1BWRA

Probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGSNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
publication title Probing the Substrate Specificity of the Intracellular Brain Platelet-Activating Factor Acetylhydrolase
pubmed doi rcsb
source organism Bos taurus
total genus 71
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 1998-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1bwrA00
4TX1A 1YZFA 1ZMBA 3KVNA 4JKOA 2APJA 4LHSA 4RSHA 4HF7A 1DEXA 1JRLA 5JD3A 4PPYA 1V2GA 4JJ6A 1BWPA 2Q0QA 1BWRA 3SKVA 1J00A 4RW0A 3DT8A 1VYHA 5B5SA 4IYJA 1PP4A 2WABA 3RJTA 3DCIA 3DT6A 4K7JA 2VPTA 3C1UA 3P94A 1WABA 5BN1A 4K9SA 2Q0SA 4NRDA 2W9XA 1FXWA 4H08A 1K7CA 2O14A 3DT9A 1ESEA 4K40A 4OAOA 4DEVA 5CD9A 4M8KA 1BWQA 4K3UA 3MILA 4JJ4A 4Q7QA 4I8IA 3BZWA 3DC7A 3PT5A 1Z8HA 1VJGA 5A4AA 4Q9AA 4HYQA 3W7VA 1FXWF 1DEOA 4S1PA 3HP4A 2WAAA 1IVNA 3SLRA 2WAOA 1ES9A 2HSJA 4OAPA 4XVHA 4JGGA 4JHLA 5HOEA 3U37A 1ESCA 1ESDA 1U8UA
chains in the Genus database with same CATH superfamily
4TM8A 4TX1A 3UYKA 1UQUA 1IBKB 1H1LB 1WV0A 4MR9A 3F6CA 3G89A 3OQIA 3K5HA 4EITA 2P4EA 1EEXB 1EI9A 1L6RA 4OLFA 4WKOA 1TA9A 2PLFA 3IP6A 1EG2A 2IHKA 1C1HA 2ZJ2A 4PCLA 4U6SA 4YCAA 1I32A 2BJWA 5FAXA 1B74A 1NI5A 3THOA 3Q0EA 4HF7A 1V7ZA 4PLVA 2BI8A 1Z4OA 2X3UA 4JMLA 1N2OA 1Q77A 1XU4A 3OPXA 4N6NA 4J94A 2PKWA 4ARIA 3L0SA 3FCXA 3O4JA 2QTVA 4OKNA 4PC3A 3ZU2A 1NURA 4YXWA 3IUSA 2I9PA 2BSAA 3ZE8A 4XX1A 5KX5A 1D2GA 5H02A 1P5JA 2AFHE 3PF9A 1NFRA 3CLTC 4WE3A 2HFJA 3C3YA 3K2QA 3RODA 1XUOA 2LXNA 5KWIA 5K1ZA 1XV5A 3MUOA 1IY8A 2OBFA 2Z8ZA 1N3LA 4LA4A 5F12A 2WKPA 3TSWA 3GVIA 3CU5A 4KFSA 3S2YA 4EFKA 2Q50A 1KAHA 5JCXA 1M2KA 4GI3A 2QQFA 4ZVOA 3ZDFA 3TE6A 5GPBA 5T7BA 2NO5A 2ZRQA 2WNHA 4JJ8A 4M60A 3QPAA 2CVQA 2WWVD 1C1YA 1M0EA 2X9QA 4YJHB 4P7JA 3CNLA 2FJUA 2V6MA 2JH3A 3WFIA 4E14A 2Y27A 4WKPA 2GT1A 2P6RA 7MHTA 1ND5A 2PFGA 3W5IA 2I7TA 4ACAA 4IL5A 3CVUA 3BMCA 1E69A 1DADA 1JAZA 4BEJA 4ON9A 5CNKA 4O1HA 1LQUA 2CD9A 3DB1A 1EUZA 1RYMA 3PC8A 1DAFA 