2IA5A

T4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
297
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMNGPYDLCDTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase
molecule keywords Polynucleotide kinase
total genus 93
structure length 297
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ia5A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ia5A02
1ZC4A 2R8EA 2YN4A 4F92B 2FI1A 1OFTA 4IVRA 3IO3A 2HXYA 1D6JA 2GAOA 3CRW1 2ZUDA 3IQWA 2PEYA 4HLUC 4Q03A 3GLGA 2RB5A 1EK1A 3RF6A 3QU9A 2ZE6A 3T06B 2JAQA 3H2YA 1LY1A 2JLQA 2V55B 3VMFA 5F3WB 1W4AA 1DAGA 3C15C 3EZ2A 4MITA 4UNRA 4DSNA 2HV8A 2GRJA 5AKGA 3MWJA 1C4OA 3A37A 2ZJBA 4Y0VA 5J4HA 1HE1C 5FL3A 4TTQA 3WHLA 2HOQA 1GL7A 2F9LA 3DMDA 3FFAA 4LK2A 3GFTA 1OV4A 1P62B 4TMWA 3TMKA 5KSOA 3FZQA 1P2TA 4RCZA 4U7DA 1GKYA 1U8AA 1BKDR 1VHLA 2G0TA 2A9KA 3GLHB 1U90A 1E9RA 5FP0A 5AI8A 4MQBA 4M22A 1OW3B 1YU9A 2OFOA 4ESVA 4LHVA 3A4NA 2IYRA 3ZD6A 2BM1A 1J90A 2XZPA 1LVGA 5GADl 1W4BA 5JWOA 3WNCA 3L8GA 1N6HA 1XTQA 4FCWA 4HATA 3BWVA 2JIZA 2ZE7A 2RAVA 3BA6A 3N5KA 1CJVC 5EZ5A 4OCZA 2NMVA 2WIAA 1SU4A 1E2JA 1ZC3A 1P7CA 1AGPA 2A5FA 5TMPA 4FD2A 4NHOA 2G88A 5FUXA 4FE3A 1TPZA 2GZDA 4P4UA 5KHOC 2VF8A 1E2HA 4S35A 4A8JC 1ONBA 4ZCIA 1MH9A 2F1IA 2JLVA 2P67A 2RGCA 4DLTA 5H8WA 2J59A 3MWKA 4K81B 4DCNA 3FKQA 2FEAA 4CIDA 3GLHE 2DFLA 4FXPA 2VSOA 1YJ5A 1M34E 3K1JA 3SEAA 2OBNA 4TWZA 3HLTA 4HI0E 2I1QA 1VYUA 1VECA 1KKMA 4OI2A 2QTVB 1L7PA 4DLYA 3U5ZB 4M1MA 2YMPA 2X8AA 4HLUA 1KHTA 1BYIA 1TQ6A 3S1AB 4DEXA 4P32A 3A6PC 4LUCA 5JJIA 3AF4A 5AI4A 5AM5A 4EPYA 2BMDA 4NTZA 5AUPB 2GHTA 1U99A 2D62A 2H57A 1QHIA 5F98A 2E9SA 1CKEA 3TRFA 2A2ZA 1TQDA 1G19A 5G53C 4DCUA 3T1TA 1PVOA 2OT3B 2QM8A 4D80A 1SWVA 1G17A 4D25A 2FNAA 4TMTA 4QC2A 1RQNA 3AF1A 2JLWA 3QU2A 2H16A 4OFZA 4LV5B 2KBFA 2OCAA 4QGFA 2ZSEA 4C7OA 4OQLA 3A1UA 3QOFA 2WFAA 4AG5A 2EFEB 3TSZA 1G5TA 1P9RA 1FFHA 2V8OA 5GVRA 1RQLA 1Z4MA 2ZYTX 2XITA 4Q47A 1Z08A 1GZSA 1US8A 2Q3HA 1E2PA 3B1VA 4HZUB 5DNYB 5JI2E 5AKIA 4CF4A 3L0BA 2Y8EA 2YFYA 3IBYA 3IDQA 3ZVNA 2FFQA 3IJ5A 4E09A 4POAA 3O8DA 1DOAA 2YY6A 4JLNA 4LSGA 1JB1A 1W36C 4JLJA 2WPDD 4AYTA 4M9XA 1N25A 4UXIA 4Q1FA 1TMKA 5EQTA 1JNYA 1G3UA 3MUFA 3TLMA 1P73A 1GKUB 2W6IA 4WXPA 2HCFA 4WZAE 3U7FB 4M1TA 4Q66C 4A8JB 3M1YA 3WKEA 5HE8A 4UM5A 2JLUA 2MMGA 3UMGA 4CF5A 4DLSA 1E32A 1NRJB 2EFGA 4TZ0A 1QHSA 1KI2A 3TJZA 4Q1EA 4UJ3A 4B43A 2IYVA 3OE7D 1IY2A 3A1WA 4EFMA 1JJVA 2CLDX 3CF0A 1FMLA 4D4LA 3IKJA 4B75A 5LD2B 1WE2A 3GLGB 1RRCA 3KBBA 1CP2A 1U9IA 3IIJA 3TUJC 2TMKA 4EPWA 3ZD7A 5ALLA 1H8HD 2YJ4A 1U7OA 3CPJB 4B2PA 3TW8B 3NH6A 3ZX5A 3OIYA 1QH9A 5JJBA 1AKYA 4U02A 2C4NA 4UMEA 4IKEA 1Z22A 2YNMA 1S9HA 3PEUA 2ORIA 3FVQA 4G5OA 2QP9X 3FTQA 1VCMA 3ZJYA 1KK3A 3KQNA 5BQ5A 4D4KA 5AWFC 2B82A 1KZ7B 1DARA 3WK4A 3SJBA 1DELA 4UU1A 3GYGA 5EE5B 1W46A 3WK9A 3GLHA 5AVVA 3RFUA 2YOGA 4B48A 4OHYA 2NO7A 3WY9A 2IS6A 1NMXA 2WJJA 2YZ2A 2FUEA 1ZVQA 3SKXA 4JLVA 2DB3A 3BGWA 4J03A 2W6ID 1JR3D 4PQRA 4MDFA 4I9GA 5AW3A 3K0AB 1ETUA 2NTYC 1DG1G 1NN1A 3NBXX 1FNNA 2Q9AA 3PCTA 1MKYA 2DFKB 1WR8A 1FX0A 4Y2UA 5CIWA 5AKJA 4UMVA 1NSFA 1Z6YA 3NAMA 1DVRA 4Q4HB 3T15A 4V0MA 1GFIA 1KK1A 1IY0A 4KCGA 5FBRB 1WB9A 1ZD9A 3OCXA 4B3FX 4DKXA 2FV8A 4KU4A 4KNWA 5AVUA 2GMWA 2QPOA 5FBVB 2O8DA 5DISB 1KDOA 3OCZA 4NWIA 4QKQA 3EZ9A 4QBGB 2GA8A 1KJYA 1D9XA 1CLUA 1G16A 1P72A 1TU3A 2ZANA 3TVTA 4AKGA 1QG4A 5AJZA 3UWKA 1E98A 1YQTA 2ZXUA 3LBHA 4Q48A 3BD9A 4EEKA 2BKEA 2WJIA 1Z0DA 3B85A 4XOIA 1KO4A 3I6BA 5AW6A 1OKKA 4TYNA 4UKDA 5H70A 4RD3A 3I72A 2FWRA 4IOLA 5GJWC 4WVFA 1R10A 3S1AA 4L6CA 4A2PA 3K0CC 3ZQJA 5FPKA 2VSFA 5K8TA 1W7AA 1Z4NA 1S2MA 2C9YA 3CRQA 1NN5A 1HQCA 4N3NA 3FFBA 3GEEA 1YNSA 3KQHA 4TLDA 4EPRA 1DAKA 1GNQA 3WK7A 5TDHA 2O8EB 3OAAA 5ALYA 3OFNA 3VQTA 3FB4A 4ESHA 3O8RA 4MGKR 4W9MC 3RS2A 4ZCMA 2QG6A 2OZEA 1H8ED 3SBDA 2FDCA 3BB4A 2W83A 4JJZA 4PSVA 4TL8A 2FH5B 2CNWD 3LAWA 4PFSA 1Q22A 4ZV4A 3H86A 3EPRA 3MJRA 3AH8A 1OLOA 1AM4D 2QSYA 2OFXA 4EELA 4OBEA 3ND9A 4KVAA 3G5UA 3MMPA 1US8B 1CTQA 1W44A 1GIAA 3TGPA 2FZ4A 2IC5A 3WGUA 1OFIA 1ZD1A 1XJ0A 2WKQA 4TMVA 3ZH9B 2VF7A 1RKBA 4KBFA 4A2WA 3MGCA 2Q9CA 2JAOA 2F55A 2OXRA 5AVRA 3OCYA 2B30A 3KKNA 2WF5A 1SVLA 2ZRHA 4JT4A 4L4UA 4Q4LA 1MO3A 2AXPA 2WOOA 1XEWX 4C0QC 2C9CA 2ZR9A 4AG6A 3SJAA 3QKSB 2CCKA 4TT3A 4YLGA 3C14C 3NEYA 5AVYA 4YXWA 4JLPA 2ZSAA 3K70B 2I4IA 4ZPXA 3V9PA 2BC9A 2WAYA 4LV6A 1KNXA 3CNOA 3EA0A 3U60B 5EJEA 2IOHA 2C2HA 3CNHA 1QZXA 4C0AC 1Z4IA 4EPTA 2BJWA 1DG3A 1OXUA 4Z8YA 5J4LA 1OH5A 5LD2C 3OZXA 1G9XA 3ZQ6A 3P27A 3SE0A 1ZCAA 1YRAA 2GNOA 1ZNZA 3VKGA 4JYCA 2YMQA 2BDTA 4BGDA 3TNFA 5KOYA 5B2ZA 3R9XA 1IOZA 1YRBA 3KJGA 4GBMA 1NP6A 1W1WA 2KE5A 3JVUA 1TQ2A 3FDIA 2AR7A 4KBGA 4YC7A 2BVNA 4JVSB 1KY3A 1D2EA 4EQ6A 1KI6B 2ZBEA 4GOJA 2OA0A 3B60A 4TYWA 2J0VA 3ZS8A 3E81A 3N07A 4UARA 3VKHA 1G3RA 3M4YA 1Z29A 5KSPA 2WWXA 4MH0R 1IWOA 5DI3B 4W7SA 4D4JA 2IHBA 2LKCA 3TLXA 4WW0A 2ZRCA 3DKPA 4H1WA 3IGFA 4OHXA 5L3QA 2H5EA 1ESNA 1KDRA 2OG2A 5GJCA 3U6KA 4BLPA 4NL4H 2H92A 5LB2A 2HDOA 1NY6A 3ESRA 5T41A 3Q3JB 3U6BA 3QPUA 3KZ1E 4YCNA 4BFXA 1N9KA 2ZS8A 2HO4A 4PZZA 1G8PA 3ZW7A 3K0AA 