3B2EA

Crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
349
structure length
307
Chain Sequence
LTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDLADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Get1 stabilizes an open dimer conformation of get3 ATPase by binding two distinct interfaces
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 95
structure length 307
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b2eA00
4HLDA 2J46A 1P4SA 1KI8A 2VHTA 5HZHA 3AVYA 2F9LA 2GESA 4I1SA 4TN1A 4RD0A 2MSEB 4BEJA 1W36D 4KBGA 1N6KA 5BW8A 1CF4A 5E7JA 5FH9A 2ZJYA 3U4QA 1Z0JA 2YWHA 3TSOA 3K0FA 2VEDA 4Z51A 4NBSA 1S96A 2P6UA 2JEOA 3PFIA 4EFNA 3BORA 3EX7C 3Q72A 1ZRHA 3HR8A 1JAHA 2WWHA 2YZ2A 4Q4HB 4C7OB 2CL0X 3A1TA 3MWLA 1JQJC 4FCWA 3PXGA 4BLPA 2MMCA 1G5RA 4TSFA 4UJ5A 4JL8A 3R9WA 4TQ9A 3QXCA 4V0OA 4JIMA 2ZRFA 2B7BA 1WDTA 3EZ9A 3ZVLA 3PIRA 1HH4A 3N2EA 3QUSA 1R5NA 2AN9A 3OAAA 4D4JA 5JSZA 1UKZA 2OAQ1 5F98A 3RABA 1ZM2A 1ZD1A 2JJ2A 3FOZA 3MUFA 3TSWA 1Z47A 4LWZA 4LJAA 3S1AA 1OT3A 2WAXA 4AC9A 5DYIA 5JEEA 3SR0A 4OL0A 3EIEA 4PQYA 3IIMA 5KDOA 4WVFA 1H65A 2O8EB 4CEIB 2NPIA 3DL0A 5DI9A 2ZI3A 4FIDA 4CDGA 4QFMA 1XPOA 1YR9A 1FTSA 4A15A 2CCKA 5FL7D 2GXQA 2C9YA 4TMWA 1E99A 3QF7A 5KDLA 5HCIA 4JLKA 4AYTA 3CRVA 1HQCA 3Q3JB 3K53A 4MGKR 1NN0A 5J40A 3ZD7A 1KOFA 4I4LA 3GJ4A 4IVRA 4FCVA 2J0UA 4FN5A 1IN8A 2P5TB 2D7CA 2WWGA 2ZSEA 2JAQA 3CH4B 3OIYA 2C78A 2QAGC 2CXXA 4PHHA 1IN6A 3CPJB 3VQTA 4RFSA 2FE4A 1E2IA 3WYAA 5E4FA 5GJCA 1PVOA 3C5CA 4I1UA 3RVBA 4O2LA 4TT3D 2G6BA 5E7IA 2OBNA 3EPHA 1XBTA 2Z4RA 1WE2A 121PA 4PSAA 1YE8A 3U7HB 2ASEA 1N0VC 3FMIA 2FOLA 2IUTA 1XEWX 3TUJC 3C4JA 3C7KA 821PA 3ASZA 3LXRA 1KJYA 1T3HA 2YWEA 2HF9A 1GKUB 2BC9A 3LWNA 2ZI9A 1R0YA 4DT1B 2GDJA 1E0AA 1M7BA 2O8FB 4E22A 4Q1DA 1IN5A 2RGGA 2BM0A 5JJKA 1VG0B 1NVUQ 4JJZA 4OJQA 3FVQA 4HATA 3T1VA 1GKIA 3AP3A 1E2FA 2Q3MA 1Z5ZA 1F2TB 2A5DA 1R8SA 4BLQA 3R7WA 1NG9A 4M53A 4TMXA 3NXSA 3SHWA 2IHYA 5J5CA 1UF9A 2WWYA 2ZJ5A 4PXAA 2VO1A 1A82A 4ZCIA 2IWHA 4NYIR 1HT2E 1Z0IA 1OKKA 2DCUA 2HLDA 1KO7A 3HU1A 3L2OB 3DMDA 4JJKA 1EFRD 4IFBA 3J81k 1UKEA 1XEFA 4Q48A 4YDHB 3W5JA 4DDVA 2UVQA 1E2NA 4OK6A 3MJRA 2G3YA 4DEYA 4RJLA 1GOTA 1UKVY 1X8JA 1BMFA 3QPWA 4Q02A 4IDQA 2QMOA 1OXSC 2IA5A 5AJWA 2W58A 4B33A 2X2EA 4XWAA 4RFVA 4YQFA 3DM9B 2F55A 4Q4LA 1FNMA 3UATA 1Z07A 3FB4A 1A7JA 1XTRA 3MWJA 1KSHA 3FMFA 4FCTA 3A4LA 4JLDA 1ZNZA 4YMVA 2CVHA 2R8RA 2BJVA 5EP3A 1VHLA 4Q01A 1XX6A 3KTAB 2J87A 1E2PA 4W5HA 1FMLA 1UDWA 1KI3A 2OFWA 1PLKA 5JMTA 1GZSA 1OHHD 5SZKB 5G41A 1GRQA 2OESA 4C0SA 2QGNA 5AUOB 3FHCB 4IDOA 2RGNC 2A7QA 3IQWA 2IF0A 3KB1A 3AP2A 3B1XA 1W5SA 4IOLA 4HLCA 1PLJA 1U8ZA 1UEJA 3GMTA 1Y63A 3KUDA 1GSIA 1X1RA 1IN4A 4OBEA 4UKDA 1NMZA 1QHHB 2J59A 3I3SR 2C99A 2V3CC 4A0RA 4Q4AA 2WWFA 3A37A 2C77A 3THXB 5G3ZA 2W6JD 3KZ1E 4X8MA 2ZR0A 1JR3A 2OXCA 3O8BA 5DN6D 4ZDWA 1D2MA 2Z4SA 3AGPA 3X1XA 5GADl 3MCAA 3PEWA 1BKDR 3B1VA 2VP9A 1G5PA 1COWD 2D3WA 2GZDA 2AHOA 1XJQA 5HKKA 2QROA 5IT5A 4Q9HA 4FMCB 1PUJA 4LYHA 4DSOA 1JAIA 4CT5A 2WSSD 1E0SA 2CCGA 1VG8A 3A1UA 4P4TA 4C0QC 5EJEA 1WRBA 3VKGA 1GKYA 1KDTA 4PR0A 1CJMA 1NY6A 4DLXA 3EA0A 4CEHB 4HAWA 2ZXUA 2YVUA 3EXAA 2VP2A 1E9BA 3QNUA 3UIEA 5FOTA 1XZPA 3LVRE 5DO9A 5FOWA 2DB3A 1XP8A 4DCUA 3A1SA 2ZS7A 2QQ0A 4EPRA 2O8DB 2QEQA 4D25A 2ZM5A 2XSZA 3UMRA 1O87A 1W0KA 221PA 1Z2CA 2P3SA 1DAFA 1S8FA 2BWJA 3AUYA 1GNPA 4LCBA 5F9HA 4ZCMA 1E2MA 2BIFA 3IBYA 2RMKA 1ZMXA 3DDCA 4DC9A 1QZXA 3UMSA 3IIJA 1AM4D 4EUNA 4LV5B 1X3SA 2WHXA 4GMXA 4NCHA 2D2EA 1ZC3A 4NYJR 4LGMA 1AKYA 1KMQA 3D3QA 2EFCB 4OI1A 3TGPA 4O3MA 2XB4A 2OE2A 1CULC 1EFTA 2WJGA 1DG3A 2ZIAA 3A8TA 4MUBA 1MABB 1KI1A 2V7QA 1NRJB 1YRAA 3ICEA 1P6XA 3GCGA 2QSYA 2O0JA 1W2GA 4WA7A 4R7ZA 4EDHA 1N2CE 3DZ8A 3AVWA 3I5YA 2A9KA 3RS2A 3BD9A 2GCOA 1XTSA 1NSTA 2YC2C 3IKJA 1G5TA 1EG7A 2O52A 2XZLA 1DAIA 1YZKA 4URVR 2WM9B 2ZITA 5FBVB 2ZRMA 1DAHA 3F0TA 3Q5DA 5KNCA 3K0AB 2VLIA 2QM7A 4QHYA 3NEJA 1F60A 5AJVB 1OF1A 4WAUA 1M2OB 3Q7PA 2YYZA 1LF5A 2H8KA 1U0JA 4TL8A 3GJ8A 4KLZA 1F2UA 3OFNA 4L8GA 3TR5A 1TQ4A 3BERA 4PZLA 1U8AA 1X8LA 2AKAB 2QUZA 2ZYUX 3GEIA 1CBUA 2GWHA 1S9HA 4QM7A 5FUXA 2ZJ8A 5BN4A 3REGA 1OJLA 1V43A 2IYTA 1KK0A 1BYIA 4D80A 3K70C 1J99A 3QPUA 5K8UA 2CHVA 3FKQA 2Q21A 2NO6A 2W6ID 5DNYB 2JLQA 3A4MA 4E03A 1HE8B 1XD2B 3AF1A 4NYMQ 1OXUA 2CJWA 2BMEA 2VA8A 5KPJA 2RGEA 3PCRB 3T12A 3I62A 4A8JC 4PO1A 3QKSB 5SZJA 5KTYA 4KFTA 3BFVA 4NCJA 1GRRA 5B58C 3DO6A 1CLUA 3TVTA 5FI1B 3GJ3A 5HTKA 2BCJQ 1VCIA 4Q1CA 4YMSA 5FOUA 5FPHA 2ZREA 5DLQC 2JJ1D 2NIPA 4B35A 1B0UA 1II8A 2AFHE 3RRMA 1UBGA 4HDOB 2I3BA 1HT1E 3BE4A 1W4AA 4MRVA 3TJZA 4BLTA 3TKLA 2QL6A 3GLHA 3K8YA 4C9BA 4ESVA 3K9HA 2QAGB 3MFYA 3B85A 3T5DA 5LPNA 3IUYA 4AKGA 1GUAA 1E98A 2GCNA 4JLBA 2F1HA 3C16C 2ECKA 3B5JA 2VP6A 4EIWA 4M0LA 3CUEF 1NIJA 3LQRA 1KIMA 3G0HA 3CRRA 1RRCA 2GVZC 1Q12A 1U99A 5B64A 3LLUA 1E1QA 2ZRHA 2VSXA 4A6XA 4ZI3A 2XTNA 1DVRA 2H5EA 3HU3A 2XNDA 2QY9A 1MT0A 2R6AA 2VQSA 2FWRA 2FDCA 1DPFA 1XEWY 2IXFA 4DLZA 2J5XA 4QJ4A 3QPVA 2XB2A 1P75A 2ZI5A 1CR1A 4AKHA 1G16A 4QNRA 2O0KA 4WXPA 3KFXA 2ZRNA 2ZJZA 3AF4A 1MOZA 3NBXX 2DPXA 4YDSA 4BLRA 