1NASA

Sepiapterin reductase complexed with n-acetyl serotonin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
b'ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEPIAPTERIN REDUCTASE
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 97
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nasA00
3QWAA 1ONNA 1KY4A 2Q45A 3PQEA 3LT4A 4BGVA 4I1IA 5CEFA 3ZHYA 4D41A 5GZ6A 2W98A 3G1TA 4Y6SA 4OYRA 1VLLA 3KSDO 3WICA 2NQ8A 4A03A 4R9SA 5AXBA 1XU9A 2VRCA 1WWKA 5F1KA 1U4OA 3U4HA 5B4VA 1D1SA 3WIEA 4Q3EA 3S2EA 3H5NA 3LT1A 4E5PA 2VNSA 3GVIA 3RFXA 5H81A 1LLUA 2FSSA 2WDZA 2IYOA 3C1AA 5DN9A 1DO8A 1UAGA 2NSDA 3FF4A 3WIDA 4D3DA 2PV7A 1N7HA 1GCOA 1ZXLA 4HUJA 4FFOA 1O6ZA 3M2TA 2BLLA 1HETA 1F8FA 3H2SA 1IZ9A 4DLLA 1GDHA 2HK8A 5EQDA 5TSDA 2VT2A 1CRWG 5A02A 4BL5A 1BDBA 2B37A 1NQ5A 1B3BA 3FI9A 2JAPA 2PD6A 2Y1GA 4IINA 1GAEO 4WEQA 4NJOA 4GGOA 3RBZA 3RFVA 4EGFA 1GYQA 5B4UA 1TXGA 4UAGA 3DHYA 4YJDA 2AQIA 2CF6A 3PYMA 3S2IA 3G1UA 1B16A 5CHEA 2VRCD 1R66A 4IBOA 1DRWA 3TRIA 1IE3A 3KUXA 3MJ4A 4DREA 3D3EA 4FFLA 3WWZA 3TSCA 5BSFA 2Q99A 5GMOA 3RI3A 4RQUA 4URFA 4YRDA 4OAQA 1B15A 2WE7A 2YYYA 9LDBA 1N1EA 1HDRA 1E7QA 3GA0A 3MJTA 4OM8A 1NM5A 3IS3A 3ROMA 4UVGA 1QYCA 4CR6A 5JDCC 5I7VA 1P33A 5B4TA 3JTMA 1J4AA 1UP6A 1V8BA 4IIVA 4MP3A 4ND4A 4O59O 3Q1LA 3TZQA 2X6TA 3TF5A 4YT4A 3HB4X 4FC7A 4DL9A 1NQOA 3OSUA 3F9IA 4Z0HO 5ENDA 5TC4A 1ZNQO 2D0IA 2O7SA 1E1KA 2VZ8A 1BMDA 4Z0TA 3E5RA 3WGGA 1P1FA 1PL6A 1DOHA 4CMHA 1EEHA 4MKZA 4QTZA 1A7AA 5I9NA 4E2XA 5IDQA 5IXYA 3WTBA 3KLMX 5IAAA 4XCVA 4M54A 3VAZA 4II3A 3DL2A 4HNGA 2Y0EA 4F6CA 3RCBA 4I9HA 3ZZNA 3N74A 3ZWWA 4EEZA 1EFLA 5LCXA 4Q39A 3TOZA 1KEVA 1JA9A 2XF8A 5F5LA 4IDFA 4CM4A 2D8AA 3UXYA 3KV3O 2QRLA 3GNTA 3DBRA 2OHXA 2QZZA 4D3SA 4I9NA 4JGBA 4OKIA 3ANNA 1OFGA 3LVFO 1QXSA 4DIFA 4KTVE 1EUZA 1PJ2A 4TSKA 4J6FA 1D4FA 3HE3A 3QWFA 1CEQA 4Q3NA 2DFDA 4XEHA 4B4WA 4PLYA 4RLHA 5A05A 3L07A 4CM9A 2FHSA 8ADHA 5ICSA 3U09A 4IJWA 1PJ4A 5JO9A 3I1JA 2P4HX 2QYTA 4PG8A 2WEKA 1HTBA 3OICA 5T5QA 4YT8A 3L0DA 5LDGA 4B8ZA 2ZQZA 3P2YA 3ZV3A 2WYWA 4NHEA 2VZ0A 3OJEA 1ISHA 4CV3A 4MVJM 3GPDG 4N5MA 4MVJG 1E3SA 1P9LA 4RVFA 4LVCA 4XB2A 5G0VA 4AJEA 2GZ3A 1VI2A 2A92A 5A9SA 3LYLA 5EPOA 5IZCC 5TF4A 5KJEA 4U0JA 1N5DA 1BRMA 3ICPA 3SXPA 3ZV5A 2O7QA 4KDEA 2G1UA 4EW6A 3DZFA 4WLVA 1IPFA 1TB4A 3ASVA 3OETA 4NJMA 3VH1A 2ZTMA 1X7HA 5C5IA 1DHTA 1GZ6A 4YT5A 4EZBA 3JYLA 4GH5A 2NU8A 3ONEA 3IJRA 4P38A 4XR4A 3RUDA 3SX2A 2X9NA 3HB5X 2CNBA 4Y98A 5U4QA 3WBFA 1LU9A 2O48X 3KSUA 2XPCA 4DMMA 4TRJA 2PFGA 4BNFA 5EMHA 3AJRA 4JNKA 1YBMA 4YQZA 1HEUA 3T4XA 1W8DA 4UULA 4AJKA 4JJFA 4R3NA 1SBYA 3GY0A 1D3AA 1YOVB 4J1NA 4OL9A 1PSDA 2Q49A 4DVJA 3ICCA 4RQTA 4XYMA 4CM5A 4QEDA 2JD2A 3COSA 2Q46A 2OORA 1R6DA 3AI3A 4BQPA 3ZU2A 2A35A 2HU2A 4O5OA 1S6YA 5I7SA 3AY3A 1NQTA 5DULA 3CTMA 3MCVA 1H9AA 1XYGA 4YYZA 4Z3DA 5DBFA 5KCZA 1ENYA 3WWYA 3KHUA 5FI3A 5HS6A 3V1UA 1U2GA 3KYCA 3L6DA 3RC2A 2I67A 5FWNA 1DBVO 3EY4A 1Z7BA 1XGKA 4G65A 4KMSA 2HMUA 3GZNA 5CP8A 4C7KA 2X1HA 4YWJA 3PHJA 1KVUA 3S8MA 3ZU5A 4EJ6A 3WGIA 1Z7EA 4ZQFA 5G0SA 4DBZA 3Q0EA 3JV7A 5TLSA 1E7WA 2BELA 1JQBA 4R41A 4BOYA 4E2YA 5BSEA 2OL4A 4I08A 4K26A 3PXXA 4BKRA 4E6PA 3PVZA 3STHA 3GEGA 4D45A 3VPGA 4ESOA 1A71A 1JWBB 1ISIA 1J5PA 5B37A 1JDJA 5CDGA 1SC6A 3T7EA 3H65A 2VN8A 1X0VA 3HN2A 4K9DA 1E6EA 4B4OA 4YB8A 3DR3A 3JQBC 4M55A 3ZNOA 5J23A 1BVRA 3FTPA 4FIZA 5JDCA 2YHIA 2JHFA 1ZK3A 3WJ7A 4IQGA 5DCWA 2BFAA 3KBOA 4GX2A 3JD1A 2I65A 2EKPA 3ST7A 5K0ZA 1EFKA 5C7LO 1BXZA 4GWGA 2IZ0A 5CG1A 1LSUA 3QW2A 1HDZA 3F5QA 3JYOA 3GH3A 1RKXA 3DQPA 1O0SA 1JAYA 5TGDA 3RUHA 2AEJA 4DIOA 3QWHA 3DFZA 3ORFA 1H2BA 4KQXA 4BO2A 4YACA 4F3YA 1ZZEA 4KUEA 2O2YA 5TS3A 1I3MA 1UZMA 3KEOA 4II2A 3TZ6A 4E5YA 3ITDA 1GUZA 3DAFA 2FR0A 3ETEA 4MVJF 3DDNA 2DM6A 2QX7A 4BO4A 1GD1O 5JAMA 4WLEA 4XYGA 4W4TA 1A27A 2F00A 1GPDG 1E1MA 4JBHA 1P74A 8LDHA 4H7PA 4GMGA 1JLLA 3BMOA 2CDCA 4ND1A 4BNKA 4XQCA 4J7XA 3SJUA 3F1LA 3B70A 3U3XA 4RVHA 4CLDA 3H9UA 4RCVA 1CIVA 2EGHA 2O50A 3NDJA 4IDBA 3HWRA 4UVHA 1LDNA 4F6LA 2J3JA 1S7CA 2AG5A 4NG5A 3PDUA 1KS9A 3DWFA 5JO0A 1I10A 2I5PO 3ENKA 2Q4BA 4OOFA 3C7CB 4IXTA 2B5WA 5L53A 3ON5A 1LA2A 1PQPA 3IUPA 3L6EA 1ISMA 2HUNA 4GLLA 1UXIA 3VDQA 1PGQA 5I8ZA 3WNVA 3D3WA 3AI1A 2LDBA 2P9GA 3KLPX 3OF2A 4TKLA 3W6ZA 3IIEA 3I9JA 4L9RA 4NBWA 1XHLA 4MIOA 2OUIA 3GG9A 2GUGA 3AK4A 1E7SA 1ONPA 4CL3A 5CDUA 3P7MA 4YRBA 2E48A 3V2GA 5IZCA 1Q0LA 2X0RA 2DU8A 3I83A 5THKA 2ZB3A 4PLHA 5H82A 2OXIA 4R01A 4WLFA 4IGEA 3JYPA 3PQFA 5L9AA 2DBVO 4PLFA 2OO5A 5ES3A 4BMVA 2YJZA 5KVQA 2CSUA 1C0PA 3JQ6A 2E49A 5DF1A 2YZ7A 3I4CA 2RHRA 2NV6A 5C7OO 1JU9A 2C2YA 3PZRA 1F12A 2NTJA 1KVSA 1Y81A 4DPMA 3CPSA 5JYDA 5COBA 4ZQBA 5L4NA 1PWZA 4JROA 5A5FA 2D5AA 3B20A 4NFYA 3K30A 3DOJA 1AHHA 1R15A 4RF2A 3TJRA 4CM4B 1CWUA 3L4BC 3FSRA 1OMOA 2WYUA 3DBRB 3U62A 1MP0A 1Q0QA 3JD2A 5JYEA 3IC5A 4CL8A 2V6FA 1R4MA 4BNTA 1Y8QA 4JQCA 1CJCA 4WEOA 3TOXA 4MP6A 3AU8A 3BTUA 3Q3CA 2Z1NA 3A1NA 2FN7A 4HFRA 1D1TA 2P91A 3PK0A 3VOSA 1BVUA 3ROKA 4OSOA 4ZD6A 3VZRA 1WP4A 3IP1A 1ZEJA 1L7DA 1MFPA 1I33A 3NGLA 2Y05A 5KOIA 4WPGA 1DLIA 2SCUA 3JD0A 4UUOA 1RM5A 1PQWA 