1NASA

Sepiapterin reductase complexed with n-acetyl serotonin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEPIAPTERIN REDUCTASE
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 97
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nasA00
3EVTA 4AJ4A 1Y1PA 5U1PA 2IZ1A 4E4YA 2IXBA 2WD8A 4GKBA 2CMDA 5KJ1A 5KJ6A 4UEKA 2Z5LA 1VKOA 4XB2A 3DAFA 4IIVA 4QEDA 2A94A 4R9SA 2AE2A 5KVVA 2C29D 3AM5A 3C24A 1EQ2A 1E77A 3KYCA 4DTIA 2I67A 3D3WB 2FR1A 1IB6A 5TRTA 1NR1A 3L4SO 1V6AA 3U3XA 5K6AC 3KSDO 4W82A 4YAIA 3LT1A 3W6ZA 5B4VA 4LVCA 4Z6KA 4L8VA 1DPGA 1EEHA 3UXYA 3AM3A 3OA0A 1GYRA 4YYZA 5IDWA 2ZB8A 4FJ1A 3OQBA 4WEOA 1Y5RA 2GN8A 4KUEA 3D3WA 3M1AA 1OMOA 3TJRA 2NACA 1XKQA 1SPXA 3QQPA 1N7GA 1UJMA 2HAEA 3WQRA 1XQ6A 1MC4A 2WDZA 3ZI0A 4XD2A 4XYMA 5CP8A 2X0JA 1GUFA 2NU6A 2UYYA 1N1EA 2YQ5A 3W8DA 1E6EA 1BRMA 2B4QA 2P5UA 3KTDA 4W7HA 2WSBA 1UR5A 3TOXA 4XWYA 2OOSA 3RU7A 5L45A 3DXFA 4OJNA 4NR0A 3E18A 5IDYA 3DO5A 4P4LA 3FNEA 4DVJA 4UUPA 5HTOA 4CV3A 4TKLA 5F1KA 3WNVA 5IAAA 3UCEA 1BXKA 2P4HX 1K6IA 4XYGA 2O23A 4CM8A 3A4VA 3ADOA 2W90A 3ZCXA 2WE8A 2O3RA 1S7CA 2X58A 4EJMA 2OP0A 2QG4A 3DHYA 3V8BA 1ONOA 3KOUA 3K8ZA 3S2EA 2Q45A 1GPJA 3WQSB 3DOCA 1VM6A 4DLAA 4F6LA 1SCUA 1TI7A 5F5LA 3WGGA 4M54A 5G0TA 4R5HA 1R0LA 5KKCA 4I1IA 4GH5A 1AN9A 3O8QA 3M2PA 3ETEA 3ZWAA 4GX2A 2GN6A 3WTBA 3GVXA 2VHXA 1LEHA 4LCJA 3QVOA 1GUYA 1EE9A 5COQA 1NASA 1NQOA 2ZTUA 2AEFA 4TKMA 2J5QA 4NPCA 3ANLA 2ZCVA 4UEOA 1PJBA 4DREA 4CMGA 2JHFA 5KVSA 3KBOA 3OBBA 3E1KA 3GH3A 5A9SB 2VT3A 4J1NA 5HS4A 5L4LA 4F6CA 3RBZA 2IYOA 3JQGB 4CM7A 1ZSVA 4KDEA 4TZTA 3RUEA 3ABIA 3PHGA 4M8SA 1ZMTA 3U62A 4BO6A 3ONDA 1ISFA 2NTNA 1B8PA 4CM4B 4OXYA 3RCBA 2ZATA 3NDRA 1LXCA 2X8LA 1C14A 2IZZA 5DCYA 4CMIB 3WSWA 1QORA 5A9SA 1SAYA 3RASA 1U8FO 3JQGA 1RM4A 5IF3A 3B70A 4JN6B 2PR2A 2BGKA 3OIGA 3L6OO 1DIRA 3Q0EA 2GYYA 4QFCA 1C0IA 1H93A 3ZNOA 2VTDA 3EDMA 2IRWA 2ZTLA 3GHHA 4HXYA 3IL2A 4CUKA 2JFFA 1DC4A 3PYMA 2WYWA 2O3JA 4WLNA 3PK0A 3JQ8A 3QWBA 4YBZA 5JY6A 2GUGA 4HFRA 3RBXA 5DP1A 3AI1A 3Q1LA 5I7EA 3GF4A 5JDIA 1LRJA 3V2GA 1A7AA 1GQYA 1YBMA 2PY6A 4WK6A 3RVDA 4F46A 5TT0A 5JCJA 1LLUA 2J5KA 3BMNB 4FQ8A 1GZ6A 1OAAA 3GR6A 1M76A 3INRA 1PL6A 2NM0A 3LK7A 3AI3A 3JQAD 3QJ5A 4TRRA 1E7WA 1I10A 4KQWA 1UZLA 4BNFA 2P4QA 2HCTA 4W4TA 1Y81A 4DGSA 2SCUA 1CDOA 1W8DA 5EERA 4EITA 2VYND 3QLJA 5I8WA 5L4SA 5B1YA 2VOEA 3RIHA 3GVPA 4NNJA 2GZ1A 5CEFA 2O2YA 1KY4A 4KUHA 1PGNA 7MDHA 1WZIA 4RPLA 4KDFA 5DCWA 4OOEA 4D46A 5IFLA 2FZEA 2P9EA 4PLPA 2BFAA 3GMSA 1KEWA 4LISA 2XAAA 2R00A 4NJOA 1LLDA 2Q1WA 2ZYGA 5AXAA 1P1HA 1ORRA 4N7RA 4RCVA 1YH3A 1Z7EA 3GZ4A 2C54A 4XKJA 4CQLB 3ZWNA 1Y7TA 4E5NA 4II2A 1I24A 2B5WA 3DB2A 1LQTA 3E9QA 1Z82A 2J3KA 5CDGA 3S1LA 5JBIA 3CZMA 3ZHXA 4CLDA 5T6BA 3IOYA 4PRLA 4MP8A 4RF4A 4KP7A 3VC7A 4PGFA 3FN4A 5FF9A 4Y6SA 2DUUA 1MFZA 3E9NA 4FBGA 5A04A 1ZJZA 1NHGA 2C82A 3C7DB 5LDGA 4BO0A 1I8TA 1XLTA 2NVBA 1VL8A 2YDXA 4G2NA 4Z9YA 1R0SA 1R6DA 1MUUA 4YAJA 1DHTA 4FB5A 3GNQA 1ZKMA 3HHPA 3H4VA 4ZJUA 3I6IA 1SB9A 4RPGA 3TRIA 1B2LA 3DZGA 4LSWA 4JBGA 4M55A 1FDUA 3IP1A 2DBQA 4DQXA 2ZKLA 3E5RA 2ZB3A 4J1TA 4BNWA 1X1TA 3AOEA 2Y1GA 4WPGA 4W9NC 5A05A 4GX1A 1QYCA 1QXSA 3OQ1A 3GZNA 1DBVO 4NK4A 1E7QA 3RUDA 4BMNA 1UXKA 1QR6A 1ZK3A 1YVEI 1XWFA 4RLSA 1NQTA 1LDNA 1LDMA 3BA1A 5A4DA 1MC5A 3DMYA 1PZFA 5KCZA 5EJ2A 1KS9A 1JWAB 1TVEA 2F1KA 3U5TA 3WFIA 2YHUA 3GY0A 4BQRA 3S2IA 5JXWA 4BL5A 2DPHA 2FPIA 2WWRA 1HEUA 2D5CA 5T64A 4NFSA 4EEZA 1YGYA 2HMWA 1XCBA 3OJEA 1WMBA 5JO0A 1WW8A 3OM9A 4NHEA 4KUGA 3UF0A 4YT4A 3DBLA 3B6ZA 3ZDFA 1V0JA 1W4ZA 4L76A 4BGIA 3EUWA 5DCUA 4DLBA 1YJQA 1G0NA 1B7GO 2Y67A 1PIWA 3T7EA 3FR7A 5F3RA 4TWRA 5A3VA 3NRCA 4FSHA 3ROMA 1NQ5A 4L9RA 4RQUA 5A03A 1RYDA 4O6VA 1YOVB 3F5SA 1Q7CA 4HUJA 1U4SA 2PZJA 3DAPA 2BRUA 4Z9FA 1I36A 4U6QA 1YDEA 5L40A 3IUSA 3K96A 2OMEA 2VCYA 4MVJI 2OO5A 1XGKA 3LU1A 2EF1A 3VPGA 5TC4A 4ZA2A 2EW8A 4MVJD 5LCXA 5BSFA 2FMUA 2CVZA 2I9PA 3WWZA 4LW8A 4CM9D 1U7HA 2B69A 1G1AA 3CKYA 2FRDA 5I9NA 3EK2A 3D4PA 1E5QA 1H2HA 1JKJA 1H0KA 1HXHA 4GGPA 2VZ9A 4GVXA 3TN7A 4FN4A 2ZQZA 3JQFA 4R1SA 2JCXA 3F4LA 2ZB4A 2IE0A 3AUUA 3LSYA 3TL3A 1D4FA 1W6UA 2AQHA 4M1QA 2X0RA 4PLFA 1EUDA 1YS4A 3WYBA 1GUZA 3JQBA 2OHXA 4PFJA 4JCOA 5AXCA 5JO9A 4BQPA 1E7SA 2FHSA 1ISHA 2PFGA 4DIBA 2V6BA 3L77A 3VZRA 2AQ8A 3GHYA 4MKXA 1PX0A 4U6SA 2O7SA 2HKIA 2GCGA 3JQAA 2IDZA 4MVJF 5IZCC 2B37A 1T25A 2R2GA 2YV1A 2PKQO 2H6EA 4FOSA 3ZWBA 4TVOA 1G6KA 1T24A 4QUKA 1YQGA 1T1SA 5A06A 4WGGA 3KYDB 2DFDA 2VYNA 3D4OA 4PRKA 2AG8A 2NU7A 5ITWA 4ND3A 4P8RA 3VZSA 4KQXA 1KY5A 2O4UX 1VL6A 2NVWA 4OH1A 1O94A 5HS6A 4M49A 1XIVA 2EP5A 5IDXA 3KUXA 3NT5A 1EBFA 3GG9A 4HY3A 3OEWA 3U4DA 1LSOA 4DXHA 1T2FA 1ZK1A 4RV9A 4QXMA 5JDCC 4JK3A 2E82A 1YB4A 3ASUA 1YL6A 3QVWA 4WE3A 3I4FA 3GVHA 4MVJM 4CM3A 5TT1A 4E0BA 1IZ0A 1ZIDA 4E31A 3I52A 3DOOA 3TF5A 5CEEA 1B8UA 4MP3A 4NBWA 4OHUA 4S3MA 4RGBA 3AFNA 1N2SA 2WEKA 3NEPX 3PIIA 1HDZA 2EEZA 4GI2A 5KVCA 1JVBA 1JTVA 1U5AA 2IEBA 4E5KA 1EDOA 3LQFA 4XQGA 2WD7B 3DZBA 3ZU3A 2HQ1A 5JC1A 1K89A 3HB4X 2XXBA 5DBIA 4NU6A 3GNTA 2VHWA 1U2DA 1N9GA 3TPCA 4DPMA 1DFIA 5IG2A 1E3WB 4RPJA 3DHEA 