ZIPA 4QM6A 3GFPA 4PO1A 1DTSA 1KY2A 2TMKA 1G3MA 4PTLA 3QBTA 3VQTA 5L3SA 1RC8A 4M8NE 2ZEJA 3VX4A 4YQFA 2VF7A 4KBFA 4Q4JB 3ZVLA 3ZZ0A 5F9HA 1DVRA 5KSPA 1SXJA 3RSOA 1DEKA 4DRZA 1OIVA 1W49A 1O87A 4PPFA 1YJ5A 1KJWA 3AF2A 2YWEA 2XJ9A 4QRHA 3TGPA 1MV5A 2JLUA 1JALA 3TRFA 1PLLA 2FFHA 5J4VA 1MO5A 3L0OA 3OE7A 4M22A 3FKQA 5EXPA 3ZVMA 2QRZA 4IVPA 1W36D 1E9AA 2C99A 1T0HB 4FMCB 3AP2A 4QHYA 2IF2A 3EZ7A 2GILA 4LCBA 3AVQA 4D0GA 3W3ZB 4ASUD 3ONWA 3VU9B 2UZIR 1M7HA 2IS6A 2ZUCA 4KV9A 4W9MC 2GAAA 3EASA 2F43B 5LD2C 5KPDA 3THWA 4XVQA 2O8DA 1KTVA 2RGBA 2ZAOA 2Q3FA 1E0JA 1W47A 2GZDA 1KJYA 1Z2AA 3ND9A 2YZ2A 2REBA 4H9GA 3TW4A 1GNPA 1P9NA 4D4JA 3J81k 1E2IA 2ZYWX 1ZNZA 3I8XA 4DLZA 3GLIE 1U8AA 2ZE6A 1T5IA 3W6OA 3UMSA 2NMVA 3PCRB 4GSYA 2WAYA 5EZ6B 2QROA 2XB4A 2JIZD 1DPFA 1NMZA 1G8FA 2GJSA 3TVDA 3K9NA 1ZM2A 4RD3A 4BASA 4DBLC 3NTUA 1DAMA 1II8A 3GEEA 4UQOA 2F1HA 2GZHA 1G6HA 5KSOA 3WBKA 2WHXA 1LY1A 1KI8A 3BB3A 5AK0A 2XXAB 5EUMA 3OIUA 1DE0A 3I92A 1JJVA 1GKIA 3VHXA 1HTWA 5LD2B 2YOHA 4G1UC 3T12A 1G3RA 1JECA 2CNWD 4OQFA 1HURA 3AUXA 1Z6GA 4LHXA 3RANA 3RSLA 4B3DA 3TIFA 2V54A 3U7FB 4IJMA 2ODWA 2NGRA 3FHOA 1IAQA 1VG0B 4XSHA 4QOSA 5JSZA 3QOFA 4FINA 2AXPA 2J0VA 1CTQA 4ON9A 4AKGA 2A3RA 5K8IA 4DZZA 3X1YA 3B60A 1W4CA 1QRAA 4V0LA 1Z3IX 3I5XA 1D2EA 2GF9A 1XBTA 3LQQA 3WMFA 4B6EA 3X1DA 4BZQA 2CJWB 3DVLA 4BWYA 4L5BA 4B35A 3THXA 2RGNA 5GJBA 3QKTA 3QPUA 4B73A 3LY5A 3AVUA 2ZRJA 2KBFA 3W34A 4PHFA 5C18A 2AHOA 3RRNA 1S0UA 2F3RA 1VCNA 4IOKA 3A4NA 4YDSA 4IKEA 2CNWA 2J3EA 2PT5A 1ELOA 3R9WA 1L7VC 4KFUA 5TXGA 1M2OB 3RS4A 1E9SA 4I1OA 4Q1CA 4A92A 1NBME 1DAFA 2ZJBA 4MYUA 2HDNB 4RCYA 3WNBA 2IWRA 4ZPXA 3QQ5A 3PEWA 1CR2A 4KFSA 3L2OB 4LYAA 4HUQB 2P6UA 4RFSA 3CRW1 5EE0A 1EK0A 2R6FA 3QF7A 4KLZA 3AQ4A 5HE9A 5HZHA 1SHZA 2REOA 3EARA 2WJIA 3LWNA 4FXPA 3DL0A 1B0UA 3CZPA 5UKDA 3VX3A 1IBRA 1W5SA 2GCOA 2ONKA 2HJVA 1EXMA 2JDIA 3B85A 3N2IA 3OIWA 2GVDC 1KZGB 2QMOA 3UG7A 1NN0A 5J4LA 1HQYE 3B1VA 4B2PA 5BWMA 2O0HA 1ETUA 1QHIA 3ASZA 4XIGS 4DCNA 3OAAD 4LSGA 4GDFA 2MSDB 1TQ2A 1E2EA 2OG2A 4ZDJA 1OFHA 4Q4HA 2PT7A 2GHIA 1IOZA 2FX3A 3MAAC 4HAUA 1CR0A 4KU4A 5GJWC 4JKIA 4LYHA 1IXZA 4JJKA 3EG5A 5G3YA 4LHVA 5L3QA 2OV2A 4GOXA 2FFAA 4NDZA 3REGA 2WIBA 1KDRA 1CKEA 2WWGA 3MWYW 1XCMA 1X1SA 2A5JA 4GT1A 5FOTA 1NG1A 2OCBA 3IHLA 1LFDB 2W6IA 5H70A 5DGXA 4BFTA 4F91B 5FR2A 1V43A 2RB4A 4CGZA 4PO9A 4LJ7A 2ZRGA 3QI2A 1KO1A 4HDQB 1K8RA 4TL6A 4UNSA 5JI2E 4N1AA 4L8GA 3MLEA 4LHZA 4NYMQ 3RS5A 4MDEA 1R5NA 3RS3A 3AGQA 5DYGA 1E32A 4ZCMA 2F43A 2W6JD 3F8TA 1DO0A 3ADBA 3MJHA 5FPHA 3EZ2A 1JB1A 2J0UB 4XTCS 1WB9A 3CRRA 1EESA 3DZDA 1X8LA 3D8BA 4IOJA 1R10A 2R44A 1DG3A 1SXJE 3QE0A 4W5WA 3GLGB 4JL6A 1AQYA 2LCFA 3B78A 4QNMA 3AF0A 4MYCA 3X1XA 4IDNA 4ZDIA 4DC9A 4R2IA 2QMHA 2D2EA 5J40A 1XEWY 5FUYA 1HV8A 1RE0A 1VG1A 2AD1A 2FFQA 3NC0C 3SOPA 4EPTA 4P4UA 4PAQA 1KI4A 5ANRB 5EXSA 3SDZA 2OHFA 3V4FA 1ZVQA 4H1UA 1ESNA 2QTFA 4ZKDA 4KXFB 2ONJA 3JVVA 4NTZA 5FI0B 4C0BA 1FW6A 2DFKB 5EP4A 2GCPA 3AB3A 1CP2A 1P3JA 2EW1A 3EPKA 3RRMA 1KK1A 1J99A 4EPXA 2O8EB 1D9XA 1PLKA 3OZXA 4NONA 1U9IC 3RLFA 1II0A 4QGHA 2ZJOA 4BLPA 3NBZC 4AKHA 4J0QA 4BFVA 3SJAA 1Z0AA 4ESVA 1COWD 4L9SA 3LVQE 2QGNA 5FOWA 4Q9LA 5AJWA 5DNYB 4DDWA 3GLFB 2PEYA 2QE7D 2P67A 1TU4A 4RSGA 4MRVA 3VKGA 2UKDA 3DDCA 2F1IA 3ICQB 2Z0MA 4M1SA 2CDNA 3T61A 2EFGA 2ERXA 2ZAMA 3E2IA 5FL7D 2C77A 2XAUA 4GMXA 3RRZA 2XZOA 1E99A 4A6PA 2VA8A 4N3NA 3GJXC 2CJWA 4Q03A 2BM0A 1OH7A 5B58C 4MKHA 4B71A 1ZD8A 1KI1A 1I4DD 1N5IA 3MD0A 2WWYA 4UNQA 5CJPA 3IEVA 2ANCA 3BB1A 3WHLA 2WVJA 2IC5A 4JLBA 1E2FA 2FFBA 2CMKA 3D31A 3DOEA 4G5RA 2ZI4A 1W4RA 5F2EA 1U94A 5HE8A 1C1YA 3NEYA 1E4YA 1YQTA 1FFHA 1EX7A 2VP9A 1XXHE 1SKYB 1NRJB 2QE7A 1DADA 4LPKA 3PVSA 3GJ6A 4EJSB 4RD4A 1XD2B 4DIEA 2JA1A 4GBMA 3IQXA 4HUQA 3QXJA 3U3JA 3CO5A 3U3OA 621PA 2LWIA 1G3IA 2BWJA 1EGAA 2VF8A 3K70C 2ZI7A 1G7CA 5G3ZA 3W3AA 4DT1B 4FMDF 2WWHA 3R9IA 1ZD9A 2GJAA 4RFVA 1E79D 5AR1A 2Z83A 4KAXA 1A2BA 1G4AE 3IIKA 1Z29A 1CJUC 4Q5IA 3WNCA 4WBSA 4W7SA 4AI6A 4PQRA 5CITA 2ZRDA 2BHRA 5AUPB 4H1VA 1F2UB 1TQ4A 4LBYA 4Z54A 5KNCA 5KO2A 5CLLA 4B3BA 1OE0A 2IS4A 1E2PA 2O0KA 1H8HD 1MO6A 1CBUA 1DOAA 1P2VA 