1NASA

Sepiapterin reductase complexed with n-acetyl serotonin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
b'ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEPIAPTERIN REDUCTASE
molecule tags Oxidoreductase
source organism Mus musculus
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
total genus 97
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nasA00
1QG6A 3WTBA 5DDIP 3K2EA 4WEQA 4NU5A 3U09A 1SB9A 1GYQA 5KVQA 5C37A 3STHA 4NPCA 2EKPA 1Y7TA 1A9ZA 3DHEA 2CDAA 2WJPA 4R5HA 1PZEA 3GFGA 4EDFA 2X86A 2I99A 2Q45A 1H5QA 4RVDA 4NFHA 3ZU3A 1HSOA 2OUIA 5TF4A 2Q3EA 1I2CA 3DOCA 4N5MA 4YWJA 5KWEA 5KVVA 3B1KA 4GQAA 2E48A 3PEFA 3D3EA 4L74A 3U9LA 3QVTA 1B3BA 3LC7O 5EERA 4D43A 4R1TA 4FS3A 1XQ1A 2YFHA 1T2FA 3FTPA 1DEHA 4GKVA 4IINA 4MVJH 3PJDA 1JKJA 4CMKA 4PGFA 4OMUA 5FEUA 1RJWA 3GVHA 4Z0HO 4MKXA 3LT2A 3NJ4A 3DBHB 3SLKA 3BMOA 4IZIA 2W90A 1DHTA 4CMIA 1HKUA 4BNGA 4MOWA 3NDJA 4AJJA 1BMDA 2Y1OA 3V5NA 3IJPA 1PEDA 3QWIA 2G5CA 1QP8A 4G2NA 1TT7A 4OOEA 2IYPA 2FSVA 1AXEA 4RO0A 3UCFA 4RF3A 2PGJA 5DP2A 4PFJA 1ADFA 4DYDA 1HZJA 2W8ZA 2NU9A 3UOGA 4FSHA 4J7XA 4D45A 2PZJA 1IHXA 4OXKA 1K5HA 1ZMOA 3BZUA 3NX4A 3ST7A 2OFPA 3JQ9A 3MOIA 2IYOA 3ZH2A 1U3UA 5A04A 1GV1A 4J1QA 5KCZA 4DMMA 4CMBA 1BSVA 4FGSA 1BWSA 3E8XA 3NGXA 1LQUA 4E33A 5JAMA 3C7CB 3FNGA 3BA1A 1JW9B 1YONA 3ZGYA 2HSDA 3MJEA 3MEQA 1I2ZA 1PJQA 4IGFA 2RHRA 4BO2A 3N74A 5CEJA 1EUZA 2W2KB 1NFFA 3V2HA 4O63O 5KTKA 2O48X 4PLFA 1E6WA 5G4KB 1ADGA 1PL7A 4NK5A 1E3WB 1I3NA 4L4SA 3BMCA 2GASA 2JFFA 1EBUA 5JCJA 4GL4A 1WP4A 3GEMA 2O3TA 4G81A 4IDGA 4D44A 3BMQA 5DCYA 1V3VA 5IXYA 2J3IA 4NBRA 5COAA 1CF2O 3NEPX 4Z3KA 1ZSVA 2DBVO 2Q1WA 1EDOA 1BGVA 2O3SA 3F6YA 3F9IA 1R6DA 3H9JA 3JQ6A 3GN2A 2NQ8A 1U28A 4NJMA 4J49A 1XU7A 9LDBA 4PLTA 1PJBA 3F3SA 4DIFA 5LDHA 1PJCA 3OQ1A 1X0XA 4I9UA 3SJ7A 4CMGA 2O7SA 4NNJA 3DHNA 1UXGA 3H3FA 3ADOA 3JD0A 4NJOA 3DBRA 4Y9DA 3WX0A 2FSSA 5F1OA 5BSFA 2NWQA 4YJDA 3TSCA 3ONEA 1HDOA 2I66A 1IPFA 4Z9XA 4CPDA 1NBOA 3X2FA 2IXBA 1TEHA 1ARZA 4ALMA 1RYEA 2O23A 2VT3A 4MIEA 2H9IA 1ZSYA 4O6VA 1LLQA 5DT9A 3VVCA 2EJVA 3CEAA 5TRTA 1R16A 2EHDA 4FDAA 4B7CA 4YDRA 5JY6A 1W6UA 1GZ6A 3DQPA 3FBTA 4M8SA 5FI5A 3GR6A 3ZU2A 4E2XA 3GNTA 3IOYA 5BSEA 1LLDA 9LDTA 4UVDA 2JKVA 1PGOA 3DBLA 2G76A 3A28A 4A10A 5CDTA 3PHLA 3RUFA 4WCFB 4M89A 3KHUA 3OJLA 1YOVB 1P1RA 2GUGA 3K2BA 2JCXA 4LGVA 4PRLA 2WM3A 3ROKA 4NZ9A 1MXHA 2HMSA 2NACA 2QIOA 5TQVA 1O89A 1V3UA 2BFMA 3DTYA 3BTSA 1ENPA 1GZ4A 2GN4A 3EW7A 3U0BA 2ZJ0A 1KVRA 3VPFA 2P4HX 2GN9A 3H9GA 3D5TA 5F3RA 5A3JA 5C7OO 3TZHA 5G0VA 2VWQA 4OIMA 3MJCA 1W8DA 3OQ6A 4LMPA 4ALIA 1G1AA 2Z1NA 1N1EA 3QJ5A 4BV8A 4XB2A 2Y1EA 2XXJA 4IM7A 3PYMA 2GYYA 3IC5A 4OQZA 2C59A 3VZRA 3PWZA 4RPJA 3CTMA 3FWNA 2XAAA 2H63A 1CQIA 3FNHA 4A7PA 4MINA 3RUDA 1XIVA 1CRWG 3X2EA 3CH6A 4NU6A 2IEBA 1DRUA 1J6UA 3NTRA 1T24A 2NVUB 5JY1A 1VSVA 1H6CA 4JJGA 4QX6A 3RFTA 1UZNA 3WYEA 4MVJF 4HP8A 4DTIA 4CLOB 4JP2A 3JQAB 4WLVA 1B3RA 3BAZA 5CDYA 2BI8A 2YW9A 4PLZA 3EDMA 3ON5A 4J90A 4CV3A 3I52A 4G5HA 4CV0A 3R3JA 3Q2IA 4F6CA 4K26A 1I5RA 2FRDA 1DC3A 4MVJD 3OICA 4RVHA 4G65A 1PQUA 3ANMA 4AJLA 2Y93A 4DPMA 4DGSA 5HBRA 4UUNA 2ZYGA 4TKMA 4XKJA 4YJFB 4BNHA 2AE2A 2O4CA 2VCYA 4Q39A 4IQ0A 1DLIA 5I9MA 1I3MA 1K6JA 4J0FA 2ZTLA 1S6YA 2D2IA 3HADA 3L4BA 3RU7A 1WAMA 2QHXA 5HWSA 3PXXA 1ONNA 2OGUA 2Q2QA 1AE1A 1DIRA 1ZK3A 3E9NA 3KETA 1AHHA 1BDBA 1NXQA 1U2DA 3NKLA 3AM4A 1Z73A 4J6FA 1JKIA 1C1XB 1JAXA 3TL2A 3ZZNA 3EZLA 1PZHA 3AJRA 3WQSB 4MDHA 1NP3A 5IZCC 1E3SA 1Y81A 1P3DA 3GLQA 4EGFA 4XD2A 1E3WA 1F8FA 5G4KA 3C1TA 3PHGA 5IDQA 1LSJA 2GCGA 1EBFA 3QWHA 3VZQA 1P33A 1P31A 4D0RA 1K2WA 1UAGA 2EKQA 1HYHA 4FC6A 1B26A 3F46A 1ZVMA 2D1YA 3G49A 1Z82A 1N92A 2HU2A 4ALJA 1PJSA 3B20A 3ETDA 4BNFA 2FMUA 4KUHA 2VWGA 5TJ9A 3CMMA 4FFPA 5EINA 1NQOA 4I9NA 4ZQGA 3VVBA 3T4EA 2PD6A 5U4QA 5B12A 4F45A 3E03A 1OC4A 3K9QO 3RBXA 1ONPA 4IZHA 4LCJA 3PIDA 1U8XX 4KTTE 2ET6A 3TJRA 4TMFA 3BHMA 2WSBA 4PLCA 1RKXA 4U6SA 1LDBA 1XQ6A 4CQMB 1R4NA 1SCUA 2WE7A 4OGWA 4B3HA 4WUVA 4TQGA 4IJUA 1FDTA 3BHIA 2QQ5A 1IPEA 4AJKA 4JQCA 1E7YA 3MCVA 2XPCA 5BSGA 3KB6A 4IDCA 5ILOA 3NGLA 3WBBA 2Z1MA 1ZUD1 1RYDA 4DLLA 2JCYA 2ZIZA 2HJSA 1ZMTA 3DONA 3QSGA 5JE8A 4BNLA 5G4LA 3QVXA 1P9LA 2WD8A 4NQZA 3WDSA 4B79A 2G0TA 5IXSA 3ZV5A 3F5SA 3JD3A 1LX6A 3BMOB 3AFMA 3H5AA 2UV8A 5LC1A 1PX0A 1AN9A 1YH3A 2ZYDA 1NAHA 3DAPA 3RIHA 2FN7A 1GY8A 3O9ZA 4H15A 1VL6A 5EQFA 4A5OA 2NV6A 1XHLA 1MB4A 2NLOA 4RF5A 1HF3A 4RPGA 4XA8A 4A26A 4D3FA 3FTNA 1HETA 1M75A 4NFYA 1DRVA 1P1JA 2DBQA 3KEOA 1EVZA 1W4ZA 3Q11A 4CR8A 4D41A 3L4SO 1LC3A 4DLBA 2VZ8A 1KEUA 1SOVA 1EK6A 2JD0A 1U5AA 2Q4BA 2HK9A 1IL0A 3PLNA 2QZ9A 4FJ1A 4BQPA 1Y9EA 3C24A 1MG5A 4OSOA 4YB8A 4GSLA 1DIGA 4FCCA 2AW5A 1HE3A 3OJEA 4Z0PA 2PH3A 3A1NA 2DFDA 1PWXA 2W2LA 1U3VA 1FDVA 3C7AA 4KZPA 2XOXA 3QWAA 5ES3A 2J3KA 1MC4A 1AGNA 1TB4A 1K6IA 2ZB8A 1F06A 1UXIA 2DAPA 2FR1A 1GV0A 2GERA 2P2SA 3PYXA 1P1KA 5HA5A 4ESOA 2RIRA 1X0VA 3D0OA 2X0NA 4FJ0A 4RPLA 3OHSX 7MDHA 2BMAA 2C82A 3I23A 1LC0A 1I3LA 2YDYA 3DBHA 1YL7A 4MKZA 3G17A 2YHUA 3LU1A 3OQBA 1FDSA 4Q3NA 4IPTA 4R51A 3ANNA 1BXKA 4AFNA 3NT2A 3L4BC 4ITUA 