3B2EA

Crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
349
structure length
307
Chain Sequence
LTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDLADLTGSIPGIDEALSFMEVMKHIKRQEQDEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
publication title Get1 stabilizes an open dimer conformation of get3 ATPase by binding two distinct interfaces
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 95
structure length 307
sequence length 349
chains with identical sequence B, C, D
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b2eA00
2EQBA 5DHFA 1L4YA 2XAUA 3W5JA 2QORA 3AP2A 4B3FX 1OB5A 2JLSA 5BQ5A 4QNRA 5FTNA 1MABB 3ZVRA 1M7GA 3KKPA 2VA8A 3IIJA 3QI2A 3RS2A 2Z83A 2O8EB 5JHHB 4PXAA 1Q1QA 2ZRAA 3MWKA 1Z2CA 1YZNA 5DHAA 4LBVA 4BZXA 3CH5A 4U00A 3TR0A 4URZR 2OE2A 2F43B 2ZYUX 2CJWA 4PC7A 3WNBA 1Q0UA 2GBLA 3L0OA 1A5TA 2B92A 2PJZA 1XP8A 2NO7A 3AUYA 3BFKA 2FG5A 5CLLA 4TQUS 3K1JA 4Q1EA 4IOLA 4LGMA 2A5JA 3EX7C 5EXPA 2QUZA 1EWQA 2AKAB 2ZI3A 3AF1A 4ZI2A 4B43A 3IILA 4LHXA 3RYTC 1YR9A 4D25A 1P4SA 3MJHA 3K0SA 2NO1A 1SULA 2QAJA 2B21A 2WAYA 4GL2A 2CEAA 4V0OA 4C2TA 1YU9A 3DM9B 4Q4LA 1FPMA 1SVSA 5G41A 1U99A 4QGFA 3MG9A 5FTJA 3W3ZB 4YMTA 5JSZA 5BN5A 1R0ZA 1Z0FA 1QHGA 1NG9A 1G3IA 5AJZA 4A82A 1VIAA 1PUIA 5FBQB 5JEDA 3X1ZA 3F0TA 2NZ8A 2OO7A 4C9BA 4AKIA 2CCGA 3SZRA 3U3MA 1N3BA 5B57C 2P2LA 2RGNA 4YQFA 1IY0A 2AXNA 4JLVA 721PA 4BECA 4ITRC 1G3QA 4TL7A 2GAOA 4JLMA 5EE1A 4AIIA 2QENA 4IEIA 5DH9A 4OQXA 3KZ1E 3PV0A 5CDFA 3OAAD 2ZXUA 1JXOA 4LRWA 4JL8A 1QDEA 1E2NA 1AS2A 2ZJAA 3TW8B 1DG1G 2C95A 2C5LA 3KFXA 1MO3A 3SI7A 4BWYA 2IYLD 1S4QA 3K70D 3TW4A 3E70C 5KPDA 4AC9A 1TUIA 4QJ5A 4C0QC 4HB3A 1F3OA 521PA 1UBGA 1SHKA 2ZR9A 3RABA 1Z0DA 2V6IA 4B34A 2WWIA 2UKDA 1BMFD 3QY0A 4ZO4A 1KO5A 3OEED 1JQJC 1U0JA 4OHXA 4K46A 3TR5A 4FMBB 4FINA 1G7TA 4KAXA 3THYA 1VG0B 3KXLA 3SN6A 3L0PA 3D3QA 4M9ZA 2BM0A 3U3RA 1GOTA 4F91B 1IM2A 1ELOA 4TMZA 1N6LA 3CX7A 1DELA 3RRNA 2QMOA 2DFTA 2R9VA 3CRMA 5JEEA 2I1QA 1SZPA 1D8TA 2B7BA 3WP1B 1FNNA 1GWNA 2PT7A 3VNUA 1E2IA 2WZQA 2YWEA 4LHYA 2X1VA 3VAAA 2A7QA 4X8HA 4DCVA 1GSIA 3IBYA 2EVWX 2XSZA 3L2OB 2VP4A 1N5IA 1DTSA 1KJWA 4AKHA 3WMGA 1XEWY 1KYIA 1UEJA 3CPEA 4M9XA 5DI9A 2OBMA 4JJKA 4KVAA 1P2TA 1KJZA 2VHUA 2FSFA 3IIKA 1UBCA 2ZAMA 4PC2A 4PC3A 4ARZB 2XXAB 2O8CB 1ZU4A 1SVLA 1GRQA 2H16A 4JLAA 2AFHE 2UZ3A 3ADDA 3W6NA 3KJEA 4D81A 1OSNA 3HPQA 1US8B 5EP2A 4A2WA 1KMHB 3HYTA 3L82B 1CF4A 4LSGA 1DAIA 5DNYB 1N5LA 2A5FA 3BORA 2FEMA 3WNCA 2PZFA 2G88A 1F60A 1YR8A 4DLYA 1G8PA 2IEYA 1Q20A 2ZROA 4W5HA 3GEHA 3C4JA 3RS4A 4I1UA 1A1VA 4IDPA 5HZHA 4IVPA 3LH5A 5KTYA 1NVVR 4C7OA 5GVRA 3EZ6A 1U8YA 1OYYA 1VCMA 3CR7A 3KTAB 1ZNWA 4JJZA 1XXHB 4UNQA 4XWKA 3BWDD 3QF4B 4JKYA 1ZCAA 3TK1A 1G4AE 4MRNA 1CTQA 4E22A 3AVTA 2F1IA 3BJIC 1U2RA 5DLQC 4LV8B 3UWKA 4ESHA 1IY1A 2D4HA 3GLHA 2QL6A 2IWHA 1JR3A 4QHSA 1EG7A 2BIFA 1A2BA 1N6OA 4BGDA 2ZYWX 2UZIR 2ZEJA 3RNLA 3RS3A 1LS1A 2FOLA 4D26A 1SKYE 4B73A 1KY2A 4R2IA 1K6MA 2WV9A 5SZKB 2ASEA 3THXA 3QXCA 4NCJA 3WP0A 4A6PA 3LLUA 3HU3A 3U3KA 4CZ2A 3AVOA 3QG5A 4OL0A 2NG1A 3HU1A 3QKUA 2DWOA 4F4JA 4DB4A 1K8RA 1U8AA 3R9IA 1AIPA 3CF0A 4R9UC 2V55B 3THWA 1TEXA 1VKJA 3R8FA 2NQ2C 1Z6GA 2GF0A 3REGA 5UKDA 4LUCA 3BBPA 2VPPA 2WSSD 3CZQA 3GP8A 3OF5A 5LDDC 1Q1BA 4QM7A 1IBRA 1P3JA 2WPDA 4QG7A 3SC3A 1P9NA 1VMAA 4GBMA 1XCPA 3ZGXA 4OK5A 4JL6A 4U7DA 3I73A 2YWFA 4ZDJA 1F2UA 4UJ3A 1U9IA 4NCHA 2UVQA 1QVRA 3W90A 4ILEA 1KMQA 1OXUA 1W48A 2HJGA 4LJYA 4WVFA 3PXGA 2BMEA 2J7PD 3GLIB 4DSNA 2ZUDA 4OBEA 4MGYR 3EPLA 3FKQA 4WOPA 1TF2A 3VU9B 3NC0C 3UANA 2CE2X 1XEXA 2VYFA 2Q3MA 1E32A 4F92B 5CK4A 2WIBA 2ZI9A 3AEZA 1NIJA 4MH0R 1O87A 1VPLA 5JJIA 1P62B 2DYKA 1CP2A 5TARA 1FW6A 2QZ4A 3DMDA 2F9MA 4HUQB 1SVOA 3T12A 4Q1CA 1G41A 2FX3A 1SHZA 1W4CA 3SS8A 1XU4A 1GAJA 2OESA 2IXFA 4KHZA 4PPGA 4TYNA 4Q4HB 2IUUA 2X8AA 1S0UA 2JLZA 4LDJA 1UPTA 5C2JB 3NHAA 3C14C 3IGFA 5KPJA 1CS4C 1NLYA 2P5SA 3CUEF 4QBGB 4NYJR 4MRSA 4B2LA 5FBVB 5J4LA 5FUXA 3GJ4A 4WXPA 4A2PA 2V3CC 3LY5A 5FBWB 1AJEA 2JJ1A 2RHMA 4JVNA 2WKPA 2ORIA 1PVOA 2WICA 1TNDA 4D0GA 1QBKC 2DY1A 2YZ2A 4LV5B 1BKDR 4JLBA 2XGJA 2P3SA 4A8JA 2ZYVX 1KSFX 1P9WA 4GDFA 3JVVA 2CCKA 4JT4A 5JI2E 4A9AA 4BLPA 4Q9HA 2C9YA 2QNRA 1N25A 1S2MA 4RZ2A 4DEYA 2IS6A 4YDSA 5FTMA 1F2TB 3K8YA 3W6PA 2GJSA 4HB0A 5DYGA 2YNMA 2IWRA 4KITB 4GMXA 5CYOA 1FOEB 5IK2D 1RC8A 1TEVA 2G3YA 4C4PA 2RGCA 1N0WA 2R6CA 3OAAA 1M2OB 3B9PA 1KHTA 3IUYA 1RIFA 1MV5A 4BLTA 1NNEA 1X1SA 3LQQA 2W58A 2GXSA 2FZ4A 1XD2A 2VLIA 3NHBA 4LYAA 1W36B 4MKFA 3GCGA 3VQTA 2IXEA 1IN7A 5B30A 4GOJA 2ANBA 4CEHA 2R6AA 2OFWA 2P6NA 1VG9B 3R20A 4EQ6A 1T9HA 4FI3C 1TTTA 1OHHD 2AK2A 4MQBA 4TTQA 4GMDA 4ZV4A 3N2EA 4D4MA 1BMFA 3Q85A 5HR5A 2J0UA 2P67A 3OIVA 3K9LA 2CK3A 3OEEA 3LVRE 2FFAA 3SHWA 4O2LA 4H9GA 3GLGB 4PSVA 4M1WA 1BYUA 1NBME 2QM7A 5CDFE 4RD3A 3T1VA 4M21A 1G17A 1WMSA 1PV4A 3VR2A 2IUSA 2O8DB 1J8MF 5DI3A 2W6JD 3K0FA 3QSYA 4DIDA 1OF1A 2PLRA 1JB1A 1Z8FA 1XNJA 2ZRMA 1D6JA 4M2LA 5CYPA 4B6FA 4P4SA 4MYUA 3IHLA 1G19A 4OQLA 1XTQA 3ONWA 1S3SA 1VTKA 3ZD6A 2D2EA 4BUJA 1L4UA 2H57A 5EUQB 1FP6A 4EPXA 1P9RA 1XEFA 1P7CA 3B1VA 421PA 2HCJB 4LYHA 4TWZA 3FWYA 