3O8DA 4LDJA 1FX0B 4V03A 2GXQA 5C4GB 4B32A 1RJ9A 2ERYA 2HT1A 1E9CA 3K9GA 2IW3A 1GL6A 2GKSA 1GITA 4CEHB 1KMHB 4Q9KA 5DHFA 3QKSB 4OKSA 4HB0A 2JJ2A 4O0MA 5HR5A 1ZBDA 2LKCA 1E2KA 4HLUC 1ESMA 2D06A 3MWJA 2AD5A 4QBIA 5CM9C 1D2NA 2MSCB 1ZNXA 2IYQA 2JLWA 3L0SA 4M9QA 3U3MA 2KI5A 4JLPA 3WYGA 1S4QA 4OQNA 3U44B 4OK5A 3LVRE 1Q3HA 4NBSA 1N6LA 2X19A 3QF4A 4LY6A 4A0GA 2ZRKA 2J87A 2O8CA 1QG2A 4LJ8A 3A6PC 4QHTA 1U8ZA 4MKIA 4TTPA 3TBKA 1IN4A 1NKTA 2XJ4A 2QY9A 1T8UA 1KI2A 2ZQ5A 3BK7A 4RZXA 3CR7A 3VR2A 4HAWA 1LW7A 3MWLA 1Z28A 4K46A 3B9PA 2J0UA 5EQTA 3FE2A 2H17A 2PJZA 2ZRFA 4P0TA 2NPIA 2A7QA 2RGAA 2XNSA 3QPWA 4DSNA 3WHKA 3ZH9B 1GNRA 4GP7A 2QP4A 2J7KA 1FUKA 5JCPA 3K0FB 4PHGA 2E9SA 1M6NA 3M4YA 2JATA 4CIDA 1K5DA 4JYBA 2H8KA 4DWJA 2I4IA 3ZQ6A 3TQCA 2YVUA 4MYTA 5FTMA 3RAPR 4OJQA 3IGFA 1Z22A 1N6IA 5FOSA 5B30A 1SHKA 3U6BA 5DE3A 1IY2A 4Q4AB 1GRRA 1ZIOA 4IVRA 1KY3A 3RVBA 4LI0A 2O8EA 2PMKA 1WRBA 1V5WA 5H68A 3BFXA 4PO8A 1KDPA 2EVWX 2ZE8A 4BFYA 1N6RA 1X1RA 2B7CA 3AKYA 4CEIB 4WZAE 1M74A 5BQ5A 3IQWA 3KXLA 4C30A 4OHWA 3OF5A 2C98A 4K8OA 3GLFA 2ZSDA 1GTVA 3L43A 1KNQA 1BOFA 3OEEA 2K5UA 3R8FA 2JGNA 2MSEB 2WWXA 2BMJA 5KSYA 1UEJA 2A5GA 3GD7A 1XEFA 2RGEA 5C2JB 1Q21A 3CF0A 4DLRA 1RYHA 4D25A 1CJKC 3WY9A 1FOEB 4AKIA 1NJFA 1FUUA 1Q20A 4YXWD 4NL4H 4KYUA 1ZU4A 3BFVA 5E3HA 4EUNA 5DISB 1CJTC 1Q44A 4DJTA 2JJ1D 2GTPA 4A8JC 1GAJA 2YOGA 4RD6A 2QI9C 1CRPA 5CB6A 2BBSA 1QBKC 2QM7A 5TMPA 5CDFA 2C9YA 5DI9A 3OFND 1NJGA 2QSZA 4V0MA 1BKDR 1LS1A 4QNRA 3MWKA 1U9IA 4CT4B 2J41A 2ZUDA 1SVKA 1GUAA 3Q8XB 1W2HA 4AG5A 2P3SA 2V4ZA 4IRUB 3K0EA 1JQLB 1K5GA 1W36C 4US1R 1RVDA 4CT5A 721PA 4PPNA 4Q9JA 1Q1EA 4ABYA 5KDLA 3VR6A 2XTZA 4EKDA 2CLDX 3A1TA 1G7SA 4Q00A 3CRMA 2H57A 3B1ZA 4YXWA 5AWFC 1VPLA 3TUJC 1AKYA 4I1UA 4AYTA 1UDWA 1X8JA 5GADl 1MKYA 3K70D 3QSYA 3VR1A 1FQJA 3SN6A 1W0KA 4A36A 1KNXA 1P2SA 3RYTC 3MG9A 2O0JA 2W00A 3RABA 4BPBA 1KAGA 3VR3A 4MUBA 3UANA 2NTYC 3AVVA 1ANKA 1XTIA 1GILA 1YZQA 3CWZA 3OFNA 4OYHA 4O3MA 1E2HA 4HSEA 2ZYUX 3P1JA 2OCPA 3LH5A 2ZTSA 3TSZA 4MH0R 3SNHA 4R98A 1XMSA 5F98A 1AS2A 4HATA 4LBWA 5FOVA 1XJCA 3HR7A 1W36B 3C8UA 1GKUB 3PUZA 4D2IA 5JECA 2FSGA 3ZIAD 4GI7A 4AWXA 5GVRA 4PPQA 5KDDA 5FBQB 2YINC 1AGPA 3CPHA 5EE3A 1II8B 4NPHA 2QTVB 3U3KA 2DPXA 1T6NA 4XOIA 1IJFA 4ACBA 3UXMA 1IM2A 3VKWA 4Q1DA 1CLUA 1S1MA 3HDTA 3U44A 2NG1A 3BB4A 1XZPA 3TNFA 1MRSA 4A82A 2ZIAA 1RW4A 3L0PA 4NYJQ 1C4OA 3THYB 1OT3A 1ZUHA 4URXR 5CM8B 1Z08A 4M1KA 1O3YA 4WOPA 5BN3A 2DFTA 2GJ9A 1Q1ZA 4BFXA 3NBXX 4HAZA 1QVAA 3I1FA 4JSTA 3JVUA 4LPSA 3ZS9A 2EYQA 2QQ0A 2XITA 1Q3TA 4ZCIA 2QTHA 4NYIQ 3CW2A 3X1WA 2KE5A 4NHOA 2IXGA 4C2TA 2P2LA 2Q0HA 3QVUA 1P61B 3GP8A 3T1OA 2HYDA 2GCNA 4DUGD 3AP3A 2DB3A 3THXB 1CEEA 1D6JA 4HLUA 4OHYA 1UM8A 3SQXA 1FP7A 1P5ZB 4Q01A 1T8TA 4JBXA 4DB4A 1OPXA 3ZYCA 1DAIA 1KO5A 1W48A 2IXFA 3BC1A 4JLDA 3TMKA 1KI6A 2Y8EA 3KJIA 4BRWA 4E22A 2IYUA 3OHMA 5EP1A 3ADKA 3BGWA 1ZUNB 4TMTA 4ZKEA 1G8YA 4MKFA 1VECA 1II9A 3GJ4A 3M1IA 1S8FA 4QL3A 1S9DA 1XWIA 4Q4AA 1CXZA 3TUZC 1XCGB 1YR6A 1OHHD 4PAMA 1KHTA 1S1CA 4XTRA 4B3CA 1DAGA 2FEOA 1EFCA 2Z5FA 3KQHA 4FWIB 2IBMA 4RFSB 1NMXA 1RRPA 4PQFA 3AVTA 1W1WA 3GJ7A 2XB2A 3CR8A 4TSFD 2GETA 1KSHA 3W6NA 1JI0A 3TUIC 4LYJA 2QQEA 2IYWA 4GZLA 4LGMA 2SHKA 4C9BA 1E9DA 1NKSA 3QXCA 4CEJB 2GCOB 3H1TA 3I32A 1JBKA 2W83A 2FG5A 3E1SA 4DDUA 1Q1BA 1EFHA 3QY0A 1FTSA 3C14C 2FGKA 5FTJA 1SZPA 4DB2A 1OXUA 5J4HA 3AVWA 5ELXA 3EWSA 1RYFA 4D4MA 3KX2A 5CLQA 1KKLA 5DI3B 3TK1A 1XEXB 3P26A 1Z0DA 4KODA 4M1OA 4Q4HB 2BKEA 5SZIA 2JLZA 1IXRC 1TQ6A 3TSOA 1VCIA 3SEAA 3PG5A 3DHWC 4FW9A 3WP0A 3AVOA 2G0NA 5IF9A 1E96A 3KFXA 4TYPA 3BH6A 1XNJA 4B43A 1D9ZA 2DWPA 5L3QB 4UXJA 1G1MA 2X2EA 2IUTA 2EFHB 5K8TA 1DG1G 1OF1A 2ZE5A 2IXEA 4JJZA 5E95A 3UATA 5BYKA 1JJ7A 1YZNA 2V8OA 2ZRBA 2HYIC 4F93B 2DWQA 4Q21A 3SQWA 4N0DA 4TL7A 4A9AA 3GLFE 1G8PA 3L82B 2IYSA 4BGDA 3U6KA 3Q7QA 3IUYA 4C0QC 1Z06A 1UKZA 2HLDD 1IONA 4M53A 4FIDA 1L2TA 1OH6A 4I99A 2QAGC 3K1JA 3EC1A 3Q85A 4A8JA 3F3YA 3REFA 3CX6A 1TADA 3H2YA 2XZPA 3OEHD 4PC1A 5HCIA 1CU1A 2V55B 5IT5A 1E1RD 5JS8A 1OXSC 1J90A 4FMBB 5LBIA 4HZUB 4AIIA 4TL8A 4O2RA 4M21A 4V0ME 1XTJA 3CX7A 3HU3A 4DLYA 