3B2EA

Crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
349
structure length
307
Chain Sequence
b'LTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDLADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Get1 stabilizes an open dimer conformation of get3 ATPase by binding two distinct interfaces
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 95
structure length 307
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b2eA00
2VF7A 4F4CA 3C5HA 3SZRA 5DHFA 3RANA 1NBMD 1EXMA 4WIAA 2JGNA 2WAYA 1ZRHA 2X8AA 4HLUA 1M7GA 5JCPA 3G0HA 2FGJA 5DYGA 2QUZA 2FPLA 1L4YA 1C4OA 2EFGA 3LNCA 3NC1C 4A6XA 3AVYA 1ZD9A 1B23P 2ZR0A 4AI6A 3ZH9B 1OXTA 2PMDA 1XDBA 3VKWA 2CCGA 5BYKA 3QF4A 5DLQC 2W58A 1II8A 5GJVC 1D2EA 1RYFA 1Q1ZA 3V9PA 2W0SA 3CNOA 4M1YA 1X1SA 1XD9A 3OEHA 3AF1A 3LRPA 1ESMA 1GDDA 3IO5A 2ZU6A 4B44A 2ZXUA 2NPIA 2PEZA 4I99A 4DEYA 4II7A 2CBZA 2R65A 4WZ6A 4PPNA 1WP9A 4MRPA 1E2HA 4BLQA 1P2TA 2N1BA 1CS4C 1WRBA 4YXWD 4X8LA 4ABYA 5FH9A 3O8DA 4NL4H 3T35A 1E69A 2D4HA 3C4JA 3QVUA 2IWHA 2C78A 3FE2A 3REGA 1CP2A 3E2IA 4DLRA 4PC3A 2JA1A 2OFXA 1NLZA 4C0KA 1G19A 3TK1A 4JLPA 4MYUA 3GLGB 1XPOA 4BFTA 3W6OA 3U7EB 3QPWA 5IHPA 5F9FA 3OAAD 3R20A 1KDOA 2EQBA 2V8OA 4PQYA 4EQ6A 4P32A 5AWFC 3I73A 2AX4A 4Q1AA 4HB3A 1WBDA 1COWD 2DCUA 2J41A 2WJJA 3BS4A 4V0NA 5DE3A 4IXNA 3SFZA 2ZVQX 1KK1A 2ODEA 1CR0A 1F2UA 2QMOA 1WB9A 1IXRC 2JASA 2ZI3A 4NH0A 3WNCA 4IVQA 2X1VA 3UATA 5A5GA 5H8WA 2E87A 5KSZA 3AQ4A 1VKJA 1H65A 4MRVA 3VX3A 5JS7A 1KDRA 1Q22A 4AG5A 1ZCAA 4M2LA 4P4UA 4D4KA 4G5QA 3KQHA 4FXPA 4PSAA 1D6JA 1OH6A 4FI3C 3D31A 1X8JA 4DCTA 4TSFA 4C4PA 2G77B 1DAMA 2C2HA 2G0NA 1E32A 2JJ1A 2YINC 4R98A 4DDTA 1EFRA 3QG1A 3THXB 2ZITA 2P2LA 3B1WA 4WXPA 5BQ5A 4B3XA 1WDTA 3M4YA 2ZPTX 4DLZA 2GBLC 3AP3A 2RHDA 1O3YA 3UK6A 3DVLA 1DBSA 1E0JA 3R9WA 3SC3A 1GWNA 1XD8A 5A0FA 2VL7A 1QHIA 4D4MA 2ZIAA 3QE0A 3FFBA 1SHKA 5J47A 2ZJBA 1J70A 1OW3B 3O8BA 2J0UA 1J2JA 2NQ2C 3TBKA 3X1XA 5JHGB 2FEMA 1P60A 3RS7A 4W9MC 1P5ZB 2IXEA 2AKYA 4KFTA 3SEAA 1CKEA 1GL6A 2HLDA 1KO5A 2VSFA 4LHWA 4YONB 2D2FA 3RWOA 3ZZTA 2FG5A 4Q48A 4RFSA 4URWR 5IT5A 3T12A 1E2EA 3K0FB 1EG7A 4XOIA 2AHOA 2ZJ8A 2YKGA 1IN8A 1SVOA 4EDHA 4L5BA 2ZRCA 1AZSC 3CF0A 3WMFA 3THYB 4KODA 4P4SB 4EFMA 1W1WA 2Q3FA 3BERA 4BFUA 1W5SA 3NC0C 2PLRA 4DCNA 4JS0A 4F92B 1F5NA 4Z51A 4OI4A 4QHYA 1MABA 2YNMA 2PCLA 2QG6A 4M1KA 3O8RA 3GJXC 2TMKA 4HUQB 1XNJA 4MKIA 4XSHA 3RYTC 5G41A 5K8UA 1G291 1G9XA 1L2TA 1NMZA 4JLBA 4A9AA 1P3JA 1VTKA 1SHZA 1Z8FA 5KNDA 4LC1A 3BC1A 1T0JB 2HF9A 4PFSA 5J4LA 3IBGA 3KXKA 4OK6A 4QNMA 2C77A 4O25A 4KHZA 1WXQA 1ZUHA 3B85A 3DO6A 3JVVA 4GPTA 5FR1A 2NOAA 5FBWB 4B3FX 2O8BA 3RRMA 2G88A 2P3SA 3E70C 4N3NA 4ZPXA 4A82A 3HU2A 821PA 4US1R 1AS3A 5TVKA 2ECKA 4QHTA 2AD1A 4RD1A 1P9WA 3S1AA 3GLGE 1Z0IA 3OIYA 3X1ZA 1E1QA 1GKIA 3OEED 4MKFA 4OHWA 4ZCLA 4EKDA 1RE0A 2NGRA 2P6UA 4EFNA 1DAFA 3UMRA 1TTTA 1TF7A 2WJYA 3QUSA 3RSOA 4C0SA 1Z3IX 1SKYB 1VIAA 2BCGY 2FGKA 1W0JD 1OXSC 2QPOA 2WOJA 2YOHA 1CJVC 3LDAA 2OUKA 1EWQA 3TH5A 1PV4A 2ZRHA 4B76A 1E79A 1QZXA 1MO5A 4NHOA 5AJYA 3PJRA 1R5BA 4V0MA 4Z1MA 3UG7A 4B3CA 1NVUQ 1QHYA 3DMNA 1CLUA 1I4TD 1ZM4A 2GJAA 2WM9B 1RPZA 4U5XA 2A3RA 4G5OA 1ZBDA 2GXUA 1KI2A 4CEHB 4LBYA 1UF9A 4C3ZA 4HB0A 4A8JA 4XD7A 2VQSA 1S4QA 1U0HC 2NO0A 3UPUA 4LBVA 2GILA 4BLSA 2BMEA 4G01B 1DG1G 1SXJD 2RGDA 5H70A 4GL2A 5BXQC 5H1YA 3BE4A 4LJ4A 3B1YA 3IPYA 3R7WB 5C18A 5IRCD 5FI1B 1JR3D 2J59A 2YWFA 4PAMA 4M9QA 2C9OA 4LBZA 5BYJA 1YKSA 4G1UC 2QZ4A 3SR0A 1C9KA 1JQLB 2YWGA 2P6NA 4PHFA 4TT3D 1R0YA 4TTQA 3CW2A 1G7TA 1U2RA 4O2LA 3AGQA 3OZXA 2HJGA 2VHJA 1S0UA 1YRAA 2G3YA 3GLIB 1NKSA 1D9ZA 3W5IA 1JALA 3THWA 1D8TA 4KYIB 4NCHA 4TLCA 4FMCB 2GEVA 1D2MA 3PEYA 4CW7A 1E94E 2EWWA 2FDCA 3CX7A 1P7CA 4P0TA 4UKDA 2ZRBA 4Q5IA 4L8GA 2AL7A 3N5CA 1E2GA 3A1VA 4C2UA 5BW8A 1JEDA 3AKCA 2JDIA 3A4LA 1NY5A 1F6BA 1VYUA 2N46A 4PAOA 3CF6R 1VMAA 1DELA 2AWNA 2ZR7A 3CX6A 1WBBA 3EIQA 4V0KA 4URVR 3MUFA 3SBDA 2R6DA 5F3WB 4A2WA 1VIYA 1Q44A 5HKKD 1YZNA 3OESA 4A6PA 2QM7A 2GK6A 4C0QC 1OH5A 2Q9AA 4WZBE 3B13B 2ZUDA 5FTKA 2XGJA 5KDOA 4TQAA 1R2QA 1VCIA 4XH9B 1E2IA 2BMFA 2QGZA 2V7QD 1KDPA 1G17A 4LK2A 1DG3A 4Q4AB 4MQBA 4QHSA 3ADBA 4IVPA 4OBEA 1O87A 1W0KD 4M9SA 3K09A 4J0QA 5CLQA 5EP3A 1NLFA 4WW0A 3I1FA 3U7GA 1G6OA 3UXMA 1KK2A 3KX2A 1J90A 2PBRA 2REBA 1HV8A 3WP0A 3SHWA 1G8GA 1OHHD 4FCTA 2ANCA 2VF8A 3AGPA 3ZQ6A 2WMOB 3T61A 5LDDC 3CZQA 4EPVA 4R2HA 3TVDA 5JJLA 3EPHA 2IHBA 1R5OA 5F9HA 1LW7A 2ZREA 2QMUA 3DEFA 4QC2A 4L4UA 1Z83A 2O8FB 2ERXA 4JL5A 4MDFA 1C1YA 2FSIA 3Q9LA 1U9IC 4NTZA 1NBME 4B48A 4BLPA 1KO8A 2ZS8A 3FFAA 2WIBA 5FPKA 1OXXK 2IF0A 2Z5FA 4WBSA 2BDTA 3NBYC 3QJYA 3DPUA 5L3SA 3TR0A 1SKYE 1FMLA 4LBWA 4B2IA 2F9LA 3B1XA 4FMBB 4A0FA 2DYKA 1OF1A 6Q21A 5AUQA 1MR3F 1S1MA 2ZRDA 1NG9A 4M22A 3MWLA 3CPEA 4JMPA 2ZR9A 4A0GA 5AUNB 5CB6A 4DLSA 4D0LB 5A4JA 2QPAA 4OQNA 4LI0A 2OV2A 5FOXA 3V00A 2V1XA 2WZQA 4OK5A 1G8FA 3FHOA 1M34E 5CK4A 4ASUA 4TLBA 2RGBA 2WJVA 2ODNA 1Y63A 3P26A 2F3TA 4ARZA 4DCVA 4Y0VA 4TMZA 5P21A 2C95A 2NIPA 2KJQA 4RZ3A 3RRYA 2WTUA 5EZ6B 2ZROA 5EXTA 3TUJC 4LHYA 1E2FA 2ZSBA 4LHVA 1XPRA 3EIHA 2UZIR 3DMDA 1G4UR 