2IA5A

T4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
297
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMNGPYDLCDTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Polynucleotide kinase
publication title Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 93
structure length 297
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ia5A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ia5A02
5E7IA 3KQNA 3EZ2A 5ALJA 1X8LA 2QY9A 4Q1FA 3BE4A 3CLVA 3ESRA 1DG3A 1DAMA 3JVUA 2PH1A 4G01B 1YVDA 2GK7A 3GFPA 2QBYA 1X42A 1QZXA 1KSHA 2XSZA 3HYTA 1ZP6A 3Q9LA 1XCPA 2ZU6A 1VPLA 4Q1CA 1ZUIA 3WY9A 4TQUS 3A4LA 1GL7A 1P2VA 1VG0B 2WTUA 2VEDA 1IWOA 2WKPA 4XH9B 1N6OA 4B75A 4DCNA 4F38A 3AM1A 2WV9A 3ND9A 5L3QA 5IK2D 1OB5A 3CNLA 3CRQA 5KO2A 1T9HA 3VR5A 2AUTA 3VU9A 3RS3A 1U90A 4CEJB 1WRBA 3QPVA 3F0TA 4NKRA 2ZR7A 3KXLA 4EFNA 2FPKA 4O0MA 1RKVA 4CRWB 2IS2A 1TEVA 3J7TA 5ALRA 1Z4KA 3N5KA 2YNMA 4OQXA 3SBDA 2FSIA 2CJWB 3AVYA 3T1OA 3W5BA 4UAVA 4DLWA 1VDZA 5KSPA 1VFPA 3BIFA 1P5ZB 5FP0A 1E0KA 2FEMA 1W47A 2Z83A 1TA0A 2J46A 3ADBA 2BCJQ 3L8HA 1NRJB 4UMDA 1N25A 1NG9A 1ELOA 2A3RA 5ALOA 4D25A 1LB1B 3CR8A 5H70A 3PV0A 4HGNA 1E9AA 1WB9A 3EC1A 3OZXA 4C2TA 4JL8A 3I76A 4URYR 1OXXK 1GVNB 2UZ3A 4XIGS 4ZEWA 4CEJA 1D2EA 2W00A 3AF1A 4A2QA 1KJWA 1GKUB 1OKKD 1T0HB 2JATA 5ALEA 1RRGA 3PEVA 2QRZA 4K46A 1JJVA 2JDID 3ADCA 3TBKA 2QORA 1BMFA 4UQOA 3LBNA 2HXSA 4TWZA 3GJ8A 5KHOC 1CR2A 4LSGA 4V0OA 4TSFA 4M1TA 4E88A 1HTWA 3M6AA 2QL6A 2CK3A 4UNSA 1DO2A 2ZRBA 5H68A 1RDFA 4YH1A 1XMIA 3T1TA 1LVGA 4RD3A 4XPZA 3DZ8A 2WJVA 4LOAA 5ALHA 1R5BA 4B3GA 2FG5A 2GXAA 2ONJA 4M1SA 1DPFA 1N6IA 2NO1A 3PUZA 3P26A 1KYTA 2IOHA 5LDDC 4JBXA 4LHWA 1XTSA 1IOZA 2WHXA 1S8OA 5AW4A 3VAYA 2YJ5A 3DZDA 4HGRA 2IYUA 5C18A 2G3YA 3FKQA 5DE3A 3AVWA 4HZUB 3GLHE 4M1KA 4LYJA 2IWRA 4YGYA 4XE5A 3A1TA 2GVDC 4IFBA 4AS3A 4MGYR 3UANA 3PXGA 1UBCA 2BOVA 1R0ZA 2VP2A 2KBEA 1BS1A 3KKOA 1TEXA 5J47A 1E99A 4DCTA 4M0LA 1NN1A 1QHXA 4WW0A 4LHYA 5ALKA 3W5CA 3FZQA 2G6BA 2BVNA 2IYWA 4JLJA 3SHQA 2RMKA 4OHVA 5HZKA 4ZDKA 3OE7D 4F92B 3KD3A 5AM1A 1NI3A 3RC8A 2ORVA 4KVGA 2PT5A 2IOFK 4U7DA 2ZROA 2V6IA 2GMWA 1O3YA 2KWIA 4AKIA 2VO1A 3WP1B 3IDQA 1WZCA 4LX0A 2ZXUA 4KCGA 4WIAA 2QI9C 2GAAA 1IXSB 3VHXA 1LTQA 3EWAA 4G5OA 1SHKA 1TPZA 1PLLA 2YMQA 2QM8A 3NTUA 4HZUA 3QU2A 3ZW7A 4RCYA 3AR2A 4D4MA 4Y0AA 1D2MA 3BB1A 2F9MA 2CFTA 1UKEA 4HYYA 3ET4A 3QLEA 3E5HA 3W5AA 2BC9A 1U0JA 1E9RA 3K9GA 2WWXA 2CDNA 1NY6A 3RRZA 5IT4A 2GRJA 4BUJA 3KTAB 4URVR 2EWVA 3GP8A 1Q3TA 2H1LA 3W90A 2KBFA 3TVTA 3NDPA 1W4RA 2P3SA 1E2LA 3IGFA 3ZX5A 4KXFB 1UEJA 4EPXA 4TMVA 1CR6A 3NRJA 1NLFA 1SVSA 4DJTA 4ZDWA 1D9XA 1T5IA 1W5TA 1X6VA 2OFWA 1XF9A 4HAWA 4Q4JB 1AKEA 2FDRA 2XJ4A 2F1RA 2XITA 4HB0A 3BXZA 4Q47A 5AHXA 1I4LD 5AKZA 1FFHA 1DARA 3EW9A 1YE8A 1C1YA 1DBSA 2OEPA 4LJ5A 1U2RA 2ZI9A 3BFXA 3SHFA 2IYYA 4B34A 1OYWA 3O8CA 2C4NA 1N0WA 4LJAA 3X1XA 4HYTA 1L4YA 4DXAA 3KJGA 2O0KA 2DWQA 1IN7A 3R9WA 4UASA 5FUVA 3U7HB 2J7PD 1OPXA 1G7SA 3K09A 3KTAA 4JYCA 5C46F 5KSOA 4OK5A 2WJJA 1J8MF 3K9NA 4RVCA 5ANRB 1QG4A 1YR8A 5BYKA 4MGKR 3WMFA 4C0JA 2EAUA 5KSYA 3AUXA 4UARA 4Q4JA 1E9DA 1E94E 1R7RA 3ECCA 5AVXA 2ZRAA 1OH8A 3DEFA 2VP6A 4EPRA 4PZYA 1RLOA 1NP6A 4KODA 1AN0A 3UG6A 4V0LA 4Z51A 2GHTA 4LPKA 2ZAMA 5F9FA 1E4YA 1G20E 3GYGA 3I32A 1H8ED 2IHYA 5FPSA 3TMKA 2NOAA 2QTVB 3AR8A 3GLFA 3F9RA 1A2KC 1IN6A 3MCAA 2O9JA 3R8FA 5ALZA 3EA5A 3RF6A 5ALFA 2A5DA 1EX7A 3BWDD 3L0OA 4M1WA 2KE5A 4OI2A 2HCBA 4Q02A 4MUBA 5A0FA 1DEKA 2AWNA 2YJ3A 3CX6A 3QXHA 1Z08A 3U3MA 2IL1A 5AW5A 1OJLA 4PTLA 5FBVB 3MWYW 2NO5A 1NN0A 1KK0A 2ECKA 3KJHA 4ARZB 2AMYA 3SMVA 2JIZD 1AS3A 3N2EA 4QGFA 1N6RA 2ANBA 2VSFA 4IW3B 4LC1A 4PQFA 4B3CA 5JECA 4QGHA 3BH0A 2NO4A 1RJ9B 1E2NA 3VMFA 4J0QA 1QHIA 3WMGA 5J4HA 1N5JA 4HAXA 4DLSA 3MJHA 4Q18A 1H65A 2B7BA 1COWD 2F43B 3K9LA 4NH0A 1TJ4A 2VTKA 3CX8A 1BO6A 1N6NA 3A1VA 3D3QA 4TMWA 2P0EA 2N1BA 1BIFA 3IO5A 1PVOA 3CB4A 5JZVA 3DM9B 1KI7A 1MO6A 3QUQA 3QF4B 1IAQA 3D31A 3RS5A 3DOFA 2VP0A 5JCZA 1E2QA 4C2UA 3AF4A 1CR0A 1DADA 2RGXA 4W5WA 5FL7D 4ARZA 3T5GA 5HR5A 5AW6A 1CJUC 2RAPA 4L15A 4D0LB 1GKYA 4UMEA 3BB3A 3LWNA 3RAPR 3IILA 1ZD3A 2G08A 3NWJA 4HSEA 4HGQA 2OESA 1NVVQ 3SNHA 2AHOA 4JIMA 1U94A 3A37A 4KV9A 1YMQA 3THOA 2OV2A 1MKYA 2F43A 2XNSA 4TYQA 5E3HA 1KY2A 2AFHE 4B71A 2IC5A 4N1AA 5GADl 5A5GA 2D74A 4PAOA 5TB5A 1UF9A 1TADA 2FA9A 4AY2A 5ALLA 4Q7LA 1XP5A 1JR3E 1CQZA 3H0KA 5FI1B 4DSNA 1NIJA 2G0AA 2DY1A 4O25A 5HTKA 5L8VA 1SVOA 1G41A 3QF4A 2ASEA 1VMAA 4LV5B 4DUGD 1QHYA 2OAQ1 3THWB 1T0JB 2I4IA 4MQBA 3C41J 3QXCA 4HAYA 1ESNA 5KSZA 2YJ4A 2KJQA 3KUCA 5EXSA 2I1QA 4XTRA 2F55A 3L8YA 1KO7A 1Z0AA 3ZTWA 4YCLA 1OV4A 2LKCA 4GSYA 5SZKB 2GF9A 2GESA 3A1DA 1FMJA 3O8DA 4V0ME 4JLBA 4BX3A 4BPBA 1TNDA 2ODAA 5AR1A 4HZIA 1DAHA 3MWJA 1H8HA 3NKVA 2RBKA 2ZI7A 4HB4A 3C15C 2GJSA 3CZQA 3DVLA 1E32A 2ZRDA 4LK2A 5D3QA 1WVIA 3QNMA 4KX3A 1CJVC 4CF5A 1NBMD 3GEHA 4QGAA 1EXMA 1GKIA 1KO8A 4JSYA 4LY6A 4M1OA 1ZMXA 2NYVA 3HLTA 4KBFA 1N0UA 4IKEA 4QNMA 3ZJYA 3AKEA 4YONB 2VLIA 1XTJA 4O8CA 4LBYA 1Z2AA 5AVVA 1AZSC 5EQTA 2ZU0C 3ZDQA 3THWA 2BBSA 4NBSA 4DWJA 1W0KA 2IEYA 1SULA 