1U8YA 4BLSA 3O8DA 1JXMA 1YZTA 4URXR 1V5WA 2ORIA 2JLUA 2ZU0C 4M1TA 3FDIA 3AP1A 2C8VA 2EFEB 2FPKA 1W46A 2WMOB 3QG1A 1WF3A 1R5OA 2NO1A 4CEJA 2V9PA 1JPNA 4JBXA 5BWMA 3KKPA 4HDCA 2OM2A 4M2LA 3KXKA 4FI3C 1R5BA 2ZE5A 4LY6A 1XXHB 4CW7A 2CLCX 4QJ5A 4PANA 2O8BB 2C03A 4C3ZA 1NVVR 2CNWD 5AJXA 2QBYB 4ZKEA 5AJYA 2FSHA 1B23P 3CWZA 1WQ1R 3I1FA 3IEUA 5FBWB 3P4XA 2V6JA 3T15A 1RYFA 3I92A 1Z6GA 2WJJA 4IKEA 1SXJA 3B1WA 1P72A 1TPZA 2FG5A 2WIAA 2IHBA 3VNUA 2P2LA 4P4SB 2G88A 2XITA 2NPFA 4G3XA 3SHFA 1YQTA 1T0JB 1XRJA 2F3TA 1IXZA 2G1KA 2OV2A 2WICA 4NDZA 4TYQA 1S2MA 2R44A 1FX0B 5KNDA 3BGWA 4JMPA 5C4GB 2AXNA 3EPLA 1PLLA 2JIZD 4DDWA 5C2JB 4JLNA 2KE5A 2JLVA 4PPFA 1T8UA 5TARA 1QDEA 3X1WA 1E94E 3CRQA 3GEHA 4LYJA 2DFKB 2QRZA 5AUPB 1E0KA 1GFIA 4BFXA 1MO4A 1AGPA 4Q19A 4TTRA 3TE6A 5HZKA 3JZMA 3HWSA 2P6RA 3BBPA 3VKWA 1ZNXA 4ZI2A 3OE7D 1UBEA 3CZQA 4HB3A 4Q1EA 3ZIAD 4F7WA 1QF9A 4F92B 1QVAA 2J7PA 2Z0MA 3TUIC 5K8LA 2FU5C 3WRXC 3ZZUA 4PC3A 1M7HA 2PZEA 4XTRA 1J8YF 3THWA 1PJRA 4MYTA 4LV6A 2ORVA 2XOKA 1NMYA 2JLYA 3B60A 1RJ9B 1S4QA 1NP6A 3OEHA 1CXZA 2NQ2C 4TLEA 4MKIA 3GLGE 1XMJA 4BWYA 4IJMA 4RD6A 1MRSA 2W0SA 2ZSDA 4MYHA 1EX6A 4DCSA 2C9OA 4YMTA 2P67A 4B34A 4XWKA 2GF9A 4QC2A 2HCJB 4X8LA 3U4QB 5JCZA 2X77A 5FUVA 4M1OA 5LB4A 4NE2A 3HDTA 1ELOA 1R0XA 5LDDC 4NP6A 4IOJA 4TLBA 3RC8A 1WCV1 4IDPA 4PSKA 4XTCS 1I4DD 5CDFA 2EYQA 1JECA 2B8TA 4W9MC 4XJXA 2BOVA 4DLRA 1WBDA 2IEYA 4A1FA 1Z29A 4POAA 2UZIR 1NNEA 4TYYA 1KK1A 4QBIA 2ZJOA 3AVQA 5K8TA 4TL6A 2CK3D 2YHSA 1KSJA 5TB5A 3A58B 4O25A 2FA9A 4MQBA 1TUEA 2YC4C 3KKMA 3S1AB 4ITRC 1A2BA 4LJ8A 4LSGA 3GP8A 5JWHA 2A5FA 2ZE6A 3IPXA 3KKOA 4ZKDA 1KZGB 2IWRA 3KQNA 1PV4A 2FNAA 1KJZA 2XJ4A 2FV8A 2V1UA 1W48A 521PA 2WJIA 2H7VA 1IQPA 4GFDA 3K0CA 3BH6A 2AX4A 3GLIA 3O47A 4JSYA 1DO0A 2KWIA 3I8XA 2FSIA 2IYUA 2BMFA 2QN6A 4UNNA 4Z8YA 3UMFA 2ZYTX 3NBZC 4YMUA 3NEYA 4A9AA 1KO4A 3SJBA 2DFLA 1NBMA 3ZD6A 4NZYA 4BGDA 1XD9A 4XD7A 2N46A 2R2AA 4GOJA 2FGJA 3I72A 3IO3A 3Q8XB 5TVKA 1JNYA 2GBLA 1KKLA 1NN3A 2J0UB 4RD3A 1PZNA 1KAOA 2OO7A 2ZR9A 4H1VA 5FL7A 3PUXA 3PITA 1ZYUA 5CITA 2TMKA 2PJRA 4X8HA 3LW8A 1E9DA 4NMMA 4KODA 5EXPA 4TYWA 1GNQA 2MSCB 1W47A 1XDBA 1R0WA 4PAQA 1KYIA 1P2UA 1GL9B 1XB2A 2H1LA 3CLVA 4QKQA 2IS1A 4N3NA 1AQUA 1TAGA 4QHTA 3WP0A 3AVTA 1GIAA 1GAJA 2WVJA 1OFHA 3GLFE 1P3JA 4TT3A 2BMDA 4JT4A 1CJTC 4ZIRB 5E95A 5J47A 2NZJA 1GVNB 3EC2A 1W5TA 4NYIQ 2G9NA 4F93B 1QHSA 2Z5FA 2EFHB 3IGFA 2RGBA 5KOYA 2J45A 2ZRAA 4AYXA 4PSVA 4RZUA 4EPYA 4A36A 2JLRA 3RC3A 421PA 1OIWA 3W6PA 4RKFA 1L7VC 2ODEA 3UWOA 2Q3FA 4KI0A 2WOOA 4LHYA 1HTWA 3C15C 1JJ7A 3GLFB 4PC1A 4KV9A 5JI3E 3SQWA 2WJVA 4B3CA 1DBSA 3VR4A 1J7KA 1XWIA 2WWXA 3K70B 1SVIA 2FJUA 3FKSD 1UAAA 5FPKA 1YZUA 4AURA 3ICQB 1R2QA 4DB2A 1RRGA 4KLNA 4E5UA 4DLWA 4QJ3A 1KI7A 1G18A 3AQ4A 1TL7C 3NTUA 1IAQA 4LHXA 2I1QA 1WA5A 2A2ZA 1CJUC 3BB1A 1T3LA 3PV0A 3NKVA 4OJKA 1P9RA 1EWQA 3CZPA 3UG7A 1UM8A 1E9FA 4L9WA 4EFMA 1T0HB 4BE7B 2BBOA 1GITA 1XU4A 1S1CA 2IXEA 2PJZA 1R8QA 4A8JB 3QEOA 3GEEA 1EFRA 3QXJA 5CB8A 3QY0A 5DHAA 3SYNA 5JHGB 4II7A 1XNJA 3DMNA 1P9WA 5EP2A 3UANA 2JLZA 2PL3A 2ZJAA 4MRRA 4E09A 1YR8A 1NJFA 3Q5EA 3TR0A 2D7DA 1E1RD 1TX4B 3U5ZB 2C2HA 4KSBA 1QHYA 4TMKA 2R62A 4UXJA 1L4YA 4CF7A 1E4VA 621PA 4A0FA 4RY2A 4LJ6A 5M04A 1G7TA 2GEUA 5EP4A 3FHOA 1KNQA 1TQ6A 2GXAA 3A36A 3GLGA 4NKRA 4LBVA 2FF7A 1J90A 1W4CA 3QKRA 1JJVA 4EKDA 1RZ3A 2OG2A 4NONA 3ZVNA 3LH5A 4RZ2A 2CLSA 3DZDA 5EE3A 5FPYA 3W9YA 1OHHA 5KDDA 1T4GA 4G5GA 1QHIA 4HEJA 2RHDA 2NMVA 1IN7A 1P9NA 2ZJBA 4OHZA 3TNFA 4D81A 2ZRCA 4DCVA 1KDOA 3G82C 1VECA 1ZUHA 4BFTA 2IXGA 1R6BX 2JLSA 4Q21A 5EE1A 4GL2A 2D4HA 1KY3A 4TYNA 1U90A 1US8A 2B21A 3BIFA 4WXRA 4KBFA 1FUKA 4PPQA 5SZHB 2VIIA 4MRPA 5L3SA 2W6JA 3P1JA 5H68A 1E9CA 2ZTSA 4L9SA 3UPUA 4DLTA 1XCGB 1EFHA 5DN6A 2IT1A 4M1YA 2IW3A 2ZR7A 2NO0A 4D6PA 2J7KA 1AS2A 1OXVA 4BFWA 4JLPA 2HJGA 1KI4A 5C4MA 1GDDA 2VSFA 5EE5B 2OCAA 3Q85A 1SULA 1VDZA 2AFIE 2WSSA 1G41A 2GJKA 2G83A 4AG6A 1HYQA 4MKHA 1FPMA 1W7AA 1XTQA 1CR2A 2BCGY 2QP4A 1Q44A 2OZEA 4LPSA 1VPLA 1D6JA 1P62B 3AF2A 4A2QA 1FOEB 1NN5A 4B3FX 4LJYA 2RGXA 4Q03A 4CT4B 4AKIA 3RS4A 3LFUA 2WOJA 2PMKA 1GILA 2GAOA 2WAYA 2WJHA 2QORA 1DAKA 1SQ5A 5JJLA 2VHQA 4V03A 1AS0A 1AIPA 2N1BA 4PPNA 2ZRIA 4HDQB 4B44A 5IF9A 4KFUA 2CL7X 3BC1A 4QBFA 1KO8A 1DE0A 1X6VA 4MGZR 4K46A 2VBCA 4TZ0A 2PMDA 2WV9A 5DSZA 2R6CA 2ZEJA 4RCYA 2GBLC 1D2EA 4XWOA 3H86A 3M1IA 4F91B 1EXMA 1Z2AA 2GJAA 3OHMA 4N0DA 2QG6A 3R9IA 2IK8A 2YWGA 1CR0A 2Z6VA 721PA 2FFQA 4MGYR 2VSOA 5EUQB 1L2TA 3WHKA 3PUYA 2WKRA 1CKEA 4ZV4A 1E79D 1E0JA 1U98A 1ZM7A 1ZUNB 4OHXA 1KSGA 1HURA 4OQFA 4C0LA 1LF0A 4FMDF 3SJAA 2YOGA 3MMPA 2O8CA 4GT1A 4IXMA 3NHAA 2R6DA 1UBCA 4A4DA 1G3QA 4Y0AA 1GM5A 1AA9A 1E2KA 4WZAE 4Q00A 1F48A 3O8CA 2LWIA 1E3MA 1D2NA 3EARA 3IHLA 4DWJA 3FHTA 1OIXA 2GZHA 1IHUA 4WW0A 3R9XA 2E9SA 4XSGA 1Q3HA 2XXAA 2C9CA 2QPTA 5A5GA 2EFDB 3VX4A 2QPOA 1BO6A 1F2UB 4HZUA 5HCNA 1ANKA 1MO3A 3JZAA 1SKYE 1G4AE 3FGNA 3MLEA 1KMHA 5KO2A 4AK9A 5AUNB 1DOAA 2GCPA 1E2EA 3BAFA 4KJZA 3C8UA 1EX7A 2GETA 1E2GA 4JVSB 4DHEA 2BM1A 3EC1A 4BFZA 1NIPA 4RZXA 2A5JA 2DWPA 4HLUA 3KJIA 4BPBA 3T1TA 3DKPA 3MG9A 4Q4JA 