1NASA

Sepiapterin reductase complexed with n-acetyl serotonin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SEPIAPTERIN REDUCTASE
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
total genus 97
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nasA00
5DCWA 3RC9A 4KZPA 4CMKA 1U7HA 3ZN2A 1PZHA 1VLLA 1ZXBA 1A4UA 1YS4A 1MB4A 3LDHA 4URFA 5CAEA 2YY7A 1EDOA 3GDFA 4BGUA 4AG3A 1TA4A 4YTEA 1ISFA 5F1PA 3CKYA 2C29D 1H93A 4EITA 3V8BA 1E3SA 1RM4A 4R3NA 4JLWA 3HG7A 4RVSA 4MVJE 2GGSA 2RIRA 1GV0A 1UZNA 2Q49A 4UREA 3K2EA 3HN2A 1WPQA 3FSRA 4RLSA 1Z7BA 4DQVA 1J49A 1ONPA 4WLNA 2ZYGA 3RFVA 2JCYA 3CMMA 4XB2A 3VH3A 1PIWA 3PYMA 5EESA 1P31A 4D3FA 1ZH8A 4MVJA 3JQ9A 4GSLA 4EI2A 4FPXA 2ZJ0A 1CDOA 5EN4A 1BW9B 5L3ZA 4KTTE 4BNVA 3HE3A 3F1LA 4YEDA 4JGBA 4BUCA 3IKVA 2Q1TA 3OIDA 3Q9UA 4I1IA 1Y5MA 1PS9A 3GGPA 4HXYA 3ORFA 4NHEA 4RVFA 2PD6A 4Z9XA 2ZB4A 2R2GA 3WGTA 1PR3A 3GMSA 2BI8A 3Q3CA 4Z9YA 3D5TA 4WNIA 3MEQA 3UW3A 5K6AA 3VZSA 1XU7A 5T57A 5IG2A 1PJCA 1LSOA 1QG6A 4IDEA 3I9JA 5BSEA 4RCVA 3WDSA 5H82A 4GX2A 1JKJA 1PJBA 4MVJF 4JNKA 3WGGA 2RH8A 4P8RA 4CV3A 3QJ5A 2NADA 2A9FA 3D7LA 3DEYX 2NLOA 4PZEA 1UZMA 2OZPA 3EMKA 5ER6A 5GY7A 2E48A 5H83A 2BHLA 4RQTA 4G65A 2X23A 1G6KA 4A0SA 2AG8A 3PLRA 2QHXA 1J6UA 1ZNQO 2YQ5A 3DMTA 3DZJA 2DM6A 3GQVA 1OFGA 2E4AA 3WYBA 3KSZO 1ZEMA 2E82A 2HK9A 1F0YA 3JD0A 3WGHA 2X22A 4L0QA 3IUPA 1E1LA 4FB5A 3ZWXA 5BT9A 4PLCA 1BWSA 3JQGA 4YAIA 5EL0A 2W2KA 4NFYA 2NTVA 4Z3DA 2PLAA 3HNPA 2UYYA 1G1AA 1MP0A 3V5NA 3DC2A 3P2YA 4E5MA 2H1SA 1PZEA 4ZHSA 1I3LA 1NQTA 4TKLA 3TFOA 3JQFC 3SEFA 3WWYA 5H81A 4GWKA 1MX3A 2Q50A 2Y68A 1NXQA 1AHHA 3SXPA 2RHRA 2CSUA 4W7HA 1I3NA 1ADGA 1U5CA 1VKOA 3KYDA 4UVEA 3GAZA 3NV9A 4CM7A 2W8ZA 2O23A 5KJ1A 1YL5A 4OJNA 3NRCA 3JCZA 3UN1A 1KBZA 1ML3A 5F21A 3F4LA 3PEFA 2GDZA 1AUPA 1X15A 4BNIA 3RUEA 3EUWA 3KO8A 3WJ7A 4GGPA 4AJPA 1UDAA 1L1FA 1H9BA 3ZWYA 4YB8A 2VYVD 1V3TA 5JS6A 1IPFA 1R6DA 4PVCA 5COQA 2ZTLA 1WAMA 4FFNA 3R0IA 4Z6KA 4B8ZA 1FDSA 4YT2A 3Q2IA 4UVIA 1XKQA 1U8XX 1YH3A 1MLDA 3BMCA 2D5AA 3BHMA 1MG5A 1K0UA 1QYDA 3GGOA 4BVAA 4NBVA 4WLOA 4XJTA 4JJFA 3P19A 5JDIA 2WD7B 3CSDA 3QP9A 2A92A 4ND1A 5JFOA 2J8ZA 4DC1A 3U4CA 4HBGA 1XELA 1E7WA 4BNTA 2IZZA 4GX5A 1IPEA 1QLJA 1SNYA 2B5WA 2W2LD 2VZ9A 1H94A 1NQOA 3DBVO 4B3HA 5KVSA 1H5QA 1R66A 2B37A 2JFHA 4KP7A 3GFBA 3UICA 2VQ3A 1HDOA 1B7GO 5TIIA 3ZV5A 2QQ5A 1LI4A 1FDUA 5ENDA 1AXGA 4CQMD 5CDTA 4GBJA 2CNBA 4R1TA 4MVJH 1G0OA 3K6JA 4OH1A 1J4AA 1QYCA 1VL6A 4WGGA 3TFQA 4YAGA 5JCJD 3KEOA 1I8TA 1ID1A 1ORRA 3C1TA 4JBIA 4DIBA 1N7GA 1N1GA 4JBHA 1BGVA 1R4NA 5KTKA 1B16A 5TJHA 3C7DB 1JDJA 1I01A 4MO2A 3ETDA 2XXBA 3K73O 2YHIB 1MFZA 4CM8A 4UUMA 1K89A 1P44A 2VZ0A 3NTOA 3H2ZA 4AVYA 5L4NA 1T1SA 1ZVMA 1TT5A 5G0UA 4JX8A 3WGZA 2I9PA 2GN9A 2UUPA 2X0RA 3F3SA 2QRLA 2X5OA 1Y8QB 4HNGA 3IQDB 2O48X 3I5MA 2W4QA 3AUUA 3PIDA 2PD4A 4P4GA 1A27A 2YHUA 2VUUA 4KTVE 4WKGA 4P4NA 4EGFA 1ENYA 1N9GB 1DC4A 3WGIA 1H6AA 1O95A 2XPCA 4NZ9A 1K3TA 5EPOA 4IXTA 3U62A 2GNAA 3WFIA 2Y1DA 3STHA 1C14A 4CM1A 5A5FA 1PQWA 4W6ZA 1DC3A 3HQ4O 3NJ4A 1H6DA 2FMUA 1UJMA 4PCVA 3I23A 1F14A 4IMRA 1SBYA 4OXKA 4ZQBA 3IKTA 4E31A 4E2XA 3HDJA 1NFQA 3RC7A 1C1DB 1ZJYA 4NR0A 1QR6A 1FDVA 4LMPA 2PGLA 4WLEA 3E18A 4LRSB 5JY1A 4M54A 3C7AA 1X13A 4W82A 1M66A 1GUYA 3MZ0A 3HJAA 4FSHA 4EEXA 3RVDA 3Q11A 4D0RA 1ZMTA 4E12A 3MOIA 2AQIA 1F8GA 3DL2A 4JK3A 4E2WA 3M2TA 3LF1A 1E6WA 3ZHZA 5JMPA 2G0TA 2TMDA 4DRYA 1T24A 3W4KA 1E6UA 4FIZA 2O2YA 4J1NA 1NBOA 1D1TA 3PDUA 4JXKA 4NI5A 1XIVA 1CF2O 4UAGA 1ZUD1 5AYVA 5B37A 3F5QA 3GG2A 4FC7A 1C0KA 3OJEA 4BS9A 1XHLA 3GHHA 1PS8A 3E5RA 1LRLA 3BMOB 4BO1A 2JD0A 1PWZA 2B83A 3DAFA 1OBFO 1HYHA 4CMEC 1LLQA 4WCFC 3FPLA 2QZZA 1I3KA 3LU1A 1SEPA 3DTYA 1ZK3A 3OQBA 2IXBA 3BXXA 4NBTA 1U3WA 5THKA 4BNWA 4B79A 1T2DA 2Q2VA 1MA0A 5A4DA 4R01A 4EEZA 3VZPA 1QRRA 2HO5A 4F6CA 3GLQA 2IRWA 1L7DA 4XZ3A 3ZH2A 3IS3A 3PFWO 2PKQO 3JQAB 3CH6A 4HFJA 3AJRA 5ITVA 1ADCA 2ZK7A 1NVTA 3AW9A 4ALLA 1Q1NA 3TF5A 1PR9A 4O6VA 3RQSA 4B7XA 1ZSYA 2EGHA 3G0OA 4CODB 4CJXA 1OAAA 1VKNA 2VWQA 2OL4A 4BMVA 5TLSA 2VYVA 3OEYA 3ONDA 3NKLA 3JQ8A 2YV1A 1U2DA 4A5OA 1DAOA 1LDBA 1JA9A 2QX7A 3ST7A 1W6UA 1LJ8A 4E4YA 2Y1FA 1DPGA 1LLCA 1N8KA 3UH1A 4E32A 3R6DA 4MVJI 2B4TO 1EK6A 2LDBA 1HYEA 1LU9A 4CM4B 4PG4A 5A9RA 3GK3A 2HK7A 2R00C 2I65A 3L6EA 1D3AA 2B69A 4YT5A 4WCFB 2W2LA 4NH4A 1VJTA 3U0BA 2Y1GA 3QWAA 5BSHA 2EKLA 2Q4BA 2GZ3A 3FCOA 3WIDA 2WMDA 3H9QA 2IODA 3OJLA 1XU9A 4E6PA 1RPNA 2FRDA 4CQMA 2D1YA 2ZKLA 4EBFA 3D4OA 1WMBA 4FFRA 5DBGA 3OIFA 1QKIA 2FR8A 3UF0A 5AQ1A 3F6YA 3DR3A 1ZW1A 4L8VA 4DQUA 1YBVA 1ZCJA 2H63A 5KVQA 5TRTA 4NU5A 1C0IA 3JQBA 2X86A 1BXGA 1YOVA 2YZ7A 5JYEA 4QO8A 1WXDA 5TQVA 1DSSG 1DIAA 2IEBA 3HWRA 3K5PA 3HZZA 4HFRA 1YKFA 5CG1A 2PV7A 3RC2A 3Q0EA 4J4TA 1K6JA 2EWMA 4QQRA 4G5HA 3I9LA 1E7YA 5F5NA 4LW8A 1RJWA 4BO3A 4E13A 2IDZA 4NBUA 2Z1NA 1RM3A 2HU2A 4RORA 3CTMA 1X1TA 2DKNA 1X7GA 1O5IA 3ANMA 2EKPA 4TRRA 3TOZA 1QMGA 1LNQA 4LSWA 4R1UA 2GPTA 4BV8A 3K8ZA 3RUDA 4CLEA 3TWOA 3IC5A 1P0CA 4YJHA 2P9EA 1DIHA 3QSGA 5C7OO 1ISJA 1PL7A 4D79A 1YB4A 3JQ9C 4CR8A 1QV7A 4RVUA 2V6BA 1DOHA 3CZRA 1Z75A 1VL0A 