2BMDA 2Z4SA 4AURA 2JARA 2OBBA 1YS9A 3ZS8A 1Q1ZA 3HR8A 2R62A 2GETA 4OI4A 3AGQA 3OIVA 3L8ZA 1IXRC 3U4QB 4AK9A 3KDSE 1IJEA 1NY5A 4JLDA 5AVQA 5E4FA 4DCSA 1VG8A 4JB3A 5ALVA 4PHTA 4YXWA 4XVRA 3FVQA 4L9WA 4PANA 2WWGA 4DLTA 5CYPA 1KI8A 3N70A 5BW8A 5ALNA 1T8UA 3FMOB 4IEIA 3G0HA 3W8NA 1R8QA 2QSYA 2RHMA 3CRW1 1L8OA 1OYYA 4Z8XA 5DYIA 4B2IA 4HDOB 4ERNA 3ZS9A 3LV8A 1FQKA 5FTKA 3TVDA 2C2HA 3WXMA 4DDWA 1OIWA 4NWIA 2Q4TA 3CRMA 4KU4A 4LBVA 3ZIAA 4Y2QA 1IBRA 2CN1A 3E2IA 4YMTA 2ZOSA 4KAXA 4HLUC 3GEEA 3AVVA 2GHQA 2HT6A 4ZPXA 3SU8A 2PZFA 4QHSA 1Y63A 1VCMA 4MRVA 2J59A 1GP2A 5AVSA 2GXQA 1Z88A 2EYUA 1RLTA 1KDPA 4RFVA 3U4QA 3OF5A 4Y0VA 3WK8A 1F60A 2GAOA 4RZXA 5K8TA 2DFTA 1LV7A 3KKMA 2VF8A 3SBEA 4DFDA 5FOVA 2QQEA 1XZQA 1T5SA 3NUQA 4H9GA 4MYUA 2AL7A 2YJTD 4Q7MB 1JECA 3NBXX 2O52A 1W36D 4OFZA 5TXGA 2VF7A 4DZZA 4Q1EA 5FOTA 2WWYA 5M04A 1ZNWA 2EVWX 3MRSA 5F98A 4C4PA 3VNUA 5DNYB 1Q12A 1XCMA 4Q1AA 3X1DA 1UDWA 4FXPA 4AIIA 3LA6A 1IHUA 3U13A 1LY1A 1UKZA 3DKVA 2FFAA 4Q19A 1L7NA 2HYIC 4XVQA 2HF7A 3QUSA 5B58C 2V1XA 2JAWA 4YQFA 2D62A 2FH5B 3CRRA 3B1WA 2YINC 1WPGA 3KKPA 4GOKA 5TY0A 1MABB 1T9ZA 4FW9A 3HU1A 1FMLA 2X77A 1UFQA 4G1UC 2YHSA 2B8EA 3BH6A 4MKIA 4HEJA 2ZSDA 1QQ7A 2QLTA 2ORWA 1P4SA 1ESMA 3IRUA 4A0RA 5AI4A 4JLNA 4JZKA 1JJ7A 3RRYA 4D4KA 2CL0X 2XTZA 2G80A 3R4CA 3QF7A 3TSZA 4BX2A 5TVKA 4C0KA 5AM3A 221PA 3A4MA 2WF7A 3OEHA 4BNDB 2QYHA 1D8TA 2JLXA 4IOLA 4PC1A 2FN4A 3HP1A 2ZITA 4UNQA 3LNCA 1KZ7B 1QHSA 1CIPA 5AJZA 2C8LA 1TL7C 3EX7C 4KFUA 1HEIA 3QKRA 3R9KA 1KKLA 3SE0A 3SQWA 2NO6A 4BFWA 3GLGB 2WZQA 3G82C 5FPYA 1P60A 3WNDA 2OYCA 1FUUA 1YZTA 4TL7A 3AR3A 2GEVA 2V6JA 3UPUA 2LKDA 2W6JD 4TMKA 4GRAA 4M4SA 4P33A 2Q21A 2XZOA 3BRWD 2IBMA 4F7WA 3UMBA 1WCV1 2BJWA 1FL9A 3TGPA 1XEFA 3IIJA 2IXFA 4Q5IA 3AEZA 1HA3A 3HPQA 1FZQA 3I5YA 2BDUA 4EQ6B 1MH1A 3UKDA 4AKGA 2C98A 4R98A 1TQ2A 1W1WA 2C04A 2GZAA 4X8HA 1N9KA 4G9BA 3W5IA 1NF2A 4BNDA 3ZIAD 1CLUA 3AVQA 1NG1A 4XJXA 4JMPA 4UNPA 3SS8A 1KSGA 4JVLA 2IYVA 2D7DA 1QYIA 1R0XA 4BX0A 2FSHA 4JL5A 1YZQA 1ZIPA 4N0EA 3B1XA 2JJ1D 3OEED 2JJ2A 1II9A 1W44A 4X8MA 3TW4A 3GLGA 3K70D 4ZIRB 4HLUA 2V54A 3ET5A 4LBZA 1SKYB 3ZD6A 1U8YA 2ATXA 2QAGB 2WPDA 2A5GA 5K8UA 3GLIE 2VP9A 4GZMA 4NYMR 3L0IB 4PQYA 4RZUA 2YMPA 2ZJ8A 1M6NA 4F72A 3QVVA 3IBYA 4EQ6A 4DIDA 4BZPA 3KQUA 4GL2A 1OW3B 2CL6X 1TQ4A 3AKCA 4PPQA 5FUYA 2B0CA 3LO5A 1SVIA 3QPUA 1KDOA 2NO0A 3B5JA 4LJ9A 1F2UB 5AVRA 1R8SA 2NMVA 1GSIA 4WAUA 2QT1A 2OSBA 1Z07A 1U8AA 2GXSA 1US8A 3K9HA 4LZZA 1XTIA 2C77A 2P65A 1HY3A 4PPNA 3L1UA 3W34A 3FB4A 4CZ2A 1G1MA 4GZLA 3DDHA 1XU4A 1U99A 3K0AB 4ZIRA 4JVNA 2ZRMA 4N3NA 3L0CA 4OK6A 1RE0A 3CH5A 1RMYA 1E4VA 1GL9B 2QAGA 2YZ2A 3P32A 4HLDA 5FR1A 3R7WB 2EFHB 3ADDA 3CKLA 2F1JA 4LYAA 4LYHA 1XP8A 4C9BA 1E9EA 3MWLA 5C4MA 3NANA 2XJ9A 5K8LA 3VFDA 1NBME 1KSJA 5H1YA 3SJCA 1IY0A 2C5LA 1RRCA 4YMVA 2QN6A 1UAAA 1TU3A 5FTNA 2E9SA 3DL0A 4Q66C 2B8JA 5CB8A 2OO7A 1SXJE 1F2UA 4I4LA 1G64A 3GJ5A 3B60A 1XMJA 2BWJA 4Y3UA 5IK2A 4DT1A 3SN6A 5FFMA 1ZCAA 2GTPA 3LXXA 5TMPA 1Z4JA 5AVZA 4RD0A 1XD8A 3L5KA 3CIOA 3TUJC 3K0AA 2G09A 5AKGA 3BD9A 2G1JA 4Y2XA 2ZBEA 4B3XA 3IKJA 4YDHB 2WOJA 1X1SA 1HE1C 3PFIA 4PC2A 1FQJA 1YZUA 2EFEB 3R7WA 2G0TA 1ODFA 3B2EA 5L3VA 4TZ0A 4QHYA 3EIEA 3P1JA 1GL6A 3AF0A 2DQSA 2REBA 4AI6A 2Z5FA 4Q4LA 3G5UA 4H1WA 2AK2A 3B9QA 2KI5A 4JLMA 4UU1A 2Q0HA 4LHXA 1HQYE 2QQ0A 4PC7A 4WZAE 4LJ6A 3VHLB 1U7PA 3ONNA 3QU4A 3A8TA 2VP4A 1WXQA 1PUIA 3DPUA 4BEJA 1ZC3A 2ZQ5A 2BM1A 4LHVA 4MRPA 3VR6A 1QDEA 1SKQA 3V00A 1JQLB 4Z54A 1D9ZA 5EP1A 5JLJA 2Q9BA 3ZZUA 3RS7A 1XEWY 1G16A 3VX3A 5BQ5A 4A1FA 4RY2A 5CYOA 1YRAA 4ZDIA 2XXAB 3L8EA 2WWIA 3M0EA 1FNNA 2CL7X 4Q9KA 1FOEB 3P96A 1JPNA 2QP3A 4U5XA 2XNDD 2Q3HA 5KYKA 3EF0A 1MOZA 4DDTA 3GPLA 2JDIA 2IS6A 4DLYA 2JASA 1U0HC 2CNWD 2WWFA 2AK3A 5AKJA 1JR3A 4EPTA 4V02A 4BFZA 1HURA 4OCZA 3QXXA 2MMGA 1UKVY 2QENA 2RAVA 4Q9HA 3R9XA 4L6CA 2C9YA 5AW9A 3U26A 3QPWA 5CDFA 2P6UA 2P69A 2AH5A 4ESVA 4C4RA 4UXJA 5AI8A 5FI0B 4IEEA 1FTNA 4LJ7A 2B7CA 2BDEA 1M7BA 1GOTA 4UNNA 5AW8A 1EFCA 1S1CA 1OFUX 4TLEA 2C9MA 4QJ5A 2XXAA 3VU9B 3L0BA 2OT3B 2X1VA 2GILA 3AUYA 4BQSA 1TMKA 2OCPA 2WIAA 3TLMA 4HDCA 2RB5A 1E2GA 1U2SA 2H17A 3NIWA 4LGMA 1KI1A 5FTLA 2CBZA 1YZNA 1FNMA 1VECA 3RWOA 2FEOA 3I1YA 4NP6A 4J2TA 3RYTC 1NMZA 1NMXA 4QM6A 2CVHA 4IOJA 5GJBA 1FP6A 4DLZA 2JAOA 2PMDA 2I55A 3DKPA 5AW1A 1CJKC 2AX4A 2VH5R 5JMTA 1HT1E 1ZNZA 3OE7A 2OZEA 1XXHB 3L0SA 2NQ2C 4QBFA 1G5PA 4BASA 1Z0JA 3EASA 4IFEA 1J90A 5EE0A 1XZPA 2IYQA 2D2EA 4R7ZA 5EXXA 4A9AA 4URXR 3CRVA 1E9FA 4M9SA 1T5LA 5TDHA 2F1HA 1QF9A 1XRJA 1YKSA 4AYTA 4DC9A 2BY4A 2HCFA 4BLSA 2YMMA 4JDPA 4QQFA 5AM4A 2QRNA 2RHDA 1XD2B 1CJMA 3AP1A 4LJYA 1X1RA 1KK3A 4KN8A 3KQLA 1N5IA 5CJPA 1JAHA 4NCIA 3LVQE 1JALA 2ZJBA 1UEIA 4H1UA 4B74A 2WICA 2P27A 5EP4A 3T1VA 1LFDB 1OFTA 3EF1A 1U81A 4IVPA 2HEIA 1XCGB 1M1YE 1XXHA 4B48A 4CVNA 1TF2A 2YWEA 1CS4C 1V43A 1E2IA 2FFQA 2XTNA 3LVRE 5CITA 721PA 3M1YA 4Y2VA 4GMXA 3EPJA 1O03A 5J4LA 2VSXA 1VJRA 1KI6B 2RGDA 2V4ZA 4LDJA 1YQTA 4KFTA 3LDAA 5GJWC 1RKQA 4NZYA 3ZVNA 3PG5A 4YDSA 3AVOA 3R9IA 4B6FA 4X8OA 2F7SA 4FD2A 1XD2A 1O08A 2ZI5A 1N6PA 2ZJ2A 2EW1A 3K09C 3U44B 