5FOSA 4ASUA 3QF4B 4TL7A 3I8SA 1OH8A 1E9SA 1IBRA 1SKYB 3EPKA 2BEJA 1OLOA 3SFVA 2OHFA 2CL6X 3HP1A 1LFDB 4CEIA 1RFLA 1NSFA 1QG2A 1H8EA 2GHIA 2QSZA 3GJ6A 3NDPA 4D0NA 2ZE8A 4Z1MA 1HA3A 1GL6A 1JI0A 2F1JA 2IYVA 2ZPTX 4DEXA 1L4UA 5JCPA 1SVWA 4OI2A 3QXSA 1DEKA 2ZYVX 2CHQA 2IBMA 2PX3A 2GRJA 1W0JA 1G1MA 2HT1A 1FTNA 1AZSC 1II8B 1N6NA 1KO1A 1N5KA 2CBZA 5DIFA 3IDQA 1M6NA 1Q20A 3QVVA 5IK2A 3V4FA 4OHVA 3SE0A 4UNPA 1Z0KA 4S2EA 1VMAA 5JECA 4LJ4A 3RS7A 4QOSA 1G8GA 3WBKA 2DFTA 2JJ1A 3CIOA 5IRCD 4D26A 4AY2A 1E2JA 2OSBA 2XJ9A 2ZANA 4UXHA 1KSFX 3EIHA 2NZ8A 1Q3TA 3NG1A 4QGHA 2JCSA 3B2EA 3K9GA 2OUKA 3WP1B 1Z0AA 4K8OA 3UKDA 2CCJA 3QVUA 3LO5A 2O5VA 3X2SA 2F6RA 2PX0A 4L4UA 1N5JA 5EE0A 2AD1A 2OT3B 1PUIA 2C04A 3ZJYA 3RYTC 4PAOA 1SKQA 1KHTA 4EPWA 2O8FA 4BUJA 2AWOA 2WPDA 2ZAMA 4JLMA 3AVPA 3EZ6A 4LHWA 2W2VA 5CJPA 1GNRA 1G17A 3K70D 1TU3A 3CF2A 2DWOA 2YINC 3JVVA 2HLDD 3SDZA 3VR5A 1U0LA 4F4JA 1YJ5A 1F2TA 2RGAA 5HR5A 3V00A 2C5LA 1FW6A 1NVVQ 4PAMA 4TL9A 4EQ6B 3F8TA 4HYYA 3W3AA 1WB9A 4I1OA 2QT1A 1FP6A 4TQUS 1JBKA 1NF3A 2XNSA 4M22A 3NH6A 2ANCA 3RAPR 3O8RA 1N0UA 1KI6A 5JS8A 1N6IA 4V0ME 1CEEA 4FD2A 4UXIA 4HSEA 4Q7MB 1ONBA 4RD2A 1L8QA 1Z6XA 2REXB 2ZI6A 1RRPA 4Q7KA 3T06B 3KJGA 2PH1A 3SYKA 3FYHA 3FMPB 4M9ZA 1G21E 3DKVA 3K9LA 3OEED 2OFOA 1Q1EA 2B92A 1P61B 2E1RA 4N1AA 4R2IA 4IVQA 2OCYC 3X1DA 2RAPA 1OPXA 1OH5A 4GRAA 1KI9A 5FUWA 3GQBA 4HZIA 1UDXA 2MSDB 5FTNA 5KSPA 2BKEA 5KNBA 2QM8A 4YXWD 2RB4A 3W8RA 1VCMA 3WHLA 2Q9BA 2H18A 4G5SA 2IF2A 3QIAA 2NTYC 1UFQA 1EK0A 5L3RA 3DVLA 1TMKA 2YV5A 2QI9C 5JWOA 2QMUA 4W7SA 2XTMA 3RS3A 1UBFA 1ODFA 3VTKA 2RKOA 5TMPA 1NLZA 1TUIA 2VHCA 5D3MB 4P31A 3B7GA 4A92A 2EW1A 1ZP6A 3KKQA 4ON9A 1KNXA 3HPRA 3KKNA 1JR3D 5FBLB 5KHOC 4HAZA 1CP2A 1A1VA 1T5IA 2W0MA 5AWFC 5CK4A 2AK2A 4B76A 4KSCA 3CNNA 1ZM9A 3AF3A 2CEAA 3DPUA 3NH9A 1GG2A 3EA5A 3IBGA 1FZQA 4JL5A 5LD2C 1W4BA 2VL7A 3KB2A 3OE7A 1DADA 3ZQ6A 3ZIAA 5DE3A 4ARZA 5BXQC 2OFXA 1MH1A 3THYA 4LYFA 4OQXA 2DHRA 3CNLA 2QP9X 1OSNA 2HYIC 1E2HA 3LV8A 3AKDA 3SJZA 3BXZA 1VYTA 3GFTA 3K9NA 3U6BA 2HYDA 1Q1BA 4GMDA 1Z6AA 3UG6A 1Z06A 2D06A 4M1WA 4Q47A 3RRYA 2YWFA 4D4MA 4Z54A 1A5TA 3M4YA 4UNSA 4LV8B 1NG1A 4O0MA 2BJWA 4DSNA 1E69A 4UNRA 5B30A 5BN5A 1I4TD 3L0SA 4FMCF 4K81B 4KFSA 3RNLA 4GDFA 3QBVA 4ZDIA 3DHWC 2JDID 4RKEA 5C46F 1Z08A 2VRWA 1DAGA 3RSLA 4BRUA 3KFVA 2PZFA 5JEDA 3OIVA 5GJVC 5K8IA 1G8HA 1BOFA 1OFUX 1VHTA 3LLMA 2ZU6A 1SHZA 4KYIB 2XSZD 1QRAA 1SHKA 2FSGA 2J3EA 2LKDA 3EZ7A 3ZZ0A 4CYMA 3QG5A 4F38A 1ZU4A 1LB1B 1W0KD 4HLUC 1OV4A 4IXNA 3W5IA 4EFLA 4QBGB 4AYWA 1JEEA 2CVFA 4JZKA 4M1SA 3VR1A 4HB2A 5JFGA 1SGWA 4WZBE 4I81A 4FWTA 1R10A 3KXIA 3U3RA 2V6IA 1XXHE 1Q57A 1T3SA 2EU8A 1U0HC 2HF8A 2QMEA 5FTKA 3GLIB 1VG1A 3NHBA 2R6FA 4AIIA 4XVUA 5DISB 4DIEA 2IX3A 3Q9LA 4B3DA 2FMXA 3MSXA 5GVRA 1G8YA 3B13B 3T1OA 1G3RA 1CRQA 2V7QD 4NCIA 3D31A 4B43A 3BOSA 2WKQA 1JXOA 1M74A 4PHFA 3GFPA 2PEZA 5JHHB 4MYUA 1M1YE 1A2KC 2FEMA 2CE2X 4C30A 3U60B 4IOKA 1BH2A 1AN0A 2OEPA 1E2DA 3VKHA 4DCTA 5DH9A 1RRFA 2AK3A 3M6AA 4JS0A 1P7CA 3VU9A 1DS6A 5DHFA 4E07A 4EPTA 1TEXA 2ZS8A 4G5RA 4A6PA 3PENA 1TF5A 4IHQA 4U5XA 4A82A 2CMKA 2F43A 2PEYA 4KVAA 1ZIPA 5CIQA 3DM5A 3OFND 1FFHA 1AS3A 1VKJA 2ATXA 3OIWA 3FFBA 4LJ9A 1LV7A 4DUGA 1H8HD 3FTQA 3E1SA 5H8WA 1P2SA 2ODWA 1YZGA 1AJEA 1CRPA 2GVDC 2P5SA 4NPHA 1II0A 5UKDA 1P5ZB 3LBHA 2FPLA 5FTLA 4UQOA 1A4RA 3QXXA 3T1QA 3QJYA 5EXSA 4V0MA 4WIAA 2ZSAA 3PVSA 1UPTA 1LW7A 1XEXA 3CR8A 1SZPA 3PEVA 5HE8A 1LS1A 1KJWA 2QQEA 4KO8A 3A4NA 4HAXA 1WXQA 1CIPA 3HPQA 2IYZA 5KSZA 2IYYA 6Q21A 2G0NA 1XFAA 4Y0VA 2V4ZA 2OCBA 1KDRA 2HUPA 3BRWD 2E87A 5FPTA 4Q7JB 3LNCA 3WBJA 3ZDQA 1F6BA 3AVUA 1OYWA 2QA5A 4Q1AA 1G64A 3AEZA 4JKIA 1G20E 1XD2A 4JL6A 2NO7A 2ODBA 2IUSA 4IRUB 3AM1A 2FZ4A 4GP7A 5CLLA 3SOPA 3TSZA 4OQLA 4QL3A 4DXAA 2GTPA 3K0FB 4DVGA 1U9IA 5J4HA 3L82B 3QKSA 2BBTA 3ZVRA 3RRNA 1OYYA 3V4RA 1O3YA 1WMSA 4ESHA 4RCZA 4HAUA 4D4KA 5HPYB 2DR3A 4LX0A 2Q9CA 1RE0A 4NYMR 3C41J 3KXLA 1HY3A 1XZQA 1T8TA 4B2LA 1G7CA 3UK6A 2IS6A 4CRWB 2GJSA 4ILEA 4LZZA 4PHGA 1F5NA 2VYFA 3WXMA 2ZUBA 1NL3A 2GEVA 1X86B 1RYHA 2QAGA 4D0GA 3K09A 2UKDA 5JSZB 1NI3A 3P32A 1DELA 1OXXK 1XMIA 4M21A 1E1QD 2RGCA 2C95A 2CLDX 4MGIR 3SJCA 2IS4A 4IDHA 3UWKA 2PLFA 3H2YA 1XF9A 5BYJA 2XNDD 1OFTA 3CRMA 3VAAA 4J0QA 3SQXA 3VMFA 3SN6A 2P0EA 1LS6A 2JA1A 3T34A 5KSYA 3EAQA 2J0SA 2HDNB 3PEYA 4NTZA 4XIGS 4B2PA 2QNRA 1K6MA 3I73A 1GTVA 2QRNA 4DB4A 3FE2A 2NG1A 3EWSA 2J41A 4X8OA 4Q7LA 3CF0A 5CM9C 3B9PA 1FQKA 4GZLA 4JLJA 2G1JA 1YHNA 2K5UA 4TTPA 5CIWA 2H17A 2DY1A 2J9RA 1XTJA 2A78A 2RCNA 5FBRB 5L3SB 4EPVA 3IIKA 4EJSA 4RFSB 3A1VA 2VP0A 1YZQA 1KY2A 3TRFA 1MR3F 1P2VA 4C2TA 3TIFA 2Q0HA 4LHZA 4P33A 5GJWC 4US1R 1NY5A 1HE1C 3CM0A 3OIUA 4R2HA 4V0KA 3SU8A 2ZRLA 2R65A 1KZ7B 3V9PA 1W1WA 2IC5A 1WBBA 4IFEA 1SXJD 1XXHA 5KYKA 1X1SA 4B71A 2O8BA 1W2HA 1VYVA 1N0WA 1ZBDA 4URWR 2Z83A 2QBYA 3ASYA 4G1UC 2J0QA 4AD8A 4JLOA 2GXSA 2KSQA 4P32A 3WYGA 3LRPA 3BB3A 1ESMA 2PCJA 2WTUA 4US2R 4KU4A 4BQSA 3SI7A 1SVSA 3AB3A 3GD7A 2QTHA 3TVDA 1C9KA 4RD1A 2WKPA 4FWIB 2OAP1 3HYTA 3ZVMA 3PQCA 4MH0R 3R7WB 1FX0A 3D7MA 2GILA 4B6EA 2XAUA 4KITB 1D9XA 1KKMA 3QQ5A 