2IA5A

T4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
297
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMNGPYDLCDTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polynucleotide kinase
publication title Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase
total genus 93
structure length 297
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ia5A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ia5A02
5DN6A 4Y2VA 1JR6A 1KO8A 4V03A 1YNSA 1YQTA 4BWYA 5BXQC 4BEWA 2O8CA 3EARA 2FSFA 3DKVA 4GP7A 4MGIR 2DHRA 3NVAA 5AIAA 3V4RA 1Y63A 2OCPA 1WXQA 2AX4A 3R20A 4FWTA 2QT1A 4ZO4A 4RETA 2ZM5A 2GXAA 4M1MA 1Z0FA 3L5KA 3DMNA 2VL7A 4NHOA 2JDIA 4I4LA 1Z4KA 5AVXA 1YVDA 3V4FA 4YXWD 4US0R 4BFXA 1U7PA 2OG2A 3TKLA 1HYQA 4KN8A 1G17A 5FBVB 2FPXA 1N0UA 3CZQA 1T3HA 3U44A 2O8BA 3VU9A 1T5TA 3TE6A 2BWJA 4LHZA 2HF7A 4EELA 2O8DA 4OQXA 4IVPA 5G40A 1PUJA 2ZI3A 5JJLA 4U5XA 1E9AA 1KSGA 1MO6A 1XRJA 4UAVA 4JKIA 4U7DA 1FTNA 1FNNA 1Q20A 4UM5A 1P2UA 2N46A 1Z4LA 3SMVA 5AHXA 1HH4A 4JDPA 1XD2B 2BVNA 3LXXA 4PANA 1T4GA 2GK6A 1U8ZA 4F7WA 5LPNA 4DT1B 1EFHA 1S4QA 1G8GA 2XJ4A 1Z6AA 3ASZA 4Q21A 1DVRA 3B9PA 3B2EA 3VX3A 1UEIA 3U7FB 2IK8A 1XPOA 2F55A 1MABB 2E87A 1EFTA 3AR3A 4CEHB 4NWIA 2UZIR 3HYTA 4PQFA 1SVSA 2VO1A 2ZAMA 1IXZA 3A4LA 3LBHA 1CEEA 4CEJB 2OCYC 1T5LA 4Q4HB 1Q0UA 2W6JD 4JLBA 4PZYA 4WW0A 1TA0A 3OCXA 3SDZA 3ONNA 1GL6A 1UF9A 1TMKA 3MMPA 5A3SA 2J45A 1HE8B 3OESA 1YZNA 3KQUA 1E2QA 4F93B 4F72A 1VCMA 2O52A 3W3AA 2WIBA 3GYGA 2HT1A 1PLKA 1A2BA 2ZVQX 4OQLA 1EWQA 1XVIA 1ZS9A 3EZFA 4G0NA 1IQPA 2GCOB 2ZS9A 3BH6A 3C16C 4IXMA 3U5ZB 1FUKA 4N0EA 3PEYA 4HLCA 3A1VA 1XB2A 2ZRHA 3N2EA 1NN3A 5JEDA 1NVVQ 1OXVA 3M1YA 3GLIE 4LHVA 1E2DA 2NMVA 1U2RA 5CB8A 1DAHA 1P9RA 1RMYA 4XSHA 2HHLA 1U0JA 1P72A 2V6JA 3GJXC 1DARA 5B30A 5IHPA 4IXNA 1XEFA 1XTSA 3PIRA 4AIIA 1L6RA 4BFTA 4M1SA 1Z4PX 3EPRA 1FX0A 4I1UA 1RVDA 1WVIA 4QGGA 3K0FA 3DNPA 3SZRA 1LF0A 1OH5A 3TQFA 2IS1A 2VIIA 3NXSA 4GZMA 3SJBA 1VHLA 4Z54A 5AVZA 2QP9X 3PCTA 2F1RA 3WHLA 1TTTA 2C9MA 4C0LA 1KO1A 1NLZA 1MR3F 2HCFA 2GHTA 3QG5A 1L8LA 2ZRAA 3D6JA 4QJBA 1E2IA 5K8IA 3TQCA 3AR4A 3ZWDA 5FPSA 1RW4A 1QHHB 3PUXA 3TMKA 4A2PA 2YJ6A 2BV3A 2ZR0A 3NDBB 1TEXA 2QLTA 2ZYWX 4TQAA 3RRZA 3FPAA 3VMFA 4B44A 2JA1A 3WBKA 1GSIA 3ONWA 3QU2A 5JJIA 4D0LB 3OIVA 1W1WA 1W48A 3QNUA 4V0NA 3WMFA 2BMJA 3U60B 3ZVMA 3F8TA 1IXSB 4NBSA 4V0OA 1J70A 1Z88A 4B6JA 4WZAE 3EPJA 3N8GA 2JDID 1G18A 3MJRA 4IDNA 3S1AB 4O2RA 4ZCLA 5HZHA 3GLFB 2ERXA 4QBHA 4MGYR 2OXCA 5HZKA 3PCRB 5C4MA 2YJ4A 4D2IA 2WWHA 3U3RA 1II8A 3EA0A 2D3WA 4B73A 1ZD3A 1TQDA 3Q5DA 4M22A 3THWB 2W2XA 3RHFA 2W2TA 4D4KA 3A58B 3HPQA 3EIQA 4G5SA 2B82A 1FPMA 1GRQA 3GEHA 3ZZ0A 1TJ3A 2D62A 1XCMA 4AG6A 2QAJA 2OAP1 2G9NA 2CJWA 1KYTA 1CJVC 2IEZA 3KJEA 2MSEB 3RVBA 2ZUBA 3IKJA 2BBOA 2ORWA 2RB5A 2H18A 4TQ9A 3DPUA 2YV5A 4HAYA 5EZ6B 4UJ3A 1CIPA 2NO5A 4GOXA 2AL7A 3AF4A 2PH1A 3OIWA 3PVSA 2EVWX 3UATA 4MRNA 4TLAA 1SVWA 1AKEA 2QORA 1S9HA 4EPXA 3OPXA 3FMIA 2ZSEA 2ZITA 4JVSB 3AH8A 2FFBA 1A2KC 1FP6A 3P1JA 4DC9A 1GM5A 2PLFA 1YJ5A 2A9KA 1NNLA 1UBFA 3MSXA 1OYWA 5K8TA 2F3RA 3DM5A 4MKHA 4OQNA 1UKEA 3OAAA 2QM7A 4US2R 1QF9A 2W0SA 1WPGA 1P9WA 3CNNA 3K0AA 4M8NE 1R5OA 4OBEA 4BLSA 4XTCS 4CYMA 2YBDA 4PPGA 2ZXEA 3UIEA 5AVYA 4TLCA 3I62A 1V43A 4MKIA 1SXJE 8OHMA 5AW5A 4DSTA 3PEUA 2RGNA 2BKUA 2HUPA 1P3JA 4QJ3A 5ELXA 4IDQA 2V1UA 4IVQA 4FFDA 3CRRA 4FXPA 5ALPA 5ALZA 1E2FA 4Q9KA 3BOSA 4DBLC 2V8OA 2J41A 2JJ1D 5SZJA 2J87A 3EZ9A 2FNAA 1YZKA 4DLTA 1H8ED 4FW9A 2GWHA 4IDOA 4QJ4A 5KUTA 2VA8A 5FTMA 1ZNXA 3I5YA 2RGCA 4BQSA 3H84A 1HT1E 2ZUDA 4LV5B 5CM9C 3FVVA 4AS3A 1NF3A 5AK0A 4Q5IA 1TF5A 3VR2A 2X2EA 3IO5A 4PSAA 4PR0A 4LPKA 5B57C 1UAAA 2A5DA 2RARA 1N6HA 1VG0B 3EF1A 4G01B 1WA5A 5C2JB 3CRMA 4Q1FA 1U02A 1XXHE 4D0GA 4NYMQ 2AUTA 2ZRCA 4I1OA 2QP3A 1G5RA 3SJZA 5L8VA 2F6RA 1IN4A 1NRWA 2H5EA 4TMKA 1Z29A 1II9A 1TF2A 3TVTA 3TW4A 5SZHB 5FTJA 4MITA 4A92A 2LKCA 4Q66C 2G88A 3ADKA 1BKDR 1Z22A 2AXNA 2B8WA 3D6TB 3UG7A 3BS4A 4DCSA 3L0PA 2RGDA 5CK5A 3HPRA 4Q4JB 2KSQA 2VHUA 2VYFA 3FMFA 4OJKA 5FTKA 2R6AA 4D4MA 4BGDA 3FPBA 5TB5A 2XOKA 2R8YA 3NALA 2NQ2C 2NZ8A 4PHFA 3WP1B 2JAWA 4PZZA 1QVRA 3W6PA 4GMDA 3WBJA 221PA 4D81A 4R2IA 4LBVA 4ZDKA 5JSZB 1G3IA 1YR8A 2G80A 2ZYTX 4QFMA 5FI0B 4XQ0A 2GFHA 2GCNA 3N07A 1WCV1 3UMRA 2HV8A 2VBCA 3OFND 4FCVA 2HOQA 3EA5A 3TW8B 1BOFA 1Z07A 2FGKA 3M1IA 2ZETA 2WWIA 4TLDA 3DVLA 3SHFA 5JRJA 1K5DA 1Z06A 1NY6A 2AWNA 2FV8A 1ZM4A 4IRUB 5D3QA 5AI0A 4YCNA 4DLYA 3EPKA 2QP4A 3BFXA 2OBLA 1Z4IA 3HYCA 3FTQA 1N6IA 1NVVR 1J7KA 2C4NA 3TSZA 2ZBEA 1L4YA 2XITA 1X6VA 5TARA 4B3BA 3CBQA 2ZANA 1UPTA 2YC2C 2WPDA 1VYTA 4HB2A 4XWKA 2IS2A 4JLKA 1P2TA 2C77A 4LRWA 4MA4A 2JLVA 4GOJA 2MU1A 1WBDA 1CU1A 4RD1A 2DWOA 1YZGA 2R44A 2WJHA 1M1YE 4IOLA 4PQRA 3TGPA 3E70C 3QUQA 1R8SA 4XJXA 2WTUA 4TZ0A 1U0LA 3A1CA 2ZRPA 1XP8A 4W9MC 2CLCX 1N5JA 3CX7A 1IY1A 1E96A 2ZRFA 4Q7MB 4KVGA 4OKSA 3T1OA 5J4YA 1XTRA 3GLGA 4PNHA 1ZCBA 3FKQA 4RSGA 2WSMA 4PQYA 4TYQA 4BASA 1E9CA 5SZKB 4DDVA 4KBFA 1PVOA 3R8CA 2OBBA 1U9IC 2QA5A 3RYTC 3LDAA 3W34A 1S8FA 1KJWA 4M21A 1LB1B 2R2AA 4A0HA 4HGQA 2ATXA 2ONKA 3MJHA 1PLLA 