1LX6A 4QO8A 2HK8A 3L6DA 5EPOA 3PDUA 4ZQBA 4J9VA 3H5AA 3VHRA 2YFHA 4OXNA 1OC2A 2CFCA 4YR9A 4O59O 3UCFA 2C07A 5TJHA 3EY4A 2BKAA 3RFXA 1YQDA 2Z1NA 1K6XA 3V1YA 5KJCA 1Z75A 3I83A 4JNKA 2PA3A 5IZ4A 3L4BC 3HWRA 2V7PA 2VWGA 2X9VA 3QVTA 1X7DA 3MWDB 4B7XA 4R54A 1DIAA 1YB5A 4XRGA 5JDIC 4NMHA 2CDCA 3O38A 2YHIA 4YAKA 4I08A 2QHXA 3FPLA 2P9GA 2CVOA 4RVDA 2W2LD 4WLOA 5IN5A 4AJJA 1GEEA 4NG5A 4LRSB 4XGNA 4AJNA 1Y8RB 4LCEA 3R3SA 1TXGA 4BNYA 2GZ2A 2NWQA 5AXBA 3HJAA 5ICMA 1HYGA 2X9NA 1ADGA 3BMOA 3F4BA 4AJHA 3JQDA 2VRBA 1B16A 1NPTO 1X0VA 3GVIA 5I9MA 3VZQA 4DLLA 1GD1O 2PKQP 4M87A 3WJ7A 5TGDA 5MDHA 4RVFA 1CERA 1VPDA 4L4RA 1IUKA 4BKOA 5DP2A 1Z45A 2WMDA 1GZ4A 4BNHA 1JWBB 3GRPA 4JQCA 2DC1A 2QZ9A 2Y1CA 1LDGA 1UZMA 3A9WA 3ON5A 4D7AA 4PG5A 5AQ1A 5BSEA 1WZEA 4FIZA 1UZNA 3R0IA 3ZH2A 2G5CA 3W6UA 2EKQA 4HP8A 4UULA 3SC4A 4N5NA 1X0XA 4M89A 1TLTA 1ZW1A 1U3UA 2RH8A 3BMCA 2RH4A 4D45A 3C1OA 2I5PO 3FTNA 3H9GA 4MVJA 3HNPA 1DO8A 1ZK0A 1EUZA 3Q3CA 2X0NA 3WGTA 1E5LA 4BGEA 1E3SA 3DZKA 5CHEA 4XYBA 2RHCA 4OMUA 3IS3A 1GQ2A 4KTTE 4ND2A 3WICA 4XX0A 4BNKA 2CVQA 3SBOA 1XR3A 1FF9A 1U8XX 2AQKA 3BTSA 1C3VA 4JJIA 3MOIA 1KVUA 3DC2A 1TB4A 3H3JA 3BTVA 1YBVA 4L75A 4MP6A 5JCXA 1J6UA 3C8MA 3PWSA 2YZ7A 3PLRA 1D1TA 4GPD1 1EK5A 3KEOA 1Z6ZA 1B14A 1T2CA 1UXIA 2Y99A 3FWNA 2CZCA 3H6KA 1UXGA 2X5OA 1Y9EA 1A27A 2B0JA 2HRZA 3JD2A 5AOVA 2X7HA 3WGQA 2NQ8A 1I30A 2Y66A 1MFPA 5HM8A 3AUSA 3ZV3A 2G0TA 4FFNA 1U9JA 4GMFA 2B4TO 4WJZA 3ROQA 1RKXA 3JQ6A 3VVBA 3DBRA 3FF4A 2X9GA 1U7TA 3NV9A 1R4NB 1SBYA 2PZKA 3CSDA 3W4IA 1Q0LA 1ZK2A 1PWZA 3KHUA 1CIVA 2F00A 1WP4A 3DDNA 3EAGA 2EWMA 1R16A 1AE1A 3VH1A 3KLMX 3I6QA 4AJ1A 4K6CA 4MPDA 1DRUA 3WMWA 4EEXA 4WLVA 5I7SA 5L7YA 3B20A 1N92A 3LYLA 4OOFA 3Q6IA 4CMAA 5JCJD 1BG6A 1DC5A 1R4NA 3PTZA 3RBVA 4EYEA 1F8FA 5EMHA 1OFGA 3V1UA 4BHTA 2Y1OA 3NTRA 5B4UA 3ICCA 4YVFA 1B0AA 3X2FA 5IDQA 2QRLA 2JD1A 1PZHA 3H2SA 2BF7A 2I6TA 3ONEA 1BWSA 5ENVA 2V6FA 1H6AA 1LDEA 1P1IA 2A9FA 4U8GA 4R41A 3ROKA 5CDTA 4CQMD 1A4UA 1RPNA 4X54A 4E21A 3DFUA 5COBA 3VH2A 4E5MA 4D43A 4MKZA 3PI7A 4YPOA 2DT5A 3OECA 4YXFA 1EBUA 2Q2WA 3ZV6A 5DNAA 4XR4A 3S2FA 1QYWA 3TQHA 1JW9B 2DAPA 4GAEA 1IPEA 3PWZA 3U09A 3PJDA 4IIUA 4Q39A 1TEHA 3ZGYA 4OIMA 3V2HA 3JQFC 3HSKA 4L4XA 4Q3BA 5IJZA 4G65A 3ZNPA 4CL8A 4Y6PA 4OSOA 3D5TA 1LNQA 1L1FA 2PK3A 3S8MA 5T8KA 1FDSA 5GMOA 4J6FA 1NFFA 3WTCA 4XZ3A 1NXQA 3RFTA 2W2LA 3H8VA 4IDCA 3AY7A 1XELA 3ZWXA 2EERA 2PLAA 1I3KA 2VWHA 4ZRMA 2B5VA 2I99A 4EUFA 2Y1DA 3FNGA 5G0VA 4BUCA 2ZYDA 1BMDA 2JHGA 1E1NA 1V3UA 2D59A 5JPIA 3S2GA 1HYHA 4OKNA 4CM8B 3ETDA 3KB6A 3AFMA 5BNTA 3WR5A 4Z3KA 2JFGA 1ISJA 3UHAA 1FDWA 4WCFA 1XA0A 3HADA 3A14A 3WS7A 2O50A 4NFHA 1DHRA 4PLTA 5EL0A 4BO8A 4FR5A 4AJKA 2FR0A 3DHNA 4YAEA 2CF6A 1WDKA 1P1KA 2IYPA 4DWVA 2O3UA 4CL3A 2QIOA 3ZWOA 4TRJA 3IIEA 3RUCA 5HBRA 3OETA 3VVCA 4DC0A 4RZHA 3O8QB 1E6UA 4B7UA 3IQDB 2VQ3A 3K30A 5L53A 3BMQA 1RJWA 1BGVA 2X22A 3JYQA 5JNLA 4EGFA 1UP7A 3FTPA 5JC8A 1H9AA 1HDYA 4KWHA 3GC6A 2PTGA 1WXDA 4RVSA 5T5QA 1D7OA 1YE3A 3NDIA 4GWKA 4CJXA 4BGUA 2EXXA 1FDVA 5DF1A 3RWBA 1EZ4A 1ENOA 1XU9A 2A92A 3IDSA 3PIDA 4NBTA 3H9EO 2FN7A 5H82A 3VDQA 1HSOA 2WJPA 4BKQA 1J5PA 3FCOA 1FDTA 4CUZA 1CJCA 1W73A 1E1KA 1P31A 4PIVA 4B4OA 4PG4A 3PQDA 4GL4A 4IDEA 2VN8A 2PH5A 5A02A 1CEQA 2HJSA 3PQEA 4R3WA 4Q3EA 1I2CA 1VI2A 2YDYA 1E92A 3IAHA 4MIEA 4LMRA 1DOHA 1MV8A 4JJFA 3DMTC 1E1MA 3HDYA 3EYWA 4ITUA 5GZ1A 2YY7A 3GG2A 4I5FA 2NU8A 4Z3DA 1IY8A 1EUCA 4OKIA 3RC7A 2DLDA 3PFFA 3KSUA 4R69A 2BGMA 4E3ZA 3LC7O 3WNQA 5F1OA 4NK5A 2EGGA 3OH8A 4CUJA 1NVGA 3ENKA 3BYZA 4Y6RA 4U5QA 4EW6A 1TA4A 4PLYA 3W4JA 5FWNA 3JQ8B 2WYVA 3JV7A 2DTXA 3WB9A 5KJFA 1TT5A 4XQCA 1HE4A 5CG1A 2IEDA 5B12A 3G1UA 3MOGA 4R01A 5LC1A 2NUAA 5L95A 2D4AA 5CFZA 2A35A 1KEUA 4JROA 2OZPA 5U9CA 2CF5A 1OOEA 5JSFA 2GD1O 2J8ZA 1O6ZA 1NP3A 2D5AA 4NIMA 3VH3A 3SC6A 2H63A 4WASA 3WYCA 5B37A 4E2YA 2O2SA 2BD0A 2Y05A 1YRLA 1YQXA 2GF2A 3NTQA 5CPBA 1LDYA 4CQMB 2I3GA 1O9BA 3BAZA 3WIEA 4UREA 1KC3A 4YJFA 1J49A 3I4CA 5COAA 3WIDA 1KEVA 4O63O 4HX5A 2CUKA 2JL1A 2ZJ1A 1M2WA 1VL0A 1X7GA 3IMFA 1T26A 2YJZA 5ITVA 3I9LA 3FNFA 4MVJE 1BTOA 3LC1O 2QW8A 4CMBA 1PGPA 5JAIA 3FD8A 4CQMA 1DLJA 1LUAA 3GGOA 1C0LA 3I23A 1D1SA 1SMKA 5AYVA 1NBOA 3IJRA 2ZTMA 4PLHA 1GFSA 1ADFA 3GNSA 4IM7A 4ZRNA 2Y0DA 3P2OA 4O5OA 4DQVA 4J49A 4JBIA 4IMRA 2FR8A 3MJTA 5CDUA 4IXTA 4ONEA 1PJSA 1G0OA 1MLDA 4BNUA 2DPGA 3IKTA 4J0EA 1MA0A 2FWMX 4ND5A 1JAXA 3ZU2A 1FMCA 4R3NA 4YEDA 1ISGA 4IJKA 3RI3A 3G49A 2AE1A 4YTEA 4D41A 2ZTVA 2AA3A 2PD4A 1NAHA 1A5ZA 2AEJA 2AMFA 1KIFA 2OBNA 3LC2O 2XOXA 2BELA 2VUUA 3JCZA 4NQZA 1YKFA 4UVDA 4LRTB 4CMEA 3AI2A 4QT0A 3U4CA 2Q99A 1YONA 2BI8A 5EIOA 2YV2A 1XEAA 2EIHA 3P5SA 1ENPA 3KETA 3GZNB 3L07A 4HV4A 3VZPA 1P74A 1R37A 4NH4A 1AHIA 1PQWA 2B35A 1DAPA 3CZRA 4L74A 4CODB 1YL5A 4HFJA 1GZ3A 3FHLA 4MJLA 3GFBA 4WNIA 3RFVA 3LZ6A 3UVEA 3NT2A 4XIYA 4FC6A 5G0UA 3R1IA 1U5CA 1IYZA 1E6WA 1SOWA 4BV8A 1ZEJA 1LJ8A 3C3XA 2JJYA 3ZV5A 3GPDG 3O26A 1L7EA 1ZMOA 4YRAA 4JXKA 4IJVA 4UVEA 2Q4BA 1YXMA 2C59A 3TL2A 3WG9A 4UUNA 3DBLB 5K9ZA 4G81A 3DEYX 4PLGA 3HE3A 3DOJA 4O0LA 3K5PA 4BB6A 3BIOA 3RC9A 