3O2NA 1MQAA 1CIJA 3GPDG 3EXIA 3HJAA 1LDBA 3NDBB 2FUEA 1O8BA 1IEWA 2X4DA 1HNWB 4LKOA 1IBLB 3Q11A 4CDGA 2PQ2A 2VP0A 2C4KA 1BEZA 2OA0A 2NZUG 3RQIA 3VR5H 4BFYA 5A5GA 1E5DA 3EXAA 3WZMA 1CRLA 1XZCA 4A8PA 1F3LA 1OLUA 2ZSBA 4GIBA 4LSGA 4UNNA 2PS3A 3O5AA 3G9TA 4WNAA 2FFJA 3F7MA 2E5FA 3PF8A 1PD0A 1YR2A 3KQTA 3ESCA 4DSOA 2WJ6A 4YR7A 3H2IA 1Z7BA 2C4MA 4RFSA 4RPKA 5DIZA 3DONA 1G59A 3CBGA 1FW8A 3A6HA 3LDGA 3KHTA 1A8IA 3FOFC 2I6GA 2ZS8A 1CBUA 3LK6A 2ZT5A 3A7EA 5HUHA 2FPUA 4TTIA 1VBNA 2AFRA 4OB6A 3PX2A 3O8BA 4N5LA 4C2AA 3VH3A 1GHTA 2WYWA 4QAJA 2RKOA 4BX2A 2XHZA 4P3XA 1A76A 2ZYVX 5J1SB 4P0PB 2GLUA 1I2BA 1PDWA 2AI3A 4KHZA 2IWRA 1CP3A 4BMPB 1GLNA 4RMNA 1U7UA 3U7JA 3T3GA 4R5MA 4BVAA 1FLDA 1M2HA 4XQ0A 2H4WA 5SYNA 4A4DA 3WK6A 3BULA 4B82A 4FM9A 2IH4A 5A62A 1XTBA 1E9RA 3QVJA 1ZGHA 3L1JA 2F3TA 1KAEA 4MW4A 5AVKA 4BJ5A 3X2FA 3AFHA 2WA1A 1GY8A 1TJ5A 1GWNA 1XNHA 2PNFA 3U1BA 5IBRA 2IXGA 1DELA 2QG6A 3KIPA 2WTNA 2GK4A 4Q4JA 4RENA 4G0WA 1H2WA 1QF6A 3WK4A 1PT6A 2CJFA 2X0FA 2CLSA 1J1ZA 4CR7A 1TKAA 2G6BA 4HYEA 4EPVA 1QGED 4M53A 2IUYA 1RXSA 2CK3A 2FHPA 4K9OA 4BJ3A 5FPSA 5A05A 1JPJA 4RMGA 4BC0A 5C1OA 3F6YA 5KSOA 3U7GA 4N48A 3GG9A 3AYZB 1NLFA 1GARA 2OILA 4K2AA 1XA4A 4RMIA 1MGPA 3N2ZB 4KAAA 4UMVA 4C6RA 1MLDA 2COUA 3RRZA 2QM7A 3M5PA 4MS3A 1VMDA 1MVLA 4YHHB 2I3AA 2QTTA 2CXTA 1ZD2P 1DQSA 1LRKA 2FEWB 2QZSA 4FFSA 3SQWA 2GF9A 2Z83A 5JDIC 3WNBA 1QQ7A 3NWEA 1LI5A 3T9EA 4MV9A 1XA3A 2HLHA 3VR4A 1XMJA 5KTTA 3I6IA 2AE2A 1PHPA 4IZHA 5IF3A 1CZRA 2H5LA 3FXAA 1Z2CA 3OO1A 1YI8A 3KX2A 3UA3A 1OPRA 4OXIA 3RT9A 1TVKB 4ZVKA 5LQUA 2FTKE 2G1UA 1Q14A 1CF4A 2VQDA 2CC2A 2A3RA 4JI6B 3ZBPA 3EDYA 2B92A 3T7KA 5C81A 3LTNC 4Z4CA 3W3AH 3PWSA 5KWSA 2P2GA 5I8ZA 4FS3A 4RV9A 1Y1QA 4E4TA 4G5GA 3MGCA 4Y2JA 1HLGA 1DKQA 3VDMA 4NZ9A 4US2R 4OHZA 2R0QC 4ZMRA 2JJMA 3EGIA 3ER6A 2QTZA 4MMXB 4J6FA 1MBZA 3C8ZA 3CEAA 2RAUA 2Y1WA 3TZEA 1O54A 3LP6A 4B8ZA 3FUXA 3MJSA 3NBAA 1WBBA 4HNUA 2HJWA 4JS0A 3OTWA 2RG7A 2IEAA 1UL1X 4G63A 4QLAA 2QJRA 3GMTA 5K0EA 1GILA 4AKGA 4YJGB 2C2XA 