3K2BA 4L4XA 3PGJA 3MJVA 3PPIA 3JV7A 3EGOA 3NGLA 3P7MA 3U3XA 5AXDA 4LCJA 2WTBA 3SBOA 1DJQA 5TF4A 3V2GA 3E6AA 1P1FA 3K92A 4DWVA 1P45A 3ZWWA 2FPGA 4PG6A 5L7WA 2Y67A 4XR4A 3L6OO 3DZKA 1MUUA 5C37A 1YVEI 2DUWA 3NDRA 1XSEA 1N2SA 3LLSA 3MJCA 3TRIA 5K9ZA 1LLDA 1GEEA 1RYEA 1NHGA 1T2AA 4IZHA 4OSPA 4IQ8A 4HV4A 1K5HA 4D0SA 1DHTA 2GYYA 3OIGA 2WSBA 3GZNA 3WS7A 4IDBA 5A06A 4Q3DA 1EMDA 3FRJA 3E8XA 2ZB7A 1GY8A 3FN4A 2PKQP 4MJLA 4NG5A 5EINA 4F46A 5A9SA 1WNTA 4BNFA 4BNHA 2D4AA 1HXHA 4LK3A 1A7AA 1YQXA 4QO7A 4RQUA 1JWAB 1U5AA 4E5YA 4XYMA 3GF4A 4KDEA 5KCZA 1EUDA 3WSWA 4J0EA 2JD1A 3K30A 3NTRA 1DRWA 2PGJA 1BVUA 3DBLA 4MVJD 1BSVA 4O63O 1LUAA 1DC6A 1X7DA 4BNYA 4EDFA 3CE6A 1X7HA 4KUGA 4B7UA 1ZIDA 3QVOA 4XGIA 3ETEA 4ALNA 4EUFA 1IL0A 2BD0A 2JL1A 3ZWBA 4XIYA 1U7TA 2DVMA 2HAEA 2GO1A 4RPGA 5EJ2A 8LDHA 2JCVA 3GH3A 5B4TA 4R4JA 2VRBA 1PEDA 2NU7A 4GLLA 1T4DA 2B5VA 4BO5A 3DO5A 4FBGA 2V65A 1GQ2A 3TZ6A 3X2FA 3GDOA 1Z45A 4WECA 3D3EA 4RJTA 2VWPA 4XQEA 4YQZA 4DXHA 4CLOA 3I9NA 4BMSA 2C54A 5JDCA 4ZICA 1A9ZA 3H4VA 3HB5X 3HDQA 3NDIA 1ZO8A 3AFMA 2Z95A 1UXKA 3C1AA 4EUEA 1LSJA 1ZKMA 3NT5A 4RF3A 3AI1A 3VHRA 4XKJA 3JQGB 2AE2A 2CVZA 3JYOA 2W2KB 5DP2A 5C5IA 3A9WA 5EQDA 1Q7CA 3ADOA 1LSUA 1B3BA 4PLFA 3PQEA 2O4UX 4U0JA 5CDYA 2X0NA 1AHIA 5IJZA 5JDIC 3WGOA 5ENVA 2O7SA 1E7QA 3F5SA 3VPSA 2YFHA 5KJ6A 4IGFA 4YJGA 3QWFA 2C20A 2Q1WA 4CMJA 3H9GA 1A71A 2WYWA 2FZWA 4UUNA 1UAYA 4ND4A 4EJ0A 1GAEO 1YQDA 3IOYA 1E3LA 3JYQA 4RZHA 4RL6A 1M6WA 1UP4A 4YRDA 1V8BA 4UULA 1NWCA 1DLJA 3RBVA 4GMGA 2ZYAA 1PJSA 4RVDA 6LDHA 1GQYA 2HSDA 4M49A 2OBNA 2GF2A 2XF8A 1R4MA 2WEKA 4GLOA 5JW6A 3ENNA 1TXGA 3TJRA 2ZTUA 4YJFB 3KLMX 3H9EO 3GGGA 4QTZA 1D8AA 1NP3A 2BFAA 2BFPA 5T6BA 2E49A 3W1VA 3UUWA 3KOUA 4MIEA 5AXBA 4NU6A 5T5QA 3RJ9A 2WM3A 4XQCA 3AI2A 1P1RA 4TVOA 4CLDA 1BXZA 3BMCB 4A10A 5HM8A 3WOHA 4RF2A 1E3WB 3EVNA 3ROQA 4QSMA 3PGXA 1FJHA 3PQDA 2VYND 1PZFA 4KUEA 4G2NA 4WE3A 4JJIA 3BA1A 3D4NA 4HFMA 1AN9A 4W4TA 4FGWA 2J5QA 5JAQA 3U5TA 2QYSA 4JCOA 3WFJA 2BLLA 3ZU5A 1OI7A 3SLKA 5CDUA 4X54A 3ANLA 3VPHA 4Q9NA 3Q9NA 3WSVA 3TN7A 3LZ6A 4AJNA 5JXWA 4A03A 3FTNA 3H2SA 1BTOA 1F8FA 1ONNA 1T2CA 1FF9A 4JQCA 1R4NB 3RFXA 3DAPA 3EC7A 3D4PA 3L4SO 3OP4A 2Z1MA 3ZDFA 1UR5A 3PYLA 3DHNA 1VSUA 4YBZA 4CM8B 4QFCA 5CP8A 3V2UA 2EP5A 4UVDA 3VTZA 1EVIA 3AY3A 1MXHA 2FP4A 4OAQA 3AI3A 1WMAA 2DFDA 2EGGA 9LDTA 4YAEA 5FI3A 3GDGA 1YL7A 1P3DA 1PTJA 4YA6A 1EUCA 3IP3A 4CM6A 2ET6A 3D5QA 3FR8A 1HZJA 2O2SA 1FDWA 3ICPA 5GZ6A 2C2YA 5JC1A 1V3VA 4RLHA 4D41A 1ENOA 1NAHA 4J49A 3SC4A 3ZWNA 4DMMA 1WW8A 5IAAA 4NJMA 3KYBA 5C3MA 4GKBA 2ZQYA 3OJOA 4B4UA 5COBA 5A9TA 3RBXA 1B0AA 1X14A 1H6BA 4ZRNA 4BNMA 2SCUA 4MDHA 3PJGA 4IINA 3ZHYA 2PA3A 3I3OA 3R3JA 1E92A 2Y05A 4DLAA 3PIIA 4D44A 2DC1A 1MV8A 1JLLA 3QW2A 2GRAA 2G1UA 3QIVA 3DDNA 7MDHA 2PH5A 1ADFA 3KHUA 2ZATA 1YONA 2X1HA 1EK5A 4MVJM 5F5LA 4Z0TA 3PXXA 3CEAA 4A26A 2DBQA 3VPGA 2AXQA 3FHLA 4S3MA 2ZCUA 4WEQA 1E3IA 3ZHBA 3CPSA 1DIGA 1LQUA 4J0FA 4AJIA 3QVTA 1UZLA 4NQZA 4DPMA 2Q46A 1OOEA 3B1KA 1EVZA 5DDIP 3OECA 4XEHA 4CUKA 3E48A 3RROA 2ZCVA 7ADHA 2NV6A 5TSDA 3RD5A 1YL6A 3NT4A 3RASA 2Q99A 4OXNA 1O9BA 3D1LA 5EQFA 1QXSA 2GZ1A 1V6AA 2GLXA 2J3IA 3S55A 3ZNOA 1B8UA 1Y7TA 4LISA 4HADA 4WOKA 2CDCA 2G76A 3I4CA 1R0LA 3PHLA 1ZK0A 2D8AA 1YO6A 4NK4A 3EDMA 3L4BA 4HFNA 1UH5A 4YAKA 2DUUA 1U3UA 4Q39A 5GMOA 1P74A 2BRUA 3WTBA 5DULA 3PHHA 4DYDA 3JQEA 1BG6A 3E9NA 4PLTA 3FNGA 3BIOA 3G1UA 3KV3O 1IUKA 3C3XA 4CMIB 1JU9A 3E03A 4IQGA 4PRKA 2X8LA 1O0SA 2NM0A 4PG7A 4L73A 4PRLA 1JTVA 3L77A 4I9NA 5JMWA 3GOHA 1E6EA 4PIVA 2O3UA 3JQBC 1EFLA 1W73A 4ZJUA 4I5DA 1HDRA 3ONFA 4IMPA 3JQ8B 4YWJA 3GEDA 4YR9A 2WWRA 4TZKA 3B1FA 3TQHA 5BQFA 3U4HA 1KVTA 1R16A 1BHSA 5JO9A 2YJZA 5J23A 2AEJA 2B36A 4XDZA 4L4SA 4IPTA 2BGKA 4LCEA 3PHJA 3D3WA 2HDHA 2OUIA 4CLRA 1KEPA 3ZNNA 2I67A 5FWNA 1OC2A 4J91A 2VYNA 2O3JA 4JJGA 4XB1A 4B4OA 4IXWA 3G17A 2YFQA 3M1AA 4L76A 1ZK4A 3DHEA 1NPDA 4DBVO 4FDAA 4CR7A 1PWXA 4J6FA 2W98A 1HF3A 2EEZA 4GX0A 3ULKA 5BSFA 3ZV3A 3D0OA 4PN3A 4CQMB 3KTDA 2HUNA 3H5NA 3RIHA 2HRBA 2YV2A 4CV1A 3ETGA 2B0JA 3UCEA 1BMDA 3PP8A 5THQA 2NVWA 4F3YA 1TEHA 3NDJA 1BXGB 1YOVB 2V6GA 1HDYA 1A4IA 5HS6A 1NX6A 2RHCA 4AJ1A 2O3RA 1U9JA 1EFKA 4OGWA 2ZYDA 2IYPA 5GZ1A 2D2IA 1U4SA 2NUAA 4CM3A 3U49A 3VVBA 1HDCA 4I8XA 3BMQA 5F3RA 1YDEA 3H3FA 2P4QA 4L9RA 3ICCA 2Y0CA 1QYWA 4Q3EA 4M87A 3M1LA 1HEUA 1E1KA 1WLYA 4AJHA 4PFJA 6ADHA 4NNJA 4IDFA 1DAPA 1OMOA 4YJHB 1CETA 3PWSA 5U4QA 2ZQZA 1VPDA 3LF2A 1SO8A 1V35A 1E77A 2VT2A 2HRZA 1NR7A 4DC0A 3GVXA 4MIOA 1ULSA 2VRCA 4YXFA 4OYRA 3VZQA 3F9IA 4A27A 4PLVA 3WGQA 3PFFA 4CMBA 2ILTA 5DCUA 3OQ1A 3S1LA 2CD9A 3HFGA 4YPOA 5KJFA 4XGKA 1VJ0A 2HMTA 2DBVO 2V6MA 1KC3A 3RWBA 4BQRA 5JNLA 2Q45A 1Y9EA 5DF1A 3O4RA 5L53A 3SC6A 4AJJA 1F17A 1BW9A 1Z73A 2DPHA 1BDBA 3OJFA 4Y6RA 4U5QA 5T8KA 2JFFA 4LGVA 1QYXA 2Q1SA 3PZRA 3V1YA 1Y8RA 2AE1A 4FJ1A 1EUZA 3G79A 4FC6A 3GZNB 4ZQGA 3DOCA 1J0XO 3GUYA 1UXJA 4N5LA 1GU7A 5DP1A 4A7PA 4QXMA 3RKRA 4XJSA 3DBRB 3OJ0A 2DAPA 1WVGA 5JDCC 3WQSB 3DQPA 4TRJA 4LSMA 3VOSA 2YW9A 5A9SB 3N58A 4JP3A 1E3JA 3ZU2A 4BIIA 3VDRA 4CV2A 2JJYA 5DBFA 4CUZA 3VTFA 