5KPDA 4C0AC 3I4LA 4ASUD 3MD0A 1K6MA 1VG1A 3H84A 1JR3D 1XB2A 2AWOA 1RYFA 4EELA 3A36A 5DH9A 2J7PA 4D6PA 4IXMA 3SEAA 3TQCA 4R2HA 1AM4D 2ORIA 3WHKA 2WVJA 2J1LA 5EUMA 5CM8B 3X2SA 4B32A 5ALMA 2ZEJA 3PUWA 5G3ZA 4RESA 4OHFA 3U60B 3QBVA 4I9FA 1KI6A 4GP6A 5ALDA 1KI9A 1G6HA 1GWNA 2O0HA 2BEKA 2IYRA 3DMDA 3MUFA 4A8JC 2ZTSA 4B3FX 1JXMA 5FOSA 1RMQA 2B82A 4B43A 1OFHA 3UWOA 2C78A 2PJZA 4Q7JB 2WSSD 4Q9JA 4YMUA 3NAMA 1YJ5A 3MJRA 4CNQA 3U44A 1E2FA 2OFXA 1S96A 1TF5A 2PEYA 3HU3A 3CR7A 4B6EA 1DOAA 1W2GA 1ZVQA 1MO5A 1H8EA 3I8XA 2XZLA 1G5TA 4P31A 1UPTA 5SZHB 2A5YB 2ZRIA 5AESA 4PAMA 5KNBA 1EFUA 1W2HA 4MITA 3RWMB 5E0OA 3TAUA 4UJ5A 4GBMA 1U9IC 3OPXA 3KXIA 4II7A 4OD0A 4CT5A 1NVUQ 4MWOA 4EENA 1E0JA 3RHFA 2PBRA 4KSCA 2JIZA 1KI3A 3WBJA 5JBQA 1NJFA 2VSOA 4QHTA 2HJGA 1ZJ6A 1T3SA 4AC9A 2AXPA 3LLMA 2DFNA 2B92A 3C16C 4Y2TA 4JVMA 2JGAA 4LUCA 4UJ3A 1BKDR 1QVRA 3I72A 4P3YA 1COWA 3ZGXA 3SQXA 3ZWDA 1NVXQ 3GLIB 2WKQA 2GDJA 4B35A 2NTYC 2X19A 2IEZA 5A4JA 4B73A 5B64A 4Q9IA 1R10A 4A0HA 1T91A 2YY6A 4DWOA 1AQYA 1IXZA 3LLUA 2H8KA 3ONWA 2WAYA 2OBMA 3QI2A 3QEJA 1YDFA 4YIHA 4CEHB 2HO4A 4DRZA 1Z4IA 4URWR 1F2TB 1I2DA 1AGRA 3CWZA 3LX8A 1XDBA 2ZSAA 4DLUA 3GFTA 2IUSA 4LC0A 1TTTA 4O2RA 2ZRKA 2GFHA 1G3RA 2GJAA 1DAKA 2ZYWX 4M21A 1QHNA 1QQ5A 1S4QA 3IUYA 4R9UC 1ZAKA 1EFHA 1EX6A 3NBFA 5FL7A 4EIWA 3UMSA 5JHHB 1NVVR 1P9NA 3ED5A 2NPIA 1ZD5A 1W36C 2OG2A 3GJ4A 5EJEA 4DB2A 2PR7A 3RRMA 1AZTA 1S8FA 1WF3A 4M1YA 2ZRFA 5DHFA 1N5LA 2ZYUX 3DO6A 3H2YA 4M22A 3VKHA 4OHYA 4RKEA 5BXQC 4UXHA 3RNLA 3GLIA 1JR6A 3O8BA 1Z6GA 3OFND 4A8JB 3EPRA 1Q22A 4L4UA 3UWKA 2GCOB 4NCNA 1ZRMA 2ZUCA 3IIMA 3QKUA 1RW4A 3GLFB 4CEHA 1E9CA 2GJ9A 1EWRA 1TQDA 1UBGA 1F2TA 2AXNA 4PR0A 3RSLA 1RKBA 2VRWA 3I3SR 3U3RA 4DUGA 4XWOA 4LRWA 4OHXA 3KDPA 2FMXA 1XWIA 4GXTA 1S2OA 2IYEA 3PUXA 3CF0A 3REFA 4Y2RA 2ZM5A 1TJ5A 4CF7A 4AWXA 2ZR0A 2CHQA 2X2EA 4OHWA 5TARA 3FM9A 1KZGB 2BEJA 3F8TA 1EK2A 4YMSA 1GNQA 4HB3A 1OSNA 3EZ9A 2G1KA 4DSUA 4WZ6A 1Z28A 3KL4A 2QGNA 3TKLA 1YHNA 4G5RA 4A8JA 1GRRA 3KOOA 1NBMA 2QE7D 4D26A 1RFLA 3T61A 2GCOA 4ZDJA 4BBJA 2JGNA 2ZBFA 5J4VA 2OBNA 2GWHA 4F93B 1E69A 2B8WA 2WBLC 3U2QA 1G8FA 2ZVQX 1L2TA 3KKQA 5LD2C 1R4AA 1TX4B 3QEOA 1CKEA 1TE2A 3UG7A 3FPBA 2WKRA 3AR7A 3KB2A 4IOMA 2BCGY 5EZ5A 4IDNA 2GCNA 4IOKA 2UZIR 1U9IA 4M9XA 5AUNB 3AVTA 3H4MA 5CK4A 3L2OB 3QQ5A 1OXUA 2JLQA 3FFBA 1GILA 3CM0A 2RB4A 2Q9CA 1NKSA 3CPHA 2NGRA 4TMZA 4PPGA 5AK4A 1W36B 2QTHA 4PC3A 3I8SA 5BN5A 1G8PA 2QPAA 5AJVB 3QU5A 2AFIE 3FGOA 4PPFA 4OK3A 5JI2E 3KJEA 1KO1A 2Y8EA 3BERA 3SFVA 4E07A 5FL3A 4NFLA 3BJIC 4A4DA 2PT7A 3TIFA 1NVWQ 3K70C 1GUAA 2JLYA 5CJ2A 4Q03A 5LB4A 3Q8XB 5AVUA 4WXRA 3GJ0A 3QVUA 2FPWA 3B85A 4C0SA 3R09A 2ONKA 1P73A 2G0NA 3FMFA 1WP9A 2WOOA 4HI0E 4A0FA 4J03A 4GMDA 3T5DA 2CCGA 2R6DA 3HWSA 3OCWA 2MSCB 4NAVA 2WSMA 3Q5DA 3VAAA 5CLLA 3V4RA 2J0UA 1VCNA 1TJ3A 3A1CA 4OJKA 4D82A 5AW3A 3M1IA 3Q3JB 4DIEA 1AJEA 5FUXA 1TF7A 2VHTA 3LBHA 1N6KA 1ONBA 3UMFA 1NNLA 1JNYA 2K5UA 4Q4HB 1W4BA 2GF0A 2AR7A 4A0GA 3W3ZB 1Q1EA 3MFYA 2OILA 2HSZA 1E2KA 1A2BA 3NHAA 2I3BA 2IHBA 3TK1A 1D6JA 1NSTA 3FFAA 5LD2B 3FMIA 4QG7A 1R6BX 2DPXA 3I62A 4GT1A 3UMCA 3KC2A 5GVRA 4Y2JA 1E1QD 2W6ID 2J87A 4U00A 3SHWA 3AVXA 2W4MA 1DAFA 1Z29A 3SJAA 3PR1A 3KXKA 2IYLD 4P4TA 2ZBGA 4D80A 1T8TA 3PEUA 4EEKA 1NJGA 1OLOA 1SXJD 2KB0A 3L43A 5ALTA 3MLEA 4NYIQ 3SC3A 1J97A 4DKXA 2BMJA 2AN9A 4P0TA 3I73A 5HE9A 4A2WA 2ZJZA 1Z22A 1N2CE 4Q4HA 3LD9A 4E22A 3TH5A 2ZE7A 2IOFA 1W46A 2OE2A 1F5NA 4KFSA 4MKGA 5JCPA 3EIQA 2V1UA 4EZEA 4C0LA 1RKUA 5ALQA 1G4AE 2EFGA 3D8BA 3TNFA 5F2EA 3K70B 1GDDA 1I4TD 1ZYUA 1KJYA 3D6TB 1K8RA 5JJKA 3FYHA 3BGWA 5L3SB 3OTQA 2W6JA 4MDEA 1B0UA 1GIAA 1E9BA 4BFVA 4R2IA 3F5FA 3HJNA 2WF6A 4L16A 2A7QA 4I1VA 2B1QA 3JZAA 1AGPA 1L8LA 3FGNA 1EK0A 3ZI4A 3QY0A 4V03A 2F3RA 2IYZA 4JBYA 1KO5A 3TJZA 3PUYA 5HE8A 4W7SA 5EE9A 4KBGA 3BS4A 3FE2A 2WAXA 3DV9A 1A7JA 2D2VA 5G53C 2FX3A 5BN4A 2BBWA 1M7HA 2ODWA 1ZD9A 3N5CA 4CIDA 1E98A 2ATVA 2JAQA 2RCNA 4F71A 2C99A 1S2MA 3MSXA 4ZCLA 4DEYA 1P2SA 4EPVA 4C4TA 3NG1A 1JEEA 2FOLA 1BH2A 3AP3A 3NIBA 1OIVA 2O8BB 2JJ1A 3OEEA 2YWHA 3PEYA 1Q57A 3SOPA 3GLHB 5CM9C 3W5JA 1X86B 5L3SA 3LX5A 2IUUA 4TT3D 1U7OA 2R6GA 4QM7A 1FTSA 1ZM9A 2AD5A 2QP4A 2W2TA 4EAQA 4KO8A 4XTCS 3B9PA 4FCWA 1IN4A 3BC1A 5IDVA 3TUIC 3LH5A 2HCJB 2CCJA 2GJKA 5B2ZA 2ZYTX 1GM5A 1OB2A 2ODEA 4DBLC 4TYWA 1L6RA 3W5DA 3CPEA 4A2PA 2R8XA 4ZEVA 5FUWA 3V9PA 4NONA 1L8QA 1W48A 2CHVA 3A4NA 2NO9A 1G291 2W2XA 3EPKA 1WR8A 2R44A 2V8OA 4ACBA 2QAGC 4D81A 2DWPA 3NH6A 3NH9A 2ODBA 3QKRB 3N2IA 521PA 1KKMA 2O8BA 2OM6A 1TQ6A 3GLHA 4I1SA 4ZO4A 4ITRC 1RC8A 1DAEA 3P20A 2YWFA 3B8HA 5AIBA 4MUAA 1UADA 3A1UA 3W8RA 3ZYCA 1TUIA 3E81A 3KUDA 2JAUA 3WK9A 2Z6VA 4LHZA 4OI0A 1VCOA 3BH7A 2Q6TA 4WBSA 2ZUBA 1WDTA 4EUNA 3NC0C 2ZBDA 1CJTC 1Q0UA 1NN5A 3GMTA 4MA4A 4OL0A 2JLSA 3SFZA 4HB2A 1LS6A 1RMTA 2I33A 3DAOA 4NE2A 3P27A 3X1YA 1G7RA 2ZRNA 4AYXA 4QJ4A 2ZAOA 5IHPA 1P62B 4NYJQ 5AK5A 5E7JA 2QPOA 2PZEA 2ZRJA 3W9YA 4IG4A 1XNJA 4HAVA 5CB6A 2YOHA 2GBLC 2DHRA 3X1ZA 3KZXA 5AVWA 2IWHA 2PMKA 4JT2A 3RABA 3RS0A 3MPOA 3N07A 2OCBA 3TAHA 3QUBA 4HATA 2HT1A 4CF3A 2J3EA 2RGNA 3A6PC 