4U0KA 4CQMA 1G0NA 2RBEA 5L95A 4FJ2A 3WMWA 1PZHA 1U4SA 2AW5A 1AE1A 3KYDA 1UXJA 2Q50A 1KEUA 4R4JA 7MDHA 5AXDA 3M1AA 2V7PA 3DBVO 4GX5A 3QV1A 2CVOA 3I52A 1EVIA 2YV3A 3IMFA 2IXAA 4QX6A 2XOXA 4XJSA 3BTVA 4HXYA 3LSYA 5G4LA 4XQ9A 2QIOA 2DLDA 4BUCA 4I5EA 1BW9A 4K6FA 3SBOA 5A9SB 5BSHA 2X9VA 1HKUA 2O3SA 4FGWA 3Q2IA 4ZHSA 5T8KC 3ZWXA 3ROPA 1YDWA 1UDCA 1NPDA 1YE3A 3JQBA 1GUYA 1PS8A 2IDZA 1PGNA 3CINA 1PIWA 3UW3A 5BNTA 1I24A 2O3QA 3DTTA 4L73A 1GADO 4E21A 4CQMD 1UDBA 3GR6A 4NJMB 3ZWBA 6LDHA 3I4FA 2UVDA 3TWOA 3W4KA 4YT2A 5EESA 3QVSA 2C07A 1X1TA 1LDEA 1DSSG 2EEZA 1E6UA 2RCYA 5L3ZA 2Q2WA 3PFFA 1A4UA 4GVLA 1P1RA 3QJ5A 5JCXA 4M49A 2BKAA 2RHCA 2Y1DA 3ZHXA 2VWGA 2ZTVA 1OOEA 4XQEA 4IDEA 3WNQA 4XGKA 2DTXA 2EWMA 1VM6A 1V0JA 2VUTA 4PFJA 1H6DA 3W4JA 3D1LA 4KDFA 1JW9B 1Y5MA 5U1PA 1GTMA 5HWSA 4DC0A 2DQ4A 3IQDB 3KB6A 1HE4A 4XGNA 3MWEB 1Z75A 4BNMA 2C2XA 3ANMA 4RGBA 2CD9A 4RZIA 1KVRA 3PGJA 1M67A 1ZVMA 4Q3AA 3F4LA 5DT9A 1NP3A 3WOHA 5HS4A 4XYBA 3NV9A 1C1DA 4AJ4A 3OA2A 4KUHA 1E5QA 4DUPA 1M6HA 3KRTA 3BMNA 3KYCB 2W2LA 4N7RA 4OJNA 2VUUA 1YBVA 2ILTA 3ZWVA 4A0SA 2Y1OA 1J49A 1IZ0A 1H9BA 3PHIA 4TWRA 4IJVA 2I99A 3GZNB 2R6JA 1T4DA 1NTOA 1SCUA 3IDSA 5CG2A 1T2EA 4BNLA 1GQQA 5A9TA 1V3UA 1JN0A 1QKIA 1Q2XA 4PG4A 4HADA 1UXGA 4JJGA 1HDCA 2XAAA 5HM8A 4HNHA 3L9WA 1IHYA 3PHHA 4XZ3A 5IDXA 1PJQA 3RUEA 1VL6A 1H2HA 3ZW8A 2Y67A 4GSKA 4J9VA 1PS9A 4FN4A 4HWKA 3QVWA 3S2GA 4AJLA 5ITWA 5TNXA 4P4GA 2VHVA 4GPD1 4FFRA 3LZ6A 3U0BA 3BZUA 3BXXA 4YJFA 1QLHA 3WGZA 2ZKLA 1PJSA 2W2LD 5I7EA 2V65A 2Z95A 4IQ8A 3MJEA 2YHIB 3G3EA 2BFPA 2VRBA 4JP2A 1Z82A 3O9ZA 3UCXA 1U3UA 4OIMA 3R0IA 3OMLA 1NFRA 2AXQA 4RV9A 3JQ7A 3C1OA 4ALKA 3MJCA 4JJIA 2GO1A 1PZGA 3X2FA 4IY1A 1FF9A 1ZEMA 5A04A 1TA4A 4U5QA 2QRJA 4CUZA 4AJ1A 4G81A 2NQTA 5A9RA 1XDWA 3ZW9A 1EUDA 1BWSA 2ET6A 5F21A 3BHJA 1MA0A 2B4QA 4O1MA 1DFIA 2WWRA 3PJDA 4E4YA 3PRJA 1ZO8A 5H83A 3BYZA 1NAIA 1ISGA 5A4DA 4IQ0A 2QQ5A 4FQ8A 5AXCA 4IIUA 3EVTA 3ZNQA 1SO8A 2VUSA 4IS2A 1ZFNA 2OZPA 3BAZA 4PRLA 3RKRA 3VKUA 2CF5A 3L4BA 2NU6A 1ENZA 2UUOA 4AJOA 2UV8A 1I36A 3K2BA 5JFOA 4HBGA 4Q3BA 5EIOA 1YONA 3BMOB 3MOGA 4LVUA 5EERA 5FFFA 4EITA 1HYEA 5JCJA 2PY6A 2W8ZA 3VZPA 3HDQA 4M1QA 1B26A 4PN3A 5I9MA 3TQHA 4MP8A 1I3LA 5JAQA 2EF1A 5THQA 1DAPA 1NFFA 2JCVA 4J90A 3TN7A 5C37A 2GDZA 4BO9A 3O03A 4R5MA 4ZQEA 1A9YA 1XQ1A 3DONA 4D0SA 4M86A 4XB1A 2JKVA 4A5OA 2P9CA 1PZFA 2FZWA 4QUKA 3UFXA 2EW2A 2FRDA 1ZJZA 4QECA 3UUWA 4DBVO 2LDXA 3MWDB 1LDGA 1SB9A 3NRCA 3R3JA 3H3JA 3VH3A 4GX1A 5L7TA 3EZLA 4CV0A 4BNIA 3D3WB 3H3FA 1EDOA 1O8CA 2W2KA 1N1GA 4RJTA 1QMGA 2ZTUA 3I23A 3UKOA 2BRUA 3TZHA 5DDIP 3VH4A 1UR5A 1I2BA 3DB2A 4WLUA 5KJFA 5JCJD 3F6YA 4NBTA 3DOOA 4BGIA 5FEUA 1DIAA 1T24A 5DNAA 5T67A 5T8KA 4LK3A 2Q1TA 1F14A 3JQDA 4WCFC 5L7WA 1NQAO 3KOUA 3QSGA 4J1QA 4DLAA 4GSLA 3VPSA 1QSGA 1O94A 1B8UA 2PD3A 4OGWA 2NWQA 4M89A 1Q7CA 3OECA 4MKRA 1YQGA 1X13A 2P4QA 1NXQA 5CDSA 1A5ZA 4OHUA 5DOVA 4IPTA 4WE3A 3FCOA 4WLOA 4DPKA 4L0QA 4JK3A 2JD1A 3ADOA 2RIRA 3TFQA 4DLBA 4RVUA 3G17A 3WXBA 2ZYAA 3GFGA 4HP8A 4E5MA 4DIBA 4G2NA 4TZTA 3JQGA 3PJGA 3ETDA 4FPXA 1C14A 2YHUA 4XKJA 3CUKA 1NWHA 4LCJA 3WYEA 2CFCA 4CM3A 2GR9A 2EERA 4NMHA 1DC5A 1TLTA 3DAGA 3DBLA 2G17A 3PIIA 4QT0A 1M76A 2QW8A 1PL7A 1WZEA 3H9JA 1B0AA 3N58A 1PGPA 3OQ6A 3VHRA 4CMCA 4A2CA 5F3RA 4QO8A 3F1KA 4LCEA 1CQJA 4BO1A 2DFVA 1R4MB 4TQGA 2DAPA 1O5IA 3JQAA 3JQEA 4IJKA 3E82A 1Y8QB 2PD4A 2ZQYA 1YQXA 5G4KA 1P0CA 4AL4A 4KP7A 3RUIA 4LSMA 2YFQA 1I8TA 1WVGA 1L1FA 5JAZA 5TQVA 5EL0A 1B14A 2DKNA 3U4IA 3MEQA 3LF2A 4CMGA 2Q2VA 3GRPA 5JY6A 4CQMB 4N5LA 3D4NA 4JN6B 3WBBA 1AUPA 4Z9XA 1FDWA 2A94A 3KYDB 3VDRA 4J91A 4UEKA 2PGJA 4GLOA 4CMBA 1YL7A 1EQUA 3WSWA 3OQ1A 2GSDA 1Y8RA 4DC1A 4AJNA 1IOLA 3H7AA 3INRA 2D1YA 4R1UA 2C5AA 2OFPA 2X9GA 4YQYA 2EG9A 2PH3A 1MXFA 3PP8A 3JQAD 4LMRA 2I9PA 1BW9B 2D5CA 1YQDA 4HKTA 4MIEA 4JIGA 1K6XA 4E31A 1WMAA 4IDDA 4RLSA 1U8XX 3UVEA 2VWQA 3HZZA 3D64A 3F5SA 2EKQA 2X7HA 4I5FA 2YV2A 4NFSA 1KC1A 3GUCA 4LGVA 3Q11A 1DJQA 3HJAA 3FPLA 4E12A 2EHDA 2P5YA 1K6JA 4CM9D 3CEAA 2YV1A 4TRRA 1YS4A 1DC3A 3GZ4A 4NNJA 1PR3A 1GEGA 2UDPA 1PJCA 4IGFA 3D4PA 4NBVA 2BFMA 1HYGA 4FBGA 4JBIA 5LDHA 3E9MA 4N54A 4CMEC 4XGIA 3V8BA 3GC6A 1GUFA 4TVOA 5U9CA 3AUUA 3I9LA 5TT0A 4KQWA 1NAHA 3WB9A 4ALIA 5EQFA 1E1LA 3RVDA 1IY8A 2O3TA 4IM7A 1ULSA 2VWHA 3S2FA 4NK5A 1JTVA 1FDTA 4PLTA 4D3FA 4IDGA 4I9UA 3LT2A 3FD8A 1RWBA 3V1YA 3H9QA 2EW8A 1E3EA 4YAGA 3OHSX 4OXNA 2EP5A 3DBHA 3V5NA 4R69A 3FTNA 2X8LA 5IZ4A 2AE2A 2PR2A 5KTKA 2B0JA 1C1DB 2BF7A 1VRWA 3W1VA 1RM3A 3TZCA 4HFNA 3UICA 3RKUA 2AG8A 3KO8A 2GN6A 2B69A 3BMNB 4TVBA 5CPFA 1MG5A 4ZQHA 3RU9A 2DTEA 5IXSA 2IODA 3EAGA 5JXWA 3HADA 3NX4A 2O23A 1U7TA 3WGTA 4DYVA 4OOEA 4L4XA 1P1JA 1LRJA 5JPIA 4MJLA 5IJZA 4R1NA 4C7JA 3EYWA 1YB5A 3UCEA 4OSPA 1N2SA 4CR7A 1C1XA 4EYEA 4ZA2A 1BG6A 4BS9A 4ND2A 3RC9A 4FOSA 2C59A 2VZ9A 1PJBA 3HDYA 2GRAA 3RFTA 5DCYA 4U7WA 3VVCA 1E3LA 2DBQA 1TI7A 2NTVA 3BHIA 2JJYA 3EHEA 3GAZA 3JYQA 3UGKA 1WLYA 5B12A 5CAEA 2IZ1A 1ZJYA 2POQX 3L9XA 5FI5A 3VPFA 2IZZA 3LK7A 1IULA 3ADPA 3AWDA 3PLNA 5TRTA 4YJFB 4U8GA 2JFFA 5L45A 3OIFA 4WCFA 5BNIA 6ADHA 5AQ1A 