4S35A 4IICA 1V9SA 4IBOA 4CLOB 1DJLA 2YX1A 2ZXFA 3W2TA 3KVYA 3NBXX 1BD3A 1D04A 2LKDA 1QIIA 1YRYE 3ICWA 1D2AA 3DC7A 3WP0A 4D6XA 1RVDA 4CTOA 1CNMA 4LCJA 3KQVA 3MWDB 4B6FA 5EE3A 3ZD7A 2EDAA 2O0KA 1OA0A 5KJEA 2WJHA 1KQ3A 1TM7E 5I9MA 2BM1A 3ZVNA 1EZ4A 5DTMA 3GEDA 3OECA 5JBNA 1LI4A 1ZUNB 4KLCA 4M22A 5TF0A 2QV7A 2XDAA 2IHNA 2A35A 2MSDB 3OCUA 3L1UA 4I1IA 1Q74A 1ULAA 3WDLA 4X1IA 1B2LA 1LY1A 3HU5A 4CF5A 4K6HA 2BTEA 1YB4A 4B6QA 4Z1OA 1CIVA 1LC0A 5A6SB 4EELA 4IFEA 2WWFA 3FNRA 4DWWA 4RTMA 2I62A 4UAJA 1M75A 4ZAYA 5BT8A 3B5EA 1Q2XA 2B94A 4WXRA 3EVAA 3IVCA 5BSWA 5JIBA 1N3IA 1JWAB 1X14A 3VNVA 2I6TA 5E6RB 3KC2A 4I50A 1ZMBA 3N8GA 3ESYA 1QH8A 2A2ZA 2C96A 2IEGA 4L95C 4TMTA 5TGDA 1X1TA 5K3OA 2KHZA 3WS7A 4H3VA 2X9NA 4J0JA 3SJCA 1KI8A 4RA6A 5CLIA 3LE8A 1PNRA 1IM8A 2GCPA 1DNPA 4MUHA 3N28A 5T67A 3IELA 2FP4A 2C57A 1PK9A 5HUJA 5K6TA 5SYMA 4IDEA 2EJCA 5HHTA 1SC6A 3DZFA 5LQRA 4U6NA 1LSUA 2PA3A 1IATA 1DXHA 2PBZA 1GJRA 3WQRA 3B9BA 1YR7A 3PBKA 4UHJA 4XGQA 4N3NA 3WAGA 4YRCA 1NAIA 3SLGA 4O1IA 3PC3A 4DRXA 1NVVQ 3B13B 2AJDA 2N47A 2NU7B 1GAJA 3OE5A 3PPIA 2DHRA 4QT0A 1FS4A 4TTTS 3U48A 1CRPA 2H0QA 1WDMA 4D6PA 3ASUA 3BD8A 2OV8A 4JLKA 5A3QA 3AK4A 4OQZA 4NU8X 2VP9A 4ZOLB 5CW1A 3R4VA 5D3QA 1CU1A 5ITWA 1GZ6A 2BEVA 3I92A 5GJBA 4LCBA 4RF4A 1Y6ZA 2NTNA 1NMZA 5B58T 1QHYA 1RDFA 4J0GA 2ADFA 3GZNA 4ENSA 5HKBA 3F4KA 1GVHA 2O2DA 2Q3DA 1M7GA 4X92A 3U7FB 1YFZA 2I76A 4I2VA 3R9WA 3D54D 4HFMA 3HNOA 1X80A 1E1RD 2WHPB 2JIQA 4QREA 3MVEA 4WZAB 2H4XA 1N2CA 4A10A 1QRTA 4C2TA 3ONNA 4WZZA 3TE7A 2PKCA 2VSXA 1Y8RA 3NTUA 4CM7A 4L76A 4YCLA 1XEAA 3ORSA 4ZQCB 3NIGB 4BWYA 2UXBB 4GOMD 5JRZA 1GG2A 3O26A 3K4QA 2NO9A 1J5XA 3LBYA 3BCHA 1RPNA 2Q5JA 1WNFA 3RVLA 2JCGA 3UB2A 2C78A 3RYHA 4ETMA 1NVXQ 4BYMA 1JFFB 2ONJA 1QBKC 4QOHA 3E22A 3BWEA 1ILEA 4IIUA 1CS4C 3OFNA 5FUVA 1UZUA 3LCMA 1WY5A 1UAYA 2AUNA 3FHJA 4KJZA 5KHAA 5CDUA 1D0SA 4HQLA 2FI1A 2XNHA 3VC3A 3G2KA 4PGMA 5JDCA 3HKBB 2NXEA 4Y2SA 3KWFA 4MNTA 3D4IA 1QGDA 5K0CA 3M9LA 2BBWA 5DU2A 3IJEB 1AMOA 3AEYA 3L1VA 1M72A 