1E9FA 4V02A 1WA5A 3A1EA 3GFOA 4XVRA 1L4UA 3GEIA 8OHMA 1LB1B 2XZLA 1JUDA 4LBWA 1QQ6A 3U3OA 2QQEA 3TE6A 4YXWD 1FX0B 2IEZA 1UDWA 4JSTA 4TN1A 3I61A 1OIWA 2YKGA 1R5BA 4II7A 1FZQA 5JJKA 2EYUA 3E8MA 2AWOA 3N8GA 2QTFA 3TSOA 4ZKDA 4WA7A 4Q4HA 1YZLA 3VR4A 4NFLA 3GLIB 3EC2A 3B82A 1WPGA 5EP1A 4LC0A 2IOFK 3NKVA 1N6RA 1CR2A 2PZGA 2O8DB 4KFUA 1MO6A 4TL7A 2CHGA 5EP4A 2W11A 3FMOB 4HSEA 3A1TA 4Y2SA 3OTQA 4MYHA 1KSJA 4L8GA 2ZBFA 3KXIA 3LXRA 3QKUA 2DFTA 3QVUA 5FUYA 3I1YA 1O08A 3GJ5A 1HTWA 3CRMA 1OFHA 3P96A 5HZKA 1CJTC 1KO8A 4GPTA 1E2IA 2BIFA 1WF3A 2AFIE 1KI7A 3SFVA 3EWIA 2QL6A 4XD7D 1C1YA 1U2TA 3QX7A 1XX6A 3KJHA 5AW4A 4C9BA 3L8YA 5FTLA 5AW9A 2CLCX 1Q57A 2FX3A 2GBLC 1JEDA 1KDTA 4IRUB 2NGRA 1ZJJA 3KUDA 3FM9A 521PA 2YC4C 2REXB 5JSZA 4OHVA 3UM9A 1VG9B 2O8EA 2P27A 2HLDD 1ODFA 3UG6A 1NRWA 1U7PA 3GEHA 2QY9A 4X8OA 4CZ2A 3GLGE 2AWNA 4V03A 1ZM9A 1IHUA 1G18A 1KSFX 5J4VA 1A4RA 4ITRC 4O0MA 1UBFA 1KO7A 4CEIB 5GJBA 3NANA 4GP6A 2XGJA 2WWHA 3QYPA 2QNRA 2Q3MA 2XB4A 2I55A 2LCFA 4O25A 1SVKA 1HT2E 4DCSA 4OHFA 4PAOA 4QGAA 2CEAA 5AM2A 1OB2A 1DE0A 1AQ6A 1Z8FA 2YWFA 3WYAA 1G3IA 3GLFB 3NUQA 2EWVA 4Z8XA 4M0LA 5KSYA 2I54A 2FFAA 3EC1A 4GFDA 4QM7A 2Q4TA 3QNUA 4YIHA 1S3GA 1AK2A 3E5HA 5EE3A 5AKZA 3SR0A 2EWWA 4H1UA 4UXHA 5ALXA 3P20A 4NYJR 2UZ3A 1ZRMA 2VLIA 3NXSA 4K46A 2YWGA 5A3RA 1JALA 3EARA 4XWAA 5EXSA 2GEDA 3QKSA 2C99A 4Y2VA 4LPKA 5KDOA 3RSOA 4E03A 1SKYB 1KK0A 2GWHA 3DVLA 1G20E 3T12A 1EFRD 3QU5A 3QF7A 4L9SA 2CHQA 1Z0AA 2CDNA 1Z4KA 1DADA 3QI2A 2WOJA 2GILA 5AK5A 3W6OA 1KOFA 4BRUA 1Q0UA 2VRWA 4ASUD 1VTKA 5KNCA 3E70C 3VR6A 1OH7A 3K8YA 3BORA 2WTUA 5AVWA 3QXSA 1DO2A 3HR7A 1GNPA 3A36A 4ZCLA 2ZS9A 1QG2A 5E7JA 4EQ6B 2RGEA 3RS7A 2Q3FA 1RPZA 1K8RA 2MSEB 3CKLA 1KI6A 4F7WA 4Y2RA 1YR9A 1IXZA 3KKOA 5HPYB 4OJKA 5FOSA 4Q00A 2OCBA 4NYJQ 1P3JA 4M53A 1K5GA 4UNQA 5DI3A 3LD9A 3R8CA 3B5JA 1AQUA 3O47A 3K0FA 2ODWA 1GWNA 1R6BX 5L3QB 1SVIA 3CPHA 4B6EA 1K1EA 3FMIA 4LOAA 3RC8A 4IDNA 4MYTA 2GXUA 1N5LA 1OIVA 4URWR 1MOZA 4ACAA 1WDTA 3OEHD 4LJ4A 1B23P 1PW5A 1I4DD 2R6DA 2VHUA 4PNHA 3UMFA 5K8UA 1U9IC 5CLLA 5AUQA 3KKMA 4RVCA 2RKOA 5H68A 4DT1A 2NG1A 1W47A 2BM0A 3AEZA 4PSKA 3DOFA 3VKWA 5IHPA 4Q9HA 2BJVA 721PA 4YDHB 2C88A 4M8NE 3X1WA 3GLIA 3AKDA 2BEKA 4PZYA 5SZIA 3ADDA 2ZBGA 1Q20A 2C9MA 3K9NA 4NCJA 4UQOA 3K9LA 1GDDA 2QE7D 4BBJA 2WSSD 4G5RA 4RESA 1XMJA 2O0KA 1YZGA 3I73A 3OESA 3Q8XB 4IJMA 2O9JA 1L8QA 5JECA 2X77A 1Z0KA 1IONA 3SI7A 4P33A 3MMZA 1FQJA 2YMLA 5TARA 2ZJOA 4JSYA 3QIAA 4M2LA 2UVQA 1W36D 4MKGA 5JBQA 3W3ZB 3W8NA 2ZRMA 4EAQA 2BMEA 4HB0A 1AS2A 3W9YA 1D8TA 1VIAA 2G77B 1AGRA 5AVTA 5A3SA 3AR8A 3QVVA 4N0EA 1XTSA 2QZ4A 1M8PA 4BFZA 1E6CA 3AR5A 4Q7LA 2NZ8A 2VTKA 1E96A 2ZRGA 3QE0A 4F38A 2ANCA 1E1RA 4GXTA 2XAUA 2AFHE 2FPLA 5UKDA 4OI0A 2QSZA 1XEFA 3Q9LA 3FPBA 3PDWA 2NIPA 5JSZB 3B6EA 5ALSA 1BYUA 3I4LA 5IK2D 5HZHA 1J8MF 4GNKA 3TAHA 2AH5A 4CEIA 2BKUA 4BFUA 4UASA 2P6UA 4F93B 1G5PA 3SFZA 1NNEA 4TMKA 3I8XA 1ZIPA 2JASA 3IRUA 5K8LA 4O8CA 5AKKA 1XTJA 2V6IA 1JECA 4XVUA 4HB2A 1E4YA 5ALZA 1F6BA 1RRPA 5P21A 1QRAA 3GLFA 2I34A 2RGNC 2IWRA 3OEEA 1T0HB 1LTQA 1ZP6A 2QE7A 4QBFA 1Z5UA 4P4TA 5AJYA 3ADCA 2B1RA 3SU8A 1I4TD 1COWA 2DPXA 3LNCA 3V4FA 2C5LA 2WZQA 4JKIA 2OBLA 4XJXA 3Q72A 3FMPB 2ZQ5A 2QN6A 3D6JA 1TF2A 2C95A 3NHAA 1QHHB 2JJ2A 4G0NA 3WXMA 2RGBA 4ZDKA 3AR6A 2RGAA 4Q1AA 1Z0JA 4YONB 4DDWA 5ALMA 5IS2A 4LY6A 3REFA 4PC3A 1EFCA 3SDZA 4CW7A 3HYTA 1XF9A 1B0UA 3RSLA 1ZD3A 2B0CA 4FMDF 1XP5A 1NJGA 5AUOB 2ZEJA 3AV0B 4KI0A 2DCUA 4Y2JA 5E7IA 4HB4A 1WRBA 4BFYA 1XTKA 1GL9B 1DAHA 2FU5C 2ZRIA 3LX5A 2JLXA 4R7ZA 2XB2A 1OH6A 1II9A 4B32A 2ZS7A 4GMDA 5CLQA 2ZYUX 1Z4OA 1ZD4A 1E9SA 5KPDA 1KMQA 3VAYA 1JR6A 2CJWA 3AQ4A 4QJ5A 1XPJA 3ZWKA 5C18A 4TLCA 1ZAKA 4Q9IA 5AM0A 3REGA 2ANBA 4YMTA 1Z4JA 4B6FA 1LVHA 4L5BA 4HGQA 2PMKA 2RAPA 4UXJA 4RZXA 4BFSA 3GJ0A 4M1KA 2P0EA 1HA3A 1XWIA 3KKPA 2PCLA 3FYHA 4QHTA 2ZBDA 2H8KA 3K0FB 4ON9A 4ACBA 3FOZA 3ZU6A 5AW0A 4IHQA 2CL0X 2D4HA 5ALIA 4M9ZA 1R2QA 2GJ8A 2OE2A 2CE7A 2PL3A 5JEDA 5AM4A 4HDQB 1SZPA 121PA 2GCNA 5EP3A 2YJ6A 4DW8A 2AK2A 1RKVA 4HAXA 2ZYVX 2ZXEA 4OKSA 1JQLB 2ONKA 3P4YA 4DT1B 1NY5A 3DL0A 4UU0A 2ZJ2A 2LWIA 4KLZA 3U26A 5M04A 2QUZA 4I1SA 4BLQA 5EE0A 2ZSBA 4L57A 4IOKA 4AYXA 1KGDA 2HCBA 4JKYA 4LYJA 4YCMA 2JLSA 3PEWA 1E2DA 1G4AE 3AKEA 5EUMA 5FPTA 5FH9A 2NPFA 5JHGB 5A0FA 1II8A 4A9AA 1S8OA 1IQPA 2NO5A 2O8FB 1ZINA 1U8YA 1L8LA 2X1VA 1CJKC 2JAWA 1EX7A 4P0TA 4LDJA 3LV8A 5KNBA 2O2XA 2ZUCA 5JZVA 4PPGA 2GVDC 4RKEA 4GSYA 1FUUA 5BN5A 1GAJA 4JYBA 3AVYA 1KI3A 3AP3A 3VHXA 4UMDA 1G41A 5FBLB 3K1ZA 1Z4PX 1EK0A 1R8SA 2R44A 1AA9A 4KLNA 4FI3C 2HDNB 3PUZA 1GP2A 1Y3AA 1E79A 2AKAB 3KX2A 3EG5A 3E1SA 2C8LA 3ZYCA 1X6VA 1OT3A 4D0NA 4QRHA 2B8WA 2CLSA 2Z5FA 3AKCA 3SQXA 1FW6A 2EYQA 4IOJA 5JCZA 2RBKA 4B6JA 3DAOA 5AM3A 4JLOA 5JI3E 2ZI4A 1RMTA 1ZJ6A 2VBCA 2XX3A 3PGVA 1S1MA 2HT1A 3BBPA 2GK7A 2JEOA 3HYRA 2ODAA 1A7JA 3ZVMA 5FI1B 4US0R 5DN6D 2GXSA 4V0LA 4GP7A 5FOUA 2G08A 3CRVA 4TMZA 4IFTA 4CT5A 4AKIA 4R9UC 5C2JB 3QF4B 1JQJC 5GVSA 3THWB 3O8CA 1OYWA 2CK3D 1IN4A 2IYLD 2ZR7A 1E2MA 3RWMB 3BERA 1IN7A 2MSNA 1XD8A 1IJFA 2IHYA 2IYSA 2IYUA 2E87A 4MYCA 2FF7A 