5KPJA 3T1OA 1NJFA 4LWZA 1Z0DA 2VHTA 5JWRA 4ESHA 3LD9A 3JVUA 4OKSA 3SHFA 1IN5A 2F43A 4HLQB 4MITA 4B75A 3WRYC 1EFCA 3NH6A 1BOFA 2Q9BA 3RRZA 1DPFA 1JQJC 1VHTA 5TV2A 2ZSEA 2JJ8A 3U7HB 3I92A 1GM5A 1I2MA 2CMKA 2XB4A 4BLRA 3TQCA 4YMUA 3IBYA 3EIEA 1E0KA 4Q47A 1DEKA 2VP0A 2F1HA 1OIVA 4FWTA 1OFHA 3C14C 4RSGA 3MLEA 1Z07A 1M7BA 4QBHA 3CO5A 4BFYA 1N5LA 4HAWA 4Q9KA 3U5ZB 2O8EB 5FOVA 4YLGA 3BOSA 1FNMA 4D4LA 1XFAA 2R9VA 2PLFA 1XTIA 4LYFA 1L4UA 2OT3B 2KWIA 1NIPA 2W6JD 4NP6A 3BGWA 2OLKA 5D3QA 3IO3A 1ZJ6A 4KI0A 3QXCA 2RGNA 1NI3A 2VP2A 3IEUA 4NONA 2WKRA 1XB2A 3CRW1 3LA6A 2W83A 2Q0HA 3WYGA 2QSZA 2FPMA 5CB8A 1SXJB 1ZAKA 1KKMA 4H1UA 4QGAA 3OIUA 5HR5A 1E9SA 1TUIA 1LS6A 1KI9A 5EQTA 3CM0A 3ETLA 1G7CA 3NTUA 5KSYA 1XXHA 4GFDA 4URZR 4GMXA 4RKFA 5KPDA 3GQBA 1KO1A 1NVXQ 3GJ4A 3E1SA 4M9XA 4RJLA 1UFQA 2CNWD 2DPXA 4B43A 3U44A 4EJSA 2W6IA 4Q19A 4AY2A 1VYTA 2H17A 3B1VA 2ZI4A 3ZVRA 5JEEA 4ESVA 1XZPA 2O8DB 2B8WA 4EPWA 1J99A 4CZ2A 2GJSA 4LJ7A 4B6EA 4CYMA 2X2FA 4DLVA 5DSZA 5SZHB 4HB4A 4B73A 2VSOA 1GG2A 2RGGA 1XJCA 1VDZA 5G3YA 2C5LA 4C0LA 1TL7C 5C1BA 1QF9A 2JJ2A 2CE7A 4EUNA 2QE7D 2F1JA 4IDOA 1IOZA 2FX3A 1VCNA 3C7KA 2W00A 4LV6A 3T5GA 4DLXA 4DUGD 3QPVA 2LCFA 4DCSA 5JJIA 3I3SR 2XB2A 2F1IA 1KTVA 2GVDC 1G16A 3B60A 3PIRA 5EE3A 3A4MA 5J4YA 2ZAMA 4K81B 4AYTA 2ZRJA 5D3MA 1US8A 4DBLC 4WA7A 3LQQA 5EXSA 5DH9A 2ZETA 1OFIA 4KO8A 1XD2A 4DIDA 4BGDA 4OQLA 4DDVA 2LKDA 1JAHA 4C7OA 2H1LA 4NBSA 3VKGA 1H8HA 3C41J 4NE2A 1IN6A 4JLKA 4V0LA 4CT5A 2CHVA 1TEVA 4JJKA 4DIEA 2I4IA 1NMXA 1NN0A 2LWIA 1VG8A 4CT4B 2OFWA 1CEEA 3NEYA 2QAGA 4G5RA 4Q9LA 2QBYA 4NCNA 1FX0A 3FTQA 3ZGXA 4OL0A 5IK2D 2J0QA 2OBMA 1NRJB 3TW4A 3H4MA 4NYJQ 5SZJA 3KTAB 4PSKA 1SULA 5FL7A 1GNRA 3EXAA 2E9SA 2OCPA 4FCVA 4OHYA 2CK3D 1GKYA 1DAEA 1KAOA 5CM9C 1N2CE 4QBGB 4RY2A 5SZIA 3KZ1E 1OKKA 3PUVA 2FFQA 1GRNA 2WIAA 4LJAA 5TARA 1FUKA 2R6AA 3H86A 3K1JA 1RFLA 4D2IA 4BLOA 4KITB 2ZYVX 2IWRA 3E5HA 3ICQB 8OHMA 2VBCA 5E4FA 2WAXA 1DADA 5TB5A 1XMIA 4NYJR 2ORIA 4DC9A 5CIWA 5SZKB 4JJZA 3AVTA 1SVWA 2FFAA 4Q9IA 2GCPA 1OFTA 2OEPA 3BBPA 4KVGA 2JIZA 1FOEB 3EWSA 4TL7A 2ZI7A 1G3MA 2WBLC 3FPAA 5J40A 4CRWB 1F2TA 1GVNB 3PFIA 3K0AB 3KKNA 1KY2A 2O0HA 3QOFA 4QFMA 1X1RA 2ZRMA 5F2EA 1S3GA 4TL8A 3GLFA 2P65A 3VHXA 3AKYA 4AWXA 1SXJE 1XTSA 2H8KA 2J7KA 2QM8A 1T5LA 3CLVA 1M2OB 1QHGA 3KJGA 3EWAA 4TLEA 2C8VA 3VNVA 3D3QA 1LF0A 1JR3E 1M7HA 2G0TA 5JSZA 3GFOA 1X8KA 1ANKA 2WWIA 3LX8A 1OXVA 3VFDA 3PEVA 5M04A 2B8TA 2FEOA 1MOZA 1Q1BA 3WRXC 1BMFD 4ZDKA 5AJWA 1G18A 2XTNA 4Y0AA 3CR8A 4CF7A 3DKVA 4ZO4A 3LXXA 3VR2A 3AF3A 1PUJA 1YZQA 2JLUA 1VG1A 3A1SA 3B9PA 5FOSA 3TIFA 4G3XA 1V43A 2QP3A 4HZUA 1A2KC 2O8BB 2QRZA 2QMHA 4QGGA 3L0SA 1E1RD 1NN3A 2YOGA 3LWNA 3OE7A 4NDZA 5HPYB 3U4QA 3P4YA 1GIAA 1Z08A 1G5RA 2GJ8A 3V4RA 3SE0A 2OHFA 3EASA 4FWIB 1WA5A 1E4YA 1W0JA 5AJZA 2FSGA 1XCGB 2GBLA 4BASA 4KCGA 1NKTA 4E09A 1VYVA 4HAVA 1G6HA 1W5TA 1YQTA 1ZM7A 2GK7A 4JLVA 3L43A 3K0SA 1YZGA 3X1WA 3NHAA 3QXHA 2MSDB 1MO3A 1W2GA 2C99A 2GJKA 5JRJA 1SVKA 4B33A 1SVSA 5GJBA 3LQRA 2D7DA 1A5TA 1CF4A 3CWZA 4DT1A 3TKLA 2XNDA 4ZI3A 4JVNA 1WCV1 2MSEB 1IAQA 1JXOA 3MSXA 3P32A 3QKRB 1YVDA 1DE0A 2QT0A 3U61B 2J7PD 1Z6AA 3X1DA 1RRCA 4A36A 4P31A 1EK0A 2ZUCA 1Z63A 3RSLA 4YQFA 2AR7A 1W4RA 3B2EA 2ZSDA 1NP6A 3LVQE 1VECA 3U3MA 2QORA 2JLYA 1N5IA 4AK9A 5E3HA 1W4BA 2PEYA 5B2ZA 5EP1A 3QKSB 4IHQA 2QU8A 1PLKA 4PC6A 4Q00A 1ODFA 3LO5A 4ACBA 4DCUA 1SVLA 1E9BA 4ZIRA 1KKLA 2YZ2A 2ZJOA 3ZIAA 2QP4A 2EVWX 1W7AA 3SYLA 1LS1A 1XEWX 1V5WA 3B5JA 3W34A 1W49A 3ZS9A 1Z5ZA 3C16C 3IPXA 3LW8A 3L8YA 5L3VA 2KSQA 4P33A 4PO1A 5DN6D 4PZZA 1Q1EA 1DO0A 2VP6A 2REOA 1MO6A 1Z0AA 1CULC 2DY1A 2QSYA 4TTRA 4B71A 3W3AA 4C0HA 1S9DA 3BWDD 2ZEJA 3QKTA 4GOXA 4RCYA 3EPJA 1NIJA 1P75A 1YHNA 1TQ6A 3P4XA 4LV8B 3RHFA 4GI7A 1UKEA 5FUXA 4UNQA 1CRQA 4JLNA 1T6NA 4M4SA 2JLWA 2BIFA 3HU1A 3KFVA 4MUAA 1WE2A 2I1QA 4Q7KA 5EUMA 5J4VA 1OSNA 4HDQB 2RGEA 1ZC3A 3SN6A 1G64A 1Z6GA 1CR2A 4KSCA 5AR1A 4C0JA 1QG2A 3I61A 4DB2A 4W5WA 5JS8A 4B47A 5FTNA 1VCOA 4HDOB 3RDPA 5G40A 2KBEA 2V7QA 3LH5A 3DKPA 1OYYA 4EAQA 2XOKD 4JLOA 1T3LA 1Z29A 2J87A 2CJWA 1T91A 1KJWA 2MMGA 4IOMA 2C9CA 2QI9C 1GSIA 2B7CA 4BZXA 1KSGA 3PITA 4XTRA 3RS0A 4F91B 4Q1BA 1P4SA 5FBLB 1GZSA 3MWKA 1UBCA 3CUEF 2WJGA 1A4RA 3HR8A 4HLUC 5FBVB 4AKEA 4CEIB 2H18A 5E7JA 2ZE8A 2JLSA 4ZKDA 2ZS7A 4HEJA 1N6LA 3EARA 1E6CA 2DR3A 3AF4A 1SXJC 3VU9A 2E1RA 4M1TA 5HZKA 2EFDB 4EPTA 2CVFA 4R9UC 4EPRA 4MH0R 3Q85A 1W48A 3QEJA 3CKLA 4BFSA 4BLTA 2DB3A 3C15C 4QM7A 3L0OA 4LDJA 3CPJB 2XXAB 5TY0A 4LJ6A 4Z8YA 3QG5A 2EFCB 3NH9A 1AS0A 2NO1A 1QVAA 2CCJA 4GRAA 4IW3B 3RC8A 4Q4HB 4DLUA 1XPUA 2J0SA 1OB2A 5FL3A 3K0CA 3LBHA 2FE4A 3FHCB 1UEJA 1GRRA 4XSGA 5HCIA 4B2PA 3FDIA 4L9SA 5CK5A 3UG6A 3CRVA 4AD8A 3CNNA 1SZPA 1KGDA 1X86B 4IEEA 4MGZR 1SKQA 5L3QA 1OH8A 1JB1A 4XWKA 1OV4A 2YJTD 2I3BA 1J8YF 2GDJA 3Q5DA 2QT1A 4DHEA 2IHYA 3GCGA 4JLAA 5KSOA 5CM8B 3UKDA 3Q72A 1UKYA 4QJ4A 3IIMA 4LY6A 1G3IA 2VP9A 2O0KA 3CZPA 2VYFA 2WPDA 1KMHB 1Z28A 3KUCA 4NZYA 5FBRB 2DWPA 4HSEA 1CR4A 1QG4A 1RVDA 1YZUA 1GTVA 2HYIC 4R7ZA 3TUIC 2XZLA 3PEUA 3CH5A 1SVMA 2D62A 3UWOA 3OFND 3B6EA 3K70C 4AIIA 2NTYC 1UJ2A 1L7VC 