2O3SA 2P9CA 3CIFA 4GLOA 3TZKA 3UGKA 4NJMB 1PL8A 1QMGA 1Z7BA 4R51A 1RM5A 3NUGA 4JIGA 4YT2A 2NU9A 3O4RA 1DJQA 1NFQA 3F1LA 5G4LA 3QWIA 4PLCA 3WMXA 3TOZA 2Q2VA 1LI4A 3D7LA 4IBOA 5TSDA 4OO3A 3OHSX 3SEFA 4DYVA 2PWZA 3JD4A 3GAZA 1DSSG 4IDAA 1O0SA 1YJ8A 4NJMA 4IZHA 2DKNA 1ONPA 1M6WA 2ZB7A 4GLLA 1E3EA 3PGJA 4D3SA 5TS3A 2HK7A 2PZLA 1YWGO 4BKRA 1VKNA 2VUTA 3PP8A 4FW8A 2PH3A 2J3IA 4ILKA 4AICA 1GCUA 1EVZA 1SOVA 4EBFA 3F1KA 4WECA 1E0DA 3AK4A 1B26A 2Q1SA 3CE6A 3OJOA 4CLEA 5FFFA 3L9XA 3OF2A 3OQ6A 3GGGA 5DZSA 3HDHA 2PZMA 5DN9A 4Q3CA 2Z1MA 3VPFA 2H5LA 4RJTA 1H6DA 1CQIA 3MJCA 3AU8A 4S1VA 1AXGA 3GUYA 1ADBA 4HBGA 4R9RA 3L0DA 3MEQA 2IZ0A 3D64A 3PJFA 3WGZA 4PLVA 1QV7A 1VC2A 4DC1A 4PZCA 1PJ4A 1ARZA 2GZ3A 4OSPA 3QY9A 4PLWA 3JSAA 3JQAB 5FEUA 4BIIA 1BW9B 4B4WA 4JJGA 4YB8A 1CWUA 4EI2A 3Q9UA 3QHAA 1VE9A 3D5QA 4IQ0A 3RD5A 1M67A 3LF2A 4MO2A 3TNLA 4OM8A 1MX3A 4Q9NA 2FZWA 3VDRA 4II3A 4BO3A 5C3MA 3K31A 4NI5A 3BXXA 4WKGA 3H9JA 5K6AA 3BHIA 2XXJA 1MGOA 1LBEA 2C20A 5H83A 2YV3A 3SLGA 4AJ2A 3NX4A 4PVCA 1BW9A 4FPXA 2X5KO 1WLYA 1VJ0A 1YO6A 2PD3A 3NJ4A 3VKUA 3ZHBA 5L7TA 4WCDA 1LTHR 3KXDA 4ZD6A 3OEYA 4RL6A 4W99A 3NT4A 3RUFA 2ZJ0A 2O7QA 4B7CA 1H9BA 3NDJA 1DC6A 1JN0A 3OMLA 2NV6A 2FPPA 1F06A 3A28A 1NR7A 3KSZO 2D8AA 2HMVA 4FOOA 4XIJA 1C1DB 3EW7A 2EW2A 4BVAA 4L73A 3ANNA 3RUHA 3WGYA 1I33A 1BHSA 5HWSA 3PGXA 1N7HA 4BNNA 4TRNA 4ZGWA 4F45A 3K73O 4IQGA 4KTVE 2AG5A 1BDMA 1N9GB 3KO8A 3JQ7A 1PWXA 4J16A 4R1TA 1P3DA 2DU8A 3PFWO 1EVJA 3FPCA 3NYWA 1IHXA 4GBJA 4E12A 4R5MA 4YJGB 1HSZA 1C1DA 3WGOA 1J4AA 4DBZA 2HU2A 3NAQA 2UUPA 5EQFA 1YL7A 3W4KA 4DBVO 1U28A 3ZNQA 2P2SA 2VT2A 4CR6A 1H2BA 1VSUA 4FJ2A 2BI7A 3QSGA 2PKRA 3F9IA 3PJEA 4XQ9A 1YBAA 3QWHA 3DZJA 2YHIB 4FS3A 3H2ZA 2YW9A 4QSMA 4YJGA 1F8GA 3C85A 2FP4A 2W2KB 3QA9A 4RVGA 3F46A 1BXGA 1GU7A 5GZ6A 5JMPA 3T4EA 3TFQA 4CLOB 4PN3A 3HUDA 4B8ZA 5CG2A 3KM0A 1HETA 2E6UX 2Q3EA 3IP3A 3N74A 1M75A 3BMOB 3DQPA 3HQ4O 2D0IA 1IHYA 1MG0A 2EG9A 2Y1EA 3M1LA 4DIFA 1VJTA 4J7XA 3VKVA 1P9LA 4FFLA 4PG6A 4IDGA 1F17A 2X86A 4TQGA 1K3TA 1U3VA 3MTJA 2DM6A 1EE2A 3AOGA 4J2OA 1NTOA 3AJRA 1P1JA 1NWCA 2GNAA 2W2KA 4PG7A 5F1PA 2DTDA 4GWGA 7ADHA 1GTMA 3H9UA 4CLOA 5ER9A 4Y9DA 3RKUA 3G0OA 1LRKA 5TIIA 1ISIA 3GN2A 2ZQYA 5EN4A 4B3IA 3WBBA 3LVFO 3NJ8A 1EK6A 2JD0A 1HWYA 4RORA 4ID9A 4AJIA 3ETGA 4MVJP 4P4NA 1ZXLA 3ORFA 4CMJA 4E5PA 1OI7A 1Q0QA 3RC2A 5C37A 1P45A 3E8XA 4WNCA 5MGBA 3BMCB 5EINA 4ALMA 2X1HA 3LT2A 1Z73A 4AJOA 4Z0TA 2OORA 1DXYA 3ICPA 1QYVA 3COSA 1I3LA 1KBZA 2BLLA 2EP7A 2VHYA 4WEQA 4DYDA 1DLIA 2R00C 2UAGA 3EHEA 1EMDA 1HTBA 4L4SA 4XGIA 3R3JA 1NM5A 1GY8A 1QKIA 5G4KA 3E9MA 4IS2A 2BFPA 3ZW8A 2ZYAA 3INGA 5FI3A 4YJHA 3E48A 4ROSA 1I3NA 2P91A 4MIYA 5L3ZA 4RVHA 2CDAA 4XQEA 3GA0A 1SEVA 5I7VA 1PJ2A 2QRKA 2VZ8A 4FD3A 1V3VA 4YJDA 3VPXA 4OL9A 3WFJA 4CV2A 5G2OA 3IKVA 2FSVA 3GMDA 3GUCA 4GSLA 1E3IA 3BHMA 1PGOA 3ZWPA 1P1FA 5JS6A 4XDYA 4IINA 4HFNA 2EJWA 3V5NA 1LU9A 2LDBA 1HZJA 3T7CA 1NVTA 1E3LA 1OBFO 1FK8A 2ILTA 1K5HA 1HDRA 2JCVA 3AOEC 2YYYA 3G79A 6ADHA 3DBRB 4OYRA 4PG8A 1PJ3A 5KTKA 4NFYA 1UDBA 3OJLA 4JGBA 2CDBA 4N18A 1DRVA 4AFNA 1U1IA 1PS0A 1JU9A 4PZEA 4P4GA 2H1SA 4BO4A 2AXQA 3MWEB 4BNZA 3WXBA 4XGKA 3WOHA 2HK9A 3I9NA 1U4OA 2X4GA 3UICA 3CH6A 1WWKA 3OIDA 2AW5A 4UUMA 1CF2O 5JAZA 4W6ZA 4R4JA 1RM0A 1ULUA 3TZ6A 2RHRA 1CYDA 1MB4A 3JYPA 2WYUA 3WDSA 4PZDA 1HE3A 4D3FA 1R15A 4ALKA 2E37A 1IPFA 1U3TA 3LT0A 4GQAA 3RSHA 3H3FA 4LN1A 4XR9A 1UAYA 4IQ8A 4XDZA 3PHHA 1GYPA 2CD9A 1JA9A 4TZKA 2I76A 3MCVA 1VJ1A 2NTVA 1GADO 3PVZA 1BXZA 1DDOA 2YFQA 3PWKA 3JTMA 4B79A 3MJVA 1ZH8A 2QZZA 2NSDA 3DBHA 5A5EA 3I5MA 4BB5A 1V9LA 4C4OA 4BO9A 4ND4A 3KV3O 2I65A 6LDHA 5LDHA 3PHLA 4MVJH 2VHZA 4B4VA 1R4MB 4W9NA 5JYDA 2B4RO 2GRAA 5JY1A 1F0YA 4ZQEA 1Y6JA 5EESA 3RJ9A 1DIHA 1A7KA 2EJVA 3CXRA 3DAGA 4RPKA 4CLHA 4Y67A 2DTEA 1TT7A 3B1JA 1AHHA 1E3JA 1J0XO 3HDJA 4YQZA 5ENDA 1KVSA 2RIRA 2EKPA 3E5MA 1N5DA 3U49A 1QYXA 1PJLA 1DFGA 2B83A 3ONFA 1I3MA 1ZEMA 1T2AA 5THKA 4A03A 5T67A 1R4MA 2VWQA 1SO8A 2Q50A 1ZVMA 3AY6A 3WYEA 4EZBA 3DONA 8LDHA 3LLVA 1S6YA 3AUTA 3IUPA 3OA2A 3ANMA 5L7WA 3OJFA 3UCXA 1X15A 4WLFA 2VOJA 5A5FA 1QG6A 4CR8A 1U3WA 3OIFA 3JQBC 4UUOA 4I5DA 2C2YA 4WCFB 3S55A 4RZIA 3OICA 1KYQA 3ZW9A 4JP2A 3HB5X 4AL4A 4AVYA 2GASA 3ZWYA 5A9RA 1ZCJA 4J1SA 3VPSA 3D0OA 4JLWA 3W1VA 4D3DA 2E4AA 3PJGA 4HKTA 3ZWCA 5KWEA 3GGPA 1DJNA 4E30A 1X7HA 2J6IA 2ZIZA 1JLLA 5DOZA 3GEMA 3BMQB 4A0SA 4A73A 5HRUA 4BO1A 1X13A 1DAOA 1PZGA 2E49A 1ZJYA 2JAHA 4KWIA 4XRRA 5G0WA 4IDDA 3PEFA 4RVUA 1T4BA 2H9IA 3QW2A 5BT9A 2XF8A 3SVTA 3ASVA 3MJ4A 2G82A 1A71A 4UVIA 4NDNE 4MDHA 1UDCA 4J90A 2JCYA 2E48A 3A06A 1ZSNA 3UH1A 4E33A 9LDBA 2DUWA 4B3HA 2W4QA 4J91A 3T4XA 3KZVA 4C7KA 3Q9NA 4ZQFA 1LLQA 3DZIA 3CUKA 4WLUA 1C0KA 4CR7A 4MKRA 2YUTA 2ZCUA 1PJCA 3X2EA 4P22A 4LSMA 3ZNNA 2C2XA 4J0FA 1V8BA 1QYDA 1F14A 4IMPA 2HDHA 4BNVA 5IZCA 1ISMA 4F3YA 5JW6A 1BVUA 5C5IA 1UDAA 1V35A 1ADCA 3U9LA 1U2GA 5H81A 2EV9A 5ILOA 1NYTA 4YWJA 4TVBA 3AY3A 4HNHA 2VNAA 4D0RA 1TT5B 3RUIA 2P68A 1K2WA 4RF5A 2WE7A 4HNGA 4WOKA 1LA2A 3BTUA 3GAFA 1N1GA 2OFPA 3RROA 4J7UA 3QIVA 1PR3A 3TZQA 4CM1A 1EDZA 5BR7A 