2A3RA 3KJHA 1OE0A 2Z43A 5FTMA 4BEBA 2VF8A 1NMXA 2I4IA 4PC6A 5CYOA 5LB2A 4IDNA 4PPGA 3LX5A 4RZ3A 2FPMA 4BZQA 2RGNA 1T91A 4JVLA 1N5LA 1Z0FA 5H1YA 3C5HA 2XOKD 4OQNA 5AUQA 1G6HA 3U44A 3OEHD 1DO2A 4KAXA 2DYKA 4F4IA 2Y8EA 4URUR 4NCNA 4S35A 4RSGA 1DTSA 3DOFA 1S0UA 1SXJC 2FGKA 3LBNA 2IYWA 4BFSA 2EYUA 3L8YA 4DRZA 1RJ9A 5LD2B 2O8CB 1XTIA 5C1BA 1DAMA 1P2TA 1E6CA 1Z63A 1T9HA 3I32A 1J70A 1G3IA 3TUZC 3WRYC 1GRNA 3SFZA 1EESA 5L3QA 2OCPA 1E79A 2XZPA 3KL4A 4WBSA 3R20A 4CZ2A 1QBKC 2QTFA 3RANA 4WOPA 1EFCA 3EZFA 1UJ2A 4W5JA 3MWKA 4B3XA 3A6PC 4GZMA 2DWQA 1OFIA 1Z6YA 3CPHA 5TY0A 3RHFA 2XXAB 2V1XA 3U61B 1U81A 5EE9A 4WZ6A 4G5QA 2EVWX 4HZUB 4TMZA 5L8VA 1YR7A 2VF7A 1JR3E 5J4VA 4FW9A 3KJEA 4HI0E 1IOZA 4GBMA 2ORWA 4MKFA 1Z0DA 3IO5A 3NVAA 5EXXA 1KMHB 3MAAC 4Z8XA 2IUUA 5FR1A 4LPKA 3HYRA 1S3GA 2D62A 2A5GA 2W2TA 3H1TA 4IEIA 3L8ZA 1W49A 2ATVA 5CYPA 4Q4AB 2GA8A 2RGDA 4B6FA 4IEEA 2FZLA 3R8FA 1VIYA 4LHVA 3ZGXA 1G3MA 2WIBA 1N6PA 1YVDA 2ZSBA 3T61A 3OESA 4YONB 4Q4JB 1ZM3A 2FFHA 1ZNYA 1CJKC 1NBMD 3WNDA 3TLXA 3W34A 4XD7D 4D4LA 2W2XA 1U9IC 2JLWA 5DI3A 5FI0B 4LBWA 4DSTA 4MYCA 2ZROA 4JBYA 5FL3A 1W36C 1AK2A 3FFAA 3H4MA 1MO5A 1IXSB 3U6KA 4GNKA 5FFMA 5EP1A 1T5LA 3ZZTA 1COWA 5BQ5A 1YKSA 4C0KA 1ZNWA 1N6RA 2GK7A 3AF0A 5F3WB 2GJ9A 1G9XA 4LI0A 3WMGA 3Q7QA 3TBKA 1E9RA 1UKYA 3K09C 1JB1A 3KUCA 4HUQA 3K0EA 3QI2A 4OI0A 4JVMA 2ZE7A 3IEVA 1JR6A 2O0HA 1NLYA 1E9EA 4JKYA 4Q18A 3RRZA 4NYJQ 2OBLA 3U3KA 3LQQA 2ODNA 2RH5A 3LBIA 1IY2A 2AR7A 1EWRA 2ZVQX 3K0CC 3EG5A 3N70A 5G3YA 2IYLD 3NC1C 4KCGA 3ADDA 2V8OA 1Z28A 4U02A 3QSYA 4ZIRA 3TAHA 1UEIA 3QKUA 3AVVA 4FMBB 5CM8B 4Q9JA 4OHWA 4DLYA 2GK6A 4DDUA 2QE7D 3EZ2A 1R4AA 3CR7A 1Z6TA 2EWVA 4PC7A 4OK3A 3LD9A 1HEIA 3TW8B 5BYKA 3GLFA 4EJSC 4C0HA 2WWWA 3GJ5A 1IONA 1Z3IX 3VR6A 1N3BA 2R9VA 2HT6A 3NBYC 1GWNA 4AKEA 4DZZA 4U7DA 3ZLJA 4ZO4A 1G6OA 5EUMA 5B57C 1KI6B 3LA6A 4BASA 3RSOA 4LOAA 4V0NA 2GCOB 1LVGA 1ZCBA 4TLDA 4TLCA 1OB5A 2OLJA 5J4KA 1JEDA 4L5BA 4TSFD 1Q21A 4BZPA 1KK2A 4AG5A 1N6OA 2EQBA 4A8JA 2W00A 4PZZA 4MKGA 1NKTA 2QP3A 4NHOA 1NLFA 3QBTA 3GJ7A 3TMKA 4QG7A 4ACBA 3HJNA 3OAAD 4Q4HA 3ZS9A 2ZYWX 1QHXA 4C7OA 3PUZA 2BV3A 3MJHA 4LC1A 2JJ2D 2FFAA 5DYGA 3LDAA 3BK7A 3EW9A 3WMEA 1I2DA 4O2RA 4URYR 4BFVA 2ANBA 5CJ2A 5JS7A 1AGRA 4UJ3A 1F3OA 3OEEA 3U3MA 1P73A 5D3QA 5JWRA 2C98A 3FPAA 4GOXA 4M9SA 5LBIA 4ZDKA 1M7GA 4ZPXA 1LTQA 4BFUA 2XGJA 1Z22A 1Z8FA 2B7CA 4L16A 1P60A 5F2EA 3CX7A 1T6NA 4YXWA 4B2IA 4AI6A 2SHKA 1Q0UA 1SVOA 4QRHA 5EQTA 1FQJA 2CJWB 2ZI7A 1VYUA 4XOIA 2O8EA 2F1IA 2IYQA 1YR6A 3H0KA 3GLHE 2XZOA 2Q9AA 2W6IA 3PG5A 1G4UR 3AKYA 3BJIC 4CIDA 5GVSA 3ADBA 3WYFA 4HUTA 2EWWA 5FBQB 4LUCA 3AKCA 4PHTA 4GSYA 2QT0A 4TYPA 2WBLC 2GEDA 1W4RA 2VPPA 5C18A 1OW3B 4D2IA 1KAGA 2PT7A 4P0TA 2ZRPA 2ZS9A 3RS0A 4P3YA 3T5GA 4ARZB 4RVCA 4BECA 4XVQA 2PZGA 4Q1FA 3THYB 3SZRA 2QAJA 4ZCLA 1TADA 4FXPA 2RHMA 3QOFA 3GLHB 1ETUA 3KQKA 3HU2A 2HV8A 3ND9A 3RS5A 1U94A 5F9FA 2BMJA 2GJ8A 3LXXA 1ZVQA 4PO8A 4TMTA 2QPAA 3CBQA 5FOXA 3NIBA 4AWXA 2B8WA 4LJ5A 3TAUA 4DLSA 3PUVA 3I4LA 2H92A 4H9GA 1ZW6A 4MA4A 4XH9B 3PR1A 1E9AA 4LRWA 3EWAA 5E7MA 3W90A 1NVWQ 4OI4A 3VHLB 3LAWA 4DT1A 5ELXA 4R9UC 1XMVA 1LY1A 2JDIA 4QNMA 3AVOA 2ERXA 2X8AA 4RD4A 3CPEA 1C4OA 1TQ2A 1AQYA 3CNOA 4M8NE 1FMJA 1OKKD 1VIAA 1II9A 2IEZA 2PT5A 5FOVA 2HJVA 2ZI4A 5J4YA 1ZM4A 3WNCA 3OZXA 3RDPA 1BMFD 4MUAA 4QGAA 3A1WA 1SXJE 3B1ZA 4CEJB 5TV2A 3UXMA 2D74A 5BN3A 2J1LA 5E3HA 3ND8A 1GL7A 3B78A 4LBZA 2BKUA 4D0LB 4MRSA 3LY5A 4JLAA 4Q5IA 2JLXA 3W8NA 1Q1ZA 1XMSA 2GKSA 1SVKA 1MV5A 2HEIA 4R98A 4HB4A 3ETLA 1DARA 1FP7A 1QG4A 4LK2A 1BYUA 2KBFA 3I5XA 3CX8A 1XCMA 3VU9B 3QE0A 3P27A 1D5CA 3U2QA 3U7GA 1G8FA 1SXJB 4H1UA 2FSFA 4PC2A 5P21A 2IYSA 4R71A 5L3VA 3BH0A 2F43B 1E2QA 2QZ4A 3CONA 2CNWA 4A2WA 2XEXA 5JLJA 3CWQA 4I1VA 4LBYA 3B9QA 5EZ6B 3KTAA 4BFYA 5EZ5A 3GJXC 4GPTA 1QVRA 2BDTA 2HXYA 1AKEA 2ERYA 4JBWA 1K5GA 2OXRA 4HLQB 1RW4A 1S1MA 3JVUA 5FR2A 3X1ZA 3ZYCA 3KQLA 1RPZA 4BZXA 4PQFA 4JLVA 4OQMA 5EXTA 5FPSA 4NU0A 5IDVA 3SEAA 1E2LA 4C4PA 3AH8A 3IILA 2ZVPX 3L0PA 5KU1A 5KSOA 2JGNA 1OXTA 1XEXB 1H8HA 2V54A 2YOFA 2JIZA 3CF6R 3KQUA 4B73A 4XVRA 3THOA 2I1VB 5TDHA 2JASA 4ASUD 3DOEA 3CRW1 3ADKA 5CLQA 1QHHA 3B82A 4B74A 4PX9A 1K8RA 1YU9A 3TH5A 5JBQA 3THXA 3THWB 5HKKD 1I4LD 1H8ED 2X1VA 2NO9A 2ZRGA 1KO5A 5CK5A 4Z1MD 4IVPA 1KI2A 5CDFE 1VCOA 4QBHA 4UNQA 3QF4A 4M1KA 3U7FB 4PFSA 3L43A 4B3BA 2D2FA 5G40A 3ZQJA 2QMHA 4JYBA 1W0JD 2YNMA 2A30A 1BS1A 2WJYA 1KK3A 1YZNA 1XTKA 4P4UA 1R7RA 1YRBA 2GZAA 2KBEA 5IK2D 5FTJA 1W36B 3VNVA 2FX3A 4QM6A 2HCBA 3L0IB 1S9DA 2FN4A 4MITA 4C0JA 5TXGA 5B2ZA 2X19A 3CW2A 5A4JA 3TW4A 1QHGA 1U2RA 2H16A 3NC0C 3SBDA 4A0GA 3L0OA 1G3UA 1NN1A 3GLIE 4IOMA 1BIFA 3PEUA 4QHSA 1TNDA 2LCFA 4DLVA 1FUUA 3DEFA 2IL1A 2BVNA 2LKCA 3RLFA 4HAVA 1NBME 5DGXA 3NBFA 2O8DA 2CK3A 4TLAA 4NCKA 2YKGA 3LW7A 2WPDD 2IS2A 1KDPA 3AUXA 3EASA 2G0TA 1K5DA 2QTVB 3IHWA 3AVXA 1E32A 4KXFB 4JYCA 2CHGA 1HQYE 3MRSA 4HB0A 1ZC4A 4OKSA 4URZR 3SNHA 4YC7A 4Q9IA 2KB0A 1ZINA 3ZH9B 3CO5A 3CKLA 1XPRA 1CS4C 4B32A 2YJTD 3G5UA 1ZU5A 2ZRBA 1XJ0A 3B8HA 4M9XA 3C14C 2VHJA 2BBWA 2YOHA 3K0SA 4PO9A 3QKTA 1OIVA 1MABA 2NGRA 4GP6A 4KYUA 