3CBQA 5F3WB 1Q22A 5FUXA 2KSQA 4E07A 4B3GA 2J45A 4ERNA 1IXSB 1W5TA 4KYIB 4M1MA 2CK3D 1E2MA 2FPLA 4KSBA 4TL9A 1A2KC 2QL6A 1SKYE 3Q7PA 4XWOA 4TYQA 3EPHA 3EXAA 2QT0A 2ZJ2A 3L8ZA 1YR7A 2J1LA 2V9PA 2FU5C 4IVQA 4LC1A 3A1UA 3M0EA 5CJ2A 4P4TA 1E98A 1G291 1RRFA 2HLDA 2AKYA 4IDOA 2IUSA 3QG1A 4M9ZA 4ASUA 4P3YA 1AM4D 4Z1MD 5E7MA 2G6BA 3B13B 2GK6A 4POAA 2D4HA 4HEJA 2FZ4A 4JZKA 4QJ3A 1GKYA 3OEHA 2Q6TA 3AV0B 1RRCA 2LKDA 2X2FA 4MQBA 4UJ3A 4QBFA 3THYA 1HT2E 5EXXA 4DDTA 4B44A 3SYNA 1ONBA 1S3GA 2OE2A 4OI0A 1N0VC 3B8HA 1Q57A 1XMIA 3CONA 2IWHA 1ZMXA 5B57C 2CHVA 2ZXUA 3PUWA 4L16A 5FTKA 4AC9A 2FPMA 1KO7A 2QENA 2JIZA 1P73A 3CF2A 5CIQA 1EWRA 3FOZA 2ZRAA 2ZJ5A 1RPZA 3A1WA 4IOMA 1TEXA 1UBCA 1HT1E 2OILA 3FDIA 3ZZUA 4BFWA 4XVUA 4TMZA 4HB4A 4Z1MA 3T1QA 2IYTA 1NI3A 1Z6AA 4B2LA 2Q9CA 2KWIA 1M7BA 1OB5A 4URUR 2DFLA 5EJEA 3NHAA 1M8PA 4X8LA 3TSWA 1NL3A 3VR5A 2O52A 3T06B 4A2WA 1XTKA 2C9OA 3KKPA 3PXGA 3EZ9A 2BBTA 3W5IA 3B1YA 3KQNA 3ZLJA 1OJLA 1KMQA 4TQAA 1E2DA 5A5GA 4PZLA 3KZ1E 3LRPA 1PUJA 3BORA 4V0OA 3D3QA 4W5JA 4LOAA 1MO4A 4PSVA 2NO6A 5FL3A 4KITB 1XJ0A 1NG9A 1ZD1A 1TPZA 2CE2X 4JS0A 3GJ5A 4CEJA 2BC9A 1Z0KA 1G19A 2G88A 1YE8A 4OL0A 3PITA 3I72A 4Q1AA 4M9XA 3I73A 2EQBA 3PEVA 4PR0A 3FMOB 2AR7A 2R6CA 5DI3A 1XEXA 1KDTA 1KIMA 4G01B 3SZRA 2GEDA 4K81B 2ZSEA 4A1FA 3AVYA 1RJ9B 4LJ6A 4DCVA 1KDOA 4YC7A 4Q1BA 1IN8A 1JR3D 1KSGA 4DKXA 1ZM9A 1EFTA 2GWHA 1AJEA 1UJ2A 5EUQB 1A4RA 2KBEA 3IIMA 5M04A 2X77A 3NEJA 1YZUA 4D0NA 4WA7A 2CE7A 1SVOA 2VPPA 2OLJA 2IK8A 5KUTA 5D3MB 1R0ZA 3FMIA 2VP0A 1UF9A 1JXMA 1QHYA 4GOKA 3FPAA 4YMVA 1E2LA 1AA9A 2BKUA 2PL3A 2YC2C 2GEVA 3F0TA 3QF4B 1X8KA 3Q3JB 3U4QB 1UADA 3ZDQA 5LPNA 2WJHA 2O8CB 1E9FA 1TF2A 3KJEA 3OAAA 4PHHA 3LX8A 3K53A 3U7HB 2OO7A 3UWKA 1VIAA 4LYFA 3GJ0A 1YKSA 4G5GA 5AUOB 1I4TD 2BVNA 5KDOA 3GJ3A 3FTQA 1ZINA 2FMXA 5JJKA 4C3ZA 3M6AA 4NCNA 1QHHA 4HZUA 2VYFA 1TF5A 3LXXA 1X6VA 3LV8A 2D74A 3LBHA 4UNRA 1GG2A 3MSXA 4B48A 1G16A 4JLNA 3TQFA 3BD9A 3HR8A 5E7JA 4FD2A 2GRJA 5TDHA 3TLXA 4MGKR 3U5ZB 2OFOA 1U99A 2VHQA 4CYMA 4X8OA 3F5FA 3ZVRA 4RD0A 4YLGA 1Z6XA 3KUCA 2YWHA 5DYIA 2JLXA 1LB1B 2CLSA 2DYKA 1FMLA 1JAIA 1OXTA 5JEDA 5D3QA 4BZPA 3CX8A 1AQUA 2AKAB 4KFRA 2CCKA 3CNNA 4F38A 5TARA 4C0AC 2G0TA 2W6JA 2DBYA 4PAOA 3I62A 2GESA 5AJXA 5H1YA 2QAGA 3FYHA 4ILEA 3SBEA 4S35A 1VDZA 1P75A 4WIAA 4DCTA 1GSIA 3R9XA 2ZVQX 4C0KA 1U0HC 2FF7A 3WYAA 2A9KA 4F4IA 421PA 3U61B 4KFTA 5DN6D 2B8TA 4WZ6A 3SS8A 2YNMA 2PJRA 5IK2D 2QM8A 1TUIA 1VTKA 4W5HA 4I4LA 2IHBA 1IN6A 3FB4A 3Q5DA 1CR1A 2HEIA 4KVGA 3V9PA 3MGCA 1MT0A 4LZZA 4BLRA 2ZE7A 4KI0A 4LBZA 3U7GA 2YOFA 2WZQA 2VL7A 3FVQA 3UWOA 2VRWA 4AYXA 2G3YA 4B47A 1AN0A 2IEZA 3JZAA 3P32A 4TLBA 2FWRA 2G1KA 2AN9A 4JVNA 3G82C 3SYKA 3L8YA 5AUQA 4KO8A 1KGDA 2H5EA 4LV6A 5J4YA 1NN3A 1NVWQ 2OBLA 1DO2A 3H84A 4PFSA 4TMXA 3BH7A 3PR1A 1N6KA 3ADDA 5C4MA 1NIJA 4D4LA 3KTAB 2NOAA 1COWA 1R5BA 4LHYA 2WBLC 1OB2A 4MRSA 3HP1A 4R2HA 3QEJA 5BW8A 2Q9BA 1XDBA 4URZR 5FH9A 3NKVA 5KNBA 2JASA 4EAQA 2BBOA 3TAHA 3W6PA 2F1RA 2AFIE 3KKOA 3U2QA 1NLYA 3K0AB 3CLVA 1T0JB 2Q9AA 2WSSD 2J9RA 3IHWA 5FL7A 2YWFA 4EDHA 4Q18A 3AH8A 2PZGA 3N70A 1KSJA 3ECCA 4HB2A 3MUFA 2FJUA 1BO6A 1FPMA 3CUEF 3UG6A 3LLMA 5B2ZA 4R71A 4C0JA 1XZQA 2WV9A 1WBBA 5JHGB 4BZXA 1G18A 5FBVB 3A58B 2WOOA 4S2EA 1Q12A 1D2MA 2GXAA 1FL9A 1Z0FA 1E6CA 1H65A 1F6BA 4M1YA 4QFMA 3A8TA 3I61A 5JWRA 1U0LA 3RC3A 1A5TA 3KB2A 3BXZA 5SZHB 5A0FA 2P0EA 3PENA 2AL7A 1G4UR 1N5JA 2V7QD 3IKJA 4LK2A 1G7TA 4B75A 2WSSA 1TAGA 2BJVA 5IDVA 2V1UA 3QNUA 2B21A 4TT3D 1G5TA 1Z8FA 1RFLA 1E2GA 1MR3F 2W2XA 3K70B 4PC7A 2HXSA 2RGCA 1Q0UA 4G5SA 2F6RA 4BECA 1E79A 3CF6R 4RZ3A 4WAUA 5D3MA 3NC1C 2WJGA 1OSNA 4B34A 3S1AB 2VBCA 2C9CA 3GFTA 1L4YA 1FZQA 4FMDB 3U4QA 3PUVA 1JEEA 1F60A 1SVWA 2BDTA 2ORWA 1H8HA 1N6PA 2OAQ1 4NKRA 3EW9A 3PEUA 2A5YB 2ZRMA 3QXXA 5JI3E 1T5LA 4PSAA 4MYHA 3T5GA 3TW8B 5E7IA 2V7QA 1CRQA 2IEYA 2F7SA 4R9UC 3NBYC 1TTTA 3MRSA 1P72A 4TT3A 3UK6A 3DMDA 1P6XA 4KJZA 2VO1A 4YMUA 5JZVA 5K8LA 2ZVPX 3Q5EA 2Q3MA 3TR5A 2UVQA 4Q02A 3AUYA 4EFMA 3EWAA 3W5JA 3NXSA 2PEZA 1KI6B 2ZU0C 2F9LA 3O47A 3AKCA 2XX3A 1N5KA 1UFQA 2NO1A 4AURA 1NN1A 1TMKA 4KLNA 5G40A 2BV3A 1H8ED 