3B1KA 1Y8QB 3ENNA 1DIBA 4ND1A 2OXIA 1P77A 2JD2A 4O1MA 3HN2A 2I66A 3BTOA 4XB1A 3P7MA 5JDCA 1JDJA 3ULKA 2P5YA 1KEPA 3E6AA 5KKAA 1HDOA 5JFOA 4CM6A 1Y5MA 1SB8A 3LLSA 5AXDA 1LQUA 2OBYA 4BOYA 3EZLA 2NTJA 4YJFB 1VSVA 2V6GA 1UH5A 2O4CA 4QX6A 1AUPA 1Y8QA 5GY7A 1LRLA 2XPCA 1Q7BA 3V1TC 4KZPA 2GO1A 2J3HA 2FOIA 4CPDA 3GOHA 4PVDA 4J2HA 1GV0A 4ALJA 3KEQA 1Q1NA 1WMAA 5A1TA 8ADHA 4IUYA 3GPIA 4LVUA 1DRWA 4DIOA 2Q4EA 3VTZA 4FCCA 4GMGA 5BNIA 3ST7A 4TMFA 4UAGA 3LT4A 2NNLD 4OQYA 2DBVO 5F21A 4EDFA 1ID1A 2PGDA 3EZYA 1GR0A 1B3RA 4I5EA 2DVMA 2ET6A 4J3FA 3JQCA 4AJEA 4AJPA 3TSCA 2PGJA 3EMKA 3NKLA 2HRBA 4CM4A 1I5RA 5KJEA 1R12A 5IN4A 1BVRA 2C5EA 2CNBA 2O3QA 3L4BA 5FYDA 2GGSA 1ZXBA 2GR9A 2Q2QA 3K2BA 4E32A 4CMIA 3ZWMA 1X14A 5ICSA 1FJHA 3INTA 2HLPA 3MJSA 3ZV4A 3F5QA 4A26A 1VRWA 4DUPA 1SZJG 2Y68A 4EJ6A 3ZHZA 4BNMA 3NGLA 5TLSA 3WGIA 4IGFA 2G17A 2EKLA 1I2BA 1A9YA 5DULA 4NU5A 2DBZA 2AHRA 3C1AA 4CM5A 4N54A 4RO0A 4J7CA 1NHWA 2HJRA 2BFMA 1P33A 3RUAA 4BO2A 1IZ9A 1DC3A 1WAMA 2D2IA 5C7OO 5CDYA 4KMSA 2IXAA 2HUNA 3ZWWA 3JD1A 4H3VA 3CEAA 4Q3NA 1JKFA 1I32A 1LDBA 1NWHA 3BMNA 5DBGA 3SLKA 1Q7GA 4E2WA 3ZHYA 2Q46A 1PZEA 3PZBA 5AVOA 2CY0A 4DMMA 1GYQA 1QSGA 2UDPA 2W98A 4RQTA 4BGVA 3C1TA 2AEMA 4E2XA 4AJLA 3R6DA 1WVGA 4YAGA 2C5AA 3RU9A 4YDRA 2VRCD 1ZUD1 1WDLA 4N5MA 2JKVA 2NADA 1AGNA 1XYGA 1GCOA 4CLXA 5GZ3A 2Q1UA 1H94A 2UUOA 2QYTA 1KVRA 5JE8A 2R6JA 4Y98A 2Y0EA 5ILGA 1LC3A 2GERA 4MINA 1NAIA 4ZVVA 4H15A 2QYSA 1D3AA 2VWPA 1JAYA 4IJWA 4TROA 4UVHA 5JLAA 3PXXA 1HZZA 1PS9A 3U4IA 1M66A 2QQ5A 3C7AA 1QLHA 3RC1A 2GN9A 4K9DA 3M6IA 1WNTA 3JQ9A 4BV9A 4CQLA 4W7IA 3GLQA 3B1FA 4OAQA 1RM3A 2D3TA 3ROPA 2HMTA 3O9ZA 4EUHA 3IJPA 5C7IO 2Y1FA 5A3JA 3PYXA 3KLPX 3G1TA 5TQVA 4TRMA 1WDMA 5DOVA 1E7YA 2OL4A 2RCYA 4INAA 3TZCA 1ML3A 5G0SA 1NVMB 1XHLA 1OC4A 3HFGA 3GEDA 1A4IA 1BSVA 1T2EA 2O48X 1M6HA 3DFZA 3PQFA 3D1LA 5HA5A 2W8ZA 3K92A 2ZK7A 2NLOA 2VYVD 2HMUA 4FJ0A 4H7PA 3WWYA 4XJSA 3UKOA 2Y93A 1NFRA 1ZSYA 4FFOA 3PHJA 1RWBA 3AWDA 4E5YA 1EQUA 4J9UE 4BNLA 3P19A 4A27A 4FFPA 3D3EA 5I7FA 1E1LA 4QECA 2QX7A 3PLNA 4OGWA 2Q1TA 1DEHA 4K26A 4Z9XA 1C0PA 3DR3A 2D1YA 3AM4A 1PEDA 3I9JA 1Q2XA 4IJUA 4D44A 3KVOA 5T8KC 3EGOA 5K0ZA 5EQDA 1KVTA 3QVXA 3DWFA 2WTBA 3K6JA 4R68A 5IXYA 2RBEA 2G1UA 3MJEA 3QP9A 3G17A 1GEGA 3Q11A 2X23A 2Z95A 5BSGA 4ESOA 3BZUA 4BS9A 3WBFA 3PDJA 1HE5A 2RAFA 1AXEA 4FDAA 4BMSA 3Q2KA 1LSSA 2TMGA 1PU2A 3ZN2A 1X1EA 5B4TA 1XDWA 1I0ZA 3E82A 1CQJA 5DBFA 2J5RA 4R1UA 4R1NA 1IOLA 2YQ4A 3CPSA 1I2ZA 1OZAA 1DFHA 4WCFC 5JAQA 4RLHA 5BQFA 4XEHA 3OP4A 1HLPA 2V6MA 4DL9A 3UAGA 3UW3A 1EVIA 1KETA 3SXPA 3PHIA 3V2UA 3QWAA 4DQUA 1I01A 2BFOA 1Z74A 1ZFNA 3MTGA 1PGJA 1C1XB 1HLDA 1Q0HA 3AUAA 3GRKA 3I9MA 3LF1A 4NBRA 3G3EA 5L51A 1H6CA 1ULSA 1H6BA 4BKUA 5L9AA 1PL7A 3F47A 3DBVO 1YOVA 2V65A 4J4HA 4A10A 4DPKA 4I9HA 3TZHA 3ZZNA 4I9UA 4DA9A 2QRJA 1N8KA 3QVSA 3W8EA 2VZ0A 1T1RA 3K9QO 1IULA 3HDQA 5TF4A 3VTFA 1UXHA 2HO5A 3A1NA 1C1XA 3PRJA 4CV1A 5KVQA 4NBUA 3JQEA 2EGHA 3JQ7B 1LC0A 3O03A 4J43A 3L9WA 4UVGA 3WX0A 5THQA 1BDBA 2BH9A 2G76A 2VNSA 3U0BA 2BGLA 4BNGA 1MG5A 3H7AA 4IDFA 4A7PA 1ZBQA 1HE2A 3ADPA 1GDHA 4JX8A 4Z0PA 1EFKA 5KIAA 3TFOA 1KERA 4J4TA 1EVYA 4LMPA 1PQUA 2UVDA 3H5RA 3VPHA 3ITDA 4Q3AA 2WM3A 4PLZA 3ZU5A 4RF3A 4Z0HO 3VH4A 5JYEA 3GDFA 3UN1A 3GDOA 1B3BA 1GAEO 2C7VA 4YACA 5J23A 3N58A 3P2YA 1B15A 5TX7A 4CMKA 1HT0A 2DFVA 4G5HA 1BXGB 3FRJA 3CTMA 4C7JA 4JBHA 4ALIA 4BNIA 4U0KA 3WLFA 2VRCA 3KYDA 4BMVA 3QWFA 2I3AA 3SX2A 3GK3A 4NZ9A 4YRBA 1PQPA 1A9ZA 1FXSA 1K6JA 4B8WA 5DDIP 1PTJA 1QP8A 3VOSA 3PPIA 1WPQA 1QLJA 3H5NA 4XA8A 2NQTA 3GFGA 4WUVA 1MXFA 2DQ4A 4UEJA 5TNXA 4GSKA 3RKRA 4ZQHA 1T4DA 3PYLA 3JYLA 4MIOA 2UV8A 3QV1A 5TJ9A 4ZN6A 3U4HA 1P1RA 1PJTA 1ZZEA 1CETA 1R0KA 3VAZA 3KYBA 2GN4A 3FBTA 1O89A 2AQIA 4WLEA 3QE3A 1NX6A 5F5NA 5KNLA 1SEPA 4LK3A 1F12A 2GLXA 4AG3A 4TSKA 3FSRA 1L7DA 3E03A 3HZZA 4XYLA 3I1JA 1XU7A 4GGOA 2OP1A 4N5LA 5DT9A 5BSHA 1R66A 1O5IA 3CMCO 1LSUA 2PD6A 3JD0A 3PZRA 3K2EA 3DMTA 1GL3A 3H65A 4Q3DA 3KRTA 4ZICA 2Q49A 2GPTA 5CEJA 1DB3A 3RJ5A 1XSEA 2WD7A 3SJUA 1P44A 1XG5A 1O8CA 3ZU4A 2PGLA 2JAPA 4E6PA 3DTYA 2OGUA 3CINA 1E3WA 4YQYA 4DMLA 2VYVA 2FPGA 4R16A 1P0CA 2TMDA 1A72A 2IODA 5G4KB 3NGXA 3DL2A 4IDBA 4BO5A 1MXHA 2HSDA 2LDXA 4HADA 3DTTA 3N7UA 5ER6A 3F6YA 1EFLA 4YJHB 3FBGA 3FI9A 4NBVA 1HF3A 2B36A 5A9TA 2DBRA 3SJ7A 3I3OA 3JYNA 4K1LA 4L0QA 2C0CA 3UFXA 2J3JA 4D79A 1PGQA 1RYEA 3TWOA 3UUWA 3IC5A 4PCVA 1HKUA 3WGHA 5CPFA 2CSUA 2OUIA 4IY1A 4A5OA 3FR8A 5CAEA 4K6FA 1V3TA 3M2TA 2EHDA 1Y8RA 2PV7A 1DIGA 4J4BA 3UOGA 1UAGA 1NNUA 1B8VA 1E7RA 2A4KA 4BO7A 4CMEC 5T57A 2NVUB 4E13A 4I9NA 4CMHA 5ADHA 1XQ1A 1ENZA 4LGVA 4QQRA 5FI5A 4CV0A 4WOJA 2FY8A 4QTZA 4QO7A 3QRWA 4H16A 4YCAA 2VUSA 4Y8VA 4YRDA 3CMMA 1CRWG 1GV1A 1GPDG 2VHVA 4U7WA 4KOAA 2FSSA 4FGSA 1HDXA 1HRDA 1HDGO 3W8FA 1ENYA 1JQBA 4RPHA 4ZHSA 4D0SA 3TDKA 2NVUA 5I8ZA 4OXKA 3GDGA 4GX0A 4RDHA 5I9LA 3HN7A 5U4QA 4CM9A 1ONNA 1HL3A 4B3JA 4ALLA 4DRYA 4MVJG 3D4NA 5L4NA 4BKPA 2X5JO 4FFMA 1VLLA 4GVLA 1LSJA 3GQVA 3GVCA 1QV6A 3JQ9C 1PS8A 3EC7A 1UP4A 4FGWA 4D42A 1GQQA 2JFHA 4CLRB 5CDSA 1UP6A 5C7LO 4RF2A 