4QL3A 4PHTA 4IFBA 4N1AA 4TL9A 2VHTA 5ALPA 5KUTA 4Y0AA 1TU4A 4CEHA 4E88A 1J8DA 2J7PA 4HAUA 2ZRFA 2R6CA 2I3BA 1Q1QA 5DSZA 1IXRC 5DO9A 1W36B 2LKDA 3P4XA 3NDBB 2FOLA 1QHHA 1CBUA 3TW4A 4ZI2A 3X1ZA 5HCNA 3CX7A 2J46A 1G7CA 1Z47A 3LW7A 1BS1A 1RKUA 2OLKA 4XQ0A 1NVVQ 1R8QA 3W8RA 4ERNA 4URZR 1D9ZA 4LYHA 1U02A 4WAUA 4G9BA 4BZQA 1DAFA 5CB6A 1U2SA 4BFTA 3UK6A 4Y2YA 1Z0IA 3NEJA 1WZCA 4E07A 3SNHA 2GJKA 3WKBA 5FPYA 1HV8A 1WBBA 1E2GA 5FTMA 2A7QA 5AESA 1X1SA 4A6PA 5KO2A 3EXAA 2R8YA 2K5UA 4AP9A 2BY4A 2IYWA 3AF0A 4PQFA 2QYHA 1VG8A 4QGGA 2CJWB 5DI9A 2ODEA 1GRQA 1QYIA 2ZROA 1KKLA 1U81A 2EW1A 2GEVA 2QGNA 4LHZA 4PAMA 4X8HA 4Z54A 2EFDB 4JDPA 2QPTA 3NC0C 5ALJA 1VG0B 2JDID 4P3YA 2E1RA 3HU2A 2IYXA 4OL0A 2QMUA 1NN0A 3ZZ0A 1AKEA 1ZM2A 1E4VA 1OFUX 2VIIA 3L8EA 1FL9A 3CBQA 1RDFA 4LJ7A 1YE8A 3DEFA 2W4MA 1N6LA 2YV5A 4TQAA 4IDPA 4XOUA 2VL7A 5KYKA 4CT4B 1LS1A 1SULA 2V54A 2NZJA 2OHFA 1E9BA 4PO9A 3UIEA 4JMPA 4FMBB 5EE1A 2IUUA 2QLTA 1E2EA 1S8FA 2B21A 1KYIA 3NHBA 5CDFE 2I33A 2YJ3A 1P9NA 5AHXA 1XCGB 1CIPA 2G1KA 2WSMA 5JS8A 3A4LA 2QMHA 2ZRKA 3Q5DA 1EFHA 3GJ3A 1XRJA 2OYCA 3CH5A 1W0JD 2ZREA 2I6XA 1W5TA 2ASEA 4OYHA 4WOPA 4DIEA 3TUZC 5AW7A 2IXEA 1EK2A 3AR4A 3GD7A 4DSOA 4AI6A 4CE6A 3T35A 4D82A 3L0OA 2VHQA 1GTVA 1II8B 3VR3A 3W90A 5L3SB 1GITA 2O8FA 3F0TA 1ESMA 1R4AA 4ASUA 1NF2A 1UBEA 1F48A 2XTZA 3D3QA 1Q44A 2JJ1D 5AVSA 1CJMA 1ZU5A 4FW9A 1XZQA 3LQRA 1XBTA 1BMFA 2OFWA 1LF5A 4NZYA 5IRCD 1NVUQ 2G3YA 2OV2A 1RC8A 2HJVA 3RS3A 2XXAA 2PJZA 3HWSA 1UEIA 3QXJA 4LX0A 3RS5A 3SYLA 2BDEA 1KZGB 4EENA 4RKFA 2J1LA 2WMOB 1JPJA 2IBMA 2CVFA 3CR8A 2XNDA 3UPUA 2CFRA 3KXKA 5IT4A 1OHHD 2H1LA 1TA0A 4XE5A 2DWOA 2WWIA 1YZKA 2ZAMA 3KTAA 1E0AA 4JLDA 1IM2A 3C41J 5ALUA 2W0MA 3ZTYA 4LWZA 1E2FA 2F3TA 3K0CA 1N6OA 1KAOA 2QP3A 2QU8A 5D3MA 3L8FA 3SJZA 3RAPR 1PLJA 2CBZA 3HR8A 2JA1A 1E0KA 2G0AA 4B2IA 4IEEA 2FGJA 1AS3A 2RB4A 3I28A 4TLAA 3TSWA 3BFVA 4M1SA 2JLZA 2D2FA 5BN3A 3R9WA 1RE0A 1WXQA 1W0JA 5CM8B 2F3RA 4R98A 4CNQA 2H18A 2DHRA 3GJ4A 4OQMA 3W5JA 1S9DA 1NVVR 2W0SA 4DB4A 5HCIA 1P4SA 4D2IA 1KDPA 4EFLA 4HDOB 2VH5R 2IUTA 2PT5A 3QF4A 3THWA 4XVQA 4BKMA 3EZFA 5JS7A 1XXHA 1ZD5A 1KYTA 4ZIRB 4V0OA 2RGXA 2EFCB 4YCLA 2OCYC 2DWQA 1CJUC 2RGNA 3CIOA 3RS0A 4DHEA 4UNNA 1CR1A 5TXGA 3SJCA 2OM2A 2P2LA 3QNMA 4FMDB 2GZAA 4CEHB 2VP2A 3HP1A 3PFIA 4BFVA 3KDSE 3ASZA 3LY5A 4DLWA 4QBHA 3AR7A 3HPRA 3CX8A 3VAAA 3WYFA 2XNDD 2OLJA 1WMSA 4Q1DA 1G7RA 5JLJA 2W00A 2KSQA 3HJNA 4Q4AB 3CO5A 4LJ9A 1XTRA 1T6NA 4Q9KA 5G40A 3P32A 2O8BA 3T34A 3NALA 4W5JA 1QHYA 1JPNA 1I2DA 4B35A 2VHJA 3E58A 4JB3A 4B3GA 5IK2A 3U61B 3MRSA 3PIRA 3L0CA 1LV7A 2CFTA 1CRQA 2GJ9A 1S1CA 4OJQA 4FINA 1XD9A 4JL5A 2PLRA 1KMHA 1KI9A 5G41A 2HJGA 3V00A 4MRPA 3ESQA 4L15A 4RFVA 3MWLA 5AKXA 3L0IB 3GP8A 3B1YA 1YVDA 3G82C 3B78A 2BEJA 2VO1A 4DCTA 3ET5A 1KI4A 2ZITA 3LBIA 5HKKD 1N2CE 3B7GA 1F3OA 1YV9A 4BLTA 5B64A 4Y2PA 4V0ME 3LH5A 1QQ5A 3CB4A 3B1WA 1X8LA 4K8OA 2B8TA 5IT0A 2QRZA 4M9SA 2GAAA 4LYAA 5A3QA 3ZDQA 2I1VB 4MRSA 2Z43A 3RWOA 1R0WA 1K6MA 4PAQA 3QU7A 1Z3IX 4HEJA 1FMJA 2CL7X 4C4SA 3SBEA 4CF3A 4A0GA 2EAUA 4YH1A 3EWSA 4RZ3A 2QBYA 5K8IA 3WBJA 3NH9A 3UXMA 1U0LA 1Q91A 1S4QA 2G6BA 1EWRA 2O0HA 1D2NA 4FWTA 2DY1A 5AK6A 4M1OA 2QT1A 2R8ZA 2FPWA 4KYTA 2ATXA 1W49A 3X1DA 2ZSDA 4DBLC 1Z07A 4B3CA 2P9JA 3ONNA 5L3SA 1G3MA 2FSIA 1FPMA 3W6PA 2CHVA 3AM1A 4LJ6A 2J45A 1N3BA 3MWYW 5FBWB 1EFTA 1FUKA 1M7BA 2VSXA 3BFXA 5LDDC 2CN1A 2C9OA 4NCNA 5SZHB 3QBVA 2XXAB 2WHEA 1OPXA 3NVAA 6Q21A 4BEVA 1HURA 2UZIR 5JFGA 5LPNA 5AKHA 3MSXA 2VPPA 2IT1A 2QP4A 4KYUA 4YMVA 2C96A 1OXXK 1L7MA 4GI7A 4MRRA 2ZI5A 3AVQA 3FMFA 3TH5A 2CXXA 4OK5A 5JWHA 1A2BA 3CH4B 5HKKA 2PBRA 1RYHA 3KTAB 1FTNA 4DRZA 5BYKA 5KSZA 2R8XA 3ND8A 1C9KA 4FWIB 5DE3A 4ZEVA 5D3MB 2C04A 3E2IA 3AVPA 4Q1BA 2OCPA 3CLVA 1QHXA 5AI6A 1T5SA 1KTVA 3IB6A 4F72A 1GILA 2AD5A 2D74A 4L9WA 3EX7C 4RETA 4DCVA 2WJHA 4IXNA 3QQ5A 4N0DA 4YDSA 4GDFA 2VP0A 3W5DA 4EZEA 3MJHA 4KXFB 3ZIAD 1M74A 4GRAA 3SZRA 2ZSFA 4IXMA 4YMSA 2QM7A 2WIBA 5KU1A 5FOTA 1YDFA 3EPHA 1X8KA 1F2UA 3BFKA 3QKRA 1UKVY 5C4MA 4JLAA 1LF0A 4ZI3A 4EJSC 5F9HA 1E0SA 1W48A 2PX0A 1XXHB 4J2TA 3UMBA 4ZIRA 1GSIA 1L8OA 2AHOA 4NYMR 1SQ5A 3TKLA 5C4GB 3LFUA 3AGQA 3N2EA 4B2LA 2V4ZA 3O8BA 3PUYA 4Q7JB 3T61A 3WK6A 2IYTA 2GZHA 3BWDD 4Q9JA 4URVR 2VYFA 3LLUA 2Z4RA 4OD0A 5FR1A 3U44A 3Q5EA 1ZNWA 1ZM3A 1HH4A 2GXAA 4Q9LA 5AIBA 2GF0A 4Q4AA 1SGWA 3RRNA 1TX4B 1EWQA 3BB1A 4FCTA 4NYMQ 2O8BB 4C0SA 3B8HA 2XJ9A 4PSAA 5D3QA 3ECCA 3QU4A 3X1YA 3KZXA 1NLFA 3K9GA 4A6XA 3SC3A 4QGHA 2ZI9A 4TMXA 3CW2A 4MWOA 2FPUA 5IT5A 2VP4A 4B33A 1GKIA 2AUTA 1Q1EA 3SYKA 3SMVA 4Z1MA 3DNPA 4HYTA 3I8SA 3EZ7A 4FIDA 2D7DA 1KMHB 1EFRA 1ZUHA 1JEEA 2A78A 3A1VA 5EP2A 4A92A 4DEYA 2JLYA 3OE7A 2J87A 2A30A 2NO9A 3CWZA 3U7GA 2EU8A 2G1AA 4L6AA 4MUAA 4BEJA 4BX2A 5AK0A 1Q1ZA 2HUPA 4NYIR 1XZPA 3B9QA 3WNDA 1HY3A 3S6JA 1NKSA 3LVQE 3OHMA 3SQWA 4C2TA 3ZVLA 2XTNA 4DUGD 2J0UB 3PJRA 4HB3A 4US2R 3PG5A 1UDXA 1QBKC 4LC1A 3WHKA 1RLOA 1GOTA 2J7PD 5SZJA 3QUQA 1OF1A 3PQCA 5BN4A 2G83A 1M7GA 1P60A 1UBGA 1G6OA 2HT6A 3CUEF 2JGAA 2OO7A 2QTHA 4DLUA 3DDCA 3FGNA 4LCBA 1MO5A 5DLQC 3H0KA 4HYYA 3WKDA 1Y63A 4JLKA 