4FI3C 3EWIA 5HZHA 1Z0DA 4TQAA 4M1MA 1Q3HA 3P4XA 1ZD8A 4M9QA 1UKYA 2R6AA 3AF3A 2QA5A 2QM7A 1Z0KA 2VHJA 4FE3A 4V0NA 4ZI2A 1VIAA 2R8EA 4PQRA 4BLRA 3L82B 4C7OB 1AKYA 1Q91A 1G9XA 4BRUA 1US8B 3PCRB 4M9ZA 2ANCA 4BFUA 2NPFA 2ZIAA 1G3QA 1JAIA 5C2JB 2ODNA 2P5SA 4IDHA 4CGZA 5F9HA 5AJXA 5DI9A 1KAOA 3FHCB 4Q7KA 4Q9LA 4CDGA 1AQ6A 2XNDA 1Z0IA 4C4SA 5JEDA 2R6FA 4FFDA 4IVQA 4WVFA 5DGXA 1DTSA 4IDQA 4MKFA 2CNWA 4MYHA 1Z6YA 1Y8AA 1Z4PX 4X8LA 2JJ8A 2ZRGA 5KNCA 2F9LA 3REGA 2XB4A 2ZRHA 2FZLA 1N6LA 1Z2CA 1D5CA 5J40A 4G5SA 3WHLA 2R8ZA 4BLPA 3TRFA 4BEWA 3BORA 1SZPA 2QP9X 4HGOA 3O47A 2H57A 4Z1MD 4IVRA 1E79D 3O8RA 4C7OA 2YFYA 4DT1B 2BDTA 2IF0A 4FINA 4KSBA 3U7FB 1YNSA 3L8GA 1W0JA 3OESA 1EWQA 2AD1A 2QGZA 1VHTA 3HYCA 4BFTA 2Z4RA 4OI1A 2ZS8A 2RKOA 4LI0A 2YOFA 1XJ0A 3WK6A 3ICQB 3NEJA 3N28A 2UKDA 4KITB 3JVVA 3ZH9B 4AKHA 4QJ3A 1Z4MA 1K5GA 1E2JA 3B7GA 4JKYA 2P6RA 4I1OA 3ZX4A 4ESHA 2IYSA 2GVZC 2P6NA 3CONA 3WK7A 2OCAA 4HUTA 1MH9A 1G19A 2WMNB 1G8HA 2H7VA 3C7KA 3ZU6A 3J81k 1CR4A 4IRUB 1FP7A 3FVVA 5JWHA 1RIFA 3GCGA 1E1RD 1HYQA 1T6NA 2QMUA 4A6PA 2B30A 2ZE6A 5JJIA 3E8MA 4BKMA 3PENA 1R0WA 3A1WA 4PFSA 2ZI3A 3WGUA 1YR9A 3WNBA 2R8RA 3SYLA 4AS2A 1WMSA 2HOQA 2XEXA 4E5UA 5ALUA 4TL6A 2PX3A 4L57A 4PX9A 4D0NA 3FPAA 3MGCA 3EPHA 3CPJB 4EX7A 4RFSB 1S9DA 4BZQA 3SYNA 3T34A 2ZRPA 3GFOA 4WA7A 1G3IA 3EZFA 4URZR 5G3YA 3L1VA 1G8YA 2WJYA 1UM8A 5EP2A 4TN1A 2EARA 1Z6XA 2AKAB 3IPXA 2FUEA 5A3RA 2N42A 1GAJA 4TTPA 3QX7A 1UBEA 2F3TA 3CH4B 1BYUA 5AM0A 1U8ZA 3FWYA 4UW9A 1UBFA 5FH9A 5AKKA 2GBLA 1Z8FA 2RGCA 2VKQA 3I5XA 2RARA 4QBHA 1IQPA 1E9SA 2R9VA 4UXIA 3OIWA 3OIYA 4D4LA 1E0AA 2P11A 2BV3A 3LXRA 2VHCA 3D6JA 1TU4A 4MKHA 1OXVA 1KNXA 2C96A 1LNZA 3W3AA 5D3MA 3PGLA 3ZD7A 1RYHA 3QIAA 3FDIA 2W58A 1SWVA 4QXAA 3AKDA 3AQ4A 3ZQJA 4US2R 3AR9A 3CNHA 2ZRCA 5AVTA 3NBYC 1YV9A 4RFSA 2D2FA 1M2OB 5AM2A 1IJFA 1LW7A 2D06A 2TMKA 4ASUA 1Q21A 1ZM2A 4MYTA 5H8WA 1OFIA 2R65A 4K8OA 3IJ5A 1OH6A 3RRNA 1P75A 2A2ZA 4QBIA 3W6NA 2D3WA 1U02A 5AI9A 4M2LA 2ZI6A 2O8EB 1PUJA 5FOXA 2JLUA 3NDBB 3L8FA 1G3MA 3UM9A 5L3RA 2V7QD 2ZJ5A 4B2PA 1J2JA 2WF9A 4D0GA 4S35A 1DAGA 3SKXA 2REXB 3I1FA 5AW7A 3IEVA 3SZRA 2MSNA 1XX6A 2GO7A 3PDWA 1W0JD 1XD9A 2IA5A 4XSGA 5LB2A 4V0MA 1Z3IX 5FPHA 4F4CA 4BZXA 3K1JA 2YV5A 1P2TA 3TE6A 1IY1A 2WSSA 3LFUA 1KDRA 1CBUA 3EAQA 2LCFA 3ZZ0A 1CXZA 2WJHA 3LBIA 4C0QC 2JLWA 2X2FA 5HKKD 3QG1A 4KX5A 1Z4OA 4KNWA 2VPPA 4QKQA 3FOZA 2O8EA 5AI5A 4PZLA 1SU4A 2CLDX 2FJUA 2J0SA 3VNVA 3CO5A 2WF8A 1YR6A 4TMTA 4BWYA 3RFUA 3ND8A 2CFSA 3OCZA 4NPHA 2L0XA 3GJXC 5JJBA 2HJVA 4LYFA 4RJLA 1XPJA 3QSYA 4NL4H 1OT3A 5AJYA 3SYKA 1QRAA 4EFMA 4HAUA 4XD7D 2MU1A 1IN8A 2E1RA 4V0KA 2HDOA 2VHUA 3M9LA 1YRBA 3LW7A 1JXOA 1P2UA 5P21A 3VR3A 1YZLA 3AR4A 1KO4A 3GD7A 1HT2E 2MMCA 1Q44A 2B6HA 3B1ZA 3CF2A 1MR3F 1FX0B 2FWRA 1J8YF 4AG6A 4B47A 4NCHA 3B8EA 3LRPA 5FTMA 2C8VA 4TYYA 1XTQA 2GEUA 1G18A 3K0SA 5DLQC 5AJWA 3K1ZA 5AVYA 1A1VA 5AIAA 3EC2A 3E84A 1A5TA 2PLFA 3THYA 1G7TA 4BFXA 2CXXA 2X8AA 5CIWA 4M8NE 4EPYA 5FOUA 4US0R 4PNHA 2QROA 3C4JA 5EE3A 4NV0A 3QG5A 2RGBA 1Z83A 5CLQA 1W7AA 3PJRA 1VHLA 2Z43A 3KKNA 4CT4B 1U2TA 1Z5UA 1A4RA 1GITA 1NRWA 3LQRA 3ETLA 1NIPA 4B33A 1RLMA 1QHGA 1PJRA 2YOGA 3QOFA 5JJLA 1VYVA 3WKDA 4W5HA 1Z6TA 5AI6A 1SVKA 1HH4A 5E95A 4JLOA 3B13B 4PSVA 2WJIA 1FX0A 3OFNA 3PQCA 4IDPA 4MGIR 5JWOA 5TV2A 1T4GA 2XTMA 1P3JA 2ZJAA 4KVAA 1MT0A 1W49A 3BFKA 1Z0FA 4G3XA 2ZI4A 2A78A 1WBDA 2OXCA 5JSZB 3PCTA 3S6JA 1DAIA 2Q4RA 4JJZA 1W4CA 4RD6A 1WA5A 5KUTA 1WE2A 2G77B 2FI1A 3V4FA 2FPLA 4ILEA 3A1SA 2CCKA 5DHAA 2EWWA 5LPNA 1I2MA 3WKCA 1EK1A 4O3MA 5IT0A 3HPRA 5JRJA 4W9MC 4FMCB 3IEUA 3CZ4A 3IHLA 2I1VB 3BK7A 4MRSA 5FR2A 1VYTA 1ZC4A 4BLOA 4G63A 1EFRD 4L6AA 5JFGA 1S3GA 1I4DD 2N46A 2ZYVX 3L0YA 3PVSA 4HLQB 4JLPA 2CJWA 3RSOA 2ZJYA 3LW8A 2OXRA 3QNUA 5HCNA 3QXSA 3E70C 1SVMA 1XJQA 1II8B 2NO7A 2F1IA 4Z8YA 5DYGA 1KYIA 5SZJA 1Z4QA 1SXJC 2G1AA 4L8GA 1OHHD 4L9SA 2QE7A 4H1VA 4IHQA 1VYUA 2ZPTX 1LVHA 2A5JA 1VG9B 2FPSA 1KSFX 3E1SA 4C0BA 4B3BA 5JSZA 3MC1A 4BEVA 2YC4C 2HLDD 4WOPA 2QMOA 1BOFA 4CE6A 1Q20A 4E03A 5DN6D 5IF9A 5C4GB 4PHFA 5ALPA 3ZWKA 2OLJA 1E96A 2YKGA 4ABYA 1MO4A 1UDXA 4Q4AB 3SF0A 3TW8B 1ZD2P 1RZ3A 1ZUNB 4KYTA 1OIXA 5JS8A 4UMVA 3S1AB 1DELA 1KTVA 2REOA 4FCTA 2ZSFA 4A92A 3ZTYA 3AH8A 3KZ1E 1Z06A 5AK0A 3WKAA 2Q3FA 2XX3A 2FNAA 4KHZA 5DO9A 3T12A 2P9JA 1U98A 1JI0A 1XEXB 3QUTA 2B8TA 1DVRA 4GIBA 1KOFA 2QPTA 1F5SA 4KNVA 1II8A 2FV8A 3UMRA 3WBKA 3M4YA 3WNCA 2XSZD 5GJVC 3EARA 4LBWA 1RRFA 5FBWB 3WKEA 2C88A 3IQXA 1R5NA 5KTYA 4ZEXA 4LV6A 3R8CA 1ZM4A 4W5JA 5FPTA 1WQ1R 4OBEA 1LF0A 4YMWA 5IS2A 3T35A 4Q4AA 2BBOA 2Q5EA 2YBDA 3BA6A 4IJMA 1FPMA 3HR7A 2WM9B 4MH0R 3GJ6A 5BYJA 5UKDA 3KBBA 4DDVA 3S1AA 3CWQA 3T1QA 2WFAA 1K5DA 3CUEF 1Y3AA 2WMOB 3BBPA 3LY5A 3VKGA 1KK2A 4RETA 3EZ7A 1LS1A 1P72A 2IX3A 3BWVA 1XJCA 4Q1DA 1P9WA 4QNRA 3SI7A 2I7DA 3MN1A 3VR4A 2JA1A 1XEXA 2J0VA 4DW8A 1TAGA 2OHFA 4GP7A 4QL3A 1SGWA 1HV8A 4OHZA 3CZPA 3U7GA 2DWOA 3QXJA 3NHBA 1HQCA 4OQFA 3MAAC 2FPMA 3QYPA 4RCZA 5SZIA 1ZM7A 1ZD4A 3JZMA 1MRSA 2HV8A 2QZ4A 4GPTA 4BE7B 1HE8B 5ALIA 3K53A 4AG5A 621PA 2WJGA 4UMFA 4PO1A 2UVQA 1KI2A 4DSOA 4DCCA 1SXJB 