3RQSA 1LLCA 4I8XA 2Y0CA 3AU9A 1P0FA 1ZK4A 1PSDA 3LDHA 4HFMA 3RAJA 4BNXA 1IE3A 1YDWA 2GDZA 4YT5A 4XCVA 4YT8A 1KOLA 3AW9A 1D8AA 4MOWA 2BHLA 1ZO8A 3F3SA 3DBHB 4IGEA 1YB1A 1E7MA 2VTEA 2HMSA 1NQAO 2X6TA 1K0UA 3WJAA 5KOIA 1NPYA 3WSVA 3H9QA 4A2CA 4YA6A 4CLRA 4E2ZA 4ALNA 1NPDA 1SC6A 1MP0A 2GSDA 1H5QA 3GT0A 3I9KA 4ZU3A 4OQZA 3WQQA 3STHA 3Q2IA 4EUEA 3L6EA 4QFDA 3HG7A 3OFSA 3FNHA 4GKVA 2POQX 5ES3A 1PR9A 1UXJA 1SNYA 4GX5A 4EJ0A 4ZQGA 4BNJA 4RDIA 5JAMA 1JKIA 3GN1A 4M86A 1IL0A 1Y9AA 3ZWVA 4JP3A 4IXWA 1T2DA 1O95A 4XYEA 1JVSA 5IXSA 1PJQA 3NTOA 3EVNA 3JYOA 4P38A 3BHJA 3DZFA 4IZIA 5JMWA 4I5GA 4IPTA 4B4UA 4BNTA 3I9OA 3HFSA 3OJ0A 4U0JA 4HWKA 4XJTA 1HDCA 3C7CB 3OSUA 1KVQA 1QRRA 2C7GA 1W0CA 4FFRA 3GEGA 1KC1A 2PNFA 4J1QA 4K28A 4FC7A 1ZNQO 3JD3A 1HYEA 1UUFA 2BMAA 5BNFA 2O3TA 2X0IA 3FWZA 4DPLA 4IS3A 3ITKA 4CMCA 4URFA 3DZHA 3MZ0A 9LDTA 3KYCB 3WLEA
chains in the Genus database with same CATH superfamily
1C7FA 1P5ZB 4XSVA 5U1PA 1TECE 2IZ1A 4E4YA 1SELA 2QOEA 4O4JF 1R74A 1TA9A 1Q77A 1M8JA 3R09A 4UEKA 1VKOA 3DAFA 4HG2A 1P7YA 2GK6A 1E2IA 3F7TA 2OGTA 3HJCA 3ZE1B 4JOBA 2Q3FA 5CIQA 4IIVA 1MGPA 4QTUB 5G3YA 3TO5A 3H2IA 2CFTA 1QK3A 4G0MA 1IHPA 4RMNA 4EG5A 1IZYA 1JLLB 2FW0A 4WY2A 2C29D 1JKXA 1K63A 3NB0A 4C43A 1XMOB 3SFVA 3ETJA 1HYQA 3C24A 2B92A 5HOEA 2XQIA 4LC1A 2I67A 5FTKA 3D3WB 1IB6A 3IIIA 4JYBA 5ECGC 3U40A 1S4MA 4DDMA 2IKSA 4ZO4A 1MENA 2OENG 1Z88A 2V5VA 5FBWB 3JAKA 3U3XA 5K6AC 2C4HA 3HGTA 5LMCA 1JG1A 3HCBA 3KOMA 4HLCA 1RC0A 4W82A 3VR4A 2HZBA 4YAIA 4LZOA 3THOA 2RIPA 3EEQA 1DPGA 2FQ1A 3TVTA 3HKDA 2VXBA 2IPMA 5SYNA 2YJNA 2PUGA 2H1IA 3LKDA 4WEOA 3BD9A 4FTWA 3T3GA 4DLYA 1UPAA 4Z5XA 2HMYB 3EDCA 4HH1A 1SBTA 4K3VA 2NACA 1G7SA 3OQHA 2MR6A 4M0LA 4QXPA 3GCWA 2PGNA 1SPXA 1Z37A 4R8SA 2XGMA 5G1NA 3LKBA 2QBYA 1KBQA 1WHTB 1MC4A 4KIFA 1OWLA 2WDZA 4RWZA 5IT9A 3ZI0A 1J0BA 1NJ8A 4YV1A 2LIVA 4XYMA 2H92A 4ERXA 1GUFA 2NU6A 2EJCA 3G82C 3K0AB 4PQEA 1DUIA 1DV2A 3U1BA 1G5FA 5AJUA 2B4QA 3BWXA 1H8HD 3MWFA 1JH8A 1KSGA 1N33B 3TOXA 4XWYA 1GG2A 2OOSA 2BFEB 2UZ1A 1VE6A 1K8RA 1A88A 1P81A 1M72A 1R88A 1K2VN 1XZCA 5IVIA 3RU7A 3UB3A 4C0AC 4KODA 2GAAA 4OJNA 4HNTA 5EEHA 4NR0A 5DWDA 3E18A 1VLQA 2D62A 4P4LA 3KUCA 1EP3B 4BB0A 2XVMA 3OY7A 2AOVA 5FPYA 2A6PA 4Z7JA 2RMKA 4OFZA 2FLKA 2ZP1A 5WRFA 5LUAA 1Y8ZA 2GH1A 3JARB 1T43A 3P5BA 1G4AE 3X2SA 1QTNA 3IQIX 3QU7A 3ZBUA 4U5XA 5IULC 1NXVA 4JZKA 3A4VA 1U28C 1H0HA 1O9HA 2WE8A 3ZJYA 3ME5A 4ALIA 2X0EA 4B6SA 4BUJA 2QM3A 3V4FA 1CUFA 3CRNA 1UBNA 3WQSB 3PQ4A 1U2TA 5EIAA 1L4KA 1L5NA 1VM6A 3FCXA 1SCUA 2YVLA 1C1YA 1TI7A 5F5LA 4MS4B 1GLGA 4HZUB 4DEXA 3V9PA 1XEFA 1R0LA 4YCJA 3K05A 3DCYA 2QUIA 1TO6A 3DMRA 3EXHB 3GL9A 4GX2A 3JZIA 2HYDA 2GN6A 1C3LA 2OE2A 1JEEA 2VH1A 3KEGA 4IX1A 1XAIA 4ND8B 4QJ5A 4Q9DA 4DMHA 1HOXA 4M38A 3G9XA 3QFSA 5F2KA 1KZ7B 3REQA 2QTNA 4N8EA 2J9ZB 4B2IA 2WUEA 3P20A 4FOPA 3LYUA 1L5OA 4TTSA 5FUVA 1OH5A 1U0RA 4OGKA 4BQQA 1QHGA 5ARBA 2ZCVA 1PUIA 3OM0A 4CMGA 4ASUD 4BVEA 3HDVA 3O2QB 4RKRA 4Y6LA 2B7CA 2PL1A 2HIHA 2PN1A 3KU1A 3KL4A 3QXGA 2NSLA 4J1NA 1NUTA 1V25A 5ALGA 3GLGE 2W2NA 3ITEA 2DULA 2QY9A 2VNIA 2XMPA 5DU2A 3V4RA 1R0ZA 1XZFA 3JPYA 5JFTA 4GP6A 3TD9A 3PHGA 4YLEA 3TKAA 2XGSA 5KYWA 5FV7A 5LMUB 3L1KA 4OXYA 3I6ZA 2W8BA 1FUKA 3WHLA 1W48A 3DTVD 3LKZA 2HA2A 1JJIA 3MGGA 1T4GA 4F93B 3OLZA 2RI0A 3MMZA 4MUNA 5LQCA 3T61A 3WSWA 5CFOA 1SAYA 5K0LA 1L5HB 5BVHB 2LIPA 4DNQA 3D54D 3QUAA 4JA2A 3WNBA 1S3GA 4TXLA 3P97A 3OIGA 2IS6A 1QHSA 3S2ZA 2H7VA 1G21A 1L7AA 4AC9A 1UC5B 4ZC1A 3DT8A 2GYYA 2FXVA 3ROGA 1C0IA 2XBLA 3JZFA 3OWHA 1DPFA 1VKRA 1ZY2A 3GHHA 2AFHA 3QMWA 5ERXA 4WLNA 2JJQA 2YRXA 1AX9A 3LXUX 1Q16A 3QWBA 4X92A 1U81A 2GUGA 4NRDA 1KXZA 1RWQA 1XZBA 4G0VA 1H1TA 2GBCA 4NCJA 5AI4A 2SCUB 1TUGA 3TI7A 4GXNA 4OK6A 3RVDA 4WK6A 3ZHCA 1KFBB 4F46A 5JCJA 3OLVA 3DNPA 3H6GA 1UWVA 2GPAA 4BQFA 1M76A 2JEOA 4E6EA 3H4MA 2NM0A 3ZEIA 1IBLB 1NE7A 3AI3A 3TBFA 3K6KA 2OEPA 1OAOA 4TRRA 3MCAA 4BP3A 5LKRA 4R98A 1Z5ZA 1PYDA 1UZLA 2YINC 3M8KA 4D9EA 3D43A 1RHJA 4MXDA 3GBPA 4RACA 2P4QA 5C53B 5T7BA 5EKXA 1U0SY 1VFPA 2IS2A 4A5SA 1Y81A 4DN6A 4ZJPA 2LCQA 5L6MB 3I1IA 2V54A 4B40A 4KO8A 4EITA 1B23P 2VYND 1M0SA 1FTSA 3X1MA 4LOKA 2EL9A 3RIHA 1JALA 2GZ1A 5CEFA 2O2YA 2AG0A 1Z34A 4KQ1A 3SX0A 4YCCA 1PGNA 2OFXA 2EZ4A 5JRJA 1O94D 4CN9A 4ZI3A 4FX5A 1T8WA 4QGBA 1UIMA 5FPSA 2WYHA 2F1HA 4OMFG 3OFND 1T6ZA 4AI6A 5JD5A 3H13A 1CF9A 4LWZA 2R7NA 1KEWA 5HP4A 4BJ6A 2R00A 3UJHA 3L8GA 2XUGA 4KQ6A 2DB3A 1ZUHA 3D2LA 4JU9A 4NJOA 3KR0A 3ORQA 2Q1WA 3MSXA 4ZO8A 1YH3A 1U3FA 2GK4A 2C54A 2QG6A 4XKJA 2QVBA 4C14A 2WT4A 4DKJA 1VBMA 1MOZA 3Q15C 4II2A 2O8EB 1XK6A 3DB2A 1AMNA 4TXNA 3KS9A 4GECA 4L5BA 4TL8A 3HH8A 3N0TA 2O54A 3G2HA 3FPHA 4H3HB 5IC5A 5LQKA 4IMJB 3R5TA 4KNVA 2UUCB 2JGDB 4UMVA 3RVSA 4KR3A 1SD2A 2AUNA 2VKTA 3FN4A 4Y6SA 5FF9A 5JASA 1JEYA 1MFZA 2IYXA 1QE5A 3WDKA 2AC7A 2BVNA 5A04A 1ZJZA 2TRSB 2YRFA 2CMGA 1K9VF 1Q0ZA 5LDGA 4BO0A 4CQNA 4C7OA 2GJAA 2NVBA 1VL8A 5DJ5A 2HHAA 1R0SA 1DHTA 5NLLA 3JSXA 2ISCA 1K6MA 1NN5A 1ZKMA 2EX4A 3HHPA 1LLFA 4ZJUA 2ACKA 5JD4A 3EXIA 4DR2B 2WWXA 3W34A 4IUDS 1B2LA 3DZGA 1RWOA 2BC9A 1T13A 4LSWA 4NJEA 