4DQVA 1P31A 3JQ7B 3PJEA 4JBGA 4XR9A 5CDYA 1K0UA 3FR7A 2GNAA 5JNLA 2HJRA 3M1LA 3RQSA 4CR8A 2HMTA 2VOJA 4ZVVA 3OFSA 3PPIA 1EVZA 1DIRA 1LDBA 3I6QA 2DTDA 3NJ8A 3WTCA 1OI7A 1H6BA 2HLPA 4RF4A 3RC1A 1JKFA 2I3AA 3JQ9C 2EXXA 4LW8A 3FWZA 4ONEA 1HWYA 3TL2A 1ZIDA 3HDHA 1Z73A 1GQ2A 2AQ8A 4NZ9A 3KYBA 4GQAA 4R16A 4Y6PA 3F3SA 4YXFA 3H8VA 5A1TA 4ID9A 4Y8VA 5C3MA 5MGBA 1FDUA 1XQ6A 4W99A 1VJ1A 5GZ1A 1T2AA 1LLQA 4LSWA 4CQLA 5KWEA 3H2ZA 3GEDA 3NEPX 2VTDA 4MVJI 4W7IA 4MIYA 2PKQO 3LU1A 3EW7A 4CLEA 2R00C 1QYVA 1GZ3A 3TL3A 1ZSVA 2J8ZA 5G0TA 4NU6A 2X22A 2YW9A 4B3HA 1T2FA 4L4SA 2OP1A 1UUFA 4FFMA 5L4LA 3OIDA 1FJHA 4Y9DA 1MX3A 4YEDA 4YCAA 1PJLA 4OXKA 3UAGA 3EMKA 2VWPA 4E30A 4CLOA 2Y1EA 1G1AA 1MUUA 1QR6A 2HMWA 3RROA 4R1SA 3NT5A 1ZUD1 2I3GA 1LRLA 3ETGA 4RZHA 2AQKA 3KETA 2DC1A 3ABIA 4QFDA 1ZW1A 2J5RA 4TMFA 4GX0A 3OJOA 2W2KB 1WZIA 4W6ZA 5IN4A 3EC7A 1KYQA 1AGNA 1DIBA 1BXGA 3L4SO 2C54A 1NPYA 1DC4A 3EVNA 4P22A 4PLVA 3RJ9A 1JAXA 2Q1UA 1N9GA 1HLPA 1IB6A 2GN9A 4LRSB 4E32A 4D46A 1WAMA 1U2DA 4QFCA 1K3TA 3UHAA 4PRKA 4IS3A 1EVJA 1TT5A 1WNTA 3QA9A 3WDSA 4CV1A 5K6AC 1VE9A 3QHAA 4LISA 1QG6A 9LDTA 3SLKA 1HL3A 3ASUA 4QO7A 3V2UA 2O4CA 2ZK7A 3GVPA 5JY1A 1TEHA 3AFMA 2FR8A 2HK7A 4EDFA 2Q4EA 4WNIA 5A5EA 2D59A 5L7YA 1MV8A 1XKQA 3WGQA 3VZQA 3D5QA 3G79A 3IP3A 3GUYA 1W0CA 3JQGB 3GN2A 3ROQA 3RUAA 3VTFA 3VPXA 3WQSB 1KEWA 2OOSA 4CMEA 1YBAA 3R3SA 4W9NC 3L77A 2G82A 3A4VA 4P4LA 3ZHBA 5IN5A 4BKOA 4OO3A 2BMAA 1YJ8A 3O38A 1KC3A 1T26A 4PCVA 5JDIC 3DBLB 2J3KA 3INTA 1LEHA 1CQIA 1E5LA 2GPTA 1J0XO 1GL3A 5KIAA 2YY7A 4CMIA 5CEEA 1FK8A 3FWNA 2WD8A 5AOVA 4RPJA 2VOEA 3ZH2A 3AOEC 4J4TA 4F45A 3JQAB 3GDGA 1E7YA 1IHXA 3E9QA 4K28A 5G4KB 1SAYA 4UUPA 1DJNA 2V6MA 1PL8A 1YH3A 4B7CA 1Z45A 4B79A 2D4AA 2HAEA 3NUGA 1YWGO 3JQFC 5JLAA 2OP0A 1NVMB 1YJQA 3AUAA 4CV2A 1SNYA 1SZJG 1E7MA 3C7DB 4LN1A 3E03A 5JE8A 3ZWOA 1XA0A 3GMDA 2O3JA 2NU9A 5DZSA 3DAPA 3WFJA 3KEQA 5EJ2A 3KXDA 5JAIA 3ZHZA 5T64A 2FP4A 2R2GA 4MVJE 4UUMA 2X0NA 1ADCA 3MTJA 1Y8RB 1ZMTA 4AVYA 4Q3DA 4C4OA 2ZCUA 3IAHA 3PLRA 4NK4A 4QXMA 5HA5A 1DRVA 3DZKA 3GEMA 3C1TA 3DOCA 4MOWA 1U3VA 4CLHA 2VHYA 3PDJA 5JBIA 3ZNNA 1JVBA 4O0LA 1ZBQA 1FDSA 2AEFA 1Y9AA 4ALMA 2D2IA 1R4NA 4E33A 2BGMA 1GV1A 1HDXA 4MVJP 4TRMA 1XELA 1A72A 4AJJA 1KERA 1VC2A 4A7PA 1HSOA 2NU7A 4EEXA 1DHRA 3MZ0A 4WK6A 2BH9A 5ILOA 4PLZA 1LLCA 1W4ZA 3DZBA 3CZRA 2AE1A 3D7LA 2J5QA 2DBZA 1LJ8A 4FDAA 4INAA 1LTHR 3ONFA 1ZK4A 4RDHA 3H5RA 3DEYX 3U4CA 5GZ3A 1P1HA 4S1VA 4J16A 4RPGA 4RF3A 3SEFA 3VH2A 2VT3A 1U3WA 1GYPA 1U28A 1NHWA 1NR7A 2ZB8A 1ZK1A 1GYRA 1NPTO 3JQ9A 1LBEA 5G0WA 4WASA 5JC1A 2C7GA 5TT1A 1DIHA 1X0XA 1U1IA 4FFNA 2BD0A 2P2SA 4BNJA 1YB4A 2H9IA 4FW8A 3WG9A 4UEJA 3DZHA 1SEVA 2FY8A 1E1NA 5FYDA 3K73O 3NT2A 2F1KA 4ZQGA 4CM1A 2ZJ1A 3DBHB 4RORA 1N8KA 1PU2A 1ENPA 1OC4A 5KVSA 4I8XA 2R00A 2JCYA 3B1FA 1WW8A 3FHLA 2PLAA 5MDHA 3GGPA 3BMQA 2UYYA 1JKIA 5DP2A 3S1LA 5ER6A 2JFHA 1DDOA 3GHYA 4IDCA 4J2OA 1YGYA 1ID1A 1NVTA 5L51A 4BMSA 1V35A 2DPGA 1O89A 1M6WA 4DTIA 1U3TA 3E8XA 4XWYA 1Y9EA 4BGEA 1C1XB 1TT7A 1UP4A 2Q1SA 3RSHA 2NVUA 3ONDA 2RAFA 2WE8A 3H9EO 3AM4A 2WD7A 5JMWA 3GPIA 1BGVA 1F8GA 3E1KA 4BNUA 3DXFA 3TNLA 4D0RA 2BHLA 1J6UA 1V3VA 4L76A 4OMUA 3QLJA 3TPCA 2V6BA 1IPEA 4E2ZA 3OP4A 3EDMA 3KTDA 4J4BA 3D4OA 4WCFB 4Y6RA 1P77A 3WGYA 5IG2A 3FNHA 3K2EA 1ADGA 3A9WA 4NBUA 2I6TA 5K6AA 1AHIA 3K8ZA 5DOZA 2EKLA 4XJTA 2B4RO 4ALLA 3QRWA 1PJ3A 2RH4A 1NFQA 5L40A 3LC7O 3PFWO 2QRKA 3I5MA 1LSJA 2BGLA 4BO7A 3UCFA 3F4BA 4MINA 1X1EA 2DBRA 2CMDA 4NPCA 1U9JA 1UDAA 3M6IA 4X54A 7ADHA 4AICA 3PIDA 4E13A 2A9FA 1B8VA 3BHMA 1XIVA 4IZIA 4W9NA 1LNQA 2EJWA 1NR1A 3KM0A 3ZCXA 4J3FA 1V3TA 3NTRA 1EK5A 1Q1NA 3E9NA 1ADBA 3BMCA 3W8DA 1PR9A 5JDIA 2G0TA 2X5JO 3BTSA 5KJ6A 5K9ZA 1ZKMA 1W73A 2X0IA 4FS3A 4CQLB 4ITUA 2PZMA 2OBYA 4YAEA 4KWHA 1EZ4A 1KETA 2PKRA 3AOEA 5AYVA 4AJHA 4TKMA 3DC2A 4YAJA 1SEPA 2NTNA 3OBBA 4YVFA 5BSGA 1DRUA 3KZVA 4MDHA 1VSUA 1ZK0A 1A4IA 2JFGA 4KOAA 3CSDA 4H16A 2NLOA 3HDJA 3CXRA 3JQFA 2PH5A 3S55A 5I7FA 4J9UE 2HRZA 4BNNA 4FGSA 4NIMA 5JSFA 3QY9A 3ZN2A 1XR3A 5KVVA 5HRUA 3FN4A 2CDBA 3ZWNA 4K1LA 4ZRNA 2Y93A 4R1TA 4R9RA 4CLOB 1O95A 1X14A 4TRNA 4A26A 2NNLD 5I8WA 1ISFA 3NDIA 1Q0HA 2ZYDA 3U4DA 2PKQP 2Z1MA 2HMSA 4EJMA 2P5UA 2NVWA 1QRRA 4TZKA 3TDKA 4XYLA 1X15A 4UEOA 1V9LA 4L8VA 1HXHA 1XU7A 1ARZA 1BXGB 2VCYA 5CEJA 1KEPA 1VL8A 2ZCVA 4YTEA 4IMPA 4O6VA 3VTZA 4EJ0A 1N9GB 2JCXA 3CZMA 2OGUA 4CM8A 4TROA 4WUVA 1Z74A 2XXBA 2Y99A 4GMFA 5KKCA 3L6OO 3RBVA 3PYLA 4QQRA 1RM4A 5G0UA 1TT5B 1HSZA 1EE2A 3ITKA 1RYEA 1H6AA 3AUTA 3C7AA 4J7UA 3GDOA 2ZB7A 1D8AA 1HRDA 4E5KA 4LMPA 4PZEA 1LXCA 4RVDA 5AVOA 4BQRA 3H6KA 3NKLA 5TIIA 1HE3A 2W4QA 4IMRA 3K5PA 2HKIA 2DVMA 3LLVA 1CYDA 4UVEA 3FBGA 5CPBA 2ZB4A 5ER9A 3WMXA 1X7DA 5EN4A 5GY7A 4CMJA 4PG7A 1AN9A 1P3DA 1P1IA 2B4TO 3ZDFA 3IKVA 1LX6A 1GEEA 2WTBA 4H3VA 4GBJA 3E6AA 1M2WA 4J43A 5G2OA 3FRJA 3DMTC 3QVTA 4P4NA 3K9QO 2OMEA 1I30A 3GQVA 4XRRA 4J0FA 1HF3A 3WLEA 1V6AA 2HCTA 4CODB 2NACA 1XEAA 4CMIB 4FJ0A 4D43A 4DXHA 4F46A 1YKFA 4B7XA 2QG4A 4DWVA 4ALJA 3QE3A 2HQ1A 5F5NA 4IJUA 3ZI0A 3JQ8A 2WMDA 3JCZA 2X23A 3JSAA 1BTOA 1UXKA 1FXSA 4CMKA 