3UIEA 3TUZC 4FMBB 1E2EA 2ERXA 3RVBA 3BFVA 2YWGA 3Q5EA 1GNRA 4U02A 3ZLJA 3GLGE 3NXSA 1L4UA 3U6KA 4BYGA 4KYUA 5AKLA 1NNEA 1ZBDA 2C9CA 3RDPA 1DS6A 5C1BA 5AM5A 4ZCIA 1D2NA 3CNNA 1BMFD 1KHTA 2AGVA 3VKWA 4BRWA 4FMDB 4YIKA 2G83A 4AD8A 1MO3A 4KI0A 4TSFD 1JPJA 1XBTA 3AB3A 1F6BA 2DFLA 4FCVA 4Q48A 4ZV4A 5F3WB 3RC3A 1XVIA 1E1QA 2CK3D 2VQSA 2W6IA 3EZ6A 4B44A 1ZW6A 5KDDA 2QNRA 3B1VA 2O2XA 2IYXA 4JLVA 4WZBE 1CTQA 5K8IA 1PLKA 3HDTA 4XWAA 4I9GA 4NYIR 4RD2A 1CP2A 1KGDA 1ZRHA 4M53A 2R6CA 3A58B 2ZE8A 1SXJA 4Y2UA 1VCIA 3FHOA 3WYFA 4JSTA 2FFBA 2P5TB 3EWSA 2GZHA 2NIPA 3EXAA 4IDOA 2H18A 3AP2A 2RGAA 5J5CA 4D4JA 4RKFA 3MMZA 4OKSA 4UNRA 5ALWA 5LBIA 1ZNYA 2QG6A 4JYBA 1SKYE 2XB2A 1QHHB 1J70A 4UU0A 1ZNXA 1AIPA 1XEWX 1E2PA 5AK3A 3A3YA 2FE4A 3OCXA 4B3DA 3KQKA 3DOEA 3D7MA 1E2HA 2ZSBA 2C95A 5JI3E 5DIFA 4B2LA 1Z4NA 4S2EA 2WHEA 4TTQA 2PLRA 3NVAA 4F91B 3FPSA 5AKIA 4LJ8A 4FN5A 2J0UB 1RQLA 3WYAA 4BFYA 3PEWA 1NLZA 3ZUPA 2IXEA 4JVSB 3MG9A 3RANA 1QH9A 3NBZC 4LWZA 4PHHA 4PAQA 2E87A 2ZE5A 2I34A 5AW2A 3VR2A 4DCUA 4EX6A 2PQ0A 4AP9A 2XOKA 3K0CC 1NF3A 1SVLA 1ZINA 1VJ5A 2PCLA 1KMHB 1VIYA 4JL6A 1G21E 2QAJA 1QHHA 3AR5A 1L7PA 1N6HA 3KB1A 3U6BA 1YZGA 1ZU4A 4FIDA 2R8YA 1KK1A 3DMNA 1R2QA 4TT3A 3EPLA 1J8DA 3Q72A 5E7MA 3GEIA 2ZR9A 2BIFA 1ZOLA 2LWIA 1OH7A 1DO0A 1T3LA 4MRRA 1ZJJA 1OXSC 2BM0A 2IF2A 3Q7QA 2BMFA 2WF5A 4PO9A 3B82A 3T15A 2GEDA 1S0UA 2QSZA 4OYHA 3Q85A 1CULC 3TR0A 2ZREA 1CF4A 2GK6A 5HPYB 3MMPA 1CRPA 1II0A 5ALSA 2IS4A 1RJ9A 2C9OA 3CF6R 3ADKA 3QU7A 3AKYA 1XPUA 3IIKA 4Y2YA 1RRPA 1NMYA 2RGGA 2EFCB 4JS0A 1KMHA 5DISB 2EFDB 2J45A 4NHOA 2J41A 1E2DA 3DNPA 4JLAA 4P32A 2YMLA 2EATA 1NL3A 1PZNA 4PSAA 3CX7A 2WM8A 2O5VA 1ZU5A 2ZXEA 5G41A 3SD7A 3WP0A 2B21A 1EG7A 2J5XA 1X3SA 1P61B 1OE0A 3OCUA 4HAZA 1W4AA 2V55B 1ZCBA 1IY2A 5CDFE 2HXYA 3ASYA 1JBKA 2Q3MA 1G3UA 2GCPA 1J99A 3GJ7A 4CW7A 2IW3A 3UMGA 4AYWA 1WBBA 2NZJA 3U3OA 4DLXA 4KJZA 2W11A 1KDTA 2IT1A 3EA0A 1G17A 3ZVMA 4UKDA 1CU1A 4NYJR 4QOSA 4HAIA 2O8DB 4KFRA 4DLVA 4R71A 1E0SA 2A30A 3FMPB 4ZKEA 3C5CA 3TR5A 3WGVA 1S3SA 5FBRB 3SJBA 2RGNC 4MRNA 3QKSB 3OHMA 121PA 3PUVA 4L5BA 1XMSA 4PXAA 2W2VA 2GZDA 5FPKA 1K1EA 3QU9A 2D4HA 3SJZA 3KJIA 1DE0A 5AKHA 5DI3B 1JB1A 4XOUA 2VL7A 5J4KA 1G5RA 4HDQB 3THXB 3FKSA 5EE1A 3KFVA 2GNOA 3N1UA 2JCSA 3R20A 2R2AA 3VTKA 3AVPA 3I6BA 2OA0A 2VP5A 421PA 1QQ6A 2XOKD 5G40A 3SR0A 2O8DA 5JEEA 3OAAA 2WIBA 1SHZA 3H1TA 4EKDA 3NASA 2CLCX 1N0VC 5FTJA 4XWKA 3U61B 5A3SA 4NMMA 4TLCA 2QMHA 3U3KA 4RD1A 4ZCMA 2OM2A 4A82A 1N3BA 1E3MA 5ALYA 2MSEB 2XAUA 2BKUA 1OXTA 3K0CA 3QKSA 4DLRA 1L7MA 1RVDA 1P9RA 3CW2A 2BMEA 1GZSA 2EYQA 3IBGA 4TYPA 3C5HA 1GRNA 1IONA 4YC7A 2ZUDA 5DI3A 2FDCA 1XXHE 5GVSA 4B76A 3THXA 2PL3A 4OJQA 2MSDB 4QGGA 4TLBA 4BEBA 4EJSC 1Q92A 2QEQA 1J7KA 4OQLA 5KPJA 2PJRA 3QENA 4I81A 4C0HA 3KQHA 2NG1A 5T41A 4Z1MA 4A36A 5B57C 1KI4A 4XSHA 1E79A 5EE5B 2GJ8A 3WK4A 1ZUHA 1TUEA 4URUR 1ETUA 2PEZA 2V3CC 3SKYA 1R5OA 2CFRA 2DCUA 2RGEA 3WRXC 1AS2A 5ALGA 5KOYA 3AR6A 1AQUA 3U3JA 3FHTA 3BAFA 1M74A 4YCNA 4UM7A 2EU8A 2IK8A 1AA9A 4NDZA 3TSOA 4C30A 3ASZA 1N8NA 1IM2A 6Q21A 4YLGA 1OF1A 3L0PA 3RS4A 5AK6A 3GJ3A 1BYIA 3ZVRA 5AKXA 3I92A 3NEYA 4TLDA 3CBQA 5JWRA 1S1MA 2HDNB 4FWTA 4BECA 4XOIA 4ACAA 2J0QA 2DBYA 1SVWA 1E1RA 4EFLA 3GQBA 3ZVLA 1YZKA 3AV0B 3B78A 1O87A 821PA 2YJ6A 2FFHA 2FU5C 2HF8A 4LPSA 3WMEA 5AKYA 1F48A 1M8PA 1GNPA 1T3HA 3ESQA 3AF2A 1ZIOA 2ZG6A 1H8HD 4KYIB 2J9RA 4EPWA 4DB4A 1Q1QA 2ZJOA 4PZZA 5J4YA 3VQTA 2HF2A 3MWKA 3DM5A 3U19A 2IXGA 4PSKA 4HGPA 2FSFA 3B6EA 3HYRA 4JKIA 3DHWC 3Q7PA 1Z5GA 3RS2A 3QE0A 2JEOA 3PIRA 3OCYA 8OHMA 4MGZR 4NTZA 2FEAA 3WK5A 5JHGB 2QT0A 4KLZA 2IS1A 1W0KD 1Z47A 2X4DA 5AKEA 5FBLB 4Q00A 3C8UA 3FKSD 4WXPA 1EFTA 4RSGA 1ANKA 1F3OA 2OUKA 2ZETA 3ZZTA 1VKJA 2OLKA 2XGJA 5AICA 1E6CA 1L7VC 1MABA 3C14C 4FWIB 4QRHA 1P6XA 4F4JA 2GA8A 2FPRA 4Y2SA 2VA8A 1UJ2A 1SWWA 3B1YA 1CRQA 1CR1A 4IXNA 3KFXA 4EJSB 3OAAD 4YXWD 4JLKA 4A6XA 4P4UA 1W5SA 2QU8A 2FUCA 4TQ9A 1T5TA 3SDZA 2SHKA 3AGPA 2ZS9A 3UXMA 4BLQA 1GG2A 4G0NA 5EP3A 2F6RA 5AUQA 1V5WA 2Z0MA 2CMKA 4GNKA 4LJ4A 1RPZA 1FW6A 1M7GA 2WWHA 2YVUA 1EESA 1E2MA 4PHGA 2VIIA 2W43A 2PCJA 4MDFA 2QUZA 1N5KA 3CNOA 4RZ2A 1X8KA 1JEDA 2JLRA 2GKSA 4EDHA 1GFIA 4CEIB 2GXUA 1B23P 3SLRA 1QVAA 1KAGA 1MV5A 2A9KA 4D2IA 4K81B 2CE7A 2V7QA 4G5QA 2BBTA 3I61A 1IN5A 2G88A 2C8KA 1Z4LA 4TMXA 2CE2X 2HEGA 5DSZA 3TSWA 4DCVA 2B1RA 2WWWA 1KY3A 3WYGA 1SQ5A 4GI7A 4TLAA 4EJSA 3HU2A 1VTKA 3IO3A 2ZVPX 5AW0A 2A5FA 1MRNA 2HI0A 4DVGA 1AS0A 3K8YA 1L7OA 4UAUA 3QBTA 2HHLA 1G6OA 4CYMA 4UATA 2C03A 3H86A 3BB4A 1KMQA 1JUDA 3KX2A 3U7EB 4TL8A 2DB3A 3T06B 5HKKA 2HUPA 2G07A 1X8JA 5EZ6B 2QTFA 4FMCF 2DR3A 3QGMA 3W6OA 2H92A 4CEIA 4Q21A 1C9KA 2ZANA 1ZRNA 5EXPA 2I6XA 3K0FB 4RZ3A 4UM5A 3IB6A 1JQJC 1G4UR 2DFKB 2QMEA 1NN3A 2XZPA 3LAWA 2BHRA 4MYCA 4US1R 2I54A 3IQWA 3K0EA 4JBWA 4NU0A 2ZS7A 2FZ4A 5AWFC 4TL9A 4P4SB 2RH5A 4JJKA 1FEZA 5AI0A 4HUQB 5FBQB 5D3MB 4E09A 4DDUA 2ZSEA 2P2LA 4XD7A 4NCKA 5B30A 2FSGA 1S9HA 4ZI3A 2JLVA 3B9BA 2V9PA 2FPUA 5EXTA 4AKEA 2OAP1 5AUPB 3E58A 4O2LA 1M34E 3L7YA 4YCMA 3LQQA 1A82A 2EQBA 1GTVA 2VYFA 1NKTA 1GRQA 2J7KA 1ZM3A 3NALA 5JS7A 