3SQXA 4URHA 1NUHA 1R50A 3IHTA 1IU9A 4OKIA 1K89A 2R96A 3KAJA 4DA4A 3QFHA 3ZI4A 2FSHA 1J7JA 2VJPA 4YPFA 1M74A 3Q88A 4KOEC 1XTVA 3IPYA 4QDTA 4US0R 4O29A 5CVJA 4AN0A 3RVDA 3OZCA 3CX8A 5JRDS 5IVDA 3DTVB 2QGFA 4LHVA 3OPYB 3UJDA 1VE9A 3C7CB 1PEKE 3AJAA 4FLFA 4LJ6A 1WUJS 3H3XA 2A9OA 2ECKA 4RK7A 5DM4A 4L5AA 1FDVA 2J48A 1O3YA 3FI0A 3X1KA 5COQA 4DY6A 4F45A 2JIZD 2VSOA 3ZLUA 3PPYA 1N0WA 2HXYA 3I3OA 5FWXA 2QI9C 3WYGA 1D4ZA 1O5IA 5IXJA 3Q5GA 3LHSA 4V0NA 3KNZA 2B8JA 4TN5A 2VYFA 1T4BA 2DBZA 2WSYB 4Y2VA 3UJBA 4LHSA 1ZHFA 5IAAA 2OL4A 2ZM5A 3FBWA 3LM8A 2R4TA 3K1JA 3STWA 4YAGA 3UGKA 2FR0A 5KC9A 4OHMA 1MT0A 3VKHA 3IQIX 4UUPA 4ZDJA 1AJEA 4PYJA 4U2KA 1TJYA 2XA1A 1Z3IX 3ILXA 4U6QA 5BSKA 2D7JA 4FKMA 1ZESA 1SXJD 4DIDA 2F64A 3U7RA 2K87A 3EW9A 2VWQA 4V2IA 4CV1A 2JGNA 3QX8A 4TUYF 1OI4A 4TVBA 3TKYA 4F71A 3CZMA 1GXSB 1M8KA 2D74A 3Q1KA 4RSGA 4DRZA 4Q3DA 4Q4HA 3TW4A 3IAHA 2WF8A 4TROA 5EJ5A 5EWJB 5LJLA 2CV1A 1CNFA 3A9TA 3EVBA 1UEXC 4GBGA 4MIEA 1I3LA 3GPCA 4FR0A 1JTFA 3ZIUA 3D6FA 1XRMA 3GARA 1GQYA 4L4YA 1EUCA 2ZYSA 2PL9A 3IDSA 3KYBA 4G67A 3ADCA 1ZI8A 3GUYA 4CQMB 4DV5B 5MGBA 4C7MA 2R8EA 3OF3A 2CLLB 4BWVA 2VJMB 3LVBA 4YMIA 3TCXB 1B0PA 2R8RA 4HUQB 5K3FB 1FJXA 3OWOA 3U3JA 3GVXA 1JIUA 3QXHA 1T2EA 3SZOA 1GTMA 1KZ9A 4Q9KA 5KOYA 2I4MA 3I9V6 5EI5A 1MZPA 2DKFA 1XC7A 3KJNA 4ZEXA 1YS4A 1S2DA 1TRKA 5BSTA 4LHZA 4I8DA 1CUXA 5IJZA 2OBXA 2P3LA 2OWDA 2X1MA 1SVUA 1XNGA 3NR2A 1LLQA 3TW8B 3ZEIA 2GBCA 3VOAA 4GLJA 2ROQA 4RADA 2IPNA 1TTQB 1C9JA 3TTWA 1GUBA 2JGAA 2X8JA 2IGBA 2JFVA 2AOUB 2QR2A 3DV0B 4YJ2A 2V7PA 3TDKA 2H31A 5KYUB 1CY8A 1KA9H 1RE1A 1F1JA 1KDYA 3AINA 5DGIA 3RPEA 4XWTA 4C30A 4BQFA 3DB2A 5KTMA 2WWYA 1AK2A 5A0TA 1B14A 4B4OA 2FUG1 4ZAXA 1V26A 3LT1A 2BFBA 2JGDB 4CCWA 2PSHA 3MQ2A 4Y3UA 3TG2A 4G3XA 5I45A 5JT1A 1W93A 1Z5PA 2IBSA 5CLLA 3W05A 2HO5A 4KE7A 3L4JA 5F78A 2GAIA 2O4CA 2NUTB 3ISJA 3TAHA 3K1YA 2DLDA 1PUIA 2J45A 2GM9A 3LT0A 3OT4A 1X74A 2BP7A 2NSDA 4BV8A 4X7RA 3JWHA 2DJ5A 1A3CA 4XIIA 4DXDA 1T36B 1ADYA 4CM9D 1BXZA 4Z4QA 5HPYB 1JXQA 