4MIYA 3PGJA 1PU2A 2VZ0A 5CPFA 2C7VA 3FD8A 4IJVA 4W9NA 3DFZA 1F17A 4CM4B 1Q7BA 3RJ5A 2PD3A 3D4NA 4NH4A 2IODA 2YV2A 3HB5X 3OFSA 2ZK7A 4JCOA 2HAEA 3AU9A 3GEGA 4FFLA 5U1PA 4QXMA 5A1TA 5KJCA 4AJ4A 1T25A 5IZCA 5TSDA 4AJEA 5DBFA 2RHCA 4OKNA 1WZEA 2GNAA 3TF5A 4TSKA 1JWBB 2CUKA 2GF2A 4TZKA 1HE4A 4HNHA 5DOVA 4E21A 4E2ZA 4JIGA 1KBZA 5JC8A 1HWYA 3AWDA 3W6ZA 3DMYA 3OA2A 5TS3A 1IZ0A 3DZJA 2X5OA 1DHRA 2B5VA 3WGHA 1F0YA 2JHFA 5I7VA 1B0AA 2V65A 4TRMA 1TVEA 2JHGA 4OOFA 1N8KA 4XR4A 1O95A 1G0NA 5G0TA 3UGKA 1BHSA 3AOEC 3MTJA 4D79A 5T8KA 4XRRA 2PK3A 3KSDO 3W8EA 2EW8A 5IDWA 1PQWA 3GC6A 1DOHA 2Y0DA 3VDRA 1WMBA 2O3QA 3JD2A 3DZBA 3BXXA 3NYWA 1BXGB 4PVDA 1N7HA 3HNPA 3KYBA 4J9UE 3U4IA 4NI5A 3L9WA 3PYLA 4P22A 4H16A 1Z45A 4W6ZA 2B4QA 3VPXA 1GYRA 4QQRA 3GZNB 5ICSA 3GAZA 4CLEA 1X7DA 2VRBA 2QRKA 4F6LA 1TI7A 1DBVO 3U5TA 4E0BA 4L75A 1Z6ZA 3UKOA 1QYWA 3WGYA 1YWGO 1DC4A 4EUHA 4I5FA 1YO6A 5ICMA 2DTDA 1E3IA 1KY4A 1KVQA 1CEQA 5B4TA 3GGPA 4B3IA 2ZTMA 1N9GA 3L6EA 4E5KA 4GLOA 3KSZO 1CIVA 3LK7A 1X15A 2X0IA 3DAFA 1Q0LA 3AUSA 3GDFA 1KETA 5A9TA 5L9AA 4BGEA 3P19A 4XQ9A 3FHLA 1C1DA 4HV4A 1D3AA 1EMDA 1IULA 3H65A 1RWBA 3INGA 4GX2A 3RI3A 3BMNA 4JN6B 4D46A 4KP7A 3QA9A 1X7HA 3VC7A 1KVSA 4NK4A 5JO9A 1J5PA 3W8FA 4BO7A 4DREA 5MDHA 4J4TA 1MP0A 1T2EA 3KZVA 2YHIA 4JJIA 3KTDA 3DTTA 1KC3A 2AG5A 4RQTA 4BO0A 4XYEA 3JD4A 1QYCA 4HUJA 4OSPA 4CUJA 1R66A 1EUCA 1U4SA 1LUAA 3ZW9A 3RROA 5ENVA 2D0IA 1E7WA 1AHIA 4WNCA 3H4VA 4GAEA 3MJVA 4B8WA 3JCZA 4CM8A 1ML3A 4B4VA 2O3RA 3WR5A 4J2HA 4IDEA 2Q49A 4LW8A 1P1IA 5BT9A 2I3AA 4GSKA 3CZRA 3GK3A 1QKIA 3AI1A 3VH3A 3SC4A 3PFWO 2QZZA 2E6UX 3WGTA 2SCUA 3WJAA 4Z9FA 3RBZA 1PJ4A 1LRKA 4BVAA 3ZV3A 2E4AA 3ZNNA 4XCVA 3PRJA 2FOIA 3H3JA 1YQDA 2TMDA 4IXTA 2ZB3A 4M1QA 5IZ4A 2DUUA 2C5EA 1PL6A 1C1XA 1WDKA 4B4UA 4C4OA 1K89A 5EJ2A 1HYGA 4BNYA 2FPGA 2J3HA 4AJ2A 1UJMA 1IE3A 4FOSA 4TRRA 3KO8A 1C0PA 1Q1NA 4HNGA 3VPGA 1BVUA 5AQ1A 4CLOA 1WDMA 2ZTUA 4TVOA 1NX6A 1YS4A 3AW9A 1WXDA 1XLTA 3S2GA 5HS4A 3UW3A 2NTNA 1XEAA 1LDYA 2ZQYA 2VN8A 1IYZA 1VL8A 2IZZA 4R69A 3JQ7B 4P4LA 4R1SA 4S1VA 2NTVA 1ADCA 1H2BA 4C7JA 1LLCA 1ZXBA 3INTA 5JDIA 4QFDA 4BO1A 4L4RA 5GY7A 5AVOA 1B8VA 1I36A 1A71A 3HN2A 3DOJA 3LZ6A 5AXDA 1N1GA 5H81A 5THQA 2BGKA 1LSSA 2JD1A 3Q3CA 5T67A 2FZEA 3H2ZA 1XGKA 3CUKA 2D8AA 2FR0A 3A14A 4D3DA 1EVIA 1KY5A 4KWIA 4D42A 1UDAA 1QYXA 2X5KO 3LC1O 2ZTVA 3GVXA 2W2LD 5HS6A 1DAPA 3LLVA 4K28A 4CM9D 3FPCA 4GX5A 1HZZA 5JXWA 2WYWA 3WSVA 2ZYAA 4GGPA 4UVHA 3TDKA 2AG8A 4ZRMA 1ZJZA 1I10A 3D3WA 2FPIA 2ZQZA 4M54A 3PLRA 4WKGA 5ILGA 1XSEA 4E5MA 3CIFA 4KQXA 1U7TA 4MJLA 2O2YA 4E2YA 1HDGO 5JYDA 1ULSA 1L7EA 5TJHA 1ZJYA 3CE6A 5G0SA 4CM7A 4RZHA 4CR6A 4E32A 4BNWA 2PGDA 3ZHZA 1LDGA 4PCVA 1NWCA 2CVZA 3N7UA 4QEDA 5I7FA 4E5NA 3GHYA 3PJGA 3IS3A 2X9NA 2HO5A 1V35A 3FR7A 3O03A 1FDWA 5IFLA 1HE5A 3AI3A 4IIUA 4UUPA 4B4OA 2P4QA 4IMRA 2B4RO 1O8CA 4WE3A 3HSKA 4CQMA 2Q46A 4WASA 3JQEA 2B0JA 2B4TO 5TX7A 1G6KA 1QLJA 3BTUA 5G0UA 4WPGA 2GN6A 1H6BA 1U2GA 3OP4A 3DEYX 3GMSA 2NVUA 4IIVA 4Z3DA 5TGDA 3PWKA 5F5LA 1ZSNA 2X22A 5K6AC 5AXCA 3NT5A 1X7GA 4W7HA 5CHEA 1RM0A 2BFOA 1MC5A 3ABIA 2X4GA 4ZQBA 1T2DA 1NQTA 3JQ8A 4GGOA 4M49A 2RAFA 2C07A 1SMKA 4GPD1 5L4SA 4R9SA 3DZIA 2EGGA 2X0RA 4B3JA 2Z95A 3ZHYA 3B1JA 5CFZA 2NADA 4JBIA 4XDYA 3E6AA 3GUYA 3GF4A 3JQFC 4IMPA 5DULA 4FJ2A 4CJXA 4CQMD 2HRBA 2PV7A 2CZCA 2CSUA 1Y8RB 2YJZA 1P1FA 3GEDA 3RUIA 1ZIDA 3K31A 3LT1A 5JPIA 2CF5A 3GDGA 2BFPA 3GNQA 5IF3A 2I5PO 3AY3A 4BQRA 1NVGA 2QX7A 2FY8A 3DC2A 2PR2A 2UUOA 4O59O 1NFRA 5JC1A 1V0JA 2YQ5A 2X7HA 2UVDA 3UN1A 1LQTA 1GQYA 3TZ6A 4TWRA 1DAOA 5C5IA 3ZU5A 4PVCA 2I76A 4YRBA 2C29D 1OI7A 3OM9A 4MO2A 1TA4A 1I8TA 4DIBA 1FF9A 3OBBA 4FBGA 3ZCXA 1DC6A 1GAEO 1GUFA 1NM5A 2E49A 3DXFA 4R1NA 1UXJA 4Y67A 1B15A 1Y9AA 4CV1A 2H5LA 3FNEA 4EITA 2AXQA 3ZNQA 5I9NA 2R6JA 4RPKA 1YBAA 4YBZA 3RUHA 2ZB7A 3SC6A 1LDEA 1GEEA 3OIDA 4RF2A 1YB5A 3PJFA 2PGLA 1E3EA 4MKRA 3QHAA 4S3MA 4XWYA 4HX5A 5G0WA 3LLSA 3U4HA 4R1UA 1I0ZA 2JFGA 3L6OO 4XYBA 5ENDA 3LDHA 3QIVA 4BMSA 1LRJA 3OA0A 2CVQA 4B7XA 3WMXA 4CUZA 5KJ6A 4R3NA 1NVTA 4KUEA 1IB6A 1X14A 2AEJA 3JQAA 4ID9A 1R4NB 4MVJP 2O3JA 2X23A 5T64A 2QW8A 4OM8A 4U0KA 4ZN6A 5EL0A 3FRJA 1LTHR 2GRAA 3DAGA 5H82A 3H9QA 1TLTA 4Y6SA 3V2GA 4RPHA 4WOKA 3RFVA 4CMEA 2EGHA 3B1FA 5A03A 1ISIA 3E9MA 4NBUA 3RWBA 3HDJA 3ZNPA 3UFXA 1A7AA 5JDCC 3SJUA 4RORA 4BGUA 2DBZA 3SXPA 1KEWA 1BG6A 4KOAA 1DFGA 4BKOA 1EFLA 1TXGA 3F5QA 3UF0A 1KVTA 4CLHA 2EW2A 1BVRA 1SOWA 4NBVA 1EE2A 4I8XA 1ZCJA 4IDDA 4INAA 3EC7A 1PGPA 1MA0A 2C2YA 4FIZA 4N54A 4WLOA 4YT8A 2OZPA 2PKQP 3D4PA 5H83A 3WS7A 3QY9A 4CM8B 2YFQA 1MV8A 6LDHA 4NG5A 1P77A 3GDOA 3H5NA 4ZU3A 5CDUA 2GR9A 3PTZA 2DC1A 4P4GA 1YE3A 3PZRA 3K73O 5MGBA 3RVDA 5DCWA 4RV9A 1E7SA 1ONOA 5L45A 2NU6A 3RAJA 1LA2A 3UUWA 4J7UA 4NIMA 1QRRA 1VI2A 3TL3A 1DFIA 3D5QA 3DZGA 1T2CA 3CPSA 4GBJA 1KERA 5K6AA 4TRJA 1QORA 3S1LA 4L0QA 4K1LA 3K8ZA 1EK5A 5DP1A 4WLUA 4UAGA 1SPXA 3PDJA 4CM4A 3HB4X 1DFHA 3B6ZA 3CINA 2DU8A 3NV9A 4FR5A 3M6IA 3D4OA 5HTOA 3IUSA 2E82A 4FD3A 4XYMA 1SB8A 3ASVA 1YDWA 3AI2A 3FI9A 2QRJA 2D4AA 2XXBA 4BNUA 2UYYA 4LISA 1RM5A 3DDNA 2Y1DA 2J5RA 5FI3A 3ZWYA 