3GLFE 1XTKA 3OEHD 4DHEA 3PITA 5CK5A 3OCVA 3N8GA 1KJZA 3B9RA 2W0MA 4POAA 1AK2A 2HX1A 2CEAA 5ALXA 1Z6AA 4PC6A 2CVFA 4TYNA 3I28A 3K0FA 4TZ6A 4BLTA 3EIHA 4N0DA 4XVUA 3UATA 1C4OA 4KLNA 4QJBA 3VX4A 4FYPA 2CHGA 5IT5A 2VHQA 1QBKC 1OH5A 2JLZA 4P4SA 2O0JA 2O8CB 2HYDA 2ZRLA 5HCIA 4HUQA 3TQFA 2O8FB 3FTQA 2BJVA 3QKTA 4GOXA 4ZKDA 1RQNA 1G7CA 4MUMA 2H5EA 2PZGA 2W83A 4ON9A 3X1WA 4QFMA 1YU9A 1XTRA 2FF7A 2IYTA 4GFDA 5EUQB 4I1UA 3DDCA 1XPOA 1U0LA 2IUTA 2NZ8A 4G5GA 3U5ZB 5KDLA 2GHIA 2HF9A 1CEEA 2OBLA 4NCJA 3QXGA 1ZD1A 2DYKA 1ZS9A 3WKBA 1KIMA 2P67A 1QG2A 3IHWA 2ERYA 4GOJA 5GJCA 3A1EA 5BWMA 1KNQA 4LCBA 5KNDA 2CLSA 1HUQA 2FGJA 5IRCD 1Z63A 1XMVA 4IFTA 4TTRA 3W6PA 1Q1BA 5BN3A 4RD4A 4B6JA 4OQNA 2KSQA 3OIUA 4GDFA 2JJ2D 4HLCA 1FUKA 1PLJA 3BOSA 1NLYA 4NABA 1OKKA 3AVUA 2O8FA 2O8CA 1NSFA 4QBGB 1EFRA 2OCYC 2G9NA 4A15A 3PGVA 2WPDD 4DEXA 2YC2C 4LV8B 3RLFA 2OFOA 2D7CA 2Q9AA 2FPXA 3QJYA 2QBYB 5KU1A 3P4YA 3ZQ6A 3UK6A 2PX0A 3IPYA 2PKEA 5AUOB 4NYMQ 5CIQA 3F3YA 1OHHA 5ELXA 4Q1BA 5KDOA 1XPRA 1PW5A 3EG5A 5A3QA 4JT4A 4F4IA 1PV4A 2AKYA 1EGAA 4Q01A 3TLXA 2VBCA 3WRYC 2HLDA 4C3ZA 2BKEA 2FGKA 2H16A 5DN6A 1DG1G 2G06A 2YN4A 4XQ0A 5L3QB 4CF4A 1P7CA 2YYZA 1XFAA 2W0SA 3THYB 4Y2PA 1Z5ZA 1LF5A 4FMDF 4I99A 3QUCA 3ICEA 4QC2A 4OQMA 4PO8A 1R0YA 4BGDA 5JRZA 3NC1C 3VR1A 5FOWA 1G8GA 4BFSA 1YR7A 4DSTA
chains in the Genus database with same CATH superfamily
4X7MA 4MVJI 1JSLA 4EI8A 2P0AA 2AR0A 2QIOA 1TTHA 2EGUA 1CHDA 1KPIA 3JVUA 2PH1A 2AUNA 4R3WA 1YVDA 2GK7A 4QJIA 1FMCA 5C8YA 5K0ZA 1KSHA 2B9VA 1PWZA 4HFNA 2GT1A 2ZU6A 3V8MA 5IVHA 1MZPA 1VPLA 1G4HA 1ZUIA 2V5UA 4WMLA 5EXDA 3WY9A 3A4LA 5ADVA 1HDZA 2WTUA 1ECGA 4YJHA 2WKPA 4OUKX 2C2GA 4OX9Y 4DCNA 4F38A 4I4CA 2WV9A 3Q0EA 3F49S 3Q8WA 4YJFA 5C35A 5KNDH 5KO2A 1Z38A 4AO6A 3Q1LA 2ZZKA 1DUVG 4KACA 3KUKA 1C7JA 1LDNA 3KQSA 2PT6A 1JVBA 3QPVA 1DBPA 4NKRA 5D5HA 3KBOA 3V33A 2WC1A 3HC7A 2ATEA 3P9SA 2R5WA 4LZLA 2D5BA 1D1PA 1UP4A 5DNUA 3N5KA 2X8JB 1JJBA 2XRMA 2GI4A 4OQXA 4U2CA 4X85A 5B3AA 5TQJA 3T1OA 4M7PA 1ECLA 4F06A 3W5BA 4CFZA 3P0HA 4NESA 4DLWA 3O8QA 5ES4B 1PJSA 5JNWA 2C0CA 1PE0A 1JJFA 1QP8A 2FRVA 1E0KA 4WASA 1WQ4A 1W47A 2Z83A 2ZLBA 2X9VA 4HF7A 3WL8A 4DG5A 1N2ZA 5HK9A 2YCBA 2FG6C 3GP3A 4YCJA 4IIYA 2FWIA 3FDZA 1DLJA 4RY8A 1NG9A 1LX7A 2AJCA 3VR0A 4D25A 1L5SA 4TKUA 1YZHA 4MHSA 5H70A 1LDEA 3KWMA 2EKBA 3T8YA 3IP5A 4RABA 3IOMA 3E6AA 3P2KA 4DTIA 2NTJA 3OZXA 4JEMA 4MQLA 3TLGB 1ZFNA 3I76A 4URYR 4XIGS 1DFHA 1GV1A 1I7LA 1PVDA 2NXJA 1JDTA 3BL6A 1DP4A 3CLUC 3L6OO 4MQEB 1ZLXA 5KTKA 1RRGA 4N7RA 2QRZA 2BKLA 1JJVA 3KE8A 3NONA 4YA6A 1EA5A 3ADCA 3KEGA 2O7NA 1SG9A 5DK4A 1RLJA 1VPVA 3VDRA 2HRRA 3LGXA 2HJHA 3H9JA 3ESBA 5KHOC 3ZDDA 1CR2A 5KTPA 1XQVA 1FFEA 1Q1AA 1RJFA 4R31A 4XJVA 4E88A 4OATA 3G9TA 1R00A 2CK3A 4I46A 1YA6A 3IKTA 4G4JA 2W6OA 5H68A 2VK8A 1CFJA 2G28A 2FY8A 3DYIA 1EGVB 4KP7A 1XMIA 4MTLA 4YH1A 4F7DA 4CQMA 2GPAA 1JIKA 4LYEA 2R4QA 3HUDA 2CNDA 2W2LD 2UZ4A 2NO1A 2IOHA 2ZIXB 2PUFA 3ZDXB 4LHWA 1V4BA 1CQIB 2WHXA 3D81A 7GPBA 2GD6A 4J29A 3VAYA 2YJ5A 3B3GA 1SR8A 1RI4A 3DZDA 2GPSA 1DIAA 1OI4A 3I64A 5C18A 5DE3A 3KOYA 4JQSA 2IWRA 4YGYA 4FDUA 3OPNA 1GFZA 2F4NA 4IGEA 2QW8A 4XGNA 4XE5A 4DABA 1CY4A 3JRNA 1UBCA 3KKOA 2VP2A 3PXGA 2Z09A 5J47A 1UZNA 3T4XA 4CL8A 3Q1KA 3IT0A 3QMWA 1LRLA 1Y42X 1NN1A 4LHYA 5KJEA 3G2KA 1KY4A 1YB1A 3OFSA 4XUGB 4OSPA 4CKCA 5FNVB 4KWIA 2HMVA 2OCGA 4JLJA 2COUA 4PY2A 4AZSA 1E6UA 2RMKA 5HZKA 1ADFA 1R6VA 3B1JA 4F92B 3PF9A 3KD3A 1NI3A 2P8JA 2ORVA 4KQMA 4POOA 1U4NA 4C06A 2IOFK 3RC8A 2GMWA 1O3YA 4H4DA 3FCYA 4AKIA 3FLMA 2CUZA 3EXEB 3IDQA 2C3OA 2WQ7A 1P9OA 4HOYA 3DHYA 4F4FA 5JBIA 4GKJB 3I30X 3OOSA 1QQTA 1LTQA 1IIRA 1Y1SA 2QM8A 3NTUA 3QU2A 5EFZA 1SB8A 3MS4A 4HG2A 1LFAA 1GTJ1 3AR2A 3DHEA 4HWGA 4KR9A 4EATA 3AUFA 3MBOA 1V37A 2F9MA 1U11A 4N0PA 2AMFA 2RHTA 3E5HA 4IUDS 5REQB 3K9GA 2WWXA 3DEYX 3FUCA 3JWEA 4LNHA 4UPDA 2H29A 1R9MA 4WKGA 3IAS1 4XGKA 3FBGA 3UN1A 4JP8A 2XF2A 1B6TA 4IDCA 2YIMA 3FZGA 1CHNA 4P3NA 2EWVA 5H83A 1XQ9A 4URVR 5BWLA 3GP8A 3QEAZ 5EJAA 1VSVA 2PU7A 3IGFA 1E2LA 4K03A 5G1NA 4AJNA 1Q0HA 1SCAA 1QG6A 3NRJA 1RAIA 3MRTA 4TMVA 1IE3A 2FZ5A 3QVOA 1SVSA 2FMFA 1IY8A 3PA8A 1NBEA 4MI3A 4Q3EA 4DJTA 4ZEMA 1T5IA 3Q87B 5L4NA 1J0EA 1U80A 4RJIA 3RAGA 1AKEA 1DJPA 3HZHA 4FGWA 4ZP1A 4B45A 1YFKA 4Q47A 2FR1A 5A1TA 1L4MA 1I4LD 1FFHA 4AJLA 1S2DA 1YE8A 4LJ5A 4G1CA 4KR7A 1NXWA 1WKBA 3IQDB 1H0RA 3AJ8A 4L76A 2PSSA 3U4DA 2VPIA 4M89A 5KJFA 3O8CA 3ONFA 1JAYA 5EKTA 4UEKA 2JBAB 3VOTA 1JDNA 1FFCA 1K06A 3QKWA 2GEFA 2XCTB 1ZONA 4HYTA 4ENTA 4FQ5A 4ND8A 2O0KA 2DWQA 3AI2A 5BSRA 3OURA 3ZJ4A 3ONVA 3DLPX 1OPXA 1RJWA 1ZJYA 2X1MA 3KTAA 5D85A 5KSOA 4RVCA 5E9JA 4FJ0A 1QG4A 1YR8A 1H66A 2Q6VA 4MGKR 3UENA 4IMIB 1K4MA 2GCGA 1RRMA 3GH1A 4ZU6X 1T24A 4OU5A 3TZ6A 1H85A 1UPUA 2ZCUA 1XK7A 1EG2A 3GQVA 3JAWA 1UIRA 1WCXA 3RUHA 2VF4X 1OH8A 2OUIA 1BEZA 2C2KA 3EXHC 3VC7A 4EPRA 1RLOA 1NP6A 3UG6A 3PF8A 2JK0A 4YREA 4FLFA 4PCVA 4QYTA 4V0LA 3WJ2A 2GHTA 1DRUA 3G0GA 1Y0BA 3GRZA 5F9FA 1E4YA 2VPQA 2IHYA 3MLAA 4H6WA 2QTVB 5JXWA 2C4MA 4QTXA 1NDUA 1XA3A 3V6MA 3DHVA 2A5DA 2FFJA 4M1WA 1WBBA 4Q02A 2ZDHA 3MS2A 3VUFA 2YFQA 3OSUA 3GZNB 