4JBGA 4X44A 5A2GA 5SZJA 5JPDA 4DQXA 3I4LA 2ZKLA 2ZB3A 3KOZA 4CR8A 5EZQA 3VUEA 4X65B 4J1TA 1OFTA 3EC1A 3QV2A 1NVAA 2VJMA 4IUCS 4NCAA 2QWXA 4F97A 3PPXA 5JU6A 4XD7D 2QQGA 3OTGA 2GCNA 3IV9A 621PA 1J00A 5MHTA 3NJRA 2RAUA 2O7NA 3G5AA 2GM9A 4FNGA 4NK4A 4ETIA 1E1YA 2GB4A 3P4XA 3TCNA 4ZK2A 2I4TA 3THXA 4CGYA 3OPYI 1YTUA 1C7JA 1SU7A 2NZWA 2HGZA 4DG5A 1DQNA 4ITVA 1KGDA 2I80A 3AEUB 3NBYC 4K87A 4M4SA 2HPZA 4X8LA 2B4YA 4Y18A 3MRVA 1LDNA 1ZONA 5FLKA 5BMVA 5A4DA 5I47A 3DMYA 1PZFA 3NDPA 4QATA 3HSYA 4RZ3A 1MT0A 4JLUA 3ILHA 1L8OA 4NV0A 1TVEA 4QDTA 5IANA 1FX0A 3WFIA 5JJLA 4KIUA 4ESEA 4N9WA 1BDIA 4BFUA 3S2IA 4UNQA 3Q7TA 1VXRA 4TS4A 4BLWA 4GPBA 1YVUA 4DOMA 1KO8A 1YGYA 4X1OA 1SR8A 2HMWA 3VKWA 4O4HF 3O47A 2J31A 2ZVPX 1WW8A 3K2IA 4ZZ2A 4KUGA 3WFZA 2R4QA 1CDZA 3T3DA 4YAUA 5J4KA 3V4VB 1EU1A 2MSCB 5HYVA 3CVUA 4UNSA 2OK8A 3NH6A 1YJQA 1G0NA 1B7GO 1AZTA 4TYYA 1GU1A 1OX4B 1UMBA 1R8QA 2YJ6A 4TWRA 1I2MA 3EIHA 4F7DA 5FX2A 4CKEA 1SKMA 5EIFA 5JSUA 2JVIA 1MAAA 4RQUA 4LHZA 3U7RA 3I6MA 4O6VA 4IDOA 4JVNA 3K0EA 1Q7CA 1VI5A 4UKDA 4Y2TA 1FLAA 1T36B 1KE1A 2I4OA 4CT4B 1W87A 1V95A 3DTVA 3DG9A 2HWYA 4P7GA 4U6QA 1QIJA 3GW8A 4Y2QA 3UKDA 4A3SA 5L40A 1ID8A 5KX5B 5K51A 1LPPA 1P3Y1 3I61A 3AT1A 4DV5B 4C4YA 3C5HA 1ZGHA 5LCXA 1U2PA 1WF3A 3AB8A 2CVZA 3MN1A 5IAKA 3CZ5A 1NKVA 2I9PA 1G66A 4EUNA 1BRTA 2ABWA 3JATB 4IVNA 3UY4A 2B69A 2Q0HA 2PXXA 3CKYA 1UPCA 4P6VF 4B8YA 5I9NA 1Z2EA 4GOKA 4A4DA 3R7DA 5KDDA 2CKDA 3K70D 1TA0A 2PS9A 2G80A 1ZLXA 1L8AA 2VZ9A 3QEMB 3MTBA 4FN4A 3A36A 4GGPA 4MWTA 2JCXA 3TN7A 2ZB4A 4BQNA 5IJWA 1F2DA 3GLHE 1HOTA 3I62A 4AS2A 1XU4A 5EZYA 5DSTA 1IQUA 1YSCA 3G0CA 2X0RA 3BFKA 3S5UA 4MA4A 3N0XA 1SUPA 1YMQA 1YS4A 2ZYRA 2JGJA 1RXWA 4NG4A 3H9BA 4RIHA 1E7SA 1G8YA 2FHSA 1WCWA 1C3OA 4BPRA 3NBXX 4E15A 2V6BA 4Q37A 5DHUA 3M82A 3E27A 3G7SA 4Q9AA 2XNKA 3R6LA 1KSFX 3O84A 1ZISA 4IIHA 1OLSB 3RYCA 2P9ZA 3UMFA 2HKIA 2GCGA 2CLCX 5MF6A 4EJFA 1N2EA 2XGOA 3R8FA 2JH3A 4N03A 2H6EA 4PBRA 1OU0A 2WUVA 4MR8B 1PTKA 4RGQA 1RHRA 1G6KA 2XMBA 3NKFA 1NZJA 4OI2A 3SYKA 4MO9A 5IT5A 2WD9A 4YUYA 5KSPA 3W2IA 5JAOA 2VYNA 3D4OA 2PBFA 3LX4A 2NU7A 1NI5A 2V1UA 4ND3A 3AEKA 2W48A 1KY5A 2ZT8A 3Q4GA 4LDZA 1VL6A 6GPBA 1F6BA 1O94A 3OUUA 3FOAA 4LOAA 4H1UA 3Q7PA 4M49A 4G0XA 2AV6A 3K9LA 1LBQA 3E1SA 3E4DA 3RS3A 5KMGB 1Z5NA 2ZSHA 4EZEA 1EBFA 4DDUA 4YRRA 1JIXA 4GM0A 1Y3CE 2P9YA 4DEYA 4F71A 3V32A 4HBZA 2C9MA 1Z4PX 3LUCA 3ZZMA 5JDCC 3NV7A 2J33A 4MVYA 3I4FA 2F43B 2GTHA 4J0HA 3CX6A 4PN7A 4QODA 3F5DA 3KKOA 3NFYA 3OQVA 4TKVB 2XVYA 4MYHA 1WLSA 2LD4A 4NPHA 1LI5A 2SECE 4FMDB 4WWHA 2B30A 4YRPA 2DFKB 3NAGA 3D3QA 4NBWA 5CEEA 4OSEA 1M6VA 3DPUA 4RGBA 4S3MA 2PUCA 1XC7A 2WEKA 3AP3A 4CWAA 3TEJA 1BEEA 1JVBA 4Q7KA 1JTVA 3HTXA 3QU5A 2I78A 4OLFA 4PAGA 3LQFA 1YJ5A 3DCNA 4P3NA 2BWJA 4AS3A 1AQJA 2BE9A 3ZU3A 4IR7A 2MDTA 3VJKA 4D81A 4EO9A 1ESEA 1Z36A 5JC1A 1P7WA 1R6TA 3TJZA 5DNEA 1MAUA 3GLGB 1E3WB 2B78A 3FPBA 4RPJA 1JJFA 4YRCA 4BWYA 4DJJA 4F91B 5C52B 2UXDB 2JEZA 1UT5A 3PDUA 3U3OA 2ZRNA 2IWRA 1O9GA 1TF7A 2YFHA 3D6TB 4J3NA 3VU9B 1YU9A 3HI6A 2XCTB 3L4KA 3KJHA 4L3WA 4ZVKA 5A6SA 3EY4A 3SF0A 3ZGOA 3UWSA 2Z1NA 1WMDA 3K9BA 2QN1A 3RSCA 1TJPB 2YMPA 3OZEA 4XD7A 2QUAA 1R0BA 3HWRA 3D8NA 2PT7A 4LIPD 2XXAB 2XUPA 4Q12A 4AJ9A 2V7PA 1HT3A 1X7DA 4C6SA 3F5FA 1DIAA 2R8ZA 2H65A 4XRGA 5E6SB 2IZOA 1P6QA 1Y8AA 2CDCA 3EJWA 4WACA 4EATA 4YAKA 5BWBA 3OPYA 4DR5B 4RVDA 1TAUA 4KDCA 4FMCB 2OV1A 2GX6A 2VUIB 3JR7A 4IIYA 4XGNA 4AJNA 1Y8RB 1DBQA 2C5HA 5DM0A 3SR4A 3UTDA 5BUQA 2C9OA 2FXIA 3D6UA 1TCCA 1Z56C 4JB0A 1ULHA 1C7EA 3E22A 2XT6A 2AWOA 5CGZA 1LZLA 2X9NA 1FRVA 5AI8A 1HFEL 1NBAA 2F9MA 1P5RA 3CUVA 3JQDA 1UT6A 2VPWA 5H3LA 4LC9A 4A15A 1B16A 1NPTO 4CHTA 1US8A 5I9MA 1JJ7A 1GD1O 1RP7A 3EIUA 1BDHA 1R3UA 3WJ7A 5EEGA 5TGDA 1UFOA 1NF2A 1O0BA 5AW0A 5HIAA 4YP0A 4L4RA 3WB1A 2VYQA 5DEIA 3A6FA 4S1OA 1M34B 5EHZA 2ZIGA 1ABBA 2Y1CA 1UZMA 5IH3A 3RB8A 4D7AA 1OA1A 3LRPA 1K4KA 1C9DB 4N0QA 2ZVQX 4GBED 4K9SA 1YASA 1WZEA 4FIZA 2OK7A 4NU8X 1W36C 4XWAA 1CU1A 3KQOA 1RP1A 3FLBA 3ZH2A 3W6UA 1C9MA 3O0DA 2JI8A 2EKQA 4X62B 1VG0B 1CUWA 2H1LA 5EKSA 1F2TB 2EX0A 3ET4A 1UODA 5JHHB 1U98A 2PRIA 3UAWA 3BE5A 1TMYA 1YE8A 2I2FA 4LJ7A 4M89A 1ZW1A 3KTAA 3BMCA 1KOFA 2I9KA 2RH4A 2OZLB 3B12A 2CKMA 4OLBA 1ZK0A 3O83A 5FTMA 1CEYA 4K6KA 1CRLA 3M3DA 1W49A 1KPIA 5KO2A 1WMFA 3Q3CA 3WGTA 5FEMA 3W3AH 1D5CA 2QZPA 1E3SA 3QOXA 1A2OA 2I71A 3DZKA 1RQXA 4KI0A 5CHEA 3PNPA 3ZE2B 2RHCA 1CS0A 5C5EA 1HZZC 1T0IA 2ADOA 3QUBA 1YDHA 3IS3A 3KWMA 2F3RA 4ND2A 1V45E 2CJWB 3T06B 1Q1ZA 4DLRA 2R0QC 3SBOA 1XR3A 2QLNA 3AI7A 3BF7A 5BSRA 5AHWA 1IMOA 3NHJA 4LHVA 2BMFA 2D1QA 3BTSA 5FUQA 5JI3E 4KMRA 2HU5A 2IBMA 4JJIA 3HSSA 3ZIDA 4CF3A 1KVUA 4KAXA 5AKJA 1T8UA 3UV3A 2WJJA 4F04A 4L75A 4MP6A 1V43A 4MS1A 2PE5A 1J6UA 5LA6B 2DY1A 2I7CA 3ZE6A 1EZ1A 4BLUA 1UC4B 3E0QA 3OQNA 1QPBA 2IBSA 5HK9A 2JLRA 3K5WA 5BYBA 3UJ9A 4TV9B 1GGEA 4DT1B 1B14A 1JDVA 5FKJA 2RHMA 2YY5A 3QXXA 4I4CA 2QUHA 3FWNA 2V7EA 3AW8A 4J76A 3EEYA 4V1CI 1Y9EA 1FS5A 1Q11A 1T34A 1YZVA 3GRAA 3HEMA 2KM1A 4Q4HA 4YGXB 2X7HA 2ZYSA 3QE2A 3CSSA 1R9NA 1LS1A 3EWNA 1EM8A 1MFPA 4TS1A 5CU7A 1DE0A 2JH9A 