3R7WA 4PHTA 2BDTA 1SULA 2RAPA 3S6JA 2GTPA 4FCTA 1FEZA 2WKQA 2BM0A 4Y3UA 1RDFA 1XP5A 5JWRA 2KJQA 2FEAA 4BX0A 5ALFA 1E2NA 1KK0A 3K9GA 3FKSA 1RKQA 1T3LA 1KJYA 2ODBA 5TXGA 2GZDA 1R2QA 5FOSA 2FDRA 4LJ7A 2OT3B 4YONB 4CEIB 4LV6A 3UMBA 2FPKA 3MN1A 4ACAA 1RJ9A 2D2EA 2ZE7A 3T5DA 4PPQA 1ZIPA 4UXHA 2ZI5A 3GJ0A 1F2TB 1EFRA 2HCJB 4D26A 2IXGA 1ZNYA 2WWXA 3PFIA 4R9UC 1DOAA 4Q1DA 3KXLA 2VP5A 3B1VA 1GL9B 2C9CA 2WOJA 3L43A 5EXXA 1RRFA 2OLKA 3K0CA 2I7DA 3QXJA 5KDDA 2AFIE 3QKSA 4ON9A 2ZOSA 5TMPA 1E9EA 1N6LA 1EGAA 2GK7A 2XOKD 1UKVY 2J59A 3OF5A 4URUR 4EFNA 4A15A 4LWZA 1Q3TA 2ZROA 3WKCA 1WZCA 3BD9A 1D9XA 2H1LA 2IYWA 2D06A 4LOAA 3K9HA 2EWVA 1Z0JA 3QF4A 1F48A 3D31A 4WAUA 4A8JA 1RE0A 3TJZA 3VTKA 4F92B 3QU7A 5AW1A 2SHKA 2QTHA 5AI6A 3U13A 4B47A 2PEYA 3FHTA 1XMIA 4GI7A 4G63A 1VFPA 3THOA 2QE7A 1CTQA 2XAUA 1QQ7A 4JL5A 1BYUA 3A8TA 2GBLC 4QGHA 1W4AA 4MKGA 4ZDIA 2C8LA 2W4MA 3D8BA 3E8MA 5T41A 3VR6A 3W8RA 4OK5A 1F2UB 4RJLA 5JRZA 1WR8A 5AW7A 3THXB 1E0KA 2FG5A 3QEJA 4GP6A 1NJGA 1KAOA 4HYYA 4L9WA 3EC2A 4CT4B 1LS6A 3AVWA 4P4UA 3GLIB 5ALRA 2WPDD 4DCTA 3WHKA 2WOOA 3U2QA 3W6OA 1NNEA 3CB4A 2CVFA 1W4RA 2MSDB 4LJ6A 4XE5A 3C5HA 1Y8AA 4WBSA 4F4JA 1QBKC 1VCNA 1SXJC 5AK4A 3RS4A 3RS5A 4JYCA 3MPOA 1KI6B 5FTLA 2JEOA 3GEEA 2R65A 4PC7A 3UMCA 3ECCA 4FMDF 3LQQA 1KI1A 2HLDD 2IA5A 4Q9LA 3IHLA 2VKQA 3HLTA 5AW4A 4NFLA 4ESVA 2B1QA 1VG1A 3C14C 5DIFA 2D4HA 1RRPA 3A4MA 2WM8A 4S35A 4B76A 3GLHA 2JJ8A 3THYB 1OV4A 4URXR 3M0EA 3H4MA 1YZQA 3IIJA 3UK6A 2RBKA 1U99A 5A3QA 3BA6A 1D9ZA 2GEUA 2GETA 3LA6A 3N2IA 4EIWA 2W58A 2QQ0A 2ZJOA 2MSCB 2X19A 5CK4A 5DYGA 4AY2A 4HAWA 1P75A 1N0WA 3BAFA 4V0MA 5AJZA 3FPSA 4XSGA 1H8HA 4PAMA 1IN7A 1TF7A 4JVNA 3SFVA 3QF7A 5FH9A 5DLQC 2PEZA 3B9BA 3FKSD 4TSFA 2F7SA 521PA 2DB3A 2JATA 3KD3A 1XEXB 4S2EA 3BH7A 4RKEA 1FOEB 1G8FA 1QHGA 2EU8A 2B7BA 1GFIA 4IEEA 2YJ5A 3TNFA 5HE9A 1O03A 1VJRA 5TDHA 1KMHA 2P6NA 4DKXA 5IT4A 3PV0A 1E2KA 1G41A 4OCZA 4X8OA 5DE3A 4BEBA 1CJMA 1EFRD 3K9NA 5TV2A 3C15C 2AFHE 5JI2E 1R5NA 4MWOA 3JVUA 1XCPA 4YQFA 1G7SA 3QNMA 2JLSA 1VHTA 1OKKA 4LBZA 4RCZA 4C0KA 3GP8A 1GDDA 5ALUA 3IPYA 1NG9A 2VLIA 1PV4A 3SJAA 5AICA 4JLDA 2CK3A 1D2MA 5DISB 2BMDA 3HP1A 4M0LA 4PTLA 1Q1QA 4R7ZA 3AF0A 4ASUA 2DBYA 2ZVPX 1OIVA 4RFVA 3E1SA 3SHQA 4AS2A 1Q44A 2VHCA 3CO5A 3ADDA 5EE1A 1F60A 2ZSAA 5CDFA 3SHWA 2XXAB 1NJFA 2QE7D 1M34E 2QT0A 4Q02A 4DLUA 2YYZA 4M1KA 2R6CA 2QBYB 2IOFA 1KDOA 2C9OA 5ALJA 4KYIB 5KSZA 4CGZA 3CRQA 3A1DA 2R6GA 1NKSA 1DTSA 3ND8A 4ITRC 4Q47A 3TSOA 4EQ6A 1F5SA 2FE4A 1TU3A 5J4KA 1Z0DA 1SXJB 2RCNA 4CF4A 2O2XA 2QUZA 3BGWA 3UPUA 1G7RA 4UNQA 2LWIA 3ZIAA 1ODFA 4EPYA 1N6NA 2HXSA 2Z0MA 1XTIA 4HUQB 4JB3A 1T6NA 1ZD1A 5E7IA 1E1QA 3DEFA 4DLRA 3ED5A 4ZV4A 5AW2A 5AR1A 4BECA 2FGJA 4NCIA 4RD3A 3AM1A 3SYKA 2ZJBA 4LUCA 2OZEA 2RMKA 5JWHA 4U02A 1Q1ZA 1AZSC 4O3MA 3GD7A 2P67A 5LD2C 4WOPA 5UKDA 2IF0A 2QZ4A 2IBMA 1R0XA 2P3SA 4HLUC 4URWR 1XXHB 1KK1A 1QRAA 3VNUA 2AWOA 3QX7A 1TAGA 1IY2A 1KYIA 4QKQA 5ALVA 1DAIA 3NH9A 2RGGA 2KE5A 3ICEA 2B8TA 3K0SA 4O2LA 4JKYA 4NKRA 421PA 4HZUB 3MWJA 2OXRA 2ZJ5A 3BORA 4XTRA 5FUWA 4C0AC 1GOTA 4BX3A 4KU4A 3SLRA 1VTKA 2CE2X 5KSOA 1T9ZA 4TSFD 1BS1A 1XDBA 2VRWA 3QENA 3FB4A 3KFVA 5JFGA 4LJ4A 2WJGA 2IF2A 3I1FA 4KYUA 4YDHB 4Z8YA 4PPFA 4HUTA 4L16A 3BXZA 5JECA 1RLTA 4UAUA 4ZEVA 1TUEA 1ZUHA 2KBFA 4Z1MD 5BN5A 2VF7A 1CXZA 1E2JA 3KX2A 2B0CA 5P21A 1UJ2A 4Y2RA 2GA8A 1G3UA 3CPJB 5KO2A 1W7AA 3AR8A 1VPLA 5JLJA 2WJVA 1N6PA 4W7SA 3TUZC 5AI4A 1KSHA 1R6BX 1KY3A 1EFUA 1RRGA 2Z4RA 3EWSA 4CZ2A 1WP9A 2QN6A 2ZI7A 3CZPA 4GNKA 1CRPA 2G3YA 3IHWA 4IHQA 1GRNA 3UWKA 5AW9A 1BMFD 4TT3A 3PDWA 5EUMA 3KKMA 2J1LA 1N25A 4ASUD 1N6KA 2ZU0C 1YR7A 1G20E 2CN1A 3WK9A 4OHXA 1L8QA 1Z0AA 2H17A 1S1CA 1VKJA 3GJ4A 4JLVA 5KDLA 4BFZA 821PA 3AVYA 3L8HA 2J7KA 4NZYA 5BW8A 5J4HA 2O0JA 1R8QA 2QAGA 3CW2A 5G3ZA 5IRCD 1OJLA 3OIYA 3U4QB 4ZKEA 2HJVA 1U8YA 2N42A 4KFRA 4TYPA 4PXAA 1SVMA 4KFSA 2ODEA 2V9PA 3FZQA 3VNVA 2ECKA 4D80A 1G3QA 1RKUA 3ET5A 1G19A 1MO3A 3HDTA 2O8FA 1P61B 1U7OA 1DS6A 3BC1A 4KXFB 1ZD4A 1EESA 3LVRE 5FBRB 4IKEA 4PAOA 1D6JA 1SHKA 1T0HB 4FMCB 1T5SA 3TAHA 3AKCA 1SWVA 2J0QA 4LGMA 3RSLA 3ZIAD 1RMQA 1YRAA 1R0WA 3EF0A 2IUUA 5JWOA 2RHDA 1QH9A 1EX6A 1XFAA 3GJ8A 1X8LA 5G41A 2FSHA 5LD2B 2AK3A 3T06B 3M6AA 4CEHA 3NDPA 2Q5EA 3RS7A 4KAXA 4KITB 3LLUA 4Q4HA 2P6RA 1E1RA 2BBWA 4NV0A 3WK7A 1TL7C 1AQYA 1TX4B 3ZU6A 3LNCA 4DWJA 2OV2A 1T9HA 1A82A 4UJ5A 1TEVA 3NH6A 1Q91A 3MAAC 2OA0A 3MD0A 3ZQ6A 1DELA 1R0YA 2ZE6A 1KDRA 5GJWC 4PAQA 1RFLA 3I1YA 5FOXA 4DCVA 4JLJA 2ZE5A 1P6XA 3WP0A 2WMOB 2O0KA 1OPXA 1IXRC 5DI3A 5AK6A 1HA3A 3GEIA 1AGRA 2DCUA 5LDDC 3U6KA 1XU4A 4Q48A 2ZREA 3IIMA 3Q72A 4QC2A 4TMXA 5L3SB 2DY1A 4NYIQ 2XTZA 2B1RA 5BN4A 3MUFA 2HYIC 4BNDA 1KSFX 3EZ7A 1Q21A 3LVQE 3HU3A 2MMCA 3NC0C 3RRMA 3GLGE 3R8FA 3K0EA 4C30A 3FGOA 5AVRA 1AN0A 5HPYB 1QHIA 4TMTA 1P9NA 1KKMA 4IG4A 1XJCA 2VP6A 1DPFA 3OIUA 4B34A 2Z5FA 3A1TA 4QXAA 4BEVA 5BYJA 3C8UA 1R0ZA 2IT1A 5EP3A 3I4LA 2AXPA 4Q7JB 2O8CB 1GP2A 4LC1A 3U6BA 1KGDA 5AK3A 3EPLA 1J97A 1NRJB 1W0JD 2QQEA 3BE4A 4QGAA 1VCOA 4US1R 2YJ3A 4FI3C 1K8RA 3H86A 3N28A 4NE2A 3U19A 3RLFA 4FD2A 2V1XA 4JL6A 3AVUA 4NABA 