2ZTMA 2Y1EA 1N5DA 1Q7GA 4RPHA 1A7KA 3KYCA 3L6DA 3FNHA 4O5OA 2FY8A 2BGLA 3DBLB 4N54A 1UXIA 2EG9A 2ZB8A 4EYEA 4GVLA 4A2CA 1Y9AA 4BQPA 4TQGA 5JY6A 2PFGA 3W8DA 2GD1O 5BR7A 3SX2A 1B26A 4XRGA 3A14A 3I4FA 3A28A 3OBBA 5LDGA 4K6CA 5AVOA 4J2HA 2GSDA 4YAJA 1SPXA 1YQGA 4ZGWA 1JKIA 5T67A 2GN6A 4GKVA 1PQUA 4BO8A 5JCXA 2P2SA 3VPXA 5I7VA 3PVZA 4GGOA 5K0ZA 1HETA 4WPGA 1HSZA 2HQ1A 2VHXA 4N5NA 1B14A 1W0CA 2RBEA 4MKXA 3DTTA 1UUFA 3DBHA 4QFDA 2J3KA 3CMCO 4EJMA 2NVUA 1PGJA 2C5AA 4J4HA 2VHWA 5L51A 4UVGA 3F4BA 2AQ8A 4BKPA 4CLOB 4RVGA 1YE3A 2ZJ1A 1SMKA 4R16A 2O4CA 4XQ9A 4OMUA 4BB5A 2CDBA 4XD2A 2DPGA 1PU2A 2Y0EA 3RUHA 3AWDA 1JW9B 4FD3A 1YJQA 3QV1A 3UFXA 1MGOA 3EZLA 5FYDA 4IDDA 2NQTA 4U8GA 4WLFA 4XCVA 1Z6ZA 3PQFA 2I6TA 2AQKA 4R51A 3DAGA 3H9JA 4UUOA 3GVIA 1WWKA 3ZV6A 3WQRA 4BNUA 2X5JO 2H5LA 3TL3A 2Z5LA 1FMCA 3MCVA 4XYLA 3DONA 3RUCA 3T7CA 4P38A 2X9GA 1KY5A 3S8MA 3PZBA 2VWHA 2FZEA 2JHGA 3IUSA 3KSUA 3Q1LA 4R3WA 4CQLA 1TB4A 4GX1A 3C8MA 4UUPA 4D43A 1P0FA 5ES3A 2E6UX 4G81A 4YJGB 3WMWA 4IM7A 2DBRA 2QRKA 4PGFA 1C1XA 5IN5A 4AJ4A 3WNVA 1EBFA 1GPJA 5TGDA 3WLEA 5B12A 5JC8A 3DZGA 2G5CA 2GN4A 4LRTB 2HKIA 4NDNE 3ZWCA 4H15A 5I8ZA 2WD7A 2EP7A 3JQFA 2CVOA 4FJ2A 2H9IA 5CFZA 1GR0A 1I5RA 3IAHA 3JQDA 1IB6A 5CPBA 2VNSA 1TT7A 1HDZA 3WWZA 4K28A 1H6CA 1TVEA 1T2EA 1YBMA 3UVEA 4GPD1 1Z82A 3ZWVA 4YCAA 4OSOA 4RVHA 3AU8A 3LT0A 2HMSA 3RKUA 2WJPA 3L9XA 2BH9A 5A02A 3VPFA 1DRUA 3N7UA 3GN1A 5KOIA 4RDHA 3W4IA 2A94A 5AXAA 4OIMA 3TZHA 2WYUA 1Z7EA 4IDCA 5ITWA 5HS4A 2GR9A 4BKUA 1P77A 1EQUA 5JBIA 1Y8QA 4BMNA 3D64A 4J43A 3W8EA 5TS3A 1ENZA 1YGYA 2YQ4A 2NU6A 2A35A 5I7EA 3EVTA 3DXFA 2OXIA 4RDIA 4DTIA 5K6AC 4LVCA 1O8CA 1E1MA 5FFFA 3IDSA 5B1YA 2DFVA 4EW6A 2IZ0A 4QUKA 1X0XA 3PK0A 2IE0A 1LDYA 3AK4A 1S6YA 3OA2A 2NTJA 4B3IA 4Q3BA 2VT3A 3LVFO 1TI7A 4Y8VA 4GMFA 4BO0A 1NM5A 2DTEA 2E37A 3BHJA 2I5PO 4U7WA 1BXKA 1NYTA 5L9AA 3KLPX 3ADPA 3L9WA 3OICA 3MWEB 2J6IA 4GQAA 4YRBA 4FR5A 2DBZA 4UEOA 4P4LA 5F1OA 3LSYA 5FF9A 3I52A 4KWIA 5I7SA 3DMTC 3V1TC 3W6ZA 1ISIA 3OEWA 1SCUA 3E1KA 3GMDA 4ALMA 3IMFA 3EYWA 4ND2A 4ITUA 4M55A 3ROKA 3PJFA 2VHVA 3TL2A 3TNLA 4INAA 3G1TA 5A3VA 5MGBA 5EIOA 2DLDA 2X0IA 4R9SA 2CZCA 3M6IA 1RWBA 4DBZA 3L4BC 1GYQA 2B4RO 3ITKA 2X4GA 3ZWOA 1EVYA 3S2FA 3GNQA 2NU9A 1EDZA 4FCCA 1YXMA 5KNLA 1AXEA 3E9QA 2Q4EA 4R9RA 4J7XA 5JPIA 4ZD6A 2EXXA 1PGQA 1QLHA 1DDOA 4ND3A 4NFHA 5ICMA 4BHTA 1P9LA 1Z74A 5G4KA 1N7HA 3GEMA 1DBVO 2POQX 3KUXA 4W9NA 1C0LA 1GUZA 5IF3A 1PGPA 1H0KA 4XR9A 2AEMA 2O3QA 3HDYA 1VC2A 1ZK2A 1C0PA 5ILGA 4C7KA 4R5HA 5L45A 3N74A 4R69A 4XYGA 2NU8A 1HYGA 3DZBA 5IXYA 2EHDA 3QQPA 1NPTO 2JAHA 4NMHA 5A05A 5DBIA 1O89A 4Y6PA 3DFUA 3WMXA 5HWSA 3JQCA 5DCYA 3FF4A 4Q3CA 4Y9DA 3WJAA 1ISMA 2AEFA 3ZU3A 3EAGA 4E21A 4M8SA 2VHZA 3GR6A 3O8QA 2FWMX 2NNLD 1XWFA 3BTSA 3OSUA 5A5EA 4NIMA 1PJTA 4R68A 2OO5A 3RJ5A 1NQAO 1LDEA 2D0IA 1XLTA 2EKQA 3DOJA 3QWBA 2XAAA 3HDHA 2Q2WA 2QYTA 5JYDA 4QX6A 1LC0A 3TZKA 1VJ1A 3Q6IA 3CINA 3KZVA 1TLTA 4M1QA 4R54A 5KKAA 5JSFA 1PJ2A 4ZRMA 1KVQA 2IYOA 1QORA 4FFPA 3LT2A 4ID9A 4WNCA 2DQ4A 1PQPA 4HNHA 4CM9D 2QG4A 2YDYA 4M89A 1ZXLA 3ON5A 3GVCA 4XRRA 3KYDB 5FEUA 4D46A 4YRAA 5HBRA 3K9QO 5CG2A 1GD1O 1HE2A 2UAGA 4KMSA 4FFOA 2WD8A 1NFRA 1I33A 1WP4A 1P33A 3OH8A 2P91A 4IUYA 1LXCA 3IL2A 3BMNA 1ZZEA 3KBOA 1I2ZA 1R12A 5DOVA 5TT0A 4U6QA 4B4WA 1JVBA 3RU9A 4YQYA 3WTCA 5JAMA 2B35A 3VH1A 3BTVA 1P1HA 1E0DA 4FFLA 1M75A 3PWZA 1V9LA 4RO0A 3D3WB 1HDXA 3WLFA 4XA8A 4PG5A 2OOSA 3C24A 3GPDG 3M2PA 5A04A 1I3MA 1SB9A 2GERA 1QV6A 2O3TA 1SB8A 1ZK1A 5BNFA 4IIUA 1M2WA 1MC5A 4D3SA 4BO9A 4FN4A 1LDMA 3PJEA 2JCXA 3DZHA 4W99A 5CDSA 2BELA 4MPDA 1E7RA 4CMAA 5IXSA 4ND5A 2NACA 4DUPA 3NJ8A 2F1KA 4WK6A 1MFPA 3QHAA 4ILKA 2R00A 3DB2A 4WEOA 3RSHA 4OHUA 5F1KA 3SLGA 3KXDA 4RF5A 5FI5A 3JD2A 4ALJA 4YVFA 1QP8A 3L0DA 4YACA 1YRLA 1NFFA 2DT5A 1I2BA 1PZGA 4E5PA 4XDYA 4H7PA 3WYCA 4DA9A 1FXSA 1MC4A 1VSVA 5G0SA 4XIJA 1H9AA 1UP7A 2Y93A 4B7CA 5HTOA 2Q2QA 2X0JA 1IOLA 4GVXA 4R41A 4CMHA 3GAFA 5ICSA 1O94A 1GCOA 4EUHA 1DB3A 1TT5B 3BMQB 5T8KC 2Y0DA 1FK8A 5U1PA 5L95A 2A4KA 5TNXA 2NVBA 4IZIA 3T4XA 1NR1A 1VM6A 1KVSA 4AL4A 4DIOA 3A4VA 3GT0A 1LEHA 4OXYA 2BF7A 3E9MA 5A03A 3DWFA 3SJ7A 4LMRA 3H5RA 2GZ2A 3H8VA 1ZMOA 2BMAA 3SVTA 4TRNA 3UGKA 3ZWPA 2BFOA 1U3TA 2CUKA 4R1NA 3PHGA 1GZ6A 2QZ9A 5EMHA 2NTNA 4PLZA 4ZQEA 3R3SA 4JBGA 1U28A 4OO3A 4YDRA 4AJKA 5I9NA 1XA0A 4ROSA 3VVCA 1R0KA 3AFNA 4BOYA 3S2IA 3F46A 1K6IA 4F6LA 1BDMA 4F45A 1R0SA 1EQ2A 3PYXA 2UVDA 2VRCD 3JSAA 2P5YA 4CM5A 2VN8A 1NQ5A 3JQ7A 1P1IA 3LYLA 1AE1A 3V2HA 3PRJA 3PDJA 3W4JA 4KQWA 2VWGA 2P4HX 2C82A 2P5UA 3AM4A 3VKUA 4W7IA 4ZU3A 1A5ZA 2V7PA 3DZIA 4I08A 4NK5A 5IZCA 1RM5A 4PZCA 4ZVVA 3H5AA 1Y8RB 4BGEA 2BKAA 2HJRA 1RYDA 3GUCA 3NGXA 5DT9A 3WYEA 1GDHA 4XX0A 1XCBA 3NAQA 4CLXA 4FGSA 4D7AA 1DEHA 3AY7A 2EJWA 2YV3A 3UKOA 4FJ0A 3QWIA 2O50A 2FOIA 3C85A 1GUFA 1B8PA 3E5MA 1PSDA 3UAGA 1KETA 4J90A 3ZGYA 4IJKA 4E5NA 1UXGA 2JKVA 1DC5A 1N1EA 1CEQA 4HX5A 3GA0A 4FFMA 4S1VA 3KYCB 1DFHA 5TX7A 1EEHA 3RUIA 4D3DA 1EE9A 2HJSA 2CDAA 4CM9A 5CPFA 1ARZA 1NAIA 3MJEA 2VTDA 2R6JA 1HLDA 2I3AA 4RZIA 1GQQA 2O7QA 2PH3A 2X5KO 2P9CA 