4KSCA 1E3MA 4Q1AA 3WMEA 3OIWA 1KOFA 5TB5A 2VEDA 4QM6A 1WA5A 4ZDWA 3PG5A 1F6BA 1GDDA 1WXQA 2Q0HA 4GOKA 4DBLC 3ETLA 2GJ9A 1II8A 1ESMA 2N42A 3H1TA 2C96A 3K9HA 2JLXA 4OYHA 2YJTD 2SHKA 1D9ZA 1SVMA 2ANCA 2WOJA 3R9WA 2GAAA 2WIAA 1CBUA 2L0XA 1FTNA 3M4YA 3AB3A 4M4SA 4DZZA 2BKUA 4M22A 1FQJA 3EZFA 1X8LA 6Q21A 4A36A 2Z6VA 1YZUA 3B6EA 1GILA 1A82A 1RW4A 3RHFA 1RRCA 2A2ZA 3K0EA 4QBHA 2ZM5A 2ONJA 2EWWA 1EXMA 3OHMA 3UXMA 2GEDA 2YOFA 1BS1A 3RWOA 3A6PC 1T91A 1ZM2A 4BZPA 4MGKR 1YKSA 1G7SA 2BWJA 3THOA 2CHGA 4D0NA 3AF2A 2YINC 3AKEA 5ELXA 1XRJA 4PHTA 5KHOC 1GNQA 5K8LA 3WYGA 1KDPA 2B7CA 3C16C 4TTRA 1RKBA 4Q02A 1W36C 1U98A 1II9A 3P27A 2CE7A 4B32A 2F3RA 4A0FA 2PBRA 5J4HA 1X6VA 2RH5A 3ICQB 2IBMA 1G21E 1W4BA 4QOSA 3NEYA 4LBZA 1ETUA 1WE2A 3EPKA 3R9XA 3LWNA 2CJWB 1Q44A 5LB4A 3BS4A 2BC9A 2B8WA 4TL6A 3EPHA 3EIEA 1P72A 5FR2A 2G0NA 2BBWA 4EFMA 3UMFA 2GVZC 3LW8A 2VQSA 3CONA 4JZKA 1XBTA 2NPFA 4M1KA 4PPNA 3GLHE 4NTZA 4E5UA 2YOHA 5FBLB 3O8DA 2WJVA 4OHWA 4NZYA 1H65A 4G5SA 4LJAA 1QHYA 2DPXA 1XTKA 4FD2A 4XOIA 2J7PA 2WOOA 2QSYA 2F3TA 1R7RA 3DO6A 2XB2A 3T61A 5BW8A 3UMSA 4ACAA 3QKRB 4QGGA 2GRJA 4AK9A 1ZC4A 3CRVA 4TMTA 3IIMA 1KK1A 3KXIA 3NEJA 3CM0A 3GFPA 1OH6A 4GFDA 3IO3A 3I72A 1G291 2CNWA 1RPZA 5FUWA 4ZDKA 1N5KA 1AKYA 1NKTA 5EXXA 4P31A 3LD9A 4OK6A 4OHVA 5L3SA 2CXXA 1KI8A 4FMCB 4YMSA 2OCAA 1Z0JA 1DPFA 2GJKA 1FMJA 2PMDA 4IEEA 1E2PA 1X3SA 5ANRB 2JLYA 5L8VA 3QVVA 2V4ZA 3AVPA 1S96A 1KI7A 3LQRA 2PX0A 1AA9A 4AY2A 1IN8A 1DS6A 1CJMA 2ZETA 5FFMA 1ZJ6A 3P4XA 1OH5A 3SE0A 4XVRA 3O8BA 3MLEA 1W44A 4Q48A 2BKEA 2A9KA 2CVFA 1R0WA 1R8QA 2OM2A 2O8BA 1TF7A 4JVLA 3U4QA 2VF7A 5EJEA 2F6RA 5EP4A 1N6KA 4C3ZA 1NRJB 1N6PA 5M04A 4B75A 1YZKA 2QI9C 3CNOA 3VKGA 3I92A 3THYB 2IS1A 1TUEA 3L8ZA 2FNAA 2BJWA 2BDTA 1EK0A 2VP0A 3L8YA 4D0LB 3RLFA 5KSYA 2TMKA 3EC1A 3ZQJA 2JATA 2E87A 3I62A 3FMOB 1KGDA 4B44A 1RVDA 1W2HA 3B1XA 1KSHA 4RD2A 3M0EA 4B3GA 1ZUIA 4EPYA 3H2YA 1ZIOA 1G9XA 2YYZA 2F9LA 2J46A 4JLPA 3CR8A 2ZU0C 1GFIA 3B5JA 1ZM7A 1ZUNB 5IK2A 1E99A 3S1AA 4LJ8A 4LYJA 1FNMA 3TUIC 4ERNA 2QEQA 2J0SA 2A78A 2AD1A 2RGDA 2P5TB 4X8LA 2MSCB 3UWOA 1QRAA 2IX3A 4R2HA 3N70A 3FMFA 1GUAA 3FE2A 4A15A 4TTPA 3TNFA 4ZIRB 4F4CA 3W34A 4HZUB 4NMMA 4NONA 1TU3A 2QTVB 1YHNA 2OG2A 4QKQA 1GL6A 4XIGS 4Z1MD 4US1R 4NCNA 4BLRA 4DT1A 2ZSBA 3BOSA 1S3GA 3TMKA 2BBTA 1UEIA 2FF7A 5JJLA 2PEYA 4DKXA 3DDCA 3LXXA 3QKSA 4OHZA 1W46A 2C77A 2FGJA 1G64A 2QMUA 4HB2A 2CL6X 3AVQA 2ZRHA 3QJYA 3W9YA 2W6JA 1R2QA 1Z0IA 3DKPA 1T3HA 3FFAA 3BERA 1GRRA 2REXB 4KXFB 4Q4JB 1D2NA 4O25A 3U6KA 3ADBA 1ZYUA 2XTMA 2B6HA 1G8YA 5KNBA 1E2JA 1E98A 1J8YF 2IYYA 4IXMA 3NXSA 4ZKEA 1SXJA 4Q66C 1HQYE 1U0LA 2VP2A 3A1VA 4OK3A 4RD6A 4EUNA 1W47A 2O8FA 3U60B 2WPDD 5HE8A 3RANA 3V4RA 5E95A 3CBQA 1NMXA 3P32A 3TE6A 1LVGA 2RKOA 1TQ6A 3ZYCA 1E9RA 3CRW1 1OFIA 5FPYA 1E6CA 5FL3A 4TL8A 1ANKA 2H1LA 3D8BA 1L7VC 3G5UA 3QXHA 4XD7A 4Q7JB 4YLGA 3RWMB 4TYWA 4Q1DA 4DDTA 4YDHB 2RB4A 5CK5A 4A0RA 5TV2A 1Q1EA 3TIFA 1G3MA 5EE5B 3HJNA 4GI7A 2WMNB 3AKDA 1DOAA 1E1QD 2GWHA 3QBVA 2OAP1 4LYFA 1D9XA 5P21A 2ECKA 4HLUA 4A92A 2QP3A 3CH4B 1F48A 1VYUA 2GJ8A 1ZAKA 4FCTA 2RAPA 3EA0A 2PMKA 3C5CA 3X1DA 3BGWA 3IHWA 1WBDA 3NBXX 1XTRA 3CNNA 1KK0A 3SJCA 3GEIA 2QE7D 3T5DA 1XEXB 4MKIA 1IN4A 1PLKA 3KQKA 1VECA 4RVCA 4Q18A 1T5LA 2JJ1D 1LV7A 2Z5FA 1A4RA 2XOKA 3FVQA 3B13B 3X1XA 3K9GA 4V03A 2R8RA 2YV5A 5EZ5A 2A3RA 2GEVA 4RSGA 4UXIA 4DUGD 4PO1A 1JXMA 1MRNA 2F7SA 1XXHE 2ZQ5A 1G7RA 3OE7D 3SJBA 2ODNA 4MGIR 2ZRDA 3IEVA 2QPTA 4BFTA 4DCUA 1ZC3A 2LWIA 3X1WA 2GA8A 1S1CA 1II0A 1YRBA 2ZJZA 4DCNA 2OHFA 5IT5A 1GL7A 1JECA 4UNNA 2CDNA 1J70A 2AHOA 1W7AA 1NBMA 3CKLA 3UPUA 2ZVPX 1M7BA 4HAXA 4KFUA 5BYKA 5FUVA 1E96A 2IUTA 5BN3A 4MYCA 3EZ2A 4A8JB 1EGAA 2R6DA 4I1SA 4Q9JA 4PHFA 4RFSA 4CT5A 1XMIA 1T4GA 2ZJOA 2CHQA 3K53A 3QPUA 4PQYA 1QVAA 2XZOA 4BE7B 4OI0A 2ZS7A 3FYHA 1E0AA 1ZD9A 3OEHD 3BFXA 4XVQA 2QT1A 1NVVQ 3QXJA 4P0TA 4B6EA 1SKQA 4IVQA 3CZPA 4LC0A 1W4AA 2QTFA 5JI3E 1CIPA 1ZM3A 3LAWA 2J0QA 4DIEA 4BFXA 3GMTA 2CK3D 2Z4RA 1L2TA 4TYPA 2ZE6A 3H86A 1HE1C 2JGNA 3KKMA 1BO6A 4Q4AB 4E07A 5LD2B 1KO1A 4NE2A 5B2ZA 1T3SA 4ZPXA 1XD2B 2J1LA 1NVXQ 2ODEA 2VP5A 2G0TA 4H1VA 2BBOA 3K70B 4CEHB 3WHKA 1G16A 3KQLA 2Z0MA 2PX3A 4CEIA 4EQ6B 5EXSA 2QT0A 1CJUC 1AGRA 3ZVLA 2G6BA 2XZLA 2ZI7A 4UNRA 1X86B 1KI3A 5DGXA 1OFTA 2EYQA 3RS5A 1U9IC 2J0UB 3AF0A 4HLQB 4DCSA 3AKYA 1KZ7B 4Q47A 2C03A 5KNCA 2AFIE 4FMCF 1FL9A 4KI0A 4M1TA 3CWZA 4LBWA 4UNSA 3SEAA 4FIDA 1P75A 4U5XA 4TMXA 2ZJ8A 3LRPA 2ATXA 1KJYA 2VRWA 4Q9IA 4P4SB 3SYKA 1HTWA 3M6AA 5DIFA 3TJZA 4MUAA 4Q01A 5C46F 2JLVA 3A4NA 2OSBA 4QRHA 1CLUA 3IBGA 4MUBA 4OI4A 5EP1A 5FOWA 3T15A 3OIUA 1H8EA 1IJFA 1DE0A 3ASZA 1N0VC 4TQAA 4G0NA 3SJAA 4TMWA 3WRYC 3ZVMA 3NIBA 4KV9A 5E7IA 3WRXC 4OI1A 3WBKA 4WIAA 4BFYA 4IOKA 4KBFA 4QNMA 3QXXA 4LJ9A 4IW3B 1R4AA 3U7EB 5JS7A 4OJKA 1BYIA 1AQYA 3U7GA 5EE9A 4Z1MA 2V54A 4DCTA 3NVAA 1R10A 2WSMA 2Y8EA 2BMDA 3L0IB 4D6PA 1N0UA 2Q21A 1S9DA 2XJ9A 3LO5A 1UKEA 4A8JC 3IQWA 4V0ME 1C4OA 1WCV1 3FHCB 1KI4A 2VP6A 3TQFA 1BIFA 4NPHA 1J7KA 1NN3A 2GCOA 2D7CA 2X2EA 2ZRPA 1K5DA 2W2VA 4L4UA 1YZTA 3VX4A 4L16A 1R0YA 1IQPA 2B8TA 4NYJQ 3ZH9B 5L3QA 5FH9A 2FPKA 