1OFTA 3EZFA 4G0NA 2Z4RA 2I1QA 5JWHA 1F2TB 1YZTA 2QPAA 1OW3B 2HCJB 1G9XA 4OHXA 4KBGA 3RHFA 1QF9A 1KK2A 2NIPA 1DELA 4RKEA 4BFSA 3KUDA 3NH6A 3ADCA 5JS7A 2ZYVX 4M1WA 4NP6A 3A4MA 1G20E 5HZKA 2A78A 2GK7A 2ZR0A 3E70C 5DO9A 1NSFA 2N46A 2QEQA 1R8SA 4OK3A 4P4SB 1E0SA 3V4RA 2PCLA 2VP4A 1NVVR 5FBLB 2ORIA 2QP3A 2ZITA 2ZSAA 4MDFA 2ZUBA 1N6HA 1H8EA 1T9HA 2PLRA 1XPOA 1KAOA 2BEKA 2O5VA 1NY6A 1P9RA 3B5JA 3LW7A 1QZXA 4HDCA 4HYYA 4JLAA 3P27A 5JJIA 4P31A 5TVKA 4M2LA 4QGGA 4MA4A 4DHEA 2OFXA 2QPOA 3MJRA 3NH9A 4UNPA 3ICEA 4KCGA 4MRRA 2R2AA 4U00A 2QBYB 2WPDD 1KI9A 3AP1A 4V02A 5HTKA 4QKQA 2QT1A 4D0LB 4ACAA 1N0WA 4NE2A 3KTAA 4L4UA 2WKQA 1ZCAA 1JPNA 3G5UA 2OBNA 4PQYA 3G0HA 4M0LA 2F9MA 1KOFA 4PPGA 1ZC3A 1LV7A 3C7KA 2ODNA 3K0AA 2NO7A 4NYMR 3C41J 2FOLA 2C5LA 3HJNA 4PC3A 3IPXA 3RS2A 1YR8A 1OYYA 2ZRHA 4JLJA 3K09C 4LV5B 5EP3A 3GLIA 2JJ1A 3GLHB 4LWZA 3ZVNA 1BYUA 4A8JB 2C96A 3IO3A 1RZ3A 2WPDA 3B6EA 1ZAKA 5EE1A 4HI0E 3A36A 4YMWA 3LD9A 2J0QA 1PUIA 3WMGA 4PC2A 3GEIA 4HB3A 4QXAA 4M9SA 3SC3A 3WYFA 1YU9A 1YZLA 2AK3A 3IDQA 521PA 4DSUA 4ZIRB 121PA 3A1SA 3WRXC 2BOVA 2GAOA 1OH8A 3UKDA 2HXYA 4ZV4A 1CIPA 1GL9B 3FWYA 2H7VA 4HDOB 4D26A 1Z07A 1W44A 1W4BA 4AK9A 5KHOC 4L9WA 4Z51A 2ZJ8A 5E4FA 3I5YA 2W0SA 4URYR 3QXHA 4WZBE 1N6NA 2B7BA 4DVGA 4C4PA 4A4DA 2G77B 1WA5A 4BRUA 4O2LA 1NBMD 1LVGA 5HCNA 2ODEA 5FUVA 4ZDWA 4D82A 3S1AA 3IILA 1TL7C 3LQRA 4IDHA 2IX3A 1BH2A 2ZI5A 5KOYA 5JWOA 1W0JD 3KQUA 1N25A 2J7PD 4F7WA 1VMAA 2RGGA 1E2QA 3KQKA 3GPLA 3T1VA 4BLQA 3K0CC 4C0HA 1G17A 1HYQA 4X8HA 4PZYA 4YMTA 3SFVA 1XFAA 1IQPA 3VNUA 3ZIAA 2BIFA 4RKFA 2V1XA 5L3RA 1XRJA 5FPYA 3BWDD 3ETLA 1CS4C 3GJ8A 1BIFA 3LXRA 5FTNA 4BLOA 1UKEA 1AK2A 4EPVA 4C7OA 3HPRA 1UBGA 5J47A 1AKEA 1OKKD 3QENA 4JLKA 5JBQA 3H86A 1PZNA 2CLCX 4V0NA 3KFVA 2IHYA 1P2UA 1HE1C 5JJLA 1GIAA 5G53C 5GVSA 5JLJA 1N3BA 2J7PA 2D3WA 1NMYA 1I2MA 2JLQA 2XOKD 3KDSE 3DKPA 4G3XA 4UKDA 3ZJYA 2VTKA 2ZREA 4DCUA 3TE6A 4A0FA 3PQCA 1BMFD 2NO9A 1XMJA 3IBYA 4UXHA 3ASYA 1S3SA 3C16C 1F2TA 3SJCA 1VCMA 1EWQA 1QHGA 1ZYUA 2ZR7A 1CJVC 2JAQA 3KB1A 1TQDA 2VHCA 2YYZA 2CBZA 4NZYA 3BFKA 4IW3B 1R5OA 1P60A 3T34A 4DUGA 3RNLA 2CCJA 2WJVA 2O8BB 2P5SA 4DEXA 4RZ2A 1XU4A 2BMDA 3EZ6A 3GMTA 5FR1A 4Y0AA 3W8RA 4P4SA 1EX6A 3EIEA 4BFUA 1W7AA 1G64A 1PLJA 4XVRA 5EZ5A 3X2SA 2DFNA 2R9VA 1EFUA 3FGNA 1G3QA 3GQBA 2ATXA 1N2CE 1NVXQ 4Q7JB 4QJ4A 1SXJD 4TQUS 1E69A 1BMFA 1ZNYA 4MKGA 3SI7A 4U5XA 2I3BA 1U90A 2MMGA 1QHSA 4A0HA 3RC8A 1P4SA 2J0SA 1OHHA 2L0XA 4URVR 4FMCF 2H16A 1NF3A 1KO8A 3P4YA 1G5PA 3O8CA 1OIWA 2QBYA 2PX3A 1JEDA 1OXXK 2WMNB 3NWJA 3OE7D 1NLFA 4PXAA 1AZSC 5JRJA 3QIAA 4RY2A 5FI1B 1R2QA 4QBHA 3UMFA 3VAAA 4TSFA 2ODBA 1U2RA 4II7A 5FFMA 3AF3A 2ZRLA 3KKQA 5DSZA 4PZZA 3LAWA
chains in the Genus database with same CATH superfamily
2WWFA 4MS4A 1E5TA 3WGNA 3IX7A 4NBKA 2W71A 4Z8YA 3WGGA 4ARZB 4RCZA 3PL1A 1U81A 1PT5A 4JELA 3GRUA 1W87A 4DBVO 3BERA 4RS4A 3JZMA 1M6WA 2AXNA 2B8JA 3MM4A 3ILSA 3DJYA 4RK7A 1TAHA 2WFMA 1DX6A 2PR2A 1DIBA 2PDAA 3N07A 4XM1A 1Z4OA 4YO7A 2WJYA 2ZZMA 4DLSA 1WS6A 3VVMA 2Z6VA 2P5UA 4IIFA 1UBEA 1KK3A 1YASA 3DMRA 1XDUA 1TCUA 3FSRA 5A62A 1O4WA 1F8FA 2QUZA 1EUDA 4OU5A 1N2IA 1QGYA 1ZNWA 4U2KA 1JHUA 2MR5A 4GO1A 4WGFA 3RYHA 4CLEA 2W2TA 4QYMA 1ZJZA 3DLCA 3SX0A 3V4SA 4BX9A 4I1PA 4DDMA 1H2XA 1KJ8A 2EFEB 4JVLA 2C94A 2VBGA 4UHFA 4ZAZA 4ZIRA 1GNQA 1RJFA 1P3DA 3PDCA 821PA 1EEXB 4HAVA 3TZHA 1QCCA 5D1HA 3SDSA 4XWAA 1TRHA 3AONB 2ZJ4A 1XP5A 5EZYA 1RYYA 2CXTA 1T8WA 2EKPA 1CJCA 2OT3B 3I37X 1ODJA 4JBIA 4IIGA 4LBVA 1V95A 3KWFA 3T5CA 4DCGA 5LBUA 1P9WA 3GAZA 2I0FA 3S0JA 1NSTA 4LOLA 4MUMA 2QU8A 4IXMA 4G5XA 4PLGA 5T4HA 4YRRA 4ENQA 3F74A 1DTEA 3PDUA 4Q7MB 1MAHA 2ZIEA 2IU3A 1PQ4A 1NBEA 2PUHA 1KFKB 2AQ8A 4G26A 3UMGA 3FAZA 2ACEA 3IPYA 5FWAA 2O19A 2FRXA 5LDDC 3LCRA 4YRQA 1GRQA 1L5RA 3FZNA 4RELA 4D6PA 1N77A 2KB0A 2WHQA 3HB7A 1N6OA 1YK0A 3O4IA 3VTKA 2CCGA 3ROEA 4B87A 3ROZA 4ZRNA 4Q7KA 1OR8A 5FP0A 5BV1A 1V7ZA 4PYNA 3OQBA 1ODLA 4H35A 1VDMA 2XPCA 1XDDA 1EFRA 5T8KA 4RIFA 2B5WA 1XZFA 3WMRA 4US2R 3BBPA 1UQRA 3L0IB 1IN5A 3BJIC 3GCZA 1VC2A 3IQDB 3KEOA 4OQEA 1UKVY 4MZDA 2QORA 2E0IA 2E1RA 1TNDA 4TMYA 4TQGA 4CKBB 