1N6LA 1IM2A 1GP2A 3T35A 4EJSB 4EQ6A 1CTQA 2PLRA 8OHMA 4CGZA 3TK1A 1RKBA 2FFBA 3N5CA 4MDFA 2CE7A 4V02A 3W6OA 1ZUIA 4LYAA 3X1YA 4B47A 3MGCA 2REOA 3IQXA 3OF5A 5HE9A 4DBLC 1HUQA 4Q9LA 1NVXQ 2B6HA 4NH0A 3LVQE 4KHZA 2AL7A 2OILA 3K0AA 4B3GA 1DG1G 3P4YA 1XCPA 1J2JA 2ZRKA 3PUWA 4MDEA 1ZCAA 2ZRDA 1MO6A 2ZRJA 3TQCA 1X8KA 3KQHA 1IXRC 4Q9KA 3CB4A 1EFUA 2AKYA 2VTKA 4G5OA 3ONWA 4L15A 3D8BA 3GFOA 5G53C 2QENA 1HV8A 4C0AC 4ZDJA 4IW3B 4QXAA 3SC3A 2FEOA 4BLOA 2MMGA 3AGQA 3WMFA 2ONKA 3CH5A 4YMWA 5AJZA 2ONJA 1DAEA 2XX3A 2L0XA 4TZ6A 2GF0A 1UADA 4OYHA 3VX3A 3W3ZB 2AXPA 3D6TB 1CU1A 3FWYA 4DLUA 4ACAA 4N0EA 5D3MA 2F3RA 4U00A 5JRJA 3CX6A 5KUTA 4DIDA 2H57A 3U44B 4TWZA 3U7EB 3FKSA 4I99A 4M9QA 2HXSA 3QEJA 3RWOA 1NKSA 1EGAA 2V55B 4V0LA 1SVMA 2REBA 2A5YB 3KDSE 3ADCA 3FMOB 5JI2E 2Q6TA 2XTZA 3BWDD 3M0EA 5H70A 3SYLA 4JT2A 4W5WA 4QGFA 1Q22A 5L3QB 2AWNA 2JJ8A 4GOKA 1OB2A 1VTKA 1M8PA 3P26A 3AKEA 1NJGA 4FINA 3WNBA 5CB6A 4JVNA 4EPXA 1XPUA 1C1YA 5SZIA 2DFNA 3EPJA 3E2IA 2F7SA 1CJVC 1J8MF 3H84A 2R6GA 4LC0A 3LX8A 1E1RA 2F9MA 2OLKA 1OH6A 2Q3HA 3VFDA 3BB4A 4TTQA 3VHXA 3GLGB 2VP5A 3SBEA 4CVNA 1SVLA 1IY1A 3QKRB 2WMNB 1N6HA 4D82A 3NDBB 3RWMB 1VCNA 3VR3A 2NOAA 2BEKA 3GPLA 2QU8A 2VH5R 1D9ZA 1TF7A 1W44A 1ZAKA 4OK5A 4TQAA 4Q66C 2C96A 3B6EA 4Q1BA 4BRWA 2P6NA 5IHPA 2KJQA 4LJ7A 4C2UA 5FUYA 2X2FA 4JSTA 4QGGA 4DKXA 1G19A 3ECCA 3REFA 2IYXA 1QHNA 3AV0B 3SS8A 2ZAOA 2G77B 4TMVA 2WZQA 2PCLA 4B48A 1IY0A 5A0FA 1G291 2ZETA 3K1JA 3E5HA 4EAQA 4OHYA 1US8B 1MKYA 5JZVA 4CEHA 1N25A 1JPJA 2UZ3A 5AR1A 4XSHA 4M1MA 5DI3B 1D8TA 3F5FA 2J0VA 2F1RA 1TF2A 2AD5A 1G7RA 3KX2A 2JATA 3ZS8A 5JRZA 2BHRA 5GJBA 1ESNA 1IJFA 3I61A 1AZTA 4M4SA 2GNOA 4G0NA 3R8CA 4PQRA 3QXHA 4ERNA 4KFRA 1Y3AA 4PZYA 1TTTA 4HAYA 3U3JA 1E96A 3HR7A 1I2MA 3MWYW 4KVGA 1E4YA 3IPYA 1JALA 2IYRA 1ZD8A 2GAAA 2WWIA 3PJRA 1MRNA 4HUQB 2P65A 3MD0A 4US0R 5ANRB 1LNZA 3W6NA 1S3SA 4A0HA 4DUGD 1FL9A 1G8PA 2BBSA 1ZD9A 2WSMA 1WP9A 2VHUA 4DDTA 5J4LA 4DSUA 2GXUA 4NL4H 4P4SA 1RIFA 2FH5B 2W83A 1CR4A 3F3YA 2N42A 1Z83A 1KTVA 1ZIOA 3NWJA 2EFGA 2ZUCA 4DCNA 1JQLB 1IJEA 2ZSFA 2ZUDA 1R0ZA 1RC8A 1G7SA 3BFKA 5JJIA 1TEVA 3QENA 4GI7A 5AK0A 1VG9B 1TQDA 2CDNA 2J7PD 4PTLA 1Q1QA 3BFXA 1OH7A 1YZLA 3BS4A 3BH7A 4LDJA 4ABYA 3P20A 4B75A 1TU4A 4A2PA 3GJ0A 3VR2A 3B1YA 1RVDA 1N5IA 4FMDB 4YLGA 2VP4A 1XJCA 1M34E 5KPDA 1FNNA 2ZQ5A 4F4CA 2OBMA 2QGZA 3TQFA 3WY9A 1KGDA 3E70C 1ZJ6A 2KI5A 2ZJ2A 4G01B 4MRNA 1XD8A 2PBRA 3U3OA 3N2IA 4C0BA 2DBYA 2QE7A 4DJTA 3EIQA
chains in the Genus database with same CATH superfamily
4HLDA 1JYFA 1L3IA 3ROFA 2F9LA 3BF7A 3LF2A 4H7FA 1P2FA 1OD6A 4RD0A 1N6KA 3RFCA 5C7IO 3KVYA 4R5MA 4MV9A 1EVQA 1Z0JA 5CDHA 2Q2NA 2A92A 2B1QA 3ON5A 5CGZA 1WIWA 2WYVA 3ZDDA 4UEOA 1WD7A 5C31A 4BBPA 4BL5A 2HNKA 1I1OA 1QPGA 3WK4A 3TFWA 5AM1A 2XEDA 2Y1DA 5AVSA 1O94A 4C7OB 3WB1A 3A1TA 2QYSA 3A6GA 4FCWA 5JJIA 1UUFA 4N7MA 1EUDA 1G5RA 4TSFA 3U39A 4UJ5A 3ZQKA 3R9WA 1R37A 2E37A 1VI5A 4KMSA 3ROZA 4P7GA 1TO6A 3REQA 1PWYE 2IUYA 2NYRA 5EWMB 1JQEA 3QUSA 4MXDA 2O3UA 4BU1A 3OAAA 5EIEA 2J9FB 2WD7A 1UKZA 3SNKA 2BF7A 1ZM2A 3M6LA 4PIVA 1ZD1A 2WLSA 2XKJE 3FOZA 1VP3A 3DGEC 3NHMA 4HQRA 4DCPA 3H6KA 4XM1A 5KQRA 3QEMB 3ISVA 1JHPA 3U4CA 3LQ4A 5JEEA 4N8DA 2HHLA 3NHLA 3WJ2A 2OO5C 3NM4A 3IQEA 4U3JA 2GSWA 2VK8A 2F62A 2QRHA 3H2KA 1V5IA 4PQYA 3QU9A 3NB0A 4EO9A 3QHPA 2Y0EA 4YAOA 3STUA 3T54A 1LX7A 3IUPA 2O8EB 2NPIA 2N3ZA 2VWPA 3U49A 3E9MA 3GDOA 3ESRA 3CLUC 5EINA 5FT9A 5EJ8A 2O1XA 4IZIA 4L4SA 4A15A 2IOHA 4GLOA 1INLA 3IOCA 4RJTA 5KDLA 5HCIA 5I3ZA 4IHAA 4EGQA 1H05A 1JU9A 5CVDA 4Z4EA 4PAWA 4RA9A 2BP7A 3U17A 2N1MA 4E2XA 3KTDA 5JIBA 1KOFA 1A97A 2I3AA 3EHEA 5K3BA 2NU8B 5C8VA 1AMOA 2P5TB 2D7CA 4I4TF 2GN4A 2JAQA 3STWA 4XGKA 2C78A 4MWCA 4TSKA 2OLEA 4JNCA 3ZV6A 1A2OA 1TIKA 3AL3A 1DIAA 1A7UA 1GGNA 4M89A 1GUZA 4PSCA 4R84A 3WYAA 4BMOB 2VNHA 5EJFA 1QLWA 2Q4OA 3EF1A 4I1UA 4O2LA 5SYAA 3UJ7A 1KHHA 3ZWCA 3V8NA 1FFXA 1Y89A 3KAPA 1ULAA 1UP7A 2R25B 3TB6A 2Z4RA 2ZIZA 3DE3X 3FMIA 1O95D 1L6IA 3C4JA 2OXEA 3DLBA 4J7CA 1M6WA 2FQ1A 2XIQA 4GH5A 2GWRA 2HF9A 5CX1B 1GTSA 2BC9A 4IXDA 3B52X 5B6PA 1WW2A 1YUNA 3P0JA 3H99A 3F4LA 1R0YA 1NZDA 1Z4NA 5ES4B 1J56A 4QFDA 1E0AA 1GPAA 2LXNA 1H94A 2O8FB 3D7NA 4QJBA 2G8NA 2RGGA 3CUVA 4H4CA 1YDEA 3GCDA 5ILQA 1VG0B 3ITNA 4U6NA 3EZNA 4HH1A 1EU1A 4P34A 4A27A 4BNUA 1NVUQ 13PKA 3HCRA 4OJQA 1BHQ1 2CLMB 3FVQA 4L0CA 4QQNA 4RTKA 3AP3A 3DF9A 1XGKA 2Q3MA 4BS9A 1DXHA 5LL6P 3H2GA 1NG9A 1D2AA 1JDSA 4W99A 4KGVA 3SHWA 5J5CA 1YBHA 5K5EA 4JB3A 3PFHA 3GCWA 3LO8A 1P31A 2GAIA 2VO1A 1B0PA 3RSFA 2ONCA 2IWHA 3WIDA 5FCDA 2VYVD 4FFWA 4ZCIA 2AYXA 1YV9A 2KPOA 2JW5A 2Z08A 3HU1A 4LRSB 2VJOA 4K8RB 1P5RA 3DMDA 1Z73A 3J81k 4F8EA 1UKEA 3KJNA 1K8QA 1JPVA 4Q48A 1FY2A 4YDHB 5DGCA 5CCXA 4L78A 2QI9F 4CWAA 4GX0A 4LEIA 4ISCA 3H5TA 4P83A 4IJKA 3LPLA 4RJLA 4UTXA 1GOTA 1OBOA 5AHRA 5ELLA 4Q4CA 2QMOA 1YJCA 2IA5A 1ICIA 3IB6A 3CG0A 3ORHA 5GGXA 2FG6C 3U6KA 5DN9A 5H7XA 3C3EA 3UXHA 3KPVA 1IB6A 1ULUA 2PV0A 1L7QA 3PNVA 3UATA 3UMCA 1X7WA 4J0CA 5KYWA 3MEQA 1O03A 3NOXA 3KYBA 5FBHA 2CNBA 2IKQA 4YMVA 4WLFA 1FRFS 2AG6A 1FJHA 2FCAA 2WAOA 1FE8A 4Y0NA 1EGVB 3RBAA 1P7PA 