3T4EA 4RGBA 3QWHA 3P2OA 1I2CA 1Y81A 4IS3A 3LT4A 4J1SA 1Y5RA 3AOEA 1M76A 2CF5A 1GCUA 1ISGA 3PWKA 1CQJA 1T25A 1EE2A 3G3EA 3K96A 3L07A 8ADHA 3OMLA 3I1JA 5IDXA 3KSDO 2YYYA 3DBHB 3MJ4A 5CEFA 3ITDA 4MIYA 3ZZNA 2NVUB 3LQFA 1S7CA 3VDQA 1QYVA 2D5CA 2X9VA 3F1KA 4MINA 3AUTA 3NEPX 2WE7A 4MP8A 4TVBA 3FTPA 4IIVA 4BL5A 2HLPA 3GN2A 2VTEA 1DFIA 1KEUA 4J16A 2PD3A 4ALKA 1SOWA 1E7SA 2VOEA 3KVOA 1WDLA 1I32A 3FR7A 2VZ8A 4R1SA 2X9NA 1BVRA 4GH5A 3HFSA 4AJOA 4HKTA 3VH2A 3MTJA 5JLAA 2NQ8A 2C2XA 4CLHA 4TROA 5CEEA 2C7VA 3LC7O 3ZW9A 1HRDA 4TSKA 2XOXA 2DU8A 1W4ZA 4ALIA 4BNXA 2GUGA 4DL9A 4BNKA 2CVQA 2LDXA 2HK8A 1JVSA 1PGNA 4ZA2A 4E33A 1IE3A 3W8FA 2NWQA 3INTA 5A3JA 4CQLB 4YT4A 4YJFA 1IYZA 1LLUA 2DTDA 4BGVA 5ILOA 3W6UA 2VUSA 4CL3A 3HN7A 1C1XB 2Y1OA 5ADHA 2UV8A 2WE8A 2FPPA 4IQ0A 4QECA 4ZN6A 3OF2A 1E3WA 1Q0HA 1XYGA 4TRMA 4Z0PA 3S2EA 4DYVA 1E1NA 1LSSA 1U1IA 2UDPA 4XYBA 2EV9A 5ER9A 1RM0A 1ZBQA 2Q3EA 4Z0HO 4UEKA 1LTHR 3AM5A 4IJVA 4XYEA 3DMYA 1HLPA 1IZ0A 3OFSA 4JROA 3H9UA 1EZ4A 3B70A 4MOWA 1PGOA 1JQBA 5KIAA 1U4OA 4Z9FA 5U9CA 4FQ8A 2JHFA 1AGNA 2G82A 4MKRA 4RF4A 5DOZA 1I30A 5IN4A 3RCBA 4E30A 3AY6A 1Y1PA 2OFPA 1K6XA 1T4BA 2WDZA 4LN1A 3ZNQA 3ZU4A 4DIFA 1T2FA 3FBGA 1HSOA 2AHRA 3MJTA 2EJVA 4E0BA 4ONEA 4A73A 2YDXA 4C7JA 5G0TA 4YYZA 4ESOA 2C59A 5KVVA 2IEDA 3HB4X 3VKVA 5GZ3A 2DTXA 1PJ4A 4XGNA 3TPCA 4AJ2A 2P68A 2VOJA 5G2OA 4K9DA 4RPLA 1CERA 1UXHA 3GHYA 5MDHA 3B6ZA 1GADO 3NYWA 5EERA 2H6EA 2ZTVA 3OA0A 3ZWAA 4GL4A 3HSKA 4OQZA 2F00A 5KJCA 3JD3A 3JQ6A 4OL9A 2ZB3A 4OOEA 4IBOA 3PJDA 3LK7A 4PLYA 5JAIA 1XGKA 4Z3KA 3QY9A 2QRJA 1U8FO 2Q1UA 4KQXA 4MVJG 4O59O 4W9NC 3I83A 4BNJA 3MWDB 1UDCA 2HMWA 1PJ3A 4EJ6A 1HWYA 2VHYA 1N92A 3BHIA 3LT1A 1V0JA 1WZIA 1X0VA 5I8WA 3A06A 4CV0A 1HKUA 1YWGO 3FWZA 5JO0A 4DGSA 4DVJA 1KERA 2B4QA 3UCXA 1JWBB 4ZQFA 1ISHA 2TMGA 4IDAA 3RUFA 2PTGA 2C7GA 1NWHA 3FBTA 3GY0A 4UEJA 2JAPA 3G49A 2EERA 1ULUA 1NASA 3WICA 4OKIA 5B4VA 1CQIA 4IDGA 4AJLA 3VZRA 3ZNPA 5CDGA 3EK2A 2OBYA 3K31A 4QEDA 1LA2A 2AW5A 2NSDA 2WYVA 1CIVA 1VE9A 4JIGA 1HZZA 1LQTA 1E5LA 4BO4A 1PJQA 2JD2A 3FD8A 4OKNA 3O9ZA 3WR5A 2W90A 3UXYA 5LCXA 2HMVA 4II2A 3WB9A 4NBRA 1T1RA 5G4KB 3WQQA 4BNLA 3ROPA 2PZLA 2FN7A 4UVHA 2D59A 1X1EA 4IS2A 2VUTA 1GV1A 3IJPA 4O1MA 4J4BA 2OORA 4Y98A 3V1UA 3EW7A 4HWKA 5LDHA 3NUGA 1GTMA 2PGDA 4E2ZA 1UDBA 5HRUA 3IJRA 2BFMA 4PLHA 1WDMA 1F12A 4J7UA 4WASA 3BAZA 4E2YA 3H7AA 3RUAA 3H65A 2BGMA 4WLVA 3ONEA 4J9VA 4YT8A 1KIFA 3RC1A 1DO8A 4CMIA 3CZMA 5T64A 4L74A 3TOXA 3GFGA 4GI2A 1M6HA 2CFCA 3O8QB 5TT1A 4CMGA 5L40A 1I0ZA 3AM3A 4BKOA 2C5EA 4GAEA 3RBZA 5CEJA 4I9UA 3JQAD 3AOGA 1NHWA 2QIOA 2GN8A 5L4LA 5I9LA 1NVGA 1GPDG 4IGEA 1K2WA 5HA5A 5L4SA 1E5QA 2RH4A 4K6FA 1QSGA 3LLVA 4M86A 4OOFA 5LC1A 4JN6B 4DREA 3ZCXA 2J3HA 3DOOA 4DPLA 4KUHA 5IDWA 3RFTA 2I3GA 1A72A 1YB5A 1W8DA 3WIEA 1NNUA 3OQ6A 1DXYA 1D4FA 4TMFA 4WOJA 1KEVA 2ZIZA 4KDFA 2J3JA 3VH4A 3ZW8A 1SC6A 1KVRA 2PZJA 3ANNA 1DLIA 3BMNB 3GNTA 3DHYA 1R4MB 1GL3A 1NPYA 1JKFA 1DRVA 4BNGA 1GEGA 5JCJA 3COSA 1YDWA 3O38A 4K26A 4BV9A 3MOGA 1PS0A 3ABIA 3I9KA 4NFSA 2YUTA 2AG5A 1HE3A 2I76A 2PK3A 4IJWA 2FR1A 3GNSA 1NVMB 5DNAA 3CIFA 1F06A 1VI2A 3RU7A 1HE4A 3INRA 3U4IA 3OETA 4I9HA 1YBAA 5KVCA 1HE5A 1EVJA 4FW8A 3OHSX 1JAYA 3KB6A 2VCYA 2YHIA 1WDKA 5C7IO 2EF1A 1SAYA 4J2OA 4P22A 4LVUA 3F47A 3FWNA 4MP6A 2VNAA 3BZUA 2EW2A 3RI3A 4HY3A 1XQ1A 4BNZA 1XQ6A 5L7YA 4BB6A 1DIRA 2PNFA 5AOVA 2OGUA 4OQYA 4BO2A 4CR6A 3I9OA 1LRKA 3JTMA 2P9GA 4N5MA 4GSKA 1N9GA 3QA9A 3B1JA 1UP6A 4I5GA 4PLGA 5JE8A 3O26A 3HADA 1R15A 3EZYA 4Q3NA 4BO6A 2AA3A 4DMLA 3WBBA 2RAFA 3I9MA 1L7EA 1UAGA 4QT0A 3X2EA 4RPJA 4AFNA 3WBFA 1H2BA 4C4OA 1JN0A 3E82A 1E7MA 4BKQA 4IJUA 4BNNA 2AMFA 3C7CB 4FS3A 3NTQA 2PZKA 5IZCC 1CWUA 4MVJP 1KY4A 1HDGO 2I66A 1C1DA 3KRTA 4J3FA 1HL3A 3HUDA 1LX6A 1GFSA 3SJUA 1XDWA 2D3TA 3C1OA 4NBWA 1JAXA 1B15A 4B8WA 2X58A 4CUJA 5COAA 1VL8A 1MXFA 3TDKA 3PLNA 4PLPA 3TZCA 2PZMA 2FSVA 2C07A 2HCTA 1KYQA 5CHEA 3KEQA 4NJMB 5A1TA 3U09A 4FOSA 5IDQA 2J5RA 2V6FA 1XR3A 4HP8A 3GVPA 1SZJG 2X7HA 3ZWMA 1V3UA 2JFGA 3VAZA 3WNQA 3CUKA 5BNTA 5B4UA 3KM0A 1P1KA 3DBRA 3B20A 4B4VA 1P1JA 1BRMA 2UUOA 1Q0LA 3QRWA 3CXRA 1LDNA 3JQ7B 3PTZA 4PVDA 2CY0A 2PWZA 2O3SA 1T26A 4NJOA 3UHAA 1ZSNA 3H3JA 4K1LA 1YB1A 1PL6A 1XEAA 3DFZA 2GCGA 2OHXA 4NPCA 4DLBA 3AUSA 1A9YA 1EBUA 4Q3AA 3AOEC 3BMOA 3RAJA 1WZEA 3VC7A 3KETA 1B3RA 4RV9A 2C0CA 5KJEA 3O03A 1IY8A 1J5PA 1OZAA 4N18A 3UOGA 2PKRA 5BNIA 1CJCA 3S2GA 4PLWA 2CMDA 2Y99A 1HTBA 1IHYA 1YJ8A 2BI7A 1KOLA 3JD4A 4B3JA 2QW8A 5DZSA 5TC4A 1ZFNA 2X6TA 4AICA 3JYLA 3ASUA 4CL8A 1GZ4A 4I5EA 3BYZA 3JQAA 3WXBA 4MKZA 2GASA 3MJSA 5AXCA 3UCFA 2FHSA 1KEWA 2I99A 4H16A 5KKCA 1I10A 1I24A 2Y1CA 1LC3A 4KWHA 1ZJZA 4J7CA 4KOAA 1VRWA 3HHPA 4DPKA 4L75A 3IIEA 4OM8A 2IXAA 1D7OA 4XQGA 1R37A 3A1NA 3GRKA 4Y6SA 3ROMA 3FI9A 4TZTA 2FPIA 1FDTA 2OMEA 3P5SA 3ENKA 5TJ9A 1KC1A 1PX0A 5JAZA 2IZ1A 1DHRA 4D42A 4CM4A 3AU9A 3GZ4A 1SOVA 4II3A 4U0KA 4YJDA 3NX4A 4J9UE 3DZFA 1ZEJA 5DN9A 1GYPA 3ZHXA 1M67A 4CMEA 4WCFA 3BTUA 3GG9A 3JYPA 1B2LA 3U9LA 3QLJA 3JYNA 3R1IA 4E5KA 3WGYA 9LDBA 5G4LA 4AJEA 3ASVA 1U3VA 1Q0QA 3FNFA 1E3EA 5BSGA 