3PFIA 1E9FA 3QF7A 4S2EA 5B58C 5JFGA 1Z63A 3W8NA 3Q7PA 5JWRA 2GZHA 1EFHA 1J2JA 1G20E 3GJXC 3U44A 2GXUA 2NO0A 3SBDA 1QZXA 4AKGA 4KSBA 1D5CA 1WRBA 2FGKA 4Y0AA 5G3YA 1VYVA 2VF8A 5LD2C 5JCZA 5KO2A 3BB1A 1Q12A 3W3AA 1KI6A 5A5GA 3PUZA 1DO0A 1XZQA 2C04A 3C5HA 5L3RA 1CRQA 1RJ9A 2R62A 3QVUA 2HF9A 3HWSA 3KJHA 4RD4A 3TVDA 3VMFA 3K70C 3BH0A 3KB2A 4L15A 2AWNA 3NDPA 3UG6A 2QPOA 2CCJA 2REBA 3I5XA 3PEWA 4B2IA 2X2FA 4G5OA 1XMSA 2IF2A 4A4DA 2ZR7A 4GNKA 2BHRA 4O0MA 4L8GA 1KO8A 3SFZA 2PL3A 2EYUA 3F5FA 1JQLB 2E9SA 1QF9A 2QRZA 3EW9A 4NYMR 2O8EA 4DLZA 4BPBA 5GJCA 1VDZA 1QHNA 3WY9A 2HUPA 4LHVA 1E9DA 2GJAA 2PZEA 4NU0A 1GVNB 2J9RA 4MDFA 4TLCA 2WTUA 1SXJE 2VO1A 2O5VA 4NCKA 2PEZA 2CNWD 4DSUA 3FPAA 2O52A 3SFVA 3A4LA 1E1QA 4HAZA 2F55A 2IYQA 4DSOA 2W0SA 2HEIA 5J47A 4QBIA 4C0KA 5SZIA 3DL0A 1SVKA 2HYDA 1UFQA 2IC5A 1QHHA 4Q21A 2V7QA 2F1RA 2HLDA 3PR1A 5FOXA 1WQ1R 2ODBA 2IXGA 2ZJ5A 2AN9A 1E2MA 4Y0VA 1E2GA 2QE7A 2YWHA 3BE4A 4KCGA 3QG1A 4WXRA 1CEEA 2ZRNA 5BXQC 3AF3A 3RSOA 1PJRA 2WBLC 4KLNA 1NLZA 4PO9A 4LJ5A 3RRZA 2ODWA 3GJ3A 1DG3A 3GQBA 4NYIQ 3Q7QA 1N6IA 2VSOA 2DHRA 1E2HA 2JLWA 3TBKA 4DUGA 2I4IA 3GLFE 3LLMA 2W2XA 1ZCBA 3JZAA 4HAWA 3J81k 3LDAA 1XZPA 3MWLA 3OE7A 4BZQA 3BH7A 2RHDA 3TQCA 1FUUA 2LKCA 3Q8XB 3I3SR 5C1BA 4MRRA 2R65A 3EG5A 5FPSA 3G0HA 2IHBA 3CPJB 1YRAA 3NG1A 121PA 3X1YA 2PH1A 3K09C 5GJWC 3LV8A 2AXPA 1VCIA 1O3YA 5G3ZA 2MMGA 4UKDA 5CITA 2O8BB 1NN5A 3CO5A 3AGQA 5EXTA 1JR6A 4LZZA 4A1FA 2NGRA 4V0LA 1UKVY 2F1JA 4M1YA 2CL0X 5HCNA 3A1TA 5HZKA 4N0EA 3LNCA 4DHEA 1VG1A 2WJHA 3ZDQA 1S9HA 3OEHA 4IDOA 4D4LA 4DDUA 3TSWA 3VTKA 2DCUA 3OESA 4BFUA 1RRFA 1W4RA 2J3EA 4PSKA 2Q6TA 1FX0A 3E1SA 3AVXA 2PLFA 3CPHA 1R0XA 4C0JA 5J4KA 3AV0B 3CX6A 2FDCA 4V0KA 3K0CA 1KDRA 3E2IA 1ZM9A 1KI2A 3CNLA 4TZ6A 2OFOA 2GETA 3VR4A 3EIQA 4B3CA 3MCAA 1Z0KA 1LW7A 3B7GA 3MFYA 3RC8A 1VHTA 3NKVA 4Q00A 1E2EA 1Z6AA 1L8QA 2VH5R 4NYIR 1IXRC 4DC9A 2ZSFA 2JCSA 1ZIPA 3PUYA 4BFWA 4DT1B 3KQNA 2ZS9A 5TDHA 3PUVA 2AL7A 1SXJD 4C30A 3RRMA 3QKSB 3UG7A 1NSFA 1NVUQ 3JZMA 4WAUA 3EPJA 4UXJA 5K8UA 3RVBA 1LB1B 4EPWA 4Q1FA 3JVUA 1ONBA 4LHZA 3E5HA 5D3MB 2V9PA 3GEEA 2ZRLA 1X8KA 3D7MA 1US8A 1YJ5A 4EPTA 4O3MA 3FB4A 3UATA 2HT6A 4W5JA 2BBSA 1BOFA 1NJGA 2G77B 4XD7D 5A4JA 1NVWQ 2KB0A 3U6BA 1JJVA 1W0KD 2C9OA 2J41A 2RGBA 3GPLA 4MA4A 4CW7A 5AWFC 2RMKA 4JLOA 2FPLA 4J0QA 4LX0A 1KI9A 3IO5A 5JWOA 3SQWA 4QL3A 1EFRA 3AF4A 4QHYA 4QBFA 4QXAA 3KQUA 2DR3A 1XXHA 5E3HA 4QJ3A 2W00A 3QF4A 1GZSA 1E0KA 3Q9LA 2IL1A 2N1BA 5DYIA 3CIOA 2YVUA 3WYFA 4D82A 2ZYTX 1UDXA 3SBEA 4OQMA 2FEOA 4XWAA 1DAMA 4F93B 1HH4A 1P2UA 2JJ2A 4FN5A 2KJQA 5AR1A 1MO5A 2HXSA 4CVNA 4OKSA 3OZXA 2DFKB 4DDVA 4JT2A 4NH0A 3IPYA 3MRSA 3PVSA 3EXAA 4XWOA 5F98A 1ESNA 2KWIA 1Y63A 2KBEA 3DM5A 4K81B 4LY6A 1D2EA 1I2MA 2XOKD 4WA7A 1OW3B 2WJYA 2CVHA 1W49A 3KDSE 3PENA 4O2RA 3TVTA 2BMFA 3ZQ6A 1GNRA 1M6NA 4A0HA 1WF3A 4BEBA 1PZNA 1XF9A 4KFRA 2ZJ2A 4DLVA 2DB3A 2A5DA 2OCBA 3VFDA 2NO9A 5IRCD 4Q9KA 5F9FA 1R5BA 4JKIA 1E9AA 2MMCA 2EFGA 3ADKA 5E7JA 4BRUA 4MRPA 3NBFA 3U5ZB 2IF0A 3SQXA 1FUKA 3ECCA 4Q5IA 1NBMD 3CRRA 1HT2E 3I8XA 3AKCA 4EKDA 2RGGA 5AK0A 3IKJA 4Q7LA 3GFOA 1CR0A 2R6FA 2HYIC 3CB4A 4E03A 1XPOA 2J5XA 2D7DA 2ZE5A 1E2DA 4IFEA 5JSZB 2PCLA 3Q5DA 3B85A 5KOYA 2OZEA 1NKSA 4TT3D 1XTJA 4TYYA 2HDNB 2ZRJA 1QHXA 4PAMA 1RZ3A 4LI0A 4OQFA 4G1UC 2NTYC 3U61B 2A5YB 2KI5A 4V02A 2ZRFA 2PT5A 1TPZA 4KFTA 4Q7MB 5J40A 1SVWA 4KODA 3A36A 4M9QA 4CF7A 1Z08A 4WBSA 4Q4HA 1T8UA 3LFUA 4RFSB 4X8MA 4HUTA 1GP2A 3U3JA 5E7MA 2JAQA 4CT4B 2D2FA 2BCJQ 1JBKA 2LKDA 4JLKA 4L9WA 4Q9LA 4B33A 1Z06A 3HDTA 1GKYA 2AK3A 4QGHA 3TAHA 1JALA 1G18A 2JIZD 621PA 3D31A 5H8WA 4B2PA 3ZZTA 4B47A 5IF9A 3EARA 4PPFA 4W5WA 4DXAA 5K8TA 2W2TA 4W7SA 1X8JA 3ZJYA 2CHVA 1OXSC 1RFLA 1TADA 1OE0A 4MRVA 2QA5A 3FMPB 3QE0A 2IS2A 3QOFA 3P26A 2EFDB 3QPWA 1NIPA 3M1IA 4FMDB 2IW3A 3A58B 3KKOA 4RZUA 3LXRA 4RY2A 4EAQA 1XPUA 3I4LA 1ZW6A 3DZDA 5FL7A 3V00A 3TKLA 1MRSA 2Q9BA 1OXTA 5BN4A 2WWXA 4DDWA 2EFEB 4CEIB 4PPQA 1GKUB 2IYUA 2ZAOA 3KJIA 3QIAA 4QHTA 1AM4D 2OLKA 2R2AA 4V0MA 2F1HA 4KVGA 4NL4H 4V0NA 2NIPA 5EP3A 2EFCB 4DWJA 4EFLA 3NWJA 4HLUC 1E0JA 1H8ED 2GBLC 3QENA 2I3BA 1TQDA 3VR3A 1Z6TA 1U81A 1OXXK 2FE4A 2O0KA 1AQUA 5KNDA 3AVVA 1VCOA 1IN6A 1DAEA 4XTRA 4BASA 4P4UA 3SYLA 5HKKD 4IXNA 5TY0A 4AD8A 4B35A 4EJSA 4XTCS 4BLSA 1Z6XA 4KLZA 1E2QA 1A2KC 1UJ2A 1IHUA 1NSTA 2QU8A 4NDZA 2DWQA 4LHWA 2OUKA 3DVLA 4HSEA 4HDQB 3LX8A 4PQFA 1G3RA 1OIXA 4WW0A 3NH9A 1ZU5A 1DARA 3SDZA 2O8DA 4JL5A 5EE3A 1VCNA 3GJ7A 5KSPA 1T6NA 3MMPA 3AVWA 2C8VA 5F3WB 1KAOA 1N6HA 2VTKA 3EZ9A 2IYZA 2FJUA 3ASYA 1S8FA 4PZLA 2RGNC 4C7OB 1UBEA 1NLFA 3B1ZA 1EX6A 4MGZR 5G53C 2QP9X 4RCYA 2GKSA 1IJEA 2OLJA 3TUZC 4TSFA 5JWHA 3EA5A 5JJKA 4IDNA 2C99A 1XJCA 2ZRIA 4I1VA 2XZPA 4LPKA 1CJVC 1Z6YA 2BMJA 2Z43A 4G5QA 1AS3A 4D4JA 1KZGB 1HEIA 4URYR 4YMWA 3GLHB 3N5CA 4PHGA 5JBQA 1Z2AA 3LBNA 2YHSA 2IYVA 2GCOB 1HE8B 1W5TA 4ASUA 2G83A 4GZMA 4US2R 2K5UA 4KYUA 4A0GA 1PLLA 5L3QB 1E2LA 4PTLA 5FI1B 2NPIA 3THXB 4H1UA 4HAVA 3BXZA 1AZTA 5IHPA 5K8IA 3U44B 2FWRA 3A1SA 4N1AA 3QUSA 4YXWA 2BEJA 4F7WA 5HTKA 1GITA 4HEJA 1IY2A 3L0SA 3THWB 1RYFA 1W0KA 5JS8A 3CLVA 1R8SA 4UJ5A 