4N82A 1VHLA 2WF5A 3LS2A 4IIDA 4N9WA 4I5DA 4OFXA 1WMFA 5DSTA 5JFOA 5K0CA 4XFKA 3ICVA 1UWVA 2FQYA 3D7LA 1HYHA 4W5HA 3QIVA 3QE2A 4NE7A 5ICGA 1S5PA 4WT7A 1EZZA 1DV2A 1GZSA 2QUJA 5CNIA 3G7SA 4CQMB 3DMTA 5G41A 1QQBA 1GRQA 4C0SA 5K7SA 1TGVA 1YMQA 4DCCA 5I8WA 1D4FA 1H6AA 2A7QA 3RODA 2Z8ZA 1WCWA 5IM4A 3WZMA 3AP2A 1HXHA 1W5SA 3KQSA 4IOLA 2J85A 4HLCA 1NSYA 1PLJA 1U8ZA 2C84A 3BMOA 3GMTA 3JQAB 4JWTA 2PU7A 3IOYA 3IURA 3JATB 2A8YA 3OE1A 2QLTA 4NLLA 4EH1A 4AB1A 3HDYA 2ZTHA 1C3LA 2WHRA 1IN4A 1Y8QB 4OBEA 5HS4A 4LN1A 3V7FA 1QE3A 1RFGE 1RBQA 2I33A 4NU6A 4Q4AA 4UCXA 1S6YA 1VPWA 3A37A 2RGWA 4F72A 1AKMA 5G3ZA 2W6JD 4NCXA 4X8MA 4ZYTA 1Z7BA 3O75A 3ZNOA 1DBIA 2RK3A 5IVDA 5IG2A 4Q3OA 3W7VA 2HFKA 1D2MA 4PG4A 4YPFA 4RFLA 4DVJA 3F49S 5HUJA 3B1VA 5WRFA 4FFOA 2DHCA 1COWD 4DWWA 3JVDA 2V96A 3IAXA 4G5YA 2AHOA 2E1PA 3VSDA 4F84A 4W5QA 5A0TA 2R751 1DXYA 5ALQA 1BS2A 1ECBA 4OFZA 1FJ2A 2DWCA 4V24A 1L7EA 2XWBF 3M2PA 4LHEA 4ZYZA 1HNNA 3E22B 3RRXA 4X97A 3F6YA 5HQ3A 1O0CA 2NACA 1U1IA 5HJEA 4ZOLA 3SSNA 2FUCA 1L7PA 1KDTA 4MJ3A 4PR0A 1E8NA 1BE1A 1CJMA 4HZGA 5AKHA 5DGDA 4ZAXA 3KYDA 1TMYA 4DLXA 2ZT6A 3UKJA 4AMZA 3VPXA 4HAWA 4N6NA 3UT0A 4U8HA 2ZXUA 3ZGNA 5IVKA 2IBTA 1E6LA 1YRYE 3M1AA 4S24A 3TPZA 1A8HA 2VHWA 3HWRA 1Y48E 1HO3A 3L4EA 4U2FA 3UIEA 3FI9A 2JIMA 3LVRE 2X14A 5DO9A 4MHSA 5FOWA 4NJMB 3OO0A 1IZ0A 2XZDA 5FQOA 2A4KA 3FPCA 2G7MC 4BY9E 2QEQA 2OUIA 4E13A 3C74A 4D5GA 2PUCA 1C5KA 1C9NA 1X39A 5E6RB 4DJFC 4NG5A 221PA 2P3SA 1DAFA 3AUYA 1NC1A 3IT3A 4KPUB 1WMEA 1J8VA 1ZSYA 2R8BA 1E2MA 4ARIA 3OMXA 3IBYA 3G2IA 4K87A 3ROEA 2BSAA 3TNJA 1YBVA 1TYEB 1AM4D 4V0SA 3S0JA 2FAXA 1KEEA 4GMXA 4NCHA 2D2EA 2I8CA 2P2YA 1X0VA 2VUIB 1A5AB 1IUKA 1KMQA 4GI2A 4I55A 4OI1A 4HWPA 5DLPA 1WXWA 2OE2A 3ETCA 4J6EA 2PUAA 3FYUC 1ZD5A 1E4EA 2BH9A 2WJGA 3N2KB 3TW8A 3T3HA 4HNQA 3HM2A 4BKUA 1KI1A 4G0ZA 3O1LA 4AROA 2AZXA 4ZOCA 3NZEA 1MJNA 1NRJB 3NV7A 1P6XA 3IEIA 2QSYA 4AJIA 5K3EA 4DR5B 5U9CA 1JT9A 4HQ0A 4WA7A 1Y4DE 4TRMA 3EXG1 1N2CE 3DZ8A 3OLCX 4EDHA 3ONNA 2A9KA 3UAYA 3BD9A 3AC0A 1G66A 3H2IA 5BVHB 4Z9XA 3MTAA 1U0FA 2O52A 1NQXA 3T9FA 2ZITA 3BGDA 3EXFA 3A6FA 3QMMA 1P1FA 4WESA 4CF4A 5DYYA 3EVGA 1Z4PX 4MQEA 1X42A 5CA1B 4ZALA 2QIPA 4BNXA 4DBZA 1WWKA 2WW8A 2R66A 4PQEA 4BNNA 4D3FA 5JZOA 5KX5F 3IMGA 1LW6E 1FJXA 1J5XA 1GL3A 4B4UA 1USGA 1GKKA 3GGPA 1M2OB 4WAUA 2YYZA 4WNAA 1VFPA 1LF5A 2VPXA 3VNSA 4F9TA 3GJ8A 1C1XA 3GT4A 1FTQA 3OCZA 1H2WA 4N3AA 2YRXA 4PZLA 3TR5A 1ZJ5A 1ZOIA 1T2VA 3T41A 1GQYA 2Z6UA 1KQ3A 1W35A 4ZHQF 3AY6A 1X8LA 3NYQA 3THSA 4UM9D 1C1DB 1YHYA 4WERA 5DKFA 3W2HA 2B4RO 4KR6A 1R9GA 1KERA 2ZYGA 3BMCA 1BJKA 1SG9A 3CG4A 1JIUA 3PWKA 3GGCA 3D6AA 5CP8A 1SXQA 1DC6A 2ZJ8A 4GEGA 1VLJA 1OLUB 4MINA 4DW8A 5LQMA 2IYTA 3D6MA 2RK4A 3DTVB 1JFVA 3N3BC 5IKOA 4DMGA 1JEOA 5FXMA 2VOJA 1PR1A 3B2NA 3IP3A 4W9NA 1RSZA 1GXSA 3COJA 4S3MA 1H6CA 2CHVA 2Q21A 2YMLA 3FKQA 4UDNA 4DOMA 5IBCA 4G09A 4KQKA 1OLXA 4RDHA 1QGED 2QQFA 3CT4A 4F5YA 5BWCA 3ZXSA 2CJWA 1EM8A 1VMIA 3R6LA 4RH0A 2BMEA 2VA8A 4F2HA 5HM8A 5AVUA 5KPJA 3CLTD 4K9OA 4ZVLA 5K6AA 3T12A 3I62A 2X23A 1VKNA 2G80A 4PLZA 3U19A 1WNTA 3A4YA 4G9EA 4ENSA 3KHUA 3P5BA 4RBNA 3VHQA 2H31A 4KGXA 2ZXEA 3O4JA 3L4SO 3DO6A 3OE4A 4PWZA 3WZ2A 4D99A 2GLUA 5FI1B 3PRYA 3C3KA 4U5QA 5JBNA 2P4SA 3LIPA 1TTQB 4NU5A 1VCIA 1B8OA 1DQZA 1LBIA 2A7XA 3DMYA 2P9FA 5GY7A 2VCEA 1VBNA 2ZREA 1KE1A 2JJ1D 2EL7A 5JMPA 3VU8A 3ZGZA 3GD5A 1RAGA 2AFHE 1YJQA 3RRMA 2CUKA 4HDOB 4ARCA 1YQQA 3FNEA 4HDNA 2QRKA 4G1VA 4M8IA 4OHCA 4LRXA 4MRVA 3S2SA 1UOOA 3TJZA 2QL6A 4AN0A 1CB7A 4O29A 1NXOA 1ECGA 5GV7A 1GZVA 2GCNA 2TSYB 2A9QA 4NPAA 4YLEA 4F12A 4K9LA 4G8BA 4ZVSA 4PRYA 3W6UA 1NIJA 2CWDA 2Z2XA 3BPSA 3T7TA 1KIMA 4QTYA 5DRTA 3PGVA 2WU0A 1ULZA 3PT9A 4XX0B 2WAAA 3FSRA 2UDPA 2ISCA 1ZICA 2PGJA 1E7YA 1E1QA 1Q1GA 2O7NA 2ZRHA 1LD3A 2VSXA 3D81A 1NJ2A 1DKPA 2PRSA 3E6AA 1C0IA 3C3XA 1RWBA 3JS5A 2YASA 4GNRA 4J0EA 3N9IA 3ZV7A 2QTGA 4EUFA 4FLMA 5LZ9A 1O7JA 4J07A 3PD1A 4N8EA 2R6AA 2GBFA 2X3UA 1XKLA 3SP1A 2FWRA 5KYYB 2GD6A 1A8PA 1R00A 1XEWY 2JHFA 2R8OA 4JQSA 3IUJA 2J5XA 5JTTA 5DWVA 1CR1A 5CAEA 2AOXA 1G16A 1T6BY 5ALMA 2B7LA 2IITA 2AJLI 2R85A 2QRGA 2HSZA 2ZRNA 3AF4A 2RJ3A 4G0QA 3IAUA 1LBEA 4BLRA 1QIIA 1GR1A 1KBZA 3DE7X 1U8YA 4GMFA 3O8DA 1JXMA 4UMVA 4YDSA 3R7NA 3TYXA 2CXHA 3KEGA 4WCFA 5M2QA 1FYXA 4OQDA 2JLUA 2ZU0C 3K5HA 3NHRA 1Y6GA 3SICE 1PFKA 1Z68A 4JBNA 2ZBGA 4U7FA 3FWPA 2YFHA 5C81A 2FPKA 1P8JA 4OL9A 3I0NA 1H5QA 5DBGA 3VPGA 3W2GA 2A1TS 1LDBA 1WF3A 2AN4A 2ECQA 2FRVA 3DKRA 3L01A 3L1VA 4FD3A 3E9EA 1FNCA 4HDMB 4XPIB 4CM8B 1JPNA 4ITUA 2GEKA 2VTEA 1B42A 4WZBB 5HKBA 3KXKA 4FI3C 4LMAA 4ZICA 3E0XA 4MNTA 1XXHB 1RC0A 1U0EA 1IEQA 1XZIA 4QJ5A 4BQFA 2RSLA 2IGBA 3KETA 1RYNA 4C3ZA 3DC2A 4H17A 1HNXB 1C3OB 4GQAA 1X7HA 4AZVA 1B23P 2FSHA 4AM8A 4YRGA 3H5OA 1WQ1R 2R11A 3I1FA 3DCNA 3IEUA 2V6JA 4M87A 1E6MA 4P82A 5FBWB 3T15A 5IT0A 2Y77A 2NVWA 4QJIA 4N5LA 3F6RA 1SHLA 2XVYA 4ZZ2A 3INYA 1R18A 2JARA 2M1ZA 3B1WA 3KR9A 2FG5A 2VNAA 2XITA 3JQBC 4L73A 3KALA 3LQ2A 1WG8A 5CT5A 3SHFA 3VPFA 4ZQHA 1ZCJA 1YQTA 4C7BA 3WRYA 5MF6A 5T4BA 4WUVA 4HWKA 1UPCA 4P92A 1IU9A 1S2MA 2AC7A 2R44A 2QF7A 5C4GB 2AXNA 2QNBA 