4TTRA 2QBYB 2D2VA 1W0KD 3W5IA 2ZI3A 3AF2A 3LX8A 4AYWA 2R6GA 3C8UA 5C46F 2V6JA 4X8LA 1W4CA 4ZDJA 1OH8A 5FFMA 1UM8A 3V4RA 3G0HA 5FI0B 4AK9A 3P26A 3RRZA 1T9ZA 1XU4A 4PHFA 3ZLJA 1NVWQ 1OYYA 3QUCA 3GJ7A 4U00A 2B8JA 5AW8A 3OEHA 1T3HA 1T5LA 2O0JA 3FHOA 3DOEA 2ERYA 4JVMA 2BBWA 1KI1A 2RH5A 1P2VA 3ZGXA 4RD4A 1ZD8A 2ZJYA 3L43A 4Z1MD 1EESA 3WRYC 2P5SA 3QBTA 2W2VA 1ZS9A 2ZVQX 1P6XA 3U19A 2FMXA 4Q5IA 1YKSA 3FVVA 3KDPA 5AW2A 1K5DA 2GHIA 1SXJA 4V0KA 3AR9A 1G8HA 2QT0A 4PR0A 5FOWA 5FUWA 3VR2A 621PA 3J7TA 1X1RA 3OCVA 4KX5A 2QAGC 1YZTA 1JR3E 1T3SA 2HYIC 3AUXA 2YJTD 2ZRAA 2J7KA 1IXSB 4ZDWA 1QHNA 1JAHA 5BW8A 1KO1A 4O2LA 4B3XA 2J0QA 2GJSA 4HLDA 4JZKA 2JAUA 4PXAA 3NBZC 1WQ1R 2ZJ8A 4BE7B 5L3VA 5KDLA 4D4MA 1PZNA 2YHSA 3RNLA 1A82A 5EUQB 1N8NA 1F60A 1NKTA 1XD2A 5KNDA 2ZE8A 1ZOLA 5CJPA 2R6FA 2JCSA 1BO6A 2ZRJA 3A4MA 1N5KA 4PO8A 1W0KA 1R0XA 3M1IA 4P31A 2QMOA 4AD8A 3PENA 3OIWA 2KI5A 5TB5A 2XNSA 2WPDA 3OCUA 1F2UB 3KJIA 3AP1A 3QKRB 3QSYA 1H65A 3ZWDA 3D31A 4WBSA 2IOFA 3L0YA 3QGMA 2WF8A 4YGYA 3OFND 2JATA 1N5IA 1WBDA 1QVRA 2PEZA 2GCOB 3B2EA 3CNNA 1BMFD 1NLYA 2ATVA 2ZPTX 1DAMA 4QNMA 5ALKA 2GDJA 1M1YE 2CL6X 4JJKA 1GRNA 5FBQB 3AVTA 1E2NA 2G0NA 4JBYA 1FP6A 3QUSA 3L8HA 4HZIA 4F91B 4BX0A 1E2QA 2J3EA 4S2EA 3R8FA 5AVZA 3FPAA 3NIWA 3ETLA 3U44B 2XSZD 1JAIA 4QHSA 1OHHA 2RMKA 1A5TA 2REBA 5CM9C 1QDEA 2P11A 1Z2AA 3VU9B 5ALTA 1NL3A 3LWNA 1RZ3A 2AN9A 421PA 1NF3A 1MR3F 3A58B 3VNUA 5JRZA 2ZTSA 2QRNA 3ADBA 5FTNA 5TY0A 4FN5A 5FTJA 1BIFA 2IYQA 5EXPA 4JIMA 4MGIR 1S0UA 2Q6TA 5KTYA 1PV4A 2IK8A 2FG5A 4KAXA 2ZYWX 5EE9A 1XPOA 3IPXA 2O8CA 2JJ2D 5AK4A 2FSHA 1N0VC 3GJ6A 4LJ8A 4KX3A 5HTKA 2MSDB 3KFXA 4DLRA 2ECKA 5F9FA 3IIMA 4QJBA 4F4JA 2JJ8A 4HAZA 2P3SA 3HU1A 1NNLA 5AK3A 5AKYA 4DDUA 2FEMA 3U13A 4I1OA 5ALQA 1VHTA 4OI1A 2WKRA 5E4FA 3KQKA 1EFUA 5AKLA 2PT7A 3C5HA 4HLCA 4L16A 1FOEB 1JR3A 1N6IA 3FKSA 3N2IA 4JT2A 1EG7A 2FFBA 2J0UA 1D5CA 1SXJE 3GMTA 2OBMA 3AR2A 1TL7C 2D7CA 2GXQA 5AJVB 2CMKA 1T5IA 4R2IA 1AS0A 1IBRA 1MRNA 3JZAA 2FPKA 4I9FA 4RY2A 2OAQ1 2ODBA 4PQYA 2FE4A 1L4YA 1P9WA 3UWOA 2RCNA 5FTKA 2BHRA 3NC1C 2CVHA 1MV5A 2GESA 4QM6A 2W43A 4F71A 4MRVA 3VNVA 4KVGA 3DHWC 4G01B 2BWJA 1Q1BA 2WF9A 1YZNA 1OXTA 4AC9A 2V3CC 5AI0A 1G3QA 1N0UA 4MUMA 1AN0A 4JL6A 4PC7A 1WP9A 4UAVA 2HF7A 3UMCA 3RC3A 1UKYA 4EUNA 2W6JD 3GJXC 3BRWD 1U0JA 5A5GA 4C4TA 4B76A 4TLBA 2J41A 4M4SA 3L82B 2HXSA 1V43A 1X8JA 2B7BA 3QXCA 1ZCBA 4LHWA 3Q7QA 1SWWA 1UADA 4OQFA 3SS8A 1PUIA 5ALFA 5EXXA 4BLSA 2VHCA 2ZI6A 1XVIA 2QA5A 1Q21A 1XDBA 2IWHA 2EATA 1IAQA 3QEOA 4RCYA 5TVKA 1SXJB 2WWGA 4I4LA 4MYUA 2HYDA 1Y8AA 2ZM5A 1M7HA 4UM7A 3OAAD 4TZ6A 3EPKA 4LRWA 1NJFA 4BZXA 1HUQA 4LPSA 1H8EA 4NV0A 1UF9A 3FGOA 4CF7A 4Q01A 1RRFA 2CNWA 4EIWA 5ALEA 2A5DA 3GCGA 3D7MA 1PJRA 4QJ4A 2X2EA 4DLXA 5CJ2A 4NDZA 4PTLA 1NG1A 3CF2A 2ZRPA 4XD7A 1XD2B 1V5WA 3U3KA 3TQCA 3QUBA 4NONA 5JMTA 3SLRA 3SHQA 3THYA 3L2OB 5HR5A 2FDRA 1CRPA 3GFPA 5CYPA 2V7QA 5C1BA 1ZRHA 4FFDA 2YBDA 1KY2A 4A82A 3CX6A 2W6JA 2OXCA 3TBKA 2N46A 4D26A 2AX4A 1L6RA 2V1UA 1WCV1 2P65A 1XFAA 4G1UC 1NI3A 4NU0A 5AICA 1DO0A 3GJ8A 2FUCA 2GCOA 3MN1A 1UEJA 4RD0A 3AB3A 4MGZR 4HGNA 2ERXA 4Q1CA 3U2QA 1ELOA 1GL6A 1CEEA 4LJAA 2ZIAA 2ZRDA 4YMWA 1EX6A 221PA 1HEIA 2QMEA 3UMRA 4KFRA 1Z6XA 3AF3A 3R9IA 4EPVA 1Z5GA 1SVWA 1XXHE 2SHKA 3OPXA 1DS6A 4HAYA 3WBKA 1HE8B 3VU9A 4YMUA 3RVBA 3K0EA 2VP5A 2J0SA 2YJ5A 4RJLA 1ZUIA 3AR3A 2GFHA 3VX3A 4AY2A 4IDHA 1G8FA 2ZETA 1NBMA 2ZJZA 1ZNXA 1QVAA 2ZRLA 3QXXA 4LI0A 1S3SA 1OSNA 2YC2C 3BH6A 2PJRA 1DEKA 3DMNA 1NMZA 4G63A 2O8CB 1R5NA 1T8UA 3FHCB 1G7TA 2WV9A 2WWFA 4MKFA 3WP1B 2WJVA 4EFNA 1ZD2P 1Z0FA 2OM6A 3IO5A 4WZBE 4OQXA 3RDPA 1A2KC 4CYMA 4B71A 1DAEA 1SVOA 2GJAA 2C98A 3KQLA 2IYEA 1IN6A 3EIQA 4UATA 2ZR0A 2V7QD 5B58C 1RW4A 3H4MA 1L7OA 5CITA 1Z06A 4HUTA 4BECA 4D0GA 4ABYA 1SVSA 4NCKA 1JJ7A 4KNVA 5DGXA 4URUR 1E94E 1RIFA 1XB2A 4NE2A 4KODA 2JIZD 4Q7MB 3I5XA 1VFPA 3L1VA 4Y2QA 2W2XA 3LRPA 1QF9A 1E2LA 4TYPA 4D81A 4C0JA 3AGPA 3VX4A 1N6PA 3QG1A 3RABA 4AKHA 3QEJA 4KFTA 5HE9A 4MRNA 2QGZA 4DZZA 4C2UA 2JDIA 2QAGA 1U2RA 3M6AA 4QFMA 4WXRA 1SXJC 4R71A 2F1JA 3K9HA 1GG2A 2G80A 3U3JA 2FPRA 1Z6AA 1E2KA 5B57C 3W5BA 1W4RA 4NAVA 4PPNA 4ZEWA 1NBMD 2WAXA 4OK3A 3B9RA 1T4GA 1U8ZA 1T9HA 1GRRA 2ZU0C 2YVUA 4DCCA 3EF0A 2WJGA 3AVXA 4DB2A 2IXFA 1YZQA 3IBGA 4PANA 4PHGA 2AK3A 2AXNA 4D6PA 3N1UA 3EA5A 1Q3HA 5CDFA 3CM0A 3SHWA 2GF9A 3X1XA 4FYPA 1Q12A 2X19A 3NTUA 3ZS9A 3T1OA 1DTSA 1I2MA 2PQ0A 2KBEA 3QY0A 1E3MA 1XPRA 3KJEA 3PUVA 2PR7A 3LQQA 1CR0A 3RANA 4R2HA 1VDZA 1ZW6A 4GT1A 4BX3A 2FN4A 3AUYA 2DFNA 2ZE5A 5EXTA 3W5CA 3SD7A 4FCVA 4KYIB 2ZU6A 3KB2A 4NKRA 4KO8A 3EF1A 1ZNYA 3RLFA 4B3BA 1ZUNB 3NWJA 4A1FA 3CZ4A 4DC9A 2D2EA 4DXAA 4KSBA 2WWYA 1KSGA 5J4YA 1N6NA 4LGMA 3B1ZA 2FPMA 2ZOSA 1XMSA 2BMJA 4MA4A 4RD2A 4W5WA 1TJ5A 2FSFA 3ZX4A 4G5GA 4PO1A 2ZI7A 4Q21A 5KDDA 1VYTA 2IF2A 5FOXA 3QKTA 2BOVA 3QPVA 5J4KA 2OAP1 4QXAA 4XWOA 1A1VA 4QNRA 3ONWA 3D6TB 3THYB 1KIMA 3LXXA 1T3LA 3IHWA 1PLKA 4H1VA 4KSCA 3K70C 1LS6A 3VTKA 1RMYA 2G06A 2ZG6A 3ZTWA 5SZKB 3WRXC 1E1RD 3K09C 2VP9A 2ZVPX 4G5SA 5AVXA 4XWKA 2RGDA 1R5OA 2WM9B 4MUBA 5ANRB 1P5ZB 2FPSA 3A1DA 3TK1A 