3REFA 3VR6A 2G1JA 4RKFA 3KJGA 1KI6B 2XNDD 1M74A 2OCYC 2VHJA 3W8RA 1KKMA 5EUMA 1RJ9B 3A8TA 1XEWX 1UBFA 4TMKA 2QP4A 2QAGA 4LV6A 1LNZA 3L43A 1YR7A 2ZTSA 4HATA 3SOPA 3GLFA 4G5RA 2G9NA 2IT1A 4AURA 1F2UB 3BB3A 1XJ0A 1KSGA 2CL7X 3DHWC 4PAOA 1JJ7A 4QFMA 3A4MA 1KSJA 2DFNA 2FSHA 4HYYA 4C0LA 5SZHB 3U7HB 3GFTA 4P33A 2V7QD 3NH6A 1OLOA 1BH2A 1JAHA 2HLDD 3DKVA 4IFBA 1OXVA 5AJVB 3WHLA 1G7CA 2H92A 1I4DD 4GT1A 4II7A 4JYBA 5FPHA 4KFSA 2QTHA 2KBFA 1GG2A 2YWGA 1IN5A 2EW1A 1M7HA 3LW7A 1W2GA 3Q72A 3GJ5A 4IDHA 5JECA 3T1QA 2VHQA 5B64A 5FPKA 1Z47A 2GCNA 4HB4A 2ZI4A 2ZI5A 4JLDA 2BM1A 5CIQA 2ZI6A 4L5BA 3BRWD 4HZIA 5AJYA 3TSOA 2IS4A 3IQXA 1Z0AA 4B3XA 4B48A 3TUJC 3LX5A 5GVSA 1XCGB 5BYJA 5J4VA 1Z07A 3AM1A 3U7FB 1KY3A 1E2KA 1B23P 3RDPA 1QHHB 2EFHB 4LCBA 4XJXA 4B3BA 2OXRA 5FBRB 2OCPA 1CR2A 4ZI3A 2I1VB 5FOSA 3FHOA 3PITA 5AJXA 1FFHA 1FQKA 3IEUA 4RZ3A 2X77A 3OFND 5KSOA 5LB2A 1UKYA 4A6XA 3RRYA 4URWR 2IYXA 3PQCA 3TAUA 4URXR 4HAUA 3EASA 1AZSC 1E94E 4N3NA 1CULC 2P65A 2QMHA 4CRWB 3QKRA 1GRNA 1CR4A 4ZCLA 4TT3A 4M1MA 4QJ4A 4Q03A 2J87A 1Q57A 1YZGA 4TZ0A 4C2UA 4HAYA 2BCGY 2PCJA 4I1OA 1DAHA 2CBZA 2QN6A 5C4GB 1RE0A 2CMKA 2E1RA 4IJMA 5CM8B 3RC3A 1NY5A 4ACBA 1MKYA 1SVIA 3RAPR 3HYRA 2ZJYA 4E09A 1NY6A 2X19A 3O8RA 1LFDB 2MSEB 2YC4C 3A1UA 4XSHA 4F4IA 2W6ID 4M0LA 1XX6A 3TH5A 1H8HD 3GLIE 4PC1A 2QM8A 1LF0A 4RD1A 2IHYA 1P6XA 4JBXA 1CKEA 3Q5EA 1AS0A 2JIZA 5EZ6B 4DLRA 4I99A 5H68A 4DJTA 1Q22A 4WZBE 1FX0B 2RGAA 5D3QA 1T0HB 4DSTA 2A5GA 1LTQA 3MJRA 3LBIA 1N6RA 2BV3A 2NZJA 1W1WA 1E9EA 3AP3A 3GD7A 3T1TA 4YONB 1YZQA 5EQTA 4ABYA 4C0BA 3R7WA 1OH8A 2RGEA 2ZU6A 1M34E 1ZBDA 2QBYA 2WWGA 3ZVNA 1JPJA 3EIHA 5DI3B 3K0FB 3R8CA 4MYHA 2RCNA 3RS0A 5H1YA 1GTVA 1NI3A 2BEKA 3KB1A 2ZR0A 5HPYB 1U8ZA 5TXGA 4YMUA 3AGPA 4CEJA 3PEUA 5JLJA 2ZSDA 1SGWA 3UMRA 1Q21A 3TRFA 3B78A 4ZDIA 1AN0A 3F8TA 3H4MA 1MOZA 1TU4A 4KYIB 4GRAA 4BEJA 4NYMQ 3AUXA 5KDDA 2H7VA 3MAAC 4RKEA 5GJBA 1EFRD 2WHXA 2GILA 3T06B 4FMDF 4ZIRA 2Q3FA 1M1YE 2ERYA 4HZUA 5HKKA 2LCFA 3K0AA 4JVSB 3ZIAA 5KUTA 3UIEA 1II8B 1XCMA 2KE5A 4RD0A 3VKHA 2ORWA 2WM9B 3IPXA 3BAFA 4OQNA 1DADA 1OKKD 4LC1A 4PSAA 2JJ2D 3ADCA 3QPVA 2CLDX 1OB2A 1TF5A 1ZUHA 2P0EA 3O47A 3SR0A 1OV4A 1PUJA 4LPSA 2QPAA 2ZUCA 1N6NA 1HV8A 1YZLA 2WWHA 1COWD 1UADA 4MKGA 4Q4JA 4M8NE 3FKSD 2JDID 1QG2A 1CJTC 1E9SA 3T1OA 1OFUX 1VG8A 2ZSAA 1NN1A 2NO6A 1JEEA 3UKDA 1UF9A 2QRNA 4A2QA 2FPMA 3KXKA 4TLBA 1G6OA 2QQEA 1R6BX 1AKEA 1XTIA 2GZDA 1XMJA 4TLEA 5CJPA 3VR1A 4JBYA 1Z83A 2V8OA 1OFHA 3GLGE 2OXCA 1Z22A 5A0FA 1GM5A 4GZLA 4Z51A 4I4LA 2O0HA 2RGXA 3C41J 1MR3F 2VHCA 2JLQA 4YMVA 4BRWA 4WZ6A 4G3XA 4G5GA 3RSLA 1Q1ZA 3MUFA 4NBSA 3KKNA 4B76A 3FTQA 2OBNA 4TLDA 3SJZA 5KDLA 4EPRA 3BH6A 2ONKA 2XB4A 5DE3A 5GADl 1MABA 5CB6A 3TSZA 2ZITA 3ND8A 3PEVA 3DOEA 4Q19A 3K0CC 1C9KA 4P3YA 3K9NA 1ZMXA 2XNDA 1G8HA 1IAQA 5TVKA 2D3WA 1AGPA 2WKQA 4D80A 3DEFA 2F43A 5FPTA 2JEOA 5FTKA 1OIWA 1TAGA 1XD9A 4M9SA 4FCVA 4DLUA 2IK8A 2ZE8A 5DISB 2GK7A 3OIYA 4UNPA 3CRQA 5JRJA 2WMOB 4P4TA 3AVUA 3BK7A 5CM9C 2WAXA 3PUWA 2QROA 2CLSA 1ZNYA 5FI0B 3ND9A 1XFAA 4FCWA 4BLOA 2FSGA 4URVR 4US0R 4JLNA 1P73A 1FMLA 2VL7A 2ZJBA 1EFCA 1SQ5A 2D74A 3CF2A 3KX2A 3C15C 5C4MA 2V1XA 2HF8A 5AUQA 1JAIA 2H5EA 1E4VA 1G3UA 1QHIA 1NF3A 1VHLA 1Z28A 1OT3A 5L3SB 4GOXA 2GNOA 1TX4B 1DO2A 2J59A 3T35A 1ZD8A 5E4FA 4EIWA 4R7ZA 4RCZA 2HJVA 5FL7D 1F5NA 1ODFA 5FOVA 2JASA 4KBGA 1ZNZA 4KO8A 4KJZA 2ZREA 1CJKC 4M1SA 3P4YA 3SYNA 3FGNA 4B3DA 3VHLB 2H17A 2FU5C 1EFTA 1E9CA 8OHMA 1P5ZB 4HDCA 3WYAA 3OFNA 1HA3A 2D62A 3BC1A 4K8OA 5JMTA 2ZANA 3QKTA 3U4QB 2GHIA 2N46A 5JCPA 1W36D 1I2DA 4MYTA 2Q9CA 1OPXA 2FN4A 3FMIA 3Q3JB 1ZNXA 5SZJA 2JLUA 3AH8A 1XD8A 3VNVA 4AG5A 3BD9A 5JZVA 5CJ2A 2AKYA 2BJVA 2ZRBA 1WP9A 4NP6A 3ZD7A 2ZSEA 1DAGA 2DFLA 3B9QA 1E2FA 2HT1A 2H8KA 4DVGA 5JHGB 1E1RD 3I32A 3HU2A 4IKEA 5F2EA 1XPRA 1EESA 4ZCMA 3GJ0A 3S1AB 1N5JA 4Q4AA 1ZD1A 4NHOA 3T34A 1OIVA 4L9SA 5HE9A 4IOMA 4DLTA 3U3OA 1E9BA 1SKYB 4POAA 1MO4A 2P6RA 2XTZA 221PA 4AYXA 2W6IA 2P6UA 2ZE7A 1H8HA 3B60A 2GK6A 1KAGA 2QG6A 1EX7A 2OEPA 3GJ6A 3SHFA 1J90A 2D06A 2OAQ1 1U94A 4EJSB 3SNHA 1FZQA 4TSFD 4Z54A 2CLCX 4GP6A 1HT1E 4RFVA 1G5RA 4PHHA 3CW2A 4C0AC 3GJ8A 1R5OA 1A7JA 3AQ4A 2JLRA 5L3VA 1D2MA 4KU4A 2FFQA 4D2IA 2FV8A 2XXAA 3CF6R 2O8CA 4ARZA 1HUQA 1V5WA 4XH9B 2QGZA 4MKHA 4ASUD 1IONA 2IEZA 1KNXA 3QNUA 3V4FA 1E79D 3MWYW 5DN6D 3AP1A 2XJ4A 5JRZA 1CR1A 3NBZC 1EFUA 4PZYA 2VHTA 2NOAA 4PANA 1W0JD 3WMFA 2WWFA 1AK2A 1R5NA 1WB9A 1KMHA 2OT3B 2C78A 2OV2A 4YXWD 1M8PA 3KL4A 3O8CA 2GXQA 1FP7A 2GDJA 2J7KA 3EWAA 2QMEA 3QQ5A 2WJGA 4OHYA 1SXJB 3X2SA 1ZINA 1CXZA 4C0HA 2YKGA 1CRPA 4IVRA 3MD0A 1KO4A 5CB8A 2AD5A 2O8FB 4XVUA 1Q3HA 3HR8A 4GP7A 1E0SA 3KFVA 1KI1A 2Q9AA 3KUCA 3VX3A 821PA 3KTAA 2GXAA 4W9MC 4CDGA 2Z4SA 3DOFA 5IDVA 3IDQA 1IXZA 1GKIA 1UKZA 1JI0A 1DVRA 4DEXA 1GL9B 1DEKA 1OKKA 2EWVA 4AYWA 4PZZA 2Q3HA 1ZM4A 2OBLA 3CX8A 4AG6A 4N0DA 3C7KA 2GVDC 2O0JA 2ORVA 3LBHA 4QC2A 1KDTA 3PUXA 2BOVA 1UM8A 5KDOA 1QHSA 2REOA 3K09A 3T5GA 2IYWA 2WJIA 3EC2A 1JPNA 2QAGB 3LA6A 5H70A 1COWA 1YE8A 1KO7A 1Z29A 1X1RA 1NG1A 3VKWA 2HCBA 4Q1BA 3FKSA 2JDIA 3WBJA 4BFZA 2V1UA 3GLFB 3LVQE 5AUOB 4DLXA 3KQHA 5BWMA 