2F43B 3T1QA 1IJFA 2ONJA 4QBFA 4M1MA 3N2IA 3B78A 1ZNWA 3GMTA 4HZIA 4NKRA 1YZKA 2FNAA 4GBMA 3VX4A 2O8CA 3KB2A 4URXR 3MCAA 1OE0A 3AV0B 4V02A 3C8UA 3KJEA 2IS2A 4RKEA 4P3YA 4JSTA 4TMKA 5FOUA 3WYFA 1E0AA 3K8YA 4UXJA 2XZPA 2A7QA 2FJUA 3FKSA 3RS3A 2R8RA 3PUWA 2H7VA 2QNRA 1OYWA 1SGWA 5B58C 5CITA 1TU3A 3K9LA 4MRSA 2OM2A 4IDHA 1N6RA 2IYXA 4V03A 1KZGB 3DDCA 4JL6A 4B32A 3H2YA 2W2TA 1Q12A 4M8NE 1NSTA 1BYUA 2P0EA 5EP4A 4ZCIA 5JBQA 4C2TA 1XJ0A 1UKVY 2REXB 3MFYA 3ONWA 4RD0A 3SFVA 5J4KA 3AEZA 1TNDA 3ASYA 3ZYCA 2Q6TA 2YYZA 3DHWC 4I1SA 3Q8XB 4G5GA 3NBZC 4N0EA 4X8HA 4YMWA 1E2PA 2WSSA 1AS2A 2V4ZA 1OIXA 3DM9B 3LLMA 3OEHD 1T5IA 4JT4A 1U81A 4FW9A 4RD4A 4OI1A 1HUQA 3PUYA 1XXHB 5L8VA 3VKHA 4C30A 4Q03A 3BFVA 2VPPA 2WJIA 1G7SA 2RCNA 1MKYA 2EFHB 2ZU0C 3HR7A 5LPNA 3W6NA 5DIFA 3TSWA 4NYMQ 1ZINA 4TWZA 3AVWA 1YE8A 2VHCA 4EJSB 2AWOA 4B34A 3LY5A 1G41A 3KJHA 2NG1A 1PJRA 3GJ0A 3NXSA 3EPLA 2D3WA 3A58B 2OAQ1 4XVQA 5DI9A 5HZHA 5J4HA 421PA 2B21A 4IFEA 4HAZA 4M0LA 5DISB 5IF9A 3W5JA 3SOPA 4KAXA 4E5UA 4EIWA 4TQUS 1Q3HA 1G1MA 3AKEA 3M1IA 1XX6A 3RS2A 4NYMR 3I32A 1Z22A 5ANRB 1R6BX 3QF7A 4L9WA 2ZJZA 1P73A 3PXGA 4TYPA 1ZUIA 3TSOA 4QXAA 5KNCA 3GJ5A 1HE1C 1VG9B 4A2QA 1NN5A 1T3SA 2J46A 3SYKA 721PA 1MH1A 1KK0A 2QQEA 2ZE7A 3FMOB 3K70D 1AZTA 1US8B 5TDHA 3HYRA 1R0WA 4Q9HA 4KFSA 3GFTA 2GCOB 4QJ5A 1R5NA 3THXA 2BVNA 1GRQA 1KO4A 2ERYA 3GD7A 2BMJA 4UJ5A 2OXCA 1UM8A 1Z6XA 3U2QA 2OCAA 4OJKA 1GAJA 3AF0A 5E7IA 2XSZA 4TMTA 1FUUA 4YC7A 2BOVA 5TMPA 3ZD7A 2W2VA 1GUAA 1ZUNB 4TSFD 3QXSA 2HCBA 2JJ1D 2O0JA 4U00A 1EFRD 1II9A 1M8PA 1NF3A 2CL7X 4HB2A 3W6PA 4BEJA 521PA 4US2R 2GVZC 1NN1A 2NZ8A 5JI3E 5TXGA 3QSYA 2GCNA 2HXSA 4GZLA 1AM4D 2JAQA 2F55A 2JLVA 3KFXA 1ZM3A 4M9ZA 1KI6B 1N0UA 2HT6A 3CX8A 4BZQA 4TN1A 2QAGB 4BQSA 2JLRA 3JZAA 2CK3A 1FX0B 1K5GA 2JEOA 2Q3HA 1SQ5A 2PZFA 2FU5C 3NBXX 4RVCA 1XEXA 1P2SA 4KFUA 2WWYA 1BIFA 2YWHA 4LRWA 1G3RA 3F3YA 1LFDB 1QHHA 5HE9A 3UMSA 1T8UA 1XMSA 2B92A 3B82A 1RC8A 1W36B 4BECA 1KI8A 2QA5A 1N0VC 3K0FA 3K9NA 3TSZA 4A8JC 3M6AA 3JZMA 3L2OB 3MAAC 4TYQA 3RNLA 3Q5EA 4EPXA 5EJEA 2HLDD 1H8EA 3OIVA 5JECA 1P9RA 4XJXA 5EE9A 3THOA 2ZM5A 3THYA 2X19A 1FNNA 1TU4A 2NO6A 3BH7A 3RVBA 1OB5A 5EZ5A 2VHQA 3KJIA 1CRPA 5KUTA 4LHXA 4FIDA 4OI0A 4O3MA 5JWHA 3ADDA 4EFLA 221PA 2DWOA 4PXAA 2C9YA 1RRPA 4E22A 4Q7LA 1FTSA 2WWWA 3D8BA 2GEDA 2CLDX 2QTVB 2J1LA 2C96A 1E99A 1CBUA 1J7KA 1CJKC 2W2XA 4HLCA 3MMPA 5KYKA 4ZKEA 4M1WA 5KDDA 3HPRA 4JBXA 4IDNA 3K9GA 2JLXA 2O5VA 3AB3A 4U02A 4LJ8A 1FP7A 4TMXA 1NLYA 1RJ9A 3EX7C 3AVVA 3WBJA 1NJGA 1HE8B 5BN5A 4BRWA 4JVLA 1XXHE 4DWJA 4TYNA 5DI3A 1IY2A 2J9RA 4QRHA 2PZGA 2WHXA 3LVRE 1E98A 1WQ1R 3PUZA 1ZNXA 4MKGA 2BKEA 1Z06A 4FCWA 5HTKA 2IYQA 3VTKA 1UADA 1OH7A 3FOZA 4TLAA 1R10A 2NO7A 3O47A 4GDFA 3REFA 1NBMA 3MGCA 4JVSB 2F9MA 1UDWA 4YMVA 3NG1A 4I81A 2N42A 3DM5A 2ZSAA 1BKDR 2BEKA 3WMGA 4GOKA 1FQKA 2FZLA 2CLSA 4ZDIA 4CEJA 2XJ4A 4UXHA 1E1QD 2RAPA 3RAPR 3W3ZB 4GP7A 4Q18A 4BPBA 4ZDWA 1UKZA 4H9GA 1UBEA 1CR1A 2IYWA 4BE7B 4GSYA 4YDSA 4FD2A 2XTMA 4L16A 5LB2A 3K09C 2GRJA 1G3QA 3HDTA 3LAWA 4HYYA 4LZZA 1IY0A 4Q4JA 2QL6A 3QF4B 1AQYA 3K9HA 4OHZA 4CEHA 1E79D 1II8B 1XEWY 2IS1A 3P20A 1ONBA 2BC9A 4TTPA 4Z1MD 621PA 2EYQA 1XZQA 3L82B 2AXNA 4MRNA 1I4LD 4V0OA 4LV5B 2ZUBA 4YXWA 4QJ3A 4Q1FA 1B0UA 4OYHA 3R7WA 4XD7D 3I5XA 2IS4A 1S2MA 3GJ6A 4POAA 2BBOA 1M6NA 5EUQB 3IEVA 4WXRA 1ZD1A 3KKOA 4CGZA 2CHGA 3UANA 3KUDA 4YMTA 5GVRA 1TX4B 1CU1A 2F3RA 3N2EA 4FN5A 4LPKA 3GLIA 4D4JA 1QVRA 4PQRA 4ZIRB 1YR9A 3OAAA 5JFGA 4N0DA 5BN3A 2B7BA 1N6PA 4RZUA 1KYIA 1WMSA 2YC4C 4OI2A 2QP9X 4GMDA 1IY1A 1COWA 2PJRA 2AK3A 4DZZA 3U60B 2A9KA 3G82C 4IDPA 2RGXA 1IM2A 1E96A 2CDNA 4EQ6B 3ND9A 4PPGA 4QKQA 2HT1A 2HUPA 1ZW6A 3FKQA 3N70A 5HCNA 3W9YA 1G8PA 1P62B 1YZTA 2AFIE 1BH2A 2D7CA 2GETA 2GF9A 3EAQA 5KSPA 3DOFA 1AKYA 1E0SA 1P6XA 3K70B 2F7SA 4KFRA 2VLIA 1F2UB 4Q7JB 3VR4A 1X3SA 2YC2C 3RS5A 2P5SA 4AYXA 2ZRAA 3AUYA 3DZ8A 2I1VB 2IA5A 2WOOA 4DEXA 4DXAA 5C4MA 2JDID 3BFXA 3ZQJA 3QQ5A 2VRWA 4B3GA 3BFKA 2VEDA 2EWVA 2HYDA 4NCIA 1Z0FA 3GLHA 4JLJA 5KOYA 4PHGA 1R4AA 2VH5R 3QXJA 3TAHA 1ZU4A 3ZVLA 4IOLA 4Q4AA 3GPLA 3SQXA 4QG7A 1R8SA 1Q0UA 1X8LA 2ZRNA 4QM6A 1CJUC 2HV8A 3CR7A 4YDHB 1E2MA 3NBFA 4RD2A 3A1TA 1E9RA 2FZ4A 2GZAA 3LX5A 3RLFA 4NYIQ 3BORA 3TR5A 3GEEA 5KNBA 4MKHA 2MMCA 4FINA 4UJ3A 3EG5A 2ANBA 5DYIA 3IGFA 4DRZA 2O8FA 4QGFA 2ZTSA 3I4LA 2J0UB 5EE5B 2OCBA 2Z4RA 2P6RA 4JBWA 1TQDA 2A5YB 2RGNC 1KK3A 4OQMA 3AP2A 2G1KA 3GEHA 1YR6A 2UKDA 2J3EA 4RFSB 3GFPA 4NYIR 1R7RA 3SBEA 2QAJA 4DJTA 3VU9B 1JR6A 4WOPA 2AKAB 2F1RA 2FH5B 2IUTA 2KI5A 3P27A 4JYBA 4B3BA 3KQNA 1N6HA 1PUIA 3VR5A 3SQWA 3U3JA 3NWJA 4Q1EA 3A8TA 5DO9A 3AKDA 1DAGA 2ORVA 2BM1A 1GFIA 2IC5A 2OG2A 2RB4A 4IXMA 4CIDA 1M74A 4M53A 2IEZA 1ZIOA 4A4DA 1ZYUA 1E4VA 1TPZA 4HDCA 4JZKA 3NVAA 3IKJA 4Q4LA 4TL6A 2JLZA 1D9XA 1ZIPA 2A78A 4IKEA 2ZRFA 4EJSC 3TQFA 4BFWA 4DSTA 2QEQA 4KJZA 4Q1DA 2YWEA 4MGYR 2V54A 3F0TA 5FOWA 2OFOA 1JPNA 1UDXA 3EC2A 4DSOA 3OF5A 1MABB 1XTQA 1G8YA 2QGNA 5EXPA 5FUWA 1P72A 2GWHA 2IX3A 1MV5A 4L15A 2QMEA 2PJZA 2FA9A 5L3RA 1U98A 4BEBA 5AJXA 1FMJA 4ASUD 1EGAA 1WF3A 2IYTA 1GKUB 3TRFA 4DLWA 3TE6A 