5BR7A 3WYCA 2DUUA 4W82A 1LLDA 1PEDA 1CETA 1DB3A 1UJMA 3LT0A 4YJHA 1Z6ZA 3ZU3A 3BTOA 4IUYA 4DQUA 3EUWA 1ZMOA 2Y66A 3OEYA 3GN1A 4RL6A 5LC1A 2H6EA 3AM5A 1HDYA 3BA1A 2DUWA 3IUSA 4BMNA 1YDEA 2C82A 4EBFA 1GZ4A 3E48A 1EDZA 3W8FA 4NI5A 4A10A 5FF9A 2G5CA 1PS0A 2X5OA 1GV0A 1MB4A 3OH8A 2VHWA 3PEFA 4UVIA 4Y67A 1PJTA 4HV4A 3WQQA 1R4NB 3CIFA 1R0KA 4WECA 2YFHA 1FMCA 4PVCA 1VJ0A 2AA3A 2BI7A 1QYXA 2O3RA 3AW9A 4RO0A 2Y0CA 5DP1A 2PTGA 3D5TA 3LLSA 2P68A 5DBIA 4FOOA 5A3VA 3GG2A 4BNXA 2WM3A 1B2LA 1HZJA 3B1KA 4D44A 3F46A 3WJAA 4BHTA 2E37A 5KVCA 4BV9A 3T4EA 3IOYA 4NU5A 4ZRMA 2GYYA 2YDXA 2B83A 3WLFA 1CF2O 2ZYGA 2WJPA 3JD3A 3NJ4A 3K92A 3PHGA 2JD0A 5TJ9A 3LC2O 3HFSA 4PG5A 3Q9NA 4BGUA 4BKUA 2AHRA 4EUEA 1PGOA 1B3RA 1NYTA 2G76A 3ZWYA 3ZWCA 2GLXA 1OC2A 1U7HA 3AFNA 4UUNA 1GPJA 1JKJA 2O4UX 2HDHA 4KTTE 3QWBA 4MPDA 4JX8A 3NYWA 2NVBA 1K5HA 5I9LA 1KIFA 2HMVA 2Y1CA 3OIGA 2E82A 1U5AA 4NDNE 3FNGA 3H9GA 5KJCA 1KVTA 4UVDA 4ZJUA 2IE0A 1I0ZA 1HDOA 1LQTA 3K6JA 3VKVA 3EGOA 1P1KA 2GN4A 4E3ZA 2H5LA 3PYXA 2CZCA 1DIGA 4ND3A 3BMQB 3WX0A 1N92A 4CLRA 5JC8A 4DYDA 1I2CA 3A14A 2ZATA 1OBFO 2Q2QA 3RUFA 3MJVA 4XRGA 3FR8A 4BVAA 1H93A 1CDOA 1ONOA 2CDAA 1VSVA 4KWIA 2C20A 1IYZA 4EI2A 1UP7A 1LSOA 2E4AA 2NVUB 2YQ5A 2ZIZA 4R51A 2B35A 4B7UA 4CLXA 4DA9A 2IRWA 1PGJA 1ZH8A 2WD7B 2JL1A 2X4GA 3DFUA 3I6IA 4E2WA 1GU7A 1WDMA 4G5HA 3JQCA 3NDRA 4Z9YA 3MTGA 1I3KA 2PWZA 3MOIA 3O4RA 1NHGA 2UUPA 3RC7A 1I5RA 1F17A 3MJSA 4D79A 1H5QA 3FPCA 3ULKA 5ITVA 1RJWA 5IDYA 3ANLA 4GL4A 2IEBA 4JP3A 1ENOA 1Y7TA 3UF0A 3INGA 2HK9A 4GKVA 2GF2A 4BB5A 1JWAB 3OEWA 2C7VA 1LDYA 4HX5A 3GNSA 2EGGA 3NGXA 1U5CA 3QP9A 3DHEA 4W7HA 2HJSA 5BNFA 3UH1A 1ADFA 2JAHA 2X0JA 3W8EA 3P5SA 2NADA 4WNCA 1EBFA 1T2DA 1C0KA 1LQUA 2B5VA 2ZJ0A 1QV7A 1KOLA 2TMDA 4GVXA 1QP8A 1U8FO 2I76A 4B3IA 1YXMA 4Z9FA 4ZU3A 2FZEA 1GR0A 3LQFA 1WDKA 4MVJH 4J1TA 1E3WA 2VTEA 1QORA 3ZGYA 4BNYA 1D7OA 1Y5RA 3CMMA 2C29D 3T7CA 5ILGA 4XIJA 4YJGA 1PWXA 3DMTA 1ZK2A 3BMCB 3QIVA 4AJIA 2AMFA 3AM3A 3I9OA 4BNGA 3RBXA 4PG6A 2VHXA 2PA3A 1E7RA 4FD3A 4WCDA 4GI2A 5COAA 4CPDA 1R37A 1NWCA 2AEMA 4I5GA 4RPKA 3V2HA 5A03A 3GDFA 1Q7GA 3FBTA 1I01A 1AXGA 1E0DA 4J4HA 3ZU4A 1GQYA 4XQGA 2DPHA 3PGXA 4AG3A 4QSMA 1I2ZA 1ML3A 1XSEA 3GK3A 3QWIA 1L7EA 3QVXA 2PZKA 4O63O 2X86A 3P2OA 4WJZA 2ZTLA 2Q1WA 3DHNA 3F47A 3K31A 4YRAA 1SOWA 5TX7A 5AXAA 5ENVA 1RYDA 1RPNA 1CERA 1T1RA 1DFGA 1MC5A 3PJFA 4OXYA 3G49A 4MO2A 5COQA 4GGPA 3DZGA 1Y1PA 3VC7A 3EK2A 5EINA 3HNPA 3GVHA 2X5KO 5IFLA 4XDYA 3O8QA 2VHZA 1IUKA 4IDAA 4I5DA 3ZWMA 3SVTA 1K2WA 4B4VA 2Y1FA 1KBZA 3K96A 1EK6A 2GD1O 4PGFA 4DGSA 1TVEA 2J6IA 1SMKA 3SC6A 2JHGA 4N5NA 1LC0A 4R3WA 4CM8B 4Q3CA 4BO3A 4BO6A 3VZSA 2XXJA 1ISJA 3OJLA 1IL0A 1YL5A 4BNVA 4FSHA 3I3OA 4YA6A 1YO6A 2PK3A 2FPGA 3UN1A 5T6BA 2RH8A 4Z6KA 1UH5A 4JLWA 5T57A 2C5EA 2PZLA 4DQXA 1Y6JA 3CKYA 1HE2A 4B8WA 2EJVA 4R54A 4BO0A 2J5KA 4J49A 4P8RA 1R12A 1E3IA 2HRBA 1HT0A 1VKOA 4YAKA 1YL6A 4OQYA 1F0YA 2O3UA 3VPHA 4D42A 4XA8A 5BT9A 3Q9UA 4FC6A 3NAQA 3UOGA 1C0LA 2CVZA 1G0OA 3C8MA 3WS7A 3QQPA 4JXKA 2FOIA 5IDWA 4WKGA 4BNWA 3IL2A 1NVGA 3B1JA 3ZWAA 4AJPA 4PLGA 3WR5A 5JS6A 2QHXA 4NFHA 3KVOA 4RDIA 1MC4A 4PZDA 4XX0A 3A06A 3HUDA 2WSBA 5CFZA 1MGOA 1EVYA 3PI7A 4IZHA 3JQ8B 1A7KA 3GMSA 4R5HA 4XDZA 5ICMA 1QYWA 3GRKA 3GGOA 2BFOA 2CUKA 4S3MA 3P19A 3WFIA 3I9NA 4FCCA 2GASA 3O26A 3SLGA 2GGSA 2E6UX 2IEDA 3V1TC 4YJHB 1ULUA 4AJ2A 1EE9A 1E6WA 1EBUA 2PZJA 3LC1O 4ZGWA 1QLJA 3GHHA 1AXEA 1DPGA 4R68A 5KKAA 4PZCA 4XIYA 2A4KA 4ZN6A 3PQDA 3R6DA 4L74A 4CUJA 4L4RA 1VL0A 1DFHA 2H1SA 2J3IA 3PZBA 3H5AA 1LC3A 2WYVA 3HQ4O 5A06A 3U5TA 2VNAA 3B6ZA 5JMPA 3A28A 4FFPA 1ORRA 1B7GO 3JD4A 3CMCO 1LUAA 4NR0A 4KZPA 4CM6A 3GOHA 3C85A 4E5NA 4PVDA 3HFGA 4HFMA 3HG7A 4ILKA 1BHSA 4ZICA 4U6QA 4M87A 1M75A 3IJPA 1HYHA 2BGKA 4L75A 2GZ1A 4K6CA 5DCUA 1EQ2A 2J3HA 5KNLA 2GCGA 1I32A 4BKPA 3IKTA 5HBRA 2VYNA 4RPLA 1HE5A 3VVBA 1R0SA 1G6KA 1EMDA 1P45A 1BSVA 1EUCA 4U6SA 1XG5A 3ZV4A 1KVQA 2IYPA 1QV6A 1ZXBA 3PTZA 2NM0A 1T1SA 3N7UA 4OH1A 5C7IO 1MFZA 1UZLA 1VJTA 2HSDA 3GNQA 3I9KA 4M8SA 1NASA 1P44A 3GAFA 3WYBA 4BO5A 3W6UA 2TMGA 3JYNA 3TZKA 4BV8A 4NH4A 3U49A 1VPDA 1H6CA 5DBGA 2I66A 1ZCJA 4GKBA 3RD5A 3NTOA 3PWZA 1LI4A 1F06A 3RAJA 1QYDA 1XLTA 2Y68A 1R0LA 3DZIA 1ZSNA 5F1OA 4BNHA 4FB5A 2O2SA 1UAYA 3WQRA 3LDHA 2Q3EA 4BKQA 1PTJA 1NNUA 4RPHA 1MLDA 3OA0A 1JVSA 4B4UA 4RF5A 2VYND 3GFBA 4PIVA 1HLDA 4GAEA 3RUCA 1X7GA 4OKNA 2V6GA 4BIIA 4FR5A 1MG0A 3WGOA 3HSKA 4HY3A 4HFJA 4J1SA 2D3TA 2PGLA 1SOVA 5JW6A 4CMAA 1UZNA 3CH6A 3OQBA 3C24A 2C0CA 1HZZA 3QVOA 4UREA 2QYSA 4RVSA 1H0KA 3GF4A 4A73A 1OAAA 5CDTA 4WOKA 4CLRB 4E0BA 4A27A 1PX0A 1A9ZA 1RM0A 3SC4A 3RU7A 4N18A 3W4IA 1PQUA 4ROSA 4YAIA 1HDGO 1M66A 3R1IA 3OJ0A 1R16A 2FPPA 5BQFA 2GZ2A 2W90A 3M2PA 2PNFA 3AOGA 4OQZA 4PLCA 5TJHA 4YR9A 4XD2A 3U9LA 1K6IA 5A3JA 1C3VA 3GVXA 1WPQA 1XCBA 1DLJA 3ZV6A 4D7AA 3HHPA 4WOJA 2FMUA 3BIOA 4CM7A 1E77A 1GY8A 1Q7BA 2EV9A 3E5MA 4AFNA 3CE6A 1LRKA 5HTOA 1O9BA 2OBNA 1W6UA 3DZJA 3Q6IA 5L4SA 5B1YA 4PLWA 3GGGA 2YDYA 4DMLA 5F1PA 1LSSA 3Q2KA 4LRTB 3OJFA 2P9EA 1YVEI 2DT5A 4CJXA 4CUKA 1LDMA 3OM9A 3ZNPA 4Z0PA 1WMBA 3AI2A 1NX6A 