2Q6IA 2QZ4A 4JQSA 3RHTA 1DIOB 5CCXA 5I4CA 5H82A 3IE0A 3IIJA 4RK1A 1I6WA 1KI3A 2PCJA 3TCXB 3GZNB 4K3VA 1MVOA 2ZT5A 3M2TA 4H7JA 4EGFA 3KSAC 4Q48A 3ZHYA 3I28A 4KTTE 2EKDA 1WCIB 1GZSA 1LVUA 2O5EA 1NLZA 3OVMA 1I2DA 3O95A 2KX7A 1QPZA 1KOJA 2EWWA 1BQEA 2ZS8A 4MW1A 4U6SA 2EBFX 3SMQA 1K6MA 3PC8C 2JFQA 4HNGA 4OI2A 2IUUA 3IAUA 1SOWA 3SQDA 2PUBA 1XYVA 1U0BB 3FNFA 2PZLA 3ZLTA 4KK3A 1SA0A 5K3EA 5LP6A 1DZ3A 1YHNA 4OQLA 3L8HA 4CZ2A 3HUTA 2ZBDA 2N0SA 4CMAA 1D6MA 4UJ5A 1PYGA 1XT6A 2QSYA 2D7CA 3PGXA 3EPRA 1DKQA 4GLOA 4B2IA 5AHKA 4E94A 1JB9A 3K0CA 2HJGA 4G5OA 4HDSB 4PLTA 4D9IA 1U2TA 2PXXA 1EAMA 3AUSA 3H17A 2DQ4A 2QTAA 4FCVA 1D0VA 1ZM4A 2PKEA 4O4LA 3STHA 3ZTTA 3ZCUA 2B8NA 4PG6A 1N1EA 3KTFA 2JDID 3KZOA 3G85A 2IOQA 4OO3A 1DC8A 2D1QA 4E7OA 4EL5A 2FMTA 3MF4A 4TKMA 2NXWA 1XCPA 2AJDA 4ALNA 2VKQA 4BBAA 1P5JA 2WAOA 4MQEA 1TO6A 3CE9A 2GPSA 1K7SN 2HMTA 1V11B 3LYLA 3OWOA 2WIJA 3EWNA 4GE0A 4P3KA 4X6YA 1PKXA 4QSHA 5D6OA 5A2QA 2CV0A 4WVFA 1PN3A 4OXXA 3IL2A 1KPHA 2OV1A 3BE8A 1PR2A 3G2PA 1PV2A 2NQ2C 1T5SA 3ID6C 5BN5B 1P81A 3BXEA 4LXYA 3P9ZA 2PMDA 4XEUA 2JKZA 2I78A 3K31A 3OJFA 4I1RA 4YJ3A 2H1LA 2ZSFA 3P4XA 5AJVB 1CLEA 3K9FC 3QJGA 4LJAA 4WMLA 2Y1DA 1KYZA 4YDHB 5CX4A 5HJ2A 4CRWB 1M1YE 3AXTA 3GFBA 2WUDA 2OYRA 1Q83A 1QP8A 4IFIA 5EQDA 2HNKA 2PX0A 1OV4A 2I67A 1Z0JA 4TUYF 3TPFA 4FPXA 4AVYA 1KR2A 3EXHC 2FPIB 1USVA 1EM8B 2GKGA 4PIMA 2EIHA 4HO1X 2AJTA 2R62A 2P9GA 3OM9A 2ZANA 4N8SA 3O31A 1JIIA 4EGAA 1E1QA 1BE0A 1T2VA 1SCAA 2OXFA 1NP3A 4FWTA 1MAUA 3JSAA 4O1HA 1Z5WA 1WF3A 2BM1A 1UMBA 5IAAA 1B0PA 2YMQA 5AICA 4ARZA 1QHFA 4D3DA 1LTQA 4P53A 4XA8A 2P5TB 1ZBQA 2J6HA 2QJOA 5CLGA 1GM5A 3DEAA 4HVLA 4OGKA 3CC8A 3MJEA 3MTEA 3NONA 5IVHA 2Q3HA 3FVVA 3TH5A 2QW8A 2X86A 2NSHA 1UEIA 1RDFA 1UDAA 3JYQA 4I9GA 3BAFA 4LSZA 1AIPA 4RS3A 2YJ6A 3SNKA 4Q4JA 4XCVA 5KYUA 4XCQA 2JEOA 1ECGA 1N2SA 2ZTHA 3DGEC 4J94A 3IJ5A 1JPVA 3CKMA 2VP5A 3ND5A 3AMVA 3CUSA 3DEYX 2HSEA 2V59A 1O6ZA 3IDSA 1SFRA 2FZCA 3E58A 3M1AA 4N01A 2E21A 2FFRA 3L8EA 1I7LA 4B3MB 4REMA 3GBPA 2X7HA 3GCDA 4X8MA 1YR2A 4P33A 1GRNA 4LJ9A 4D9MA 1QB7A 3PHCA 1XZJA 2OV3A 3G13A 3C48A 4DLPA 5J5CA 3T7RA 2ZT7A 3LFUA 3OBBA 3FIUA 4BE7B 3NDPA 2R1TB 1FP6A 3V1TC 1XZHA 3D02A 4K9DA 1Z83A 4CMBA 2VCHA 4FI3C 3AHCA 4MKXA 4ZVNA 4Y2XA 3T3OA 3BMOB 1HE4A 3HYRA 3OZCA 4X84A 2JFNA 2VRCA 3KDPA 4EO9A 4IV5A 1VMIA 2AFVA 2H08A 2QZZA 3E9CA 5AVWA 3RH0A 1SUIA 4HN9A 4IZOA 2REXB 2X22A 1YQEA 1EVIA 2I1VB 1E2NA 2QSUA 2IL1A 3GV0A 3D8HA 4NC9A 5AP9A 5HKKA 2FE4A 2Z08A 3O84A 5DXFA 5FBRB 4BXOA 4CDGA 1U2DA 4UU8A 2YIJA 1UM9B 2JCYA 2RGDA 4AJHA 2SNIE 4JXZA 2O4CA 1CUIA 1I32A 1SURA 2XDWA 4MMXB 4ZODA 4R8RA 1QR2A 4JC0A 4JMPA 1CJMA 2A9FA 2HBZA 1B0AA 1PVDA 1XO1A 2PWZA 1BD3A 1F48A 2QUHA 3P7MA 4J75A 1B4DA 4XLZA 5AXCA 4YHHB 1IRXA 4KK4A 2J4DA 3IOMA 1IN7A 4S05A 2QVBA 4ZQHA 4PLFA 1Z37A 1PT6A 3M6IA 1A71A 4B74A 4CM1A 1NRWA 2I3ZA 2M1XA 4RWZA 5IBRA 3DMNA 2DFVA 3AKEA 3IVRA 3NHZA 5AK3A 3R24A 1P0CA 5BYJA 3SXPA 2HEGA 4B45A 1VSQA 2AK2A 1Z0IA 1BX1A 4PTZA 5CFNA 1H23A 1V9SA 2ZROA 3I8OA 1SCQA 4HYTA 3O38A 4LTDA 2BJWA 5KVQA 2ECKA 2CKMA 1MP0A 5C46F 3ZDZB 1QGUB 1US8B 1TCCA 3FKSD 4JWTA 5K09A 2FTKE 1U2GA 5SYAA 1XVUA 4DSOA 4OHUA 1P0QA 4DLWA 1OFUX 1BEZA 2I4TA 1RVV1 3N5CA 3NT4A 3OG9A 2X0FA 1MO3A 3T7JA 3ZBUA 2DCUA 1GTG1 5IZ4A 1XNQB 4F97A 2LRHA 3O90A 4HWRA 4KACA 2B4QA 2ZDHA 1GGKA 1JQDA 4I9HA 4I4TF 2BW0A 1CR4A 5K20A 4JLUA 2VJAA 1Z2NX 4LY9A 1KYVA 5KAPA 1NN5A 4L9RA 3CXUA 5DN6A 5TV2A 1Q1QA 3GGOA 4D4KA 4O4JA 2OB2A 1AB6A 3KR0A 2HUPA 3EIQA 1T9GS 2HAEA 1T3LA 3FMPB 3QXSA 4HDSA 4R1MA 5ECWA 1EE2A 4KN8A 1A82A 1QYIA 4NU8X 4X5OA 4JJEA 3SJBA 2OFFA 1Q2XA 5EOVA 1JIQA 4BNZA 1HE8B 4G8JA 3DM9B 1J2RA 1H6BA 2H9IA 3H1PA 3PWZA 3K1YA 3QWFA 1I4LD 1N34B 2VSQA 4W82A 3VTFA 4F4CA 4F84A 2PL5A 3ORRA 2GAJA 3GLIB 3IVCA 4KN9S 1UK8A 5G0VA 1V11A 2ZCVA 1GOTA 3EPPA 2RGWA 3MCVA 3OIFA 1HY3A 3SYTA 4DSAA 4BOYA 4KE6A 4QQRA 4BU0A 3ZD6A 2OCAA 3IBSA 1TQ8A 4GC5A 1QJCA 1Z8DA 4KMMA 3T9EA 2WYUA 1ABBA 1CULC 3AC0A 3T5DA 3DHNA 3HDHA 1VSUA 5BN5A 4JR0A 1UK9A 5JAUA 4Z2AA 1JA9A 3EA0A 4WXPA 4WUTA 1FUEA 2PX2A 1JG3A 4E1BA 3MERA 1KJZA 2FPOA 1FJHA 3JVDA 5A5VA 4MR8A 4HDMB 3W4KA 5K8VA 