2FH5B 2VBCA 2V6JA 4HLCA 5DSZA 4B71A 4ESVA 2FFBA 4DB2A 1ZRHA 1Z3IX 4R98A 4TLAA 5AJWA 3NC1C 4FXPA 4EFNA 4JSYA 1EWRA 2G1KA 1P2SA 2WJJA 5DO9A 2MSDB 3N2IA 2C2HA 1KDOA 3D6TB 5GJVC 2YOGA 3B82A 3VHXA 3WXMA 5FUYA 3CWQA 2XX3A 1NMYA 1T0JB 4LOAA 5LBIA 4EJSC 5LPNA 3ZZ0A 4OI2A 2FA9A 1G1MA 1P60A 4P32A 5FOTA 3BIFA 2H18A 4TMVA 1I4LD 1NL3A 3GLIA 1RYHA 4GPTA 4G01B 5KU1A 4M53A 5AUPB 1JEDA 2GZAA 4PR0A 4TN1A 5TMPA 3I61A 2DWPA 4F38A 4FWIB 3VU9A 2HV8A 2ZRCA 4URUR 1LS6A 3BB4A 4PQRA 4RJLA 2WSSA 3A1WA 1KNQA 2YC2C 2VSFA 1JR3E 1NP6A 3PCRB 4HI0E 1XMVA 4HUQA 3AVYA 2ZRGA 1DBSA 4IOJA 2ZVQX 2ZS8A 5AUNB 4B74A 3I8SA 2ZUBA 1CU1A 5C18A 1HQCA 3QBTA 4FW9A 2GCPA 3EZ7A 1Z5ZA 1IXSB 4ON9A 4CGZA 2VSXA 2OILA 1SXJC 1VYTA 3PJRA 4HDOB 3G82C 1T8TA 2VP9A 1KKLA 3P20A 4JS0A 4R71A 3B8HA 1NJFA 2IYRA 1IOZA 4I81A 1FTSA 3HPRA 4JIMA 1NMZA 3FHTA 1VIYA 3MWJA 3WNDA 1TL7C 1YR6A 4QGAA 4RZXA 2WWYA 3ICEA 1ZVQA 1ZP6A 1RRGA 2AR7A 4NCIA 1HYQA 1YQTA 1GNPA 4UQOA 1GIAA 3U2QA 2HXYA 4HLDA 4AWXA 4YC7A 4TQ9A 3RS7A 3DPUA 1OH7A 4ZCIA 4FWTA 4PAQA 1XDBA 3I1FA 4TL9A 4BFVA 4DLWA 4LWZA 5EE0A 3NDBB 1DAKA 2C98A 3EAQA 2FSIA 1F2TA 2QSZA 4X8OA 3TLXA 4EDHA 1KTVA 2XTNA 5G40A 4JSTA 2J0VA 5FTLA 1I4TD 1N2CE 2QAGC 5J5CA 1KK3A 4AI6A 3C8UA 3QXSA 4TYQA 2VIIA 4JMPA 2BVNA 2XSZD 1WBBA 2JA1A 1PLJA 4IHQA 1LF5A 2GF9A 4C0SA 4LBYA 2IYSA 4MDEA 4CYMA 2PJRA 1Q3TA 4AYTA 1JNYA 1OJLA 2PZGA 2NMVA 3R7WB 2QBYB 4ZKDA 4UXHA 1G5TA 2R6GA 4DRZA 3ZLJA 2W83A 1KK2A 3B2EA 3DMNA 2ZRKA 5KSZA 1XTSA 4Z8YA 1DAFA 3ZIAD 4JBWA 5KYKA 3W5IA 1K5GA 1LY1A 4LJ4A 1G6HA 1U90A 3B1YA 4CEJB 4IRUB 3VR5A 1E1RA 3MSXA 4Z8XA 3DZ8A 2J45A 1G5PA 2WWWA 4LK2A 2XNSA 3GLGA 2WKRA 3QEJA 3P1JA 4JLJA 4PX9A 4IDQA 2QY9A 2C9CA 1XJQA 3MGCA 3EWSA 1XWIA 3UK6A 4M1OA 1S1MA 1P61B 2OFXA 1MT0A 2ZIAA 2DBYA 1E4YA 1G4UR 1MO6A 4AKEA 3I5YA 4CIDA 3QEOA 4PC6A 1NN0A 1HY3A 1XB2A 3ZS8A 2GTPA 2WVJA 4DLSA 5CLQA 2IA5A 1C1YA 1V43A 3K0AB 1G8FA 4BFSA 3H0KA 1OHHA 4S35A 4JYCA 1WDTA 2GEUA 1UAAA 4NKRA 5HCIA 3NTUA 1G8GA 4U02A 3PIRA 4MITA 1J99A 3HP1A 2ATVA 3PEYA 3F3YA 4BLQA 4D4KA 5F9HA 4GSYA 1JR3D 3W6OA 4Q7KA 2FFHA 3ZZUA 2EU8A 1HURA 2IYTA 4PO8A 1TQ2A 5J4YA 5D3MA 4OJQA 1QG4A 5FOUA 3A37A 1E79A 1W5SA 1TMKA 4JVMA 5DN6A 2AX4A 2KSQA 3KKQA 2JJ8A 3BFVA 1KIMA 1P2VA 1W0JA 2R44A 4LJ6A 3NBYC 2FMXA 5CIWA 1U0HC 1UDWA 2A30A 3V9PA 4PFSA 1TQ4A 1RRPA 1Y3AA 2QQ0A 3HR7A 3B1WA 2W0MA 2XITA 1B0UA 3FOZA 2ZPTX 4XSGA 1T3LA 1T5IA 2QGNA 4WZAE 3TGPA 2GESA 3KUDA 1MH1A 5FR1A 4BQSA 3H84A 2ERXA 4EPVA 2XEXA 3ZS9A 2FZLA 3SU8A 3FFBA 1YVDA 3FDIA 1E69A 4LJ7A 2AWOA 1OYWA
chains in the Genus database with same CATH superfamily
2R7NA 3U0BA 4WBXC 4Y2XA 1BE1A 2JK1A 3O2JA 4FDMA 5FEMA 2XAUA 3ZHXA 3LHSA 4LXHA 4EHKA 2DETA 3P0FA 3RVOA 2JLSA 2QUAA 5BQ5A 5JBNA 4AW9A 1XNRB 1VLMA 1D09A 1XA3A 3PXXA 3R4VA 1TO2E 3ZVRA 4F21A 2MSKA 2Z83A 3EFOA 1D2RA 1GQSA 1T9DA 2JFHA 1VOTA 3JQAD 3TOXA 5H80A 5TQ0A 3U7JA 2H65A 2ZRAA 2WPNA 2WFLB 2PSDA 1VHDA 1WLYA 2JBWA 3B6IA 3LFHA 3MWKA 4P7KA 4HEA6 1TYCA 3ILVA 4MNTA 3ZCRA 2VUTA 1WPRA 1V3QE 3CNBA 2NPOA 3WGIA 2BHSA 4DV4B 2BGGA 2HRZA 4GW3A 2CJWA 3L04A 4ZXFA 2B4AA 3WNBA 2G1UA 1K7XB 1Q0UA 1VYHA 2GBLA 2XBLA 2YMPA 5HG0A 4BYMA 2FRXA 3BFKA 2D5LA 2FG5A 3DD1A 3GT7A 3K1JA 3DZJA 4Q1EA 4RSRA 5D1NA 3UXHA 3W04A 3AT1A 1UDAA 4LGMA 3ZGLA 5H4GA 1H42A 2A5JA 1TPYA 1V1RA 3BAZA 5DYTA 5EXPA 4TWJA 2QUZA 2WMYA 3M3PA 4MR9B 4B46A 1EWQA 2CDCA 3LY9A 5C9ZA 1TIPA 1A4XA 1XK6A 2ZI3A 3W6UA 5GIPE 3FETA 1U6IA 4B43A 4LHXA 2A4MA 2YQ5A 1XLTA 1PFQA 3FHLA 2E85A 4D25A 5GMOA 2NO1A 3T99A 4GL2A 1HNZB 2X0DA 3IAM6 3IR6A 4XQEA 4JR1A 2VJOA 3DM9B 1ZR4A 1FPMA 1IC6A 1SVSA 3D8SA 3N7AA 3W2HA 1E59A 4FN4A 1HE3A 5ALRA 1GGEA 2IPOA 1QHGA 4KQXA 4TWIA 5GV8A 4ZYVA 1PO7A 2XUAA 1VIAA 1PUIA 1RM0A 3GPDG 4HRXA 5ALWA 5JEDA 1P39A 3AJEA 2B1QA 2QLTA 5SY4A 3A0UA 2XUJA 3RF6A 4DMCA 16PKA 2FPOA 3SZRA 3GRPA 1PQPA 1FRFS 2C4VA 2ZBRA 3FW1A 5B57C 2RGNA 2AS0A 2ZJ7A 4RIGA 2GBFA 1X1EA 721PA 3JQ9C 1D0IA 2KHZA 2NVWA 3QVWA 1GKLA 4A0SA 3PHIA 2GPSA 3C3JA 3AHEA 3HHPA 4LYYA 5TQVA 1GKKA 2ZR8A 4IKOA 4OQXA 4UPEA 3PV0A 4DRXB 3DMHA 4JEMA 3WLJA 2FCRA 1G2IA 1AS2A 3WFZA 2ZJAA 3TW8B 3NEPX 1DXOA 3CEMA 1D3AA 4TPKA 2WW8A 4RHXA 1IQUA 1PAUA 4MX8A 3H5RA 1MEEA 1QOZA 4GDMA 2IYLD 5JG7A 2Q1YA 5CVDA 3RUFA 3NTOA 4BWYA 2TYSB 4HNVA 2I54A 1MO2A 3BJEA 2JIBA 3HJUA 3MA0A 1Q1AA 4EI2A 3JAKA 1YB6A 3LKDA 3DZGA 2ECPA 2O05A 1UBGA 1CJSA 1P74A 1Z5UA 2IP2A 5EQDA 3HK2A 3ZE7A 1FFWA 1XZAA 4PR3A 4PLVA 4EGSA 2PUEA 3ZEAA 1D2CA 4IAOA 4L76A 5AHXA 4S0ZA 3RO7A 5KYWA 4PNEA 3KYCA 1U0JA 4K46A 4FGUA 2C7QA 5MGNA 4JA0A 3MT8A 4U3JA 1NR1A 2E6KA 2EJUA 2I4MA 1NZDA 3DGFC 4KGZA 2HM7A 4YCDA 1SU8A 2P1DA 3ITKA 2HLPA 5THQA 3OPYI 1UXGA 1YS1X 1JDUA 2RHLA 4BU0A 5JAIA 2R25B 3ZUGA 1ELOA 1N6LA 1GYPA 1R50A 4L0CA 3RRNA 3OQPA 1TOAA 2ZT8A 4M0PA 2DFTA 3UV7A 8ATCA 3CRMA 1KQ3A 3KWFA 1H6BA 3ZVKA 1IHPA 2YHIB 4OUDA 4MYSA 2PT7A 4MCAA 3D3NA 5B1YA 2FWMX 1J00A 1XZKA 5EKUA 2VZ0A 3OU2A 4LRQA 2TSYB 3E1KA 5E9AA 2CMDA 2EJCA 3IBYA 4HRAA 4OP3A 1DWPA 1OWPA 2CNNA 4MUXA 4PO3X 3TXYA 3UYKA 3K2QA 1P31A 4FIZA 1N5IA 1Y8CA 1DTSA 3C24A 3HACA 5C1IA 4ZI7A 3WMGA 1XEWY 1KQGA 3ISVA 1KMNA 4J1TC 4XGIA 1JA0A 4JJKA 1I4OA 4QYSA 1P2TA 1R16A 