2FPIA 1NBOA 4YBZA 2BI8A 3RASA 1WDLA 2X58A 3GLQA 4YPOA 3ZWPA 2VQ3A 1YOVA 1MXHA 1DAOA 2GN8A 3HN7A 1T2CA 4H15A 4J2HA 3WGHA 1SPXA 4DRYA 2H63A 1DEHA 2PGDA 1OZAA 2IXBA 1GCUA 1YRLA 2FR1A 1H94A 4J7CA 3FNFA 3PHLA 4MVJA 3NT4A 4MKXA 1VKNA 5KJ1A 3I9MA 4PLPA 1ZSYA 4BO8A 3KSZO 2QZ9A 2AQHA 2EIHA 1B8PA 2Y0DA 4FJ1A 2UAGA 1BDMA 3AUSA 4DPLA 1E3WB 4NQZA 1YB1A 1N7GA 2Z5LA 3EZYA 3X2EA 1DXYA 4YJGB 2CY0A 1E92A 1SB8A 2EP7A 4WGGA 2VYVA 3PWKA 3GT0A 3RJ5A 1P0FA 5IF3A 3PWSA 3RWBA 3C3XA 4J0EA 2HO5A 3NTQA 3G0OA 4B3JA 1C0IA 4JCOA 3H4VA 1DC6A 2CVQA 4NBRA 1UXHA 2FWMX 1T4BA 3FNEA 1E3JA 2NUAA 2YQ4A 4RVGA 4IXWA 3LF1A 4XYEA 4Z3KA 4MVJD 4EUFA 3DTYA 4Q9NA 4YDRA 3E18A 1BXKA 1KY5A 1WXDA 1GFSA 1PZEA 3DMYA 1I3NA 4BNZA 1FDVA 2B36A 4GWKA 4ND5A 2VYVD 3AU9A 4ALNA 3RIHA 3AY7A 3TFOA 3AY6A 2GERA 2YUTA 2FSVA 4BB6A 4KUGA 5ADHA 3O8QB 3WSVA 1K89A 3D0OA 4WLNA 3GVCA 1XWFA 4EUHA 1T25A 3DO5A 3SJ7A 3ENNA
chains in the Genus database with same CATH superfamily
2ACVA 4A2QA 3B9BA 2LBPA 4H35A 3BE4A 1QH1B 4DYHA 4JJ6A 4MQLA 3LT4A 5DISB 4B74A 3UJPA 4DADA 3NHJA 5CEFA 3VNSA 1Z4QA 3HR4A 1BO6A 5AK5A 5GZ6A 2JZOA 3EIUA 4RD4A 3U1TA 4WXMA 3X44A 3E8MA 3I6ZA 4FMDB 3U5ZB 2XDWA 4A03A 2VPWA 2D74A 1EX1A 2H7YA 3CR8A 1JXAA 2QMHA 2IXDA 2GPNA 1Z47A 1D2CA 3QA3E 4UU8A 2F17A 4WIAA 1W1WA 2HQOA 3U80A 5SZIA 3W5HA 4KVGA 4MROA 2Z9BA 4C05A 4NCBA 3CW9A 4EMUA 3DPUA 4DG8A 4E5PA 2Q1XA 2PR7A 4MI9A 1L5MA 2WDZA 1BRTA 1Z28A 2BWJA 3MGAA 4PQFA 5DNWA 4YY3B 2DRIA 1KHTA 3GARA 1UAGA 2E4WA 2BVNA 1SUAA 2DGDA 3MMNA 1TU3A 2PX4A 4KFSA 3HBNA 5TDHA 4LY3A 1U3FA 1IMOA 5TY0A 1JEQA 1ZXLA 2UXCB 1JFRA 3EODA 3PNSA 2QNBA 1ZOOA 4FFOA 2BLLA 4CFSA 1HETA 3USCS 5BYJA 2BZ0A 5FPKA 4DLLA 2Z6UA 5EZYF 4OHBA 1BDBA 2B37A 2A58A 4XX0B 4AN0A 3R0ZA 3VR6A 5FOVA 3EZ7A 1M54A 2Y1GA 3N3AC 1BX1A 3SD7A 3RBZA 4EGFA 4ERXA 4HGNA 2IEIA 5B4UA 3DLPX 3K1AB 1H3FA 1TXGA 3K0EA 4IZOA 4MRNA 4YJDA 5HCNA 2F3UA 2WOJA 2CF6A 4LHYA 1V7PC 1U9IC 1K8YB 3G1UA 1B16A 2AV6A 5CHEA 5JVDF 2WAMA 3P0EA 2E55A 5F1YA 5EMMA 3VC2A 5ESXA 1PQ4A 1DRWA 4IBOA 3B9RA 1SUCA 5JQWA 2GESA 3KDSE 3WWZA 3CWZA 1OFTA 3V48A 3H2HA 4E1VA 2Q99A 1M72A 1JFFB 1Q19A 2AK2A 4PYOA 3RI3A 5DSTA 4JFAA 2CUTA 3BH0A 2R0QC 3DNPA 3U3ZA 1KMHB 1U99A 1E7QA 3HNOA 2A3RA 4QGHA 3MJTA 4BE4A 1NM5A 4ZT3A 4XIIA 3CRNA 4AP9A 3IS3A 3OT1A 3OZTA 1QYCA 4N65A 4FYMA 1P33A 2GCOB 4LQDA 2GVZC 2E87A 4D8VA 5B4TA 5I7VA 2XBUA 3KKOA 3L8ZA 2DG2A 2WB4A 5AVWA 1UP6A 1H0HA 4NAUA 4ND4A 3TZQA 2UXDB 3Q1LA 3TF5A 2X6TA 2ZUCA 4YT4A 3HB4X 4FC7A 5THXA 4DL9A 3V8NA 4B76A 2PXAA 1D2MA 3OSUA 1WX1A 1UMKA 3F9IA 4L2IB 2HIAA 5BV7A 2ADMA 2FPUA 2R48A 3K35A 5I5EA 5M3BA 2IS1A 2I91A 3U37A 4FCWA 3T41A 3OE7A 4MDEA 1TM2A 4LHSA 1ZN2A 3AUXA 1SRQA 4FYJA 3UAZA 4B2LA 3WBKA 4YJ2F 1MTOA 5I8PA 3TJMA 3N7TA 3IP7A 4X90A 5I9NA 4N03A 4P81A 4GM0A 3DXXA 1N2ZA 2CMHA 3KLMX 3LOQA 3GWZA 1EUCB 3H5IA 4XCVA 3U7EB 4OX9Y 3H9BA 2PMWB 2Y0EA 4N8DA 4PC3A 4LQCA 2YWJA 3ZC3A 3N74A 3ZBPA 3X1ZA 5D00A 3K71B 4EEZA 5IBRA 2WDPA 4Q39A 4FDUA 1W25A 1KEVA 2ZXUA 1VYVA 2AW3A 4QSHA 4ETWA 5F5LA 2ICAA 3ILVA 1JF8A 3KV3O 3K0CC 1MRZA 3GNTA 1FNMA 3UXYA 2QZZA 3X1KA 4DCPA 1CW2B 3VR2D 1ONBA 1UJ2A 5ARBA 3KJQA 3A4NA 2VSYA 2FMHA 4I9NA 2R751 4OM7A 5AO9A 3AIIA 2CEAA 4D3SA 4JEHA 1CZNA 2Q4DA 1W52X 4CT0A 3LVFO 4DIFA 3MILA 2YZGA 4JU9A 5DW0A 3QWFA 3AVOA 3H2GA 4B4WA 5CGQB 4PLYA 4IH9A 5KNDH 1R8XA 3Q3JB 1CP2A 3O8BA 1W581 2H65A 2ZJYA 1ECGA 3L07A 3Q15C 1LS1A 2X3FA 1N3BA 4LF8B 5ICSA 3SR3A 3BRSA 2XT0A 3EASA 3Q7EA 4IEIA 3NTLA 1RBQA 2MWMA 4C21A 1SR8A 4Q9HA 1HTBA 3T52A 3OICA 5KYNA 5DNVA 2V7UA 2FF7A 5GP1A 4B8ZA 4DHWA 2ID7A 3AHDA 4Q5IA 1Y8AA 2WYWA 3ZKWA 1YRWA 4B6SA 1WCIB 4DR3B 1FSFA 4QDUA 1R8SA 1FS5A 2CNNA 3WGUA 1ISHA 3WL6A 2H29A 2WPDD 2WF6A 3GPDG 4UXJA 1RWQA 3AUYA 3L1HA 4F5WA 3CZAA 4PNHA 4RVFA 4XB2A 5G0VA 5JAOA 3PB3A 4DIMA 1VE6A 4L5YA 3FJYA 4DZTA 1U0FA 1O87A 5IT5A 4W1PA 2A92A 2BKEA 1U7ZA 2XVZA 3LYLA 4XASA 4XIGS 3RUPA 5IZCC 5JXHA 2W7TA 5D7BA 1N5DA 1GPYA 3ILSA 4BBZA 2GBGA 2BM9A 2XIJA 1JJVA 3FUXA 5AK6A 3ML1A 4O33A 1YB6A 1PTKA 1WHSB 2G1UA 3DMDA 3KVRA 3DZFA 3BB1A 4G5XA 1IPFA 3AV3A 2X1LA 2B4KA 1P61B 4YK7A 3QEJA 2P6RA 2ID4A 3OETA 3VH1A 2ZTMA 1K2VN 1X7HA 3LP5A 3LPCA 3OE5A 5CU7A 3M9XA 4YT5A 1Q22A 1U6IA 4Y2YA 3LPNA 3V4OA 3K6KA 1ECCA 4ZC8A 4QYIA 1NXPA 2G09A 1WG8A 2X1VA 3HGTA 5EP4A 1G8HA 2CNBA 3TKLA 1JHQA 4BFLA 3UOAB 5AHRA 2BE7A 2O48X 5AK3A 2WTMA 3D0QA 4TRJA 3M4ZA 3BN3A 3RDPA 1QRTA 4OJTA 1KAOA 1IXRC 5DFAA 2DKFA 4ZVPA 3O8CA 1BS9A 5T41A 5A71A 3NHYA 2RG7A 2A33A 1YC2A 4LKOA 4DV6B 1TQHA 4P54A 1FLVA 1N5MA 1ODLA 2Q49A 4DVJA 3ICCA 4MPPA 3MT8A 4XYMA 4YCJA 1T43A 2JD2A 2XB4A 2Q46A 2ZI3A 3BXZA 3EHDA 2HQBA 1QCCA 3ERCA 1UODA 1JHDA 3AI3A 4BQPA 5LXTA 5IM5A 3WRYA 2Q21A 1D6NA 1VOTA 2J6CA 3E35A 4JELA 1S6YA 1YUBA 2QSUA 4ENWA 3KQNA 4HMOA 2RHGB 3N2KA 3K16A 3AY3A 1NQTA 2BR3A 4HH0A 5DULA 5C0OE 3USZA 1CUSA 3VU9A 3MCVA 1BIFA 3L0CA 1XYGA 4UPVA 1CV2A 1UMCB 2BFWA 3G9QA 4YYZA 2WSSD 4B0PA 2I7TA 1NMEA 3PV0A 3DGEC 3SOZA 5HS6A 1SC1A 2JFPA 3V1UA 4OP2A 4PPGA 4U3JB 3L6DA 3AONB 2PQ2A 3RC2A 2IKSA 4YAWA 5A6SB 4KSYA 2F3RA 4EMBA 1QHYA 1E2UA 5EPEA 1QANA 3WNCA 5T7BA 1PK8A 3B1VA 3PHJA 3NC0C 1WW2A 