1TJ4A 1U98A 1KNQA 2NQ2C 3J81k 1YHNA 5JEEA 2G07A 1P75A 4LBYA 5TV2A 1BOFA 1E99A 3BAFA 3R09A 3A1CA 3QG5A 4BQSA 4PC6A 2OESA 2H17A 2P5TB 1OXVA 3K70D 1P61B 3R4CA 1E69A 3LW8A 3L1UA 3ICEA 3PEYA 1DPFA 1ZM4A 1CR4A 5JRJA 3C16C 4XH9B 1SXJD 2RHDA 2WHXA 3TAUA 2FJUA 3LDAA 1VJRA 2EARA 4NP6A 2MSCB 3RRMA 1TADA 2IW3A 3F3YA 3AVVA 4B47A 4BNDB 1CU1A 1COWD 4C4RA 2VKQA 2GETA 1MRSA 2ODNA 2PMDA 2VQSA 2Q4RA 3A3YA 5ALHA 3EPLA 4IVQA 1TQ4A 5B30A 4CEJA 2IS4A 5AIAA 1KJZA 3BC1A 4JLMA 4Z51A 3DM9B 2IXGA 4LYFA 3UG7A 4OHZA 3GPLA 3THXA 1KI8A 5CK4A 5IF9A 1ZU4A 3A1SA 4M1YA 2PH1A 2GO7A 1W2GA 3IILA 1RFLA 4GZLA 4IOMA 4BWYA 4TYYA 1UKZA 2Z83A 2XEXA 3PGLA 4AS3A 3BH0A 4IDQA 2B8EA 4AURA 4DIDA 1Z4QA 5F2EA 3C7KA 4LJYA 4RSGA 4YQFA 3IEUA 4UMFA 2IA5A 2BV3A 4HAWA 4V0NA 2ZJAA 2DR3A 2HCJB 3NDPA 2IYYA 1AJEA 1SVMA 3BJIC 3T1VA 2REOA 1GVNB 4UNPA 3WMGA 3ZZTA 5FL7A 5E3HA 1J70A 3L7YA 3ADKA 2CCGA 3WKCA 4BEWA 4P4SB 1J7KA 2C77A 4NCIA 1YR7A 1S96A 2FZLA 1N6KA 2NO6A 2ORWA 4DJTA 4YIKA 2QAGB 1G5RA 3EIEA 4B3DA 4IFEA 1AZTA 4HGRA 1UAAA 2FGKA 1NSTA 1D2MA 3RRYA 3CRRA 2YYZA 4EKDA 1ANKA 1CXZA 5FPHA 4Q02A 1P2UA 1QQ7A 2WF7A 1FQKA 3ZZUA 3BE4A 5AKEA 2BDUA 2QPAA 3NBFA 3TIFA 2DQSA 2VEDA 2R2AA 4B74A 3NRJA 1CULC 3CZQA 3U4QA 1E9EA 3WGVA 3EWAA 4HUQA 3W5AA 1XMVA 2Z4SA 3K09A 3PV0A 1JI0A 3KXLA 3L5KA 2JGNA 1G7SA 4IG4A 1UPTA 3EW9A 2D06A 3Q7PA 4EDHA 2QENA 4JL8A 3QXHA 3FWYA 3PITA 5CB8A 4CGZA 3HYCA 4BEBA 1GUAA 5DH9A 3DZ8A 1OB5A 4AWXA 2XOKD 5AUNB 4ARZB 3FE2A 3FKSD 4ZKEA 4EPXA 4M9QA 3RYTC 4AS2A 4QOSA 3AP2A 4NBSA 3TR0A 4H9GA 4GL2A 4BASA 3HDTA 2WVJA 4JBXA 4UNSA 2CFSA 4HGOA 5BWMA 5FL7D 1JBKA 4UJ5A 3TUIC 2N1BA 3NBYC 2HX1A 2X2FA 3IUYA 3T5GA 4RZUA 1Z4LA 4TLEA 3PUWA 1TNDA 3TQFA 5ALRA 2CCJA 3NIBA 4KITB 1YZUA 1T8TA 1KO5A 3OEED 2KJQA 1Q3TA 3PR1A 1E79D 1G64A 2WMNB 1VKJA 3I5YA 1GM5A 2XZOA 3N70A 2AD1A 2F43B 3VFDA 4Q19A 2O5VA 1IN8A 1RRGA 1CF4A 3T1QA 1RVDA 5IDVA 2I7DA 2ZRBA 2OBBA 5DYGA 1AIPA 2EVWX 4E5UA 4B34A 3BOSA 4TQUS 1NIJA 1XJQA 5ALDA 4RZ2A 4RD6A 1ZM7A 1FEZA 2V1XA 4C30A 1G6HA 3VHLB 2QAJA 2B6HA 1F5NA 3R20A 4ZDIA 3WP0A 4DFDA 1IY1A 4XSGA 5DN6A 1X86B 4F4CA 3TVDA 4HAVA 1G8GA 4W5HA 2NOAA 4HDCA 1G1MA 5H1YA 3RS4A 2Q5EA 2H7VA 3AVUA 1KJWA 3I92A 3X2SA 4TSFD 1E1QA 2F1HA 1O03A 3QJYA 5AI5A 2QEQA 2XOKA 3H84A 2WM8A 1MH1A 4Q7KA 3PCRB 3GLFE 2HI0A 2YOFA 4BNDA 4F4IA 3C5CA 4URXR 2B7CA 2MU1A 4TYQA 3FPSA 4PHHA 5CK5A 1WVIA 4A0RA 4Y2XA 1J99A 4Q4JA 1W5SA 1UFQA 3JVVA 5EZ6B 1R0YA 3CF6R 3BH7A 3EZ6A 3K53A 5GJVC 4CEJB 1J2JA 3F9RA 3NG1A 4X8MA 2NO1A 3SYNA 3A8TA 4RD1A 3THXB 3K0SA 1R7RA 4BZPA 1TF5A 2OILA 3W3AA 2DBYA 3PUXA 2F7SA 3OIUA 4KHZA 5JJLA 2BCJQ 1TUEA 1N0WA 4O3MA 3EAQA 2QQ0A 1I4LD 3MC1A 1G8YA 1IN5A 4QJ3A 3L0PA 2YOHA 1XMIA 3CNLA 1Z83A 2FPXA 2NPIA 2QROA 1E9AA 3GQBA 3I1FA 4C0BA 2HF9A 4LBVA 2PLFA 4US1R 5FR2A 5ELXA 2HSZA 3WK8A 1XCMA 2RGGA 2IL1A 3KL4A 1IJEA 3SOPA 3U3RA 1Z2CA 4LBZA 4JLBA 2OUKA 2G9NA 1FNMA 3OCWA 3MPOA 4P4SA 1ZRNA 4PPFA 3MCAA 4J0QA 5FUVA 2HHLA 2QI9C 1VIYA 2PCJA 1L7VC 2YINC 1ZYUA 1G21E 1XEXB 2O52A 4TSFA 1E1QD 5E7MA 5LBIA 4AIIA 2IS1A 2GTPA 4GMXA 4CDGA 1J97A 5AM1A 2EQBA 2JARA 1OJLA 2ZAOA 3L8ZA 4A0FA 2ORVA 1W2HA 2HEIA 4KJZA 4AKEA 4UW9A 2J9RA 3DKVA 4DUGA 3GLIE 2RHMA 3KKQA 3U7HB 1Z88A 4XTRA 4DDVA 3W34A 1ZBDA 4I1UA 4O2RA 4LJ5A 3EPJA 5AJXA 4BLOA 3ET4A 2MMCA 4LV8B 1SKQA 4QG7A 3DDHA 4DLZA 2CE2X 3U4QB 2IEYA 5L3RA 1VCOA 2YWEA 3B1XA 2KB0A 4M21A 4XTCS 4HUQB 2NO0A 1O3YA 5J47A 2NYVA 4NABA 2GKSA 1XTIA 3N5CA 3B13B 3BK7A 3DM5A 4C4PA 4DSTA 4ILEA 4BUJA 4MDEA 3I62A 1CS4C 4B73A 2F9MA 1KK2A 2C78A 4C0KA 4LHYA 4NMMA 4OK6A 2FFHA 4D0LB 1NMYA 4PX9A 4ARZA 4A36A 2HLDA 1DAIA 2HF2A 3PVSA 2Z6VA 3EASA 3PXGA 2VA8A 2JJ1A 1NN3A 4IDOA 3I32A 3DV9A 1RJ9B 4GIBA 1FP7A 1OIXA 4XIGS 3WMEA 2A5GA 2WWWA 1YR8A 5CYOA 4Q18A 2WICA 3WMFA 821PA 4ZEXA 1NBME 3M9LA 2B92A 3UANA 2A3RA 4WZ6A 5ALOA 2KWIA 3THOA 4DWJA 2BBSA 1G4UR 4I81A 3B9PA 1T0JB 1VYVA 2P6NA 1AQYA 1NIPA 1FTSA 2CK3A 2GVZC 1ZIOA 3KOOA 5AI9A 4G5QA 1H8HA 1MABA 1EXMA 1JXOA 3BXZA 1F2TA 4EJSB 4B44A 1RLMA 2F43A 2AGVA 3IPYA 3KUCA 2ZRNA 1YS9A 2BMFA 2A5JA 5DHFA 1SKYE 3QPWA 4RFSA 3I76A 2RARA 3NASA 3R7WA 4OQNA 4BPBA 2FSGA 2WF6A 2AMYA 4ZO4A 1GNRA 3CR7A 2PX3A 1UKEA 4JBWA 1RLTA 1VJ5A 3CONA 3BIFA 3U3MA 4DDTA 4KV9A 4Y3UA 3MG9A 3KB1A 2R8RA 4PZLA 4KFSA 4WIAA 4BLRA 1L2TA 1CR6A 2WJYA 3R9KA 1UBCA 1HT1E 2WKPA 3WK5A 3LO5A 3UATA 4FMCF 5FPSA 4C0HA 2P6RA 1DBSA 4EX7A 5JCPA 5A4JA 4BFWA 3KD3A 4Q4JB 4A0HA 1XP8A 2X4DA 1XNJA 1X3SA 4GOXA 1XJCA 1Z6GA 3UKDA 3KFVA 4MGYR 1M6NA 1JXMA 2XSZA 2FA9A 5J5CA 5FOVA 4PC1A 3U7EB 3B8EA 2F6RA 2JLRA 2PZFA 2W58A 5LB4A 4NCHA 4DVGA 5ALWA 5ALVA 1L7NA 2GCPA 1XPUA 1VPLA 1TE2A 3IQXA 3I3SR 2C03A 3ZVRA 1SHZA 3DZDA 4G3XA 5JHHB 3L0SA 3CPEA 3ASYA 3MFYA 3JZMA 1MO4A 1OKKD 3MAAC 3QENA 4IW3B 1F5SA 1YMQA 3H1TA 2IS2A 1NVXQ 2HEGA 1TEXA 5E95A 2PZEA 1TUIA 3AVOA 3VR5A 5E0OA 2OSBA 4OHWA 4CVNA 3W6NA 1SHKA 2IYZA 1R0ZA 4C0LA 2R6AA 1XEXA 3CZPA 3MD0A 4QBIA 4MKIA 3RHFA 1XCPA 3ICQB 3BS4A 2WSSA 2VP6A 2BBOA 4I99A 2D3WA 2GK6A 1X42A 3CWQA 5AVQA 1T5TA 4QHYA 3C4JA 4TL6A 5AJWA 3F5FA 1PLLA 5DIFA 5AW1A 3FHTA 1E9CA 3D8BA 1E0JA 5J40A 4JVLA 4GZMA 2GHQA 4A2QA 4XPZA 3WNBA 