4LW8A 4JT4A 2IIVA 4KFRA 4B09A 4YALA 1M2FA 2VH5R 1NXQA 2Y4NA 3TLMA 3M1YA 5BP7A 5ILOA 5ELMA 2HSJA 1IEQA 3K9NA 5IZCA 1DXYA 3F2IA 2C20A 3GLUA 4KIGA 4WL0A 5B37A 3R7BA 5JAUA 2ISQA 4Z5XA 1CR0A 1TM5E 1R0CA 4RIGA 2HRZA 4RK0A 4RF2A 1BE0A 1YZGA 2A5FA 3MOIA 2IYTA 4XSHA 3FZNA 1YWGO 5AJWA 3ASZA 3V1TC 1O4VA 1Y1SA 2OORC 1QKJA 1SU6A 3QX7A 1QORA 1J20A 2QYHA 2UVQA 4A2QA 4NBSA 2PUDA 1VE5A 3SNHA 4O33A 2QNBA 3B6MA 2R9VA 1F17A 1GQRA 3C3BA 3HR8A 3PWKA 4OATA 1LU9A 1AQIA 4YJ3A 3W9SA 5CXQA 2IXAA 1GT91 1T6NA 1JEDA 1JHUA 3LFTA 3VAYA 4CLRB 4MI9A 1DJQA 2BFFB 2W6OA 3U4GA 3UZUA 1SQ5A 5C5EA 4L57A 2BEWA 1QUFA 2WE8A 2O8FB 4N41A 1UC9A 3K16A 3MCWA 1CR2A 4ZD6A 2C5AA 1ETHA 4YR9A 3A04A 3ISTA 4YRDA 3JAWA 1U0GA 1QYDA 4F9EA 3X1WA 3WKCA 4HB0A 4TQAA 3AFNA 3DF9A 1HO3A 3QLTA 5C5DA 4CNBA 4HOYA 1XJ5A 1N3BA 4EUHA 3IURA 5FOSA 4IDBA 4G1UC 2HA2A 3OZUA 3NVDA 3RFCA 3TZKA 3WZLA 3G2NA 3PE6A 3OJOA 2C5GA 1LPBB 4EGFA 8ABPA 5TPWA 5FTMA 3MAAC 2HA4A 3RYCA 4JLAA 4TWAA 1A4XA 2ANBA 4E3WA 3EC7A 3FB4A 5E8JA 4XA8A 1YQEA 3DT6A 1PKEA 4W82A 1BCSB 2D1QA 3RYIA 1ISIA 1OILA 2NYAA 1SC1A 4AJJA 1R0RE 4D02A 2CUTA 1P0QA 3EOZA 2ENWA 4Y6QA 5BPHA 1W9HA 2XJ9A 1W2GA 2G63A 3HHPA 2Y0BA 5SY9A 4C01A 3ZXXA 5HP4A 1BW9B 3SHQA 1VXRA 1FTNA 2CN1A 2V59A 4QXAA 1NM5A 3Q7IA 5AJZA 4MW6A 3QEMB 1RXCA 4BTLA 1RKVA 3DDOA 2GEDA 2CF6A 2PUHA 5B12A 4PPQA 4YRPA 5FLYA 2G9ZA 1QHSA 1P2SA 3FPSA 4BOYA 3T34A 1ODLA 4G2NA 5BY2A 2YVLA 3KPWA 1OA1A 3AVVA 1HORA 4PAWA 1T5TA 2OP1A 5EIXA 3IUNA 4M55A 3KG2A 2C2WA 4ND5A 5F9HA 4JH0A 3NONA 1ZL0A 4UPDA 2DY1A 2DBQA 4K1XA 3VZCA 3WSVA 2P68A 2BRUC 1JPVA 4RIIA 4YCSA 1XL0A 2ZANA 1JFTA 3COJA 1GDTA 4CEHA 1C9DB 1JIVA 1E0AA 1X77A 4XM2A 1YZQA 1E1MA 5HNKA 1OFVA 4LMRA 4GNKA 4D3FA 4KYIB 3EXHA 2C42A 3UPDA 4X66B 4HYQA 5EQDA 1O6BA 4RTQA 3AKCA 3C45A 5EHQA 3WKBA 1L5FA 1TCBA 4RZQA 4AURA 5AVTA 2R2GA 5JNTA 3M3DA 3CVYA 3G8CA 5BOSA 4EFLA 1GRVA 3HP1A 3NUGA 3DZDA 2GZSA 2VDKB 2BGTA 2CW5A 2PR2A 2R86A 2BKLA 3JCZA 4B1FA 2ZB4A 9ATCA 5DYYA 5C51B 3CSSA 1D4OA 1MOQA 1YI0A 4NI5A 4MWEA 1QYWA 2HBQA 