2XZLA 5COAA 3U26A 4NPAA 5LU8A 3Q11A 3TZLA 1ZHOA 2ISSD 2EL7A 2FPIA 3N8GA 4LJ4A 1JNYA 2GD1O 2ZJAA 1R1DA 5H81A 4KB5A 1V2HE 4XDZA 4WPGA 3LQ2A 4GQBA 5B6JA 3TG8A 2YQ4A 3B6IA 1HYEA 2I76A 2QX4A 2C95A 1L5KA 4EHAA 3N6VA 2X8BA 4D3YA 4ZO4A 2IYRA 2LTAA 4R1NA 3W8FA 1MABB 4RTNA 1Z25A 1DJMA 4HCJA 5E1BA 4JGIA 4B7XA 5TVGA 1ULTA 2GF0A 4ARIA 1WCWA 5C5CA 5F12A 2PSJA 3TOZA 1E6WA 4DEYA 2OWDA 2O8FB 4I5IA 3RWMB 3U4DA 4EY4A 2VTBA 3D4BA 3FI0A 3FHTA 2R48A 4CKYA 2KMLA 3H4IA 4WCDA 2FPKA 4E5PA 2PFKA 5AKIA 3FRIA 4MVJH 4Q3AA 2FPSA 4PG4A 1C9JA 3QKRB 5BXYA 3CH4B 5JO9A 3OCCA 1XX6A 5DHQA 4YXFA 1FP4B 1WPGA 3AFMA 3PNYA 2WE8A 2CZCA 4HLQB 4UDXX 5IRCD 2NXEA 1SBNE 1CFZA 1IHUA 3AEYA 5LQJA 3FUVA 1RI5A 1GPWB 5D3ZA 4OGGA 4PNPA 4NBRA 3LBIA 2BDUA 2F1KA 2V7WA 3CLSC 2G4LA 3MFQA 4N9WA 1KP9A 1UJ4A 4JQYA 2J46A 2YY7A 4XSGA 3R75A 3IJRA 4OI1A 3A3KA 4GMHA 3HU2A 4WFKA 3NHFA 4YB8A 1XTRA 5AI5A 3BMOA 4MDHA 3EPLA 2H1VA 2N1BA 4TSRA 1GQFA 1DAEA 4LHWA 4OHFA 3P9NA 4ISBA 1H85A 3R74A 3EIHA 4HLDA 5KVCA 4BQOA 2A0YA 4K6OA 1S3IA 3VU8A 5A4JA 2YUIA 4W9RA 1J70A 3NETA 5AJYA 4EFNA 4EY7A 1I4WA 2WT8A 2MOKA 3EA5A 2VZ9A 2COEA 4IEEA 4HRAA 3WV4A 1JG7A 2Z4SA 3FPLA 1A7JA 2A2ZA 1LVHA 1UM9A 4TVOA 1W19A 5ECDA 5H83A 4JT8A 1I4OA 2CDAA 3KQWA 4QFBA 3W9BA 3STYA 3JR3A 1HH4A 3WDLA 1JR3E 4RZHA 2QMUA 3RDPA 5GJVC 3WRYC 3HXQA 3C4JA 3M4NA 3CM0A 3AVPA 2EFCB 4PYOA 4R0VA 3L4BC 1TAUA 3ELUA 4F8JA 3TPCA 4E32A 3ZOKA 3N3BC 1ZRHA 1DKNA 5FUWA 3TDNA 1TLLA 1JYSA 1ZH0A 5D85A 1T2DA 2WU0A 1JP7A 2ZJ7A 3H9QA 4TLEA 3ZG6A 4MXDA 4DHWA 3VPDA 4OHBA 4Y9TA 3RSCA 3VKHA 4LF7B 2JZOA 3B6JA 5KVVA 1KWKA 1NSYA 2CHQA 4YLYA 2G06A 4KR2A 2ZRPA 5EPOA 2P2YA 1LNSA 3HJHA 1ZVJA 4BAGA 2Y6VA 3K30A 4GQIA 1H2RS 2X3FA 1QGUA 1US8A 3AEZA 5DRYA 4BNYA 3KLPX 1KIAA 2KPOA 4F12A 4HT3B 3GRFA 3ILYA 2VP6A 3IB6A 3W5DA 2V6GA 1G41A 4I9UA 4JR2A 4U0KA 3T7CA 2ZT8A 2ZZKA 4I4CA 1R0WA 1JEAA 1CUGA 3KHSA 5AVKA 3I9KA 2R8ZA 3WWPA 3ETEA 4L1KA 3C6QA 1U0JA 5AOCA 4FCWA 2GN1A 4IR7A 1T4DA 1FTNA 3TNJA 1NPTO 5U1PA 1W75A 2JVKA 3IFSA 1P7PA 1RLUA 5A7GA 3SBDA 1FSFA 1GGJA 2XNHA 1D6NA 1D07A 4PANA 1CJSA 4ALJA 3R6GA 1U1CA 1N0UA 1K08A 3JWEA 3MWGA 2QI9F 1IM5A 3DBRA 1TU3A 4QUGA 2GA8A 4F71A 2VHJA 3C3YA 4YCDA 2BKAA 1LS6A 4BLTA 3LWDA 2R65A 3ONVA 1E2BA 1LBSA 1JRLA 4GDMA 1SXJB 1H1LB 3OJXA 2FR0A 3C45A 3G8CA 4EJ2A 2VXCA 5FRDA 1U9JA 2ZDQA 3UJNA 3KC2A 3V1LA 4J0JA 2WB2A 3QEOA 1LPBB 1XDSA 3VNAA 1Y3BE 4CKEB 3NUZA 2HFJA 5A2GA 2B5OA 4P4GA 4RHYA 1Z5ZA 5JH7B 1X7ZB 4OKNA 1OFIA 4PF1A 1YTLA 2NQ8A 1LDYA 2OMEA 1RI2A 2HRRA 2KLHA 2PGLA 4QEDA 2VS1A 4M60A 5FPTA 5I48A 1U6KA 2DT5A 2FSHA 4EPWA 2ZB4A 1Z0SA 5DHTA 3ILVA 5DYWA 1R6VA 4OMUA 1SUEA 1V7QA 4DG8A 5LWQA 3GLTA 4IHAA 1ZMBA 3SIPA 4JB0A 4YP9A 1Y63A 1VJDA 2SKCA 4HDMA 4B5KA 1HQDA 3DC2A 2PS9A 2WDPA 3I6ZA 1T4CB 1QYWA 3UCXA 5KOIA 5H7XA 3THWB 2O8DB 2BGRA 1OXVA 3BFJA 2VF5X 3EEYA 3O92A 4IYJA 3IKTA 1R8YA 4EY5A 1HEIA 3LDHA 2ZWPA 4AG6A 4ZHQF 2G25A 1XUOA 4Q82A 5K3DA 4UZFA 5TQ2B 1MABA 4V0KA 4DDVA 3QWHA 5HJEA 5ENZA 1FXWF 1UDXA 1C3OB 2EF0A 3E7PA 3LWZA 1TJPB 2F8LA 2ZYHA 3BIFA 3LLUA 5DXJA 3TPZA 4EIWA 4FKBA 1Y8QB 3GLVA 2WJ4A 2FJPA 4JI1B 2QNBA 2O8FA 4TKVB 1PCXA 3EVCA 3B82A 5DW0A 4CEHA 3ISJA 1KKUA 5JD5A 3BM5A 1NT4A 5MN5A 2YJNA 4GMDA 2H2FA 2HREA 4G9GA 4JOCA 4KKXB 2FLWA 2UAGA 2ZJ0A 3AIIA 4D3ZA 1IM8A 2PMBA 3QKRA 4Q1FA 3TJZA 5DYYA 3ZDYB 2C7PA 3NI2A 4RF5A 2OFWA 1P0IA 1GSAA 4ZCLA 5HA5A 3YASA 1FP4A 4IXWA 1L5QA 3ZU3A 2RGXA 1ZH2A 1YSCA 2RH5A 1IOVA 4J2TA 2ZPAA 4KE8A 5A4KA 2MSKA 3IEXA 2BMFA 1WCYA 3PNPA 3PNBA 1M2WA 4R1PA 4ONEA 2BAGA 4M7RA 1XXHB 2JCGA 4QVGA 5BWCA 1EJ0A 2MMCA 3JD3A 2FP3A 2EKBA 1J5XA 2ZYTX 5I9IA 1XPUA 1AZLA 1RC1A 3EVFA 3LUFA 4XUDA 3U56A 4QBKA 2VHUA 5HIMA 1NXSA 4LE0A 3WVNA 2PZJA 5G41A 2QY6A 3UCEA 3E5HA 3VFDA 2VH5R 2OKGA 1V4NA 1U28C 3IURA 3S40A 5CTAA 5C5IA 1FRFS 3NG1A 3DCNA 3EOBI 4WEOA 2V4MA 1J56A 2BGWA 3TIIA 2VRBA 1EUCB 2FQXA 2JD1A 8GPBA 4FHCA 2P4SA 2VF4X 3OZUA 2QD3A 4DZRA 5BUCA 4KMOA 4LWPA 5EEHA 1YJQA 1W34A 2FVYA 1UXOA 1RWPA 2IYYA 2OCXA 4IQ4A 2JCSA 1D1PA 2Y1EA 3G23A 4QQ8A 5ELMA 1JKIA 4H08A 3UYKA 1E4VA 2CT8A 1UUFA 3ZE6A 3I83A 4H0CA 2BFFB 2ZS7A 2NW6A 4IOLA 4NDAA 5CXXA 3U1BA 5IYZB 3ZGVA 1VLHA 2BEVB 