1ZK0A 4RPGA 4UVIA 4J1QA 2KE5A 1N0IA 3O91A 1RWPA 4PPFA 1L5VA 1VZ2A 2EHJA 2HA4A 3X1WA 1E94E 3CRQA 1IQUA 4LYJA 1KZHA 3NJRA 4UTZA 3S2UA 2CNOA 1L1FA 1GFIA 2JD2A 1OGYA 3DP7A 4BFXA 1CS0A 1MO4A 1O77A 4LG1A 1DZ3A 3K9FC 1J0AA 3LUPA 4TRJA 1BXRA 2JGEA 1F5SA 3VKWA 2XBUA 3O3MB 3OE7D 3U7QA 3DE2X 3PPVA 3WKCA 1QF9A 4ISBA 1AB5A 1IM8A 2Z0MA 4D3SA 5KJ6A 2AIRA 1FDWA 3WRXC 2PZEA 4W4TA 5HJ5A 3KUXA 1I4OA 2AOVA 2IYFA 2V98A 3B7WA 3B9RA 2ORVA 2XOKA 3F6CA 4LV6A 4PPYA 3RAJA 1NATA 5JV5A 4I9NA 2JLYA 4COOA 3GLGE 5KWEA 2NXNA 3D1LA 1UZLA 4TLEA 4QVIA 2VDJA 2R86A 5KREA 2DHQA 5I6DA 1MRSA 1EX6A 4BDSA 2C9OA 4B34A 4UM7A 3U4QB 3V42A 4UHFA 1P7ZA 2CXTA 2LCIA 4YJDA 2COUA 2IE0A 3GT7A 4D9NA 4DAEA 3RTBA 1IN1A 3OIFA 1XLTA 3KEMA 1R0XA 3TR6A 1E1YA 5LDDC 2Q99A 1R8YA 1RYYA 4NP6A 5CVEA 5JADA 3DLCA 4TLBA 3T7KA 1WCV1 2EYQA 4OBBA 2CV0A 2H08A 3CHYA 4DLRA 4HN9A 5ITZB 1JPUA 2IEYA 4BJHB 3K20A 5ICMA 2CKMA 4LWQA 1Z29A 2GKOA 2ZAIA 1SA0B 4Z53A 3NOOA 4UCQA 4TVBA 4EP1A 1BWQA 2WE7A 2AR9A 4ZEVA 4HGZA 3QW2A 2ZJOA 3IUBA 1NNEA 5TB5A 1HK7A 1XZFA 1VPDA 3VU3A 3ED1A 3VZPA 3R5KA 3PTLA 4JJAA 4C6HA 3LDUA 2NZYA 4ZOBA 1U3CA 2YC4C 3KKMA 3SC4A 1MVNA 3O93A 1A2BA 1EWYA 3K1ZA 3M6MD 3S1AB 3H04A 2YUTA 2FDXA 2NUTB 1OASA 3KZVA 5BOSA 3IPXA 2UUBB 1Q1AA 2IWRA 5IYZF 3ZW8A 4CLDA 2FNAA 1KC1A 1KJZA 5B3LA 2FV8A 4OP1A 2RONA 4IO1A 3FFWA 5CMLA 1JKIA 2H7VA 4GFDA 4FZVA 2GFQA 2QTVA 3N05A 1RP7A 2BI4A 5AVZA 1T8SA 3O47A 4JSYA 4P54A 3FF4A 3OUTA 4UNNA 3DUFA 4NENA 4PY2A 1DQPA 2AG0A 3NEYA 1I8TA 1KO4A 1TMOA 1ZITA 2DFLA 4G8DA 5EL0A 3SJBA 3ZU4A 1M9NA 1NBMA 2EP7A 2J3DA 3WLSA 3SHTA 1X70A 4KNYA 1JA9A 1IATA 4XD7A 1U2PA 4WASA 1JSRA 1CY1A 4LISA 3F9CA 3WHIA 2Z8YA 1FJGB 4RD3A 4HH3C 1Q2XA 3DFKA 5GTDA 3MWGA 3EH1A 3RAGA 2W2QA 3UGKA 4H1VA 4LXIA 4NK4A 3PUXA 4PEVA 4EG8A 2FZWA 2WYWA 2V6FA 2V9CA 1FS4A 1GD1O 1GZ5A 4AY3A 2C97A 4FSHA 3H87A 4OHBA 2QLNA 1BDBA 1R4ZA 1S2NA 3LW8A 1KC3A 2E89A 4KODA 1GNQA 4JU9A 4XLZA 1XV5A 4F6LA 5CXQA 4D9MA 3Q3VA 3IC5A 1GGMA 1W47A 3PXBA 4EJ6A 2XB9A 1VBMA 1R0WA 3P9QA 4PAQA 2JZNA 5NLLA 4EG6A 5C8DA 1XB2A 1GL9B 4QKQA 4N3NA 2B98A 4JEUA 3K16A 5H3HA 4CM4A 3MM4A 3OBIA 3PNBA 3I1YA 4MJLA 4M0CA 1AUXA 5E95A 4J0JA 2NZJA 2XA9A 4CBVA 1W5TA 1X19A 2G9NA 4CNBA 4F93B 1Y37A 2EW2A 2Z9DA 1QHSA 2Z5FA 2Y1GA 1UH5A 1TU0A 1N2OA 2WT4A 1C3VA 1NU6A 4HNUA 1L5HB 3EEFA 4A36A 5SYMA 4WK6A 3ZBQA 4IV8A 1BSVA 421PA 3WWPA 1OIWA 3WWDA 4CKCB 4RKFA 1L7VC 1NYTA 2L18A 2Q3FA 2WOOA 4P93A 1HTWA 3OOWA 1VHJA 3MCWA 1JJ7A 3VGJA 1QH9A 3HCDA 5FWNA 3P2KA 2IW1A 1ATIA 1GR0A 1O96B 1PT5A 1QXSA 3GLUA 3JW8A 3VR4A 4CMGA 2JCBA 3G5AA 5JXGA 3K70B 2WQZA 3RVOA 4JQYA 5IH7A 2CDBA 1R2QA 3C5EA 1RRGA 4TOIA 2Y0DA 4E5UA 1U4OA 4DLWA 4QJ3A 2BFBA 4AO7A 3NTUA 5CH5A 4IWYA 2I1QA 2QSJA 3PV0A 2H0RA 2P41A 1T3LA 1Z5GA 3C7DB 1W93A 3NKVA 4IIFA 4RLFA 4QYMA 3TIVA 4ZI7F 1EWQA 3O4HA 4YCAA 4L9WA 2MJLA 1T0HB 5KSWB 3NWPA 7REQB 3QITA 4X54A 2PX4A 4R41A 3HI4A 3U7IA 3PQ4A 4A8JB 3SLGA 4H27A 6GPBA 1TCBA 2AQ8A 2H2HA 3VZCA 3C39A 4EMSA 4BVBA 3QXJA 3S99A 4QAJA 2VF2A 1EP1B 4HTFB 5HIKA 2BONA 4BQNA 2JLZA 4OB6A 4P5EA 4QYIA 5CG2A 2ZJAA 1NQ5A 2WJ4A 1BRTA 2CFTA 4YECA 3J7AC 2X5NA 2YZGA 3OMLA 3L6RA 2GEFA 2HN9A 5T67A 1E1RD 1TX4B 1VL6A 1Z8DA 3NNDA 4RXTA 4I50F 5LP6F 2C2HA 2P4QA 1NF8A 1PN3A 3LT0A 1QHYA 2HDOA 2JHCA 3BMNA 4UU1A 1D0VA 1XVLA 2VDKB 3AO0B 3ZPXA 1DXQA 2G9ZA 3PUHA 1X80A 3WQRA 4K6KA 3G1WA 4MS4B 5REQB 4RY2A 2FEPA 1G7TA 2GEUA 3VHLB 4UM9B 2PUTA 1TQ6A 5B3AA 3RYHB 3H1GA 1REQB 3DR3A 5EJIA 3GLGA 4NKRA 1YJ8A 2FF7A 3NRCA 2Y71A 3ELWA 3QKRA 5EIWA 2A9JA 3E7PA 2M32A 3UWMA 4ZZ1A 1RZ3A 1X74A 4DMCA 4NONA 3NXKA 3ZNPA 5EE3A 4F21A 3NUQA 5FPYA 2QVCA 2L69A 4HP8A 5EVCA 2QE6A 2V0NA 3DMPA 2MSKA 2ZJBA 5LC1A 4OHZA 4C07A 5JD5A 3OTGA 2WUGA 4DCVA 2EAUA 2WUVA 2PNJA 2V7EA 3I1IA 1VECA 2WUFA 3RVRA 2XMBA 4YR9A 4MQUA 2IXGA 1R6BX 2DUNA 3ZHCA 1DGQA 1QCDA 2PZLA 4B7XA 1HNZB 4B3HA 4TYNA 3QPAA 3BAZA 4G4SP 5J43A 4KBFA 3Q0IA 4N6OA 4QTZA 5SZHB 3S7ZA 4F6RA 5IXSA 4BVHA 2W6JA 4NATA 1QNFA 3F6SA 1JL3A 1E9CA 1RYDA 1Q77A 2PGXA 4L9SA 1KORA 1EFHA 1QO7A 1SZJG 4XB6B 6YASA 1PK9A 5AIAA 1QIHA 2I9KA 2TECE 4FC7A 3VDXA 1K5HA 1YNSA 2FUKA 3AEKA 3JX9A 4D6PA 1OXVA 3KB6A 3E05A 3TEMA 3UH1A 2XVMA 4U7JA 1ENYA 4GD3Q 5C4MA 3QKWA 5CFQA 5EE5B 1NR7A 4H1HA 5IDYA 4C7VA 2OCDA 2XD4A 2OCIA 4LJKA 1HYQA 4MKHA 4OHPA 4EENA 2RHRA 3CS3A 3MD9A 4D9GA 1W7AA 4GMKA 1E64A 1XTQA 3VR4H 5DM1A 3EGXB 1CR2A 4QWWA 1RDFA 4XQ9A 4LPSA 2C61A 3PRJA 4XR9A 2YS6A 3FCOA 3H3JA 4LNUB 1XNHA 4C3OB 4C7KA 3H9CA 2RGXA 4Q03A 4CT4B 2TRSB 4QTUB 4DIBA 3RS4A 1UDRA 1WXEA 4WGGA 1XRPA 3VDMA 2O7VA 2GAOA 2FB9A 1C80A 1OR8A 4XJTA 2PGLA 2WJHA 4MO2A 3SC6A 5K0NA 1XTUA 3CISA 3F8SA 1DAKA 1ENPA 1JILA 4Q16A 5KTOA 4FTWA 5JJLA 2N1BA 2V7GA 2YUIA 5D1HA 4KLCA 3HFRA 2A3NA 3F3SA 1PFVA 3COPA 1KO8A 1DE0A 4BBZA 3OJWA 4K46A 2QRLA 5TF4A 1GHTA 2WV9A 3F96A 2R6CA 4RCYA 1XMXA 2FSPA 2QMQA 3PUJA 1A8UA 3M1IA 1RYZA 3H9EO 4GE0A 2GJAA 4N0DA 4UBMA 4A7PA 1BX3A 3BGOS 2IK8A 3O3CA 3B38A 2Z6VA 1JSCA 3DFMA 5JD4A 4WXEA 3PUYA 1ESCA 2Q27A 4BRSA 2LVBA 4J75A 1E3IA 3EXEA 3BCRA 3GFFA 3T95A 1U98A 4IF6A 4JELA 1ZHHA 4WECA 1RYEA 3N8NA 2Z56A 2P68A 3MMPA 4MRMB 4EO4A 2O8CA 3OG9A 4MKXA 3NHAA 