1UEIA 4D82A 2AK2A 3Q7QA 2VO1A 3EZ7A 2V3CC 5LD2C 3FHTA 4PZYA 1U0LA 3UIEA 5KDLA 1XCMA 1T4GA 4G0NA 4YMSA 3OEEA 5G53C 4PC2A 2PCJA 3BK7A 1EWRA 2HDNB 2AD5A 2VP5A 1KSJA 3DOEA 3VAAA 3S1AB 4KXFB 3QPUA 2DHRA 1NMYA 3ADCA 3O8CA 2ZI6A 2BBTA 2Z0MA 4JL8A 1CXZA 2XJ9A 4D0GA 1VCMA 4LJ9A 1G3UA 1GILA 1W46A 3LW7A 3KKPA 3RRNA 2OILA 5JRZA 4D6PA 5AUPB 2O8CB 3FYHA 5EP2A 2O8EA 4D81A 2FN4A 1KJZA 4NU0A 2DFTA 3EC1A 3R9XA 3QY0A 2A5GA 3U3RA 3QXXA 4C0AC 1G4AE 4PQFA 3HP1A 3LV8A 4OHVA 2QAGC 1AK2A 1FFHA 4TL9A 5FTMA 4JBYA 5FOTA 3W90A 4W7SA 1A82A 1Z0JA 2R44A 1LY1A 1N3BA 1TUEA 4B2LA 5KTYA 2WJHA 4QNRA 1SXJA 1ZNZA 2ODBA 2HXYA 4A8JB 5CDFA 1G8HA 1W4AA 4ZV4A 1XMJA 1JR3A 2EFEB 4X8OA 1YU9A 1W36C 3ICEA 3BB1A 2IF2A 3L0IB 1CIPA 1KZ7B 2W0MA 4XVUA 1KIMA 4TT3A 2ZYTX 3I8SA 4LHZA 3T1TA 3EZ2A 1AIPA 5C46F 1MRNA 1JJ7A 3FVQA 1OJLA 2VP4A 1D5CA 1KNQA 3ASZA 4UXIA 4AG6A 2O8DA 4OK3A 4UNPA 2IS6A 1JNYA 2AXPA 4B74A 1E2JA 3VR3A 1E2KA 2RGCA 2XZOA 2W6ID 1ELOA 3HYTA 3MJRA 2ATXA 1OXUA 2C98A 1KMQA 3AVOA 2CL6X 3QBVA 4BFVA 4FMCF 3THWB 4QOSA 2ZANA 1Y3AA 2FOLA 1LF5A 1N5JA 4KU4A 3TLXA 3WY9A 3L0PA 2YVUA 3A1WA 3SJBA 1EFUA 4M1OA 4WZAE 5GJCA 3SU8A 1N0WA 1AQUA 2CVHA 2JJ2D 3IIKA 4MRRA 3GJ3A 5K8LA 2V1UA 3IUYA 4PPFA 4TQ9A 5JWOA 4TYYA 2Z4SA 1D2NA 1FL9A 4IFBA 1HT1E 5HKKA 1OLOA 2FWRA 4GNKA 3WNDA 1HTWA 2BJVA 4UNNA 1G5TA 1KI7A 4KV9A 2OESA 4Q66C 3NIBA 1ZM2A 3KQUA 3HWSA 2ZJ2A 1HA3A 3RS4A 2C03A 2Q9CA 3BD9A 5CJPA 1IBRA 4PSVA 4Z8XA 5HE8A 3MRSA 1HH4A 1W0KA 2ZE6A 1DAKA 1IN4A 4LUCA 1Q3TA 3EZFA 3NDBB 2QQ0A 2ZRIA 2DWQA 1OHHA 4U7DA 1DAIA 1H8HD 5C4GB 3ZD6A 2EYUA 2JLQA 1VHLA 2NMVA 4FMDB 3TNFA 3QIAA 1XF9A 5AK0A 3H0KA 3H1TA 4QBIA 3TW8B 1HQCA 3MJHA 1AKEA 1JECA 2BKUA 1U99A 2BCJQ 3KTAA 4E07A 2ZJYA 1CJTC 3T15A 2G1JA 1E9DA 2WSMA 4C0BA 5FPYA 1GITA 1Q1QA 1U8YA 3BRWD 4RZXA 4X8MA 4A2PA 3I62A 1MRSA 1KY3A 1LNZA 4XTCS 2IXFA 4KSBA 1KI4A 2WVJA 4ERNA 1IQPA 5BWMA 1T0HB 2IT1A 3K53A 5FL7D 5CYPA 2GAOA 3AH8A 1ZNYA 2PZEA 3QVVA 4H1VA 3SS8A 1W36D 4F4IA 2MSCB 1XEXB 1DVRA 2RGAA 3CH4B 4DSUA 3IHWA 1OKKD 3A4NA 5L3SB 4OHXA 1FZQA 1QHHB 4BZPA 3J81k 4EPYA 4NMMA 3SYNA 2RMKA 3BXZA 1XBTA 1HURA 1E9EA 5B64A 1ZM9A 1ETUA 2FFBA 2SHKA 4KBFA 2R62A 3K0AA 2ZQ5A 1Z6YA 4V0ME 3FWYA 3T34A 1YRBA 4TMVA 2JIZD 1NNEA 1ZD8A 4A92A 1R8QA 3AUXA 4S35A 2OSBA 1RKBA 4JKYA 1J8MF 2AFHE 4E03A 1S1CA 3WNBA 1Z0KA 5DNYB 3SNHA 4DLTA 2IYYA 2R2AA 5LB4A 1AA9A 5JZVA 4ARZB 1E2NA 1G5PA 4W5JA 1Q21A 2J5XA 4AKIA 3I8XA 4RD3A 1W4CA 4AYWA 4B6FA 1P2UA 1W47A 2D06A 4F38A 1DO2A 2V55B 1PVOA 1RJ9B 5EXXA 2ZYUX 3AVXA 1RRGA 4UNSA 4D0NA 3PG5A 4A0HA 4ZI2A 2XAUA 3A37A 4Z54A 2ATVA 5DI3B 4ZCMA 2B6HA 4MGIR 3VR6A 1NL3A 2OZEA 3LBIA 1M1YE 2CCKA 2WWGA 3NDPA 3M0EA 4JLDA 4P4TA 3U6KA 1I2DA 4MDEA 1RRFA 4KBGA 4HATA 2UZ3A 2PT5A 3WXMA 3R8FA 3VNUA 1GOTA 3CB4A 1OPXA 5E95A 3SJZA 2YHSA 3HU3A 4IOKA 5C2JB 3OE7D 1KHTA 4JIMA 2W6JA 4OQFA 4K8OA 4MA4A 1OT3A 1E2DA 3RC3A 3EW9A 3EZ6A 2L0XA 1TF5A 3R9IA 1KI1A 3BAFA 2A5DA 2UVQA 4CEJB 1QRAA 5AJVB 2KE5A 1DS6A 2GEUA 1U9IA 3KL4A 1N6KA 1S3SA 3KKMA 3SJCA 5F98A 4HI0E 1R0ZA 1YR8A 2J45A 3CRMA 2IEYA 3QKRA 2GZHA 5LBIA 2JCSA 1DOAA 2CNWA 2OO7A 1HY3A 3B1ZA 2RKOA 4Q4JB 1W2HA 3CNLA 1IXZA 1T8TA 1L8QA 1LVGA 2VSXA 2XNDD 2XEXA 3CPHA 2CEAA 2QROA 3WMEA 1E9CA 1KI3A 1ZMXA 3FMIA 3QKSA 4PPQA 4D25A 1IXSB 2NZJA 1F60A 1U8ZA 2BM0A 3U44B 1RYHA 4AC9A 3VQTA 4LX0A 1E9AA 1JPJA 2GXQA 2R6GA 3IQXA 4IJMA 4M1SA 4TLDA 4MGKR 3ZVMA 3IDQA 1JXMA 1RW4A 1XMVA 4K46A 3ZS8A 3GLGA 2GTPA 2OAP1 1F48A 3X2SA 3VR1A 2QE7A 5EE0A 3GJ8A 1U0JA 3G5UA 4DUGA 1Q20A 3ZIAD 3MD0A 1GNPA 3K0CC 4S2EA 5DHAA 1DARA 121PA 2Q3MA 2H16A 1U8AA 2OLJA 4ACAA 2ZVPX 2JATA 4XIGS 1GL7A 3UWKA 2IW3A 2DFKB 3QBTA 4TZ0A 5LD2B 1MT0A 1QBKC 2ZRPA 1XTKA 3KXIA 3TMKA 4HUTA 4F4JA 3UMFA 1MO4A 5FPTA 4OJQA 2C04A 3GJ7A 3QNUA 5KHOC 5FPHA 1RIFA 1UBGA 3QKUA 4UNRA 1FW6A 1N25A 1IJEA 5D3MB 1YZLA 1RZ3A 3PEWA 1E9FA 2A30A 4WVFA 2G6BA 5GADl 2R6CA 1KOFA 4DB4A 2BWJA 1Z2CA 2IXGA 4PO9A 1XD2B 1A2BA 1EFTA 4C7OB 3BB4A 3KXLA 2FPKA 3D6TB 2IL1A 3ZLJA 3W8RA 2Q21A 1Q57A 3KDSE 4I1VA 2PMKA 3BH6A 1EFHA 1KJYA 2GESA 4NCJA 5IK2A 1KSHA 2VA8A 2HCJB 3GLHB 2XITA 5JHHB 5CJ2A 3KQKA 2HF8A 4IRUB 5FUYA 3FGNA 2QBYB 2BMDA 3D7MA 5JMTA 1XRJA 3KB1A 4CEIA 2FSFA 2CHQA 4BRUA 1TQ2A 2CE2X 2CL0X 2Y8EA 2DFLA 2WV9A 3HJNA 3ADKA 3PENA 1GNQA 5JI2E 5CLLA 4AKHA 2V6IA 3C5CA 3CWQA 5GJWC 2BJWA 1IONA 1EESA 2A5JA 2H5EA 2G83A 2GZDA 4LGMA 4R2IA 2ASEA 3IILA 4I1OA 3QEOA 4CDGA 3I5YA 1ZCBA 4DLYA 2ORWA 4P4SA 2F6RA 5GVSA 2XXAA 3AVPA 4MYHA 4DVGA 1DAHA 2WICA 3B8HA 4URUR 2OXRA 1I4DD 3R8CA 5KU1A 2H57A 3AVQA 3NKVA 4Q4HA 1JI0A 3P1JA 1JBKA 1A7JA 4Q1CA 1XCPA 3EPKA 3PCRB 1TF2A 2WWXA 4HUQA 2FSHA 1X6VA 4B3DA 1F2TB 3T1VA 2YOFA 3MG9A 4TMWA 2PX0A 4Q01A 2GJ9A 3LLUA 4NPHA 4WAUA 5DGXA 3EA5A 3ND8A 3L8ZA 1S96A 5IDVA 3GLFB 2VHUA 4F7WA 2QTHA 4LC0A 3U7FB 1YR7A 3U3OA 4HAUA 2AN9A 1BMFA 2HJVA 1E2LA 3X1YA 3NHBA 5FUVA 5JSZB 4QL3A 2ZI9A 4BFXA 1LTQA 4LCBA 3BIFA 4Q9JA 1AGRA 1KMHA 3IIJA 1OFUX 4MYCA 4GZMA 1TADA 1OIWA 4C9BA 1E1RA 4PC7A 1XTJA 2J0VA 4PC1A 1JAIA 5G3ZA 3VHLB 3U6BA 2FV8A 2PL3A 3T5DA 4ZDJA 2FMXA 1HQYE 2WPDD 1CTQA 4LSGA 3CF2A 2ZAOA 4O2RA 3Q3JB 3PUXA 1BO6A 2ZJAA 2QENA 3EA0A 2KB0A 