5DHAA 3SHFA 1XEWY 1YR6A 3ED5A 1NG9A 5AR1A 3QXGA 3QLEA 2EFHB 4MKHA 3AVWA 2R65A 4JVNA 3SN6A 3ZI4A 4XSHA 2R62A 2AKYA 4TTPA 1VCIA 4C3ZA 4HAIA 1J8YF 2N42A 1UJ2A 1U0HC 5CIQA 3TR5A 3KC2A 1U94A 4NYIQ 5L8VA 4PPQA 2YMMA 1TTTA 2W2TA 3LA6A 2HF8A 1N5JA 2BBTA 3M0EA 4I1VA 1LFDB 2ZUBA 3BB3A 3IIKA 4UAUA 2F1RA 3SKYA 3T5DA 2AL7A 4A4DA 4TT3D 4HGPA 3AKYA 1KAGA 1RJ9A 2R9VA 3IHLA 1LW7A 3PEVA 2A5YB 2L0XA 4CRWB 1LNZA 1RKQA 4GOKA 3LLMA 5KPJA 1II0A 3UMSA 1OE0A 5DYIA 3P1JA 1QHGA 2FEOA 4FMCB 1TJ3A 4M1WA 5G3YA 2G09A 3SF0A 1P2SA 2J5XA 2PKEA 3QUTA 3Q85A 5G3ZA 2IF0A 2XJ4A 4IEIA 2GEUA 3VR1A 3KQUA 1OXSC 3B9BA 1PUJA 2B1QA 1CQZA 1MABB 5JWRA 1RMQA 4C7OB 1F2TB 3LBNA 4LHXA 4EJSA 4Y2TA 5ALNA 1Z5ZA 2BCGY 3OF5A 1MT0A 2IUSA 1TF7A 3LVRE 1AZSC 3OIVA 3WYGA 2QORA 1S2OA 4NH0A 4DSUA 2IX3A 1VMAA 1Z28A 2V9PA 4HLQB 4DWOA 2G1JA 3DO6A 4RFSB 4E22A 3MLEA 2Q9BA 4HZUA 2DWPA 3R7WB 2DYKA 1O87A 4KN8A 4QQFA 4BYGA 3N28A 3EIHA 1E9DA 1HYQA 1BH2A 1M2OB 3ZIAA 3HPQA 1T91A 4U5XA 1HQYE 2Q0HA 2Q21A 2YWHA 3F8TA 1Q92A 2P69A 5BXQC 5AW5A 4IVPA 2ONJA 2C8KA 5ALGA 2C8VA 5BYJA 2UKDA 3DPUA 2NO4A 4BRWA 1Z6TA 4TQ9A 2Z0MA 2ZJ5A 2XTMA 4NPHA 4A15A 3IEVA 1RYFA 2GBLA 2OEPA 1VG1A 4JS0A 4A8JA 4DLVA 1NLZA 1Z63A 2WBLC 3HU3A 3ZUPA 1TEVA 4PC2A 4LZZA 1TAGA 4URYR 1VCNA 1EGAA 3E84A 1KSHA 4OI4A 1G291 3WKAA 4EX6A 1ZMXA
chains in the Genus database with same CATH superfamily
2GEJA 2R8EA 2NXJA 1PKXA 4WCFC 4IVRA 4FXOA 4Q03A 3ZV5A 3IQWA 4HLUC 3CRW1 2RB5A 5FV7A 4UDOA 3RSSA 4B45A 3ZCVA 3FOCA 3RF6A 4DV5B 4OSOA 4PG6A 2JAQA 1IC6A 4ZVVA 5D00A 1L7BA 4DPMA 2DX7A 1UP4A 1NW7A 4L5JA 4MV5A 5F3WB 1DAGA 3C15C 4MITA 4UNRA 4UCWA 4IG9A 1HM5A 2JCYA 2ZJBA 2J9XB 1KRWA 1QG6A 1Y1RA 1CFJA 3ORQA 4TTQA 3WHLA 3RKUA 2WJWA 1ITZA 1GL7A 1Y9JA 1Z7YA 2F9LA 2HOQA 4NCXA 1A4XA 3FZQA 3GFTA 1OV4A 1QE0A 5JO9A 5SYNA 3H65A 2DOKA 1P2TA 3VYUB 5KSOA 4MVJG 3TCNA 1TJYA 1BKDR 2Z6AA 4YX9A 2A9KA 3FIUA 3K9QO 1X9HA 2BELA 4UNIA 1ZUD1 3O84A 5CEEA 3DYBA 4M0EA 3UPTA 1IEVA 1L3BA 2BM1A 4JR1A 5KMGA 2JI9A 2ZR8A 1DCKA 2XZPA 4WCDA 1T6ZA 2CNDA 1V1MA 1W4BA 3C3BA 3L8GA 1XZBA 5IVKA 1TLTA 5KWEA 2PH3A 2VT2A 4PLYA 3L7LA 3DAFA 4H3HB 1Z18A 2ZE7A 3IOCA 1D2CA 4IRXA 4WECA 1M1UA 2IX9A 1GNVA 3KJFA 4XB6B 1MAAA 4OJMX 4TV9A 4CKBB 3HY3A 1QHFA 4WL0A 5CFQA 1P7CA 4N0MA 5T6BA 4NHOA 1NR5A 2G88A 3W8EA 1DXHA 3WLTA 3LL4A 4S0ZA 4G86A 5KC9A 3OZBA 4OUDA 4P4UA 3A14A 3KHUA 3FDFA 3KQWA 3QE3A 4HMQA 5TGZA 2R2GA 4ZHQA 1IZ9A 1N7JA 2CUNA 3NDRA 2IU0A 5H8WA 4C7MA 3DDOA 3V8VA 2MIIA 3GLHE 1WVGA 3HNRA 2VSOA 1SCJA 1M34E 3H5NA 3K1JA 5BMVA 2J33A 1TOAA 3KHKA 3Q3VA 2QLMA 1VECA 4IH9A 4OI2A 4JX8A 1L7PA 2GS9A 3U5ZB 1EX1A 1ZITA 2EP5A 2YMPA 1JLMA 1XZAA 2X8AA 3S1AB 4E5MA 1BYIA 2DERA 5AM5A 4UBKA 5JALA 4RKRA 3M5WA 5C5IA 1A9XA 3C6YA 2BMDA 1GA1A 1Y3BE 5JCJA 4TM8A 2E6KA 4RM3A 2H57A 5HIIA 1U9JA 1QHIA 3WAGA 5F98A 1CDOA 4LXIA 1A8UA 4NEQA 1TQDA 5TX7A 2JIMA 2PANA 3EXEB 3ILYA 1KAEA 1G17A 3OTIA 3N39C 3O74A 4TMTA 3ZBTA 1J6UA 2FUNB 2HK8A 1T6XA 2H16A 2QU7A 2ZP1A 4OFZA 5AH0A 4LEIA 1A04A 3RJ5A 4BE9A 2GFQA 4C7OA 4RQTA 1E5TA 4N8DA 3DXYA 4AG5A 2BRUA 5LXTF 4BIMA 3FLBA 1OVGA 3PZBA 5AXBA 1MRZA 1G5TA 1RQLA 3PPWA 1BU8A 4KIWA 3S1LA 3KLMX 4AN4A 4YV1A 5KYYB 2RK4A 1GN8A 3ZGYA 2JH3A 2Q3HA 5AKIA 1CC1S 4HZUB 4CF4A 5DNYB 3L0BA 4MS4B 1V9LA 2M1ZA 1LPAB 3BZUA 3RVDA 1HG0A 3IDQA 2CHEA 4W5TA 1W8IA 2FFQA 2QRLA 3P9NA 2J3IA 5GONA 3JQAD 3H8VA 3RIEA 1WZIA 1Y6JA 2YY6A 3NUGA 1ORTA 3JD1A 3TWOA 2ON6A 4M9XA 1H5UA 5GJBA 4MVJI 5EQTA 4Z0TA 1P3Y1 4U2DA 1ADBA 5BXYA 4GX1A 2WFLA 4WXPA 3DMRA 4AZSA 3U7FB 2XCOA 1E60A 2FWAA 4TX1A 4A8JB 3OLXA 2IKSA 2Q2NA 2BGGA 1Y37A 4UM5A 1EI9A 5DIZA 4K26A 5EEGA 4E15A 3M5PA 4GPEA 1NRJB 4R6WA 1ILEA 2ENUA 1QHSA 3PXEA 4FBLA 3IQDB 3SXUB 2AOWA 5JXHA 4GKKB 3V8RA 4UJ3A 2UUOA 3H18A 3LCRA 3D64A 3TYXA 5CLFA 2CSXA 2FZ5A 2ZAIA 3A1WA 4EFMA 5JPIA 3CF0A 4EY6A 2C2WA 3LCUA 3O03A 4D4LA 2QZPA 1ZA1A 5A5FA 4HWTA 5KQGA 1SXQA 2IHNA 3GLGB 2FTKE 3KBBA 1SUIA 4U3JA 4ZP1A 3W77A 4EPWA 1RRCA 1K7FB 3ZD7A 5HKAA 3ORSA 1GT91 4EI9A 5EERA 3CPJB 3TW8B 3ZX5A 1EUZA 3OIYA 3DTVD 3R9XB 2HJRA 2VK8A 1AKYA 2A9PA 1BEZA 1RAIA 2J85A 4N6OA 3C7AA 3RROA 2YNMA 3HG7A 5ECDA 3DO8A 4WKPA 5JSYA 1NHWA 4XCXA 1VCMA 3G7UA 4IO1A 2REQA 3KQNA 2G71A 2B82A 1KZ7B 3U31A 3C2QA 2XNHA 4CLHA 4FDLA 4BWGA 5ICCA 5AVVA 3FAZA 1RD4A 3KZOA 2Z6QA 5IJWA 1CUIA 1ZJ5A 1JHXA 2K87A 2W8BB 4OHYA 2NO7A 2WQ6A 3RIXA 1F0KA 2YZ2A 4RS4A 3OMWA 4JLVA 4XPIA 5DCLA 1E7QA 3C74A 2QTWB 1NLMA 3RG8A 4D9HA 1JR3D 3WLKX 1B4DA 2FQYA 4F5YA 1ND5A 2QLNA 4U2GA 4G0PA 3G59A 3LI2A 2B83A 4JB2A 2AN4A 4AKTA 1NN1A 5T3YA 2Q9AA 4Q9NA 2VJAA 1W9MA 2X40A 3PT9A 5B5SA 1I3NA 2XUHA 3S8MA 1FX0A 3I83A 1VYHA 2DECA 2PUTA 1K86A 4Y2UA 5IUKC 4A8PA 2C8JA 4KPYA 1GNTA 3NX4A 1Z6YA 4PZDA 3HR4A 4AZVA 4CHTA 3LTNC 3DD1A 2YNMC 5A6SA 3MWEA 1O95A 4KCGA 1WB9A 4NCBA 5FBRB 1ZD9A 3OCXA 3FNBA 4DKXA 2XUDA 3CLSD 2QIPA 1Y1SA 2QPOA 5DISB 4E6PA 3BBLA 4NWIA 1EUQA 3EZ9A 1ZGZA 5LNK1 3HUUA 2CJPA 1C3OB 3WGHA 1LSUA 1CLUA 2ZJ1A 4EG6A 1P72A 4CLRA 1SVNA 2FUG1 3LPDA 1AD2A 4YROA 1R8YA 2VYVA 4I55F 2MYTA 1U4OA 4IJWA 5LYJB 3IVRA 3RYFB 1SPBS 3FVRA 5BSTA 4R1LA 4X1OA 2FJ0A 2UU9B 4J0HA 4TGLA 2PMWB 4QSHA 5H70A 