2EIXA 1BCSB 4GWLA 1LPMA 4HQ6A 5K3FA 1I1NA 1NN0A 3DB2A 2AMYA 2Q6OA 2ZTMA 3FCSB 4QGFA 1N6RA 5JECA 3AONB 3O4VA 4QGHA 4F3NA 3BH0A 3URKA 1WSWA 3SPXA 3VMFA 3HN7A 4Q3CA 4WXHA 3D8UA 2R48A 4Z3KA 1N5JA 2G67A 3B3QA 4HAXA 4QXOA 1GR0A 3V8RA 2DU8A 1Z8DA 4DLSA 1H65A 4NE7A 3K9LA 4OHCA 3N8KA 4JR1A 3CX8A 5JJLA 1BO6A 3A1VA 4TMWA 3RVNA 2N1BA 3OPYI 3UHPA 5E4JA 2JBHA 3PNMA 4LMAA 3RYIB 1R15A 2I3AA 1QTIA 1E3LA 4HNTA 5JZVA 4E70A 5FT9A 5K3CA 2BM9A 2VZEA 3ZNPA 3HRKA 2VRCA 2XYPA 1N34B 2E7ZA 1C9MA 4RENA 1UQUA 3DOFA 1C8KA 4RDXA 2P90A 5LQRA 1KRXA 3EY4A 4C2UA 4W5WA 4IF4A 4LGYA 3OD5A 4PNZA 5FF9A 5FL7D 1GTG1 1CJUC 2AMLA 1IU9A 2JH8A 1OC2A 3T5GA 4NU6A 4EHNA 1GKYA 3NTQA 1XMXA 4BXOA 1B8PA 2G08A 4QICA 2CUKA 3EVEA 4YJ3A 4HFMA 1FLVA 4XQ9A 1VL6A 4KV9A 1WW3A 4Q6BA 4CDRA 1M8JA 2AG1A 1MKYA 2OV2A 4TVBA 5ULLA 4L73A 1GT91 5E3HA 1KY2A 3FPLA 2ZBUA 4N1AA 4W7IA 4X1IB 3WHPA 5A5GA 3FETA 2VJKA 4PAOA 4UZSA 1UF9A 5TB5A 4B9EA 2DKNA 3I9MA 4BLWA 1XP5A 2AI1A 1PR3A 1JR3E 2QW0X 3I3OA 3NYQA 4JZYA 1CQZA 5DT2A 1Q0RA 1PGOA 4MUKA 5G0TA 1NVFA 2DH6A 1TRKA 3ZE0B 5IDWA 1GPKA 2VYVD 1G41A 1U04A 3QF4A 1W9MA 5CVEA 5JS2A 1DSSG 3HDYA 5DYNA 2QTRA 3VYUB 3THWB 4PGGA 5DBIA 5ER9A 5HS6A 2I4IA 3KZKA 1S02A 4EHKA 3DEJA 1ESNA 3BHMA 4PYIA 4CTKA 1MIOA 5EIBD 2KJQA 3KUCA 2RJ3A 4E5YA 3ZHXA 3FOEC 1ORHA 3EK2A 4AULA 1JHZA 1RWQA 3L8YA 2DLCX 3A1DA 1WOMA 1ZSYA 3PE3A 5JUWA 2D1YA 3O8DA 3E1GA 5G1PA 2ODAA 3QVMA 5AR1A 3DONA 3GXOA 4YROA 3ZDCA 1H8HA 2GH1A 1GCGA 2RBKA 3NKVA 2WJPA 4HB4A 1E1CB 3M33A 3ZE8A 1FDTA 3STYA 1E32A 1KJJA 4KX3A 4CF5A 1NW6A 4QGAA 3GEHA 4XCQA 4W1QA 5JAPA 1DRWA 1ND6A 2NSJA 4M1OA 1ZMXA 4P3XA 5EN4A 4QNMA 4IKEA 4Y6LA 3CVJA 3NCHA 4ZT7A 3ZHOA 3ZJYA 2VLIA 1GY8A 1XTJA 2QZPA 1NGSA 4LBYA 3E48A 4R84A 1AZSC 4YQEA 2ZU0C 5SICE 3ZDQA 4C7BA 4CI0B 2Z4TA 3BULA 4GX5A 4DLKA 2AVNA 5IKPA 3UT5A 4DR1B 5J63A 5K0JA 2IEYA 1SULA 3OFVA 2Z4SA 4OGLA 1MAAA 4YLYA 4HDRB 5EIOA 3UA3A 3C6KA 3HKDB 1LZKA 1E5TA 3KOZA 2R62A 1DDGA 4OI4A 1U0TA 16PKA 3EVZA 3IAFA 2PV7A 1WKCA 5D8DA 1NY5A 1EFDN 4IJUA 5E4FA 3ZY5A 1T1RA 5CA0B 5AVQA 4PZ9A 4DCSA 3BUSA 1VG8A 1H1TA 3G0OA 1WW8A 4PHTA 1GA4A 2EEZA 4P8RA 3DGFC 2H2IA 5TIIA 4AXBA 2JGMA 1XAHA 4YTEA 3UHJA 5CYPA 4BB9A 1CV2A 3N70A 1J0CA 3UH0A 3M6VA 3AWIA 2RHMA 4Z8XA 4C88A 5FTKA 2IZZA 4MJLA 1NF8A 5LZ8A 1OIWA 5FAKA 2IZ0A 1B2RA 1V8FA 2X1HA 5K8JB 1MGPA 3ZN2A 4BNNA 2YYSA 4ZJPA 1UXJA 4OP3A 3UJBA 4D3SA 3KJXA 3EFHA 1T5OA 4J1QA 5KVVA 4FOTA 4ZPXA 4CM8A 2QY6A 2XWPA 4QHSA 2A7XA 1VCMA 2OD9A 4WNYA 2I62A 2J59A 1HDXA 5AVSA 1WXGA 1ZCZA 3M6UA 2EYUA 2II6A 4RFVA 4DPMA 3O21A 3M70A 1KWGA 5K8TA 3K92A 3RSZA 1LV7A 1X7ZB 4RKQA 3W4KA 1V95A 2NAPA 1QK3A 3B48A 5FOVA 4DFDA 3AXTA 3N6XA 2RDMA 3NUQA 3O95A 4UVHA 1F8GA 4NOJA 5T57A 4WK4B 5G0VA 4BB6A 4E13A 4ER6A 4ZCPA 3HCNA 2HM7A 1W36D 5CVJA 2NU6A 2VF7A 1FS6A 5TXGA 4Q1EA 4Q24A 6AT1A 3COSA 4RHEA 5LSAA 1CERA 4RM3A 1A69A 1ZNWA 2IZOA 3HV0A 3RYCA 3HABA 3AG5A 4WXEA 1IM8A 2EBFX 2IHVA 4P5DA 1Q12A 1XCMA 1GSOA 2ODPA 4KQIA 4AIIA 2Z2KA 3LA6A 4MVJP 2OXTA 4JV5B 4JA2A 1LY1A 1MAHA 2Z57A 4ZPJA 4C6SA 4L7VA 1P7YA 2HWKA 4EB8A 2HF7A 1GGHA 4ZOAA 3TMAA 2E2WA 3ORYA 2V1XA 4GX2A 4YQFA 2GN2A 2WSLA 1EJBA 2AT1A 2YINC 4LZAA 1T9ZA 4GOKA 4X95A 4RH0A 4XYEA 4FW9A 2IQIA 2DKOA 1DOZA 5TY0A 3F4BA 3V8NA 4EDFA 1FMLA 4L4XA 2X77A 1UFQA 4GVLA 3VZPA 5I7RA 3SWWA 1QP7A 4PG5A 4AZ0A 1DKLA 4EHBA 1AHIA 1ID1A 2BTQB 4H7PA 4HEJA 4RSRA 2XQJA 1QQ7A 1H3NA 3LDHA 2ZRQA 4RIHA 2IDMA 1FFSA 2GN4A 2J3IA 3ZU2A 1QFYA 4AWBA 5KTTA 1PJ2A 5EEGA 3E4DA 5I4BA 3QX3A 2Q50A 2YYAA 4JLNA 3LF2A 3N7AA 4JWKA 1XUOA 2Y99A 4Q3KA 3W2GA 1I7SB 3R4CA 3QF7A 5AM3A 3SYRA 3A4MA 4YO8A 1XTZA 1T0IA 1USKA 1SHJA 4HH0A 4IOLA 4BNTA 4H59A 2CV0A 4LF9B 2R1VB 3DL2A 2OHJA 2YWJA 2FSUA 3ONDA 4UNQA 5CFMA 3LNCA 1KZ7B 1CIPA 2RKBA 2ZTUA 1TL7C 4TTSA 3N58A 1QVVA 3U7QA 3ELYA 3R9KA 4C5BA 4QDZA 1K86A 3PA6A 1SU7A 3QJGA 4RW0A 4H4EA 3SE0A 2GHRA 3VXKA 4D7AA 5IPFA 1ODIA 2OWEA 4LJSA 4ZC1A 1SBTA 3WTCA 4BC0A 3MPUA 5KHLB 1AU9A 3M49A 5U9CA 2PV0A 3VNAA 1KYQA 1F8XA 2VRBA 2W6JD 3A9CA 4GRAA 4Q34A 4BNYA 3JAKB 4G2NA 4LF7B 2BGWA 5FWDA 1W35A 5DLDA 3II6X 1SCIA 5A6SB 1U28C 5AHRA 2BPOA 5FA5A 4R8LA 4Q5IA 1BTOA 1ULBA 3AEZA 2F9FA 1OI7A 3BGVA 3AKZA 1HE4A 2BDUA 4UPEA 1GZ6A 1MH1A 1AMUA 1E3QA 4AKGA 1HKUA 1F0NA 2JKYA 3JQQA 1W1WA 2GZAA 1N9KA 3U0BA 2VK2A 3W5IA 3D3JA 3BYZA 2BFBA 4ND2A 4DZTA 1NG1A 4L6IA 1P8AA 5KCZA 4LDZA 2VKTA 5C1DA 2JL1A 2YFKA 4EG0A 3SS8A 4QUBA 5A5VA 1C5KA 3RG2A 5IF3A 5MDHA 2IYVA 5BV2P 4G0UA 1HLGA 3O4HA 1EDOA 2PZBA 1YJQA 3K73O 4NICA 1YZQA 2J32A 2O8NA 5KQPA 2P4HX 2DR0A 1LBQA 1YS1X 2O2GA 2Y1LA 3B1XA 3OEED 4WXMA 4D46A 3GLGA 1X15A 1XLUA 3WGLA 4ED9A 5J43A 3D4BA 4HLUA 1WDMA 3ET5A 3WFIA 1V6AA 2DJIA 2GAJA 5JXGA 3NEPX 5KC9A 2WPDA 2NZWA 3RV4A 1OPRA 2VP9A 4XX1A 4CV3A 3UK2A 4PQYA 3Q0IA 3KQPA 5J5VA 4AP6A 2D0PB 1S5PA 4YAEA 2AKEA 2VAXA 3X43A 4EQ6A 3IBYA 3KQUA 3UA4A 3N2KA 4YRRA 2G82A 3PT9A 2PSEA 4JEIA 4OSEA 4FKBA 4JYMA 1D0VA 2QJFA 2CXQA 1SVIA 2WM3A 3QPUA 1NQAO 2JZNA 1KDOA 3IAXA 1F2UB 1DMSA 5AVRA 1YI0A 2ZQYA 1QIJA 2WU1A 2G1PA 2QXTA 4LZZA 2FP4A 3LTNC 4FFPA 3BBLA 3E23A 2G9UA 4D9EA 1KA9H 3C3KA 2VDMB 4XLLA 2O3JA 2C58A 3UOGA 1UOOA 4ZIRA 