4CR7A 1GZ3A 1ID1A 1PR9A 5GZ6A 3F1KA 1DJNA 3AUTA 1ZNQO 3EUWA 1OC2A 3OF2A 5I9LA 2JD2A 4YRDA 1I24A 3ZU4A 2HLPA 2OXIA 3G0OA 3LQFA 3TOXA 4XRGA 4R9RA 3U3XA 3ONDA 3LF2A 3JSAA 1JWAB 1WLYA 1GUZA 1WDLA 4IDFA 5C3MA 2NSDA 1DRWA 1ISGA 3OSUA 3I6QA 4N7RA 4D0SA 1XELA 1R15A 1X1EA 2NUAA 1Y5MA 4JLWA 5I8ZA 3TQHA 1DC5A 2EV9A 1NVMB 2OORA 4GWGA 3SX2A 1PR3A 5L3ZA 4YACA 4H7PA 4BNIA 3ZHBA 4WCFC 3S2IA 1ZW1A 2P9CA 4E3ZA 3FR8A 1ZK1A 4J1TA 1QMGA 1ZK0A 3WSWA 2EEZA 4XQGA 1ZH8A 2CDCA 1HSZA 2VHXA 3EK2A 3JQDA 4NR0A 3DOOA 3OIGA 7ADHA 2V6BA 1ZO8A 4BGIA 1PGQA 1R0SA 2EG9A 4JX8A 4BNXA 2J5KA 1D1TA 3RKRA 3VZPA 4NBTA 2A35A 1M76A 4GH5A 3R6DA 3JYQA 2QYSA 1B8UA 2ZJ1A 1HLPA 5COQA 3TFQA 1AXGA 1A4UA 3ITKA 4CODB 4XGIA 1E1NA 4OH1A 1NHWA 2WYUA 3UVEA 3PVZA 1DDOA 2GSDA 3G1TA 3WB9A 3HJAA 2NTJA 3N58A 4PLGA 5DN9A 5F5NA 3ZNOA 1FJHA 4D3SA 3QVOA 3WGIA 4FN4A 4BKUA 5TNXA 1U5CA 2BD0A 2VYVD 3EY4A 5C7LO 4IJWA 2I67A 4ZQHA 1PJLA 4AJPA 1UAYA 4E4YA 3OH8A 4MVJA 4FW8A 1ORRA 1T1RA 3GH3A 1NQ5A 3G79A 3MJSA 5JS6A 2OHXA 4WLFA 1HDZA 3RKUA 4DBZA 5B4UA 4DVJA 1EDZA 1CWUA 1T4DA 2G82A 4RL6A 4EJ0A 3DMTC 4YJHB 4EW6A 4MVJI 2LDXA 2VHWA 4YTEA 5THKA 1BRMA 3RJ9A 1ZK2A 3WOHA 4BO3A 5T5QA 1V8BA 2X0JA 1G0OA 3OJ0A 4W7IA 4Y6RA 4GVXA 3AY6A 3OJOA 4AVYA 2P9EA 1OFGA 4BO5A 3K92A 3PP8A 5L4NA 1T26A 1IHYA 3RSHA 1Q7CA 3DL2A 3P2OA 3WYBA 4GVLA 4ZRNA 4CV2A 3SEFA 2AQ8A 1UUFA 1ENZA 3QRWA 3LC2O 2C20A 1B16A 4D7AA 1Z75A 4RDHA 4WCDA 2PD4A 3W6UA 1HT0A 3AOEA 3AUAA 1L1FA 3VKUA 4XIYA 1YRLA 1FMCA 4P8RA 1Q7GA 3V1TC 5AOVA 5JLAA 4A27A 4GX1A 1GYPA 2DFVA 5T8KC 1XA0A 1EQ2A 2YZ7A 1OBFO 3QV1A 4ZVVA 4AJ1A 4CM1A 3BMQB 2NQTA 2VYNA 3I4CA 3JQCA 2BKAA 3H7AA 1XDWA 3KUXA 1PS0A 4KTVE 4GMGA 4JJFA 1M66A 3GRKA 2Y68A 5IDYA 4BGVA 2D5CA 1NHGA 3C85A 3ROPA 1R0KA 1ULUA 1F12A 4RVGA 5F21A 3TZKA 1D7OA 3OJFA 1SEVA 4U5QA 1NPDA 3BTVA 5KIAA 1LBEA 2BFAA 4Z0TA 1SO8A 1A7KA 4U8GA 4EUEA 2VHZA 1M6HA 3PQFA 2XF8A 2EXXA 5CDGA 4FFMA 4DIOA 1CERA 3K96A 1U7HA 2WYVA 4X54A 1YJ8A 5B1YA 3DZHA 1CQJA 3I1JA 4YJHA 1A27A 1W73A 1GR0A 5TT0A 5B4VA 3QP9A 1LDNA 5C7IO 1KS9A 4YAKA 3FSRA 3WLEA 5JAQA 1NQAO 5TIIA 3D1LA 3M2TA 3ORFA 3PDUA 5ITVA 4UVEA 3K30A 5JYEA 2HMVA 4ND5A 1WVGA 2ZKLA 1K0UA 3K5PA 3WGZA 3ZWBA 3ICCA 1C14A 4NBWA 3FPLA 2P68A 2IEDA 1QLHA 3KYCB 4R16A 3ROMA 2VT2A 4L9RA 1A72A 1LDMA 2CMDA 1YGYA 1GL3A 1QV6A 1OMOA 3JQBC 5EMHA 1H6AA 4XDZA 3WMWA 1QYVA 2GZ2A 3M2PA 1ENYA 1U3WA 1H0KA 2A92A 3FNFA 4EEZA 1F8GA 1WMAA 4DUPA 1C3VA 3WG9A 1I2BA 3M1AA 2Y0EA 5AXAA 2C0CA 3JYPA 4AJIA 4Y98A 2HMWA 5CPBA 2RBEA 4JBGA 4HFNA 4YAJA 1EE9A 2BHLA 2GPTA 5JAIA 4WOJA 2P91A 3GRPA 2WDZA 3KEQA 2ILTA 1V3TA 4IJKA 5KKCA 2CF6A 2YV1A 4N5LA 3VAZA 1JDJA 6ADHA 1RPNA 1EUDA 4YVFA 4UEOA 2F00A 3KOUA 4BNMA 4DBVO 5BSHA 2IRWA 5DNAA 2I6TA 4FB5A 3DMTA 5JMPA 4OXNA 3G1UA 3ETEA 1J0XO 2Y99A 1PIWA 3I4FA 3TOZA 3KVOA 1KEVA 1XG5A 4WLNA 4EEXA 5FF9A 2VHYA 3VZSA 3T4XA 4RLHA 1H6DA 3NUGA 1VJ0A 4XQCA 2GZ1A 4UUOA 4RGBA 4HFJA 1JKFA 4HADA 4Q3EA 3I9MA 4YYZA 3C8MA 3UH1A 3EMKA 3R3SA 1XWFA 1V9LA 4BNJA 1CDOA 2FPPA 3MZ0A 3UCXA 4ZICA 1HTBA 1MX3A 8LDHA 5IDXA 3CMCO 3FBGA 3U4DA 1R12A 3DBLB 4BB6A 5DOZA 2R00A 5GMOA 1DJQA 4A03A 2BF7A 2GO1A 1GU7A 1PZFA 2PZLA 5A02A 1OAAA 5BNFA 3VH2A 1F14A 5ER6A 4EYEA 4LK3A 4XJTA 4MPDA 1E5QA 1ENOA 3A06A 3WWYA 1HDRA 4ALNA 3JQ9C 4R4JA 4Z6KA 4BNZA 3LF1A 1O94A 1Y8RA 4URFA 4U0JA 4QSMA 4IBOA 1LLUA 3EVNA 4Q3DA 3L6DA 5CG2A 1NR7A 1Y8QA 2J8ZA 4BNTA 1YL6A 1R4MA 2DKNA 2VUTA 3V1YA 4Q3BA 5ADHA 4UVIA 4KUGA 2W98A 4B4WA 5FYDA 3COSA 1P44A 2OP0A 3GPIA 2G1UA 2RH8A 5A5FA 2VYVA 3W4IA 1BXGA 4J91A 5JAZA 1YB4A 2BGLA 5A9SA 4WK6A 1T2AA 3UCEA 4CUKA 3TN7A 3Q9NA 2W4QA 2EKLA 3R1IA 3WFJA 2PZKA 3QWFA 2P5UA 4QTZA 3AFNA 5I7EA 2NVBA 4RJTA 4W82A 5BR7A 3WXBA 3GG2A 2I65A 5KKAA 3H8VA 3HN7A 3RC7A 3UICA 3HFGA 1KEPA 2WE8A 5CAEA 1GUYA 2Z5LA 1IZ9A 3G3EA 3WIDA 1V6AA 1KVUA 2HCTA 2UAGA 2AEFA 2VYND 4K9DA 4ALLA 3PK0A 1EVYA 2NU7A 1IOLA 1DIBA 2Y0CA 3SBOA 3O38A 5BQFA 4OL9A 2CVOA 4R3WA 1MGOA 4Y8VA 1NNUA 1LRLA 1C0KA 3EGOA 2D59A 4XQEA 4MIOA 1EVJA 4HFRA 1UZLA 1GD1O 4BS9A 3RD5A 5DF1A 3ZDFA 3WYCA 2JCVA 3JQ8B 1MFPA 4PZEA 4HXYA 5AXBA 3RUAA 3IKTA 4IQ8A 3JTMA 4RF4A 2HMUA 4TRNA 2Q1SA 2GZ3A 3JYLA 2HMTA 4FFRA 1ADBA 2B69A 1LXCA 1C0IA 4JROA 4QO7A 1E7RA 2DT5A 4BHTA 5L51A 4R41A 2NVWA 3WGQA 2HK7A 4I1IA 1WZIA 4AG3A 4IXWA 2BLLA 1E1KA 1DPGA 1NYTA 2CY0A 2OO5A 3PPIA 4AJHA 5JCJD 2GDZA 2VRCA 4UULA 4PG5A 3QWBA 3H9UA 3VHRA 3KYDB 4DC0A 4Q3CA 2JAPA 1R37A 3DBVO 4PG4A 4QO8A 4H3VA 2DTXA 4J1NA 1EEHA 2PKQO 2V6FA 4L8VA 1H93A 4DC1A 5HRUA 4AL4A 1A9YA 3CXRA 4PLPA 4ZHSA 4OJNA 1YBMA 3W1VA 4J0EA 3VH1A 5L7WA 4KDFA 4JNKA 1GQQA 4NDNE 2BRUA 2OP1A 1ZEMA 5CEFA 1VKNA 1HDCA 1JU9A 2FWMX 2PH5A 2P5YA 4ROSA 4CLDA 3ZN2A 2WD7B 4BOYA 1GQ2A 1HXHA 3WBFA 5JW6A 1LU9A 5A9RA 2DPGA 2PWZA 1A5ZA 1PQPA 2GGSA 4EI2A 1UZMA 1O6ZA 1M6WA 2PY6A 3UHAA 4C7KA 4JBHA 2CNBA 3ZWMA 1J4AA 1NAIA 4HKTA 5K9ZA 2QG4A 1SEPA 1H9AA 3KLPX 5IG2A 3A9WA 4I9HA 4QFCA 1VL0A 1JA9A 2GLXA 1UXHA 3S8MA 4HFMA 4FFNA 2W2KA 3L77A 3LSYA 4YJGB 3V2UA 5U9CA 4F46A 1N9GB 4UEKA 4GX0A 1MXFA 4ZGWA 1P0CA 1Z74A 2NM0A 4FQ8A 3RQSA 2J3JA 1BW9A 4YAEA 3VPSA 1PL8A 2YQ4A 3TZCA 3W4JA 3AK4A 1PGJA 3OECA 