5KJEA 3OQMA 1GCGA 4ARZB 4DQVA 4DILA 5ADUS 2VFAA 2UUBB 2O19A 1X92A 1GRQA 1U11A 1A69A 1O94D 3B3QA 3KP1A 1GNSA 3PU6A 4FOOA 2H16A 4GGMX 3P52A 2AFHE 1N2SA 4YAWA 4DWVA 4JXJA 3W6NA 4ZVSA 1DCFA 3BJMA 3HPQA 3Q3HA 4TVOA 1P0IA 1RQLA 5EP2A 5JE8A 2XMCA 1KMHB 3HYTA 3ZBUA 1CF4A 5GGXA 4MKXA 4RV5A 5DNYB 5TT0A 1UQRA 1RTTA 1Z0SA 4LY0A 3RYFA 5DNCA 5JVDA 2P3LA 3FCUB 2PZFA 1L5LA 1YONA 2I2WA 4IS3A 2NXCA 2QY6A 4W5HA 2I29A 4D5GA 3RS4A 2UAGA 1QXSA 5ALPA 3WDMA 2C07A 4IDPA 2H7XA 2I2BA 5DWVA 1VRCA 3DTYA 5KTYA 1WMBA 3EJWA 4UFPA 3GIWA 4ZQCB 3DVQX 1MAVA 1M75A 2IU3A 3EZ6A 3INYA 2HWKA 2ZJ0A 1UXHA 4ZOAA 1NW3A 1BDMA 3CR7A 3HDYA 3KTAB 3QJ5A 4GMFA 3PR2B 2ZW9A 1YMQA 1ONPA 4EELA 4F11A 3BWDD 5IFKA 3AVTA 4E22A 1UMDB 1C8BA 1T6YA 1FF9A 2YJGA 3W5AA 2AH5A 2HAEA 4WY8A 3BJIC 1V3UA 1FS5A 1LD3A 1H5UA 3TDNA 3UMCA 2D4HA 3WYEA 2XVZA 1KF0A 1JR3A 4QHSA 3BYZA 1UKCA 2BIFA 4ZAZA 3UAYA 4HYEA 2NZ2A 3LL7A 1JHUA 2ZEJA 3MNFA 5E3IA 3O84A 1QQBA 1SKYE 4M60A 3Q7SA 3ROEA 4YT2A 2FAXA 2GCGA 1RKQA 2NO4A 1SWWA 3NALA 4Y2RA 5SZKB 3VAZA 5LLDA 3NTQA 1WABA 2Y0PA 1VDMA 4AZVA 1V8BA 1VB3A 2P11A 3WP0A 3LLUA 5DDIP 3U3KA 4TXJA 4A6PA 3EPPA 5JO0A 1ES9A 2X1MA 5IF3A 3AG5A 2DWOA 1GTMA 2D59A 3P9CA 5LYJA 4J76A 3WGOA 1L3IA 2P9ZA 3THWA 2OV1A 3MJTA 4P22A 1VKJA 1E4EB 5AICA 3TX6A 3E22A 3L05A 2NQ2C 4CM1A 4EAAA 1DJNA 2VPWA 2X58A 1Z6GA 2GF0A 3JYNA 3K73O 3PNBA 3L6UA 3VU0A 2VTBB 5UKDA 5K0CA 3CZQA 2WSSD 1GAXA 4WKCA 4WZZA 1P3JA 1SUCA 3SC3A 2VK4A 4P3XA 1J2RA 3VHXB 4FFRA 3FWPA 4GQIA 2YWFA 4P92A 1HRDA 4GC5A 1U9IA 2D3TA 1L6RA 1V5EA 2I55A 3D81A 1MDBA 3H2KA 3UAWA 5FBHA 1JEYB 2BMVA 1N75A 1MG5A 1V1MB 3WL6A 3HXOA 3G0CA 3PXGA 4LJYA 2B82A 4QTXA 1YQGA 2BMEA 1K3UB 2JC3A 1ESZA 2ZUDA 3ELBA 3KDAA 2JKVA 3LIPA 3OPNA 3EIXA 2BONA 4YAUA 3AEUB 4XJTA 2QMYA 3K94A 3SHQA 1PL0A 2OYRA 1GSAA 1KEEB 3VU9B 2J6BA 2JARA 5JMOA 2IFTA 2VYFA 1IPFA 4MH0R 4JDUA 2JCXA 3MGKA 4RLHA 3CKKA 3A6HA 3DMDA 1Z82A 4IINA 4UEWA 5B37A 1JSCA 4H31A 2GTHA 4BZWA 1XAHA 2V7WA 1YWGO 2XGSA 2G4LA 4Q1CA 1SHZA 1W4CA 2IZ5A 1VPWA 1QIEA 1COZA 1JIJA 2VT2A 2I3ZA 3I1JA 3O6VA 4FSHA 1Z13A 1ISPA 1RPNA 1UODA 1TDJA 5LDGA 5JH7B 4A6EA 2VDPB 2YXBA 4LRSB 3UYLA 3WRYA 4C22A 1JVSA 1UJCA 1UPTA 4NBRA 4HPXB 5KHLB 1IHOA 2Q2QA 4N3GA 1SIBE 1JHPA 3S1LA 3VYVA 5HUQA 5KPJA 1CS4C 1NLYA 4IGKA 2GT1A 4LQDA 1MJHA 3CUEF 4QBGB 4U2EA 4MRSA 2GOYA 5FUXA 1ZMOA 2UXDB 3Q3EA 1AB6A 1J8VA 2XODA 4JENA 1QO7A 4RW0A 5FBWB 1P1KA 5ED0A 2SBTA 5BSWA 1OX6A 4G0XA 2WKPA 4IXTA 2GZRA 2DY1A 2YZ2A 4L8FA 1PR9A 1F0NA 3B70A 1OXBB 2Y3IA 1KSFX 1X1TA 1RYNA 1GQQA 1I9CA 2J85A 2VCHA 2VT6A 3IDZA 3PPIA 4ZOCA 4BQEA 5JI2E 1BN7A 3GU3A 4BLPA 5BMVA 2C9YA 1T13A 3HEBA 3B2QA 3HWX1 4KXNA 4O3FA 3MGAA 4CV1A 3DOUA 5FTMA 5KREA 3K8YA 1KQNA 2GPWA 2I6GA 1AQ6A 3OZTA 1TZMA 3W6PA 4H6VA 5D5PA 1B8VA 2GJSA 2PSSA 4HB0A 4IJQA 4KITB 2BW0A 3BXFA 1TW2A 3O4JA 2A9OA 4PAGA 4RKQA 3LO8A 3H3XA 3QVTA 3VR5D 1RC8A 2RGCA 2P1RA 2R6CA 4KXUA 2AR9A 1E77A 3PFHA 2C2OA 3B9PA 1XHEA 1ZH2A 3OIGA 1A77A 1MV5A 1RIFA 1R9JA 1Y82A 2ZTHA 1GA1A 3LQQA 4ISCA 1N1GA 4R16A 4YJHA 3T7KA 2FZ4A 1XD2A 2VLIA 3DP7A 4MKFA 1ADGA 1TD1A 3U17A 3ESRA 1W7AA 5K51A 1AH2A 2POCA 5CH8A 4CEHA 2R6AA 3VHRA 1JKMA 1PW5A 1VG9B 2OFWA 3R20A 2A86A 3KYDB 5GONA 1QYIA 3FCOA 3HKBA 7MHTA 3TFOA 1NBWB 1ZW1A 1A7AA 1E3JA 3H97A 4OXNA 1LSSA 4TGLA 1YC2A 1WDMA 4CTJA 4A8TA 2QX9A 5CT6A 4O63O 4D43A 2R00C 4PX2A 1NFQA 2J0UA 1NXOA 3MMZA 1IUPA 3OIVA 3OTQA 1BFKA 4FILA 4WLFA 3CX4A 3E2MA 3OLZA 1BU5A 3LVRE 3WADA 5IUNC 3GLGB 4H77A 2P2YA 5DCWA 3RRFA 4H4DA 3WMRA 2A1IA 3PUIA 5CDFE 3ED1A 3AFOA 3A1NA 1S3IA 3VR2A 1J8MF 4DLAA 2W6JD 4DR3B 3CBGA 4BMOB 1X9GA 4KTTE 1AHNA 1RXCA 3O8QA 4M87A 4O4HA 1XNJA 2ZRMA 1D6JA 3AXSA 1OROA 4DARA 4P4SA 2LGJA 4EY7A 1DUSA 3ONWA 4IIVA 1EK6A 1S3SA 3P0RA 3B9BA 2H57A 2W37A 2X14A 1WXDA 3HH8A 4N5IX 4D9KA 4BEWA 2O9JA 4EPXA 4JR0A 4QJBA 5AVTA 1SCUB 3CSUA 421PA 4WUVA 4Z7JA 2BFPA 2W11A 1P9LA 1RU3A 4OHOA 2BTQA 4PBSA 3WMEA 4DJ5X 1UT6A 3PZRA 1KOFA 3QTTA 3EPRA 1C0PA 2FPPA 2P6OA 2VEDA 4KO4S 4QRDA 5TB5A 4ZTZB 1RP1A 4QM6A 3WFIA 2B5OA 1TRKA 5BPHA 1WXQA 3A1FA 3MGBA 3NU1A 4QICA 4QFCA 4FUQA 3A3OA 3OSZA 2G28A 2GJ9A 3ETLA 4I50A 5I6DA 3ESZA 1ZKMA 5KNLA 1VE1A 4YXFA 1UPAA 1UWCA 1ZSNA 4GP9A 2YJTD 4FQ5A 4EJ0A 1F7UA 1WP4A 2WOJA 2OBYA 5IJWA 1CBUA 3ZNQA 2OO3A 3LHDA 3KOUA 1FTNA 2X3FA 4R1OA 4HUJA 5DHPA 1NNUA 1I0IA 5A1JA 1W5BA 4V3BA 4DY4A 3EXEA 1R00A 1DAOA 3CLTD 1G59A 1WZEA 3EGEA 3GHHA 3A2LA 1VJ5A 3B6EA 4FGSA 5L4NA 1GILA 3UGJA 2W6OA 2A2ZA 4JEUA 3K0EA 1NUSA 4QBHA 5LBUA 2F9FA 3PWZA 4WGFA 3VNSA 3KQWA 1T6BY 4UEKA 1MJFA 3VUFA 5CYGA 5EXDA 5ITZB 3A6PC 2QRLA 1BWSA 1Y8QB 1T5TA 3WQSB 3R5XA 4RMIA 1X87A 4BZPA 1YKSA 1G7SA 2BWJA 4BGIA 1N57A 1XAGA 5LA6B 4MICA 3F6PA 4PZUA 2XKAA 4HDNA 2G4CA 1T4DA 3AF2A 1XIVA 1PK8A 2YINC 3AKEA 3NONA 3T3HA 5C52B 1NP7A 4MWDA 5K8LA 1PT9A 4KWTA 3WYGA 4RVSA 3HLYA 4EFKA 1SC1A 4Q02A 3WYNA 4S1WA 1U98A 2HU8A 5LZ9A 3L01A 3P27A 1EVYA 3I6BA 1PZEA 4A0FA 4BNMA 2PBRA 1VKOA 3L7IA 3OF2A 2HK9A 2BFEB 3GPIA 1GZHB 1T6XA 3KELA 3WWYA 3ICQB 3TZQA 2P3QA 1RBYA 2RBEA 2ZB8A 1XRQA 1U7DA 3JATA 4FNMA 3R5SA 4QRIA 3R9XA 4JHXA 1Q44A 3TZEA 1MV8A 3BS4A 5AK3A 4Z49A 2IYPA 4KACA 3RYHA 1B76A 4FYKA 4EG4A 