3L0OA 4X8LA 3U26A 5ALNA 1O3YA 3AR2A 1E9BA 1G6OA 1G8HA 2C98A 4TT3D 3RWOA 4F91B 2TMKA 3ZGXA 3U44B 2O8BB 2ZYVX 3S1AA 4POAA 3SC3A 1S3SA 3GLFA 1D2EA 2OUKA 4G5RA 5AJWA 5FPTA 2ZIAA 2O8DB 1L7OA 3L8YA 1S9DA 2NGRA 3HU2A 1PW5A 1I4DD 1KDPA 4I1SA 1EXMA 1G5TA 2JARA 3PJRA 1LVGA 3KFXA 4H1VA 1XX6A 3KUDA 2PL3A 5AIBA 5AUQA 3X1DA 5AI8A 5B64A 4P0TA 3P27A 3PENA 5JHGB 5ALOA 2Q6TA 1GNQA 4XVUA 1XD9A 2HCBA 3IQWA 2W00A 2WSSA 3MRSA 5JJKA 5DN6D 4UMEA 1N5IA 1U81A 4ZI3A 1JB1A 4EJSA 2PCJA 4BLPA 4F38A 5CB6A 1YMQA 2VTKA 4Y0VA 4N0DA 3FOZA 2G08A 2X8AA 4W5WA 2ZUCA 3DL0A 4BZXA 1FP7A 5ALLA 1JAIA 2GZHA 3AGQA 3BB3A 3SQXA 3WKDA 3ZS9A 1N6RA 5IT0A 4FYPA 5BN3A 3B13B 3O47A 4GDFA 1GRRA 4TL9A 2GJKA 5FUVA 4E22A 3KJGA 3AVVA 1E1RD 1UBGA 2J7PA 3P96A 1DAFA 4IJMA 2WMNB 3EASA 2IS6A 4UU0A 1ZJ6A 4IOMA 1MRSA 2G1JA 2A5GA 2A30A 4M9QA 4BLQA 4P31A 4LYAA 2BDUA 2EFGA 4GRAA 4DDWA 5BYKA 1IONA 3I61A 3CR8A 2REXB 5GJBA 4OI0A 2ZR9A 3EIHA 5EJEA 1B23P 3AR5A 3FFBA 1DBSA 1RYHA 4JVMA 3ZZUA 4QNRA 3L0BA 4GT1A 1AKYA 4C4TA 5GJCA 1T0JB 1G7CA 4LHXA 2EFEB 3CONA 4MYUA 3ZZTA 3WNDA 2QMEA 2WVJA 5IS2A 4BYGA 2GXSA 1GIAA 3SNHA 2RGNC 3P4YA 4KCGA 2FFHA 4WXPA 5FP0A 2QU8A 2VSOA 4XPZA 1KIMA 2QPTA 1OFTA 2EATA 4HGNA 4C4PA 2GVZC 1XMSA 3LX5A 4GIBA 2ZYUX 1I4TD 1P2VA 4EZEA 4K81B 4DUGA 1XTQA 2FPMA 2YZ2A 4UNPA 3UMFA 3ZWKA 3GLHE 4TMVA 2VP2A 4F71A 1NMXA 1T5IA 1XEWY 1Q57A 2DFKB 4FIDA 2NTYC 2F9MA 1W47A 5KNBA 5AM3A 4JSYA 3BWVA 5AW0A 1YR9A 3U3JA 1ZYUA 3ESQA 4BKMA 3K1JA 1ZM2A 3NBXX 3IBGA 2B92A 2ZSFA 2J0VA 3Q7QA 3CIOA 1ZC4A 1CR0A 4BLRA 3BJIC 5JZVA 4V0ME 3QUTA 2IYXA 5CLLA 4BFVA 2H7VA 5HKKA 1Z6TA 4C4RA 1RYFA 3KTAA 4FCWA 1A5TA 5JS7A 1Z4OA 2R8ZA 5IDVA 2ZXUA 3NTUA 2OFXA 3CKLA 3U3OA 5AVWA 1E9FA 4RZ3A 1W2GA 3ZTYA 1E79A 1AM4D 2WM9B 4P33A 2HEIA 1U2TA 3ZTWA 1W4BA 1II8B 4WZBE 1B0UA 1T8TA 1L7NA 1RKBA 3R9KA 2N1BA 3JZAA 4OI2A 5AUNB 2OM6A 3NRJA 2GVDC 4L5BA 1J2JA 2ZJ2A 5EZ5A 3MC1A 3CWZA 2AGVA 3WYGA 1HUQA 4YIKA 3PQCA 2G1KA 2CJWB 4TYYA 1YRBA 2VH5R 1FTSA 4G5OA 2WSSD 1GWNA 3BERA 1TU4A 3KXKA 4B2PA 4BEJA 4LJ5A 2JGNA 4JT2A 4MGZR 5AW3A 1FNMA 3AKYA 4QHSA 4I99A 2HT6A 3CLVA 4ZPXA 1SWWA 1NKTA 1FFHA 4AKEA 4AKGA 3NBFA 2REBA 1Z28A 3A1SA 3AUXA 3RC3A 3QXGA 2XNDA 4Y2YA 3PXGA 3SOPA 3TR0A 4ARZA 1ZD8A 2PT5A 2W6IA 5CDFE 1OH8A 1N6OA 4Y2JA 2J0UA 3K09A 5JEEA 1ZOLA 3QLEA 4NYIR 1MKYA 3L82B 4DCCA 2A78A 1ZU5A 4C0QC 1X8JA 1U2SA 1OF1A 3QYPA 4HGRA 3NIWA 4LBYA 5EP2A 3BK7A 2OILA 2Q3MA 2QSYA 3RWMB 2CXXA 2P0EA 1NBMA 1KK2A 4QBGB 1G3MA 2NOAA 4UW9A 1KI8A 2UVQA 2ZRGA 3EIEA 4LI0A 1DEKA 2FMXA 3A6PC 1CR4A 1EWRA 1YV9A 2XZOA 4C2TA 1XF9A 3LW7A 2D74A 5FUYA 3P20A 3KJIA 4B2LA 2I33A 3ZI4A 3EWAA 1IY0A 1GL7A 5B2ZA 4D6PA 4J03A 1NIPA 1P62B 121PA 4EFLA 2XB4A 1OXUA 2FEOA 4A6XA 1A1VA 2C5LA 3OCUA 4DUGD 2XZPA 2R8XA 4GFDA 3B1YA 4RFSA 3LW8A 1KI7A 2ODNA 3BH0A 4UMVA 1Z2CA 1NLYA 2AR7A 3SYLA 4XWOA 3FVQA 1QVAA 2FFQA 1CS4C 5D3MA 2BY4A 1GTVA 2WF9A 3NKVA 1YE8A 2K5UA 1N3BA 3FDIA 1BO6A 3OAAD 4UATA 2D7CA 3F3YA 5E4FA 5E7MA 5ALHA 5ALTA 4HI0E 4CEIA 5AVTA 3CUEF 1Z5GA 3KQLA 3J7TA 2Y8EA 3REFA 3ZX5A 4NDZA 4ZIRA 3UANA 2VP4A 2OAQ1 3B6EA 1FQJA 4A2WA 4DLSA 2G09A 4BUJA 2WF8A 5FFMA 2QROA 2MMGA 1E79D 3GCGA 1OFUX 3KZ1E 4NONA 4UMFA 3P4XA 2GRJA 4TLEA 2MSNA 4EEKA 2I4IA 2C88A 1TADA 3K0CC 1IBRA 4N3NA 3RRYA 1VJ5A 2CLSA 1F3OA 4LC0A 2NO9A 4E88A 3ZH9B 4ESHA 2V7QA 1ESMA 4QHTA 1AK2A 2KWIA 4G5QA 3MWLA 2QSZA 2FH5B 4XVQA 4A8JC 1ZD2P 3IIKA 1NF2A 5C1BA 3KKNA 4JJKA 4L9SA 4FE3A 3OEEA 3NHBA 1WBBA 1W36C 3IEUA 3ZX4A 3P26A 3AEZA 2CEAA 2WF7A 5AKXA 1JAHA 3PITA 3TLMA 3W5AA 1LTQA 1GUAA 4H9GA 4KSCA 1PJRA 5FOTA 3SJCA 3WYAA 3AKDA 5J4VA 3IQXA 4WXRA 3KQNA 2GMWA 4GOKA 2YNMA 3HR8A 4Q00A 2ZG6A 1XMJA 3BFVA 3ZS8A 2C99A 3T35A 5A5GA 1SU4A 3M4YA 4A1FA 4HGPA 1UBCA 4I81A 4RD6A 1G64A 1RIFA 3TIFA 4V0KA 2GDJA 4F4CA 3GLIA 5FOUA 2GEDA 3T34A 3WXMA 1KJZA 1AJEA 5L3QA 2C03A 3WMEA 4EUNA 3D3QA 3A1EA 1XMVA 3I5XA 4V0LA 2BM1A 3QPVA 3QXXA 2Q9AA 2ZRDA 4NU0A 4OHWA 1SVOA 2WBLC 4NP6A 3RAPR 3CH4B 4IDPA 4P4SA 4ZCIA 5KTYA 3GLGB 1Z5UA 2GJSA 4OHVA 4AYXA 2B30A 1IN8A 1DADA 5EQTA 2J9RA 4UNSA 2A2ZA 4KHZA 5DNYB 4MRPA 2RGBA 4JVLA 3E2IA 4RY2A 4J0QA 4UASA 2GESA 4Y2UA 1RQLA 1GKYA 3BRWD 4HATA 2YN4A 3C7KA 4PPNA 4B75A 4B35A 4B71A 2ORIA 2WF6A 3R7WB 1ZIOA 2IYUA 2D7DA 3CWQA 5FR1A 3AR7A 4DDUA 5EXPA 2IYZA 4CIDA 2E1RA 2JAUA 2ZSDA 4I1VA 1HURA 3MFYA 1E3MA 3HU1A 3QBTA 4M1YA 4PC3A 4PO1A 3VFDA 5CYPA 1XPJA 1JQLB 1NVUQ 3WNBA 2WWYA 1NN1A 1JXMA 2IW3A 3B82A 4M4SA 2B8JA 3DZDA 1OIWA 3K1ZA 2DQSA 3SKYA 2OM2A 4JLPA 2WAYA 1D5CA 2EW1A 4JT4A 3ASYA 3OZXA 4R71A 1XPRA 1G1MA 5AM4A 1KNQA 1L7PA 4EKDA 2ZI4A 1RJ9B 2OCBA 3BBPA 2Q3FA 3QU9A 1US8A 4TMZA 2YY6A 5FPYA 1SHZA 1Z4NA 4JBXA 2PJRA 5H68A 1ZU4A 1NLFA 3VR5A 3QXHA 4PC1A 5AKLA 1VG8A 1QZXA 1V5WA 4YMTA 2IHYA 2NPIA 3B1XA 4M9ZA 1U94A 1NMZA 2DR3A 1FW6A 4NYMR 3QKSB 1M8PA 3C4JA 4MGKR 2QMHA 4OYHA 1DAEA 4JLMA 5BQ5A 2NO1A 4QJ5A 3SU8A 1R10A 1JJ7A 3KJHA 1OYYA 4L4UA 4JJZA 4TTPA 4EPRA 2B8EA 2I34A 2AK2A 4B3FX 1DAKA 1GNRA 1EX7A 3AF1A 3QF4B 4HAXA 4A8JB 3ZVLA 3UWOA 4D4LA 5ALQA 3MCAA 2V7QD 1S3GA 5J4LA 3K70D 1W36B 1MRNA 2FN4A 1AGPA 1E4VA 4C7OA 1E99A 4H1UA 4JLOA 2AMYA 5EE5B 5AUPB 2CL6X 1OW3B 3WKAA 