3OM9A 4E3ZA 1C3VA 1NTOA 4Y67A 1ENPA 1XG5A 4EZBA 5C7LO 1O6ZA 5KWEA 2OP0A 3QVXA 1LBEA 4WJZA 4CLRB 4HUJA 3LC1O 2PR2A 4BGIA 4GWGA 1PL8A 3TZQA 5IDYA 4BO7A 3PI7A 4U6SA 1D1SA 3MTGA 4TWRA 1H2HA 5I7FA 3I6IA 1GZ3A 4XWYA 2FSSA 2PY6A 1CRWG 1DIBA 3Q2KA 1IULA 2EW8A 3QE3A 1U2GA 1LDGA 4D45A 1LRJA 1SEVA 3TSCA 2J5KA 2HMUA 4DLLA 3IP1A 1I36A 3QVSA 1GYRA 3EHEA 3T7EA 3WG9A 3QVWA 2G17A 1B8VA 4FOOA 3GC6A 1DJNA 3AUAA 4H3VA 4TKMA 3U4DA 1G0NA 1OC4A 1ONOA 1ZSVA 5G0VA 1IHXA 4JP2A 5I9MA 1PJLA 1KVUA 2AQHA 2EIHA 2FR0A 4PZDA 4L4RA 3WX0A 1MG0A 3BTOA 3I6QA 4DQXA 4N7RA 4J1QA 5G0WA 4IY1A 4BKRA 4CPDA 4PG8A 3PHIA 1KS9A 1Q7BA 1RKXA 3LC2O 3ZV4A 5IZ4A 2XXJA 2Y66A 2OP1A 3FNEA 4WLUA 3FPCA 3GRPA 3INGA 3GEGA 3GPIA 4WCDA 4RPKA 3GVHA 1HT0A 3NT2A 3EY4A 3JD1A 4I5FA 1CYDA 4J1TA 1DFGA 4ZQHA 1Y6JA 5L7TA 1ADBA 4CMCA 3ZI0A 1Q2XA 5IFLA 3H6KA 4R5MA 4O0LA 4WUVA 2RCYA 2CF6A 4MP3A 1IZ9A
chains in the Genus database with same CATH superfamily
5DCWA 2D8MA 4WXRA 4CMKA 1DAEA 5JXJA 1ZXBA 1A4UA 2JEZA 1MB4A 1J56A 3TW0A 5CAEA 1EDOA 4E15A 2RHTA 1TA4A 4LYDA 1XDDA 4QNNA 5A7FA 4W1QA 3V8BA 1MO6A 5TV2A 3IALA 1YJ5A 4PV7A 4PSCA 4RPCA 4LFCB 4X85A 1NW7A 3E2PA 3RS4A 3RSZA 3TIXB 2RIRA 1AKTA 3CUYA 2P9YA 3CQ9A 3ZHQA 1WPQA 3HA2A 2H17A 4DQVA 4TSFA 3L43A 1ONPA 2W8BA 1HZZC 1W4AA 4CXMA 2EJTA 2J7PA 2MIIA 4B7AA 3UHJA 1XPRA 3CMMA 5GONA 4XB2A 2Q5OA 4Z4QA 4EY7A 4PICA 1P31A 4D3FA 2OZKA 1A2BA 1JR2A 1ZH8A 4I4TA 4RTOA 1FP4B 2GAAA 1F2TA 1FNDA 2XE8A 3QLTA 2QTLA 4FPXA 4MEAA 4RDIA 1CDOA 4O3FA 4PYOA 2VLBA 5B1DA 5L3ZA 4BNVA 5AKHA 5ESRA 3DOFA 3HE3A 3F1LA 3JZIA 4JGBA 4BQOA 3IKVA 1VPVA 2X2FA 1P2DA 1C5KA 3FM9A 3RM3A 3KTAB 5BSUA 2XBLA 3ORFA 1VL2A 4RVFA 3AF5A 5BMVF 3BB3A 2R2GA 3FCUB 3TX2A 4Z8YA 1SCIA 3MOSA 1G5QA 4GIBA 3B9QA 3X1YA 1F4LA 3UW3A 5K6AA 5FPPA 5F2NA 2LCQA 1XU7A 4L3OA 1N9KA 1LSOA 3NBYC 1KDOA 4C14A 3AHGA 5BSEA 2GJ4A 5CB4B 4MVJF 3NFRA 3PUJA 1SC9A 4ITRC 1V1MB 1BJRE 2RSLA 2JFXA 1GRNA 1N75A 4ZYYA 3QVMA 4KLNA 5CFOA 3CR3C 4BZXA 1QF6A 4LI3X 3NHWA 3EMKA 2GD2A 2GM4A 3V7FA 3WJ1A 5H83A 2X2OA 5KSWB 2VPZA 2W7TA 3F78A 4RQTA 5HUJA 5DGXA 1G6KA 1UDXA 2ZJYA 3GLHB 1IRXA 3PLRA 1QFZA 1UK7A 5EP4A 5AD1A 3COPA 5LOVA 3R5TA 2DM6A 1R9NA 2A5LA 3EVZA 5BWBA 3GQVA 1OFGA 2WSYB 2YQZA 3CLTC 4WERA 1SXQA 1U7XA 2BEWB 1T5SA 3KSZO 3NHRA 2YFYA 3UYKA 1G20E 1GQRA 5JXIA 5M2QA 1C30B 1F0YA 3CRZA 4KNYA 2AYZA 4MGZR 4FB5A 4MYSA 5ADHA 4FK8A 4WOCA 4Y6GB 3OP1A 2YWCA 2NUBA 2W2KA 3NHKA 4LWOA 2DJ5A 1MZPA 3U80A 3N5CA 1M8KA 5JADA 1XRLA 3QIAA 2QD2A 2UYYA 1MP0A 3FVTA 4WINA 1G20A 4IDHA 4F4JA 3C3JA 3MGBA 2DR3A 4YMGA 3LHFA 4UBMA 3H9BA 1NJFA 3NB0A 3TW8A 1FVOA 3EWIA 3E58A 3SEFA 2QMEA 1SIWA 5H81A 4GWKA 5KX5B 1EFCA 3IVXA 2ZXUA 2Q50A 3NMUF 5BVGA 2JLYA 3Q7PA 4N5DA 1U2RA 4B8YA 1N5KA 1ZMXA 1NXQA 2ATCA 5JH7B 1RXVA 1O4VA 4X94A 1Q12A 4JQSA 1SUFA 4YCBA 1YZGA 1ADGA 4P36A 4EPVA 3KYDA 2VQFB 1N36B 1Z0IA 1PRYA 3LJKA 5J2UA 2JI6A 2W8ZA 4HB3A 5KJ1A 3NRCA 4JL5A 5JWHA 3JAKA 1KBZA 1SD5A 2OOKA 5F21A 2HXSA 3SDBA 2BFEB 1L1RA 3GFOA 1V11B 1YRYE 1U9CA 3W5UA 3R24A 1AKVA 4MA0A 1W75A 2P77A 3WJ7A 2P62A 4AJPA 1SHZA 3ACDA 1XTBA 1CHDA 4YB8A 3DEAA 1DKMA 1QRSA 3RF6A 1IPFA 3USES 4PVCA 5E3IA 2XYVA 2GCEA 2JGDA 3LWBA 4X3OA 1WAMA 4FFNA 4I55B 1DINA 3CLHA 3ETCA 4NOLA 4R9UC 1IY0A 3OSZA 4O4LA 1FDSA 2AMJA 3EOAI 3QITA 1Q1AA 3K5WA 4UVIA 5F7ZA 1VG8A 3AETA 1M8JA 3ZCTA 2C7BA 2D5AA 3QXSA 5EWMB 1K0UA 1F48A 1QYDA 3PUIA 4N1AA 4UXIA 5JBQA 3ICWA 5KI6A 3HFJA 3P19A 4JJFA 2WD7B 5CTJA 3LY9A 5JDIA 1LNZA 1MC8A 2VAWA 1YB2A 4HBGA 2X1MA 5JFTA 4U02A 1AQNA 5C34B 1QLJA 3JARB 4CETA 1NQOA 1ATZA 3DBVO 3IPLA 3LFUA 1H5QA 4RCZA 4DGQA 2YH2A 3UICA 2CBGA 4AURA 3PNPA 1GXSB 4OYLA 4Q7LA 2QQ5A 4RFVA 3W7VA 4F0JA 5T4EA 1XU4A 4P7KA 1FDUA 5ENDA 2PUHA 4AN1A 5JXHA 4BMPB 2R1TA 3KVNA 5CDTA 3LUHA 3AL2A 4MMZB 3KQHA 2WIBA 1QYCA 3MGCA 3VMFA 3TFQA 1G3RA 2OKGA 5EZYF 5JCJD 1N8TA 1XRSB 3KEOA 1MAWA 1XFDA 1JDZA 3AKZA 4JYPA 1ZN8A 5EE5B 1N7GA 3FI0A 4I14A 3D54D 2ZM6B 1EP2B 1ZXXA 1FLNA 3A27A 1JDJA 2FMIA 1I01A 3I39X 2BGGA 3VZCA 2YXNA 2YHIB 2RGEA 3PDIB 1E96A 2F3QA 1T8YA 2O2XA 1D7AA 4XFKA 5DM60 4C4AA 2FYTA 3VFDA 4FCTA 1D1PA 3HK2A 2V54A 3WGZA 2I9PA 2GN9A 1QHHA 2X0RA 4DJAA 3F3SA 1WUKS 3LIPA 4LDAA 2AN1A 1Y8QB 2X5OA 3B9PA 2QM7A 1XAIA 1B1AA 2RK6A 1GWNA 1PNVA 2DOKA 3DLCA 3I5MA 3IQDB 3QMMA 4PHFA 4P4GA 2PLNA 5C8VA 5SYAA 2Q6TA 1D0VA 1S7GA 1L8OA 1DG9A 2ZRDA 1RRCA 1UJ2A 2XNCA 1M2JA 3WGIA 1ACJA 3UJHA 3STWA 3OKAA 5GPBA 2QRGA 3FLAA 3WFIA 2Y1DA 1JHUA 1C14A 4DYHA 3MT7A 1NI4A 1ZRSA 2Z6VA 3NNNA 2NW6A 3NJ4A 1H6DA 5J47A 4DIMA 2ZXFA 1E2DA 2Q7XA 3TMKA 4DW8A 4G0UA 4AUMA 5C8YF 2XVYA 5JAPA 3KQUA 4IMRA 4MYTA 3TRJA 3V3TA 4I50F 4N0QA 4OHVA 4KR0A 4CGZA 5AFSA 5JMOA 2JFPA 1C1DB 3L8ZA 4NR0A 5IVIA 2WUWE 1UBUS 2F1HA 4OI2A 3A3PA 1XF1A 2VDWA 4BB9A 3NUZA 4M54A 3C7AA 1OQAA 4RLQA 5G41A 1H2EA 4WACA 3LBIA 4R2JA 1JBQA 1JLKA 3C74A 4W82A 2Q5QA 1CB0A 1GUYA 4FSHA 4QASA 3G82C 1XMPA 4D0RA 4WKPA 3UK0A 1JEYA 3KZCA 1HE8B 4EFKA 3CY6A 3MOIA 3L7AA 3OHPA 2G5GX 2WVHA 3HVHA 1DQYA 3BUSA 2JHCA 4A8PA 4CTMA 1I0IA 1A7JA 1P9NA 1HYQA 3ZHZA 4IEEA 3F97A 1OKKD 2G0TA 1U1DA 1FUKA 2ZT7A 4DRYA 1QKKA 1E6UA 1HUQA 4FIZA 1ZNWA 3LP5A 