4HZUB 4GT1A 1R0XA 2ZJ5A 3U4QB 2H92A 3ZVNA 1TAGA 3H84A 3GLIE 4LYHA 4A15A 2RHMA 1U94A 1VPLA 4RD6A 1TMKA 1BS1A 1XU4A 2GA8A 1P2VA 2PX3A 4GP6A 4Q02A 3U3KA 2V9PA 3TGPA 2NPFA 1Z6TA 4B35A 3AVUA 5KO2A 2QTFA 2ONKA 3LBNA 3KQLA 3HPQA 4RZ2A 5H68A 4RCZA 1JJVA 4PO8A 1KO7A 2ZE5A 2ZRGA 2D74A 3PV0A 1N6NA 5K8IA 1FTNA 3CONA 4D80A 4DKXA 2CXXA 2IYRA 2G9NA 5K8TA 3FKSD 2WKQA 2J7PA 4LYAA 1G7RA 2Z83A 1NVWQ 1A1VA 4BWYA 2HEIA 1IN7A 1G20E 2OCYC 2GKSA 2LKCA 1HT2E 3WHKA 4DT1B 2XNSA 1II0A 1HYQA 3LXRA 3MWYW 2EW1A 4BUJA 4D26A 1E3MA 5FPSA 1T3HA 2ZYWX 3I72A 5CIQA 2XTZA 5FBQB 4BFZA 2IUSA 3GLHE 4XWOA 1ZP6A 4JYCA 4LOAA 3SI7A 4KLZA 1XTRA 1KDTA 2QRNA 2VIIA 4DDUA 2WWFA 5FTLA 4DSNA 2ZRKA 4G5SA 5BN4A 2WSSD 5DN6A 1CJMA 3VMFA 3CRQA 4LJYA 3CBQA 3GP8A 5CYOA 3QENA 5FR2A 4XVRA 2IYVA 4HAXA 2GF0A 1G21E 1FP6A 4IVRA 2OBLA 2X77A 3B7GA 1KNXA 3ZZ0A 3K0EA 1N6OA 2ZSFA 1UPTA 1XWIA 1SVIA 2Z6VA 1LB1B 1TEXA 2VTKA 3SDZA 2BEJA 3FMFA 2GAAA 4F93B 5J5CA 3CRRA 4W5HA 2QN6A 3OIWA 4PX9A 1F3OA 3GEIA 1QDEA 4PTLA 4GOJA 2BBSA 1HEIA 1UAAA 4M21A 2IBMA 2A2ZA 2IK8A 5JLJA 3CIOA 2IYZA 4NCKA 3F5FA 4XWAA 2OBNA 1UBFA 1T9HA 3BJIC 1XJQA 3Q7PA 2BBWA 2GNOA 2FFHA 2IYLD 3IQWA 2ODWA 4IEIA 4JVMA 3ZJYA 2ZRLA 2GCOA 5FFMA 2O52A 2OE2A 1FPMA 1EX7A 2PT7A 1E2QA 2NO9A 2RH5A 2V6JA 2XOKA 2XX3A 3A36A 1DTSA 4TZ6A 1NSFA 3GLFE 3EZ9A 4PHHA 4PHTA 3WHLA 1JEEA 5JCZA 1QHNA 4MUBA 4OQXA 1XEFA 3T06B 2PH1A 5B30A 1EX6A 3IHLA 1AJEA 2P5TB 2P67A 1S9HA 3BB3A 1P9NA 2CJWB 1Z47A 5B57C 3RABA 3DL0A 4IDQA 2XSZD 1NY6A 5FI0B 4I4LA 4PR0A 5UKDA 1ESNA 1KI6A 1W44A 2GXSA 1PLLA 1XP8A 3PQCA 2DFNA 4FMDF 3SJAA 1PZNA 1Z2AA 5FTJA 5JJKA 1GP2A 1FQJA 1AGPA 2D2EA 4ITRC 1N5KA 1K6MA 3BH0A 4UQOA 5E7MA 2FF7A 4KYUA 1BYIA 1S8FA 4HAYA 3TJZA 4US0R 4TYWA 3AP1A 4LJ5A 3RWMB 2WKPA 4LYJA 2EU8A 1NVVQ 2K5UA 1K5DA 2ZS9A 2IYUA 2YV5A 4MYTA 1IHUA 1LV7A 1KSFX 4IOJA 3A1UA 1K8RA 5ELXA 1NG1A 3B9QA 3OHMA 4URYR 4Q21A 1H8ED 1N6IA 4ILEA 4A1FA 3TAUA 4N1AA 1ZC4A 5JEDA 2GXAA 3AM1A 4KVAA 3NEJA 2WMNB 4JT2A 4PZLA 3ZZUA 3LFUA 3FMPB 3A6PC 3TUZC 2CLCX 1NVVR 4PAQA 3F8TA 2DBYA 4LPSA 4QGHA 1TQ4A 2QPTA 2Z43A 5L3QB 3V4FA 3DZDA 4AKGA 4A0RA 1AN0A 1VG0B 4AURA 4ON9A 4HLDA 1YJ5A 2KBFA 2R6FA 4R71A 4JLMA 2BHRA 4JSYA 3TVTA 5CDFE 1KAGA 3OFNA 4Q7MB 3WP1B 5AUOB 3ECCA 4O0MA 2GHIA 4PANA 1U90A 4RFVA 1ZVQA 1GL9B 2IYSA 2X2EA 2ZI5A 1P61B 3W8NA 3KKQA 3PVSA 2BV3A 1PLJA 4CVNA 4DDWA 2IUUA 3WYAA 4KLNA 5EE1A 3QI2A 1QHSA 3FB4A 2QY9A 3AF2A 2WWHA 3ZDQA 3PR1A 2A5FA 4JKIA 4I1UA 3MWJA 1ZU5A 3WBKA 1QHXA
chains in the Genus database with same CATH superfamily
3KVVA 3R3JA 4J2HA 2Q4BA 5CDGA 5IAKA 3SYRA 1QAQA 2V3VA 1BHSA 4KLRA 5EZQA 4R54A 2X86A 3C3XA 1SA0A 4EY6A 1ZRHA 1NM5A 3A70A 3G0HA 3SG0A 1ZJJA 3L18A 3D3WA 1MORA 2PFKA 2IQ5A 2QUZA 1NVMB 4FFLA 2C5BA 1RSZA 4P2BA 4N5IX 5T8KC 4R68A 3GOHA 4FYWA 1HDYA 5FWNA 4P53A 3AVYA 2HIMA 2GEFA 4F4UA 3KVOA 1FQOA 4O4IF 3SZGA 5AKZA 1KVUA 3L92A 5CFOA 3AR3A 2AFHB 5CDSA 3VKWA 1XDBA 3QF4A 3NHJA 3AY0A 4RVDA 2ZUSA 3PC7A 1D2EA 3M3PA 1RYFA 3RW9A 1YOVA 1JU9A 1JMKC 1TJ3A 2R6ZA 4J4BA 4M1YA 3RF7A 1DV1A 1Z16A 1E3QA 2R60A 3O1JC 1U1DA 5CM2Z 2VJLA 3FPKA 4JEUA 3KR2A 4KQ6A 5CU7A 5K8JB 3DHEA 1YDMA 2ZU6A 3VDRA 1VI6A 3E0XA 4OKIA 3FHLA 2PEZA 2XE7A 2P8JA 2OCKA 4I99A 5JISA 1BGXT 1ZEJA 3PDIA 4CG3A 2WYHA 3SQLA 1Z9BA 2H65A 3RK4A 1C7RA 1SD2A 1P29A 1XZDA 4MVJF 3VM6A 3CNEA 2XUDA 2Q1WA 5IJXA 3FWKA 4BLQA 3KQWA 4FOSA 1WRBA 3OM0A 4J76A 2OHXA 4K9OA 4ABYA 3C8ZA 4JP3A 1FFGA 5FH9A 3T35A 3QVUA 3EDQA 5DGHA 5IAOA 1GPKA 1UXIA 2QTAA 3E2IA 1C3LA 2JA1A 2OFXA 1GTG1 2X14A 2QRKA 1PZXA 4FFBA 1Z0ZA 3GW8A 3ZCTA 1FZTA 2OZPA 2DMRA 3W6OA 1E20A 2H5LA 2QLNA 3B7PA 3QPWA 4L4YA 3WHPA 5IHPA 4KO2S 2P8SA 3GLUA 5B53A 5GIOE 5C52B 2F4VB 3IA2A 2Q62A 4U63A 3ZZMA 1ODIA 2RAFA 5K3BA 4HB3A 5DASA 2W70A 1A9SA 4G9EA 1COWD 2M2IA 2Y1EA 2WJJA 4Z99A 1WBDA 4V0NA 3R7SA 5A03A 4CODB 4JDPA 2HPZA 1CY8A 1WHSB 4Z0PA 4MI1A 1UPCA 1LGYA 1YRLA 3A6FA 4NH0A 3TQQA 4AZ3B 2X1VA 3M70A 4IFTA 2DOKA 2R8BA 3DDWA 1NX6A 1YBFA 4AJKA 3AQ4A 5H8WA 9ATCA 4ZAGA 3VX3A 4D74A 3K92A 4GPIB 4M2LA 4P4UA 2PKCA 4G5QA 4FXPA 1D6JA 2C7BA 3QFFA 3D31A 4DCTA 1PNVA 5LU8A 2FLKA 1Y8RB 3BSSA 3THXB 1E32A 2RARA 2EKLA 3QG1A 4Y2RA 3SVTA 4LF5B 1QZUA 2FETA 4LY3A 5GAJA 4BNVA 3PSAA 5AQ1A 4UAJA 3E9CA 2ZATA 2FSVA 1MDFA 4C4ZA 4GWGA 1HDZA 2C4HA 3O2QB 1XVLA 2GO1A 4AG3A 1I1OA 3EB9A 1KOLA 4K9SA 4EUSA 5DTJA 2OD7A 3AP3A 2K6GA 3ASUA 4OIMA 2PUGA 1L4LA 4JEIA 3PDWA 5DIZA 3UK6A 3ZGLA 1DBSA 3T5AA 4NY1A 3R9WA 3ZWOA 1XD8A 1PEDA 1DO8A 1XV5A 2CDRA 4OX9B 2AHRA 2NXCA 1D04A 1HQKA 2UZAA 4G9BA 3WLEA 4MAAA 5K3OA 3QE0A 3FFBA 4C7OA 5DCYA 1HG0A 4FT2A 5C5CA 1MAUA 4DTIA 4GPZA 1WUIS 5FV4A 1TT5B 2ZJBA 1OW3B 2ADFA 4J43A 3C3MA 4XB1A 5AKHA 1LI7A 1E1NA 1WX1A 3RS7A 1R4NA 2GM5A 3HBAA 4Q1VA 1NATA 1DB3A 4KFTA 3SEAA 1JLMA 5KJCA 4LZAA 2FWPA 3D43A 3PC4A 2VUSA 5KNBD 1U65A 3QA9A 4WZAA 3L06A 1L5HA 4E3ZA 1PX0A 4LE0A 4RFSA 1P0IA 3T12A 1ATZA 1GA6A 3D1JA 3ZK8A 1EG7A 2AJDA 2YKGA 2Q4EA 1PL6A 1P44A 3A4YA 3FYCA 3NJRA 1PT9A 1C3OA 2HU2A 1O6ZA 2QUBA 5FDFA 3I04A 4G8DA 3CF0A 3O03A 5KTKA 1NZDA 3MRTA 3N0XA 1JZSA 4GSLA 2OFPA 2NXEA 2P40A 4P4SB 1GD1O 4BKRA 3X0DA 3FD8A 4AZSA 2Q3FA 2P90A 4D98A 