3BMXA 3L7IA 5JQGA 4EY6A 1IK4A 2G0TA 3QVGB 2GA8A 1Q57A 3HC7A 1D2NA 1W4BA 1QHFA 3EY9A 4UM9D 4F56A 5KTYA 1VZ3A 3AG6A 4GMFA 1U5BA 4TXHA 3FOFC 3ROZA 5CBPA 1RQNA 1OLUB 2VNJA 1PR1A 2WYOA 2OCDA 4TMYA 1VJCA 3DBRA 4XLTA 5DFAA 5FNVB 3T7DA 2X9GA 1U7TA 4PC6A 3HZHA 2WWTA 3LP6A 2BT4A 2GN2A 5FNZA 3CCCA 5KC8A 3LW8A 2EWWA 3K72B 4KAAA 1SG6A 1Y7IA 1Q0LA 2WI8A 4MQMA 1HTTA 1PFWA 5A5VA 3KHUA 1TQ4A 2GCEA 5GVRA 1DEOA 4L16A 1U3DA 1JYSA 1UK8A 3L7YA 3KJQA 4KCGA 3VH1A 2VYFA 3AV3A 3I6QA 4CNQA 4DWOA 2VDNB 1DRUA 3WMWA 4EEXA 2DBYA 4JL6A 1RU3A 5L7YA 3SHVA 4K1XA 2VCHA 5EE5B 2P1RA 3O73A 2H7CA 3R9KA 5K0BA 1TVKB 3I2IA 3FPEA 4MJXA 5SV2A 4CMAA 4A16A 5KHLB 2ZLBA 1F8FA 2B4AA 2OKGA 2Q29A 3GD5A 1Z28A 3ICCA 1YCHA 2BPOA 1B6SA 2GXUA 2FETA 3IXLA 3X2FA 3LBFA 5HJEA 1QKJA 2JD1A 1PZHA 2I6TA 3M34A 1L4BA 1P1IA 1NY5A 2A9FA 5H1YA 5CDTA 1PHRA 3P9NA 2IIQA 5J2TA 4JUFA 1G8FA 3KKQA 3MPOA 4QEKA 2A9RA 2QGZA 5COBA 1ORDA 3RRNA 5BV1A 3DKRA 2NOAA 2DT5A 3O7MA 4O4IB 2VF5X 5FR1A 1UBRS 3ZV6A 1YRWA 1J8MF 2HEGA 4Z8YA 3HGMA 1MABA 2ZBGA 2CVPA 3TQHA 5IF9A 1G8JA 1JW9B 1YJCA 2QRVA 3B6JA 3K1TA 3ND6A 4E2FA 3PJDA 1TEHA 1KJ8A 1ST2A 4FR2A 3ZGYA 5CYGA 3BEOA 4L4XA 1NXSA 4UE6A 1USKA 4ZAFA 2IK8A 3DF9A 3QVVA 3SQMA 3BL5A 4R9NA 1G2OA 5T8KA 4C7BA 4AKTA 3QW4B 4J6FA 1UK9A 1P2BA 3CF4A 3HP1A 2NUTA 4XZ3A 2ZR9A 3P94A 1SG0A 1XFAA 5LN1A 4G1EB 3ZGXA 2ECKA 1N2GA 1P4RA 5K20A 1RI2A 2BEWA 1M10A 4HXFB 1VJRA 1F48A 2A57A 1IVNA 3WLHA 2VJOA 1I3KA 2FMIA 2Q28A 2OO7A 2XMQA 3FYTA 4EUFA 1QK4A 1KP3A 2FEPA 1FDOA 3QUTA 3DJYA 4BUCA 1MNAA 1BMDA 3QM1A 4KO4S 4CE6A 5AW1A 1E94E 2SKEA 4U2CA 2XMSA 3IKJA 2D59A 2P3SA 3CLTD 3NYIA 4FYKA 8GPBA 3T1TA 4IIGA 2PVCA 3H3XA 5M2QA 3KB6A 3EWIA 5K3BA 3WRXA 1XLWA 1ZNZA 1ISJA 1QX4A 2JFGA 1IWOA 1XNGA 3R3HA 4WCFA 5IP5A 3UHAA 1ZA2A 4KGVA 4CG3A 2CVHA 3CLKA 2WKRA 3UJNA 5EL0A 4BO8A 5BOVA 4AJKA 2XYGA 2VH2A 4LPSA 2PLNA 4YAEA 1FY2A 4MR7B 2IQIA 1WDKA 4K88A 1P1KA 3IDAA 4DWVA 5CFRA 4TOIA 2Z58A 3IFSA 1SVOA 2MINB 4KC0A 4LA4A 4LOHA 4BLTA 3ZYCA 2QMHA 3QEKA 4CFZA 3VVCA 4WERA 4Q0MA 1AMUA 4B7UA 4BZXA 3FY4A 2O19A 4P86A 3C3EA 1VG1A 1ZJ4A 1HM5A 1M2VA 3ZC3A 3BD7A 1VE3A 4QHSA 2O2HA 1XT6A 2VHJA 1JXOA 2RHWA 4KWHA 1O5TA 4RVSA 3TECE 3W3ZB 3GT4A 1GRQA 1P91A 4X8HA 5T5QA 2FUNB 4IFTA 5IK2D 2WSLA 1FXWA 1PTJC 1V9SA 2UVPB 1F7UA 2EXXA 3GARA 3QG5A 3JAMA 5CB4B 2FPUA 2I7VA 4BFXA 5IVPA 3JU3A 4MLCA 4Z53A 1N9KA 1XU9A 2NVOA 5LKAA 5K09A 4KXQA 2LTAA 2QQFA 3P2EA 2YWCA 2J9FA 1XA4A 3H9EO 3JVEA 2F17A 1WSDA 2QMYA 1XI2A 5LP6C 3VDQA 3CLUC 1Y9DA 4GI7A 4P32A 1J5PA 3FCOA 1T1JA 4D9CA 3H7IA 1P6XA 3NWBA 1L4NA 1THGA 2ZYVX 3VNUA 1GHTA 4FM9A 2YWHA 4D6XA 3NM6B 5KQMA 5IARA 4PG4A 3VR4H 2NZVG 4ZHQA 1W44A 2DH6A 1E2QA 2WU4A 4JLOA 4CRWB 2I6GA 2JFUA 2E5WA 1D0VA 1GDDA 1FP4A 5EWLA 2H0AA 3THWA 4EHIA 4ZCIA 4MIEA 2C31A 4LMRA 5L3QA 3GPBA 3TIVA 3EDOA 1E1MA 5HQ3A 2XWPA 3EYWA 4UCWA 2GN1A 2FE4A 1EFDN 1ODCA 2PWBA 4MCJA 1WBBA 5FLYA 1ZIYA 4PE5B 4PR3A 4XFKA 4Z3DA 3P2MA 4MARA 2NU8A 4AUEA 4DMRA 1J70A 3PFFA 3KJIA 3KSUA 4MA5A 3PC6A 4R69A 5BMVF 1NBEA 2RBKA 4E3ZA 3WNQA 4ZVUA 4RTRA 1L5KA 3ED1A 3OH8A 1A96A 2X6RA 1NMXA 3QLVA 4N8DA 5ECWA 5AVJA 5FWNA 3NO4A 1TA4A 1V7PC 2CN1A 3W4JA 2NXWA 1QIEA 1KI1A 4L50A 1BROA 1G59A 1VCHA 1GKUB 1NVVR 2QRQA 4E94A 3K6SB 1GG5A 2HRCA 2IEDA 2CFOA 4J8PA 2V9ZA 1RRCA 2XYQA 3G1UA 3TSOA 4R01A 5LC1A 3RHTA 3WL5A 5BV8A 3TUZC 2Q6LA 1B73A 2X6QA 5EVCA 4WBNA 2D4AA 4ZKDA 5IASA 2AX3A 3HZOA 2ZI5A 2A35A 1KEUA 1AQUA 4NWIA 1DZIA 3BRWD 2PO5A 3ZKWA 2W22A 4D82A 3DDWA 4PXAA 1NC3A 2H63A 5B1IA 4C05A 4E2YA 2FHPA 1YRLA 4LZJA 5JROA 2GARA 3ZI4A 4XVQA 2XUIA 3LGAA 4MWSA 5IUKC 3USZA 2ZIEA 1Q3TA 3DDZX 5K4HA 1TD1A 1GT91 5C1DA 4P0PB 1WPXA 1OI3A 4RH1A 1SBZA 2CXXA 3HKBB 2FCRA 4Y9RA 4AZSA 2EFCB 1BJKA 1RMYA 3SF8B 2DLCX 2WHPA 4N0EA 3WV5A 1KEVA 3PHBE 3OQOA 1GPLA 2VPPA 2QLBA 3FPSA 4BJ5A 5IHXA 1HG1A 2JL1A 2WFZA 4IGIA 5GIOE 3OLQA 4BAZA 4HI0E 3SN6A 3V34A 1CJTC 1PG2A 3OOHA 5FA6A 2VDOB 3L7KA 4FFVA 3J81A 2O8FA 2KE5A 3FFTA 4MVJE 1VSTA 1KH2A 3FNFA 3LC1O 4G5XA 1XMPA 2ZRCA 4H3SA 3QNMA 1PGPA 2NO6A 3O31A 3C5WP 3HK2A 4F7WA 1MC8A 2PAFA 4MV9A 2H0RA 3RVNA 4MMYB 3AR2A 5AVSA 1ZZGA 3FD8A 3PUHA 4ZRDA 3V2IA 2OZEA 3E9CA 4WTOA 4F9EA 3I23A 5K0SA 4IXNA 3WHIA 1W2HA 2BFFB 5B64A 2O0KA 3NHYA 1NBOA 4JC5A 1EXMA 4AROA 3HL4A 1GFSA 1ADFA 2XNDD 3BL8A 3CZ4A 4YMWA 1MO2A 1XZPA 2Y0DA 3U39A 4J49A 3R6GA 1W4LA 2Q3DA 1U0GA 3MJTA 4HAIA 4ONEA 4BY9E 1BE1A 2ZUSA 1ODLA 4R6XA 1YFZA 5ETJA 3RV4A 5KWSA 5ICSA 3UMGA 1OCEA 2HT6A 4INOA 1JAXA 1DOZA 4JHXA 5CA1B 3ZU2A 1W0KD 2WNHA 4R3NA 4JC0A 2IYEA 4YEDA 3IEUA 4TYMA 2JFYA 4FYIA 5CNJA 4M2LA 4DW8A 3R4VA 3Q9SA 2OZKA 4JOCA 1LPBB 4D41A 1P2SA 1VCOA 2HC9A 1VBNA 2PD4A 4GIBA 4UHCA 1A5ZA 4XLZA 1VRVA 2AEJA 2AMFA 3EE6A 2OBNA 1FIUA 1NI4A 2BELA 4AMBA 1UWKA 1Q0SA 1WDTA 3FDIA 3JCZA 4NQZA 5GONF 3R76A 5JNUA 2HF8A 2X8JA 1U94A 1YACA 5C8DA 1GGHA 1ZAKA 7REQA 1S0UA 2Q99A 3LBAA 4B6JA 1UC9A 2Z2IA 3B6IA 3L0ZA 2B6HA 4OQFA 2VUHB 5J43A 1FNBA 1GZ5A 1JX6A 3GZNB 4MZXA 4WSOA 5F9FA 3VZPA 3RIYA 5GJVC 3DBOB 2JFZA 3TFWA 3GB9A 3R0QA 2OHVA 5H70A 4DIEA 3LUBA 1RNLA 1I2AA 4WGFA 4CODB 3I72A 1GZ3A 3OHMA 2IZ7A 4RTKA 4WNIA 3RFVA 3LZ6A 3TNJA 