3R5FA 3ILHA 3ENWA 2BBWA 2NUAB 5JALA 3HA3A 4Z53A 1JIVA 5F9MA 4RZIA 3Q8LA 5A5DA 1XBTA 4FOLA 4M1KA 2I78A 3UJNA 4U2GA 4J1QA 2YRWA 6GPBA 5CLJA 2FETA 2HJWA 2VJCA 4L28A 4ZQFA 1CUBA 5KU7A 3HEAA 5E4YA 1NJ6A 4YRNA 3BQMB 1TJNA 4NZYA 1H65A 1CUDA 1JBQA 5IULC 3GN1A 4KOAA 5DBOA 1Z2EA 3PNVA 2VSYA 3ZLVA 3AY0A 4RY8A 4ARCA 1XTKA 1WQ4A 4XOIA 4EOGA 1D1SA 3DD5A 4ME6A 2F3TA 3NUGA 3T61A 5BW8A 3UMSA 3QKRB 4FHEA 4IO1A 3LTEA 4CLXA 3O38A 4NV1A 3CRVA 4AUMA 1G0NA 2OSVA 3IIMA 1KK1A 3NEJA 1B42A 2PUBA 3LK7A 4NAVA 1OZAA 2EGHA 1G291 2CNWA 2YRFA 2HREA 2ZIFA 2ZSIA 4GLJA 3GJTA 1AKYA 2G82A 1XDUA 4HWPA 4P31A 3LD9A 4QGSA 1Y5IA 1KU6A 1P2DA 2CXXA 2WJ3A 2ZUEA 3F71A 4ZOBA 1Z0JA 2H08A 2PMDA 1B4DA 1J21A 5B58T 4KE9A 4KNWA 2KW5A 2AG6A 1X3SA 4GYWA 5ANRB 5L8VA 1ZL2A 3QVVA 2I76A 2X6TA 3FGPA 1KI7A 2PX0A 4UM9D 1IN8A 1DS6A 1CJMA 2ZETA 4M6WA 1ZJ6A 2QW8A 3P4XA 1PHRA 4B79A 1E3QA 2AG5A 4DA7A 5DP1A 2NVUB 1W44A 2ZVJA 4QOFA 1Y3FE 4GLFA 3L93A 4RGBA 2CVFA 2CHEA 3H13A 4F1KA 1C8VB 2BFWA 1UXJA 2P8SA 3AFNA 3U4QA 2VF7A 2TMYA 2FEXA 2E3JA 2F6RA 2IDMA 4R9RA 1N6KA 2B94A 3W5CA 1N6PA 3LPDA 3PDUA 4LDPA 3WK6A 5F5LA 3OP4A 5KNCD 3AUJB 1GGNA 2POQX 3M6UA 4RQTA 1I01A 3MJFA 5CVEA 3X1JA 2FNAA 1L5VA 1RWQA 2NT4A 3IBCA 2VP0A 3U9SA 4D0LB 5CD9A 1GUYA 3DNMA 2W2KA 3GAAA 2IRWA 3EC1A 4G9BA 5JH7F 5KSYA 3I62A 1CUSA 5JCOC 1EPUA 4RBNA 1U1DA 3VA7A 5B3AA 1GO2A 4H27A 3B1XA 3H6HA 4L27A 3IP6A 1U5BB 4R3UC 4P84A 1QR2A 3M2PA 4RD2A 2O4CA 3T5MA 4ZAVA 5HJ5A 1NVDA 3M0EA 2H1CA 3L77A 4FE3A 1ZIOA 4HS4A 1ZN2A 2F9LA 2J46A 2X1HA 1YZ3A 2IYOA 1GD1O 2Y1KA 2ZU0C 3CR8A 3B5JA 1H0SA 4ER5A 4AVYA 1M6VA 4B9EA 4OUKX 1NTRA 3DOHA 1GZ4A 1QBGA 1O4WA 3R7AA 1GUDA 5BV8A 3R3SA 1I9GA 1FXWA 4FBMA 4ERNA 3S4YA 3UC9A 5AK5A 2B8JA 4GG1A 3IVCA 3N0VA 4LMAA 5TS2A 3UWOA 4QU5A 2IX3A 4N48A 4HGPA 2R6ZA 3F2IA 1GUAA 4GF5A 3L4KA 3SZMA 4ZIRB 5CXQA 3E35A 4F4CA 1ID8A 3E82A 4JOQA 4LXTA 1VA5A 2WU0A 3FZQA 4FJ2A 4NMMA 3AETA 5KWJA 4AQYB 1YHNA 2C2ZA 2OG2A 1H2RS 3B38A 4XIGS 4US1R 4Z1MD 3KL2A 2PSEA 4QYWA 4NCNA 2O0LA 1IDOA 2ZSBA 3M5CA 1USKA 3MQ2A 3O4VA 2JHPA 1H5NA 4UPDA 3TMKA 5JJLA 4AZ3A 4G25A 4DKXA 3VZDA 5C0OE 4OHZA 3B7PA 1J0BA 3OY7A 4KK3A 3P9RA 5CGQB 5BWLA 1G64A 1QGZA 3Q3CA 1KETA 1WCIA 5BY2A 2ST1A 2ZRHA 3AVQA 2W6JA 3BMQA 1NVMB 3NHZA 3V8EA 4FEGA 3UAXA 5EN4A 2VNHA 4KXFB 1IDN1 2OL4A 2XPCA 1P0PA 2GA9A 4BYGA 5CLHA 4F5WA 4GUAA 5IAGA 4NIMA 1ZYUA 3I01A 1G8YA 1R6XA 5KNBA 1Y9DA 3WLAA 4W5OA 4A5SA 1J8YF 1J0EA 1FBTA 4ZK2A 1J1ZA 3W3AD 4Y6LA 4KR2A 5ETJA 4Q66C 3PA8A 1HQYE 3LUJA 1YV9A 2VP2A 2Z57A 3O82A 4K1LA 4MI1A 1PP4A 4HL6A 2UZ0A 3NNNA 3R5TA 1NMXA 1RYDA 2O07A 2FFRA 2QNIA 1P4RA 4QQNA 4Y9DA 3KQQA 1TQ6A 1DC4A 3CRW1 1VGRA 5DW3A 1F7VA 2PNFA 1E6CA 3QE2A 1UZLA 5EZQA 4CKCB 1SC3A 3KOMA 3HCDA 1L7VC 1QH1A 3QXHA 1S8AA 2B61A 3PHCA 1JT2A 2D5AA 2ZIXA 1FU7A 3JQBC 4D92A 2EW8A 3NKFA 2Y99A 2FUKA 4J0IA 1Q1EA 3TIFA 3EGIA 3HJNA 4A7PA 4NBUA 2QUBA 4EARA 3O4FA 2R8XA 1OFVA 3BCUA 4GKKB 1DOAA 1EE9A 1KFEB 2IZ7A 4CUJA 3QBVA 1P8AA 1C4WA 2GM5A 3BQNB 3LP8A 4PZEA 4LYFA 1QIFA 3U1BA 3ZXSA 4XASA 2QP3A 1C3JA 3BIJA 1WS6A 3N75A 3TRJA 2QIOA 3ID6C 1DMRA 4OXXA 5K6TA 1VYUA 2FK8A 3GH1A 1V8PA 4IJ5A 4XLTA 4MIKA 3HKEA 2PMKA 3C5CA 5DEIA 3H9UA 5AT1A 4KOEC 3UJ9A 4X64B 3HBLA 5HUHA 5AW9A 1E3DA 3KOOA 5EMMA 4FFVA 2FF5A 1XEXB 3ACBA 4WDRA 3KQKA 1B2RA 4RVCA 1ZA1A 2FSUA 1T24A 3IOCA 3COPA 4N3BA 1A4RA 1CUXA 3TZBA 3F6CA 4OIFA 4IZOA 3TZLA 3W9UA 3X1XA 2JI4A 1F0YA 3IHTA 3QPCA 3GL9A 5REQB 2YV5A 3V8PA 4LF9B 2A3RA 1PGOA 1RQPA 1A98A 2FP3A 2NM0A 3ZW8A 4E0BA 3MMSA 5HJEA 2ZQ5A 3OLYA 4KR3A 1YDGA 1ZEMA 4AO8A 7REQA 4ZCSA 1P4GA 4GKJB 1U3UA 1HE5A 4TSKA 4TXMA 1QGYA 3CUUA 1Y7LA 2P2ZA 4BFTA 5JSKA 4DCUA 2WYUA 4OLHA 3QEKA 1ZC3A 3SZUA 2HPZA 5CDYA 2GAJA 1RXUA 3FUWA 3N8NA 5CFRA 2GA8A 1X1QA 1II0A 1JN0A 1YRBA 4Q3DA 1GL7A 2H9YA 5CT8A 3IEKA 5BR1A 2AHOA 4ZAGA 3IOMA 3I30X 4B3RB 1IL0A 5AVXA 5DM2A 3KPUA 2UVDA 3TOSA 3K6SB 4JUIA 3I0NA 4R8KA 5C81A 3M4XA 1E96A 2IUTA 5BN3A 4A8JB 1DGQA 1EGAA 3PLNA 6REQA 1XMIA 3V7NA 3ZHYA 2DLCX 1QAOA 2ZJOA 4OJMX 3K53A 1V95A 2XZOA 4E2WA 3V1KA 2ZS7A 3CLUC 1RKVA 1TT5B 4YMHA 2Z9CA 4X6LA 4IDAA 4Z4GA 1C3EA 3B1FA 4X1IA 2FI1A 2Z2KA 3P45A 1GQOA 3COWA 3ZU4A 2QT1A 1NVVQ 3QXJA 4B6EA 4F2PA 3MAJA 1M8GA 1N92A 1R5JA 5F7ZA 1U7PA 1ZM3A 4W7HA 1L5ZA 4CQNA 3B3FA 2FUNB 1AF7A 3H86A 2JGNA 2P90A 5AKLA 4AQDA 4KQ9A 2J1LA 4EI7A 2PUHA 3M5DA 5KCMA 3ITNA 1K3FA 2VP5A 1LK7A 2YXDA 1FS6A 2BBOA 5JANA 2HWYA 3A7EA 2ESRA 4ZHSA 4EG6A 5AOVA 3FTDA 1GCIA 4IKPA 1E1CA 4EQ6B 2DWUA 1JFSA 1CJUC 2BGKA 2EJTA 3HVKA 4KXYA 3ZVLA 4CQLB 5JJ5A 1X7DA 1A2OA 3FKJA 2IYAA 4JX9A 2XZLA 1NAIA 2ZI7A 4WLOA 2ZYSA 3ND6A 1OFTA 3TLAA 5F4BA 2Z5VA 4C6RA 3EF0A 3AONB 3EGOA 3Q3IA 1C1DB 2HGZA 4DCSA 3TPFA 1LNSA 1S2GA 1SWVA 2XUKA 2DQZA 3OT1A 2C03A 2PBFA 5KNCA 2NUPA 3AI3A 4JJ4A 4KI0A 4WZAB 1P1HA 1X7ZB 3IXMA 2XMDA 3CWZA 1RAEA 5EKXA 1P75A 1D1PA 2QQFA 2ZK7A 1YULA 2ZJ8A 3OQIA 4ITUA 5I7OA 4HMOA 1KZ4A 4PZPA 3ZU6A 4LGYA 1BDIA 3S5UA 1HTWA 4XDGA 2QTAA 3ANXA 1VLZA 3W8FA 4V1CI 3A4NA 3RYCB 1ZDMA 3EHDA 4MUBA 4G37A 1Z6PA 5EJGA 4KNYA 4FFLA 2OECA 3OIUA 3S40A 4X94A 4J0CA 5KWSA 3ASZA 4TQAA 3D0KA 4MWZA 4U39A 1FJ2A 1Z5GA 2CJXA 1EVJA 3DMTC 4MQMA 4UPVA 3WRXC 1VHQA 