1NBOA 4KVAA 4ARVA 4EG8A 1D1TA 1UFQA 4ZO4A 4F8YA 2PUFA 2A9JA 4Z7QB 4EF5A 1BCSB 3QV2A 1CV2A 1FU4A 5HKAA 3VVMA 4LQCA 5FBHA 1N9ZA 1YZLA 3IUYA 1RI5A 2DUNA 3ZK9A 5K6RA 3FPGA 4ZCRA 3ESRA 1ZJ6A 4PZYA 3TTSA 2V1UA 4NDAA 2RBKA 3X1WA 3DGFC 4YV1A 1XHLA 4P9NA 1U2EA 4FZJA 3D4IA 3WL6A 4BO1A 2NGRA 3ISJA 4IIGA 1OBFO 3IMGA 5REQB 1S2NA 4DE5A 4CMEC 1LLQA 3PEVA 2OG1A 4CG3A 4LE2A 2QZZA 3HO1A 3PC8C 2D0OB 3Q7RA 3U7RA 2MTBA 1ZK3A 3GFQA 1E0SA 3OQBA 5THKA 4C0QC 2POCA 1BN7A 1T2DA 2Q2VA 2XE6A 4WI1A 4R01A 5ECGC 1QYRA 2XB8A 4PFSA 4F5DA 1G8HA 1RRKA 2HO5A 2JJQA 4GZLA 4MS1B 3GLQA 4F6CA 4UJ3A 2AXEA 3H16A 3HR8A 3IHKA 2W6JD 3OWHA 2KM1A 3HA7A 2QU8A 2H4ZA 1SVUA 2IY8A 1PT9A 3OX3A 1MR3F 2A4MA 4HFJA 4RSMA 1DV1A 3OOEA 3AJRA 1R2QA 2OFFA 1A8IA 1Q3HA 3HP7A 2H1OA 1Q1NA 5FOQA 1GTSA 1T2UA 2H5JA 2EGHA 3ZW7A 3MT0A 3BDVA 1DAFA 2VWQA 2MSWA 2OL4A 4W5OA 5JRDS 1LW6E 2PS0A 4TTPA 3LLUA 4EF6A 4A5OA 2OCGA 4Z3OA 4N39A 2GPNA 3T1QA 3ZGVA 1JA9A 1ZONA 2H1VA 1W6UA 5B1HA 2HGZA 2IIVA 5TPZD 3ST7A 3LW8A 3R5KA 2Y1FA 1DPGA 1U2GC 3UH1A 3HMQA 1KO4A 3GT4A 1Y3FE 3OCWA 4TXJA 4E32A 3OURA 3QNWA 2AZMA 2XCSB 1Q21A 1D04A 2B4TO 1Q92A 3AF1A 4B33A 3JATA 2UVQA 2WSSD 3GQBA 1K3UB 5A4JA 4PG4A 1OAOA 1X1AA 2QZ4A 5ECYA 1GQOA 2I65A 2N1BA 4UHFA 3U39A 5LNK6 1KYIA 4TQ9A 2X41A 4Q1FA 5BOSA 2E18A 1W5EA 3K4PA 1X70A 4QPPA 5E1OA 2XJ4A 1GFWA 1VJTA 1V45E 3U0BA 5EP3A 3QWAA 3L7DA 5CA0A 5BSHA 4I1RA 1R4AA 3H75A 2ISQA 3PC3A 3SYLA 2YWHA 2XWJI 5JZOA 3O4FA 1SPBS 1UBHS 4Z4CA 2Q6KA 4U00A 3RHFA 1FOEB 3DHWC 3TIVA 4H4EA 4HEA6 2Q6IA 4EBFA 5C1DA 1M2VA 4BFUA 7REQB 2UUCB 1N0WA 3DDCA 4FFRA 4P31A 3MMPA 3D81A 2FR8A 2XW6A 4KXVA 1OLOA 1A3CA 4IV5A 4ZREA 4L8VA 3HCFA 3LWNA 2H63A 5KVQA 4J1TC 5TRTA 3ANTA 3T15A 1C0IA 3ZWDA 1MO4A 1YOVA 2YZ7A 2ZANA 3CNLA 1WXDA 3OZSA 2IEBA 3WZLA 3SKYA 4OKSA 2MINB 5EWJA 1EJBA 2J0QA 4HFRA 2H3HA 3A2KA 1HT2E 1YKFA 3LTEA 5CG1A 3ABRB 4OHKA 1RBZA 4QQRA 2BDEA 4QOJA 4ASUA 4GLFA 2GJ8A 1LPNA 3FFXA 4G5HA 2YY5A 1E7YA 4EJ2A 2JLVA 1SKYE 4LHSA 2GNOA 3K7EA 3KJNA 5HQTA 2VCHA 4HVAA 5EUMA 1P81A 3F67A 2PKCA 2VDNB 1ZD3A 1DAHA 1TYEB 3WNZA 4YPVA 2Z1NA 1RM3A 1U28C 1Z2OX 2HU2A 2VHEA 2Z8XA 3AVOA 2NMVA 4S1OA 4MWCA 2HTEA 2J9RA 3NOQA 1O5IA 2RHLA 1YHYA 3DCYA 3P94A 5LZ7A 4BLPA 2EKPA 4TRRA 8MHTA 1QMGA 2F3SA 1VE6A 2GPTA 1OTHA 2C4NA 1NUUA 1OV6A 1Y48E 1SWVA 1K8RA 4PQGA 4CLEA 2P9EA 2Q1YA 1T8PA 1O57A 2O6LA 2DHRA 5FWDA 3RTEA 1DKLA 3CCBA 3SSMA 4CCWA 3AVXA 1PL7A 3QKSA 4CN8A 3CFYA 4HT3B 1JT2A 1H3EA 3PD7A 2P2NA 1QV7A 2K7ZA 4HNQA 1MQAA 1EVQA 2V6BA 2I6XA 2RONA 3CZRA 4GI5A 2ZZNA 5M3BA 4GZ5A 1FTNA 3EPKA 2KPOA 3K2BA 1WPRA 4IEIA 1ZD8A 3NM5A 5L3SA 3NGLA 1PBNA 4KSBA 1H5UA 4FM9A 3LKZA 2I78A 3NHUA 3F98A 5A4MS 4K2AA 4KQ2A 2FWIA 1L7AA 5TF4A 4DWVA 3DMGA 3O2SB 2VSOA 1POWA 3OKFA 4L95C 4EOGA 2FPGA 2AL7A 3A9VA 3PQ3A 4K9RA 4ANFA 2VRNA 3C97A 2NO9A 4AC9A 2DP4E 4LSGA 1QKJA 1JFRA 3B2QA 2P3QA 3I12A 4ZZ1A 2BZSA 1E2NA 1S2DA 2XUQA 1WB9A 3NDRA 1D1QA 1P4AA 1OKKA 2CLOB 1V8FA 2EZ8A 4ZZ2A 3CRRA 4CCSA 5CAEB 4P0PB 4PPNA 4UFNA 5HJ7A 3ZDAA 3MJCA 4LUCA 3TRIA 1LLDA 2YOHA 2ZOSA 1OWNA 1RYEA 1T2AA 3MWDA 4FHCA 2BR5A 3KJZA 4LOAA 3SYRA 3ACBA 1BS2A 1VE7A 4Y1GA 3GFPA 1P5HA 3KU1A 4NULA 3FGPA 4ABTA 1W5TA 2RJ3A 3OFNA 1M1ZA 1BEEA 3E8XA 1PG2A 2A5GA 2ZB7A 2H92A 3KR1A 4U8HA 2W8BB 3DDOA 3V4RA 4NG5A 5DEIA 1W5BA 3DVAA 3NOOA 2AYXA 2NV0A 3PQ5A 3AF3A 3TLEA 5A9SA 5GONB 5MN5A 3ED5A 1OTXA 1V41E 2IPOA 1A7AA 2QRQA 3MHPA 5DTEA 3R0VA 4I4TB 1JWAB 2CJWA 3O3MB 5T3YA 2DECA 3GF4A 2PRSA 4FOPA 5KCZA 5TE9A 3D2AA 4J0EA 1GG2A 1Z8DA 3K30A 4CU2A 2EOAA 2Z4RA 1GILA 1DRWA 4QUGA 1A8SA 2ZDHA 2XGMA 3FCSB 4E2FA 3EE6A 3TNYA 1BSVA 4O4IB 1W76A 5TQJA 3THXB 4GP6A 2W6JA 4B7UA 4CQNA 5HJ5A 2XDYA 4XASA 1P4GA 2O14A 3DE3X 2OZEA 2Q5EA 4LVNA 2HA3A 3HZOA 3MUOA 4DSOA 4EUFA 4CIBA 3ZDDA 1M1YE 3FGNA 1HQCA 3A9SA 4JD5A 4KXMA 4WKOA 3DMHA 3DS8A 3WFZA 1C9KA 1DNPA 1UQUA 2G40A 2IU4A 2GCPA 4NPHA 4ZAVA 3NTLA 5A4FS 2YZ2A 3OKPA 3MTQA 4C1BA 4GHWA 4ENPA 2Z4SA 3OTIA 3HVIA 5TPZA 2NU7A 4GLLA 5CIQA 1I80A 1PFWA 2B5VA 2HSWA 4FYMA 1W6RA 1M1YA 2PSJA 1FFEA 3B6KA 3OU6A 1Z45A 3BIFA 4FBGA 4WECA 2OPHA 2VWPA 4TVSA 4DXHA 2VBIA 3A9UA 4MWGA 2C54A 3NALA 5LOVB 2WSSA 3H4VA 5ARCA 1CF4A 4ZJYA 5KDDA 1JMYA 3NDIA 1C2TA 1R6TA 2Z9BA 3KSBC 3WIUA 5LLTA 3HYRA 5BW8A 4BAGA 3C1AA 1V95A 4L6CA 4B3BA 3HYNA 3B3AA 3R0XA 2JLUA 3JZDA 5KPJA 1TQ2A 3AJ9A 4RF3A 2XDQA 7GPBA 3CLVA 5M04A 4YV0A 2BEKA 4F2WA 5CXQA 1TADA 5DP2A 1OT5A 2W2KB 1KA9H 4OQNA 3SIXA 1IM5A 2JGLA 2PS3A 5IAGA 2XUHA 1EA7A 2QD3A 1F6DA 4Y30A 4YAOA 2ZYTX 3HB7A 1LSUA 4ESEA 1VKHA 2P1RA 4TM8A 2GPJA 1AHIA 5IJZA 5ICGA 5JDIC 5K8JB 4IHQA 2V0GA 3WGOA 1NE7A 1NRXA 1QIGA 1D09A 1A95A 1YCDA 3FSGD 5D3KA 5HILA 2VAMA 3F5SA 1PFKA 3TW8B 1DEXA 1KARA 3H11A 3QWFA 2H0QA 4EX7A 4CMJA 2CL6X 4QGSA 5TF0A 5BYKA 5BVGB 2FW6A 1RE0A 1N6PA 3HKBA 3QVUA 2A9KA 3QX7A 2WYWA 2FZWA 4CTOA 1UAYA 4JLNA 1A5BB 4U2GA 1ZJJA 4M83A 4Z1OA 1E5XA 1XV5A 1ZVJA 4Q4HA 1UP4A 1V8BA 4UULA 2DETA 3ZHSA 3GJ8A 2VIIA 3NQ41 2XMZA 1DLJA 3RBVA 3JAKB 3P4YA 3PD1A 4EZIA 4RACA 1PJSA 2QUZA 4RVDA 1IATA 3SHFA 2I62A 2R5WA 1DCFA 1NRIA 4M49A 5ANRB 5CDFE 4JOSA 2XF8A 4OEHA 2PUDA 1GHTA 5G1OA 1WO8A 2EFCB 3BREA 