4E5PA 5JDCA 2CDBA 4CMHA 4CMAA 4II2A 4XZ3A 1BW9B 5JFOA 4IY1A 4W99A 4YT2A 3MWEB 3E5RA 1VC2A 4J9VA 3E82A 4W4TA 2LDBA 3GVIA 1YJQA 4CQLA 5HM8A 3GQVA 3VOSA 1ISFA 4TZTA 4KMSA 2IZ1A 2B36A 1D4FA 3RASA 3JQAD 3ZW8A 3CZMA 3F4LA 3P7MA 2YUTA 1LI4A 1I3KA 3DBRB 3PHHA 3ETGA 1M2WA 4GKBA 1PS8A 4QUKA 4NHEA 2Q2WA 4PG6A 4A2CA 4BO8A 1ZXLA 4IGEA 4BO6A 1YBVA 4M86A 3RUEA 2ZATA 3S55A 1U3TA 4ND4A 3EAGA 1JVSA 4L73A 1OZAA 2EF1A 1ZZEA 2AQIA 5JDIC 5DBGA 3HHPA 5F1KA 8ADHA 2X5JO 5IJZA 2EWMA 1CETA 1UR5A 1PZGA 1SC6A 3S2FA 5DCUA 3HDQA 1YDEA 4MVJM 2HKIA 3JYNA 2BH9A 4UREA 4I5EA 4LVCA 3TWOA 1WW8A 1O5IA 1UP6A 2C5AA 5I7SA 2V7PA 4PZCA 1EFKA 3WTCA 2YDXA 2Y66A 1PS9A 2FP4A 2OBNA 2X8LA 4BMVA 3PQEA 4YJFA 4ND1A 3GNSA 1C1DB 3WQQA 1ZKMA 3OETA 4BKPA 1E0DA 3O8QB 4BNVA 2DTEA 1P74A 2HJRA 2Y05A 4LRTB 3ZWOA 4BV9A 4DRYA 4YPOA 1Y6JA 2IZ0A 3VPHA 3VKVA 5KJ1A 1E5LA 4RVUA 4HWKA 1ISMA 1HDXA 2OL4A 1U4OA 4JK3A 2VTDA 4KDEA 5ER9A 4DWVA 3UAGA 4BIIA 3JQ7A 1PJTA 3T7CA 1VRWA 3IKVA 5IAAA 4DA9A 2WTBA 1YKFA 3T7EA 3BMCB 5EPOA 1WPQA 3HQ4O 1K3TA 1P45A 3WGOA 1H94A 2X1HA 4YAGA 2PFGA 3LT0A 4LN1A 4YJGA 4FC7A 1ZK4A 2VTEA 5I8WA 4EBFA 1UP4A 1MFZA 3IIEA 4WJZA 3KYDA 2VRCD 3BHJA 4M87A 5DBIA 3I3OA 1E1MA 4GLLA 2AQHA 3BTOA 1VE9A 3LYLA 2P9GA 4OXYA 2EP5A 4ND3A 3GZNA 3DFUA 3JYOA 2V6GA 3M1LA 3RU9A 2DPHA 3AY7A 5B37A 3GZ4A 3PGXA 5F1PA 2YV3A 4I08A 3UXYA 3JD1A 1C0LA 4FFOA 4OO3A 1X1TA 3PWSA 3HDHA 4YQZA 4IDBA 4WECA 3B70A 5BNIA 1U9JA 3D3WB 4XGNA 1KC1A 4GI2A 3ZHXA 4PLHA 2TMGA 4PRKA 1UP7A 3Q1LA 4FGWA 3WJ7A 2F1KA 5EN4A 3O4RA 4TKLA 5EQDA 2EIHA 1GDHA 1GCOA 2V6MA 3V1UA 2VWHA 3IUPA 2O2SA 5EESA 2IE0A 3JQFA 3Q9UA 2B37A 1UDCA 2C7GA 2WEKA 4QT0A 5A3VA 5A9SB 1D8AA 3TRIA 5CG1A 1VPDA 1E1LA 3I6IA 3WICA 4BNNA 3IL2A 2I3GA 3U49A 3HZZA 3PIIA 3NAQA 5J23A 2Q1UA 3MOGA 4YT5A 5L7YA 4UUMA 4W9NC 1CYDA 3FCOA 4CM9A 1HYEA 3BYZA 1QSGA 1XCBA 3DR3A 3I9LA 2UDPA 1ZBQA 4KQWA 5FFFA 2OBYA 2VNAA 1DLJA 1YXMA 3W4KA 2NU8A 3E18A 4XEHA 3VDQA 3FF4A 2CD9A 2PNFA 1ISJA 2X9GA 4ONEA 4CL8A 1QYDA 2B83A 1E3JA 4ILKA 4Q9NA 3I9OA 3KM0A 1HRDA 3RFXA 2VOJA 3MJTA 3ZWPA 1SNYA 1E3LA 4II3A 4N18A 3NDRA 3H2SA 3O26A 1EZ4A 3HUDA 3S2EA 3GUCA 4HY3A 2J5QA 2J6IA 3DZKA 2Y1CA 4BKQA 4PZDA 5JBIA 1B2LA 1E6UA 4PG8A 4LSMA 2ZCUA 3JQGA 4O1MA 4QECA 2OMEA 4FPXA 5A06A 3GMDA 5KVCA 1YQGA 4CMIB 1HDYA 1MG0A 1DSSG 3JQGB 3ONFA 4JGBA 1U8FO 4DQVA 4RLSA 3AU8A 2G17A 2YHIB 3JV7A 4L4XA 2POQX 3PHJA 3KBOA 4PLVA 3ROQA 4TROA 3H5RA 3KLMX 2IDZA 1N5DA 4GWKA 4J7CA 4LSWA 4RVFA 4CMEC 3PJEA 2AEMA 2DBRA 1FK8A 3VTFA 4TVBA 4YXFA 2VUSA 5IN5A 2C2XA 2GD1O 2Q99A 3PFFA 4O5OA 2B35A 3BIOA 3ANLA 2AQKA 4CLRB 1UH5A 2X9VA 1JAYA 3D64A 5JO0A 4CM5A 3MWDB 1NR1A 4WLEA 1P1HA 4ZQEA 1JTVA 1KOLA 1XU9A 1YL5A 4RZIA 4WNIA 4B7UA 1WNTA 3OEYA 2X58A 3KXDA 1YOVA 1VSUA 1JN0A 3NRCA 1JVBA 1MLDA 4RCVA 3C1OA 1YVEI 3F47A 1E77A 3AM3A 3MTGA 4JXKA 4ZJUA 2D3TA 1P0FA 1YB1A 1EQUA 2Y67A 3P2YA 2H6EA 3DZFA 5AYVA 3WFIA 2PA3A 3IMFA 3ADPA 1GTMA 1X13A 1J49A 1GADO 2X6TA 1B14A 2BI7A 1S7CA 5TT1A 3ZI0A 4BNKA 4R54A 1BDMA 4IDAA 3ZV4A 3TZQA 2D5AA 3F4BA 1E7MA 4BO4A 2FHSA 5L40A 4I5DA 3DO5A 5L4LA 3ZWXA 4YQYA 5L7TA 4E5YA 4YRAA 5A4DA 5KJFA 1N7GA 4E30A 2ZCVA 4N5NA 4PIVA 3WNQA 2EERA 1M67A 2HUNA 3EVTA 3NJ8A 3E48A 3OIFA 4WGGA 1K6XA 3OMLA 4IQGA 3WGGA 1VM6A 2VOEA 3JQBA 2HDHA 3NTQA 4DQUA 4LCEA 1NFQA 2NNLD 3ULKA 4AICA 4L76A 3WQRA 1QV7A 5TLSA 3NTOA 2DQ4A 4A73A 4E2WA 2YY7A 4P38A 4NJMB 4UVGA 3HG7A 1SAYA 1CJCA 1PGNA 5CDSA 1TT5A 2PKRA 4CQLB 1OOEA 1E7QA 1E92A 3OEWA 3P5SA 1RM3A 1XR3A 2FR8A 3QE3A 3QVWA 4ALKA 4J3FA 4E31A 2WMDA 4DYVA 1I01A 4IS3A 4LMRA 4DLAA 4I5GA 4CLRA 4O0LA 5A05A 4CMCA 2EP7A 2WD7A 4E12A 1GPDG 3GG9A 5BNTA 5IN4A 3TFOA 3ZWCA 3ZV6A 3W8DA 5T57A 4M55A 1QXSA 2Q50A 4CM6A 4DL9A 2VQ3A 1YQXA 3ENKA 4A0SA 4YT4A 1PJ2A 1LNQA 4IUYA 3AUUA 3GT0A 3IDSA 3RC9A 1H9BA 3E9QA 4J16A 5L53A 3KSUA 4Y6PA 5KVSA 2E37A 3RC1A 2H1SA 4HBGA 3U62A 3IP3A 3PQDA 2JJYA 4EJ6A 3RUCA 4J1SA 4XB1A 4BL5A 4BMNA 4WCFA 4DQXA 2B5WA 4IS2A 2Q4EA 3GGOA 3TPCA 4OKIA 3RC2A 2AMFA 2VZ9A 4OQYA 4B8ZA 1MUUA 3PHIA 1DIAA 3D7LA 3PI7A 4WEOA 3L9XA 1QR6A 3NDIA 1I33A 4OAQA 1JLLA 4F3YA 2R00C 3GA0A 3GAFA 2HRZA 3E5MA 1NASA 1GFSA 5JCXA 4E6PA 3RCBA 1RM4A 3IP1A 2UUPA 1IY8A 2DVMA 1PJ3A 1VJTA 4NMHA 1W0CA 2VUUA 4MP8A 4MP3A 4OHUA 1FDUA 4FOOA 3Q2KA 1IUKA 2FZWA 4BKRA 3Q6IA 1GCUA 3GHHA 1Y5RA 3GY0A 1LJ8A 1Q0QA 2C54A 3AM5A 3ENNA 1NTOA 2O3UA 3QW2A 1D1SA 4J4BA 4K6CA 5JMWA 3PZBA 1DIHA 1Y8QB 1BXZA 3WIEA 3KV3O 5GZ1A 2HQ1A 2RCYA 2A9FA 2JL1A 3F1LA 4AJOA 4YA6A 3K6JA 1VKOA 1R0LA 3ZWNA 3L0DA 4CM3A 5COBA 1AUPA 2VNSA 4GMFA 4OYRA 4KWHA 3GVCA 4YAIA 3I83A 2QYTA 4RDIA 5EIOA 2OOSA 3A4VA 1HL3A 3BMNB 3GGGA 4ZA2A 2JAHA 3QVSA 1UDBA 2CFCA 1Q0HA 5KNLA 1HE2A 4ND2A 3FWZA 1U1IA 3R0IA 2A94A 3ICPA 5L95A 4CLXA 1Z7BA 1PSDA 4JP3A 4RQUA 5ITWA 4DMLA 5GZ3A 1XYGA 1O0SA 3NT4A 1WWKA 3CKYA 1NPTO 1SZJG 3EHEA 4BUCA 1T1SA 3AOGA 3ITDA 4Q3AA 4AJNA 4CMJA 2Y1FA 3SVTA 2AHRA 2YYYA 3GN1A 2Y1GA 1NPYA 2BELA 5CEEA 1GEGA 2DUWA 4RVSA 2EJWA 4XGKA 2WWRA 1ISHA 3ZWWA 1LEHA 2DM6A 5FWNA 2PTGA 3GVPA 1E6EA 2BGMA 3EZYA 1VLLA 4DXHA 1PWZA 1SBYA 3GFBA 4PN3A 3Q0EA 3MJ4A 1LSOA 5JSFA 2VWPA 3O8QA 3LT4A 3DHYA 3WLFA 3H9EO 1I32A 