5A6VA 4PGFA 4BFYA 4KBFA 1MX3A 3K32A 1QFMA 4QNMA 3LT1A 5IBPA 3VI3B 3S8EA 1WJGA 4MGHA 1MVOA 1AKMA 3S27A 1MVLA 4I5GA 5T4EA 2FPIA 1R4AA 2SCUA 5JS7A 1T29A 4L85A 1RXVA 5EE9A 4Z1MA 2QZJA 5G02A 4MAFA 3E7XA 5F77A 1R10A 2WSMA 1ULZA 4DQDA 4EI8A 2XJ9A 1GPJA 2C8JA 4J49A 1QSGA 3D3WA 4NH4A 1R0RE 4QFBA 4V0ME 3WV4A 1KI4A 4R2LA 3TQFA 1JUDA 1Y9AA 5LZ8A 2CVZA 1S8NA 2X2EA 3ABOB 4L5CA 2ZRPA 2W2VA 4DYDA 1YZTA 4QDZA 1IQPA 1U7TA 5CA0B 2OCIA 5TIIA 4FHGA 4KDEA 4NFYA 3OPMA 5FH9A 5JFGA 3L02A 5LCXA 4WOBA 3ZE8A 4H7FA 5IDYA 3W8NA 3SHVA 5JWRA 3ZZMA 1POXA 3PL5A 1G2QA 2BTOA 3E5MA 4GVXA 1WHSB 2NO0A 3F98A 1IXYA 3AOEC 2Q99A 1PJBA 3EXHC 8ABPA 4R51A 1L4MA 1SZCA 2O3TA 4KLCA 4Z0TA 3UOWA 1PFYA 1CZRA 1DKMA 5J59A 1ZRNA 3O4GA 3KALA 4ZCQA 4HJXA 1Z45A 4TZTA 5JNWA 3SGLA 1SVUA 3G1TA 1S5PA 1Q12A 1RYEA 3OO1A 3W3AA 4BGUA 1HLDA 1DO0A 1MEOA 1XZQA 4JXZA 5JIBA 1KEPA 2HSDA 3QVUA 4BL5A 2HF9A 1WETA 4RD4A 1DSSG 3K70C 1DT3A 1RWOA 3RFVA 4TXLA 1ODLA 1U7OA 4WN9A 3HNOA 2QPOA 4RVGA 3NNSA 5BQ3A 1OYVA 1P5HA 2CCJA 2REBA 4RU1A 1UOQA 3K0BA 3I5XA 2B1GA 1WY5A 1JQBA 2E7ZA 2ORED 2UZAA 4KQKA 3DPIA 3PSHA 3UBMA 4F71A 4A4DA 2R8EA 3QI7A 1HDYA 4L8GA 2BEVA 2O6LA 2PL3A 2FZKA 3ESCA 4Y2JA 4WHMA 5SICE 5TGZA 3S70A 5JAMA 1QVZA 4I46A 4BPBA 3Q12A 1U7WA 5GJCA 5CFLA 4DQXA 1Y98A 3WY9A 3CEHA 4LHVA 1U2GC 5FPPA 2PUFA 2OP0A 2XNHA 3KSRA 2WTAA 4EITA 5FO1A 4F85A 5C4IA 2J9RA 2GEKA 1PJLA 3PFKA 4J94A 4N7RA 13PKA 1LBQA 3FUUA 4NCKA 4WZBB 4L8YA 2O52A 4OV6B 3SFVA 1DEXA 1GU1A 5AKKA 1A88A 4HAZA 4TKLA 2V5AA 5BSMA 5J47A 4QBIA 4X97A 1EUCB 3ROXA 1EH5A 4O2BB 1JR2A 4JI3B 4HRYA 1IULA 3CYFA 3VBEA 4AECA 2IC5A 3TGLA 1ST2A 3GDOA 4F9GA 1QHHA 4MR9A 3HJHA 4Q21A 5T7BA 2QTLA 2V7QA 1AVTA 2LIPA 4XPZA 5CPBA 1HC7A 2B25A 2UXBB 3R6GA 1QLWA 1FDRA 2IXAA 3BHJA 2IIVA 1X2BA 3DJFA 1E2MA 4Y0VA 4MEBA 2VJMA 3RUEA 4EO7A 2JCGA 3KZVA 1MNAA 3NHUA 3NHWA 2WBLC 1J0CA 4LJ5A 3GJSA 1DG3A 2GH1A 4FX2A 2W71A 1MQ8B 1IEQA 3BXXA 3EGXA 4LISA 1CP3A 2XT9A 3RSSA 1IOWA 2GI4A 3X2FA 2PR7A 3HN2A 3OBIA 2DHRA 1E2HA 4F3YA 1XKXA 1PWZA 1Y3CE 1ZZEA 2VZ9A 4O1IA 1FDVA 3TBKA 1CB7A 1QQ7A 1D1QA 1XVTA 2AFVA 2OD2A 1XZPA 3EBOA 3IAUA 4K8RB 3FVVA 4BZQA 3NHPA 3IQDB 1FUUA 2LKCA 5F64A 1VJTA 2AFHB 3RQSA 4DQUA 3I3SR 3ISJA 1JJAA 5C1BA 5FWNA 5A0VA 1EX1A 1AMNA 3X1YA 4WJZA 2VHEA 2HSJA 3PRHA 3V42A 1JDBB 3VKGA 5HK9A 2YN4A 4X92A 1B6SA 4BO4A 3T8YA 5IM5A 1ML4A 2O8BB 2MMGA 3LPAA 3O0DA 5C37A 3CO5A 2JRCA 3MIIA 2JFWA 3AGQA 1J8DA 3GLSA 4U2DA 3TLZA 1HDXA 1NPTO 3E7FA 4JJ6A 4K3UA 3FROA 3HUEA 2IEGA 3C2QA 3SQOA 3RVJA 3HV2A 4FOPA 4LZZA 3DH0A 3I8OA 5AVRA 3V8MA 1DQPA 3I42A 2R1TA 1Y5RA 2PS3A 3W1VA 1AO3A 1PKXA 3A1TA 5F33A 4EZIA 2QLLA 4C7BA 4N0EA 2RK4A 4OHKA 5HQTA 1XJ5A 1MCZA 1QUFA 1S9HA 1TA4A 1WO8A 3DL2A 3NM5A 5JPIA 5BRJA 3N2KA 3I4CA 3VDMA 1SJ9A 1BHQ1 3OESA 4YRQA 1RRFA 2AG1A 2QD2A 2GYVA 4NBNA 2Q5FA 1I2BA 2XCQA 1FX0A 3TCNA 2E4UA 4XE5A 1FDOA 1C3XA 4YRZA 3GOQA 2FWAA 3RH0A 3VU1A 4YCJA 3AV0B 3CX6A 3QPAA 2YW9A 4V0KA 1KDRA 4AY6A 4R9NA 3O03A 3E2IA 3UV3A 1U28C 1QNLA 1EFDN 2LCIA 3EUWA 3K1AA 3CNLA 4KE7A 3CR3C 4QOHA 4Y3UA 3L0BA 2OFOA 5ESDA 3EIQA 3MCAA 3B7GA 1EHCA 4U5QA 1V3VA 3MFYA 2ZCJA 4EG0A 3LWDA 4QT0A 2YHIA 4J16C 5I7RA 3INRA 4AX4A 4MWGA 1R8YA 1Z6AA 2H63A 2MDTA 3HR4A 1RLMA 2VH5R 1TVKB 4EYKA 4UATA 1E4OA 4X1OA 4FSDA 3PUYA 4ALMA 1Q95A 2ZS9A 2B4KA 4G07A 4DGQA 4HXYA 1WZ2A 2CZCA 2UXCB 3FSEA 4C30A 3EPJA 4L5JA 2R8YA 1ORDA 3SFTA 1NGSA 3RVBA 1L0BA 4PLCA 1WMAA 4DBVO 2D4AA 3OHSX 1LQ2A 2G71A 3K8OE 2IZ0A 3IDSA 4G1CA 1SCBA 2AOTA 4QUKA 5TF4A 1VE9A 4CKYA 5B3KA 5K8VA 5JAQA 1H05A 3D7MA 2C5SA 2YMQA 3RHZA 1YJ5A 4KSYA 3WKCA 5K0EA 3UATA 1PFVA 5C8DA 3L9WA 2RAVA 2YIDA 3LUPA 5IKMA 1Q7EA 1KR5A 1ZIDA 2V7XA 4BNFA 5A4JA 3LY7A 1H85A 4FR5A 1G2PA 1W0KD 3SD7A 3U39A 5I48A 3IT3A 4MVWA 4AQ7A 4ZRDA 4ESOA 4HR7A 2X0KA 1T36A 3P2IA 3VR6D 1A9TA 1L7MA 3LL4A 4AZ0A 5BN1A 1ND5A 3FBTA 3MGGA 4DPLA 4LX0A 5E8JA 2QD3A 3WJ7A 1N2IA 1OCEA 1ZGZA 1LK0A 3QM1A 3WAGA 1WZNA 5JWOA 1G63A 1EFRA 1UQUA 1JIKA 2CVQA 5A4AA 4ZYXA 3NDJA 3B20A 3U4IA 3OZUA 1CQWA 3ONEA 2H51A 5BQXA 5IHXA 1N1DA 4F7DA 1H0RA 4WD3A 4EGJA 3KQUA 1YFZA 5AHKA 1QFYA 4QJ3A 2OTCA 3EEOA 3RVMA 1DU4A 2W00A 1M76A 2NV0A 3Q9LA 3Q2OA 1UMDA 2N1BA 4DV0B 4MRAA 3WYFA 1EFVB 2QTTA 3IUEA 4HWTA 3R1IA 1Y89A 1YJAA 1DAMA 3JQGB 4LA4A 5EMLA 1A8QA 1QQAA 3AIIA 3C6YA 1CF9A 2KJQA 3D9QX 4ZEMA 2Z1MA 1MO5A 1RQ2A 1E92A 4I8IA 4CVNA 4ZMSA 1OBFO 1PK9A 1V7CA 3I9MA 5K3SA 2XDQB 2YZMA 1SEPA 3NGXA 2PTHA 3IPYA 3K5PA 3NXKA 1HX7A 4GMKA 5J9FA 5AXBA 1UC4B 3N1UA 3OJLA 2ZATA 5L7WA 3M81A 3K9FC 4ND5A 4K9RA 4C2BA 1UJMA 4K81B 4LY6A 1I2MA 4R3NA 5ENZA 3K5WA 5CXUA 4PLTA 3KDSE 4BV2A 1WTAA 3T4XA 2YWCA 5JTTA 2GD6A 3D0RA 1Z8DA 3TVTA 4B7ZA 1E4EA 4F72A 1P19A 3AHJA 1OWMA 3P2MA 5F35A 2PPLA 4ZJUA 1VJRA 2ZJ2A 1EQ2A 2A5DA 2VTBA 5DMXA 1K89A 2AOXA 3DAYA 5IT9A 2RI6A 4OAPA 1T3ZA 1GEGA 1R5BA 1DQZA 2MMCA 3VH2A 2EFGA 2LXNA 2HHCA 2QV7A 1EE1A 3NYRA 1GNVA 1XCBA 4HPJB 4MUFA 3ILYA 4GICA 3IMFA 5AW1A 4BRUA 3OVMA 4MQ6A 5DHUA 2IF0A 2Z95A 1NNLA 1JHMA 2CZGA 1NBMD 3MQFA 3OE4A 4Q5IA 3CRRA 3EB9A 3H5OA 5D6OA 1UUFA 2H52A 4FFOA 1TQHA 2CKDA 4GGOA 5AK0A 4EKDA 3IKJA 5ADHA 4N6NA 4S1PA 1CDOA 3ZY4A 3REQB 2HYIC 4E03A 4NCBA 5CD1A 5G4LA