3NT2A 4FWTA 4RBNA 4ZXFA 3OUTA 4DUZB 5G0UA 4KBGA 1G9SA 2BR4A 1MB3A 4TVSA 3DL0A 3QE9Y 4RA9B 4W9MC 3ID6C 2GEDA 4ZYVA 2VTBA 4F4CA 1SK8A 3PC4A 2XMDA 3R5FA 1CG6A 1P1BA 3LDAA 3ZQKA 4EW3A 3SLRA 1ZM4A 5CLQA 5H68A 3TSYA 5E95A 2M32A 3MILA 5IT4A 4DRZA 3BS4A 1BEUB 1I1NA 3WG9A 1W93A 3O8BA 2OCGA 1UKBA 3DBLB 4QM7A 1ZYUA 2A86A 5K9ZA 1SUBA 1TRKA 4LV5B 2YYZA 4YRKA 2IYZA 5EMNA 3RC9A 2O3SA 2X3UA 3A1SA 3M4YA 3HVRA 4UU8A 2QLFA 1F5NA 3C2QA 4G1UC 3IKMB 2R7KA 4U2KA 4A91A 1QMGA 4C01A 2O0LA 4YK7A 3LHDA 3UNXA 5HQJA 4LJ6A 1SOAA 4YT2A 2R6HA 1WCIA 1NFQA 2FW8A 1NU6A 3A1CA 5D7BA 5G4LA 3WMXA 4KPUB 2IUFA 2XRYA 5EJ6A 2Q2VA 5IRCD 3N75A 3D7LA 2CMHA 3ZWQA 3OQPA 1JR4A 4OO3A 4D3YA 4GICA 3S4YA 3UUFA 1T9GR 1CJSA 3G88A 3Q8XB 5B1SA 5IWCA 1XVVA 3T8YA 3VSAA 4IDAA 1FBTA 1O6BA 3HEBA 3AVVA 3D7MA 1JSLA 1MJNA 1NZDA 1YJ8A 1RKBA 3HXTA 4ZGGA 4BGDA 1KY3A 1U7DA 2DKNA 4W5RA 3F67A 4OP1A 5DSZA 1OX5A 1SHZA 2L17A 3EIWA 4OXIA 5TS3A 3PR1A 2HK7A 3GAAA 4GRIA 1GGKA 2FOLA 1VKNA 1U8TA 4FW8A 3MQ2A 1ZR2A 2PH3A 2JIBA 4U9IS 4AICA 3M49A 1GZ7A 1SOVA 3W6OA 3MXTA 4EBFA 5IJ9B 3RAFC 4WECA 2OV3A 1AZLA 3EF0A 1Z7GA 3R3VA 4OK5A 5E3IA 3WWCA 3OJOA 5KWVA 2AJCA 3OQ6A 5DZSA 3QYFA 2EIXA 2R5NA 2PZMA 1ZM9A 4DR3B 2V96A 3VPFA 4YCDA 3QX8A 5TQ2A 2G8NA 2OXCA 4ZEXA 4KQCA 3OZRA 1M3SA 1AXGA 4S1VA 1SUAA 3OQMA 4E22A 2IDKA 4XDGA 2P67A 2VBIA 3BRWA 3L0DA 2IZ0A 2VQ6A 3AUJB 3WGZA 2YOGA 3WWOA 1VC2A 1XTVA 4HDMA 5CH5A 2XBMA 1SPBS 3G5TA 2VQDA 1V5WA 5FEUA 2CB0A 3JSAA 2GESA 2RB4A 1TJ4A 3R7BA 1ZI9A 3VV2A 1FU7A 2RGNA 2ZYHA 2HX1A 5TMEA 5ADUS 2BIFA 1SG9A 3C3BA 1Q6ZA 3G2PA 3Q9UA 2G83A 3HCDA 2PPVA 2O1WA 4TLCA 4MWCA 4NAHA 2PMEA 1GZUA 2ZTSA 4MO2A 3TNLA 3H16A 4JQZA 1IXSB 2ZROA 1TVMA 2FZWA 1VE1A 2WTXA 1OD6A 1K7SN 1CD5A 4B2LA 3EWAA 2O8DA 3H9JA 4EP1A 5BQXA 4GMXA 3CUSA 4HQKA 1DKQA 2HXSA 2WTNA 4B7ZA 1J9GA 2JK1A 4TMZA 3ILSA 5JCZA 2HW8A 4GM1A 4PVCA 2WT9A 3LDUA 1T1EA 4FPXA 3ZHQA 2X5KO 3NJ4A 2PD3A 4NXNB 1PEAA 2A0WA 1G2IA 1PLKA 2GYUA 5B30A 3RYFB 1LTHR 2JI4A 4ZD6A 2AUTA 4C3UA 2XWJI 3OPXA 2GJ8A 3CY6A 1DKRA 4KXXA 3RTDA 1XDUA 3RVMA 1NMQA 3ORHA 3G2JA 4XVRA 2XNDA 3TQFA 3KR2A 5AIBA 3RUFA 4DIMA 1PL0A 2O7QA 4WKNA 2HSJA 2MMGA 3NDJA 1JZSA 2WUGA 1G5PA 2FPPA 3N0WA 4QPNA 3E53A 4FYPA 1TGVA 4PFQA 1Y33E 2D8AA 4FOOA 1PV1A 2VP5A 4HWPA 4BVAA 4Q21A 1SKQA 1YNOA 3NXKA 4V0LA 2W37A 3WAJA 4B3RB 1BHSA 2WA1A 4LYGA 3AZQA 3UA3A 5HWSA 3HCNA 3EIFA 1N7HA 3EDRA 2H3EA 2I4NA 2AF4C 1E6CA 1XAJA 1WX1A 2PS3A 5AHXA 4ZGWA 4GYKA 1SWVA 4ZDJA 1IY1A 2OQ2A 4I1PA 2HIAA 3AR3A 3L7NA 4KTVE 3PRYA 3ZDYB 3FW1A 1B2RA 4MUEA 2GZRA 1PLJA 1GCIA 4FKZA 4FZJA 3U3DA 3C87A 2PZ8A 4JB2A 3K8YA 1P3DA 4D4GA 1EVJA 5K6TA 2H1OA 2QAJA 3FSGD 5H3CA 5I9BA 3VUFA 4AP9A 4GBJA 1C1DA 2YTZA 2H48A 2FP4B 5I7RA 2VLBA 3D02A 3KZXA 3GJQA 5EP3A 3FUCA 3NAQA 5B1EA 5D3QA 5BVGA 5EQFA 2QMUA 3EXG1 4F2WA 4RQBA 1BAPA 2P2SA 3ZNQA 4K9MA 4RV4A 1VSUA 3Q8KA 2BI7A 4I50F 3P1JA 1H2WA 2CUTA 2PKRA 4S05A 1SHKA 2AUMA 1YBAA 3HZRA 1OZHA 2YHIB 3DZJA 5FBZA 1HE8B 2ECQA 3T7KA 4WADA 1EPUA 3KT6A 5AK4A 1F8GA 2ODPA 4PZYA 1TIPA 4PC3A 3K9CA 4PYNA 3H87A 2R1ZA 3O8OA 4BBJA 4C4XA 1W85A 1BXGA 2B3DA 3M0EA 1TE2A 1DXHA 3HRHA 3L6UA 3HVHA 5JZ9A 1XTZA 3OU6A 3U80A 2H2GA 4MPRA 5DI9A 4A8JA 2Q3EA 1QWOA 1Q1GA 1RAIA 3ZZ0A 2W58A 3M1LA 1IZ8A 3WI7A 3BC1A 4DIFA 1VJTA 2VP6A 1GUAA 4J7XA 4AG5A 1YUBA 3MD0A 4PG6A 4QPDA 2C96A 4KACA 5DGIA 2WJ4A 3PXCX 1NW6A 2P4SA 5TARA 3MTJA 5LJIA 2DM6A 1EE2A 2EOAA 2LR0A 2XHZA 3IEKA 3LE8A 4J2OA 3W7BA 3AJRA 4A1FA 5CB6A 1NWCA 1TADA 3H1PA 4CEJB 1M1YE 4GWGA 4WZBE 1L5SA 4GMDA 3H9UA 2Z57A 1E3TA 3MERA 2FSPA 4PPYA 2FWJA 5ALQA 1CUZA 4KYVA 4TV8F 3WL6A 4CLOA 3MMPA 5ADVA 3ESAA 1OAOC 3KP1A 1MO3A 2DPMA 3L05A 1XRPA 3PQ8A 4X7PA 2WMYA 1EK6A 3DXYA 1HWYA 3UB2A 4ID9A 2HF9A 3LPLA 4LGMA 1A8PA 1R6VA 4RKQA 3VR5D 1JQDA 1ZXLA 3ORFA 1LW6E 5CXXA 4E5PA 1FXUA 1BCRB 3CN9A 1YVDA 1Q1QA 3DWGA 5FT9A 3Q98A 3CNLA 4OY3A 4EPXA 4RD3A 3UJ3X 2NNWB 4GNKA 4YROA 4UM8B 3CR8A 3QNUA 3EA0A 4P9NA 2OVFA 4I99A 3O7WA 4Z0TA 2OORA 4G8CA 3COSA 2DRIA 3I12A 1JR3D 2PBLA 2VHYA 5DX1A 1MOQA 4EB3A 4TKZA 3F96A 2R00C 2WQZA 3EHEA 3HCFA 3K4QA 5H8WA 2E7ZA 2REQA 1MJ5A 4L4SA 4QQ8A 1U2QA 4B6FA 3C3PA 4F5EA 4ZODA 2WA2A 3V3KA 2JLCA 1FP7A 1NM5A 1J22A 3RLFA 3CNBA 3HI4A 4DXAA 4CG1A 2BFPA 1W8IA 2IV7A 3INGA 3CF2A 2E21A 2CLOB 4EG3A 3A9UA 4M7OA 4YJHA 3RVBA 4DLKA 2GYWA 4KRYA 1XMIA 1XBTA 4Y30A 3N2GA 4BLPA 4MIYA 4ZVNA 1CRQA 1F0PA 3GA0A 5T3UA 2VZ8A 4F9GA 5AIAA 3RNOA 1DAFA 1T35A 3NRJA 2O2JA 3PNOA 4DB2A 4QVGA 3NHKA 4G4JA 1OJLA 5E9JA 3DC7A 3ESCA 4UUBA 3D6HA 2QJFA 1QFZA 3IAM1 1M7HA 3KKMA 3BJIC 5C18A 1E3IA 2HA6A 5ALOA 4WNAA 1PGOA 5JH7F 1P1FA 3SBDA 3T5MA 3VI4B 2VBFA 1GQFA 1RWVA 4MVWA 1WXXA 1M7BA 2V6IA 3QPWA 3V5NA 4X9XA 3MT7A 2ATVA 2DPLA 4G0WA 1WMSA 3TR0A 3R9XA 1PQ4A 1M0TA 1YGPA 1ATZA 4C6HA 3F98A 4MDYA 3T7CA 1E3LA 3ZW7A 1TX4B 3TR5A 4MPJA 4J1TC 2ILTA 2R6DA 2XCIA 3EZGA 3VHLB 1ZCZA 1HDRA 2BBTA 4B3TB 3LYAA 1CLUA 2ZM5A 2YYYA 3G79A 1MW8X 3LQRA 1D2AA 2ZUVA 4LG1A 1ZOPA 3OJLA 1CZUA 1W1IA 4OHVA 2F3UA 4G97A 5B1DA 2WJIA 1Q19A 3PKZA 4M1ZA 5K4GA 4P4GA 4RH3A 2DHCA 3R24A 1Y7HA 3LRTA 5IM4A 1JVNA 4GKJB 5CLHA 2QP4A 1DX9A 4FDTA 5DASA 3FZQA 3VHQA