3OZGA 3A7EA 2WV7A 1AB6A 1RP7A 2G9UA 2HSWA 3CE9A 3HB7A 4IJQA 3HVKA 3NC0C 3N9IA 2PLRA 3TOVA 2DUUA 4DCNA 5L6MB 2YHAA 2VQFB 1Q15A 4ZVTA 3RC7A 1CJBA 5F1OA 3AR4A 2Y0PA 1PFYA 4O4JA 4QHYA 2IHNA 2YNMA 4FOTA 1CDOA 4HPWA 7GPBA 3O8RA 3E58A 2VJMA 3ETCA 2VT6A 2BTEA 1XNJA 2PPVA 3IMFA 3AO0B 1L7PA 4XQCA 4XJVA 4JJAA 2HHHB 1BW9B 5IX8A 4M0EA 1Q2XA 2WHPB 3SHOA 2H52A 1G291 1HZZC 1NMZA 3KYIB 3KYCA 1RQGA 3MGBA 3QVSA 4MB2A 5FPPA 1Z8FA 2XRMA 5GWXA 1FW8A 1RZVA 1NX9A 3BC1A 3G9UA 1T0JB 4PFSA 4UCFA 3GLKA 4KHZA 1M6WA 5IXYA 4LFCB 1ZUHA 4A23A 2B82A 2XVXA 3HB1A 3MWFA 2G9RA 4NU6A 4B3FX 4MR9B 4E2YA 3USES 1AD2A 5TJHA 1Q5PA 2ZIXA 3F4KA 4PV7A 4US1R 1N78A 4EHJA 2ECKA 1X9GA 2IRWA 3O1IC 1JZQA 2AD1A 2Q49A 1C50A 1I32A 2FW0A 2Y6UA 4IJVA 5GV8A 2C97A 3U4HA 1RXVA 3P94A 2WMDA 3IS3A 1MX3A 1RE0A 2P6UA 4MGHA 3KYDB 3DFKA 1R16A 5E1OA 3NBMA 3UMRA 4ZTBA 1TF7A 1DRKA 2WJYA 4LVOA 2XB6A 3WKEA 4D6XA 1W93A 2CWDA 1Z3IX 5FA8A 2FGKA 1W0JD 1OXSC 2H8GA 1KOJA 2YZKA 1CJVC 4D9JA 4BJHB 1TUGA 1EWQA 1KPGA 1ZVJA 1LZKA 1IRIA 3ACBA 3EULA 2BFFA 4B76A 4FNOA 3ZEIA 4YGYA 3MIZA 2MYUA 5AJYA 3DLPX 1ZCZA 4TZKA 4C87A 4OUDB 4B3CA 1QHYA 1B6RA 5I47A 4U4AA 1I4TD 1KMNA 1GPNA 1O96A 2DULA 1G66A 4JN6B 3FXAA 1RYEA 4F3NA 1RPZA 2WM2A 3P0IA 2A3RA 2R48A 3SP1A 4AP5A 1ZBDA 1E3WA 4TLLB 5J2UA 4DM3A 1JEAA 2ZXFA 3GVPA 1KAEA 5FO0A 2XVZA 5JO9A 5KYXA 5G4KB 3G13A 4G01B 2C31A 4B6SA 4LVCA 1NVDA 3GNSA 1SXJD 3PEEA 2RGDA 1F0PA 2M6SA 5KSWB 1T6ZA 1JR3D 2J59A 1DKNA 1ZOOA 3MT0A 4D9KA 1KF0A 2WJAA 4PAMA 4M9QA 1ACJA 2C9OA 5TQ2A 5BYJA 4ZARA 1SUPA 4KVZA 4BEWA 4AMZA 1J07A 5CT8A 2V96A 1BX0A 1CUCA 1C9KA 1QO7A 1T13A 3Q0TA 4TT3D 4C7MA 1R0YA 1GRCA 2ONYA 2HW8A 2WHQA 3DMFA 3GFBA 1EBBA 1U2RA 2R7AA 2VJDA 3AGQA 5MFZA 3DEKA 2H1HA 1JIIA 3EOZA 1I7SB 4JD5A 2HJ9A 2G6TA 1W19A 5GQSA 3W5IA 5KEIA 1X80A 2O2HA 1D8TA 3MXOA 1C3VA 1ZD4A 3MJCA 3FTDA 4AJ1A 4WBXC 4R1SA 3BVPA 3D6HA 5BSWA 3H2ZA 1MZPA 4PGFA 3L6DA 4P0TA 4FZRA 2ZRBA 1P31A 1QKKA 2J9YB 3PFNA 2BP7B 3BZWA 2V5AA 2JGRA 2EFJA 4RPJA 4W1RA 3PPXA 4EW2A 5CLJA 3ZVNA 1AKNA 3TZHA 4N0MA 4DY6A 3N5CA 2XYQA 3AJAA 4L95C 3AM3A 2JD1A 5K3SA 4C2UA 2XKBA 2H59A 2ODTX 2JDIA 3AKCA 5C51B 2O59A 3A4LA 3RU7A 4RY8A 1VYUA 4HH1A 1MHTA 3CF6R 1GCGA 2ZR7A 2JHAA 1T6XA 1E7MA 1UT6A 1DKRA 3CB2A 2VYND 4V0KA 2NYUA 1TEZA 4GI2A 4G65A 3PC2A 4RTOA 1RHRA 4ZAZA 2HOQA 4C0QC 5IG2A 1NUSA 1TRKA 1QH9A 1EWTA 1DOZA 3OIDA 4TQAA 4V38A 5ALMA 3GK3A 4XH9B 3A11A 5HIIA 4R7GA 2V7QD 4Q4AB 3R1IA 4MQBA 4JQSA 2M6LA 3QHAA 3O74A 4G4IA 4MS3B 2VNAA 4NAUA 3SC4A 3K09A 2G9QA 3TZ6A 2IKQA 1WR8A 3MCZA 4TTVA 4WW0A 3I1FA 4HHEA 4NQZA 5EP3A 3TW8A 4B4WA 2XW6A 4PW0A 2QTMA 3GVXA 4CL2A 2H9AA 1G8GA 3EF0A 3CZ9A 4ZZ2A 3UK0A 4C3OB 1ZZEA 4JP5A 4DBLE 1F51E 3UBMA 3D8TA 4M89A 1P7YA 2VF8A 4EWLA 3CZQA 4XWGA 2JKYA 3KCNA 4C05A 3ZQKA 3CJQA 1P7ZA 1SK8A 4PIVA 2Q5JA 2W7TA 4YPVA 3WLQA 3KHTA 1WD5A 2QMUA 4L4UA 2O8FB 4JL5A 4H6PA 2BR4A 2GCGA 4HH4A 1V8PA 2XGGA 4BLPA 4DJFC 2ZS8A 3FFAA 1L6RA 2WIBA 3I30X 2IF0A 4MP6A 4BNUA 5FPKA 2R79A 3KZVA 5A9SA 4WBSA 4EKGA 2COEA 3B36A 3NBYC 3ZE7A 3DPUA 2ETVA 4MVYA 4DIUA 4L5AA 3TR0A 5K0FA 1Y8QA 3CVOA 2P6PA 2F9LA 4A0FA 2DYKA 2MSLA 2ORED 1G5FA 1MR3F 4UD2A 1QQBA 3JQAB 2FUG1 1LXCA 3FNRA 1BN7A 3G8BA 4PZCA 1P2DA 3EXEA 3MWLA 4M22A 4Q37A 4B8ZA 4ZK6A 2ID8A 1KFEB 4AMUA 4QTYA 2ZR9A 1GPMA 1P7WA 3DD5A 4J9VA 3IKTA 3STYA 3LWDA 4D0LB 4LKRA 2QPAA 3NB0A 5F98A 3DVSX 3BL8A 4UEJA 3CLSC 1HEYA 2FRXA 2P30A 4FSHA 3COYA 4TMYA 4F1JA 2DEUA 4JC8A 3I0ZA 2WYOA 4OK5A 1YI1A 3I9MA 5IULC 4AJ9A 3AINA 1FNDA 4FZ5A 3HO8A 1U2GA 3HJCA 4FXOA 3O4JA 3UYLA 5I7OA 4OHBA 4TS9A 1Y63A 3BSYA 1M2GA 3CNHA 2WHEA 1E1YA 3ITNA 4Y0VA 1VLLA 2YXBA 3RD5A 4FOOA 3WJ1A 3ZI0A 3RRYA 1NA5A 2ZROA 2BZSA 3ZUGA 2FPGB 2ZSBA 1CB0A 5EHQA 4MQMA 5KOHA 3DV9A 3VH1A 3UMVA 5B7QA 2RHLA 5CXUA 2D4AA 2D5LA 4LWZA 3T1OA 4NFLA 4UVEA 2OFFA 5HOQA 3JVUA 4OKSA 3SGLA 1DKMA 2NLOA 2IDJA 3OT1A 2QW8A 3TZBA 2AE1A 4E4YA 1N8NA 1U9ZA 1EFCA 5LOVF 2Q9BA 2CLIB 4RE6A 4FYYA 5JJCA 2L18A 1ORWA 4INAA 1RWKA 3EN0A 2YS7A 3AZQA 1TLFA 2C2XA 5GP1A 3QE3A 1HDRA 4KG7A 3KALA 3NYRA 1I2MA 2CMKA 3DZFA 4BLRA 2X8JB 5L45A 3TZKA 4DNPA 4QM6A 1JEQB 2LE0A 3LF1A 4Q47A 1X70A 1KS9A 2Q2QA 2Q6LA 3P45A 3DDZX 3SS7X 3VGJA 4ND8B 3EFOB 3U9TA 3AOGA 3DBIA 3G1WA 5E6UA 1Z07A 5ENVA 2VN8A 1F3LA 2Z3VA 4L4ZA 5LLSA 3JD4A 3IMEA 2WAOA 1DLJA 5TMBA 4FYXA 2V4UA 4O4IA 3M5PA 3EY4A 4NARA 3UMYA 3M2TA 4BMOB 3LCCA 4B80A 3AR6A 2R9VA 3LC2O 1L4HA 3T9EA 3WFZA 2X7JA 1L4UA 3D4OA 2B4YA 3DXFA 4HAOA 1JDJA 4M49A 3UJAA 4EG5A 4ER6A 3D5QA 2W6JD 3M33A 2OLKA 1HXHA 2G17A 2I7TA 4FKBA 4F3KA 1BX1A 1XMOB 4FIZA 4PCLA 1MJNA 2GB4A 4DA8A 4P1ZA 3HXPA 1Q16A 2WR8A 2WKRA 2DR2A 2RK4A 3PS9A 3CRW1 2JRLA 2W83A 1N33B 3RYHB 2ISSD 1EDZA 3MEQA 3SIPA 4QGAA 1KKMA 3VI4B 1XLUA 3WB0A 3KLMX 3OIUA 1E9SA 2O1SA 1CEXA 2MSWA 4BNKA 4MVJA 4UTXA 3JX9A 3CM0A 2O3UA 4URZR 4RKFA 1DQZA 4GYKA 3U4IA 4MLCA 5CH5A 1UM9B 3EUAA 3GEBA 4RYDA 3HA2A 1NVXQ 3GJ4A 3E1SA 5HGXA 3ZKAA 4PNZA 3E84A 4MMZB 4LXXA 1TO6A 5AVVA 1QMGA 3V3KA 5EPUA 3RVJA 1V6SA 1A1SA 2B8WA 1R6DA 4M7RA 3O8OB 2GJSA 4LJ7A 3I9KA 4A91A 4CYMA 2TS1A 5DSZA 2OB1A 2QJFA 4DLVA 4YRAA 4B73A 4II3A 3FR7A 1M5TA 1OZ0A 3M6IA 3NIDB 5GMOA 1WD7A 2W4MA 