1MTOA 4CKWB 3AR5A 4O2AA 3TW6A 5B2ZA 3ZK7A 1U3CA 1Y34E 2EXXA 3FUWA 5CT9A 3TXYA 3USES 1YZ3A 3DYIA 5EHZA 1NF8A 2Y1FA 4QBGB 1L5RA 1UBUS 2YN2A 4NAHA 1FVFA 3H1TA 4J8PA 2O9JA 3PFKA 2EEZA 4ZU3A 1HNNA 1RD4A 3GIDA 4HDRB 2ZYWX 1U3DA 4RF5A 1NOJA 1WXWA 4JB2A 4Q05A 2AJTA 4EP1A 5LKRA 4I5IA 3IEPA 3EBOA 1GUDA 1S5PA 2PY6A 2CL5A 2AYXA 2FF7A 3RSHA 2C4UA 2HK7A 4FHZA 3A1CA 4PLHA 3P0IA 3PGJA 2HCJB 1QGOA 2P2SA 3LUFA 3JYLA 3R24A 3R5TA 1TM3E 5KREA 4KW7A 3LZCA 1R6XA 3RHTA 3IDZA 3B1KA 1PR9A 2LDXA 3U7QA 1ZR4A 4F60A 5G4LA 5HBGA 2HLDA 3FB1A 3DUFA 5CT8A 1XTIA 4F2WA 1YT5A 1K6IA 4U2FA 4P9NA 1TMGE 4I5DA 1ZVJA 4IQ0A 5KX5F 3C3KA 3I2JA 4IFTA 3RE1A 5I5EA 1ATIA 2Z09A 2EGHA 3HR7A 4RTOA 2ASEA 3RT7A 1HZZA 1AM4D 3QF7A 3O3NB 4BNUA 1DAIA 3FGNA 2CHFA 4JWTA 4TSKA 2EFHB 4LXQA 4N8SA 5DI3B 2ZW9A 5I8WA 1QYRA 1PG5A 521PA 1OPXA 5IBCA 2CVFA 3GRYA 4GO1A 1C41A 3A4MA 1C1XB 2YW2A 3H75A 4H35A 5FPQA 3WHIA 3EG9B 1XLTA 4PGHA 3R6TA 1KI7A 4HXGA 5D3MB 5DNCA 4NBUA 1AV6A 3ZDDA 1Y8CA 2B7LA 1F2UB 4NRDA 4G2TA 3G02A 4FJ2A 2C3UA 4QPNA 2WD7B 1UEJA 3LY8A 2NZVG 1Q3HA 3MW8A 3W1WA 4UNQA 1P4SA 5ALUA 3R5KA 3SQNA 3AKZA 1BDJA 3LUKA 1R8JA 3ZZ0A 3EAGA 2DHDA 3HADA 1MR3F 2GKGA 3NATA 4RJLA 3U1TA 4EI9A 4FQ5A 1M10A 3K72B 3GBVA 3LC2O 4OHKA 2Q5CA 3MIIA 4QM7A 2AEFA 4EVSA 3TW0A 1QHNA 2WKWA 4WKGA 3NH6A 4Z1MA 2XVXA 3TOXA 1QDEA 1M2GA 1PK8A 2ZWAA 3G17A 5GJVC 2AEMA 1T1IA 2IF2A 3KR2A 4J1TC 3TDNA 1FZTA 3KR0A 2Q3MA 1C14A 4KO3S 4XEHA 3PC4A 2D4HA 2ZWPA 4K9QA 4JXKA 3DM5A 2ZZKA 2QTAA 4MQUA 4QVGA 1KEEB 2DQZA 1ZCFA 2V3CC 1RYHA 4ZYYA 1WXEA 1ZW6A 4BN5A 3H6KA 5FA8A 2WG2A 3Q87B 5FRDA 1JA1A 2HMAA 4F4CA 4P7KA 3KYDA 4BB0A 1ZN7A 1UODA 2VF7A 3P27A 1HX7A 3RKRA 3VJRA 5FBZA 2IK8A 2EZTA 2VUIB 5EZQA 4J16A 5I4KA 3E5MA 2K6GA 1NBWB 1CUYA 2GM3A 2DPYA 3D3WB 4LBZA 4NYJQ 5AKJA 1RI5A 3KEQA 1KI1A 3EW7A 2I2WA 3TVTA 4M9QA 3FCOA 2WIJA 4TWRA 4ZALA 2XAUA 3EZ9A 3HUFA 3C16C 3CF0A 1SUSA 2O0MA 4QG7A 1S01A 5FLKA 1T1SA 4PRLA 5GGYA 4PLCA 2F90A 4GSKA 2FOIA 4KXLA 5G0VA 1BXRB 4ZO6A 3SJ7A 5J4HA 4MGIR 5E4YA 4DT1B 1P77A 3RVQA 