2YOGA 2ODWA 2O0HA 2ZRMA 2QM8A 1Q12A 3OEED 3L0IB 3L8GA 2I3BA 4MH0R 5DHAA 1XPUA 5F2EA 4PHHA 1Z4QA 1SZPA 3QGMA 1NI3A 1Q1EA 2BOVA 4Y0AA 4YC7A 3MWYW 2YMLA 1JPJA 1SVLA 2CFTA 4G5GA 4URVR 3AP3A 3QKRA 2R62A 1R5BA 2PZFA 2XJ9A 5KNDA 3NUQA 3TVDA 4KNVA 1S8OA 5CITA 1E4YA 1N5KA 1JNYA 1GKIA 1NG1A 2WAXA 3AV0B 4Q4AA 2ZTSA 4JS0A 3AGPA 3UKDA 1YZUA 4DWOA 5K8UA 5AWFC 2O8EA 2F1HA 1G8PA 2A5FA 3GQBA 5AESA 3SD7A 1CQZA 2KBEA 4CF5A 1GVNB 3BFKA 5J5CA 1EFCA 3X1XA 1U0HC 2WZQA 4CRWB 2OFWA 1UKYA 3I8SA 4TTRA 3ZQJA 2HO4A 2G0NA 3QJYA 1S96A 3GLHB 4BBJA 1TE2A 4MRRA 1KNXA 4QNMA 2YFYA 5CIQA 1W36D 3MG9A 3E81A 4PX9A 2FPLA 4NMMA 5H1YA 2YINC 1WE2A 2CMKA 4CF3A 4Q1EA 1OH7A 4XD7A 1WDTA 4O0MA 5FBLB 3AF3A 1TUIA 1OLOA 1KTVA 3KKOA 3R9IA 3IJ5A 2FJUA 3HJNA 4LV8B 2F1JA 3X2SA 3ZLJA 4TZ6A 2I54A 4C0SA 5DO9A 3O8RA 1EK0A 1M7HA 1P2SA 4AI6A 4L15A 4B48A 5JJBA 1KSJA 5DH9A 4MYHA 1RMTA 5FOVA 1JJVA 4B43A 2JLXA 1E0AA 4NAVA 2YKGA 3MMZA 1ZD5A 3TSWA 5JS8A 3OCVA 1CR2A 4AYWA 4R2HA 4KYTA 4OHYA 1KMHB 1NVWQ 2FX3A 2A7QA 2ZE8A 4K46A 2QRZA 3T15A 3DDCA 4CW7A 1E94E 4P3YA 2Z83A 3HWSA 1OHHA 3CPHA 4MRSA 1Z6XA 2JJ2A 4TL7A 5ANRB 721PA 4O25A 1RQNA 1UFQA 3B9QA 4V02A 1TNDA 2C8KA 4OFZA 4OQFA 4MQBA 3RC8A 2ZAOA 4TN1A 5KU1A 5AKIA 1CKEA 4DW8A 2BDEA 3F0TA 1PLJA 3Q3JB 2ZBDA 1P4SA 4Q19A 5FBWB 2EARA 2V6IA 2F43A 4TLBA 5IK2A 2PCLA 5H70A 3QUSA 2ANCA 1ANKA 1ZC3A 4E03A 1LFDB 3MGCA 1A7JA 2ZRLA 3KUCA 3I28A 2VQSA 4RCYA 3B5JA 4OJQA 2PMKA 1M74A 4OI1A 3SBEA 1Z47A 4PO9A 1H8HD 2JASA 4A82A 4L6AA 3RS3A 3L7YA 5JI3E 3IUYA 3P32A 3CRW1 2FFAA 4TWZA 3SEAA 1AS2A 3LV8A 1UDXA 4KNWA 5HCNA 2QGZA 3LBNA 1G4UR 4AWXA 5FR2A 5HCIA 2W43A 2CBZA 5SZIA 4Y2QA 1G7TA 4KLNA 3OE7A 2QAGC 1GAJA 5LB4A 3AVQA 4DVGA 3RANA 3Q9LA 2R8EA 3I76A 3SE0A 1RLMA 2VEDA 2CE7A 5DSZA 2HSZA 4UNNA 3EC1A 2IYEA 1N5LA 4LCBA 5CM8B 1BH2A 2BCGY 4X8MA 2Q3HA 1G6HA 2EQBA 4KX5A 3IGFA 2HDNB 3R9WA 2LCFA 5AKGA 3N70A 1VECA 3MWKA 4Y2XA 3W5DA 1OKKD 4URYR 4ABYA 2C96A 2IYSA 3RS0A 2G0AA 2IEYA 4YLGA 1IOZA 2NO4A 4IFTA 1KO7A 2CK3D 1FUUA 3W5CA 4GL2A 2PLRA 2QTFA 4LHWA 4YMUA 3KQHA 3CM0A 1XTKA 4HEJA 2XB2A 5AVQA 4DSOA 4D82A 4EX6A 4EX7A 4M1OA 5F9FA 3KQKA 4JZKA 3UMGA 3FHOA 2ATVA 4OI4A 4B3CA 4BE7B 2AKAB 3QBVA 4IFEA 3ETLA 4Q7LA 2JLWA 2IL1A 1I2DA 5G3YA 4AKHA 1JUDA 4DIDA 4YGYA 2G07A 3KOOA 2BHRA 4A6PA 2C8VA 4AURA 4XD7D 4MDFA 1ZNZA 4UXJA 2GF0A 4AD8A 1NY5A 2V3CC 2HX1A 3LX8A 2JLRA 3L1UA 1KI2A 2FEMA 3DM9B 1Z3IX 2DWPA 4BZPA 2FUCA 1IAQA 2GEVA 4A0GA 1T8UA 1XJ0A 3SFZA 3WK4A 2PQ0A 3W5JA 5K8LA 1E9DA 5FL7A 4JMPA 3CX6A 1XD2A 4BZQA 1W49A 3BB4A 4DFDA 4DT1A 1BYIA 1NBME 4G9BA 2C04A 1YZLA 3SKXA 2BMFA 1NL3A 1OFIA 1Z2AA 2OBNA 1E1QD 1MABA 2QNRA 1OT3A 4NCNA 2IHBA 5EP4A 2HEGA 3DOFA 3ZUPA 2DPXA 1S2MA 1M7BA 4CEJA 1MH1A 5AK5A 3ZYCA 4HLQB 4C9BA 3X1ZA 4HAVA 1G9XA 4ERNA 3JVVA 2R6DA 5AJYA 3UG6A 2GXQA 4Q18A 5EXSA 4LJ8A 1ZVQA 1DO2A 4N1AA 1NP6A 4A4DA 1T3SA 1OFHA 4BRWA 3VAAA 4P4TA 4LDJA 3ADBA 5IK2D 4D25A 3ZVNA 1FZQA 2GCOA 2PZEA 4G1UC 5TY0A 4EPWA 1YR6A 4DB2A 3ZDQA 3NANA 3VX4A 5F98A 1JI0A 1Q22A 1YKSA 1ZBDA 4L8GA 3U3KA 2ZI6A 3HYRA 5LBIA 2AD1A 5E95A 3WY9A 2WF5A 1JEDA 2H92A 3QPWA 1N2CE 1W44A 2G1AA 1VG9B 3DO6A 1XTJA 2JAQA 4Y2TA 2QAGB 2YWEA 1QQ6A 4KLZA 2WWGA 1KZ7B 2A3RA 2VP0A 2OE2A 5FUXA 3A4NA 4BPBA 3CNHA 4WVFA 3R09A 5AM0A 1OXSC 3OE7D 2O8FB 3B85A 5BWMA 4PSVA 3EZ6A 4B32A 3HR7A 3NC1C 2OEPA 3LAWA 4LJAA 2CFRA 3O8BA 1VDZA 2BEKA 3TAUA 1OE0A 1IN5A 1QHHA 1O87A 1X86B 3VKWA 1NMYA 4II7A 1P73A 1WMSA 3T1TA 5DHFA 2NO0A 4XOUA 3AP1A 4XVRA 1M2OB 4EJSC 4DLXA 2IYQA 3AVOA 3BIFA 3WK8A 5KPDA 4YMVA 4B2IA 3FYHA 2XTMA 2CCJA 4R98A 3TUIC 2XNSA 1I4LD 1KI4A 1L7MA 4L57A 5A3RA 1A4RA 1KY2A 3N5CA 3WRYC 4UNRA 3UMSA 3KZXA 3VU9B 4CT5A 4NH0A 2XGJA 4TYWA 3IRUA 4EENA 3KB1A 1Z4JA 1XZPA 1HE1C 1QHYA 1SGWA 1KI9A 1YU9A 4KFUA 4UKDA 4C3ZA 4ZKDA 3ND9A 1E2MA 1ZJJA 1Z0IA 5G53C 4EFMA 1WF3A 2W0MA 3EW9A 1VIYA 3LRPA 3PEVA 1NN0A 5IT5A 2YVUA 2IC5A 3B8HA 3IEVA 4HGOA 1W5TA 1J90A 3THWA 1MV5A 1TJ5A 5ALWA 2VP9A 3KC2A 5AJVB 2DFLA 4M2LA 4NCKA 3PGLA 2ZQ5A 5DI3B 4KV9A 1S1MA 2CL0X 1KI3A 5EE3A 3I6BA 3IPXA 4HAZA 1CF4A 2QEQA 3X1YA 4Q03A 4Q1AA 3TH5A 2OESA 2G06A 3T12A 4IDHA 2F9LA 2REOA 2UKDA 5IF9A 3EXAA 3L0SA 1LV7A 3LD9A 4LYHA 4UQOA 5FL7D 1X42A 4XOIA 4BNDB 1YDFA 2IYLD 3QU4A 4QGFA 2JJ1A 4LHYA 1H8EA 4YMSA 4LK2A 1N8NA 1BIFA 2V55B 4DLZA 2YC4C 5AW8A 4GZLA 1XZQA 3H2YA 1CR6A 2J46A 1U8AA 2JIZA 4ZI2A 4LYFA 3T1QA 2C2HA 2R8RA 2X4DA 2I6XA 1Y3AA 3E84A 3DV9A 3IDQA 2BC9A 1NVXQ 4OQMA 5ALYA 4QM6A 2ZRKA 1E69A 3H1TA 4BRUA 5AKEA 3I92A 1UADA 4DHEA 5EUQB 2JLYA 5AKZA 4YCMA 4A0RA 3DMDA 2GF9A 2BIFA 3GPLA 2GZAA 1CRQA 4ACBA 2P27A 3OTQA 3QUBA 3FGNA 3CNLA 2QPOA 1ZM7A 3CRVA 1AIPA 4BLTA 1QHSA 4M1TA 2NYVA 1C4OA 1H65A 1FX0B 3GJ3A 2H16A 4GPTA 5CJ2A 3K0FB 4GSYA 5JHHB 1E9RA 4JLAA 2ZBFA 3VAYA 4Q9HA 2Q9CA 3B60A 3LY5A 4DLWA 3UM9A 2V4ZA 5GVSA 2X77A 2BKEA 2NZJA 3LO5A 4ZDWA 3U7HB 3LLMA 5E7JA 5FBQB 2JLZA 2CVHA 3L0CA 5FPKA 3ZW7A 4B74A 2P65A 1ESNA 3OFNA 1VCIA 5F9HA 4NYJQ 2ZS8A 2Z6VA 4GXTA 1G21E 4YDSA 4EJSB 3A3YA 3IB6A 4IEIA 2ZR7A 1R7RA 5A0FA 1JECA 2VHJA 1G16A 4MRVA 3VHLB 4YIHA 1QG2A 3O8DA 2V54A 1XEWX 1YHNA 1KKLA 2DFNA 2P9JA 3OCZA 5AW6A 1P7CA 4NCHA 3FHCB 