2HK8A 3GPDG 3I9JA 3HDYA 1LSUA 2DLDA 4Z9YA 4XYLA 3QLJA 4PG7A 5JNLA 4U7WA 4E13A 5LCXA 4ZD6A 2R2GA 2AE1A 3VH4A 5CP8A 3KYCA 1GPJA 3IQDB 4K6FA 3GOHA 4XR9A 2IXAA 3RBVA 1HEUA 3VTZA 1KIFA 3C7DB 3I5MA 5DZSA 2VHVA 4LRSB 3LVFO 2O50A 3E1KA 3KRTA 2A4KA 1HLDA 5LDGA 2GN8A 1KYQA 1FXSA 2PZMA 3TNLA 2AA3A 4YR9A 5K0ZA 3ASUA 1DXYA 4LVUA 4P4NA 1DO8A 5KJEA 4CL3A 4UEJA 1Y1PA 2RH4A 1UXKA 3I9KA 4U6QA 4XX0A 5T6BA 3FN4A 4XYGA 2Q2VA 1BTOA 1PTJA 4R68A 1N2SA 4EJMA 5A5EA 1VJ1A 1TT5B 4J4HA 4MVJG 1B8PA 3I9NA 2JFHA 3WNVA 3HWRA 1DB3A 3HFSA 2PLAA 3C1AA 4J43A 4ZQFA 4EZBA 4XIJA 4DPLA 1ZFNA 5G2OA 3ZWVA 3INRA 2Q1TA 1NWHA 3V8BA 2ZB4A 1Q2XA 4PLWA 5TC4A 3HE3A 4DPKA 4YCAA 3QQPA 4MP6A 4YEDA 4R5MA 2O4UX 5KOIA 2QRLA 3SLGA 1B7GO 1JQBA 4R01A 3WWZA 2O7QA 3CSDA 3C3XA 1Z7EA 4MVJE 1L7DA 1XKQA 4PLYA 3U4CA 1ZEJA 4EUFA 4XJSA 3IAHA 3DB2A 3DWFA 3IJRA 4NFSA 1T4BA 3H6KA 4J2OA 3ZWAA 1H2HA 1R4MB 4BB5A 1O9BA 4BO9A 3L07A 2I9PA 1A4IA 3EYWA 1I30A
chains in the Genus database with same CATH superfamily
2AN9A 3IOCA 4EI9A 2PJRA 2FEMA 3K2EA 5CXQA 3U09A 3PGKA 1GYQA 4EPTA 2CXOA 3RTEA 2A5DA 3MQ4A 4MV8A 4DXAA 2QPLA 4AWXA 1YHYA 1A9ZA 3KPUA 2H17A 3ZE6A 3C1UA 3PSHA 2CDAA 2WJPA 2ZSIA 1PZEA 3GFGA 4KGZA 2AJ8A 2A67A 2X86A 4AP9A 3OT4A 4LZPA 1TAHA 3C48A 1WO8A 4NFHA 1FX1A 3W5DA 3AJAA 4L8LA 4RTNA 4JOQA 5KHLB 1SU4A 5KVVA 1M33A 1PW7A 4MR7A 4GQAA 1L5KA 5ISMA 3DLTA 3O2QB 2SKCA 3U9LA 4ID3A 3QVTA 1VDZA 4XIFA 1OX6A 4QPPA 4Q7QA 1WE2A 3DE7X 2O2ZA 3GH1A 4M9SA 2YFHA 1ML4A 4G23A 4HH1A 3HB1A 4YMVA 2WJ4A 3TW4A 4FT2A 2ODBA 1R0BA 3ZIDA 1X2EA 2F9MA 3U61B 1JH9A 5FEUA 2NP6A 4NBNA 1CE8A 5HK8A 3INNA 4Z0HO 4KOEC 3HKBB 3HY3A 3NJ4A 1E2FA 4MKXA 3RJTA 4DR2B 2J33A 4LRQA 5A7HA 1Z15A 5HP4A 5AICA 4ZVQA 3FMPB 3QOFA 1Y1QA 3ZH9B 4Z7NB 4AJJA 2FW1A 2Y1OA 2XUGA 1INLA 4NBSA 4QJBA 3IJPA 2NW6A 2HFJA 1P2BA 1QRDA 1J8MF 3RREA 5KB3A 2BH2A 1QP8A 3NHPA 4OOEA 1ESEA 1JHXA 2FSVA 4MJXA 1J8DA 1IWBB 1IHUA 4RF3A 3SAJA 4XWTA 2DBYA 1VPWA 1XXHB 1CYEA 5FO1A 3UOGA 2GJAA 1K97A 3U3JA 2GFIA 2G36A 1UFRA 2HD4A 3R2JA 4WK4B 3TBKA 3SHQA 3WNCA 1O4VA 2P11A 2P4SA 5DHSA 2IZ7A 2ZI5A 3AESB 1W5AA 2QN2A 3K1JA 2OFPA 2MJLA 3JQ9A 3NX4A 4BAGA 1RLIA 2VJLA 2EQ5A 3DW1X 4GXNA 2FHPA 4W1QA 3ZW7A 3ZCVA 4YJKA 1Q1EA 5A04A 1GV1A 3ZDXB 5DM60 2GFHA 5JRDS 4J1QA 4OI4A 4DZTA 2WJGA 2ZIVB 3T3GA 3FLAA 4NMMA 4EK9A 1ODTC 4FGSA 4CMBA 1BDIA 4YHHB 1I1QB 3NGXA 1S5PA 4NBKA 3V1MA 2WQ7A 3RLFA 3Q1KA 4KAXA 3S2UA 1YMVA 1YE5A 2YWBA 3HV0A 1HFJA 5JAMA 1E3DA 4LRUA 4RNDB 1JW9B 3DTNA 3UWPA 3ZGYA 3KKLA 4NJEB 3MEQA 4HRYA 3FMIA 3U17A 2G3YA 2RHRA 2F64A 3FOBA 1WXWA 3N74A 5AM3A 4F92B 4GLBA 2W2KB 2CNKA 3IKTA 3QPWA 2FQXA 3UMFA 5JH7A 1E3WB 1I3NA 3BXOA 3SK0A 4DSAA 2GASA 4D8WA 3W5UA 1UEIA 1EBUA 4P7JA 5FOUA 5JCJA 4ZI3A 3WAJA 1P6QA 2VK8A 2PUJA 4KSBA 1TC2A 3IMKA 3BF8A 4MHOA 2AL7A 4YRGA 1SCJA 4FYVA 3OQPA 5CVUA 3SWWA 5HQ3A 1C7ZA 5E4JA 5BWLA 4P36A 3DT6A 5IXYA 4NBRA 4LZOA 2F55A 4CF4A 2Q3JA 2XEXA 3AUJB 4FYHA 2H31A 3L7YA 1K8XB 2Q1WA 4HK4A 4QOFA 2I29A 3N0VA 2Y1KA 2WD9A 1IBSA 3TMYA 4ZYXA 3HK2A 3ZUPA 1X42A 1PWYE 2PFSA 1H2YA 1PJBA 2J0EA 3IAM6 3GXBA 3OQ1A 3ZWKA 1J2EA 3OCYA 1X7XB 1OF1A 4I9UA 4ZO8A 5EE1A 4MWBA 4NNJA 1IWOA 1XA3A 4C7BA 2IEYA 1I4EB 2EBFX 2V59A 3QXJA 1KFEB 3DBRA 2RMKA 4Y9DA 3IEMA 3GGDA 3JWEA 2FSSA 1CPYA 4OQMA 4PZZA 5BSFA 4OK3A 1Y34E 2RHGB 4YJDA 3WGLA 1MJHA 2IYAA 3ONEA 3D1VA 5CFOA 1HDOA 1ZOLA 2I66A 3W2FA 3OTIA 3X2FA 4F5WA 1TEHA 1UT5A 3L8EA 4FFBA 2XVYA 4WV3A 1WF6A 4MVCA 1J0EA 4HUTA 4ITRC 2I1LA 4L3VA 4DV0B 1J1IA 1NJ5A 2C2KA 3JW8A 1V7ZA 2WUEA 5KTTA 1O08A 5TRTA 3EEIA 1QIGA 2EHDA 1MDBA 2BUBA 4FDAA 2V1UA 5JY6A 1X94A 4GHWA 3RS7A 2FOXA 1ZIPA 3DQPA 3FETA 4E2XA 2PO5A 4AI6A 1G6HA 1LLDA 2HQSA 9LDTA 1I0LA 2WJ6A 3GEEA 5H80A 3STYA 2JKVA 3VKGA 3DBLA 1E1CB 3X1YA 3O95A 1H0RA 2I7CA 5JASA 3GFQA 4ZZ2A 2RJ3A 3OIUA 4XASA 3QKRA 5F4BA 4IEFB 4FT4A 2J7PD 1HNNA 4DHEA 4WNYA 4PRLA 5BOSA 2WM3A 2F43A 1QQAA 4GDFA 1P2FA 3ND9A 4YCMA 4KFCA 2HMSA 2VXYA 4J16C 2JLSA 3RT7A 5JQGA 2IBSA 5TQVA 1O89A 4HDMA 2O8BA 2XYHA 1UBEA 1GFZA 1GZ4A 1VYVA 3TGLA 4WXYB 2ZJ0A 4EUSA 2H4XA 4QU0A 4NL4H 2PBZA 2JGKA 1N6LA 3AGQA 4B47A 4B43A 5A3JA 2VWQA 2H7VA 4RV4A 4LWZA 3ORYA 1X9IA 1DKMA 4UARA 1XOIA 3ECCA 1IBCA 1G1AA 2JANA 2Q6LA 3HY6A 3LA6A 1DOZA 1KL7A 1I9GA 1N0VC 3QJ5A 1TF2A 4EHHA 5BVHA 3PYMA 3IC5A 1ZGJA 4J0GA 1VRCA 4PS0A 2MR5A 3BRSA 5ENZA 5INTA 4GNKA 4JQOA 5FWYB 4US1R 4EFLA 5EKXA 1HURA 1ODJA 3UWKA 5AW4A 1LK0A 4A7PA 3AL2A 5AIBA 2QQGA 1OV4A 1DRUA 1JAZA 2EZTA 3UWOA 4QX6A 5LUBA 4F4DA 5CB8A 2EGUA 2X3FA 1EHCA 3ET4A 4WLVA 3OTOB 4L2IB 4WINA 5EMLA 1RQXA 4IOMA 5FOWA 4Q93A 2YXBA 5FBKA 1FYXA 4L8FA 4PLZA 3EDMA 1BNCA 1AZLA 2C57A 3D6VA 3ON5A 3O1HB 1E20A 1SXHA 2W71A 2GHRA 2IHZA 4CV3A 3ZC3A 4MLPA 5H9WA 3R3JA 4OB8A 1I5RA 2FRDA 1Z0IA 2B8JA 3IP9A 4MVJD 2PXCA 4RVHA 2ADMA 3CZCA 1PQUA 3LQQA 3ANMA 3W5IA 3NEAA 4O1IA 2ZVPX 4HMQA 4B6PA 1G20A 2XBLA 4MAFA 1EP1B 1NG1A 5HBRA 4AN0A 2C77A 2W93A 5JANA 2XW6A 3IJ5A 5IKXA 4XKJA 5JLJA 3PUKA 2O4CA 3G5AA 3G2HA 4Q39A 2PX5A 4XPIB 2H18A 1K6JA 4Y3UA 2QN7A 4LIPD 2D2IA 5HWSA 2HB6A 3OLVA 3WMEA 1ONNA 4G1CA 1M5UA 1ZGBA 2Q2QA 5AVTA 2VA8A 3OEHD 3ZOZA 4CN9A 3E9NA 4AP6A 4P92A 1JWLA 