5HKAA 1P17A 2A7XA 2ZVDA 3VC7A 2J9GA 2WHRA 2JJ2A 3I04M 3ZJ5A 4IDOA 1IOZA 2HY7A 1N8KA 4OP1A 1C8VB 1E6MA 1JFTA 3R7BA 1PF7E 1XAIA 2JFPA 4OSOA 1JS1X 1OVGA 2HDOA 2J5BA 3NO4A 4S3MA 5DRYA 3U3XA 4QGSA 3EBLA 5JJIA 4PYLA 4JJ4A 3I3SR 1KTVA 4G2TA 1WULS 2IZOA 3LC1O 1AK1A 1DXYA 3OETA 4KLCA 4PYRA 1NQXA 1X7YA 3T0FA 2B4TO 4NHEA 4X95A 2IU4A 4WY5A 4C78A 4DQLA 3K5PA 3JQ9A 4K81B 4AP9A 1O8CA 1U5BB 5DCUA 1MGOA 4QUAA 3L7JA 3R7DA 3VA7A 1A96A 2AF4C 4HO1X 1GPWB 5ULLA 2QTBA 4ZO8A 3QNMA 5HW0A 1OFIA 1C7FA 3FVWA 2EARA 4EG4A 1GUFA 1U8CB 1BFDA 4DIDA 4BGDA 5KMGB 1X7XB 2H1LA 3BIXA 4KGXA 5JZMA 3NFRA 3IV7A 5BSVA 3KQYA 3H1EA 3C41J 1XAGA 4JUIA 4JLKA 4LCJA 2XRYA 2CB9A 3JQ8A 3IT1A 4AUNA 3F2IA 1P5JA 4JJKA 5DLEA 5LNK6 2HA6A 5AVYA 3ZKWB 1O0SA 3JQBA 1X9IA 5FTWA 4ZI5A 4G5XA 4D3XA 4CT4B 2OFWA 2QAGA 3KL2A 2CF6A 4Q3CA 5HX7A 3EVTA 5HIAA 3BRWA 1FX0A 5T8KA 1G2PA 1N5MA 1RQXA 3ZGXA 4OL0A 2WWVD 2X0JA 2EOAA 1HSOA 4AULA 1ISFA 2ECQA 1TGYA 4AN4A 2RGRA 1Y81A 4I46A 4PSKA 3ZBTA 1NJ8A 1PR3A 1GNRA 1A5AB 4FCVA 3ZXYA 1D07A 2CK3D 4BO9A 1KAOA 2CFRA 4E2WA 1N2CE 1VXRA 3HSYA 5SZIA 4H15A 2ZJFA 3AWDA 3GP5A 2WIAA 2BEVA 4D2IA 3H86A 1RFLA 5KQRA 2R1VA 2OHOA 2E4UA 1YAHA 3KR0A 5B3KA 3KNZA 3KJXA 4JNCA 2CZQA 1R15A 4G56A 5E4FA 2WAXA 4KH0A 5NLLA 3TDKA 5CFMA 1JYFA 1XMIA 1SB8A 3CZMA 3FUCA 1L8AA 4AY3A 4DC9A 8AT1A 1M6HA 4BJ1A 2YY5A 3I5MA 4ZVKA 3KB8A 2PS3A 3HXKA 1AKMA 4LSMA 4EGCB 4Z4CA 3AVTA 1OC2A 2P75A 2RJNA 3MJTA 4X0EA 3VR5D 5A4FS 3SZOA 2P2DA 1I7NA 3BBPA 4JBNA 2JIZA 1FOEB 1Z8DA 3EWSA 3QOXA 3TKAA 4BRSA 2PGLA 2PUVA 5J40A 4WL0A 2V7XA 4JLUA 4YAFA 2RHOA 3T9AA 5AVWA 4BWGA 5REQA 4K1LA 1Z4OA 3RR2A 4KI7A 3KKNA 1YU6A 4QFMA 2W71A 2X3YA 2RG7A 2ST1A 3L4BA 2REQA 1QK3A 2FY8A 1SXJE 2J7KA 4AWXA 3EY9A 1T5LA 3CLVA 1M2OB 4Y8VA 2VTVA 3EWAA 2AN1A 4AMYA 2C8VA 3M6WA 4X1OA 1YV9A 4BV3A 3VNVA 1JR3E 1I01A 2FN8A 3GV0A 2G0TA 3NT4A 1I9GA 4Q3AA 3ZR4B 4X1YA 4B3JA 1ILEA 3E3MA 3NM4A 1CF9A 2JAPA 4FDAA 4NOLA 3STUA 2WWIA 5JPCA 1ZPDA 1X3LA 3SXPA 3HB0A 1PNQA 4EEXA 4IMPA 5IP5A 1CVIA 2B8TA 2YMQA 4QUEA 1LSSA 2Y93A 1Q3KA 4OLBA 4D9GA 1LJUA 2Z2KA 3KT0A 4ZD6A 2Q0SA 5BP7A 4Y0AA 4CFZA 8ABPA 3V4VB 2IJGX 4CF7A 4JELA 4DBZA 3WI7A 3R6DA 4IFIA 3FROA 4DGQA 2R4UA 4MGEA 3RIXA 4S1TA 3STVA 4Z3KA 3JYPA 3A1SA 1EFPA 3RO7A 2O8BB 1XK6A 3ZTYA 2BGMA 1A2KC 1KERA 1RHUA 2XD4A 3WRWA 1E4EB 1NN3A 3L0SA 2YOGA 3LWNA 4PQEA 3ROZA 5CCBA 2YWJA 4AP6A 1Z08A 1R37A 2GJ8A 2IELA 4MUGA 4YAWA 1U3VA 1A9TA 1YO6A 2AOVA 2OHFA 3EASA 5KHLB 4MWSA 4R1OA 3SFTA 1E9VA 1NVKA 4E70A 2GM3A 4UPDA 3W5VA 4BUCA 4JYZA 3KO8A 2JS7A 4XGQA 4XYLA 2CUZA 3DMGA 1M2JA 3HEBA 4U1RA 1FRZA 4KCGA 1LVHA 4I1YA 4L0MA 1CUDA 5KQSA 1VYVA 4HAVA 4FX5A 2GK7A 3UQZA 1WABA 3K0SA 4NNPA 3X1WA 3EXHC 3NHAA 4O4LF 2JKZA 1MO3A 1KJIA 2GJKA 1C9YA 1SVKA 4OU5A 4R8LA 2QVGA 1A5TA 2D7DA 1XDZA 3UXHA 2G25A 1M5UA 3CWZA 3P96A 2SNIE 2Q3BA 1YJQA 2YYAA 3TKLA 4CM4A 4JVNA 3ITDA 3PQDA 1BA2A 3P32A 1AQJA 3KJFA 1C0EA 1DE0A 3BN3A 2XEDA 1HF3A 3KE8A 3KWFA 4LN1A 3VO1A 1SHUX 2AC2A 1Z6AA 5LA6F 1H23A 2D2XA 4MUYA 5CT5A 3RUAA 1AO0A 3SMVA 1WMFA 2IZ5A 2AR7A 2VJAA 3W7BA 3WXBA 1NP6A 5CVEA 3SOZA 3BMNA 1D2AA 1W4BA 2F62A 2XQGA 3DP7A 3EMBA 3QIVA 5B2ZA 1VMDA 4IHQA 4PBTA 1PLKA 4Q00A 4JI1B 4HWOA 2R00A 3HY3A 4K9QA 1SVLA 1E9BA 2FUCA 4M9UA 4H4DA 4D9NA 2YZ2A 2ZJOA 3G8DA 3RFVA 3UV3A 3ZIAA 3EMKA 4LTDA 1N34B 5GZ6A 5AKYA 2F3UA 5LYJF 1DIOB 1NF9A 2JIDA 1DMSA 1LS1A 4WCFA 1RWVA 1XEWX 1ZOPA 3DZCA 2BFDB 3B5JA 5AKEA 5JAHA 1G98A 2NXWA 1YS1X 4O5AA 1W5FA 3WB2A 2H1IA 4J0GA 4Y2UA 4D9FA 4PO1A 4P33A 2HQOA 5BSEA 3I4CA 5KYWB 1T0UA 2EBWA 2X1MA 4E31A 2C8KA 2PUEA 2REOA 4O6VA 1CULC 4F21A 4YQZA 4B71A 4IKPA 2Q4TA 3L07A 3W3AA 1U3WA 4PYIA 4OGWA 5EQFA 4C0HA 1HPLA 3BWDD 1H22A 2Y67A 2CLFB 4OXNA 1U2EA 3EPJA 3N2GA 3DMTA 3IKMB 3PUIA 1P75A 3P4XA 1TQ6A 4ZQBA 3O4FA 3U26A 1NDHA 3FUUA 5CA1B 1M33A 1VL0A 1FFCA 4GI7A 5FUXA 1EMDA 2JGDB 3KOYA 4M4SA 4KXMA 3RS8A 3VDNB 1HE5A 3IVAA 3KFVA 5EUMA 1KZ4A 2N0SA 1KETA 3SN6A 3BWYA 5E1DA 3Q8LA 4GSKA 1JIVA 4L8YA 1GFSA 3CRZA 3WLAA 4EY5A 3DT9A 4CUKA 2AX3A 3F96A 1YB7A 2HPHA 4A3SA 3Q5GA 4QDKA 1LDGA 3OQBA 4EK9A 1O94D 2J5RA 3HBLA 4LG1A 5FX2A 5LIPA 4GS5A 2YR0A 1T2CA 4MW2A 1U0NA 2LP4Y 1QYWA 3LH5A 3DKPA 3JWIA 2P2SA 4UVDA 1PN3A 4DY4A 1W6UA 1GLGA 2ZSKA 3RREA 1Z29A 2J87A 2CJWA 1T91A 2XBUA 4L6CA 4F84A 4HX5A 5ITSA 1E63A 1RC8A 3PC6A 1IM8A 2IBTA 5LL6P 2IOFK 3WLRA 4E1VA 1Y98A 4HNUA 1X13A 1DQPA 2ALJA 4H35A 3B6ZA 3RG2A 3TM5A 3VHQA 5FBLB 4F91B 2I71A 5BOVA 2PS0A 4D4GA 3CUEF 2WJGA 4HLUC 5C1PA 5LMNB 2BMAA 4CEIB 2H18A 5E7JA 1XRRA 1I3LA 1T10A 1V47A 4GR9A 4K8RB 4K6HA 2XMQA 5J9FA 4YRMA 2VDVE 1JTVA 2DR3A 4QXQA 2GD0A 2YJ4A 4B3HA 4AQ7A 4OHMA 3VU9A 1WZNA 2E1RA 1FVHA 5FULA 1SZDA 3RV4A 2DECA 3ILSA 4XM1A 4DBVO 5HZKA 5I7SA 3NTVA 3GI1A 2I33A 4HC4A 3GRKA 2C5SA 2QS9A 3QEJA 4MWEA 1B74A 4JC0A 3RK0A 1JHYA 4LDJA 5IZCC 1RTTA 3CPJB 3S6JA 4QM7A 3D7LA 4UHDA 4LJ6A 3LUHA 5DHUA 4DMGA 3UBTA 2YASA 4WJKB 1RKVA 4KXWA 2VDQB 2EL9A 4GRAA 2HRZA 4IW3B 1UP6A 1XPUA 1NOJA 2E3JA 1L5GB 2XODA 4YMIA 1P2BA 5FL3A 1F2VA 5COQA 2RFLA 2X5OA 5CH3A 3LBHA 2FWAA 4MVJM 4R8RA 3FHCB 4UHJA 4IDAA 3E22A 4TUYB 5I9IA 5AI9A 4D45A 3QU7A 3L40A 1PKEA 2X42A 3FDIA 3FOBA 