3NLLA 1J25A 1JDJA 2J4DA 3AJEA 3DVLA 1JDSA 2Z8YA 4LRSB 2F1JA 3A9RA 1M5RA 1OI3A 2GXQA 4YYEA 3FYUC 4I3GA 3QQ5A 1JF8A 1IXZA 2GCGA 4CMIB 4JXZA 3P4YA 2YXDA 3OX3A 3ACCA 2YOFA 1A5SB 4AG6A 4MO9A 1QRSA 1U7DA 2QQGA 1DBPA 3RABA 1V11B 1PI3A 5AUPB 4N3GA 3U26A 5LNK6 3R41A 2B1IA 2FG5A 2MYUA 1PZXA 2OQRA 1IY9A 1W2WB 4AYXA 1E4EB 3LUAA 4IQFA 5JFTA 3L6OO 5AQEA 1CQXA 1XT6A 2QRGA 1UBSB 2X86A 4U2EA 5AVVA 4JLVA 1YK0A 3HGMA 4N5IX 5IM4F 4TV8A 4NS1A 4XR9A 4IUCS 4HP8A 3MXTA 5IW8A 2BFMA 1PS0A 2VO1A 2EX4A 1EDOA 1Z7GA 5DWVA 3F7OA 1OC2A 4G0VA 4DLSA 1A9OA 2I6FA 4QGAA 1QCYA 3JQ6A 1MC1A 2HHHB 4YLEA 1U3FA 4ESVA 3GOHA 4ICIA 4O4LB 1AXGA 4ZU6X 4OL0A 3TRHA 3ILYA 3CB4A 3N39C 5BQOA 4ETNA 1JEJA 5C37A 5LYJA 3BIOA 3BL5A 2DCMA 5AHOA 3CLVA 1I51A 3CPEA 4TVOA 4BKMA 1FU4A 4CKYA 3M6VA 3PA8A 5AIAA 3VSBA 2YY6A 3ESDA 1P18A 4GBED 4IXMA 4M4SA 5IH7A 1VMAA 5IUJC 2GK6A 4HDOB 4Z0PA 1Z5NA 1XMPA 2XB8A 4UTOA 4WBSA 3DP9A 1QP8A 1S3SA 2B25A 3C3PA 4FQ8A 1WSDA 1KETA 3R3VA 1HRKA 3BJMA 1E58A 2XEDA 3CJQA 2K7FA 5CVDA 3SBEA 1WF6A 2R1UA 3DEAA 4NVRA 2CNWD 3ZUPA 3OX4A 4DWJA 5F77A 3E7DA 6ADHA 3DFUA 3M9WA 2FG7C 3F0TA 4C5CA 4X1OA 1XVAA 1YZUA 5T6MA 2O7RA 5K0NA 1JR3D 5IBQA 3HVHA 3G2PA 2WU3A 2AT1A 4DKJA 3L7BA 2XQFA 1AKTA 1XZFA 3V9PA 1N9ZA 4Q00A 1W36D 2WMYA 3HDTA 3RJMA 3NIFB 1SXQA 3KETA 3IQFA 4HDMA 4YONB 2O8VA 3U9LA 2X23A 4UNSA 2GN1A 1EP1B 2IUSA 1I7SB 4KBYA 1IOLA 5DN9A 3PQCA 3EZ7A 3T5AA 3IOBA 1G3QA 1XP5A 3W1VA 4CM4B 2I1WA 4NMHA 1A1VA 3Q6NA 3O73A 4R2IA 1BRTA 3IBYA 4FE4A 2VDJA 3I2KA 4G5SA 4KO1S 3F1KA 5FTNA 3RAGA 2PTGA 3LX4A 3HRKA 4KXWA 5JEEA 2PDAA 4DNOA 1DBSA 3TLZA 5HKKD 2B7BA 2H16A 3L3BA 1U3UA 2WFZA 5C9ZA 2PUGA 1JZSA 3LXMA 2CLIB 2G71A 1FFXB 2HRRA 5AKIA 3WWDA 3WYFA 2I3GA 2WWIA 3R9IA 3UPTA 1D6SA 2R8XA 4XJVA 2RGGA 4TYPA 2ODAA 5H9VA 5KQRA 3MBIA 4EI2A 3B1FA 1G1AA 2VJBA 1BKYA 1SXJE 1TA4A 1V1RA 1M0WA 3I1JA 3QKSB 1JDZA 5C3UA 3HLTA 3I9MA 2YHBA 1KFKB 4TWJA 1XAHA 1YIDA 4I50F 1E6EA 4AMVA 1XDZA 3KWMA 1GL7A 4ZEMA 5J4LA 2ISCA 3ON5A 2HWKA 2LP4Y 4I66A 4UDOA 4YAEA 4MS1B 4RA9B 