3A7EA 4DWJA 2XUAA 2ZTUA 4W5WA 2R8RA 3H9EO 4QTZA 5KAMA 3ZK8A 4BMOB 1P62B 4URVR 4BC0A 3TUZC 1OH6A 4H17A 2JGDB 2LXNA 4P33A 1IBMB 1DQPA 3W1VA 5CDFA 1EFAA 3VDMA 5IHXA 3BX1A 1XZMA 3FKQA 1OUMA 3KOUA 2ORVA 4O4LB 2ZI9A 1P1RA 3AETB 2QJWA 2VJQA 3AR4A 1GG9A 3L0YA 521PA 1JR6A 5EAIA 4LFBB 3ROQA 4S0XA 4DV2B 3ANYB 1XXHE 4DSNA 2GAJA 2J9FA 1RXUA 1WG8A 5HDQA 1M6VB 4TYYA 1ZZGA 4JJIA 3D4NA 4LOHA 4I66A 1N6KA 4HFMA 3VKWA 5B6IA 2ORYA 2XTAA 4FGWA 4CIAA 3ORRA 2DQSA 3C8ZA 2JLWA 2J5QA 3KR9A 1CLUA 2ZJ6A 2BDUA 2JAXA 3LRXA 2ZYIA 3QU5A 2QYSA 5JAQA 3WFJA 4DCGA 3U5TA 1XXHA 1E3TA 1T9HA 1G5TA 1FTQA 4U39A 3UB4A 2RH9B 3VPHA 2LZ0A 2R1TB 2AR0A 3KSRA 1W581 2XQJA 4IUDS 3K09A 1I4WA 1XTVA 2DHCA 2FEPA 3JR3A 3MMZA 4IDQA 3AGQA 4M0MA 4RIGA 3FTNA 3H2SA 1F8FA 3T1NA 2FQYA 2PJZA 1SIUA 1LJLA 1W49A 3I5UA 3IAUA 4NECA 3TIIA 2VJAA 2Z1MA 5LPNA 1UR5A 5DPMA 1GPLA 3OE1A 4BTEA 3LS2A 1R8JA 4LDQA 3QEAZ 2AMYA 3QLUA 4ENVA 1MAUA 2XYHA 3K9BA 4D92A 1ZGZA 3KDSE 2TECE 3D7NA 3T1OA 4QDZA 1X3SA 1LF0A 5DVZA 4P2BA 1GLNA 1MXHA 2FP4A 3BD9A 2DFDA 3I04M 5AI4A 3T06B 4YAEA 3A4IA 3EEOA 1KS2A 4OHZA 4KV7A 4QGGA 3LA6A 3K1AA 1WXEA 1EUCA 3GJ6A 3GEPA 4PFKA 3S6JA 1QK3A 1FSPA 3DAOA 2O2SA 3VNQA 4F3TA 5GZ6A 3EB9A 4D9KA 5IVKA 3ELWA 4LZWA 4WOBA 1JNYA 3QZUA 3GRUA 3O1IC 4LZNA 3D43A 3GIWA 3KSAC 1AS3A 1TMGE 3SHTA 4GKBA 5JSZA 3OJOA 2EYQA 5COBA 1J9GA 1B0AA 1VTKA 4ZRNA 3RSSA 2D1RA 3UUEA 4EYSA 1JX6A 4BNMA 3FROA 1ITZA 2OORC 1OW3B 2YX1A 3KU4A 3PJGA 2CJYA 5F9HA 2BF4A 4GR4A 3I6YA 1E92A 2PX0A 1FU7A 1DELA 2I3ZA 1OPRA 1JG3A 3USZA 4C78A 2BJWA 3DLTA 4BE7B 1WL8A 1T5TA 2F8LA 4L7QA 2VDWB 1US8A 4JJAA 3ROGA 2QS9A 7MDHA 5JS1A 3KHUA 2FW8A 4D25A 4MV9A 5PNTA 2R48A 3ZY3A 5F5LA 5EE1A 3PXXA 4A26A 3UK2A 1JEYB 3NRJA 5DM70 3WL4A 1UPAA 1ZS9A 2ZCUA 3KFVA 1E3IA 2Q3HA 3ZHBA 4C3VA 3QOFA 4ZYWA 4XWKA 4KRGA 2ZSUA 4DMKA 1CQZA 2QXYA 2GHTA 4UBNA 3RRBA 3E53A 4QQFA 3ZI4A 3TQIA 4D9JA 4ESVA 4JVNA 3AZQA 3F9RA 5EP1A 2JNWA 1U0TA 4MZXA 3RROA 2ZCVA 4S2UA 3G7NA 2YIMA 5LL6P 2NV6A 4IZOA 4PGHA 3RD5A 4DVGA 1Z7YA 3PNOA 3RASA 3KHKA 3EF0A 1D03A 4OXNA 2E5LB 3V80A 4KVZA 1RFLA 1V6AA 2GZ1A 4UAJA 3GI1A 2RGRA 3FYTA 3IT0A 3S55A 2ZUFA 1B8UA 2X8JA 5EZ6B 3D3NA 1OAOC 4RSRA 4QD3A 1ULBA 3KLOA 3VX3A 4KO1S 2QQFA 1ZK0A 5CGZA 2WKQA 2H5IA 3KXPA 4HFNA 4PW0A 3TM5A 4MGHA 4BBZA 2DUUA 5FJJA 3ROZA 4YAKA 4I1UA 5BRJA 3UTDA 3VU9B 2CGEA 1QJCA 5KWJA 1GUAA 1W0KD 2I54A 1VSBA 3W05A 1QRAA 3ZZ1A 1DAGA 4R6WA 1VIMA 1TCVA 4JB0A 3E70C 2VP0A 1CUUA 4NEHB 3FNGA 1TCBA 3HJTA 2OV3A 4HB0A 4RTLA 4OJTA 1UQRA 4CMIB 3C3XA 1KBOA 5FL3A 2B8WA 3E03A 1D2EA 5E6SA 1TCUA 4RJIA 4R8SA 1CR4A 4HH0A 4YECA 1JTVA 1JFFA 2RK4A 3GOHA 5KNDH 1A77A 1ML4A 1C7IA 1JQAA 1XNJA 4JT2A 4UPVA 1T34A 2I8CA 1U1CA 3NANA 4JI6B 2CK3D 1ETHA 3MAGA 1XXLA 4KGZA 5LR6A 4RJJA 2OHGA 2OENG 2A0FA 2IT1A 3NWJA 4FQ7A 2WWGA 1H8ED 1KVTA 4US0R 3ZX5A 5JO9A 2YJZA 1U9ZA 1W4CA 3RU3A 4L4SA 4LCEA 3PHJA 7YASA 5IJWA 4XCQA 4CTJA 5LBTA 1BX1A 3MS4A 5JS8A 3K70D 3JATB 3GQBB 4QARA 1PG0A 2I67A 1OC2A 4S2EA 3BCUA 2ZI7A 2OCYC 2WFAA 4JJGA 5BOSB 4F93B 1GTL1 4Z51A 3M1AA 1NIPA 2H52A 2PU5A 1NPDA 5JJCA 2H2GA 3JW8A 3PHCA 4GVPA 3SE7A 1W94A 3TLCA 4AW9A 1YV9A 4JP1A 3TTUA 5C52B 1PWXA 4OHWA 3AP2A 1T8TA 3EF1A 1HF3A 5KHOC 3INYA 3WAKA 2EEZA 3ULKA 1A88A 2E5FA 3MWGA 1S2OA 5BSFA 3TI7A 5F9FA 3PB3A 1RZ3A 3JAMA 1MJGA 3SHVA 2HUNA 1M2VB 2O2DA 3WHKA 3RIHA 1ECJA 1Y4AE 1UKZA 2B0JA 2C3UA 3F7OA 1P1CA 3M4NA 3ODPA 2NVWA 2CVFA 5AJYA 2Z2JA 4LE1A 1GRCA 2EZTA 2O0MA 5K03A 1NJ6A 2P9FA 4DIDA 2RGNA 1YOVB 4MHSA 3QEOA 5DHFA 1WXFA 1PEYA 3SBXA 1RWNA 3PPXA 4OBWA 1RI2A 5EWJB 2GA9A 2RHCA 2DFNA 2IYEA 2O3RA 2C2BA 3LM8A 4P3PA 5DNEA 1K4YA 1M2KA 1R0BA 2ZYDA 4H0FA 4MJ7A 3FDIA 3SSOA 3BT7A 3SK0A 2HBRA 4N82A 1J70A 4K6OA 4V0ME 2ZR8A 4EKDA 4RD4A 1E3QA 1HDCA 5K3BA 4I8XA 1OCEA 4JQYA 2PKYX 3GJSA 1JGTA 4KE9A 4KQKA 4MCHA 3TNFA 5HKOA 5AUQA 5I9IA 2AH5A 3EJ6A 3QTTA 1N6IA 4L9RA 4DCVA 4AS3A 3GO4A 2HA6A 5HMLA 2J0SA 3NHPA 3H17A 4UHCA 5DYNA 5FUVA 3FFTA 4NNJA 4V0MA 1NL3A 4IDFA 4N01A 3U26A 6ADHA 3BGDA 3HJNA 1OMOA 4WXMA 5AW4A 2E4VA 1WUYA 2Q3LA 5D3QA 2G09A 3QKSB 5U4QA 2YXPX 3CEPB 5HR5A 5ALKA 1UBOS 1SO8A 3A1TA 4GUDA 4NEQA 4OQEA 3AEYA 1QRUA 4LHVA 1D6NA 3FX2A 3GVXA 2YJ5A 5EMLA 4Z2YA 1ULSA 1GSAA 4YXFA 5BRNA 3PUXA 2C7PA 2C5HA 2XKJE 4LBZA 4XTCS 5L3SB 4MJXA 5IABA 2REQB 1Q5PA 2D1QA 4EY8A 1PBTA 4ENQA 1YZFA 1IOZA 2CD9A 4YPOA 1QU2A 3CR7A 5BN5B 3A2NA 3IUBA 3NDBB 2BE7A 4FNGA 2FPGB 1U3CA 1BXRA 1KC3A 2Q62A 2V6MA 4QYSA 4R2KA 4RD0A 5KHAA 2N0SA 3HN6A 3IXMA 4HLDA 4R1QA 1Y9EA 3UTCA 5HK9A 3LL7A 3AEZA 3NNSA 1T5BA 3SC6A 2N46A 1F17A 4PSDA 3N7AA 1EYZA 2BBSA 4OHFA 1YCHA 4QDJA 3C6YA 1BDBA 1N2CB 5TARA 1F2UA 3WP0A 2OVBA 5T8KA 5A4KA 5HYVA 3PZRA 3VTKA 2H2HA 2IX9A 3MAJA 1RQNA 4ZQGA 1V6SA 4PNZA 2PFSA 3DV9A 3N8HA 4HYYA 3VHQA 1MQ8B 2J3DA 4D9BA 1GU7A 3RKRA 2DAPA 4Q4DA 2DQYA 3R7WB 3D7RA 3IE1A 1P1BA 4K86A 3V4FA 3DVAB 4GP7A 1EINA 5A9SB 1QIFA 1WMSA 1XHFA 1MV5A 1RT9A 1ZH6A 2YRFA 3K6SB 4CV2A 3PQ2A 2CJWB 2MMGA 3MWJA 3QEKA 4N3NA 4NATA 3KKEA 1U8ZA 4JB2A 1Z4JA 3ZQJA 5DBFA 1I4TD 4PN7A 4RVCA 4L0DA 4Q7JB 3DOEA 4RPHA 1ES9A 5MN6A 3KYCA 1W0KA 1Z4IA 2CWWA 3GJQA 2BGLA 2ZB8A 2EG9A 1QLWA 3MN1A 