4IGIA 4L9SA 3UG6A 3GRFA 3UGTA 3E27A 3S2FA 1KGDA 1M0TA 4I1PA 4QXOA 4J0EA 4X62B 1J56A 4NULA 1LWOA 4R5HA 1ORRA 4MPPA 2J5QA 1IG3A 3RJ9A 2I29A 4XWKA 1KDVA 2YJTD 2I3BA 4KW7A 3Q5DA 4A8PA 3E7WA 4KEAA 4YJDA 1V9CA 2IHYA 3GCGA 3OX4A 3RSZA 5LOVA 1XYGA 5ERGB 5ICMA 1VRVA 2GN8A 2EJUA 3WOVA 4H3VA 4QJ4A 5C7OO 1PK9A 1QBGA 1LD3A 2Q3DA 1HORA 1PSWA 1QO0A 2DCMA 4BC0A 4HSEA 3KT6A 1YZUA 1GTVA 1NBHA 3N0VA 4FZVA 4UUBA 3TUIC 4JI0B 4D3FA 3W1WA 2WRZA 1K6JA 1ORHA 2RCYA 3LQFA 3UWOA 4RPCA 1HC7A 3FZGA 3TG8A 2PZJA 4TN5A 1EH5A 1VPWA 3SICE 2F43B 2BGKA 1IJFA 3SVZA 3OCJA 4X7MA 3AHFA 3VVLA 3QX8A 2ZBEA 5KJFA 4CNQA 1N75A 3RC2A 5DYTA 4LYEA 2YVQA 1N2BA 1XZAA 2ZIUB 4WNAB 1OE0A 1DLIA 3FSEA 3G2LA 3O8QB 3R0VA 3KJEA 2VBIA 3GDHA 2ZB2A 3I39X 1I14A 3ZHVA 1SBHA 8LDHA 2IS2A 4P3YA 2J3IA 4PLCA 4ZQIA 4DC1A 4H6WA 4NXNB 2WDZA 4DV4B 2RI1A 4EX6A 1KP9A 3RS3A 2A7QA 2C5EA 4Z4QA 3UHPA 1Q84A 1V8OA 1Y7IA 1OYWA 3GGOA 3U19A 3D2LA 3L7DA 4B2YA 1YGYA 2JPDA 1SUSA 8MHTA 1T2DA 3H8VA 2DKNA 2PV7A 4HGYA 4CCYA 1FSSA 3TNJA 1UXJA 3TIXB 4CUJA 2EIXA 1FX1A 2HA2A 4JYPA 2A5LA 2O54A 1NVBA 2Y0CA 3DB1A 3NTRA 4OF4A 3F6BX 3GLFE 5KNBH 5IH7A 1XJ0A 4P4NA 1STOA 3CLHA 1A04A 1NUPA 2AQIA 4RD0A 1KE1A 3SFVA 1YE3A 3LPAA 3NPMA 1AUPA 3ZYCA 5CIYA 2YYZA 2A8YA 1JJIA 5L40A 2HAEA 5J5VA 4G5GA 4N0EA 4XARA 2JHFA 1FBTA 2V4ZA 1OIXA 1YR3A 5CXSA 4RJKA 1W5AA 1OD6A 1ISGA 1Y9ZA 2OAEA 4RD4A 1W88A 2H1SA 3PUYA 3V6MA 1WWKA 3VKHA 1EDEA 4Q03A 2H3HA 5EMKA 3CEAA 3T3OA 1PL0A 2NSDA 2Z1DA 3BMQB 1MKYA 2V7EA 2ZU0C 5LPNA 1QORA 4COKA 1RHJA 1ZINA 2R8OA 3AVWA 2VHCA 3L7BA 4MW5A 2AWOA 3WKAA 2BLLA 4LDZA 1VB3A 5DFAA 1E3SA 5F12A 1ZK3A 1PJRA 2LZ0A 3EFEA 3A58B 4L3OA 2VAMA 1CE8A 2WI8A 4XVQA 3ICCA 1XEAA 5DI9A 5J4HA 1F17A 2CNBA 4HAZA 4YJ2B 2NNWB 2QL7A 1JDTA 1JXAA 3SOPA 1CUXA 4WKCA 1Q3HA 5G1NA 1G1MA 2CJYA 2JFGA 3L4SO 4IR7A 4AO8A 3RS2A 1W34A 3QVTA 1O5IA 2OV1A 1GNLA 3QF7A 1EVLA 4IIBA 4OAQA 4TWJA 4R83A 1YS9A 4EY7A 1G38A 5HGJA 4XX0B 1DQNA 4C3UA 1Y5MA 3ZU4A 4BBZA 2BMWA 2NO4A 4F2HA 1VG9B 2I6SA 3KR9A 4QYSA 4RVFA 4UFPA 1Z74A 4UCQA 721PA 4B9EA 2Z8XA 1MH1A 3KLNA 3U4AA 3K70D 2AZTA 3AHCA 3ISTA 3OJ0A 4KFSA 4B6QA 5FQNA 1R5NA 10MHA 4U39A 1RKUA 2BVNA 2ERYA 1TVEA 2BONA 1B0PA 3IEKA 5JH7F 3WDSA 4IO1A 3QBEA 2OCAA 1MFPA 3AF0A 4OJKA 4IF4A 1LBHA 4YC7A 1TA4A 5TMPA 2APJA 4YI5A 4V1CI 5HMMA 1CZHA 1GUAA 4ENWA 2LCQA 4KE8A 3EXHB 1I0IA 1M8PA 1PX2A 4HB2A 1QCZA 1S8NA 4BEJA 521PA 3SSAA 1AUXA 2GVZC 2P62A 3AY3A 5JI3E 3CR3C 3VU3A 5L53A 2F55A 1AM4D 2JAQA 3N58A 3P0EA 5A6SB 1YBMA 3LLVA 1N0UA 3CX8A 3GOQA 2IZ0A 3RT9A 3RYIB 1KFKB 3GNQA 3SDBA 3R09A 1QLHA 2HO5A 1GY8A 2XMGA 5JS2A 5MF6A 2YJGA 3DAOA 4KPEC 3LUGA 3EXIB 2Q3HA 3ETEA 3F47A 1MQSA 4WZZA 2FU5C 2AQKA 3AEUA 1ADBA 4RVCA 4KFUA 1CQZA 1U0TA 3GUCA 3MYYA 1TFUA 2PH7A 4PBRA 3EHDA 4N0QA 5TGZA 2FX5A 3UMSA 1NXTA 1XMSA 2PGDA 4QBTA 4NZNA 4KZPA 4TKMA 3COJA 4ZXPA 3EZNA 1Q7TA 3RT7A 3TSZA 3H0CA 4I4IA 3IP3A 3U0VA 4YYEA 4A8JC 3M6AA 4C7VA 3RNLA 1GCIA 5HXAA 3MXTA 1ST3A 1YZ3A 3WFJA 2JAWA 1H8EA 2AFIB 3FDZB 2CLOB 4MULA 2X19A 1FNNA 2Q3LA 4RNDB 4R51A 3SXUA 1UPAA 3RVBA 2Y9PB 5IT0A 1A2OA 1S89A 3R6WA 3JZIA 2EX4A 5EZ5A 1HE4A 2FZKA 3DUFB 1P91A 4LHXA 2W6NA 3CVUA 4O3MA 1BG6A 3IUQA 2O2DA 4GO1A 4LWPA 1E59A 1UR5A 3PD7A 2CFIA 2DWOA 1Y9AA 4HRAA 3TBHA 2C9YA 4CG2A 4EFLA 1FTSA 2WWWA 1KH3A 2ZK7A 2QTVB 3T5PA 5CPFA 4WZBA 2C96A 4U8HA 2WF7A 1KY5A 4CCWA 1RHQA 1CBUA 1UEXC 1CJKC 4TXHA 2WU8A 2W2XA 3IESA 4H7KA 4HLCA 3TVYA 4ZKEA 4D9IA 3LCVB 1J24A 3SSOA 4O4HB 2JGJA 4L6IA 3FPFA 4ZOEA 3RVPA 3HPRA 4RIFA 1DBIA 3D6MA 5CDUA 1LEHA 3O9VA 4ALLA 2JLXA 2BRUC 2YNMD 2W22A 5EVCA 4LJ8A 1F0KA 2VCEA 4FSXA 4BP9A 4DDHA 4PWYA 2JFOA 2QR2A 3NONA 1T5DX 3BCUA 4U2BA 1OREA 2H85A 1HE8B 2C5GA 2H7XA 1JHVA 1Z5VA 5DI3A 1CT9A 4FB4A 4D9MA 4IGAA 1NTRA 3AEQB 4NPCA 2WVHA 1DU4A 5JU6A 1I4EB 2ADOA 5CTJA 1BFUA 1BN6A 2A9VA 3EXG2 3JARA 3L0DA 3PUZA 2OV3A 4PE5B 3JQ7B 4FCWA 1Z06A 1C14A 1XCBA 3RIHA 2XZTA 4GZ5A 3VNSA 3QE9Y 2PZKA 3AHEA 3NNDA 4KX5A 1YNSA 3I01A 4CBVA 3L01A 1XROA 4RSRA 1NBMA 2H1WA 3MGCA 4ZVVA 4WOKA 4YMVA 1VJDA 4HX2A 4X71A 4NBKA 1LNQA 4MARA 2ZSAA 4KIJA 4WLUA 1F7UA 5C35A 1BROA 3G88A 1ULTA 2FPOA 1UKCA 1DFGA 2O3RA 2GKOA 2SCUA 3LCMA 3V1YA 1DC7A 1H6AA 1O97C 2D1RA 3GIWA 3K35A 4KE6A 4O4LA 3RAPR 2A0YA 3SC2B 3VV2A 4GP7A 5I9TA 3DR3A 3DW1X 1ZN7A 1I6LA 3MPOA 1IEQA 1EQUA 4H9GA 2PBFA 1Z5NA 3VDQA 1BXGA 5BVGA 4JP1A 5DM70 1HR0B 4GSYA 1H0SA 2IYFA 2PO5A 2XTMA 3DAGA 5FWAA 3ZDZB 3ISJA 5LB2A 1S2GA 2PY6A 1FYXA 3LAWA 4A7PA 2I1WA 3B3GA 2ISCA 3PUKA 2GPNA 5LA6A 4O63O 4OHZA 1XSEA 3K5IA 5ECDA 5JBNA 1L1EA 2XA1A 2IS1A 3EZLA 2BC9A 4TTPA 2SICE 3LOPA 2ZDGA 3L82B 2AIRA 3PXCX 4MRNA 4V0OA 4LV5B 5FAKA 1Z17A 3C5EA 1K7SN 1MEJA 2H7CA 3EDRA 3VO9A 4ZAXA 1U3UA 3T4UA 3OJFA 4XKJA 4NESA 2PWPA 3ABSB 4NWIA 1S2MA 3CNBA 1X87A 2C61A 2QTZA 3GJ6A 3I76A 1DINA 4LTMA 4MWCA 4MWBA 1MA0A 3PX2A 4CMGA 5IXJA 3KKOA 1P1JA 1U0RA 4FDUA 3UANA 3KUDA 4ME6A 4AS3A 1JKJB 2DBVO 4XDHA 5HM8A 1LPPA 4CM1A 4BU0A 3AYXB 2NSJA 2ADMA 2F3RA 3N2EA 1FLNA 4R2KA 4I6JA 2DQ4A 1VCHA 3FYTA 4K9MA 4EP1A 5FWYB 1J22A 4I1IA 3GLIA 3KYBA 1NWCA 3ZE8A 3NATA 4GMHA 4L0DA 3LSTA 4WK0B 5JFGA 3Q9SA 1E7YA 1Z8HA 3MT8A 1GDTA 5GV7A 1LLCA 4EM6A