1U99A 5TNXA 4JVNA 4N3NA 3T5AA 4XYBA 4ECEA 3I39X 3L0CA 4OK6A 4RTLA 3MWDA 1GL9B 4HLDA 2YZ2A 4NHEA 3D8HA 1P0CA 2EFHB 2ZQZA 3CKLA 4LYAA 4LYHA 4JY7A 1QLJA 3I12A 1PD0A 2A57A 4JUAA 1A4IA 5K8LA 3G5MA 5T64A 3VFDA 1QYDA 3GOHA 3PFCA 1KSJA 5H1YA 1TYCA 1L4NA 1IY0A 1VZ2A 4OLHA 1I94B 4Z4EA 2QN6A 1VDMA 1SHLA 5MHTA 1BHQ1 4CKBB 4R68A 3D0RA 2NU8B 2BYTA 1W6UA 3K72B 3RO7A 3PHGA 4I4LA 3GJ5A 2FPPA 1JQ5A 2BWJA 3VPSA 5LLSA 2J5BA 2PU5A 3O1JC 3SN6A 3ZDAA 1AVTA 1WG8A 4N49A 3DQPA 4PBRA 2X9GA 2CFOA 3WWYA 1TJPB 1GL3A 4ZGWA 1E4EB 4NECA 1GR1A 2WHRA 3BD7A 1FK8A 1SBQA 4KL8S 1U8TA 5EPEA 3TUJC 1V9CA 3K0AA 3MINB 4ANFA 1ORIA 2G1JA 4Y2XA 4AZVA 4YDHB 1X1SA 1T2FA 1ZICA 3PFIA 3H75A 4RHUA 4K2AA 2RHGB 3R7WA 1JLMA 1ODFA 1RWWA 3B2EA 3PRYA 2QM0A 5A3VA 4JQCA 5B3JA 5L3VA 4B3HA 3UWSA 1GL6A 1JKMA 4B81A 4D99A 1XKTA 4AI6A 2FETA 2VJOA 1K6EA 3LUAA 4H1WA 3B9QA 2KI5A 4QLOA 3F6EX 1FDOA 1MN6A 3JX9A 2JAXA 5ADWA 1UC5B 2Q0HA 2R00C 4HPWA 4LHXA 3ONNA 4PC7A 3MHTA 3ZWBA 2IYFA 3FYUC 4RL4A 1R4NA 1G98A 2UYQA 1WXQA 1IZYA 2VP4A 3UHFA 2ABWA 4BEJA 2Q5OA 4LHVA 2JI4A 2WV7A 3ABRB 4QDKA 3UJCA 4F5YA 3OZFA 3Q6IA 1JQLB 2CF5A 4NXMB 2Q9BA 4CL3A 3N76A 4WOBA 2I4MA 4Z4HA 1YRAA 1KR5A 1J1IA 3L8EA 2WWIA 1SOAA 3IUPA 4HZGA 3Q9SA 1FNNA 4FFWA 1WHTB 1JDBB 3HY6A 5KYGA 4CCYB 1Y6FA 4H7KA 4U5XA 4UM8B 3IQEA 5LOVA 1YWGO 3GBVA 1M5TA 4DDTA 1W30A 2JASA 1U0HC 1KJNA 2BLNA 4EPTA 4OCZA 2I91A 5C8YB 3ZU3A 4Q9HA 4CKWA 1WX1A 3PDIA 2MYPA 1RHUA 2C9YA 4PZPA 1MTZA 5CDFA 4B6PA 1IZ8A 3ETHA 5JDCA 4NH4A 4YYZA 3JWJA 2BE9A 2AH5A 2YRFA 1C8LA 1I9GA 3JQPA 4DAEA 4ESVA 4O2BB 2FE1A 4CIYA 1FTNA 2OK7A 3RKRA 3T3OA 4NMWA 4MQ4A 5A5FA 2YWXA 3JCZA 1OFUX 4TLEA 1UJ5A 2Y9PB 5LYJB 4RVGA 2XXAA 3M9XA 3RADC 1HDCA 1SUAA 3I0ZA 3LHIA 4NOMA 4BQSA 5HM6A 4RTMA 1ZMBA 3TLMA 1RP7A 1TO1E 3NIWA 3PIDA 5FTLA 3OECA 1TOAA 1O2DA 1QORA 3MUNA 1MOSA 3RC3A 5B4TA 2XNJA 4JU9A 1BROA 1U8UA 4QM6A 4K3VA 5GJBA 1FP6A 5EHQA 2X42A 3BFPA 1W93A 4KMSA 3FMVA 3RGGA 2EJVA 2R1ZA 2VI5A 5DP1A 1CJKC 3T3PB 4DYVA 1XLWA 1RBZA 5AW1A 3L0SA 4QBFA 2NQ2C 1PYOA 5L53A 1U6IA 3C8DA 5EE0A 2O2ZA 1J90A 5BOSA 2GM9A 2ZAIA 4JWTA 4R7ZA 3ER8A 5DBOA 1B7GO 2QI9F 1T29A 4UUBA 5T3UA 5HG0A 2IRWA 4DC9A 2PO7A 5H4GA 2O14A 4H3SA 3DZGA 4DR2B 2ZJ7A 7AT1A 4OOEA 1DIOB 1XD2B 2J48A 3OWOA 3R2JA 4RVFA 3DE7X 3RC7A 3AP1A 4S1PA 5DF1A 1NVGA 4L51A 4PSUA 3RT9A 3ZGNA 3KM0A 4YRSA 2Q5JA 1N5IA 1RHMA 1SQGA 3O73A 1JAHA 3LVQE 3WQHA 4D9JA 2ZJBA 1UEIA 4H1UA 3M7IA 4IH4A 3SIWA 3T1VA 1GTL1 1LFDB 3IALA 2BMAA 4JU8A 3MS7A 3N86A 2V58A 4UPVA 4YJ3F 4CLDA 4ENSA 1GQRA 1MDFA 4GMKA 4AO7A 4CVNA 3ZVKA 1SU6A 2YWEA 1V43A 1T15A 1P3DA 4RU1A 5CITA 721PA 4DLLA 5IJWA 4Y2VA 1YDHA 3FOCA 3PBKA 4GMXA 3VGPA 5J4LA 1ACLA 1C7IA 1DKPA 4YP9A 2Y4NA 3EPJA 1B15A 3HDJA 1PEAA 3DCYA 1T8YA 4NZYA 3ANXA 3PG5A 3AVOA 1NC1A 2O0LA 3O91A 4LJKA 3REQB 3MJTA 2V6FA 4X8OA 5HFNA 2WR8A 2ST1A 3JD3A 3OZEA 3QA9A 2Q62A 3DLAA 1V2GA 3K09C 1VMIA 3QH4A 3TWOA 4WEOA 2DSNA 4ZHQA 2ZT8A 1D2HA 4NCXA 1XN1A 2IHKA 4PHCA 1V11B 1JR3D 4FYWA 1RNLA 2AWOA 3E03A 5DGCA 3T9AA 3P5BA 5KJ6A 1AXRA 2OG1A 3SQLA 2C7RA 1RYFA 4CKXA 2GEJA 3SEAA 1CYDA 3OE1A 1KYZA 3V9AA 3ISTA 2I8CA 3O2NA 1DU4A 3H9EO 4KUGA 5DNDA 4A8HA 3PNVA 4YPOA 2QE6A 4V0RA 1DV2A 3F4KA 1KI6A 2OCKA 1IQRA 3QBVA 1FFXB 1KI9A 5JNRA 1LJ8A 4W5RA 2O0HA 2AMJA 2D6FA 3F1LA 1QWSA 4B3FX 4N76A 3VR5H 1V5IA 2C84A 1QH8A 3IR5A 5FOSA 2C5HA 1RMQA 4FOOA 1U3CA 2B82A 3WL7A 2WSSD 1GUYA 3NAMA 4JOBA 5DX8A 5ENVA 3BE6A 3HJRA 1E2FA 2OFXA 3QE2A 2DXIA 2Z8ZA 3K3PA 3IKMB 2HA2A 1MO5A 1RBYA 2H7XA 4E30A 3CURA 4LFBB 3VDQA 4GZ5A 3PC4A 2AG5A 3CF4A 2JH9A 2D2XA 3HEBA 3FD8A 1W2HA 4B7AA 4MITA 5E0OA 4KH0A 4G89A 3TAUA 1C4KA 4WNCA 1FLNA 3C74A 4M8IA 4MW1A 2I87A 3G17A 4X92A 3NI2A 1M8GA 3ABQB 4OD0A 1IPFA 1NVUQ 1PSZA 1E0JA 1QIIA 1W52X 1XDWA 3FH0A 3OQ1A 4YCAA 1RPAA 1P0MA 5FLXA 4DUYB 1H6AA 2VSOA 3ZQUA 4FMPA 4QOHA 3P5SA 2ZJ4A 3C7DB 3ZLBA 3P0FA 1KFEB 1RPTA 2B92A 3PKIA 3BWMA 4UNIA 5EERA 4H7FA 4UJ3A 3FPEA 3KETA 2BTOA 3I72A 1PJZA 3ZGXA 2ZXFA 3WLPA 4H6PA 1GG5A 1Z56C 1NVXQ 2IEAA 3GPBA 1HDIA 1UZUA 2WKQA 3CG0A 4B35A 5A4JA 4ETNA 4DWOA 1T91A 2P5YA 2TRSB 4BLUA 1IXZA 3B7PA 4QDTA 3AUSA 2WAYA 3QI2A 1YDFA 2IPMA 5IAKA 2VDOB 4EY3A 1E1DA 3S68A 2C2BA 4YIHA 1RHQA 3DVAB 5CNJA 4URWR 1I2DA 1AGRA 1LCIA 2C7QA 4DLUA 4LC0A 3WIDA 4XYGA 1I30A 4O2RA 5HBRA 2B94A 2M1XA 2PQ6A 5DM60 2B4KA 1H5UA 1NC3A 1QHNA 1S4QA 2ODTX 1XKQA 2WM2A 2OOKA 1EFHA 3NBFA 3PQFA 3TRJA 3H11A 5FL7A 4ZYWA 3RIGA 1SN7A 3AHGA 2ZUTA 2YJGA 4LC9A 2OG2A 4PRYA 1TB4A 4QO7A 3RRMA 4WH0A 1RYZA 2HLHA 4JNKA 4TRJA 4DYHA 3VKHA 4O4HB 5BXQC 2QK4A 4GUDA 5BQPA 4UXHA 4IIVA 3ZZMA 3OOHA 5HOEA 1JR6A 3NJ4A 1LQ2A 2W2PA 1PDWA 3OFND 2DUWA 2CVOA 2BEUA 4OFBA 1Q14A 1JDZA 4JJIA 2H3HA 1JS1X 5HX7A 4Y1RB 4DNQA 3FNIA 3DZKA 3IIMA 1RW4A 2BKVA 3QKUA 1Q50A 5L95A 1JKJB 4IWXA 4M60A 3OLYA 1UBGA 2VYVA 3DBIA 2ZAGA 1RKBA 2ZULA 3I3SR 3LP5A 3RS8A 1L7XA 1UFOA 4E7OA 3HEAA 4QPNA 4G4SO 1PS8A 3ILSA 3KQYA 2FMXA 4J2OA 1KFBB 1P39A 5DM0A 3UHOA 1B8VA 4KI7A 1S2NA 4CM7A 2IYEA 3GT7A 3REFA 3AIIA 3OMWA 2PM8A 4CM4B 4L9AA 5LC1A 5D1HA 1HPLA 1RQXA 2ZR0A 3WNZA 2X2EA 1EWVA 3NIFB 4MP6A 3BQ9A 3H19A 3KAKA 2FSPA 3WA7A 2I4TA 3EZ9A 4X1KA 1SXHA 1Z28A