3HKBA 3JQQA 5TGTA 3RUDA 5L4SA 1UZNA 3IODA 4DC0A 5GJWC 3TECE 5DB4A 4R1TA 5KU7A 3DMFA 1T2DA 2NU7B 1YZ3A 3K0CC 4ZT6A 4G85A 1JPVA 1RC0A 3F7MA 3GYBA 3SZGA 1UZLA 3CRQA 2G40A 1QH1B 3GEEA 3OPYA 3OG9A 4YRGA 4QOHA 3KQHA 2X14A 3DLIA 1MEJA 1DAKA 3U0VA 1Y8RB 4ENPA 1AA6A 3NT5A 5TDHA 4NBNA 1SC3A 5JNVA 4ME6A 4UOZA 4D3YA 1Z74A 3Q9UA 2O2ZA 1WHTA 2WWVD 4ESHA 3UH0A 2IOQA 5JZBA 4W9MC 2RE8A 1H8ED 3FCXA 1TB4A 2D59A 2FDCA 2FH5B 1WQ3A 2ZUSA 1ZVKA 1JG2A 5ESDA 3OQMA 3MJRA 3AH8A 1AM4D 3F7OA 3MF4A 1SHUX 2OFXA 1L8AA 2I4NA 3ND9A 4KVAA 4PYOA 1CTQA 1RRVA 4EKIA 2VTVA 3PFKA 1MC5A 1DT5A 4WLUA 4G4GA 4PFKA 3DP9A 2R8PA 3WGUA 1D6SA 2GN4A 3UTCA 3FR8A 1Z7BA 2I4LA 4JYMA 2I8CA 2X3UA 3MW8A 3X43A 1UXIA 1ZJZA 1AGNA 3HA2A 4LRUA 1WY5A 5AVRA 3OCYA 4I5EA 2YN2A 3KKNA 2WF5A 3EVTA 1KQPA 3E7FA 4JT4A 5ENDA 3UAWA 1UXGA 1ZLXA 4Q4LA 2AXPA 4YRCA 1KJ9A 3F3KA 3QHAA 2ZR9A 1Y8QB 3HYSA 4XB1A 3ASUA 1FLDA 3SJAA 1USGA 1Y42X 2HU5A 4O5OA 3B89A 2X0JA 4ZYUA 2AR9A 4M38A 3GJTA 4JLPA 1XQYA 4JITA 1FXSA 1OBHA 3AEKA 1FRQA 2FRXA 2JC3A 4LV6A 3V9PA 4REQB 3U60B 1VLZA 2OK8A 4M99A 2C2HA 2XWBF 3RASA 4XFKA 4KR6A 4C0AC 5BORA 3T9FA 1DG3A 3RIMA 4BO9A 3D1JA 5J4LA 1OH5A 5AJHA 1DIBA 1G9XA 1H69A 4MQMA 5TMEA 1XT6A 3R3ZA 5J58A 3P27A 4I4IA 3SE0A 4RTRA 3EDOA 1HDIA 1YRAA 2AC7A 1UKAA 4LQ4A 1ZNZA 3QBJA 3VKGA 1E66A 4BGDA 3TNFA 5KOYA 2WUVA 4JDUA 2F4NA 4K86A 3JRNA 1OFUA 1H2XA 2KE5A 3F5QA 2PMCA 4YC7A 2P1RA 4J29A 4DUPA 1KY3A 3GA7A 4EQ6A 2V97A 3G2QA 4OU4A 2HQ1A 4GOJA 2OA0A 4Q6WA 2NT4A 2J0VA 1FTGA 3PK0A 4QXMA 1R6UA 1Y1TA 2VJMB 3M4YA 3PR2B 1Z29A 3CEMA 1CERA 2LCIA 4FLEA 4D4JA 4LMAA 1VSUA 2IHBA 2E6UX 2LKCA 2Q1SA 5JDCA 4P2GA 4H1WA 4DR5B 1TECE 4OHXA 4DUYB 5L3QA 1ECJA 1DZIA 1E6EA 1ESNA 2I03A 2Q50A 1EX9A 3N05A 2RC5A 4TKMA 3EODA 4NL4H 2H92A 1SUBA 2HDOA 3ESRA 5CNIA 2C0PA 5DHRA 1NHGA 4AF7A 5A3JA 3BA1A 3QPUA 2JLBA 3PUJA 4BFXA 2ZS8A 1FP4B 4PZZA 3ZW7A 1CX9B 5K8CA 3PUHA 3PF8A 3O95A 4D8UA 1WA5A 3GFOA 3BHIA 8OHMA 2XZLA 1JUDA 1LB1B 4HDAA 2B4KA 4FFOA 1U2ZA 2QQEA 1NPYA 3QVKA 4EG0A 5IYZA 4JSTA 4TN1A 3I61A 2YKGA 1OIWA 3V2GA 2HJ9A 1R18A 3E8MA 3I1JA 1T6YA 1BGXT 2F64A 2VPIA 3ETDA 2FWIA 2QTFA 3L6RA 3N8GA 4Q3EA 4WA7A 4PN3A 1YH3A 3VR4A 1MJHA 1LQTA 3EC2A 5EP1A 4ROTA 1N6RA 1V11A 4KREA 4K3UA 4MTCA 3ISVA 2O8DB 4F84A 1P9OA 2CHGA 2W11A 5F1KA 1FXWA 2X8JB 3DTYA 3N74A 1OAOA 4HSEA 1LPSA 5ICFA 3SSMA 4Y2SA 2FZWA 3QELB 3EQ6A 1TRKA 4MYHA 3WL3A 5JRDS 1BWQA 3V97A 4MRMA 1HG1A 4Z9XA 2H5JA 3FTNA 4R2LA 4NENB 1TM3E 2BHSA 1NDQA 2DSNA 4OOEA 2OMKA 3GJ5A 1GSHA 2YYSA 2J6CA 3CRMA 1SH7A 1CJTC 4MB2A 1KO8A 3SFVA 5HZKA 2AFIE 3EWIA 3ZHUA 4V1CA 2OGSA 2QL6A 4XD7D 1C1YA 4PGGA 4AY6A 2ZAYA 4P54A 3KQPA 4O02B 2H52A 2D1FA 3FUTA 2SKCA 2PGLA 4GOND 4MW6A 2PZAA 3FD8A 2D3TA 2V6MA 2VDWA 4G8BA 4TWRA 3DCNA 4TTIA 5CP8A 4DCGA 3I6MA 1SKUA 3PWZA 2YC4C 5BSGA 4OHVA 3UT0A 3ZHCA 2HLDD 4CMEC 1U7PA 3ZWWA 3LUAA 1UQRA 1IWPB 1IHUA 3KE9A 4FFPA 4CU2A 1DO8A 5T67A 3UGQA 3QYPA 4GP6A 3G9UA 2XB4A 3HRKA 1A5ZA 4O4LB 3K1AA 1GU1A 4OBWA 4R8VA 3UOWA 1CY1A 1U9ZA 4DCSA 1ADFA 2CDBA 4DNOA 1YFLA 3CNQS 5AM2A 1E5DA 1ORWA 3DHEA 1E92A 3RTEA 1NA5A 5H9VA 3UK2A 3VU1A 3GLFB 3KZKA 4JOBA 2YJZA 2I54A 3CLHA 3VZQA 3DZBA 2Q4TA 3QNUA 1YRHA 5ESRA 1S3GA 3JVIA 5K4GA 4HH4A 1X7YB 1DC4A 4L1KA 1IU9A 4H1UA 4UXHA 4HAOA 4OREX 3VKUA 3AIMA 1EQAA 1JSCA 4DBZA 1ZRMA 2V65A 2VLIA 3JZIA 2Y1CA 1JALA 2X4GA 4XIJA 4QBKA 4LSMA 1CDDA 1PJTA 1KPIA 4FHGA 3U0BA 2ZWAA 5C52B 1SKYB 2R6JA 1ABEA 2PKQO 3RAFC 3DVLA 4R1SA 1AV7A 3B36A 1CNMA 3QU5A 1VP3A 3QF7A 4L9SA 2X9NA 2CHQA 4CL8A 1BN7A 1XDZA 2FEWB 2Y66A 2CVOA 3L07A 4GXNA 1GGMA 4JB0A 4R05A 4U7PB 4C06A 3G6KA 3N7TA 1DADA 3QI2A 5CMLA 4HDKA 5DSXA 1GQQA 1KOFA 4ALJA 1Q0UA 1FVHA 1X70A 1YDMA 3ME5A 2CD7A 4ZCRA 1JIKA 2NUAA 1C2TA 2PUCA 2DFPA 4X7BA 3KAQA 2NV0A 3AERA 2YUIA 3P2MA 5DCYA 4CUKA 1IN1A 3UICA 3PVCA 2VZ9A 3QVMA 2OCGA 2ZS9A 3U7QA 3GDGA 3JQDA 4U2FA 3RS7A 1RPZA 3ZQUA 3CQ9A 3HCEA 1KI6A 1W4LA 1YR9A 3IL2A 3KKOA 4DDHA 2V7VA 3QEBZ 2RGRA 2E89A 4YAGA 4Q00A 1UT8A 1YA8A 4HX2A 1LBIA 1MZVA 1PQWA 1V1RB 4M53A 4HMPA 2DLNA 3LD9A 4XGIA 3K0FA 3NJ8A 2ODWA 5REQA 3DUFA 4BJ3A 4CMHA 3R0QA 1RLJA 1KOJA 1QC5B 3H11A 1AHHA 4LRYA 2JD1A 3F6PA 4V24A 4IDNA 2YICA 3FPEA 4R68A 4QATA 4ENRA 3HWWA 4URWR 4JT9A 5EL0A 2NZYA 1AHPA 1I4DD 2VHUA 3UOGA 3AIOA 5AUQA 4RE5A 3KKMA 5H68A 4DT1A 1RWWA 1M2FA 3NQ41 5JSHA 1UJBA 3AEZA 2WIGA 3DOFA 4E33A 1AMNA 4ZRNA 1V7ZA 4QWWA 3QFFA 1V5FA 1H0KA 1RAEA 3W79A 3P0HA 5KEIA 2OV6A 3SY8A 2P9ZA 2ZBGA 1YBMA 2XRFA 1YB4A 3GG9A 4P4NA 1CLEA 5G4KB 2C9MA 5IAGA 2VDVE 4AB1A 1B14A 1SXHA 3GUCA 3K9LA 4FX2A 4RF5A 1SCUB 4BBJA 2ZSKA 1J2EA 1G21A 1YZGA 2JFNA 2ZK7A 3Q8XB 1GCOA 1B74A 1EFLA 4D5GA 3LCJA 1Z0KA 2WIDA 1E4EB 3I9LA 1IONA 1RJGA 2I6FA 2ZAGA 3EGXA 4FSXA 2WILA 3MMZA 3RQIA 1FQJA 2WWRA 1T4MA 4JSYA 3QIAA 1B16A 2UVQA 3VYTB 2J8ZA 1BWRA 1JEQB 1Z45A 3MT8A 3OA0A 4MVJA 3W3ZB 3W8NA 4RJJA 4HB0A 4P7GA 4I0WB 4M60A 4YWJA 1D8TA 3DQPA 1Y7TA 1QS0B 4FGUA 4XX1A 3O93A 1AGRA 5G0SA 4ZK2A 6YASA 5AVTA 3MBOA 2HMVA 4RSRA 3LT4A 1SBQA 2EGHA 3P0JA 2Q0QA 5HZMA 3KCNA 3KQTA 2R00A 4QD3A 4RPJA 5A9RA 1DHTA 1FW8A 3WB2A 3QE0A 1ZVMA 4AUMA 2CMFA 1OWLA 4MV4A 3Q9LA 4CMBA 1EPUA 1U5BB 2C5AA 