4EYEA 2NO4A 5HOEA 4PQRA 4UNQA 1E0JA 3DZCA 3DPUA 3CN9A 4NE7A 3IYLW 4Q48A 2VYCA 5BR7A 1N57A 3QH4A 4MI9A 3TQTA 1B26A 2H2DA 3B6EA 3LPAA 2XUFA 1KAHA 2LCIA 3I4FA 1JLHA 4IQ4A 1JWLA 3D0QA 1TQHA 1LVHA 1SPXA 3HVRA 1HQKA 4BATA 1YDGA 2GN6A 1X7ZA 2J48A 2P2SA 4JLBA 5I7VA 3G9XA 4D9MA 2CK3A 1NMXA 2HQ1A 4FQ5A 4KV9A 1AUXA 1ESNA 4BB5A 1H8EA 3HFRA 1KYZA 3FUXA 3O74A 2Z2ZA 4F86A 1RIIA 1M1YB 2NVUA 2GWHA 2C5AA 3EVDA 3FUCA 4J4HA 4FB4A 3KXLA 1FFHA 2RI1A 4UVGA 4G86A 2PX3A 4BKPA 5BWMA 3O21A 1PW5A 1SVKA 2IV7A 4XQ9A 2AZDA 4FFBA 4OX9B 1Q84A 4WDRA 1OJLA 3EGDA 1FRZA 4RKRA 5G02A 4KQMA 3AWDA 2H7YA 2F1OA 1JA1A 1JMVA 2VT7A 1MGOA 4WW0A 3B1VA 2QE6A 2XDQB 3DULA 4M53A 1L7MA 2DG2A 4U8GA 3TLKA 1LVGA 1UBCA 4GOMD 1M0EA 1WCXA 3E8SA 3NIDB 4R51A 5B3JC 3DAGA 3VSCA 4UUOA 16PKA 1WWKA 2H5LA 2RBGA 2XMSA 2ZWPA 4NCIA 1XEFA 5ALQA 4XYLA 3WBKA 1ZVVA 4R71A 4QUDA 3BRQA 3K0EA 1OBOA 4P38A 2ZSIA 4LYFA 4EGAA 3IUSA 3KSUA 4L50A 1Q15A 1D2CA 4NWIA 4R3WA 3SXUA 5KX5F 3C8MA 1C3EA 2E6UX 3H4TA 4G81A 3H11B 1RQGA 5CCEA 4ZOEA 5JH7F 4PGFA 1X7WA 4EWLA 4G4JA 1BE1A 5IN5A 5AKKA 2R68A 1FTWA 4B3GA 1EBFA 1WZUA 3O8RA 1QHGA 1UMCA 4K9MA 4Q4HB 4PYMA 3CWZA 1ZR4A 2G5CA 2PS1A 4KQJA 1ECCA 2BSXA 4YJKA 3ZWCA 3BE5A 3N2NA 5I8ZA 2R44A 2WWIA 2CWDA 4MB0A 3F74A 4OLJA 3TNJA 1L3CA 2NG1A 1DVRA 4FJ2A 1Z8NA 2XVZA 1MF7A 2H9IA 5HKKD 5EY5B 1I5RA 2GKSA 5FT9A 4BPRA 1U2SA 1IU9A 1IB6A 3EQZA 5CPBA 3VVLA 4F3RA 1GZ5A 1HO3A 1SXHA 2HM7A 2HLNA 3QLUC 2FUG6 2F64A 3BXFA 2R1UA 4I55F 1Y4SA 4K28A 2EKDA 5SICE 3WWZA 3VV3A 3ZXIA 3JZAA 4JITA 4WIAA 3BH7A 1T2EA 1FU8A 3HJRA 3UVEA 4ACAA 1B8NA 3BZBA 1XZPA 4QU8A 2JAUA 4MI1A 4MYRA 5J4YA 4QBHA 3IEIA 3L9XA 3R4VA 3I45A 1PT7A 3ZV7A 1UM9A 1TIPA 1TO2E 5SY4A 4MVCA 4Y9RA 1Z5WA 1N6RA 2FKNA 2J9FB 2VDRB 3LQ1A 1SG9A 3TIGA 4E11A 3F3MA 4TTJA 3FMFA 5BWOA 2C98A 3KUUA 2A94A 3W5SA 1E0KA 2HJ9A 3URKA 4F1WA 1JPVA 1T91A 2WYUA 4CHTA 2XMRA 3FXAA 3NC4A 1IB0A 2AD1A 5FCDA 4P54A 2GR9A 1E1DA 1P77A 5JBIA 5DNYB 1NVBA 1XXHB 2VDPB 4JI5B 4GQBA 4BMNA 2JIRA 4J43A 4QXAA 3RIGA 3W8EA 2C1ZA 4IJ5A 5TS3A 1ORVA 1T2VA 2CFIA 4MDYA 3V6LA 3RVJA 2QDXA 1G63A 2XA9A 4KFSA 3RJTA 1NDUA 1PJ8A 2ARKA 2FUKA 2A35A 2P5SA 3M6XA 5DJ5A 3SQWA 1YJCA 3TLYA 3H05A 4DTIA 3DTVA 3AP1A 1D0SA 3IDSA 5JNVA 1GNRA 1DZIA 1X0XA 2WNSA 2IE0A 5A5DA 1I1NA 3DCIA 3LECA 4K8OA 2IIBA 5DTMA 1J8FA 3RLFA 4B3IA 3VO2A 4Q3BA 5JVDF 1F0PA 4MRMA 3RQIA 3MINA 2AUNA 4Y8VA 4BO0A 4EB0A 5FR1A 3ITNA 3TH5A 3BHJA 1G8AA 1A5TA 3G2KA 3WIVA 1YF3A 2FP4B 4GI1A 2JCSA 5K8TA 3GEIA 1XZNA 2UYQA 1NXXA 3KLPX 1YNSA 4OHMA 4X92A 4C5AA 4V0QA 4Y1FA 1U0SY 1LCIA 2PBRA 4GQAA 3CEJA 2IEYA 5JNSA 2BY4A 1JI3A 3G0DA 1KYWA 3LSYA 3K1AB 4U2CA 2JAQA 4KWIA 1EUCB 1TYDE 1U9YA 3QBJA 4MWDA 2G1JA 3V1TC 2NIPA 5LMUB 1WBDA 3RT9A 4KW7A 1GCIA 3UJNA 1XTZA 2NSJA 2XEDA 1QUEA 2BFCB 3CUWA 3E1KA 1FDOA 2P27A 4TV8A 4ND2A 3T3MB 3UUFA 3EW9A 4CHGA 4M55A 3ROKA 2WC1A 2VHVA 3TNLA 3RYHA 1VYTA 4E5UA 1T9GS 3G1TA 2GEUA 5JSZB 5MGBA 5EIOA 3ED1A 3U4MA 2DLDA 5A5GA 2R97A 3GUHA 1UXOA 4OGKA 2PZBA 2ZUUA 3A10A 4R9SA 2CZCA 2XB4A 1AHNA 1PLLA 2JASA 3RSOA 2B4RO 1BIFA 5TY0A 1SZCA 1TO1E 4AZ3A 2V3WA 4AKTA 4LCBA 2NU9A 1EDZA 1WS6A 3WQHA 5JIBA 1PKEA 3UMRA 4X3PA 2QPTA 1US8B 1G8JA 3ESQA 4QSHA 4DANA 2EXXA 1EKXA 1PGQA 1DDOA 3CEHA 3EC1A 3L79A 3M4YA 1AA6A 1P9LA 2D5BA 2VDKB 2P4UA 1ZGBA 2Z5FA 2V3CC 5HFAA 2J32A 5D7NA 3PFHA 3T7TA 2W58A 3ZIAD 1WVMA 1JE1A 3PCRB 5CNMA 3ZDCA 1M2GA 2H2FA 4BCDA 1ZGJA 1V7QA 1RQ7A 4BFZA 1PGPA 4QNRA 3K0AA 2QJOA 2AEMA 5FOXA 3AEKA 4HMOA 1FLDA 2XIJA 3QE4A 4NZNA 5EJIA 2E5WA 2PHZA 3MXTA 2ZE5A 5EMKA 5TMDA 3VYWA 4EHNA 2ZJ5A 5EJMA 4C7KA 2J08A 4R5HA 3N74A 3X2FA 2QZSA 5J4LA 4W5RA 1R3UA 1GRVA 1Y3HA 1YRWA 3D8NA 4LTDA 4AIIA 4LA4A 2ABWA 3BFJA 1JLSA 3QQPA 3QFTA 2DBYA 5BSWA 5A05A 1O89A 4N65A 1R1DA 1XCLA 4GOJA 5K0SA 4TMKA 3ZVMA 3TVTA 2I80A 3ZVNA 1G3IA 5B58C 2Z30A 2H3EA 2WT4A 2HCRA 3FF4A 4Q3CA 4I1PA 1PFVA 4Y9DA 3DGEC 4TL8A 4ZEVA 1ISMA 5IKEA 2ZKIA 2AEFA 3PNSA 3ZU3A 2PZFA 1XT6A 3GR6A 1JEQA 2VEDA 2NNLD 2X8JB 4PPGA 3V8RA 4E22A 1Z5VA 1EVLA 1F9EA 4DY4A 1P75A 4R68A 3H6HA 1WU7A 1ESCA 4C0JA 1LDEA 2D0IA 1O2DA 1QGOA 4KXXA 1Z29A 3RNLA 2EKQA 1FNMA 4HH4A 4PCLA 3A3YA 4QOGA 2EFHB 3SYTA 3QWBA 1DMSA 1VI6A 3WVNA 4ND8A 5F3DA 1N2BA 2HIHA 4JLMA 2Q2WA 2QYTA 3OF5A 2AF4C 5JYDA 2IKSA 4NCAA 3NBFA 2JH8A 4QX6A 3ZVLA 4ZT3A 1A8PA 5G3YA 5IT4A 1NI3A 1SBQA 4LZZA 2H4HA 3KZVA 4M1QA 4R7ZA 4UD2A 5HRAA 3GLFA 1PJ2A 3II6X 1KVQA 2IYOA 4XSVA 1C3OA 2C9DA 1E20A 3LT2A 4RKFA 4CM9D 4FGKA 1KY2A 1OBVA 2ACKA 2GZAA 4DG9A 1QVWA 2QG4A 3KZ1E 5E6SB 3UGTA 4JI4B 4TYWA 5LA6A 3H0KA 1RI1A 1ZXLA 1JFFB 5IASA 3KKMA 3TW4A 4D46A 1CUIA 3QENA 1ZN7A 5CG2A 2KJQA 3UBTA 3ZBQA 4BBPA 4OYHA 2J4FA 2WD8A 4FFOA 5HKKA 5CLGA 1JYFA 3BH6A 4IUYA 2IF2A 3OH8A 1J8MF 1IXZA 3RS7A 3V55A 1UJ5A 4KXQA 4U5XA 1QHSA 3KBOA 2F3TA 4U6QA 4UBLA 2B7LA 3SC2A 4MRNA 3CO0S 4MCAA 1AKYA 1L5QA 3EFOA 4AWBA 4RD2A 1E0DA 4H18A 1V9LA 2E4WA 1FFAA 4LJ9A 2DJIA 4M88A 4PWZA 1N3YA 1YVRA 2O05A 4XA8A 3U19A 5GZ3A 2OOSA 1A9XA 2IH2A 3G89A 1R88A 2VI5A 2YCBA 4WZZA 3VR5D 1QV6A 2Q41A 4PO9A 2Q5IA 4D3SA 4LGMA 1XZKA 2OM2A 5I4KA 1QOQB 2I55A 1Q0UA 1L4MA 2XQVA 3PJEA 3WLSA 2JCXA 1TPZA 3QI2A