2WKRA 4B40A 1MZPA 5AW9A 5CFMA 2ZRNA 2C4WA 1NLZA 3B1ZA 2PYZA 2BFEA 3HB0A 4MROA 1TM2A 4GRDA 4RD6A 1JAXA 3TL2A 3TQQA 3EZLA 1SKQA 3ZZNA 1XCOA 4FDMA 4D02A 4B9EA 4JI7B 3NTUA 5B6JA 2JAWA 3NUQA 3WLTA 1OXTA 4PZ9A 4Q21A 4XD2A 5T7BA 1F8FA 3CRW1 1RJ9A 1KK2A 1WKVA 3C1TA 3PHGA 4KXFB 3QLEA 4X91A 3VZQA 1P33A 4OFXA 4D0RA 2EKQA 1J8QA 1HYHA 1B26A 3F97A 4FC6A 3F46A 1PO7A 4H4DA 2BKLA 3G49A 4MEAA 1Z82A 1N92A 3GFTA 3ACDA 1MAHA 2LKCA 3KL2A 4OXRA 4ALJA 3IX7A 4MV3A 2FMUA 4S0XA 3CMMA 4FFPA 2JLZA 4I9NA 4ZI2A 2R5NA 3WWOA 1Y8AA 2FJUA 2PUWA 1XA4A 4Q18A 1L5HA 3DM5A 2QBYA 4X62B 3RBXA 4DL9A 4M0PA 3W2TA 1OHHA 2CGEA 3JZFA 4Q4LA 2R3SA 2WUFA 4UHBA 5AKJA 4MGIR 4TMFA 3FUVA 4HRXA 3QX3A 1HTWA 1X8KA 2ZIUB 3L92A 2DP4E 1RKXA 2FPRA 1KQOA 3TLBA 3VYSB 4JYZA 1XQ6A 4CQMB 1I5OA 1SCUA 2WE7A 3IPYA 4TV8B 4ZTBA 4ARUA 4M53A 2A1TS 4C6TA 3H1BA 3O8OB 3QMWA 3KT0A 3IVRA 4RENA 4RFSA 3RRMA 2QQ5A 4OMCA 2JCBA 2XGJA 4QUIA 1CDEA 2WPNA 2XPCA 3MCVA 2CMFA 3KB6A 1HC7A 4IDCA 1M1ZA 1R9MA 5ILOA 2ZTHA 3RHZA 2ACVA 2IK8A 2Z1MA 4DLLA 3LY7A 1XCMA 3I01M 3LXUX 2WWXA 3KR2A 2AMJA 3QSGA 5TXGA 5IT0A 3QVXA 3WDMA 4PINA 1NI4A 2XB9A 3N28A 4ZT6A 4UMEA 3EMDA 3UXHA 9MHTA 1DMRA 2JH9A 3K9NA 5ERGB 5IMBA 1BYIA 3AFMA 3TTWA 1QLWA 1MRNA 1SJ9A 1W25A 3GXOA 3L8DA 4JMLA 4MV5A 2VJYA 3PUYA 4GM4A 5CNIA 5EKSA 3TNFA 2JI7A 1E18A 5FLKA 1AN9A 3UB2A 1NAHA 1UC5B 3DAPA 4NXMB 1C3XA 3LCVB 4PN7A 1E79D 4YX9A 3MINA 1HI9A 1B74A 1NM5C 2BFEB 1XHLA 2JGNA 1J97A 1CR1A 1Y82A 1HF3A 3G02A 4R6XA 4X7MA 1QYIA 4D3FA 2AK3A 3IDAA 3FTNA 3QIAA 5T3YA 2W42A 4JODA 4EATA 4NFYA 1B8OA 4TLAA 1DRVA 1JZSA 1NOIA 3USCS 5K0TA 2UZ3A 3D2CA 1W2GA 3MERA 4NY1A 3N6XA 2IGTA 1PLLA 1PTKA 5EVJA 2EBUA 2XTJA 1U5AA 2IXTA 4XPIA 4H35A 4W5TA 3RIEA 2BKVA 5CLJA 2WOJA 2XKKA 2Z5VA 4NU8X 3ZDAA 3C24A 3I30X 1DKRA 5A62A 2RGEA 2BJVA 2RK3A 4IF6A 2A4MA 4KR2A 1HE3A 1AHPA 2B4YA 1JIQA 1J0AA 5B57C 2B8TA 3HUEA 4ZOLF 3A1NA 3LECA 3CONA 1QS0B 3VRHA 2VRNA 2XIQA 3ZY2A 4ML3A 1HNWB 1KHTA 4KZPA 4S1TA 1TCVA 2XOXA 3G8YA 4DHWA 5J4HA 4HAUA 5ES3A 1S3FA 2FR1A 1D6SA 5K01A 2AI3A 4H0FA 1QANA 3PPVA 3OJXA 3AR7A 2GN2A 3WLMA 1UBSB 4PWZA 2W0SA 1X80B 2Z4SA 1ZUHA 2OA0A 2BMAA 3I23A 1JR3E 1YC5A 4ON9A 2PSSA 3LU1A 4JI8B 1W0KA 3N0XA 1YFKA 1CUFA 5EE0A 3AYZB 5FOXA 1E0AA 5FPYA 5B3AA 1E1QA 4MIYA 3PGJA 3JAMA 3NDPA 3UIEA 2VZ0A 5CPFA 1YDHA 5E0OA 4IJVA 2ZRGA 4W9NA 1VE3A 1NY6A 3EWIA 4C0AC 1V1JA 1Q7BA 3RJ5A 3LYUA 5A4IS 1OIVA 1GSOA 2O7VA 3ZVKA 3D4NA 4NH4A 2C9BA 4QPJC 5CUQA 4Y2VA 3T3MB 1SQFA 1RI4A 2ZK7A 3OFSA 3FB1A 4JCOA 4JYPA 4MI9A 2NYRA 4RA6B 4C87A 3WLAA 5TQ2B 2Q5OA 3FNQA 3G6KA 1PNTA 5A1TA 5KJCA 1XZQA 3PCRB 2RAUA 4ZU6X 1ZUIA 2ZSUA 4C3VA 4Q6BA 4KYTA 4OKNA 4JENA 1ODSA 1OH6A 3BQNB 4B74A 1GJRA 2XUJA 2CLEB 4TSKA 2GF2A 1W87A 1HE4A 4OAPA 4MUIA 2EIXA 4PGHA 1HWYA 1SBIA 3GRZA 2JIBA 3FHOA 1E1DA 3MLEA 5I9TA 1J42A 1ISSA 1DHRA 1SKYE 2B5VA 3DGFC 2FEKA 3ESCA 4TRMA 4QICA 1TVEA 4EFDA 4YRNA 1OKKA 2DKFA 3EIXA 3KXLA 3A6GA 2A6PA 1B76A 1DCFA 4PAWA 4XR4A 3RGWS 5I45A 1NQWA 5CVJA 1HT2E 1YZGA 1PT5A 2AZXA 2GZHA 3SKXA 2YJ6A 1GSHA 2XB8A 1EU1A 1DX4A 4XRRA 5CB4F 4JBXA 3UMGA 5F7XA 2YH2A 4P7KA 3G2KA 4FZRA 3W8EA 3GC6A 3VDRA 1QP0A 2C2HA 4XCXA 1TUBB 4PVDA 1BXGB 1N7HA 3HNPA 4J9UE 3UTDA 4NI5A 2D74A 3L9WA 3LHKA 4H16A 1ODCA 1TEVA 1Z45A 4P22A 3BIXA 3MTDA 3E3LA 4IG4A 1SXJA 1BOFA 1CW2B 4WKOA 5GQSA 4MRAA 4X0EA 4CLEA 2VRBA 2QRKA 1FQWA 2EAUA 4V1CB 4G56A 4E0BA 4QDUA 1N3IA 2CL5A 2ZPAA 3G13A 1DC4A 1OGYA 4G8CA 3ZZ0A 5SV2A 2IHBA 3G0IA 1F5SA 1KY4A 3Q7IA 3VUFA 2EKBA 1BEUB 3OWOA 3TW0A 2CXUA 1PTJC 5IJXA 4DMUB 2R6GA 3LPLA 4OYHA 3WLSA 4FUQA 1H2AS 2IYEA 4GLOA 3B3JA 4HQFA 3VOTA 3CLRC 3LK7A 4ZRDA 2QAIA 3A3YA 3FSGA 2BGWA 1W9MA 1KETA 3B52X 3HH8A 1EXDA 2ECQA 4EVSA 1K7CA 1D3AA 4CNBA 3VYRB 4HQ6A 2IS4A 3INGA 2V9ZA 1RWBA 2CD7A 3H65A 2MIIA 3QXSA 2GPSA 5LKRA 1Y1SA 1WHSB 5D7NA 5IH3A 1U28C 4ARZB 2G1AA 3UT6A 4C0QC 3KSBC 2DSNA 2PL1A 1AS2A 3VC7A 4YQEA 3W8FA 4BO7A 5DN6D 1JNXX 2VTVA 2AFHA 3KZVA 4FP9A 4RXUA 2BN4A 3OM1A 3QV2A 3W3AH 2XMSA 2AG5A 3KJIA 2YIVX 4NJEA 4RQTA 4XYEA 4RHXA 1U4SA 3IAFA 3GRFA 3DMDA 3UWSA 4KR6A 4Q9AA 3L8ZA 2BGJA 2VL7A 1Q77A 1VIAA 1E7WA 1W6RA 5AVKA 1ZC3A 4CM8A 2BEWB 4FYMA 4NYJQ 4ZHQF 5EZYB 2IH2A 4B4VA 2RG7A 4IDEA 3BBPA 4WUTA 5FBZA 1P1IA 5BT9A 2OXTA 4REQB 2FQQA 1M1NB 4BMXA 3BD6A 2XCOA 4BNTA 5JHHB 3FB4A 3VH3A 4PTYA 2ZKIA 3B8HA 4MW9A 1IFXA 3OFND 4QGAA 4MLCA 2C3PA 2NPIA 2XCRB 4ESVA 4Z9FA 1KKMA 3FIJA 5IKOA 2H06A 4BVAA 3NHJA 1IRXA 2PH7A 1UBMS 3QUQA 4BVKA 3KD2A 4MWCA 3IUBA 1S8FA 2E4AA 2Z83A 4IIGA 4F8JA 2FDCA 3RC8A 1VE7A 3H3JA 1A04A 5CA1A 1E89A 2R4QA 1RHKA 3KLBA 3IFSA 2ZB3A 1DUVG 1OIXA 1ZY2A 2DUUA 4PQRA 3G9XA 3K20A 1PKXA 1WDKA 3TLCA 5IPFA 4HVLA 1K89A 3MYRA 2CLIB 5KX5A 3S2SA 2XMGA 3EA0A 1H5UA 3IEVA 2FPGA 4PTLA 4BBPA 4XI9A 4EO7A 1GHTA 2YMPA 1IE3A 5FHQA 3K6SA 4TRRA 3AQ4A 4FOTA 3KO8A 3IO5A 4HNGA 3RB8A 3RSOA 5L8VA 1SXJE 1PCXA 2FFAA 3PA8A 4YNBA 4M0EA 1G9TA 3L82B 3LX6A 4UHJA 1IH8A 3AW9A 4F0JA 4D9BA 1WXDA 1XLTA 5ESDA 5HS4A 2O8EB 2WP8J 3OM8A 3UC9A 3UW3A 4CI9A 2NTNA 2AJTA 4LFBB 3UC5A 3V80A 2E21A 3M82A 3SIXA 1UMKA 2PX0A 2IZZA 1VL8A 4R69A 5EHGA 3ZIAA 3JQ7B 1JNYA 4RMNA 4G0PA 4MARA 1CC1S 3MUEA 4R8KA 2RSLA 