2NZ2A 1GZ6A 3I4LA 5ALSA 5IK2D 4DV1B 5HZHA 1DP4A 4IYRA 4H15A 4LF8B 2H9AA 3AM4A 4CEIA 1ZFNA 5CDTA 3RS9A 3Q7IA 3FNRA 4LTNA 4NOMA 3NAGA 2P6UA 3PD1A 4K2HA 4F93B 1AKNA 2OC9A 1U3TA 4G81A 1G5PA 4QQRA 3SFZA 5BURA 1NNEA 3N75A 1K9VF 1NUPA 1C1XB 2P2GA 1JHYA 2PLAA 5T8KA 3MIZA 4NJEB 3CLSC 2J3HA 3ZE6A 1F6BA 2A94A 1BMTA 1RRPA 3GN1A 3RM3A 5P21A 1QRAA 4DIFA 2RGNC 2IWRA 4BVHA 1Y7LA 3TD2A 4ZZIA 3ADCA 3SU8A 4ALIA 1COWA 2NV6A 3WFJA 5EKUA 1M2HA 4ZAYA 3V4FA 3R5FA 2VH1A 1QONA 2WZQA 3O9ZA 4DM3A 4XLTA 4TMYA 2OBLA 1JDSA 2QLBA 2Y2VA 4XJXA 1UDRA 2MT9A 5E4JA 1K8QA 4CL3A 3LOPA 1Z2OX 1XMXA 2C4MA 1MG5A 2QK4A 3D0OA 1XCJA 3WXMA 1L5HA 4B3MB 4Q1AA 2LW7A 5ALMA 2PKQP 1PR3A 1J33A 4GYYA 3GGCA 4PC3A 5CXXA 1OA0A 4ZXFA 4CW7A 4J0CA 3DL7A 3O2QB 1FJ2A 1U7HA 1L5RA 2PWPA 3AK4A 3RSLA 2A4MA 2P4EA 1KMIY 1FP1D 1J00A 3UK0A 5AUOB 4RV9A 2DCUA 1OBOA 1WXEA 4G5HA 4RHUA 1EYZA 3ZWBA 4BFYA 3C85A 3PXCX 1GL9B 1DAHA 4GZ6A 3J7AC 3JALB 2UZ1B 2JLXA 4OB8A 2YQZA 4LDNA 5A9SB 3IERA 3ILVA 4B32A 1S2NA 1JAZA 3MUOA 2JL1A 2F1KA 3LZCA 4EO4A 1VBKA 5B4VA 5KPDA 2HA6A 4EM6A 1JR6A 1Z8NA 4MW4A 4GICA 3ZWKA 4ROSA 2C1XA 3KBOA 1ZAKA 5LJLA 3AJDA 3NWEA 4EA7A 1AMUA 3Q7EA 2AMLA 1PD1A 3I39X 4QU0A 4EMSA 4YMTA 4L5BA 1A69A 1FIUA 5KQSA 4HGQA 4EJFA 4HS4A 4RZXA 4RHFA 3RUEA 4M1KA 4MJLA 4FM9A 1XWIA 3KKPA 2IZ0A 3FWZA 3P0RA 2ZBDA 3GNQA 1EFPB 3O4HA 3ZUGA 2H8KA 1XVUA 3SSOA 3ZU6A 1IG3A 5AW0A 1NF9A 2OBFA 3CCCA 4I1RA 3VPFA 4JWKA 2GJ8A 2PL3A 5F76A 2CE7A 2IHKA 1ZH8A 2LIVA 3MQ4A 3L3BA 4HDQB 2W6PA 1P1CA 4UBIA 1D07A 3DDNA 4TXJA 4DW8A 1RKVA 5IC4A 2P4QA 3WLPA 4EHAA 1J0BA 4OKSA 1JQLB 1KEVA 1C8KA 1PP4A 1NY5A 4JMLA 5FULA 4KLZA 4MQ5A 2QUZA 4BLQA 1BDMA 2DFDA 1PWHA 2W2KA 2ZSBA 4IOKA 1ACLA 4ANFA 4BE4A 4GF5A 1BW9B 3AKEA 5JHGB 5JI2E 1ZH4A 2P3OA 1II8A 4A9AA 4YV2A 4O59O 1W93A 5AOBA 1U8YA 4JBHA 2X1VA 1T26A 5JY1A 4Q12A 4E2ZA 4C3VA 4UE3S 1CQXA 1QWSA 4QTZA 2G8LA 3FOEC 4QG3A 1R9GA 2W93A 4II3A 3SJUA 3NI2A 3LDGA 4MWDA 2DHEA 1FYFA 1XDGA 1E6UA 5JAZA 1QKJA 1P2FA 1ZJ4A 3JSXA 3IT2A 1SBCA 3AP3A 5HKLA 4D9EA 3ELYA 1N5MA 1G41A 3D7RA 1EK0A 1IAVA 3PTZA 1KAQA 1RWKA 1RRMA 1C7IA 1THZA 4Z6KA 2IZ5A 4EVRA 2R44A 3O26A 4KLNA 5LQRA 3KETA 4R8KA 1LJLA 2JI7A 3PUZA 3DFIA 1Y3AA 2HSJA 5BV2P 1P0FA 2AKAB 3OWXA 3MILA 3FTEA 2VDKB 4QXQA 2VPYA 3I2JA 2GLUA 5G2OA 1X6VA 3TTVA 5A02A 4WZZA 5KYGA 1XZEA 2B8WA 3AUKA 1IBSA 3AKCA 3MRXA 3ANTA 3AU9A 3KVRA 2RBKA 4TSRA 4UCQA 3T7TA 3ZY3A 5JCZA 1UFRA 2ZI4A 2WSBA 1DJOA 2OBXA 5T3UA 3PGVA 1S1MA 1SFRA 1PJQA 1PZFA 2PR2A 2WZDA 3HYRA 3P2JA 4G0OA 5FI3A 1A7JA 4DMLA 4GOOD 4AJ4A 2XQVA 4D4GA 5DN6D 1B7GO 1JWAB 4K6GA 1DBQA 5JNLA 2G08A 2I6GA 1WZ2A 1SAYA 2BUAA 2EEPA 4L7VA 4G2NA 2X9QA 4EY8A 3H1EA 1P8JA 4CDMA 4R9UC 2L82A 3RC7A 4GPBA 4URFA 5B58T 4ER3A 5C2JB 2PBLA 4M0PA 3THWB 5J43A 1SO8A 1DFGA 5LQCA 1EH5A 1PBNA 3PIIA 2FUKA 4MKXA 5E6SA 4YJ2A 2MSNA 2FWPA 4CKCB 3CEAA 3TMYA 1NBAA 2IYUA 2E87A 4MYCA 5KTSA 4PHTA 4N1AA 3NHUA 3HU5A 4C14A 4RIIA 4FFLA 1Q17A 1B0AA 4HAUA 2ZRFA 3OOWA 2I3BA 1Q1QA 2HCTA 2BFOA 2JVIA 5DSZA 2LKDA 5EHNA 2Z08A 2I22A 4GLJA 4HV4A 3TW4A 4D74A 4ZI2A 3B52X 3X1ZA 4JEIA 4E7OA 5JJCA 1XZ8A 1BS1A 4XQ0A 2QRMA 4MK4A 1VI5A 3T1NA 3UVEA 3ABZA 2LRHA 4URZR 1D9ZA 3ICPA 5IJZA 4WAUA 1XZKA 1TK3A 1DAFA 4NPCA 3TIGA 5CB6A 3X1JA 5TQVA 5K2MA 2P4UA 3SWWA 4Y2YA 3NEJA 3GXBA 4OH1A 4L3VA 1RAHA 5TVGA 3SNHA 4E07A 5FPYA 2XUAA 1M72A 1WBBA 2Z3ZA 2QUKA 2Y1KA 3ZZNA 1XEAA 1E2GA 2CHFA 3WLQA 1KFCB 5FTMA 2F8TA 4A6PA 4AY3A 1P91A 2XWJI 2R6ZA 4DJ5X 4IZIA 5KYUA 3ZWVA 1FTQA 4JI3B 2AQHA 1BA3A 3CSUA 4HN2A 3ZV7A 2BY4A 1XKTA 3F2VA 3GNTA 3NTOA 3RS8A 2QYHA 3LUFA 3LYLA 5DI9A 2OKGA 4UTPA 4G56A 3AW8A 1KKLA 2EW1A 2O1EA 3M3PA 2OHHA 3UB3A 4QJIA 2R00C 3PHCA 2WYWA 3GROA 2XDYA 3VPHA 2JDID 4G5FA 2G5CA 3HU2A 2Y27A 3LUGA 4EGJA 2H2GA 4DYDA 2QMUA 2IIVA 1BN6A 4HQNA 1SBHA 4WNAA 3JARA 2VIIA 2EG9A 1FL9A 4PQEA 2PV7A 3WIVA 3Q88A 1AOXA 1ISFA 5D5PA 2AFHB 4CJXA 2WT9A 4YAJA 3ZIUA 2VC2B 2C1EA 2WDPA 2XIJA 2VI5A 3EDQA 3LQ2A 2EKZA 3M3HA 4IDPA 4YJHA 4Q7QA 1VFNA 2EZ9A 2OHFA 3ANMA 2Z6UA 4P0QB 5JH7A 3UIEA 3V1TC 3E0XA 1D7OA 1SUWA 3NHBA 1LDBA 2YJ3A 1WU8A 5JNUA 1CIPA 1HOTA 5JS8A 1XRJA 1GZVA 3CH5A 3IQFA 1W0JD 2Q28A 1MPTA 2ASEA 3C4QA 4OYHA 4DIEA 2PL9A 5AW7A 3TUZC 5LL6P 2IXEA 1PFYA 3LPMA 1F1BA 4LDRA 2WVHA 3GD7A 4MV3A 4DSOA 2F4VB 1OLSB 3GH1A 2VHQA 3TLZA 2HIGA 3VR3A 3W90A 3EDCA 4H2DA 1EDEA 3P9CA 3OT1A 1SURA 4PZUA 1QTNA 1NF2A 1TMGE 3NKLA 1UBEA 3GAFA 2H51A 1ORIA 4NSNA 2GBFA 2FZEA 2JJ1D 3QZUA 1CJMA 3UK7A 5AVSA 4ARAA 5H59A 2W5UA 4FW9A 4QT4A 3JRXA 4B6JA 1LF5A 1GPBA 1Z4KA 1V6SA 1WXFA 2C7VA 2HJVA 3L7KA 2GYVA 2D5BA 2KLBA 2PJZA 2C1ZA 5B3KA 1UEIA 5MHTA 3BDAA 3KPVA 4EENA 2QTLA 2YDXA 4RKFA 2J1LA 3WAJA 2IBMA 2XNDA 2HKIA 2YFKA 3SZLA 1OHHD 1TA0A 1T5HX 2J4FA 4XE5A 1X7XA 4RTKA 5I8ZA 4ETNA 4U63A 2YXDA 4JLDA 4MCJA 2JKZA 3HJFA 4LTMA 4QTYA 4RYLA 3UUWA 2F3TA 3SEQA 3K0CA 4Z3KA 1KAOA 5JMWA 1L4MA 3HR8A 3NRCA 4LIPD 1XNGA 3OZEA 1TVEA 2HNBA 5K03A 1AS3A 3ZV6A 5KVAA 2BSQA 2D2FA 3PLNA 2DHDA 3VNSA 1E1NA 4Z9FA 5I9IA 1OC4A 2GK4A 1F51E 3H6KA 1W4ZA 3GK3A 4I8IA 2WTXA 4TKUA 3WZMA 1ABBA 4R98A 1G59A 4UE2A 1FU8A 3NBQA 3E15A 4OQMA 4J9UE 3WJ1A 5K0BA 1J0DA 4UDXX 2B8NA 4BNMA