2QPAA 5EE9A 3WGVA 1SKYE 1X1SA 5HE8A 5AVSA 4HLDA 1YS9A 1VYUA 1XJQA 1G4AE 3Q85A 1P60A 3MLEA 3B9RA 1ETUA 2P5SA 4A36A 5CIWA 1GKUB 2YOFA 5ALGA 1GZSA 1X8KA 2OCAA 1IN6A 4DCUA 4I9FA 4M1WA 4Q4JA 2FUEA 1G291 1VYVA 4IW3B 3W5IA 2YMQA 3K09C 4Q1BA 1CBUA 1N0VC 1ZD9A 3L2OB 4P32A 4DEYA 3FWYA 4HYTA 4F4IA 2R6FA 3U7EB 1ELOA 4PHGA 5JSZA 3AQ4A 2BCJQ 2I55A 2ZRNA 2FDCA 2HI0A 2P69A 4ILEA 1MOZA 2Q21A 5TVKA 1JR3A 3C5CA 2CCGA 3OCWA 1I2MA 3L1VA 3R4CA 4UU1A 3B1ZA 1ZW6A 2OHFA 3CPEA 2WHXA 3PUZA 2ZPTX 4QOSA 2E9SA 4FN5A 2FSGA 4TL6A 3NIBA 5FTNA 2O9JA 1KK3A 2FPWA 4AYTA 1K1EA 4EPVA 2JIZD 4Q01A 2OBMA 2J7PD 1X3SA 4A9AA 1QG4A 1Z63A 2CL7X 5KHOC 3L8EA 1KZGB 5ALIA 3K0AB 2PZGA 3KL4A 1QYIA 2ZU6A 4HB3A 4MYTA 4HZIA 3WKEA 5DI9A 4MUAA 4LX0A 4L6CA 3KTAB 1JEEA 1LVHA 1U90A 3A1UA 3QPUA 1AZTA 1IM2A 1ZM3A 1OXXK 5AKJA 2FU5C 4RZUA 4DDTA 2Q9BA 2CLDX 4HAIA 3UXMA 2WJJA 2XTNA 2IUTA 4Z8XA 1J8YF 2FZLA 3OHMA 1YZTA 3QKTA 2P5TB 5CYOA 4M9XA 4D0NA 3PUYA 3T5GA 2W83A 1J8DA 2ZEJA 1QHXA 3PUWA 2VPPA 5CJPA 1C9KA 1ZUNB 2D2VA 1MO5A 1DAGA 1SVIA 1ZINA 2QMUA 3KKQA 2WIAA 1FL9A 1IWOA 3RABA 1NSFA 4MUBA 1VMAA 4EPTA 3IBYA 5KDOA 4UM7A 1TPZA 1F6BA 2IXFA 3K70C 2CHVA 5KYKA 1JBKA 1AA9A 1UDWA 1Z5ZA 1SVKA 1W46A 2X2FA 3ZVRA 4Q4LA 2P6UA 4Y2PA 3QU5A 5EXTA 1SKQA 5AKHA 4BFWA 2FA9A 2ZI9A 4C0JA 4YH1A 3QXCA 3KBBA 3SF0A 2VF8A 1K6MA 3RRNA 3DDHA 5HKKD 2PT7A 5JBQA 1E2EA 4MYCA 2F1IA 2QG6A 4LZZA 4ARZB 4B6EA 1O08A 1TJ4A 1ZRNA 4KSBA 3RFUA 1C1YA 2J0UB 4JIMA 3VHXA 1F2TA 2NO7A 2EAUA 5F3WB 2BMEA 1KMQA 4LJYA 3NHAA 3ICQB 2GJAA 4IVRA 3R9XA 1QQ5A 4C0BA 2VHQA 4CDGA 1XD8A 2EFHB 3I72A 3QE0A 1EG7A 2OSBA 4RZXA 3K8YA 5FPHA 3WMGA 2QYHA 2AN9A 3H0KA 4QL3A 1FQKA 5JCZA 1KHTA 2WJIA 3E5HA 2HLDA 2H57A 2Z4SA 3W6NA 4HB0A 2C78A 3B1WA 3REGA 2ASEA 2RKOA 2BJVA 3ZJYA 1ZUIA 4EDHA 1AQ6A 4KVAA 2Q4RA 3AVXA 3AKEA 4A2QA 1OB2A 1EK1A 4PFSA 2ONJA 3OCYA 1F5NA 5KSPA 2IWHA 1XWIA 2YWFA 2RGAA 2FSIA 2A5JA 1JR3D 2BEJA 5CLQA 2AHOA 3QUCA 4RD4A 1Q1BA 3QVVA 2GHIA 5AKKA 3CR7A 3EPHA 4XWAA 2FI1A 4LPSA 2CNWA 4DLVA 3RS2A 1GG2A 2GNOA 1TQ2A 2WKRA 1F2UA 2B6HA 2QI9C 4RFSB 3THXA 4UARA 1G5PA 3LFUA 4OL0A 2XNDD 1FMLA 3GJ6A 2I1VB 2QRNA 2W6ID 2ZS7A 4NCJA 5D3MB 1G3RA 2IX3A 4BFUA 1EK2A 4E07A 4CE6A 3VR3A 2GHQA 2CFSA 2G77B 4A0FA 1UM8A 3NASA 2EWWA 1E2GA 2GJ9A 1MO4A 2NPFA 4KX3A 2ZSBA 4Z51A 3WGUA 1Z0KA 3SBDA 1Z6YA 3M9LA 4RESA 3L0YA 5EP1A 1KI6A 1NBMD 1XCGB 2G83A 4ZIRB 5L3RA 1RZ3A 2NO6A 3GMTA 4NYJR 5ALDA 2QTVB 1PUIA 2FWRA 5GADl 2ZJAA 3OEHA 1KO5A 2EFCB 4JL8A 5JMTA 1Z8FA 4WZ6A 3EG5A 4OD0A 3CZ4A 3V9PA 1ZRMA 1U9IA 621PA 1DG3A 2OFOA 2RGEA 3CF0A 4OK3A 3RDPA 3THYA 3DKPA 3EAQA 2L0XA 1NN5A 2YOHA 4C2UA 5LB2A 2ORVA 1E0JA 5FL3A 1Z83A 3SR0A 2RGXA 1ZNWA 3K70B 1QDEA 1P5ZB 4ZEWA 3BB1A 3LBIA 2AKYA 1L7VC 3KDSE 2GKSA 4PZLA 5AI5A 4QBFA 4TQUS 3PUVA 3QOFA 6Q21A 1D2NA 4CVNA 3ZD7A 4C4SA 2YWGA 3KKPA 1ZAKA 4NPHA 2W2VA 2FPUA 3JZMA 4H1WA 2HYDA 4B6FA 4YMWA 3LQRA 3VKHA 4OK6A 4Q1CA 5ALSA 5AVVA 3FM9A 1XEXA 4HAUA 3FFAA 4PC6A 2ANBA 2IWRA 4DSUA 4BX2A 1ZRHA 2ZJZA 3KXIA 1DO0A 1KO4A 2WICA 3L8FA 1E32A 5AM2A 5DYIA 3CNOA 3W3ZB 4CF7A 2GO7A 2YMMA 4Q7KA 5GVRA 3U3MA 3W90A 2HF2A 2IOFK 1COWA 5L3QB 5ALMA 3FE2A 3W8NA 4DXAA 2GILA 3NEYA 1CJTC 4LY6A 4AK9A 2B7CA 5E3HA 4B3GA 2IS4A 3N5KA 3C41J 3AUYA 1TQ4A 4GMXA 4QHYA 2PBRA 3QSYA 2Q0HA 4TL8A 3A1WA 4P4SB 2X1VA 2WJYA 3AP2A 4LBWA 4TTQA 4ZDJA 1IJEA 2J5XA 4AC9A 3B78A 1DE0A 4RVCA 1X1RA 3ADCA 1WRBA 2Q4TA 4C0HA 4TYNA 3U7GA 3TUJC 1HTWA 3PR1A 1ZP6A 3TRFA 2BBTA 2JLUA 2QMOA 1RLOA 4AP9A 2C95A 2CHQA 2JCSA 1W2HA 2PX0A 3Q7PA 4JLNA 3RSOA 1E9SA 1L8OA 3W5BA 3PEWA 4Y2SA 3KB2A 3TBKA 4BLOA 4WA7A 1UBEA 3WYFA 2HDOA 1E98A 1AQUA 4DJTA 3DAOA 2GBLA 1QHNA 1PZNA 2PMDA 3A37A 1CLUA 2AH5A 4AG5A 4O8CA 2PJZA 1NSTA 1OSNA 2RB4A 2Z43A 2IYVA 3NG1A 2WFAA 1Z6GA 5FOWA 4B3DA 3TLXA 2XXAA 3NAMA 2XEXA 3AF2A 2CNWD 1RRCA 3E58A 3DZ8A 4K8OA 2QBYA 2JLQA 3GLFE 2BBSA 3VR1A 1CP2A 4MDEA 1TQ6A 2NG1A 5HR5A 2DFTA 1E0SA 2OYCA 2OO7A 1DG1G 1SXJA 3A36A 2P2LA 4D4JA 1Q3HA 2G0TA 2QGNA 3U61B 5AJXA 2YHSA 2D2FA 2KI5A 3QQ5A 1US8B 1ONBA 2WWFA 2HF8A 3NEJA 4JSTA 3G0HA 2HF9A 3X1WA 4E09A 4PC2A 4HUQA 1ZMXA 1LF5A 3DOEA 4HDCA 4Z1MA 2I1QA 4LSGA 4IOKA 3VR4A 4JBWA 4QG7A 1WQ1R 5J47A 2R9VA 2JAOA 1W4CA 1RPZA 2G6BA 4EAQA 4ZCMA 4QQFA 1S0UA 3OEHD 5DGXA 4TMWA 4LJ9A 3K53A 1GILA 4B3XA 5AM1A 3J81k 1KDTA 4DSNA 4G3XA 2XZLA 1RKVA 5AVUA 2WHEA 4FMDB 2UZ3A 2FF7A 5E0OA 1SQ5A 4YCLA 4RZ2A 2IUSA 1L4UA 1W0KA 1XXHA 2P11A 3ET4A 1UEJA 2CCKA 4QM7A 4KBGA 3FMPB 3FMOB 4XIGS 1BMFA 1E6CA 1M6NA 4C7OB 3EWIA 2H8KA 1OB5A 1SKYB 1UKZA 4NL4H 1N9KA 3K9LA 3NWJA 1AS3A 1KOFA 2BJWA 3QKUA 4M9SA 2LKDA 2EFDB 4FMBB 4HZUA 3T61A 1JALA 4I9GA 4HDOB 1OXTA 2WKPA 5KNCA 2ERYA 1E2HA 4JBYA 2FZ4A 4HB4A 5C46F 5KPJA 3AVTA 2FPSA 4XH9B 3ESRA 1K5GA 4NTZA 4UMDA 2XSZA 1HV8A 3GJ5A 2IYYA 2ZRJA 4QRHA 2A5YB 1DAMA 1II0A 2CHGA 3RNLA 3LWNA 2FPRA 3O8CA 4HDQB 3QKRB 3QVUA 4PSKA 1Z08A 4BFYA 5M04A 2DYKA 2YMPA 2C9YA 5HTKA 2GXUA 1LY1A 3QXSA 2RH5A 2GCPA 3NBYC 4ZEXA 4KO8A 2B21A 2VHTA 5AI9A 3QG1A 4Q4AB 1COWD 3QY0A 3GFTA 1GNPA 1R4AA 2RAVA 3AR9A 3G5UA 4QBIA 3Q8XB 1CJKC 1XBTA 2XX3A 3Q5EA 3QEOA 3T1VA 2O8EB 4KI0A 2OLJA 4W5HA 3AR6A 1HY3A 5AKYA 2GAAA 2KB0A 