1KP3A 1UBCA 2Y1LA 4A4DA 5BSKA 1G3QA 4X65B 4MB2A 3RAEC 2P9YA 1AA9A 5K6RA 1NFRA 4Q00A 5JVDA 2QL5A 4U2EA 4P4LA 2LWIA 1E3MA 1LFAA 4KACA 2PH3A 3T0FA 3KRTA 4C43A 3FHTA 1B8VA 1RYBA 4RZQA 2PWPA 3K4QA 2GZHA 2I03A 1LJ8A 3C8DA 3QELA 4WW0A 1T2EA 3KXPA 3A14A 3VNRA 2VAVA 3R9XA 3NBAA 4XSGA 1OBCA 1PZHA 1NMSA 2C9CA 2QPTA 3C6QA 3DD1A 2EFDB 5D7NA 4A03A 3VX4A 3DR5A 4O63O 1F2UB 4YJHB 2IQIA 4HZUA 1JSZA 5HCNA 4IRXA 3TLGA 5I51A 3OQMA 1MO3A 3NBUA 3NC4A 1H2ZA 2EBHX 3JZAA 4DNXA 1VLVA 2DPLA 4CKZA 5LDGA 3UUGA 4FEYA 3DCJA 5AUNB 4P3KA 1VE7A 3L6CA 4KJZA 4KWIA 3LUCA 4Y30A 3E82A 2BN4A 4BFZA 3O7WA 5U1PA 3GMSA 2IU0A 4RIGA 6NULA 1JDNA 1RQ2A 2HRQA 3Q7EA 4MUJA 2DWPA 3NALA 3UTCA 4HLUA 2XUJA 1JIIA 3KJIA 4EG1A 4ASUA 1GU1A 2I7VA 3FDZA 1ORIA 1A27A 1F8FA 3I8SA 3EPKA 3I28A 1OU0A 2V74B 4FYXA 2YXEA 3VYWA 5KQSA 4OH7A 5F52A 4Y6OA 1H8EA 3GJ6A 2P75A 1ZN2A 2HJHA 4HNRA 2HU5A 4P1ZA 5DCLA 1YCHA 4BGIA 2IYVA 2F1JA 1E3SA 1N0HA 2Z1DA 2ZPTX 4YACA 5MHTA 2HA2A 1L4UA 5DX8A 1KVSA 1VHDA 2WM3A 1TLFA 3DULA 3U3ZA 1CZLA 1DEKA 3LFTA 4ME6A 3W2FA 5JCJD 1GSAA 1W0JA 2O1EA 1H2BA 2PZMA 1H1LB 3PSHA 2EIHA 3UJ6A 1I24A 2YWXA 2EKZA 3GF4A 4G0XA 3KR2A 3SQNA 2CBZA 2IY7A 3EDMA 4UHKA 4BVJA 5B12A 1Q20A 2FR8C 3GLRA 4AJNA 4DMFA 5BW4A 2AJCA 2G1UA 4FZ5A 4UNPA 4O4IF 1AV7A 4J29A 1VMAA 3EISA 4MOWA 2LP4Y 1P19A 1JEYB 2DFTA 2JJ1A 1TM1E 3CIOA 3KBBA 1IXKA 2C7VA 4DJAA 4UXHA 2D59A 1OU4A 5PGMA 1A98A 3GU3A 2Z6QA 4EMBA 1SBNE 3K73O 4WJLA 5LNK1 1KSFX 3C1TA 3D2AA 1AKVA 1NW6A 1S02A 1Y1RA 1V2GA 1ZG3A 3ESXA 3CBGA 4O08A 1CT9A 3I76A 1VHWA 2Z2ZA 4CMJA 2R7AA 3LHKA 4PCVA 2CCJA 4IDAA 1XR3A 2O5VA 4E5KA 2F6RA 4L4UA 5LVAA 1N5JA 4QDOA 1V7QA 2F1KA 3GPCA 1G59A 1PUIA 2G9RA 1K6IA 3W5UA 2C04A 3GGJA 1IZYA 3EBPA 3RYTC 4N3GA 4GKVA 4INOA 5DBIA 2WPDA 3TO5A 3D02A 1LQ2A 1JKFA 3CW9A 3HGQA 4LHWA 2W2VA 4O0LA 1I6KA 1CY0A 1GNRA 1T8YA 4RPHA 4P5PA 3CF2A 4YJ2B 2RKBA 4ZRNA 2YINC 3A6KA 2WG0A 4Q3BA 3DLIA 3VR5A 3O21A 4MCJA 1GCIA 1ZRSA 5AM5A 1JAYA 4NMHA 2IYNA 4MQFB 1FW6A 3MQ4A 1F1BA 1DUSA 1NVVQ 5J5VA 4H1TA 3W3AA 2P5UA 1WB9A 4LXHA 3UN1A 4KI7A 3DB1A 4Q93A 4X44A 4S2UA 4OPMA 1R3UA 1JIQA 4CM9D 4EM6A 3D3WB 3NH6A 4R1MA 1VSVA 1ZK3A 3V5NA 3OQNA 1T35A 2PG3A 2PYDA 2CJFA 2Q62A 2W2KA 1B8PA 3DT8A 1CEEA 1Z4JA 1DOHA 4HSEA 1GPBA 4ERXA 3OX2A 3ETEA 5A9RA 1I10A 1Z6XA 5LCXA 2ZI6A 1F6DA 1RRPA 2AS0A 4Q7KA 3T06B 2VQDA 1JS1X 1WMDA 3FYHA 5TLSA 1G21E 1Y3HA 2VYQA 2JGKA 2VRCD 3F4BA 4R7GA 2DT8A 1JG7A 4E7PA 4BNLA 1V41E 1BWPA 2H4XA 3GL9A 3K9LA 4QDKA 4N5IX 4GR5A 2F67A 2OFOA 5KNLA 1P61B 4OU4A 3L3BA 1PGQA 5IABA 2RAPA 5DF1A 1OH5A 1CIVA 2YIVX 4NU8X 1AURA 2JAOA 3BHJA 1NQUA 2H48A 1NR5A 1RAEA 4N0MA 1ZESA 3KLBA 1FSSA 2I6GA 3OT5A 1ND5A 5EYPA 1E3DA 5L6MB 3EEBA 1ATZA 3G8AA 1ZK2A 3AI1A 3IA2A 3W8RA 3D8UA 4FB5A 3L93A 1MVOA 2H18A 1G21B 2IF2A 2LGJA 3QIAA 4G5SA 1D2HA 1UFQA 4OMFG 2B34A 3BRQA 1PSWA 4HWOA 3ZHQA 1JLLA 3D4IA 2YV5A 2KLBA 2C1XA 3UQZA 2QMUA 4R3UC 4W7SA 3CMCO 3ROKA 1CV2A 1KJQA 2I2DA 1ITZA 1BDJA 4BGEA 5HX7A 2XNCA 1UBFA 1ODFA 3JR3A 5TMPA 4QYWA 3LT4A 4TKUB 1U2ZA 3TDNA 3Q7SA 1QIKA 3EVTA 5HRAA 1YI8A 1UJ5A 3KKQA 1KNXA 3U16A 1YONA 2X4IA 1EAYA 1JR3D 3CXRA 1C1HA 3EULA 3K5WA 5HUQA 1AG9A 2QX8A 3S4YA 2JCXA 3FPGA 3FOAA 3MINA 5G02A 5CK4A 4NMLA 3CNNA 1ZM9A 4JL5A 3U3XA 4E46A 1OWPA 5LD2C 2HO5A 1W4BA 3N6XA 3V80A 3OE7A 4UBKA 3ZQ6A 4DV3B 5DE3A 5IJWA 3SXUB 5HSGA 2EOAA 2PO7A 4PINA 3THYA 2NADA 2DY0A 4IP0A 2IIPA 3EIOA 3GJZA 4OQXA 5EKTA 1YS7A 4Q9NA 4UEJA 2HYIC 2A86A 3SJZA 1T6YA 3A26A 3BXZA 3CEHA 1DBRA 4NNJA 4B0OA 1JWAB 1Z4IA 4C2BA 5E8RA 3U6BA 5KHAA 4WXYB 4K0KB 1M2HA 3DMTC 4GMDA 3R3UA 3UG6A 4Z54A 2FY8A 3R1IA 3KQQA 4LIPD 3P9RA 4WX2B 3S7TA 4UNSA 3UMMA 1USVA 2POQX 4LV8B 2E85A 4O0MA 4XGRA 1E69A 3BJEA 4DSNA 2ID8A 4TVSA 1Y9JA 1QKJA 3HA5A 3NNNA 1V9LA 3NBQA 3C48A 1CZKA 3DHWC 4IIJF 4AQYB 1DAGA 3RSLA 5J2UF 1QWSA 2OGTA 2X0RA 4B87A 2QV7A 2XMDA 4DJEC 3VR5H 2D4AA 3EGDA 5K8IA 4JBLA 3GYGA 1ZEMA 4N5MA 1YGYA 4RKRA 1ZR2A 3CEAA 3LLMA 1AH2A 4HOYA 1BVUA 1J22A 4TRRA 3RE1A 3AF5A 1QRAA 1KARA 1SHKA 1UDAA 2J3EA 3ICPA 3W3AH 5JT1A 4IY1A 1LB1B 1WW3A 4XRRA 5DK4A 3NYWA 1N4AA 1NNSA 4EFLA 4LXTA 4QBGB 1Y3CE 2CVFA 4JZKA 4M1SA 4UD6A 4ETWA 5LIPA 3HYNA 2YHBA 4FWTA 5I7RA 3KXIA 3N8DA 3GUZA 2HD4A 2PSSA 1VGQA 2IHUA 1Q57A 4HH0A 1I2ZA 1T24A 4ZEXA 3T3GA 2PDAA 1KFKB 1ZN8A 1U0HC 2A0UA 3GRFA 4LA4A 2ZTLA 4M0PA 4U39A 4WKPA 1EQUA 3NHBA 1L5LA 2R6FA 5DISB 1SOMA 4YDQA 3Q9LA 2YQZA 5LYJB 2XLCA 1Z2PX 3RREA 2FMXA 1V3VA 3DXFA 3QVSA 4HX9A 3MSXA 1NQTA 2L19A 3NCTA 3E8MA 2R6HA 5GVRA 1JFFB 5DJ5A 2VNIA 4B0PA 1LCIA 2GH1A 2WKQA 3BOSA 5DNWA 5AW5A 3GFPA 3U5TA 1JF8A 2A59A 2BMWA 4GI1A 4OATA 3FHJA 1ZMOA 4YQEA 3ZK8A 1N8TA 2BGKA 1JT2A 2CBGA 3TX6A 4I8DA 3IQGX 2Q07A 5AKLA 4WOKA 1E7RA 1VIMA 4DCTA 3VKHA 2H2WA 1RRFA 2WFLA 1IL0A 3AI2A 3CUKA 2C7PA 1TA9A 4JB2A 3Q9NA 5B1HA 3IALA 5BOVA 2OQIA 3EW7A 3FG9A 5L53A 2ZS8A 3ZWMA 2BW0A 3ZWNA 1TF5A 4IHQA 4IMIB 4GE3A 3BREA 4DLLA 5JSQA 4J16A 3DM5A 5F4BA 1UIMA 5AI4A 5ALTA 1AS3A 1VKJA 2V4UA 2ZSUA 4MW2A 2Q4RA 4J3FA 2FMKA 4YP6A 1RCUA 4FONA 1FNDA 1SAYA 5D2CA 3QYPA 1PJQA 5CBPA 3DDUA 2FOXA 3E1SA 4Y9RA 5EZYF 5IUJC 4RY8A 4BN0A 3RC1A 5I48A 4JX8A 3TZEA 3WLTA 1PNOA 2Y66A 2O7QA 3IH5A