2GEBA 3ESDA 1JZQA 3DWGA 1H2BA 4I66A 3J7AC 4C7JA 3INTA 4J94A 1UWKA 1G7SA 3HA5A 1D5CA 5EWJA 4BO1A 4L4RA 1YZNA 3R4CA 5D51S 2IV7A 1U7XA 2J9FB 2Q21A 5IP5A 1A50B 3V1NA 3P5BA 4YCSA 1A71A 2IBTA 4IVQA 3DOJA 3MRVA 4G97A 2AW3A 4C6TB 4JXXA 2GYWA 3HNOA 1Y4DE 5I8PA 2PKCA 1O97D 5JS8A 3K1TA 1REQA 2R62A 4GECA 4LSZA 1QMPA 1FYEA 1XGKA 5TMEA 3AR2A 4LXIA 2B8WA 4C4ZA 1KY5A 2B8NA 1FVFA 4Q1BA 1UDAA 1QYXA 2XMBA 5CGZA 5G02A 5I9SA 5FX2A 1TYZA 4TV9F 5HS6A 1YJBA 1EIZA 1RHJA 3G8BA 3PC2A 3W5CA 2C7BA 3I6MA 4GX5A 1HZZA 2XNHA 4B85A 1CXZA 3H0EA 3SSMA 4JAVC 3AY0A 1T5DX 4WCVA 5B58C 3NWBA 4ILEA 3TDKA 4P6VF 3IBFA 1YULA 1ZD9A 4HPJB 4QYTA 3DT8A 4G8DA 4M54A 3SXUA 3WLHA 2ENUA 4G4SO 3ZY4A 5TY0A 1BU8A 3CIFA 2WNHA 1U8YA 3GX1A 3O4IA 4MJLA 3LP8A 4G01B 1IXRC 2BMEA 1QE0A 4URYR 1TLLA 2ASEA 4PF1A 1L7EA 2XA9A 4FI3C 1DT3A 1M2EA 4LY6A 3USZA 4CDRA 2KI5A 2I1VB 3Q12A 4G63A 4PYQA 3KB2A 1TKCA 4NV1A 4R6WA 1JR6A 4PCVA 1ZIOA 2GXQA 1V41E 3MK31 3C97A 4E5NA 3PJGA 1TAUA 3E1GA 1ZICA 3E7FA 5EFZA 4DQ0A 3DTVD 3ENVA 3QEJA 4UXIA 1EX6A 2HO5A 3V4OA 5C46F 1J90A 4JYBA 1OH8A 1V35A 1G7CA 2IGBA 1HE5A 4IIUA 5K4AA 3GL9A 2OHVA 3O75A 4M8KA 4TLLB 3MTAA 4HDRB 3V42A 3NBYC 5HZMA 3OLXA 4CHGA 5BSKA 4F1JA 1EFUA 2O8CA 1AZWA 4IWXA 3REGA 5F9FA 2B20A 3H3XA 3MCUA 1AKUA 1G6KA 3BTUA 1SM4A 2I2XB 2GN6A 3HCAA 4G4GA 5EXPA 2YN2A 1C5KA 3GMSA 4RUKA 1G21A 3BXHA 3HCBA 3PWKA 1ZSNA 5JWRA 2X22A 1XF9A 2XAUA 3C3JA 3RR2A 4QG3A 3Q87B 4QOIA 1Y6QA 2YMLA 2ID4A 4HG2A 3ZI4A 5K8UA 2JAUA 3S27A 3KYIB 2BFOA 2WHRA 4KQJA 4ZQBA 3CF4G 5FR2A 1U1FA 1EDDA 3K8OE 2RAFA 4NARA 3DZIA 1H0SA 3N39C 5EMKA 2Z95A 3FYHA 2IY7A 2VK1A 2Y76A 4RKQA 2NADA 2NZWA 4WBNA 2BGRA 1KZ7B 3GARA 3WYNA 5BMVF 3GUYA 4JLPA 3JQFC 4TSRA 1Z5GA 2COEA 1EUCB 1XJQA 3LCJA 2DHRA 4V2UA 1BWQA 3UEOA 2HJHA 2IA5A 3X1MA 3VZCA 4WBNB 2CZCA 2CSUA 1L4GA 1N5LA 1VCIA 3GEDA 4NNOA 2C9ZA 4PSUA 1ZIDA 1GP2A 3LT1A 4LXQA 2V7EA 5EMNA 3GDGA 5IF3A 1WUJS 2BFBA 3H6HA 3W06A 1RCTE 3SG0A 2AX3A 1LBSA 4L28A 4MUHA 3WK4A 3R8XA 4BQRA 4YP7A 4DQLA 3KJNA 1Y3AA 3KUDA 4CYMA 5BNWA 2YMMA 1JBQA 2H9YA 1NA5A 2OGSA 4D92A 2YQ5A 4EIWA 2DHDA 4ZZ1A 4IFIA 2PMKA 3P32A 1DQRA 1LQTA 2G67A 4RKFA 4P98A 4TWRA 3JRNA 4Y9RA 5HF5A 2GEJA 3WLRA 1XLVA 4PVCA 4YRBA 1KZHA 1K8YB 4AKIA 1P2SA 2I4MA 2KYRA 4Q9HA 3BE5A 2X0DA 3D3KA 4XSVA 1I8TA 4DIBA 4FBGA 1PR6A 5DLEA 2JEYA 3ZCXA 1DC6A 1HQYE 1GUFA 1NM5A 2C8VA 1U2RA 1NC1A 4MCHA 2HY7A 2ENWA 4Y67A 2G4CA 1GNVA 3A26A 4DUYB 1SXIA 2H5LA 1Y9ZA 3FNEA 4EITA 4U63A 2R6JA 3LC0A 2QRVB 4HTFA 4Q3OA 4RE5A 2K2QB 4H7IA 1YZTA 4YBZA 3SYTA 4QAJA 1XZ8A 4H31A 3FTFA 4TKUA 1EGQA 3MAAC 3AVXA 1RP7A 4B35A 3G2OA 4AD8A 4ARSA 3PJFA 1JLKA 1II0A 4S3MA 4XWYA 1O54A 5I9BA 5G0WA 3TCKA 3DXYA 3NFYA 2C5GA 4MB6A 1YBFA 1TUBA 1YJAA 4JVNA 3QIVA 4BMSA 2P9FA 3TSOA 4A8JB 4X66B 2LCIA 4HNVA 4CUZA 5KJ6A 2Q7OE 4KUEA 1JE0A 1X14A 2YC4C 2GJ8A 1JT2A 4LZNA 1SBCA 5JVDF 2XF2A 1MKYA 1QDUA 1GRVA 4LJ4A 1RJGA 4ZC8A 3UHJA 4U0KA 3FRJA 1LTHR 5H82A 4RSHA 3ZCRA 1KI4A 2PLNA 1JQAA 1TLTA 1VE1A 2XNJA 4PAMA 4PO1A 3KR1A 4RPHA 2IHVA 3RFVA 2OXFA 5CR9A 3E9MA 2I33A 3FDZA 4NBUA 3B7GA 4RHCA 5TE9A 4QHSA 3WLNA 1FA9A 3U5ZB 5JH7B 4R3UC 4C43A 1YCDA 3PKJA 2GEVA 5L6LB 4RORA 3BILA 4IL5A 4RYLA 2I8LA 1SVKA 3L7LA 5T4EA 1W94A 1KEWA 1BG6A 2IYVA 2WFMA 3CPEA 3I1IA 3IR7A 2HI0A 2XNKA 4KOAA 4A82A 3MGCA 2KBEA 5AP9A 1TXGA 4JMPA 1W29A 2BBWA 4P4UA 3K6KA 4E2FA 1BVRA 2Q5LA 4Z4QA 4YMWA 4H1VA 4R8RA 3EWSA 1EE2A 1NMXA 3OQMA 4I8XA 3WK7A 1G6OA 5BPFA 4EKYA 2ORVA 1YRBA 1KK0A 1PGPA 4N54A 5SY4A 1ESDA 1OXMA 1KMIY 1GGEA 1TK2A 2OZPA 4YT8A 2PKQP 3D4PA 4OP1A 4UBLA 5F2NA 2YFQA 2QMHA 4I4TA 4B6QA 2C4MA 1P77A 4AULA 4K9NA 4PXSA 1BD3A 3PTZA 5CJJA 2XZOA 4P4GA 3T3OA 2M6LA 3EF1A 4FFWA 5IVKA 1SIBE 1OZGA 1CB7A 1PEKE 3K73O 3RVDA 5IM4A 4RHYA 5EIBC 2JBWA 2Z2KA 3AXSA 4P80A 2CYCA 4RV9A 4JOBA 5KYXA 1ONOA 4KVFA 2YTZA 3CN9A 1XVUA 2WIFA 1Z2EA 2YIDA 1PQ4A 4R98A 3RAJA 4C03A 1NKVA 2VDQB 4LMAA 4NIMA 1QRRA 1QGZA 1VI2A 3MWYW 1HUQA 1JS1X 4NV3A 3RSLA 3TL3A 4TMYA 4EH1A 1IRIA 3HUTA 2XH8A 1AS0A 3CPSA 4DT1A 3TUIC 4TRJA 1QORA 1QG0A 3LKVA 4JU8A 4TTIA 3RJZA 4JVOA 4K1LA 3S1LA 2ZZMA 1JIUA 1G60A 3W2HA 1P2TA 4RK6A 1SPXA 1RYNA 2MCFA 1JHOA 3UJ9A 4OYLA 3M0EA 3PFKA 3HDTA 1JDSA 2P3OA 1HKHA 3M6IA 1EFVB 2VBFA 4X9XA 3W3AD 3ASVA 1U0LA 1YDWA 3RQIA 2ZJ7A 3IESA 1H69A 4JP5A 2QRJA 3D54D 1BH2A 1CQIB 2O5RA 2R6DA 2D4AA 2N47A 4F3RA 1V39A 1JXMA 2H51A 2XOEA 4WZAA 2JK0A 3GUZA 4ZEWA 2DPLA 1RM5A 3DDNA 3T8YA 2Z8XA 3PT9A 5AJZA 4G5GA 1GXSA 2JGFA 2OV4A 5GZ6A 4C89A 3DDCA 2B7BA 2OESA 3T38A 5J5AA 4CETA 3O4GA 4X1YB 1OC2A 1KRWA 1U8EA 3I32A 1S3SA 5I9LA 3ELDA 1V26A 1X2BA 3GCDA 3W79A 1CQJB 1I4LD 4YRDA 1I24A 3ECAA 3QFSA 1JR4A 3P45A 3EQ7A 4M7RA 3HKCA 1DKPA 2RK4A 3QI7A 4R9RA 3U3XA 3C7TA 3B78A 3DLPX 3LF2A 3JSAA 1VPEA 3T7DA 1E1YA 2CCKA 5B3KA 4AX8A 1NLMA 2WA2A 4BP8A 3UJ8A 2H1VA 2VAPA 2WDPA 3T1QA 1A2KC 3I6QA 4N7RA 4Z6KA 3RUPA 4BLOA 1WTAA 2NUAA 1ST2A 3EMBA 4DMCA 3MWDA 4L6AA 3VR4A 2VH1A 4GWGA 2EV9A 3QMMA 5FWDA 3L0OA 1Y7HA 4F9TA 1OUMA 3NYIA 5L3ZA 4YACA 4BNIA 4DILA 3WE7A 4M9CA 4D9GA 2OBFA 4G1MB 1VA5A 2DECA 4HNRA 1QIHA 3S2IA 2PZBA 3VHXB 3AW8A 2X7JA 1U2EA 3FR8A 2OT3B 5G40A 4FFSA 2ZG6A 1ZK1A 3DLIA 