3VQTA 1KAGA 2EYQA 1IJFA 4MUMA 1XNJA 2ZJ8A 2ZJYA 3CH5A 5KOYA 2DWQA 2QENA 2IYTA 3F5FA 4YXWA 1U98A 3GFPA 2ZBGA 1HEIA 5C4GB 3BWDD 3ZD6A 1E2LA 1J8MF 5AM5A 3G82C 2YWHA 1W5SA 3I8XA 3PGVA 4KFTA 3SN6A 3I32A 1HT2E 2F3TA 4WIAA 3D7MA 2NIPA 4FINA 1JQJC 4DIEA 1ZCAA 3CF2A 4DB4A 3RF6A 3L8ZA 4M53A 3WKBA 1CULC 3B8EA 2RHMA 2ZRIA 4LYJA 1HQYE 1D8TA 2AD5A 2ODAA 3B7GA 2IXEA 5KSYA 4EQ6B 3U4QA 3DHWC 4FMCF 5L3VA 3WK6A 2W11A 2PX3A 3W9YA 5C18A 4PO8A 4E5UA 2YJTD 3QIAA 3VKGA 1MH9A 1G8YA 3EZ2A 1FMJA 2FOLA 5GJVC 4OHZA 3QI2A 5FI1B 1CJUC 3TK1A 3I3SR 4OHFA 1NIJA 1SXJD 1IHUA 5B58C 3LXRA 4FWIB 3PG5A 4Q9JA 4B33A 2QY9A 4IFBA 1T91A 4RKFA 3SQWA 5ALEA 4DCNA 2GAOA 2GJ8A 5ALXA 3SI7A 4JYBA 4RD2A 4CNQA 1JPNA 2W6JA 2O5VA 3IILA 5EE0A 4DEXA 5AUOB 4DZZA 3SYNA 1LW7A 1JR3E 4J2TA 4BFSA 4U00A 3SS8A 1OIXA 3WNCA 3TR5A 2QL6A 4HLUA 4UXIA 2F43B 2WWWA 1W0JA 5J40A 1S2OA 3AB3A 1WB9A 3I73A 1AS0A 4W5JA 3AVPA 4Q9IA 4KJZA 3IO3A 1LS1A 1W0KD 3GFOA 2PR7A 2J0SA 1Q92A 2ZRBA 1JXOA 1E2PA 4DRZA 1GITA 3N1UA 2WV9A 2HJGA 1Z4MA 3EX7C 2EYUA 5ALKA 2VSFA 3GJ7A 3CX8A 2IYRA 4X8HA 1VIAA 4RD0A 1MT0A 5JCPA 3KDPA 4GBMA 4AKIA 2IOHA 1LNZA 2VSXA 2PKEA 4HSEA 4KODA 5L3SA 1CR1A 1ZM9A 2XSZD 4MKFA 5H8WA 4URZR 2CDNA 3NBZC 3CF6R 1RC8A 2JGAA 3WK5A 1OH6A 4IOJA 2HXYA 1J99A 1M7GA 3F9RA 3WRXC 5A4JA 1OHHD 2JJ2D 1L2TA 3V00A 1HQCA 2J3EA 3LH5A
chains in the Genus database with same CATH superfamily
4LW8A 4YO8A 1EG2A 3L1HA 4BWYA 5BXQC 2O8CA 2FSFA 1MEJA 3ONDA 4U7HA 1L5NA 3JYPA 2EOAA 2RI0A 5AIAA 5HKBA 4QEDA 3V4RA 1MFPA 2OCPA 1CUSA 1THGA 1B93A 3HXTA 1D6NA 4FZ3A 1FFAA 4CMKA 4WFKA 1BRTA 5ERYA 3HABA 3BXEA 3DMNA 2C4VA 2Y6VA 2VL7A 4NHOA 4DUZB 3E0XA 4I4LA 4CKBA 1V9SA 3AEYA 1ZX1A 3BN3A 2IHKA 4JOBA 5E2IA 3WGJA 2QTNA 3AI7A 1TB4A 5IDXA 1GCGA 3JQFC 1MQ8B 1WCXA 1NX6A 4WOJA 1HYQA 2DULA 4ARVA 1CJBA 2W2LD 4WOCA 2FPXA 2E4VA 2WNIA 3RTCA 2BWJA 3AHCA 3A9TA 1ZH6A 3N2LA 2CMDA 1IRXA 1RQ2A 3FCCA 3PICA 2O7RA 5EWJA 3N8KA 1PUJA 2ZI3A 2BI4A 3P5SA 1WKVA 4L4RA 1V8DA 1MOSA 2DTDA 4MV0A 1MO6A 4UAVA 4YAWA 3OE5A 3OZCA 1KSGA 4U7DA 1GPH1 1FNNA 2Q27A 2XZDA 5B58T 5L7YA 3USES 1I80A 5JNTA 2RH4A 2ZUSA 1IVNA 4JDPA 3MLBA 4DRXB 4EABA 4PANA 2GK6A 5J58A 4Y1EA 2Z5LA 1IDOA 3ICPA 2FPIA 3P7MA 4BB0A 1DVRA 1Y82A 4LDPA 1F1JA 5JSQA 2ZWVA 4R1SA 1X7DA 1ZGGA 2IK8A 3CUVA 4RELA 4EG5A 1MABB 2E87A 1EFTA 1H23A 4DJ5X 4HNAB 4CEHB 3S2SA 3EODA 3HYTA 1L9XA 1SVSA 2VO1A 1IXZA 1NTOA 2B8NA 3GD5A 4YPOA 5BUCA 4U8HA 1T9CA 5CLFA 1T5LA 1GR0A 1CEEA 1Q0UA 3H04A 1S2NA 4FC7A 4DV0B 3MJDA 4OMDA 1RYNA 1U4OA 1UF9A 3KSUA 4C76A 1PTJA 2ZULA 1TA9A 2J45A 3PHLA 4NMLA 2F90A 3KQUA 1R4NA 3FSRA 4MYDA 4MV3A 2WIBA 3RASA 5MF6A 1A2BA 2ZVQX 2QD3A 1NURA 3EZFA 4MZDA 1IQPA 1B00A 2QZZA 4IXMA 5AOAA 4NESA 2Q4BA 4Q34A 2NUAB 3KPJA 1Z2EA 1OX4A 1PG2A 3HS3A 1NN3A 3N2EA 5JEDA 1CB7A 1NVVQ 1QFZA 1G9SA 5JYBA 3GLIE 3WO1A 3GCXA 1CS0A 3E4DA 1DAHA 1P9RA 4PG7A 4BQNA 4C7JA 2OV6A 2V6JA 2OVBA 1DARA 3CTPA 5IHPA 2PFKA 2IU0A 1GXSB 1XTSA 1ESDA 1H4VB 1D1QA 4M1SA 1YF3A 2GHRA 1RVDA 2AFHA 1XO1A 4W1PA 2P8JA 3K0FA 2Q50A 5CURA 2C1EA 4YJFA 2IS1A 1NX9A 2VIIA 3NXSA 5IP5A 5KYUB 5EXDA 2C9MA 3MTGA 1V9LA 3OETA 2HCFA 1AUVA 2GHTA 3QG5A 3IL2A 3D6JA 5FBHA 3DHVA 4QJBA 1E2IA 4R1UA 3RIEA 1KS2A 5MFPA 3ZWDA 5FPSA 1TYAE 2ZR0A 1TEXA 4R69A 3JQ9A 3D8RA 1MTOA 3HUTA 1LLCA 2C3PA 1JWLA 4D56A 2FLVA 3ONWA 4N40A 4X61A 3PFCA 3IQFA 4JROA 1CV2A 4ZKDA 1W1WA 1W48A 4IO1A 4RV4A 4Q12A 4V3BA 4MPRA 3ZVMA 5L9AA 1IXSB 1WDWB 2FQ1A 3T5CA 1CUFA 3DEJA 3R3WA 1H2BA 1CG6A 4QOHA 1D07A 2VNJA 4KAJA 2ABWA 2FETA 2WJPA 1FDTA 3GGPA 1GTRA 2VPQA 1H9AA 1TYEB 2Q9UA 4EEZA 2ONYA 4JT9A 3UUGA 3WIBA 1JQAA 5C37A 3HZZA 3DO8A 5LA6F 5TJHA 1II8A 2D3WA 4B73A 1I13A 1QH8B 3G2OA 3AI2A 3ENKA 3Q5DA 2Q3EA 4W63A 4KRXA 4B4KA 3OX4A 4DZRA 4R1PA 2FN8A 2J5RA 4I4IA 2B82A 3ZGYA 3DLIA 4PRYA 5GM2A 5LZ2A 3D6UA 4AG6A 2AN1A 2DUWA 2BI7A 2OAP1 2UZ1A 2D54A 4WADA 5LA6A 4WE3A 3EGDA 2IEZA 1USKA 3IKJA 3UXEA 4QYIB 4B6GA 4X6UA 3DPUA 2YV5A 3Q3GE 1P1HA 5EZ6B 1ZPDA 1L5ZA 4OX9B 1Y7LA 1RYMA 1B6GA 4YUZA 1FJGB 3UGKA 1SCJA 3UATA 1P33A 1NXQA 2QORA 2PLNA 2UXDB 1AU9A 4JITA 4HQNA 2QV7A 3PC3A 4OJMX 5EZYA 1OXBB 1LW6E 4II3A 1H22A 2H48A 4GU5A 1B0AA 2OGZA 4DIBA 5KTKA 3OWHA 1RYYA 2TRSB 3QOWA 4MEAA 1GM5A 1NNLA 1M76A 4I5GA 4DQLA 4EW3A 3RC7A 1J0BA 1XE3A 1OYWA 1V7CA 2VQ3A 2I2XB 2F3RA 3DM5A 4HGZA 4MKHA 5HDBB 3VNBA 3OAAA 5K8CA 1U7WA 1WPGA 1NQXA 1P9WA 2PS9A 3CNNA 4QXQA 5JE8A 3DW3X 3QVTA 3IPAA 4IJQA 3AI1A 4BLSA 4EBFA 1X7WB 3KLBA 1JT9A 3LPMA 3T4UA 5L7TA 1VE6A 2H9AA 4EHAA 4W9NA 5AVYA 5K0ZA 4MKIA 1MG0A 4QZVA 3GXBA 3HACA 3MHPA 3T1NA 3GT7A 2RGNA 4F11A 4XYLA 5LLSA 3F3KA 4FYVA 4R1TA 4FYYA 2C84A 3NAZA 5KJCA 5E6SB 1BDIA 4FQ5A 2HSGA 2C9DA 2X0RA 1Y8QB 3JRNA 4IF4A 5ALPA 4ETIA 2HRQA 4O2AB 4Q3AA 3U3XA 4ZYXA 2HLHA 4DCJA 3EZ9A 1YZKA 4LEIA 5BV0A 4LYGA 3RC2A 2GX6A 5CP8A 2VA8A 1ZNXA 4GYKA 3I5YA 2ZIUB 3H84A 5CM9C 3GGOA 1RP7A 3HLKA 3DE6X 5E1MA 3KJXA 4CTMA 3DEZA 1IPFA 4Q5IA 1J0XO 3TS1A 4IUYA 2XQGA 4IV0A 4LIPD 5CTAA 1H9CA 3DMHA 1V3TA 4G01B 5CVUA 1EXDA 2PUWA 3CRMA 3ZWYA 2V6MA 1SK8A 4PEVA 1P8AA 3RSFA 2VJBA 2ZRCA 1AB6A 1SK9A 1G20A 3SXUA 2VPYA 5L8VA 1MC5A 2F6RA 3E4CA 4GC5A 4OHCA 2B35A 2H5EA 