1RR6A 4WH0A 5G0SA 1FYDA 1YRHA 3PXUA 4ZVTA 2HLDD 2PQ6A 4JKIA 4DBZA 4M0CA 1FFDA 3IV7A 3JV7A 4PAOA 1YCFA 5FQOA 1FQJA 3LDGA 1G7CA 3RGWS 4G85A 3P0IA 1M7BA 1E2DA 3C2QA 3BIFA 4IOKA 4DLWA 4OQPA 1GTG1 1RW4A 3I76A 2OL4A 1FLAA 1HFEL 3AKCA 3WE7A 4DSTA 5C1IA 1BD4A 1C9JA 1IEXA 1RLTA 3FIUA 4FUTA 1M1XB 4RH0A 3KNZA 1IY2A 2ZRPA 3H7IA 3VPGA 1JWBB 1T5DX 3ACBA 4GOKA 2WMOB 5L6LB 3T12A 5HZMA 5CDGA 3H17A 2FSPA 2NYVA 1SU8A 2JJ2D 4U7FA 3H65A 3HN2A 4K9DA 3KJHA 2F9LA 3DR3A 3HSYA 3ZNOA 1JR3E 2ZREA 1TFRA 5JDCA 4YUWA 2LV8A 3T9FA 4JU8A 4JJ8A 4TWZA 4WZAB 1BHQ1 1S5PA 2BFAA 4O2BB 1TVKA 2ZRAA 4TN1A 4GX2A 5AW7A 1JFTA 3DWEX 1EWTA 4YX9A 4L8LA 1WZNA 1O97D 3GOQA 4ZOBA 1U8ZA 4Z4EA 1EFKA 3V3TA 4MEJA 4EAAA 4XD7D 3HVKA 1L5FA 5IJ0A 1PLLA 4IL5A 5TGDA 2EBUA 2AEJA 3H5OA 4JLOA 2RAVA 4XWOA 1CDZA 1GTVA 4BDSA 3C45A 2O8EA 1OZGA 4H77A 2RHDA 1OWLA 4UBLA 4PRYA 4Y30A 4F3YA 5JI2E 4PPFA 4EG4A 3I0ZA 3N6RA 5TS3A 4HG2A 3AUKA 1U11A 2TYSB 1I3MA 1UZMA 1ZN8A 3HCPA 3R6LA 3LHFA 4OHZA 3U3OA 4BJ6A 1DWPA 4KZKA 3TKYA 2CFSA 4K9SA 4UTRA 4FTWA 1L4HA 1VSBA 3DAFA 1V25A 5ERXA 3DDNA 3P0FA 4BO4A 4Z53A 1GP2A 2VPZA 1J0CA 4QXRA 3OZGA 2WJAA 4JBHA 2R4UA 3DE4X 1WU7A 1R5JA 4HEHA 1MH9A 2WJ4A 3B7PA 1DTSA 4M98A 5DXJA 4GMGA 8LDHA 4B3TB 4RIGA 3V4RA 3TEMA 3R20A 2CDCA 4ND1A 2BBOA 5AHKA 2VK4A 1QIGA 4YO8A 3AR7A 3LJKA 1JEQB 3B70A 3WNBA 4UBNA 2BMFA 1CIVA 2JLRA 4JLMA 1MTZA 1ZD9A 3LLMA 4LSZA 2V1UA 1JH9A 2FXIA 2XUDA 3A6PC 5KC8A 4UCFA 1MQ8B 1JIIA 5LZ5A 1GNLA 5CXUA 3FOFC 3N8IA 3JX9A 5ESRA 1S7CA 3P2EA 4MV5A 2I5PO 1DP4A 3IAAA 3MWDA 3VUEA 4D98A 4IXTA 1CY2A 3HJTA 2NQ2C 2JEYA 2UZ0A 1PQPA 3IUPA 1N57A 3UQYS 4ABTA 5C8XA 5F3WB 4TZ0A 3WV5A 5J4VA 1XZBA 3WNVA 5I8ZA 3AI1A 2LDBA 3FAKA 2PM8A 1N0VC 3D2AA 4TOIA 3ZEAA 3WQBA 3JWEA 5CCXA 4FCVA 1XHLA 3QH4A 4O4HF 2QJRA 2ABWA 4G5OA 1ZRMA 4KAXA 3BFJA 2AOVA 4MQFA 4QIHA 4FR2A 3X2SA 1C8KA 2ZBVA 3I32A 2E48A 3DHVA 4F12A 5KYUA 4XUDA 1TTQB 4NABA 2DWQA 3OT1B 4RIHA 1MABA 3ISTA 4NICA 2QUKA 4PU0A 3DCIA 3I83A 5THKA 1PYOA 2J1LA 3GIWA 4WLFA 3NWBA 1RYNA 2GZAA 3A9CA 2B1JA 3CUYA 3NBFA 2DQZA 1ZH0A 3A4IA 4GXNA 4IHAA 4X91A 5F4BA 4KR6A 4AXXA 4C3UA 1V5FA 5L9AA 3GZJA 3ES9A 4PLFA 1LI7A 2FEKA 4TXJA 2A30A 1T9BA 2GK3A 2KE5A 4DNQA 3C6BA 3A3YA 1X42A 1MJFA 2HV9A 5EMJA 3BGWA 2HT6A 5C7YA 4OLAA 3UWKA 3VR5D 5JYCA 4NCIA 3P9PA 1G20A 1SD5A 2G1AA 2BEKA 2W0MA 4UEQA 5FPSA 3UY4A 3MWFA 3VFDA 4YFYA 4Z49A 3VDMA 2E49A 1K1EA 3GJ7A 1V7CA 3R75A 2YZ7A 3DYIA 2ZUUA 3PBKA 3OI7A 4RZQA 2NV6A 4IMIB 2C2YA 3LA8A 3PEEA 1F12A 1OREA 4N9QA 2IU3A 1SBTA 3COVA 4HZGA 1QDEA 1G3QA 4HDAA 1NLMA 1Y81A 4HZIA 4UATA 5JYDA 1FOEB 3B36A 2VQFB 4KFUA 5A5FA 4QA9A 1ZD5A 3B20A 3T9AA 1E2JA 2N47A 3W5VA 1G8AA 4BZQA 5KNCD 2XX3A 2ZROA 4RF2A 1H4SA 1LBTA 4E5VA 4KIJA 1HYBA 2JLVA 1E9FA 2AR9A 5AJYA 3C0KA 1MP0A 1DU4A 1K9VF 2X2PA 3BXHA 3TLMA 2V6FA 2RE8A 1R4MA 2QR2A 3K9CA 5C1BA 1NATA 1K3FA 3TDNA 3L1KA 3RHSA 5ALNA 3SP1A 4ZCIA 3NH9A 4JQCA 4MI1A 1CYEA 1IEQA 2ZAYA 4MP6A 1GNSA 3AU8A 3HA7A 3A1NA 1VPWA 4CGZA 2ID9A 1D1TA 4L08A 2FDXA 3Q12A 1K8XB 2VP0A 4X63A 2VAWA 4QRIA 5KCMA 2BR5A 4CBVA 3VZRA 4CIWA 1TTTA 1L7DA 1XZEA 1KFJB 4AD8A 2EZTA 3SQXA 2Y05A 3B78A 5FV4A 2YJTD 3AKZA 4CQMA 1RM5A 1I13A 4DSZA 3CRMA 1ESZA 5I51A 4Y6OA 1PZHA 1KU0A 3KYDA 3GXOA 1L3IA 2Q50A 2QI9F 2P67A 4R4JA 5DGIA 1F6WA 2A1TS 3DOUA 3LMKA 2DSTA 4S1NA 3ZKWB 4BLQA 4EYGA 4B1FA 3PEVA 5AXDA 2OEPA 3DBVO 4GX5A 3CCBA 4EO7A 2O57A 1Z6AA 1FFHA 3R9XA 2XOKD 4UBIA 4V0RA 2IBSA 2IHVA 3TM5A 2IXAA 3A6DA 3IBSA 4QX6A 4MVCA 2E6KA 3LSYA 4XJXA 2CLEB 2OV2A 3C6QA 2DLDA 5DYGA 1XRRA 3UJNA 4MRVA 1VLZA 2KX7A 2QNRA 3W7AA 2X9VA 3KEFA 2ZANA 4ZHSA 3C7KA 1CRZA 5T8KC 3AB3A 3TO5A 2Q6VA 4LKRA 4PO9A 2ACEA 1E20A 1PS8A 3W2FA 5IAJA 1PGNA 3JATA 1ZD3A 1I24A 4M83A 3U81A 3WO1A 3AVXA 4DR7B 1GADO 5A0TA 3ROTA 3GR6A 2K2WA 5D1HA 1CUCA 1EVKA 2C88A 3PUYA 4TGLA 5CT8A 5E4YA 1OGJA 2XECA 3WV4A 1D9ZA 2JK0A 2C07A 1X1TA 1THTA 1DSSG 1W85A 1NLUA 1Q7EA 2DX7A 1U0HC 4QYIB 2EEZA 4NPHA 2RCYA 2YXNA 3WK6A 3RHFA 3TAUA 5IAEA 5L3ZA 2Q2WA 3PFFA 4H0NA 1POWA 1LF0A 3W2EA 1T9KA 5HJ5A 1T3HA 4PX9A 1YIAA 2A5JA 1Q0PA 4J75A 3V1KA 4MW0A 3HY3A 4X94A 1Y7HA 2AX4A 2BR4A 1FFWA 1X87A 1RFGE 1Q3TA 2VWGA 4IDHA 2PT5A 2PGNA 1J9ZA 1Y3DE 2DUJA 3DE7X 1NVDA 2WB2A 1J06A 2CW5A 4HK4A 4EVIA 4DMHA 3SDZA 3W4JA 1P4HA 3ENVA 4HOYA 3G6WA 4KDFA 1WB9A 2GVDC 5FOQA 2PQMA 1SWWA 3PDCA 3VYUB 5C46F 5LMZA 1R27A 2DQ4A 3OPYI 2CHFA 5JJLA 2FXVA 3ANMA 4IFIA 1PW5A 2HJ9A 4C0LA 3H2YA 3N2KB 1SFRA 4HXGA 4RZIA 2HPVA 1CJTC 1SIWA 3PGJA 4WJKB 2VO1A 5GIOE 3F4LA 3HO1A 2BFBA 2HF7A 1NP3A 3EBPA 5EE5B 4XYBA 3VU9B 3WOHA 5A4AA 1C1DA 1KAGA 3BT7A 1L8LA 4DUPA 4YN3A 4DZZA 4H18A 4QD3A 1TF7A 5B2ZA 2W6CX 4DSOA 1PK7A 1TAUA 2C42A 3I37X 2COKA 3OEEA 1SC9A 4HWGA 4IR7A 3UTDA 2WSLA 1RRGA 1DWUA 3ZWVA 3F3KA 1KO8A 4AX4A 1J49A 1IZ0A 2AG1A 5LJLA 2I99A 2C77A 2VQDA 1VQ1A 2JLCA 2LP4Y 2OGZA 2HU8A 5CG2A 1JG4A 1LGYA 4PWZA 3SJZA 4BNLA 2EFDB 3O84A 3NV7A 2H08A 4LRQA 1JN0A 4Q00A 3Q5GA 4PG4A 4B84A 1QPZA 1Z25A 4QKQA 1UXGA 4G25A 5FADA 1SQ0A 3GFFA 5HM8A 3IQZA 1VYUA 2RHTA 2RAPA 1KQGA 1IHYA 1P7WA 4PO3X 1KYVA 2J87A 3ZE9A 1VL6A 4KOEC 4JSRA 4JP5A 3QXCA 3CKLA 4IAOA 3FYCA 3MUNA 3K8YA 4AJLA 