4M1WA 1FS5A 3RRFA 4E03A 1FFDA 5HMLA 4H7HA 1QONA 1GZSA 3AFGA 1ZH8A 3C6QA 1G4AE 1AGXA 3DXZA 2YOFA 3P9PA 4GU5A 3EK2A 1XZFA 3JQDA 2QL7A 3DOOA 3OIGA 3HO1A 2CXRA 2C4NA 4M38A 5JQGF 2WIKA 2VDOB 4V0LA 1ZO8A 1TK3A 3TEJA 1PGQA 1R0SA 3PHCA 4Q47A 3C6KA 1D1TA 3F8TA 4RGQA 3RKRA 4DCCA 4QXRA 4MV7A 4YRTA 5CFPA 4BLPA 1IVSA 2XA2A 4CKWB 3GJSA 2HZBA 1SD5A 5KSPA 1WR8A 1PJAA 1NT2A 4HS4A 4DOMA 1B8UA 1W30A 1OZ0A 2QE7A 1VP9A 2XE7A 4ER5A 3K6SB 1AXGA 1A4UA 2ONCA 3ITKA 1E1NA 2VVTA 3LUPA 4GXTA 4OH1A 3EWAA 3FSEA 3IV7A 1NHWA 2H2FA 2OD2A 2QA5A 2WYUA 5E7QA 5ED4A 3PVZA 2REBA 3WB9A 4BEBA 4NE2A 3HJAA 3URMA 3N58A 4EPXA 3ZNOA 1A4RA 4OPMA 2HBRA 4NDZA 2R8RA 4E1VA 3QVOA 1K3UB 3E3OA 2OHFA 3A3KA 4BKUA 5TNXA 1Q0UA 4QA9A 1KTIA 2VYVD 3ZHTA 4DLSA 3IGFA 4H1HA 5C7LO 3A1DA 4I55B 1WBDA 5JALA 1AV6A 1T34A 4GI5A 3DNPA 4Z5XA 3K09C 4ZQHA 1GNRA 3SJAA 4AJPA 1UAYA 4KQKA 3OH8A 1M5RA 2OFXA 1KYXA 1T1RA 2WOOA 3PVCA 3G79A 2B7LA 3BB3A 3MJSA 2MYUA 2OHXA 4TWIA 3TXAA 1EXMA 2PBFA 4RELA 3VU0A 3H16A 5CW1A 4HGQA 4IAOA 5IYZF 1PE0A 3M5DA 1J2TA 4YN3A 4DVJA 2RARA 1T4DA 4RL6A 2V8BA 2Q6VA 3DMTC 4B33A 2BCEA 4EJ0A 4RZ2A 4EW6A 1QVAA 1V95A 4QUAA 1OX5A 1MVOA 2BVNA 4MVJI 3FNBA 4UASA 2CNDA 5E9QA 3TNDA 3RSQA 3R3VA 2IHNA 4LJKA 4UAVA 5JAHA 4YIHA 3TOVA 1W8IA 3EXAA 4YLYA 2X0JA 3OJ0A 5BSVA 4GVXA 2MSDB 4UPDA 3OJOA 1W19A 3G8AA 3KQWA 5G41A 3I2KA 4ZYZA 2H7CA 5L4NA 1T26A 2FZLA 2XCQA 1BHQ1 1UOOA 2JEOA 2VSXA 3P2OA 2FW0A 4KRFA 4RMJA 2P9BA 3ILXA 1ZUNA 3O94A 3V7FA 2YWRA 4UNIA 4CV2A 3LXMA 3KOWA 1D07A 1SXQA 1IB0A 1UUFA 2AQ8A 3A6DA 1UC8A 3L01A 3QRWA 2ZUVA 2AOWA 1KI1A 4NICA 2JIZA 1Z75A 3IVXA 4D7AA 5KBYA 3IQZA 4UE6A 2CJPA 2FX2A 3O7MA 1ECCA 1Y9JA 2PD4A 3AOEA 4TUYF 5J1TB 1V5IA 4KJXA 3UG7A 4XIYA 2NXCA 3ZCUA 5IKPA 2JRLA 5DASA 3QKIA 2H1CA 3LDAA 3OPVA 4M0LA 5AOVA 1W36B 1FNDA 1B2RA 2X1LA 3IYLW 1L5LA 1KFKB 1EQ2A 1L1QA 1OBFO 1IY9A 2H8KA 4KAAA 4CM1A 1Q21A 1GGKA 2VYNA 4A0FA 4MUBA 4OHVA 4YK7A 2QRNA 1WHTA 2BKAA 2V6IA 3KWMA 5I4BA 2GVZC 1SHJA 3H7AA 3KUXA 1PS0A 3MRTA 5M29A 3EA4A 2RI0A 3OZAA 3GBVA 1M66A 1TEXA 4CL0A 6CHYA 5KQRA 3TW8A 1KOGA 1JFLA 3UAOA 5IDYA 1NI5A 3U4GA 3PC4A 4ZCLA 5EJ6A 1EK2A 1KEEA 5BRNA 4DNXA 1ULUA 4RVGA 1SZCA 5F21A 4HJXA 3VX3A 1KJQA 2UUCB 3WRYA 2G1PA 3OJFA 3S29A 3TIVA 5CFRA 3KHSA 1N2EA 3QI2A 3BK2A 2B7CA 3QTBA 3WVNA 2BFAA 4PGMA 2FP4B 1A7KA 3DVAB 3IIMA 3I8OA 4BVHA 5DTRA 5KNBA 2H0AA 3H0KA 2DX7A 2EXXA 3CW9A 1IJKA 4FFMA 4YUVA 5EIWA 1CERA 2VK2A 3SZLA 2PSDA 1YACA 3V2IA 1YJ8A 5HE9A 3FA2A 3DZHA 3LO8A 3SKVA 1JEYB 5CYFA 1WB9A 2E18A 4EI8A 3L8HA 3KDAA 4NZMA 2JC3A 1UADA 1X7YA 5M5BA 3CNOA 2X76A 4OP2A 2AZ4A 4J76A 4D6XA 3BJMA 3FSRA 3T0FA 4AJNA 5JAQA 1NQAO 1G5FA 3QVUA 4DUZB 2XA1A 2GBPA 3OAAA 4UVEA 4MJ3A 4OJQA 4HVAA 2HMVA 4ND5A 3W6OA 1YQTA 2RHTA 1FP2A 4XFKA 2ZKLA 4O4JA 3BCRA 2PS9A 5TQ2A 4UOZA 4L6CA 2M6KA 3V3KA 4GBED 3EXFA 5CIQA 3FPLA 3NU1A 4LGMA 2IEDA 1HQKA 1UK8A 3DYVA 4R16A 4REOA 2Q4RA 1CE8B 4L9RA 3ROMA 5BUQA 1C9KA 4UEQA 5I7RA 3EBLA 1RADA 2CMDA 3EYAA 3SMQA 3T4PA 1GL3A 2XVZA 3HC7A 3LZCA 5CA1B 1I6LA 1YE8A 2RI6A 1G2QA 5LVAA 1QYVA 3GWZA 3CJQA 1S3GA 4YMLA 3AETA 3GRAA 1H0KA 1UWVA 5BRAA 2Z2JA 4R83A 3CF4A 4TLBA 2RAPA 2IYYA 5HRCA 1C3VA 4MQLA 1I2BA 3SX0A 1GU0A 3M1AA 2YHSA 5D3ZA 1YQQA 1Z6GA 2FEOA 3P4YA 1KZ6A 1X1AA 3CLUD 3VHLB 2OV8A 3L5OA 4URHA 4PO8A 1NNLA 4S1OA 1MQ8B 2BHLA 2IBMA 3TIFA 3KQLA 1NJGA 2IIPA 2WDZA 4GW3A 4IJKA 2FZGA 1N2CB 3A4IA 5DNDA 2NPOA 2CF6A 2AI2A 2XOKA 4RPCA 5C5EA 5G53C 5KDDA 3S40A 1I7NA 5KYTA 1RPNA 4QOGA 3ANXA 3V8PA 2B1QA 3OJCA 1U94A 4UEOA 2F00A 4ZJZA 1MR3F 3C6MA 1IJBA 3CJTA 2IPLA 2Y27A 3P2KA 3SR0A 5BSHA 1JFRA 4FB5A 1SC9A 2ZIXB 3TMAA 5FUBA 1P39A 4PYLA 4F6RA 2VLIA 1PIWA 1ZM3A 2YMQA 4UFOA 5IVDA 2BGUA 5A2GA 1AO0A 1KEVA 1XG5A 5ECYA 3JY6A 4TL8A 3IE1A 2I6SA 2VHYA 3VZSA 5JYBA 4RY0A 4F5YA 3PXUA 5KMGB 2FUG1 4RLHA 3LKZA 1VJ0A 1NW3A 3HBNA 1A5BB 2G40A 1ODIA 4IYRA 3OZFA 5LQJA 3CT4A 4GYYA 1JKFA 3VU8A 4QBKA 1PL0A 3EB9A 3PD7A 4MYHA 3P2MA 2PRYA 3HJNA 5JMPA 1V9LA 4BNJA 2QNIA 2VT6A 3EVFA 3FM9A 4MGHA 3FBGA 3LPNA 3RIYA 5BUZA 2M98A 3L0YA 1IK4A 3WHPA 1VLMA 1HL7A 1TADA 1DJQA 2VNHA 3TD6A 3THOA 4A03A 4F9EA 6Q21A 4F4CA 4ESHA 4US2R 4GE3A 3IODA 3HVRA 5A02A 1PZFA 2OGZA 2PT9A 2F17A 3LW8A 4GG1A 2A33A 1FMLA 3RDPA 2V9PA 4JI4B 4EYEA 4B3XA 3LQ2A 4WKCA 4MWGA 1ENOA 3ZE9A 2Z6UA 1JDNA 3A06A 1HDRA 2HXGA 1JG7A 1SD1A 3I9V1 3WHIA 1I6WA 3JQ9C 2W6QA 1YJCA 2FW8A 4R4JA 3J80A 4BRUA 2V3CC 2HO4A 5HQJA 4RTLA 2CLLB 1ORVA 1Y8RA 4TXHA 3RAPR 4KGDA 3FZNA 4U0JA 3ZLBA 3KAPA 2IEZA 3JAKB 5AI6A 1IG0A 4DTCA 1T2NA 3EVNA 2PPLA 1AGYA 2P9YA 3L6DA 4PYNA 5DTIA 4EG5A 2WZCA 5CG2A 4Y2TA 3L0SA 2R4TA 1BEEA 1R4MA 2E7ZA 2PKEA 2VUTA 3V1YA 4DR5B 3NHYA 1IAVA 1B73A 5CA1F 5LXTF 1YR8A 4LUCA 5KNDD 5HIMA 2OP0A 3C0KA 2G1UA 2RH8A 3WRYC 4B32A 5K8VA 3QHPA 5A5FA 4GR9A 2ZAMA 3AVYA 1G9XA 3PDIB 1DBRA 4GD3Q 5EJIA 2Q6TA 4Y2HA 2QVBA 4UUAA 1Z3CA 1SOUA 1SRRA 3RSFA 1EFDN 5A9SA 5JPDA 1J0BA 1P5FA 1P6UA 2WI8A 3FJOA 3UCEA 1R2QA 3F2VA 3Q9NA 3FOZA 4YRMA 1KY3A 2W4QA 3R1IA 1VHQA 3NWJA 4MCIA 1O97C 3FE2A 5M04A 4Z1MD 5BR7A 5TEVA 3WXBA 1EWRA 1X1CA 4K9OA 4AMGA 3AF3A 3H8VA 3RC7A 1N2ZA 3X0DA 3ZJ5A 3AVWA 1GO2A 1PWEA 4MW4A 3TJZA 1XQWA 4K9KA