3C3XA 3G2HA 5B4UA 1O95D 2NTVA 2XA9A 2O20A 1CZHA 3IPRA 4ZC8A 5LC1A 4XYMA 5JO0A 1WSWA 3DB1A 1BKDR 3D6TB 4W5OA 3UG7A 1AOXA 4DCSA 2B1IA 5LQKA 2JD1A 3G59A 4U2GA 4WKCA 1MXHA 1H4QA 2AZXA 3K8OE 1WY7A 4CIBA 1JLLA 1CJSA 1N92A 3W05A 3AY6A 2VAWA 4PHFA 4BGUA 1SD5A 4PZZA 4GMDA 1PQ4A 4UEWA 1XTTA 1J39A 3GRYA 4JHLA 4AMZA 4ZT5A 2QN7A 5JSZB 1G3IA 1X1TA 2G80A 4NR0A 2ZYTX 5FI0B 4XQ0A 3N07A 2GCNA 2B25A 5JYEA 1CT9A 1PNTA 4KPUA 3CLTC 3UMRA 4CKEA 2R7NA 1E1CB 1VP9A 2Y1DA 3ESYA 1Z07A 4NOKA 2OPBA 5CBKA 2ZETA 3WB2A 4MKZA 4KQ9A 3OEYA 2CWWA 1NAIA 1Z06A 3GVIA 4GKBA 2NVWA 3BCUA 3ABQB 1F0KA 5A2GA 3DXYA 4IRMA 1NVVR 2O1WA 1CUUA 1V6AA 2BRUA 4AP9A 3JZDA 3TXYA 1SQ0A 2HREA 2XITA 1X6VA 4J3NA 3PUJA 3ZY5A 3CBQA 1UPTA 1X0VA 2WPDA 3WQBA 1L5HB 2VRCD 3LBFA 3WGNA 2IS2A 2D59A 4JBIA 4JLKA 5I7AA 4CM7A 1EUQA 4R8VA 1AB5A 5A4IS 2H4FA 1X1EA 2P5YA 1WBDA 4Z9BA 4RF3A 1YZGA 2A86A 4LXXA 1Y48E 3FGPA 3ZY3A 3CT6A 4XJXA 4TZ0A 1XQYA 1F9EA 1U0LA 2DLDA 2P4EA 1KYXA 2ZRPA 3GEDA 4H6VA 3ITKA 5THQA 3UCFA 2IPMA 4CODB 3CXUA 3H9GA 3V7NA 3N0WA 1WULS 1Z16A 2H31A 5ICGA 1QWOA 1E96A 1A71A 1M8JA 1VFNA 3DV0A 3OWXA 1PFWA 1XTRA 4ND6A 1C3JA 4OKSA 5LIPA 1ZR4A 2UYOA 1KU0A 4DDVA 2ZZNA 2G4CA 5SZKB 4K5QA 3ORSA 5DX1A 2D8MA 3RRFA 4B83A 4KBFA 4ENUA 3F47A 4FPXA 4WUTA 4UM8B 3BHNA 3STUA 3IQIX 4AJOA 4ZOQI 1U9IC 3DNFA 3W34A 4CM5A 3ICWA 1AY0A 1FFXB 1KJWA 1LB1B 1T35A 2ECOA 2R2AA 4M21A 4AJ1A 3H9JA 4HS4A 1PLLA 2IUYA 2W6QA 3TZCA 1KRXA 3HDHA 3HKBA 2GTPA 1MC8A 1KFCB 1WW3A 3FYUC 2BM0A 1V45E 1YT5A 4Y3UA 1O89A 2Y0CA 5A7GA 1YK1A 1F1BA 1XP5A 3LRXA 3L1JA 2KJQA 4GYWA 4LZAA 3AY7A 2FEAA 4L6IA 3V1MA 4KTVE 5ALFA 1OWOA 1X87A 2JW5A 1GZ3A 1XAIA 1XKXA 3U5TA 3DTTA 3CG4A 3RSQA 2HADA 3KXDA 4UTPA 1EHIA 3LKBA 5TXGA 3LUHA 5FOSA 2AOUA 1Z6QA 1PT6A 2I2AA 3M4JA 3OLZA 4JEIA 5ESXA 3CSSA 2XVZA 4YONB 3OQVA 4LV6A 2IV3A 3I2GA 3T9DA 3MCVA 4Z6KA 2FPKA 4N39A 3DH0A 3UAXA 4CTKA 2GD0A 3WOVA 3T5DA 4ZVOA 4FYMA 3UOWA 1V7PC 3M3HA 4IDAA 1EFRA 1IYZA 2HD4A 3HUEA 4OGKA 3VHXB 3PFIA 4R9UC 1DOAA 3TL3A 3GLRA 4Q1DA 1EFPA 4DNFA 1WVMA 1E61A 4IIBA 4RACA 3ZGVA 3B1VA 2C9CA 2WOJA 5EXXA 3VH4A 2OLKA 3QKSA 2GK7A 2XOKD 3EOBI 5DLDA 1U7ZA 4H2DA 3VU0A 4BU0A 3GEBA 1Q3TA 1WZCA 1K6EA 3FDZA 3OZTA 1D9XA 1PWXA 3ABRB 1O94D 2CNOA 2ZUEA 3W5VA 2D06A 3IS3A 4JGIA 4M6WA 1BDJA 3LT0A 4FDVA 3K8ZA 3WHPA 4BVAA 4F3KA 4FHGA 2VJNA 2QI9F 2IVFA 2SHKA 4JQCA 2BW0A 2RONA 4B47A 1KJJA 1K5PA 1CZNA 3FHJA 3HJHA 5HS6A 3M5PA 3UGTA 4QPDA 3O92A 3VV3A 2H0RA 1FTGA 4AN4A 1Q6YA 2NZWA 1CTQA 3UMMA 1LDBA 3E9CA 2GBLC 1C8LA 3ENNA 4J07A 1K08A 3D8BA 3E8MA 4Q9LA 3SZOA 4BVFA 1WR8A 4FLFA 5BRAA 3THXB 2FG5A 2AFRA 2CYAA 2FQXA 1AF4A 2ZTUA 4HWKA 3D02A 3FWKA 3IBTA 3NUGA 2FK8A 4RSHA 4HVLA 4FZ5A 1KKUA 1X13A 2O8VA 2RK6A 4P4UA 4YI3A 1C4XA 4Q37A 3A9VA 2DWUA 4B8YA 3F74A 3WHKA 3B3AA 3U2QA 1IZ8A 3DBRB 4KLRA 4PQGA 3RB8A 1XWFA 5HJ5A 4XE5A 1Y8AA 4WBSA 4M7OA 3RADC 4DILA 1H94A 1F17A 4ENPA 3X2EA 3QNWA 2XV1A 3IODA 2OCXA 3MPOA 4N82A 1BTOA 1OREA 3F78A 3QEKA 2HGSA 1WCYA 2JEOA 2QX6A 3CH6A 2L19A 3H87A 3M6FA 4K9LA 5CX4A 3JU3A 3ECCA 3IQDB 3LQQA 1P7YA 1P18A 4TZKA 2Y92A 4J0JA 3EWNA 5EYPB 3C14C 3EIWA 5DIFA 1RRPA 2JFYA 2GN9A 3A9WA 4IXTA 1GAXA 3THYB 2PZBA 1NHGA 1BHQ1 2Z9DA 3WIUA 2PY6A 1YDMA 1UBUS 3GVCA 5HILA 4O3FA 2RBKA 4YJGB 2Y1OA 1TRHA 3FZYA 3OUTA 4IZOA 1MVLA 4PZDA 4XQ9A 4ZT4A 3U9TA 3D8HA 1RKXA 1W88B 3R3XA 2MINB 2MSCB 2Q5OA 2VTEA 1XKQA 2Z9BA 5G0VA 3SEQA 2D0IA 3ZU3A 3HO8A 2Q62A 5DYGA 3PGA1 4HY3A 1P75A 1N0WA 2R4UA 1WZIA 3L40A 5AJZA 2R66A 1AHHA 3PUKA 1SEVA 4JVNA 3NP9A 4RHCA 1OTHA 1YBHA 1WOYA 1F3LA 1IK6A 3ACBA 1LWNA 2BUCA 3FKSD 3PPWA 3HZHA 4TSFA 4U3JB 4EGQA 1E1DA 1DV1A 5JVDF 1FOEB 3OLCX 5CA0B 4TMFA 2EU8A 4B0PA 4OU5A 1OGYA 3NEAA 5HE9A 2EJTA 2P6NA 4XUGB 4YYEA 5IT4A 4ALKA 4OCZA 1KVUA 4FFBB 1TM2A 4H3HB 3OG9A 5DE3A 5AUNB 1GV0A 3K0HA 4HR7A 3P9SA 4P84A 5TV2A 3X1KA 2J85A 2MR6A 2ASVA 4R2MA 5FQOA 3L7CA 3NBQA 5JI2E 1A7AA 2LW7A 3JVUA 4F8YA 5JVDA 4KQFA 3DT8A 1G7SA 1X14A 4F3CA 1H69A 1O2DA 1OYOA 4HNGA 3D4LA 5KX5B 5ALUA 5CEFA 1J2RA 1JTFA 2V7EA 2REQA 1HWYA 1EK6A 2DPGA 3NETA 1EM8A 1K4KA 2Y0BA 3SJAA 3U3ZA 5AICA 4JLDA 2CK3A 1EE2A 4UD2A 4WNAB 5ESRA 1XZGA 1IBSA 1J00A 3HP1A 4QECA 4UQPA 4M0LA 2VQEB 3QE2A 5HF6A 2OKCA 4E4YA 2Z98A 4TVBA 3AF0A 4GM1A 4YALA 4FFOA 2ZVPX 3UV3A 1OIVA 4ASUA 1XNQB 1V71A 3HADA 4Q7EA 3S8YA 1KY5A 1EP2B 3CURA 3AEQB 4NFSA 4K9QA 5JAMA 2XXAB 3T5TA 4EVSA 4NLLA 1QRTA 4IZHA 2QT0A 4JX9A 4V2UA 2YYZA 3VR6D 2C9OA 5ALJA 4KYIB 3TTVA 4NEGA 2PS1A 4HVTA 4YX9A 2B4TO 3ND8A 3KQYA 4M87A 4ZO6A 1QZ3A 1JU4A 1TU3A 1YOBA 4X6YA 4YAFA 3JQGA 2IJGX 4GZ5A 1SUIA 2WHPA 3KVNA 1G0OA 3UH0A 3LUFA 3C3EA 3LOPA 1G7RA 1GCAA 4BVLA 4PGAA 3FCXA 1AUXA 1J7JA 1ODFA 4DAOA 3DXFA 3OQJA 3FDXA 2HXSA 3N58A 2Z0MA 1LSSA 4HUQB 3G79A 4LAFA 3T52A 5HX7A 1FLNA 2DECA 2GCGA 3I6YA 4V39A 1NUAA 1ZD1A 2XCIA 1E1QA 5E7IA 4EHFA 3O03A 4DLRA 4ZV4A 4QD3A 1ISPA 4BECA 4F2HA 4ZJZA 5AW2A 5JCOC 2QV0A 4V1CI 1PFGA 4PIVA 3PNKA 2ZJBA 1UODA 3V1LA 1JXQA 2KHZA 4YAKA 5M7EA 3E1GA 3ZHQA 4UBLA 4O3MA 3GD7A 3MIIA 3C6MA 3ETEA 3G7NA 3ICOA 4R1MA 2PD4A 1ZONA 2GAFA 2WC1A 1TEZA 4WCVA 2IF0A 2OD2A 1VL5A 3ILSA 4HLUC 1KK1A 3FLMA 3C8DA 1TAGA 3MAJA 4X7MA 1GKLA 