1PK9A 1VPVA 4YBRA 4FFRA 4MGYR 3U0BA 3A0UA 3EIWA 2J33A 1QLHA 2W2MA 2ZKLA 1PJSA 3A4MA 3HJGA 4FGZA 5FTNA 3OKFA 3PLAE 2B92A 2HF9A 3O9ZA 2VJAA 2JJ8A 4JP2A 4R81A 1U3UA 4OIMA 3R9KA 3OMLA 5FL7D 1W8IA 3A4TA 3PNKA 4JITA 2P9TA 3C1OA 3JQ7A 1TVKB 3L92A 2DY1A 1P17A 3G2IA 4Z5XA 2CVPA 1PZGA 3X2FA 5FEMA 2B7BA 1ZEMA 2LKCA 5F5XA 4S04A 3OCYA 3RRNA 1MB3A 4QDOA 2W93A 5IJ0B 4WADA 1XDWA 1O6CA 1P73A 1CF9A 4P0TA 3PC8C 5AOAA 5JADA 3E05A 4TMKA 1OE0A 2QLTA 3RSZA 1JHOA 2O8EB 2SHKA 3NVAA 3SICE 2NN3C 1J09A 1NAIA 5A4DA 4P5EA 2MR5A 1K7FB 1XD8A 1RKQA 3SQOA 2OA0A 4EY7A 4EG7A 3AF5A 4OFZA 5FORA 1SO8A 2IF2A 3HXPA 4HDNA 3ZNQA 3RAEC 1Z5UA 2CXSA 2OZPA 3RKRA 4DDKA 3ZDEA 3BIXA 4LF7B 4LHXA 2UUOA 2O8FA 3UPDA 1EX6A 3RO7A 3TXAA 3UMBA 4D25A 4G0WA 1YDFA 5GM1A 3WISA 1V8FA 3KJEA 4HBGA 3R4VA 1Q0RA 2H2HA 2YJ3A 1Z8FA 4S1OA 4AO6A 4LVUA 4J0QA 5EERA 3O9VA 4MUAA 1BQEA 5DLYA 1B42A 5FFFA 4EITA 1HYEA 3JWHA 3VZPA 1FCJA 2FZ5A 3HDQA 1GVHA 3OCCA 4PZ9A 2H4YA 4U2CA 4LRUA 4MP8A 1YZKA 1L5OA 1AKQA 4ENUA 5THQA 1KJWA 1U8TA 3QI2A 5IWCA 2GDZA 1FMLA 1DDIA 2W6OA 4PWYA 2VLIA 5AESA 4DS3A 1I6WA 3R9WA 5BSMA 1Z4OA 3GRRA 3GYBA 4M86A 2JKVA 4A5OA 2P9CA 1PZFA 2L69A 3EW9A 3TLKA 4JGIA 4DCCA 2FRDA 4DBVO 3HBLA 2L0XA 2LDXA 3F2IA 3MWDB 3PDHA 3O1LA 4PINA 4JLDA 4JI6B 4I1PA 3PQ8A 1VMIA 3HEBA 1YVPA 1H2RS 3R3JA 1TRHA 1O4WA 3BSSA 3VH3A 4RTPA 1F60A 3CF4G 3LX4A 3EZLA 4QPDA 4CG2A 3G2HA 4MGZR 2XB2A 2GPAA 2MYUA 1IM2A 2GHIA 2EIXA 4OL0A 3UKOA 2WJJA 2GVNA 4HO1X 3TZHA 1UR5A 1CLUA 4I9GA 3T95A 4KBGA 3ADBA 4DZRA 1L8AA 3NBAA 3DB2A 4MQFB 5A2GA 2FFAA 5FEUA 3DFMA 3DOOA 3SR4A 4Z1MD 5KYUB 1WVMA 1N7JA 4LQ4A 5E9WA 3MWLA 5T67A 4OH7A 5DNAA 3L6BA 5KTMA 1MABB 3QK7A 2R5FA 1AGXA 2R87A 4LYYA 3W90A 3JQDA 4HTFA 4WCFC 3I61A 2YCLA 2RB4A 1S01A 1GSIA 2XB8A 3HCDA 1OAKA 4PYKA 3OZVA 1QSGA 4L8WB 1SXJD 1FYXA 1PYDA 2KS6A 3OECA 5K2MA 4H1WA 1BHO1 1YQGA 2H07A 4JX9A 2LUOA 1NXQA 3T38A 5CDSA 3KOOA 5BPFA 1C81A 2YZNA 2K7FA 1DAEA 4O3MA 3LRXA 3NM5A 1YTUA 3A2KA 1K9SA 2YR0A 1QBKC 1PWEA 4CIYA 3AVTA 4OXRA 2I6QA 1I14A 1V6CA 4JK3A 4IMJB 3SMQA 3ADOA 2ZXFA 1G20B 4DJJA 4DLBA 4RVUA 2ZYVX 3GU3A 2ZYAA 2AC4A 1XQWA 2K87A 4X8MA 1XK6A 4H9GA 1MPTA 3VSBA 3AKEA 4PSKA 4E5MA 1VHLA 4TZTA 6Q21A 1KYWA 1H2YA 3I9V1 4ZO9A 1CJUC 1SBIA 1JU4A 1JDSA 1Z39A 4FPXA 4WOCA 2YHUA 4JGGA 1NI3A 3CUKA 1ZW6A 4L15A 4LCJA 4CM3A 4Y9TA 2GR9A 1RLOA 4IG9A 5HIKA 3KQSA 4ZKDA 2NYAA 4O29A 3DAGA 2JLAA 2CZGA 2OV1A 3RNLA 1OQAA 4GDFA 4O25A 5E9JA 3NONA 4QRDA 3CVYA 3W2IA 1WZEA 3N58A 4MQUA 5EQTA 1PGPA 3ZDYB 3HMKA 1YUMA 1OXUA 1EM6A 2CYCA 1XQXA 2Z3ZA 3FDFA 1R4MB 5A6VA 3WWDA 3BXEA 4PBTA 1NN1A 3QELA 1CUIA 4MB0A 3ZD8A 4AL4A 2AFHE 3LCJA 1Q0ZA 3RUIA 5IW8A 4ARVA 4ZMSA 3OCWA 2ZPTX 5I7HA 5J2UA 5TQVA 3ZJTA 1YHNA 2P6OA 4OQDA 1ZESA 3QENA 4UMFA 1W9HA 1U81A 3U4IA 2WZCA 4G0NA 3FGOA 1KEZA 2Q2VA 2R79A 4EY8A 4CQMB 3BWMA 5JY6A 5IBQA 5LQJA 3C14C 3OE1A 1Z5NA 1FDWA 2A94A 2F90A 2QGNA 2ZJOA 3SS9X 4KXYA 3VRHA 3KYDB 2ST1A 4C01A 1YZHA 4WNAA 1QU2A 3DPIA 1YTLA 2PGJA 4UEKA 4INJA 1XKTA 1YL7A 2AKYA 3WSWA 1XPOA 1XCOA 2VF8A 3EJ6A 3OQ1A 5CH5A 5K3AA 3EPKA 3FOEC 1IH8A 3NLLA 5LU8A 4DC1A 2EJUA 4AJNA 2QVGA 4KRGA 1IOLA 4UHEA 3GRAA 3INRA 3R9XB 1XMIA 1ZNXA 3K70B 5AW2A 3E3MA 3OP1A 4BFZA 3AP2A 4KV9A 2DMRA 2OFPA 4MQ5A 4HUTA 2PH3A 1FQWA 4OGKA 4Q15A 4YECA 1Z3CA 3QYFA 4LMRA 4RSMA 4FX2A 4Q03A 2CMFA 3KB1A 1JZQA 4MIEA 4C6SA 3D6AA 4UXIA 3RV4A 5KAPA 5CCBA 4OPMA 1KK0A 3NRBA 4QELA 1GQFA 1WMAA 5FJIA 3M83A 3EIFA 3QBEA 3JATB 4DVGA 2VWQA 1DPFA 2GT1A 2Q6KA 4QAJA 3UIEA 4AK9A 4B48A 3O95A 1JVNA 5C9ZA 2RH5A 4MV7A 2YV2A 4FQ7A 2L19A 1A9PA 1YHZA 3A3KA 2XVXA 3MQFA 3HJAA 2AN4A 3BXOA 2JZNA 1UKYA 2EHDA 4K81B 4X71A 4CIVA 2QX6A 2FW1A 3BFKA 3OPMA 5CA0F 4DMGA 1W85B 2AH5A 3IUJA 3NEYA 2QR5A 4IHQA 5GIPE 1NOIA 5HZHA 1TPYA 3OLQA 3OC6A 4ER6A 1Z68A 4DLPA 5CXQA 2YV1A 3IOCA 4TRRA 1Z8NA 1PR3A 1GEGA 3Q3VA 4OHCA 3SZ3A 1NNSA 3MCTA 3UQZA 4UFPA 3T5GA 5JD3A 5FV7A 4AWAA 3DOFA 5JHGB 1EKXA 1D07A 3ZQUA 4KPYA 4XGIA 3GC6A 4MRMA 1FSSA 4TUYA 4QM6A 5EIBC 3C5HA 4KQWA 2XMSA 3WB9A 2YOHA 2PRYA 1P4AA 1Z0SA 2ZT8A 3HGQA 1IY8A 1QIMA 3IP9A 3G9XA 5CLHA 3S2FA 4W9MC 3COPA 3KSBC 1A8HA 3A1CA 2DJ5A 5DHRA 5FBQB 4I9UA 1SVLA 1H69A 1GPBA 1WVIA 3LT2A 1Z38A 3H9QA 2HX1A 2EW8A 3KVNA 4IIXA 4K05A 1XZKA 1QPGA 2P1RA 4C04A 4HX9A 3HA3A 2PMFA 3W9YA 2BFBB 5CM2Z 4ZOAA 1L1RA 5IS2A 1HEYA 1BDJA 2B0JA 1MHPA 1C1DB 2DFLA 5EXDA 2OFFA 3W1VA 4F72A 2R8EA 2WMNB 3ESCA 3HS3A 1TK3A 3KO8A 3AG5A 2GN6A 5AUOB 1KI8A 1SQ6A 3LHSA 3TTXA 2GJ9A 1XQ9A 2FOLA 3N3BC 2WWHA 3WDKA 2IODA 5JXWA 3EX7C 1DJMA 1THMA 3NX4A 3AR5A 2IXTA 3MUEA 4TXNA 5E9AA 4DYVA 4KRYA 4Q4CA 3BAFA 1P6QA 1JPUA 2EZ9A 2FG7C 2FF5A 4I99A 4W9RA 2WTNA 1Y4AE 4PONA 4X3OA 4LXGA 4QBGB 1SGWA 3WLQA 4OSPA 5AVJA 2C7PA 1C1XA 2O07A 4EYEA 1AKUA 2YZ2A 1BG6A 4BS9A 3FPJA 1FTNA 3H5LA 5EEGA 2C59A 3UXMA 1PJBA 2BSAA 4WINA 4RIEA 3CNBA 3QMWA 1UBMS 3RFTA 5DCYA 1F0NA 2QD2A 3CEJA 3RIMA 1UBHS 4UAJA 1IN5A 1TI7A 2ZI7A 1J2EA 4D9IA 2QBYA 4JIMA 3EVZA 2D13A 3JYQA 1RHJA 3UGKA 1WLYA 2IZ1A 1NKTA 2POQX 4W5HA 4M38A 1QS0A 5A5DA 4WUTA 5EJ8A 3PLNA 5CB6A 3UJ6A 3JAKB 5CM8B 4C76A 4LBYA 5EXEA 3OIFA 1KMQA 2F8LA 1SUBA 1BKSB 1DAHA 5AQ1A 2Q27A 