5T67A 1EP2B 1LLFA 2VA9A 4B4WA 4L28A 1N5MA 3W8NA 4LXIA 2OV6A 3INTA 4Q3DA 1QTQA 1NXXA 3LI2A 4QOGA 2EHDA 3RS7A 3O8OB 2Q3LA 3FJYA 1NNLA 1O0SA 3KEQA 2VYVA 5I5GA 5JROA 1R8JA 4ZO7A 4N8EA 1YBAA 4X41A 1BWRA 1DBIA 3IR5A 1LF5A 3F7MA 2F67A 2XWBF 2X2OA 3LDAA 3NFRA 3N2EA 3ZD9A 1XMVA 4C6RA 2I33A 1R0XA 2HTEA 3CHYA 3UAXA 3PUIA 2OZEA 2GH1A 3DUFB 4L4RA 1QIKA 3GLGE 3O1LA 3K72B 4E5UA 1JXOA 2VNHA 1WG8A 3BCRA 3DEFA 1EVLA 4OQMA 5C7LO 2ZIXB 2O6LA 4IGIA 1ZZGA 3VNQA 5LMNB 2M9MA 2ZI9A 3B1XA 1D1TA 4P82A 4CE6A 1ZUIA 2OHGA 1AGYA 4BGEA 2DEUA 3IBCA 3L8GA 2E6UX 3TZBA 4PO1A 4PTLA 4Y9RA 1G3MA 2ZYRA 5DBFA 3VQTA 1SBHA 1RMYA 5L7TA 3PGA1 4FHGA 2ZEJA 3I42A 4GNRA 3VX4A 5I7OA 5KSWB 1PX0A 3AJ9A 1V35A 3F8WA 3ND6A 2R5FA 1NHGA 4F4HA 4E5SA 1BJRE 2RAVA 2NPOA 1SXJA 3T8YA 4CFZA 1H1LA 2HCRA 5ALIA 3RI3A 1RJWA 1GUBA 4BUZA 3BPSA 3TX2A 3HWX1 4PPFA 4I1IA 1H2AS 2MDTA 3AF2A 2YWEA 3EXFB 2JFVA 3GFQA 3L7IA 3OZTA 4OAPA 3WLJA 3TRFA 4BMOB 2R3SA 1M8KA 3F6YA 3NUQA 3OZEA 1UJNA 5KVSA 5JH7A 4M22A 3FKQA 2BMAA 5EXPA 1X7ZA 1W36D 4UMDA 2CVZA 4ZVKA 3EVEA 1Y3IA 4BV3A 3ZI4A 1T0HB 2FRDA 3TLMA 3AUUA 2O2JA 3VVLA 5BUQA 1KXJA 4PCAA 4TV9B 3NB0A 4D0GA 3UJHA 5HKBA 4JB2A 2P90A 2A35A 3ONWA 3VU9B 3WX0A 2UZIR 1QWSA 4Q7EA 4YAGA 2IS6A 4IMPA 3RVNA 1L0BA 3CNQS 4D3XA 1T4CA 4W9MC 2GAAA 5LD2C 2F43B 1D4OA 5CT9A 3THWA 1SD1A 2O8DA 5IX8A 2X42A 1KTVA 3F2IA 2CF6A 3SIRA 4WFIA 1P77A 9ABPA 4DANA 4G89A 1ZJWA 3BTUA 1KJYA 2A84A 2B99A 4LRUA 5K8CA 1GNPA 3GVIA 4QYIB 1EBBA 2X1HA 4HYQA 5I7RA 1E2IA 2ZYWX 1C3OA 1FFCA 3HKCA 3QLUC 3QIVA 2ZTLA 3W6OA 1IBKB 5JYBA 4HQLA 4YQEA 2O1XA 3SSAA 3OCXA 2FEKA 4TKVA 5K3FB 2ZXFA 1RAHA 4EHFA 2OC4A 2JIZD 2XB4A 2FZWA 2Y1OA 3BHMA 3MT0A 3OD1A 1PSWA 2O8VA 3O5AA 4OXQA 4BASA 2OPBA 1II8A 1X7YB 1B0ZA 2GZSA 2YRXA 2GZHA 3VYSB 4PE5B 1EUZA 2D0OB 2IVZA 4HNUA 2ZJ3A 3BKXA 3WBKA 1C1XB 3GROA 1LY1A 4MAFA 1LDEA 3ASVA 1D04A 3BB3A 4KQ2A 5THXA 4M88A 4IRMA 1OFGA 1C8LA 5J5VA 1JJVA 1H1DA 3HZRA 4CMKA 1YZVA 3H9EO 2B5VA 2ZWAA 1KBOA 1UXGA 4YRZA 3GX1A 2R00C 3IRUA 4Z4QA 2QLMA 4MUXA 3N2NA 4RV5A 4LHXA 4B3DA 3V6LA 1R0RE 2HJRA 2W2QA 3DZGA 4BO4A 2FOXA 4GXQA 3R9KA 1RP7A 1VG0B 4XSHA 3AHFA 4QOSA 4CQJA 1WDKA 3QOFA 3A6ZA 3I9NA 3JQ7B 2G9RA 3TXXA 5JSHA 3JRNA 3L06A 2OSVA 4U8HA 4IJUA 1I0LA 4LZLA 4BBJA 4U3JA 4W6ZA 4V0LA 1Z3IX 1KEWA 3AV3A 1NUPA 2GF9A 1LC0A 2P62A 3PVZA 4H7KA 5JAHA 1MJNA 4DM3A 4KDFA 3FPKA 4BTLA 1Y1LA 2BTQA 3B3AA 1C7RA 3LUHA 3LY5A 2XCIA 1J24A 3W34A 4B17A 3RRNA 1S0UA 4Q4DA 1QG0A 3G1UA 1R6XA 3JZDA 2D5AA 3KWLA 3R5FA 5LUBA 2BFFA 3J81A 1DEAA 1HTTA 5E7QA 2X58A 5IYZA 3IP5A 2BEVA 4GKJB 4AFNA 2JAOA 2AF3C 5GQSA 2VK8A 3ANLA 4A03A 1H05A 1RYBA 2XLBA 3S29A 3FNBA 1X42A 3DDZX 2FN7A 3E9YA 3RUFA 3STTA 2AXQA 5TXGA 3R9WA 3RS4A 1SG9A 4I1OA 3ZIDA 2P2CA 1NBME 1NLMA 2FKNA 3L5OA 1LI7A 3O8OA 3QYPA 4OIFA 2ZYAA 2IELA 3KYIB 3QGMA 5KKAA 1Y7HA 4MVCA 2IWRA 1JU3A 5DTJA 3PFBA 3KVNA 5TPZD 3PEWA 2OZLB 4KAJA 4F4DA 4UMEA 4KXQA 4LF8B 1K6IA 3EJ6A 3H9BA 3NHWA 3PHBE 4TS4A 1Z35A 3OC6A 4YJFB 3TTTA 3QF7A 1YJCA 3QOYA 4W8OA 3BMNB 2WJIA 3ANMA 1GZ4A 3DUFA 1NR7A 1W5SA 1IWBB 3PLRA 2OXTA 3SQMA 2JDIA 4YRTA 3A11A 3B85A 2ZIXA 4Y1GA 4OATA 4QQFA 2PMFA 1HQYE 1PV1A 4QPNA 3GT4A 4ZVLA 4F6LA 1QTRA 3ICVA 5DIZA 2MSDB 3VBCA 3D8NA 1GPH1 4FT2A 5A4FS 4GI1A 4Q4HA 5FI3A 2P7HA 2NU8A 3SC6A 1CS0B 3TLJA 2E5FA 3UA3A 4YCMA 1R64A 4PY2A 4Y0NA 2OFPA 1IOZA 2WWRA 4I9NA 4S1VA 4PFKA 2DGDA 2FX3A 5J5AA 4WLFA 3UWDA 4EI7A 5GJWC 4QXMA 4O1IA 5SYNA 3L18A 4G8BA 5CXQA 4R3NA 4ZT3A 5FNVF 4B40A 4CL8A 4ENTA 1IIRA 3UYLA 4CMEA 2AR0A 3REGA 2D5IA 1PGJA 2FSVA 2Q4EA 2UYCA 3H13A 4FDTA 4CUZA 2GO7A 2NUAB 3TL3A 4BNIA 1OB2A 4C7XA 1L5HA 4BU1A 4GM0A 5ITZB 2E4ZA 3I9OA 1LFDB 2HHJA 1IH8A 3RG8A 1M0WA 4I08A 1PWXA 2CNNA 2Q49A 4JWKA 2VZ0A 4QU8A 4CGZA 2DP4E 4TUYB 2ZRGA 1KO1A 4TV9A 4WBNF 3EW7A 4TTSA 4L8GA 3Q7RA 3UMBA 3VHRA 1NDHA 4NYMQ 4L5IA 5J59A 3RS5A 2I6XA 2K4MA 5IKOA 1GQOA 2K87A 2JAUA 3AM3A 2F43A 3MMZA 4ZCMA 2W6JD 3F8TA 1CQPA 2ORYA 2OZPA 4D9FA 2XCRB 5E3JA 1JB1A 1W88B 2J0UB 3GI1A 2P41A 4HXGA 5EMHA 2Q2OA 1LWOA 5FWXA 3VH3A 5AVZA 4IOJA 4OP3A 1R10A 3V4PB 1P7VA 2WT9A 3BJEA 1G1AA 3PWTA 4QYIA 4BNWA 1YKGA 5K05A 1P80A 1AQYA 4UULA 3QA9A 4QNMA 3PYXA 