4PFJA 1Y6FA 3LQFA 3H8VA 1RWQA 4JB2A 8ADHA 5BOSA 2YZ7A 3PQ6A 3PYLA 3PFGA 421PA 1LPOA 3AHIA 5TIIA 5BWNA 2YV2A 1BG6A 1WOMA 4HZUB 4OVKA 5KNCH 1L7XA 2JCXA 3MWJA 2FMTA 1VL1A 2OXRA 2Z95A 3F67A 4M0EA 4IIUA 3FMVA 3GRAA 2F1KA 3MYYA 1YQXA 4KU4A 4EG6A 2GPAA 4XUCA 1VTKA 3ICCA 4QREA 1T9ZA 5K3CA 2X4IA 2W2NA 4U7FA 3WJAA 3ZCXA 3IQGX 1RM5A 2Z1NA 2VRWA 1Z15A 1G2IA 4MAFA 3FB4A 1AGNA 5IM5A 5A0VA 1Y4AE 5BNZA 3QITA 4L0MA 4HDKA 1K7SN 1ZUHA 1K9SA 4RHXA 2PXXA 5FA8A 1U9JA 3DSRA 2VF7A 1E2JA 1MDBA 2KMLA 4R31A 3H5OA 4CMHA 1B8NA 1VLLA 2GA8A 2PWBA 3UUEA 1WEHA 4KMRA 4ME6A 5JLJA 5F5XA 4MA0A 5BSUA 3HV2A 3ROZA 1RRGA 2EP5A 2XE7A 3EWSA 4KOAA 3UT5A 4CR7A 1SKMA 2G40A 2H63A 4GNKA 1CRPA 4KR7A 3NT4A 1U8UA 1C9NA 2AUMA 4IHQA 1GRNA 2BEWA 4IUDS 5AW9A 3TXAA 4IH9A 4C04A 4WV3A 4AZWA 1BMFD 3I58A 4ZHQA 3L6RA 3PXCX 1U2GA 2ILTA 4EYSA 1N25A 3ME5A 1N6KA 1YVRA 5FPQA 3BFJA 1YR7A 1TU0A 2RJ3A 3MWDA 3WK9A 4OHXA 3DCJA 3RAGA 1L8QA 1Z0AA 1AXEA 1S1CA 2PR2A 2ZR8A 4EVQA 1M1YB 5KDLA 821PA 3AVYA 1Z2NX 1RTKA 2J7KA 3O3CA 4NZYA 1R8QA 1QH1B 2QAGA 2JZNA 5G3ZA 5IAGA 3WLIA 1D4ZA 1NC3A 2PUVA 4XFKA 5ENZA 4ZKEA 4TYPA 1SQFA 1Q0HA 1RAIA 1U0TA 4KFSA 1XQ1A 2HSDA 3VNVA 2P62A 1RKUA 1G3QA 4D80A 4FC6A 3PDIB 3WLOA 3BC1A 4R41A 4GDMA 2XHEA 1UQRA 3GZTB 1KYQA 1SHKA 1Y8RB 4QVIA 3D59A 1SWVA 2ON6A 3AKCA 4E5SA 5FUMA 1Z5VA 3LHDA 1RMQA 5EJIA 3ZIAD 2C82A 4JC8A 3WV4A 3V1YA 3ZCUA 4IKPA 5JAQA 4ENWA 4FDMA 5L4NA 4NZZA 3MS4A 4GOLD 5JWOA 4X60A 1EX6A 3A04A 3GJ8A 5FCDA 4DTCA 2VYVA 3TECE 2VDJA 4W5RA 5ARCA 3M6AA 4O8ZA 3RRBA 1ECGA 3RS7A 1PUXA 3ILYA 4ZJYA 1THMA 2WJ6A 5JXJA 3PXBA 1M1ZA 2IQIA 3V4OA 3NHFA 5GOTA 2HQOA 2OMKA 1P2DA 3L1IA 4KVFA 1SB8A 3AUTA 3F1LA 3ZU6A 3QHPA 4PLHA 5JEEA 3JWIA 3NONA 1T9HA 1A82A 3TNLA 4DBZA 2VT6A 2ZQYA 4G07A 1TEVA 2ETVA 2ZJ0A 3AJDA 2OA0A 4KDRA 4BXOB 1BU8A 4UOEA 4MP6A 5GJWC 1XMXA 4PAQA 7YASA 1YOVB 4OPMA 3V2UA 5FOXA 2Y6UA 4DCVA 2ZE5A 3QLUA 1J2TA 4G85A 3COWA 1AUPA 2N0SA 2QTCA 4GICA 4DCGA 2I1LA 3PFHA 4FOPA 4DABA 4LZLA 2DCUA 2X7HA 1TVMA 4Q24A 4Q48A 2G82A 4DJDC 5LDDC 1NW9B 1QWSA 3O3NB 3ZHZA 4QC2A 3IUBA 1C3XA 5IC6A 3DJFA 2C4TA 2E3JA 2FSUA 1GUZA 2JFZA 5BN4A 2AFIB 4F6RA 1INLA 1PF7E 2HYIC 1KSFX 2Q1XA 1WDMA 5IFLA 3CW9A 5HPYB 5A02A 4JB8A 1O4WA 3HTXA 4TMTA 1PR4A 1RYDA 1P9NA 1FFBA 1EUCA 2VP6A 1DPFA 1R1DA 1WJGA 4LCEA 2VWGA 4YRIA 4TV9F 1Y1LA 1LI7A 4CHTA 3IAM6 3ZYCA 5IU6A 3LRTA 4I2VA 2AXPA 1H05A 2QVGA 4OKNA 2X76A 1DUSA 4DQUA 4ER0A 1GP2A 3U6BA 3UY4A 3PU6A 3UHFA 4CG2A 4QGAA 4US1R 4EKYA 5E9AA 3BK2A 2G9RA 2VSNA 3TZBA 3VTAA 1Z33A 1EBBA 4FI3C 1NJSA 3O73A 5EHQA 3U19A 3PE4A 1F0NA 3H2SA 4FD2A 4RSRA 4FKBA 3AVUA 3L0OA 4TV9A 5EINA 4D92A 3HDYA 1ABEA 3AR2A 1ECFA 1O95C 3NORA 2TS1A 4GHWA 5JALA 2Z6QA 2Z6UA 1G8HA 4TT3D 1M8KA 1V48A 1ZMBA 3S99A 1YFLA 2DKOA 2J3MA 2TMKA 3ZGXA 4OL9A 1RE1A 1XCJA 2C54A 4BO3A 5B6IA 1D2EA 3TCKA 5IT9A 4NQZA 3REOA 2O8DB 4E14A 3ANLA 1FDVA 1E18A 1S9DA 4D7AA 4AUEA 1I4DD 1KDPA 2JARA 1EXMA 3CPSA 1I7NA 4P93A 2FFJA 3KFXA 4H1VA 4JT8A 1SCKA 3T3EA 4TQGA 2QL5A 3H65A 3P9RA 4J0KA 4E5YA 3U4MA 5AI8A 3X1DA 2WD7A 2D5BA 3PENA 3E9MA 5K20A 1U28C 4BMSA 2HCBA 4ZAZA 2E0IA 4CG0A 4EW6A 1YIDA 3M34A 2WWVD 4H3VA 2UAGA 1JB1A 5IARA 2WE7A 4EJSA 4F38A 1T8WA 2Q5IA 2Q3LA 4FHEA 4MLCA 4WRRA 2VUHB 5LOVA 1DI0A 2C4WA 4QRDA 1J8FA 3R0IA 4GR5A 5JW6A 3DL0A 4Y6LA 1XGKA 1JAXA 4BZXA 4XQGA 5IT0A 3SQXA 1T8RA 1CEXA 1UMBB 2BEVB 4KOEC 3W3AH 4B6QA 2HMTA 4EP1A 4GDFA 3BT7A 3C87A 2WSBA 3FOCA 5LP1A 3KJGA 1T4BA 3P96A 5FORA 3FN4A 1DAFA 2AR9A 5HZMA 4FYKA 2WMNB 1O97D 2B5VA 1UP4A 1ZJ6A 3VZDA 4BLQA 3DULA 1B43A 3BTUA 3ODPA 5ICMA 4WY2A 2BDUA 4DDWA 3BZBA 4O4JF 2J3IA 3I61A 3CR8A 2REXB 1XKTA 4OI0A 3RFXA 1QPZA 4FXOA 2XE8A 3EIHA 4PBSA 4M46A 2WYUA 3FFBA 1Q1NA 3H5LA 1I0LA 4JVOA 2BL4A 3TL2A 4JVMA 3ZZUA 4M36A 3QFTA 5DNVA 1GTMA 3BTSA 3MRXA 1JBQA 1OMOA 4GEGA 4UTRA 4BZZA 2Q3DA 2Q07A 1ILWA 3CZ9A 3GUZA 1RQPA 4YHBA 2IYAA 3SNHA 1LRLA 4KCGA 4CIAA 2FFHA 4O4JA 2M1ZA 3DW1X 1SQSA 4X1YA 3Q2OA 1D3AA 4CQJA 2WJ3A 5EMLA 3DBHA 3LX5A 2BEUA 2V7UA 1A88A 3RJZA 4HNUA 1A9SA 2G28A 3DHNA 2AB0A 4K81B 1XTQA 1Q83A 1QKIA 3ZWKA 5KI6A 1JEQB 4F71A 1NMXA 2IIVA 3KSBC 5H16A 2F9MA 4M54A 1EDEA 4J1TA 5FULA 3ZXUB 3OJWA 2VNIA 3DTVD 2I4RA 3ZJTA 5E1OA 4LS3A 3OFSA 1ZYUA 1B1AA 3ESQA 4MRMB 1YONA 1U5BB 1ZH4A 3IBGA 2J0VA 3Q7QA 1ZC4A 1CR0A 2B83A 2JRCA 2YHUA 2D4AA 3F2IA 4L75A 4V0ME 4BLRA 4R0VA 4BFVA 4FIZA 4WCFC 4G65A 4G56A 4BGVA 5K05A 1PR1A 1RYFA 1TKAA 3LIPA 4MB2A 1SKAA 5IJ9B 1PR6A 4QOGA 3NTUA 4F1KA 2QPLA 3NATA 2DCMA 2DTXA 5JAOA 3ZHXA 3LS2A 2BFMA 1AM4D 2OHOA 5IYZF 3RLIA 1HLFA 2XQIA 4EYGA 1A7UA 1W4BA 2G25A 5ENDA 5KYWA 1JAZA 5ESDA 1UOPA 4RTSA 1A3CA 2J9FA 1EQUA 3CCCA 3LP6A 1ECCA 4MR9B 4YBRA 1SAYA 3TYXA 1SUWA 1DXYA 1QE3A 3EG9A 4AICA 1ZHHA 2LE0A 1P7ZA 3ESXA 4B9AA 1O94C 5C4IA 1B3BA 4RPHA 3TQTA 3OPYI 3SDSA 2WG2A 1LQUA 5IYZA 2ES4A 3D0OA 4IJWA 4QT0A 2IDZA 4UFNA 4B2PA 5CAEB 1HF3A 3KQWA 2JGNA 2P6PA 2ZK7A 3CC8A 3QOYA 2XQJA 2A6PA 4MGZR 4PPYA 1XELA 5I8PA 2W2KB 1FNMA 4MV5A 4BY9E 3AKYA 5F2NA 5B6PA 3BE5A 5KB3A 2COEA 3N76A 1A7KA 2QTAA 5JAHA 4TVSA 1FFHA 1Y3HA 4AKEA 5B3AA 3JARB 5BRNA 2REBA 1Z28A 1FPQA 3A1SA 2QY6A 3NGMA 3RREA 2ID4A 2Q99A 3RU9A 2FOIA <