4DQVA 2QVBA 1RYZA 3JQ7B 2WAOA 4G89A 5J5VA 1JS1X 4JBGA 1FUUA 3RSGA 5ITZA 3UJBA 5K6TA 1SVSA 1HG1A 1SKMA 1ECFA 3FR7A 4DQ0A 2XY4A 1IXYA 5GJWC 1WQ4A 2HJRA 1J39A 2NW6A 4Q3OA 3IAM6 3ZVNA 2F3TA 5C3UA 1C7QA 1EUYA 5LQSA 3KXPA 4J0HA 1EVZA 5BSWA 3QFSA 2ZRMA 1H2XA 2SKCA 2Y0BA 3P9RA 4J16C 4MGHA 2AOTA 1P29A 1UKBA 4RF4A 1N5LA 4JWTA 1JKFA 1U28C 4HWOA 3OCVA 5AW5A 2J09A 2EXXA 3FZNA 4OJKA 3KYIB 4LW8A 4NL4H 4KGVA 3ZIAD 2GBLA 1NF8A 2AC7A 3B48A 3QXGA 4I36A 4X84A 5FPYA 4BCDA 2VTKA 1X74A 2IV3A 1NJ8A 2PSDA 2TRSB 3HDHA 2AQ8A 1FP1D 4G0QA 4OQFA 2PN1A 4HDNB 3BGVA 4R16A 4IF6A 5AKZA 2DWOA 2SKEA 2NSLA 3H8VA 3O4IA 4IEEA 4RXTA 5CTJA 5C3MA 3GBPA 1BQ3A 5MGBA 4A5SA 5ALKA 3EVBA 4G1CA 5CVCA 2O8FB 1V9SA 4EUKA 4PZZA 5C80A 1LLQA 2YOGA 4B9EA 4CQLA 4X7BA 3BD7A 3DDWA 3ZXUB 5KWEA 4WJLA 4E08A 2C7BA 2EFYA 3ND9A 3OUZA 4MIYA 5DYTA 3LU1A 5ECWA 2W6JD 4BBAA 1LJLA 4DDVA 5K8IA 1QYVA 1MBZA 4GR4A 5ALHA 3TL3A 5M2QA 4LDQA 3H5TA 2C04A 3CRRA 4J8PA 2VDOB 1UUFA 1HPLA 4B4VA 2J45A 5L4LA 4JP8A 3I5YA 3ADKA 1MX3A 5EI5A 4EHIA 4G56A 5FD8A 2Q3JA 4GP7A 4MXDA 5K2OA 4JI7B 4YCAA 2WVGA 3DL0A 2WICA 2OHFA 3EMKA 4OUDA 1KDTA 3EQ2A 4QGBA 4BLRA 1AS2A 3UT5A 1RE0A 2RHHA 2EKBA 2V58A 3ZTTA 1MUUA 2HMWA 5F7JA 3DVLA 4CIDA 2QLJA 5KKNB 3KWJA 1ZUD1 4MQBA 1ZI8A 5CTAA 5BQPA 1KKUA 4BCBA 2VHTA 4TM8A 1P39A 1DVRA 1JX6A 2QE7D 2RK3A 2YHBA 5L3SA 3D6HA 4GX0A 1HQDA 2GF9A 1WZIA 4YMIA 3Q7SA 4MV8A 4WESA 5IK2D 4QDZA 3PR2B 1KYQA 4I1OA 1FNCA 5BW6B 4KBYA 4YJ2A 1DIBA 1BXGA 1MENA 3ZKAA 2FH5B 2R11A 5AK4A 5ALMA 4P22A 4DIUA 1AKVA 2QM3A 1TIKA 5HJ2A 5JNSA 2OPBA 3FPKA 4Q1VA 1N9GA 1TZ2A 2ZRJA 2H2GA 4Z4QA 4F3RA 2GN9A 4HTFB 3LI2A 3AJ8A 3UJ7A 3CVWA 4Y9RA 4FINA 2G07A 3KV1A 1U2DA 2I2WA 4LZWA 2AJBA 3DKPA 4M36A 4QFCA 4IS3A 4ZAFA 3UMRA 4WGFA 1MZPA 3QLVA 3EZNA 3QA9A 1T4MA 4FFSA 4TS1A 4MDYA 4XWAA 4AKSA 2YWCA 5K6AC 3I2YX 1H2ZA 1PX2A 1XP8A 3GLTA 2DXIA 4JXZA 1HL3A 3ASUA 3C5VA 4U1RA 5ITSA 4LGYA 2RI0A 2YY5A 1G66A 5JY1A 4TSRA 1U0NA 2HK7A 3OKAA 3IJ5A 1ZNYA 1JHPA 2PWBA 3PXGA 4ARAA 4ER3A 2Q4EA 3VR4D 2XI4A 5A5EA 1ADJA 1GSOA 3EMDA 3B53X 4JP1A 4OXQA 2OYRA 2PAFA 3IP3A 3ROQA 4YO7A 3VTFA 3ZYCA 3WQSB 4CMEA 5KZMB 2OOSA 3FLBA 1H1TA 4PCUA 3A4VA 1DCKA 4LJKA 4BKOA 2QW1A 3W3AA 2DH5A 1WY7A 2CWWA 4V3CA 2F4VB 1EFUA 3OQJA 1T26A 2C96A 4BECA 3JARA 4L5CA 4D4LA 1XCLA 2GM5A 1E5LA 2QGZA 2LCQA 3H19A 1YZ3A 3TTSA 2DOKA 3K2QA 2YY7A 3T54A 5CEEA 4L1KA 1HEIA 5AOVA 4RPJA 4F4HA 2QF7A 1RNLA 5EVJA 1NF9A 4MCJA 4JUBA 1IHXA 3QELB 2QUJA 1AUOA 2F4NA 4YROA 3EH1A 2VYFA 4JBXA 5M04A 3PKZA 3BCSA 4YP9A 1PL8A 2V6MA 3ESBA 3LCRA 2PV0A 3FLAA 3GXBA 2GEUA 1WZUA 5J2UB 2HAEA 3NUGA 2Q5HA 5CCDA 2YXBA 4EOGA 2JIPA 1R0CA 3HYSA 5JLAA 2H9YA 4MKHA 3V8MA 1S3IA 2BBTA 3OFND 2EBHX 3MCWA 4CV2A 1U0TA 1E7MA 3C7DB 1CZUA 1MOPA 3E03A 5JE8A 4DIKA 1CUDA 5CFPA 1QX4A 4A0QA 4MS4A 2B0CA 4MW2A 1G5TA 4LY0A 3UMFA 3J7AC 1J7JA 2QLFA 3K1ZA 1VLJA 3PE6A 4RE6A 4WNAB 5IJAA 5EJ2A 5JAIA 1TMGE 1EFTA 4UJ3A 5HDQA 5K20A 2EWVA 1A9RA 3TTTA 4E5SA 1Z9BA 3MTJA 1GGEA 1SOUA 1Y4UA 2CCKA 5AUNB 5KU7A 4TWAA 3L4JA 3ZOKA 2ZCUA 2WZQA 3U3JA 5L6MB 3SSOA 5HA5A 1DRVA 3DZKA 1ZJWA 1OTXA 2Y1KA 3GEMA 4LZOA 2BMJA 4M88A 1PYGA 3F7NA 4J7AA 3WKEA 4ZCRA 4MARA 3FOZA 1TYBE 1DI0A 1U3VA 4FSXA 2ZRFA 3ZNNA 2FB9A 1RIIA 5F9MA 3RG2A 3BWDD 3VMMA 1FDSA 1T3GA 5BV1A 1GPUA 1Y9AA 4FCTA 3RYIA 2BGMA 2EJTA 2ZYIA 1NW6A 1HDXA 4TRMA 3HV0A 3U44A 3AHHA 2QUBA 2XWBF 3ZHCA 1VC2A 2OD7A 2VKQA 4A7PA 1HSOA 4GRDA 1L6RA 2CNKA 1J20A 4RKQA 2BH9A 4WK6A 5BUQA 3MM4A 3PWTA 1ZINA 3BD8A 3DWIA 2O5VA 4IOLA 3D7LA 2HIMA 4INAA 1XU4A 5JZVA 4L8FA 4ER7A 1OYVA 2ZIGA 2BMEA 4NBLA 1F6BA 2PGXA 3DGFC 1JHVA 3ONFA 2JIZA 1NJ5A 2I6FA 3DULA 3T0GA 3U4CA 2JBAA 2ATIA 2HB6A 2Y92A 1X39A 4GLBA 2OBBA 4HAXA 4RPGA 1JHXA 3T7KA 5ECYA 4ZZ1A 1K7YA 1GYPA 4ZT4A 5G0WA 3M33A 1AY0A 2P6PA 3TCNA 4MRMB 3ZVRA 4TUYB 5DTMA 1IQ0A 5JC1A 5KPDA 4U63A 1Q91A 1QM5A 3PQ5A 4CEJA 2IU0A 2XTZA 1X0XA 5IVIA 4FFNA 3C74A 2PDAA 3OZAA 3EMVA 3E5HA 1L7QA 1QYIA 1ACJA 2P41A 2ATCA 1C7ZA 3C1UA 4DSNA 4KB5A 1HOXA 3DZHA 4ZYLA 4E6EA 3WZ2A 16PKA 2GJ8A 2QY9A 2X4LA 3WLTA 2W43A 1TC1A 3HV2A 5FBZA 4HJRA 2ZJ1A 1RAAA 4QQKA 3RRFA 1LKZA 5IABA 5KO2A 3FYTA 1QTQA 1I3CA 2P9JA 1SU4A 1N8KA 2YVKA 2DETA 1PU2A 5KVSA 3LM8A 1XRJA 3E3OA 1FP2A 1L3BA 3QVVA 2BTOA 4NYIR 1ZDMA 2RC6A 2PLAA 4ISBA 3WK7A 4F2HA 5IH7A 5MDHA 1U0BB 1A4XA 4QE3A 3BMQA 2UYYA 3HCCA 3OCZA 2ONJA 3C87A 3KZCA 1DDOA 1QKKA 4IDCA 1YGYA 1JHZA 4BMSA 1Z6TA 3P97A 1OILA 1O89A 1M6WA 1O4VA 1U3TA 4M0PA 3V34A 3ZCQA 4LRYA 4XWYA 4WXPA 5DEIA 1E2GA 1C1XB 5DIZA 2W9XA 4MUMA 1IMJA 3N2EA 2RAFA 4YRGA 3SN6A 1P0PA 1QQ7A 2EGUA 3AM4A 1JI0A 3UXEA 3VA7A 3PGLA 4LHZA 4QG7A 5JMWA 4KIFA 1OYWA 1BGVA 1F8GA 1P9OA 2QBYB 1P4RA 4WZ6A 4XVQA 5D7NA 1SKQA 1KH3A 2QENA 2NNWB 3DXFA 4YGYA 3TNLA 4D0RA 2AJDA 3D6UA 3SBEA 1J6UA 1V3VA 4FNMA 1IEVA 4L76A 4OMUA 1QS0B 1D7AA 5B1DA 1YULA 1IPEA 2Q5JA 5DPMA 4E2ZA 1T3TA 3OP4A 1OD6A 2HN9A 1Y34E 3EDMA 3KTDA 1NXWA 1VB5A 2I3BA 3SGLA 3VR3D 2W42A 3QYJA 2CJYA 4M0DA 4F60A 2HW8A 2Y4OA 3WGYA 2IPMA 4G4JA 4BMXA 1EWKA 2IYSA 1NKVA 4NYJR 4BTEA 2QN2A 1SVUA 2RMKA 2O5CA 5ITZB 2G1JA 3HACA 2I6TA 4DB2A 2O7VA 1T5HX 1D2RA 1JIXA 4AULA 3K8ZA 1YIDA 2EKLA