2VQFB 2CD7A 1F2VA 2V6FA 2YVLA 4I2NA 2ZB3A 1XELA 2AVNA 4G0MA 4DC9A 4ZDIA 2IXDA 2ECPA 3BMQB 2AG1A 3DB2A 1C0LA 1XEWY 4U6NA 1HV8A 1RE0A 1VG1A 2FFQA 4XRRA 3ZNQA 2PUGA 4IQ0A 2UZ1B 5JOQA 4PAQA 4UHJA 3O2QB 3FM9A 4TRNA 4K28A 1C7QA 1ESNA 2QTFA 2V3VA 3DZIA 4F04A 1HOTA 4KPUB 1XHEA 2I7DA 1BVUA 1L1RA 5TRTA 3AB3A 3R2JA 3M83A 4RX1A 1Q92A 4WQMA 4F2PA 1QYXA 5BRAA 5T4EA 4EPXA 1T5DX 1PLKA 2HC9A 3HBFA 4UU0A 4EBBA 1IVYA 4F2GA 1LBQA 3IP7A 3R5SA 3W6ZA 1X1DA 2HA7A 3FH0A 5KQRA 2BP7B 4I55B 4J0QA 4BFVA 4DQ0A 3E7DA 3DV2A 1M76A 2BGUA 3PGVA 4LZPA 1EE1A 2F90A 4WK6A 1Y8CA 3TD6A 4BNXA 4TRMA 4CFYA 1H0HA 1N92A 3L6UA 5EYPA 2ZUSA 1NW3A 5DM4A 1XJ5A 5EHXA 2P67A 2ZBPA 2JA2A 1TU4A 2HV9A 1S4MA 5KNBD 3EGXB 3CX4A 4MRVA 4YR7A 3DDCA 4INZA 5FQOA 2VJMB 5HUQA 1ORHA 2CDNA 4GEKA 1H6AA 2EFGA 4L08A 4BC1A 1XYGA 2XZOA 2XAUA 4UVEA 3RRZA 3V8VA 3JTMA 4IJVA 2VDVE 4K6GA 2VA8A 4KQXA 4Y30A 4QT4A 2EC5A 1EFVB 1PZFA 4X3CA 4K7JA 3DSRA 2F9FA 1WUJS 5IAJA 3KFLA 4BO6A 3T9CA 5B58C 3HJTA 4UQPA 3H6KA 1K89A 5FAKA 2IP4A 1OWMA 1Z36A 5CJPA 4CWAA 3CE6A 1ZOPA 4GKAA 4DB2A 1BU8A 1Q0SA 2GHTA 1VLMA 4CTKA 2IC5A 5EUCA 4K03A 2PT9A 3PFHA 3D31A 3ZC3A 2ZI4A 1W4RA 5F2EA 5HE8A 1L5SA 3WL5A 3CMCO 3ICCA 1GTRA 1TYCA 2QE7A 4N12A 4NBWA 1DADA 4YQYA 3RC2A 4BNLA 1VL1A 2YYYA 4EJSB 5KNBH 1XD2B 3PRKE 4JQOA 2JA1A 1I7NA 1Y4SA 2OZLA 5H9WA 5JR3A 1R6TA 5B7GA 5CXSA 1XPJA 3T94A 1EGAA 2Z56A 5DNEA 4TKUB 5ELLA 1OAKA 2A86A 4FE7A 2RHWA 2E49A 3BMNA 4B8ZA 1JYFA 1UPCA 4I4TB 2WVHA 3K6JA 4GP9A 4RFVA 1ONPA 2QN3A 4IH1A 1K2WA 3OO0A 1Z29A 2GPTA 1IZ0A 1R9JA 1ICEA 1THZA 1ZIDA 3EHDA 5IDQA 2GAIA 1P17A 2MIIA 2CW5A 4AI6A 2IYOA 3JCZA 3TQIA 2HMSA 2ZRDA 4ZRDA 4M38A 4H1VA 5AUPB 3JQRA 3C8DA 3UY4A 5KO2A 4B3BA 4KE7A 3A6FA 1H8HD 3P9RA 4Y6SA 1CBUA 5EZQA 3WAJA 2E18A 3O9ZA 1FX0B 1CS0A 2JI8A 3NORA 1EP3B 1YDFA 2ETVA 1GARA 2DTXA 2ERYA 3OM1A 3H5OA 5CNKA 2IW3A 4MW6A 1GITA 2PKQP 3VR2D 3GGJA 1U1IA 1KMHB 2XKBA 1CPYA 3IC5A 3MT7A 4WNCA 1SHUX 2I03A 5DHFA 2E4UA 3QKSB 4OKSA 3VZRA 2UYYA 2ORED 2C0PA 2XUJA 4O0MA 4MVJA 1SUSA 3CTPA 4YA6A 1ESMA 1I6LA 5LQNA 1H4TA 2NUAA 1V6SA 4YJKA 3V3KA 4OVKA 2GLUA 5IT4A 4IDCA 1DUSA 4PFQA 4XX1A 3O8QB 3WS7A 4JLPA 1UFVA 4MI1A 4MRAA 1Y8ZA 1B8PA 1RWVA 4OK5A 1C9DB 3SC2B 1JFRA 4U39A 3HDGA 3QF4A 3ESRA 4A0GA 2O8CA 1IPFA 2WUEA 2DWCA 4AJNA 3DMHA 4KLCA 5BN3B 3OTGA 3A6PC 3S2YA 4QHTA 1ZA2A 1PFVA 4TTPA 2YDXA 4KGVA 4OF4A 1RZRA 3PI6A 2Z1NA 3WKCA 1YU6A 2QY9A 2EJBA 2XJ4A 3BK7A 3FCAA 3KZMA 4FK8A 1GG5A 4HAWA 5IMSA 1Z28A 4EG4A 5DULA 4RTOA 2J0UA 4UDNA 3GWGA 5EQTA 1X1AA 3L7LA 3B5IA 3UAYA 3K94A 6NULA 4DF3A 3R6TA 1R9MA 3DP9A 1U4OA 5CVJA 4TV8F 1KH3A 3LK7A 3QPWA 2XOEA 4PO3X 3QEBZ 4IDDA 4EENA 1EXNA 5JC8A 3IPCA 1FJ2A 1OBVA 2EP5A 4OM7A 1RADA 3H6GA 1P1RA 2XMDA 5DNDA 2AUNA 4XI9A 1B93A 4ARSA 2UUBB 3VJRA 4JYBA 2XMZA 5L40A 2UZ1A 4UTNA 3ZQ6A 1Z6ZA 2FMFA 2YVUA 4WA8A 3TQCA 3RAPR 1Z22A 3F7TA 1WSAA 2H85A 4KPUA 5EVCA 1MC1A 1IC6A 4EB3A 2I9KA 1IY2A 4Q1VA 4WINA 3F9CA 5ITVA 2X9QA 2XHZA 4J0DA 1MPTA 1KPIA 1KY3A 1TYZA 3RGWS 1IIBA 3Q0IA 4NFSA 2WF7A 4FGLA 3CEMA 1YWGO 3EXG2 3W1EA 1Z2PX 1N6RA 3MVEA 1PRYA 1Q7EA 2BP7A 2C7VA 1KEUA 4I55A 1Z4JA 2B7CA 1PR0A 3AKYA 4HDRB 5IAKA 5AM5A 3OY2A 2YBEA 1YQDA 3QMWA 1F7UA 4CQMA 3DH0A 2CXHA 2F3UA 2C98A 3HN6A 4HGYA 4L0DA 4UAGA 3UQYS 1V6CA 1SIWA 3UB3A 1U0TA 4BYGA 5ALVA 1E1MA 5COQA 2JGNA 2MSEB 3PQDA 4GAEA 1M66A 3FKJA 2VJMA 3RTEA 1XEFA 4K0KB 3OZIA 1NYTA 2Y76A 3PXEA 4I50F 4DLRA 1NVBA 4N82A 1NJFA 4JP8A 4LTMA 1Q20A 1U0SY 2P9ZA 3E22B 3GDOA 4NL4H 1EFVA 5E3HA 3JD0A 2X9GA 2G9ZA 1NASA 4PVCA 4DJTA 3N0XA 2JJ1D 3KWMA 3NVMB 4PIVA 3ESCA 1YDGA 3QHQA 2OVBA 4MV0A 2QF7A 4X1YB 1VE3A 2BR5A 4KL8S 2BI4A 4ZV9A 3AM5A 4D9HA 1DO8A 3MWDB 1XN1A 4K5QA 4FYYA 1M8FA 2QM7A 3UOAB 5HF9A 2A0WA 2C9YA 1RFGE 3OFND 4YAFA 5DI9A 2XMSA 1Z4NA 4K9MA 1BKDR 3HI4A 2J41A 1E2UA 3MIZA 2C7RA 5CVVA 1SVKA 1GUAA 1Z88A 3OPVA 2PH5A 4AG5A 1W2HA 1G5FA 2QUJA 5C3UA 4I3FA 4C7KA 1TLFA 2DUJA 1QKKA 2P3SA 4P7FA 4ZQIA 4MV8A 1L5ZA 3OA0A 4JROA 2VHVA 1EXWA 3PNSA 5DM1A 4BBZA 4QODA 4DFDA 5AKLA 4CT5A 5CX1A 721PA 1ORWA 1PZMA 1SELA 3QW2A 2IIBA 1K7XB 4N5IX 4Q9JA 3A6KA 3RD5A 4EKDA 1FFXB 5GV8A 2CLDX 4DCMA 2P79A 1WDLA 1C3LA 4GKKB 2Z8YM 4JJ6A