1U8CB 1GPMA 3DO5A 1TB4A 4XGRA 1PJLA 3O9MA 4A0QA 3AZQA 3D3EA 4RH0A 1UUFA 3P2YA 3T9BA 2D1TA 2G36A 4KVAA 2EWVA 4ZOCA 5HF9A 2JGKA 4H9GA 2DRIA 4DYDA 1QQTA 1MDBA 2QX9A 2WIAA 1ISMA 2BCJQ 2ERYA 4WCVA 3V7UA 5GINE 2BM9A 5HZGA 4HS4A 1X8JA 4NU6A 1JL3A 1LLCA 2WTAA 2A5DA 4RHYA 3PYXA 4CBVA 1JMKC 2A9FA 3LCVB 1K0FA 2N46A 4PS0A 5CMLA 1RLMA 2Q0XA 2I3ZA 3O83A 3U62A 4BIMA 3IR5A 4D6YA 4ZIRA 2C29D 3MJTA 1Y9EA 1PZEA 5EMKA 5ARDA 3GGJA 5G02A 2Y0DA 1X0VA 3IXQA 3P5SA 2ZRLA 3DAHA 3PHHA 4AQDA 1C8KA 1ZJWA 2BY4A 1DBRA 1T4CA 3OA0A 4GI2A 1MB4A 2XRFA 4MWCA 4NE7A 4Q5IA 3U49A 2XYRA 5DM70 2QHXA 2BSXA 1ZOOA 3VPHA 4BQIA 2AKYA 4DMLA 2PZEA 2QW0X 4TPKA 4XZ3A 1XZEA 2AF3C 3ROMA 4Q4AA 1JDBB 4FU0A 1ISRA 4F7WA 2IITA 1GO2A 1TI7A 1OR8A 3K2IA 3AFOA 1WMSA 1U2DC 1ZFNA 4LWPA 4NABA 1P1KA 2BHSA 3FVTA 3H5AA 3ZGXA 4O4HF 1R88A 2HHCA 2GHIA 2XB9A 3A36A 3F5QA 3T7DA 3TQRA 1H4TA 2O05A 4ZDKA 3L7AA 1W52X 3QELA 5KKNB 3FOCA 3COPA 3L06A 5A5FA 4DUYB 1UWKA 3I2HA 4OHWA 2SKCA 5GQSA 1PJQA 3IMGA 5B6IA 2Q5HA 2ZYRA 3CW2A 1DCMA 5AW2A 1TYCA 3RRXA 5JAMA 1UZLA 5AUOB 1QH0A 1V4VA 1JI3A 3D3JA 1U02A 3SVLA 1S89A 3MS7A 2P6UA 1VG9B 4MAMA 2WF6A 3NNDA 4RGQA 1ZQ9A 1NP7A 5CDFA 1V41E 3DR3A 4GSYA 3ZE0B 4GUDA 3FMIA 3PKJA 3QI7A 4M99A 3QE9Y 3ND8A 1KMHA 1ORRA 3WB9A 1H22A 1ODTC 5IUKC 3I9NA 3WNCA 3KWLA 4CG1A 1ZSNA 4RLHA 4L7QA 4XW2A 5IJXA 2LCIA 2FN8A 4EQ6A 4YV1A 1Q7EA 3G9UA 4FDAA 4JLNA 4DUZB 1SXPA 1IUNA 3MN1A 2CCKA 4BPBA 5TF4A 3VO1A 1QFYA 2HADA 4XB1A 4GAEA 4XQGA 1GKYA 3GDWA 5DGXA 3N6VA 5LIPA 4DYVA 1KYTA 3PUJA 2NTEA 3CE6A 1LZKA 3GFVA 3QUSA 4XSVA 5TPZA 1P81A 2Q7DA 5IKXA 1I3KA 4RK5A 4OBEA 3ZIDA 1JJFA 4IHJA 4QUEA 2ATIA 1G8FA 2ZAIA 4UUNA 1IULA 2E4ZA 1EJ0A 4HAUA 4BLPA 1TTPB 5GADl 4J4BA 1ZHOA 3RSCA 1E2NA 2BLNA 3MIZA 1ZH0A 3TK1A 4C7JA 1EK2A 3BEOA 2FPGA 4JI7B 2Y68A 1W0CA 3A2NA 2JL1A 4MCHA 5JMPA 3VKVA 2HD4A 3VR5D 1ADBA 1Q0SA 2J9XB 3K0HA 4V1CI 2Z3WA 5IDYA 4WBNB 3LBNA 3SX4A 4B44A 3VV3A 4OUDA 4YWJA 2AIRA 2ZQYA 1DIHA 4QQKA 2B8EA 1N5IA 2W6QA 2WB2A 1NTOA 3HVUA 4DSZA 1KNQA 1XI2A 2FSUA 2IE8A 2A1IA 3G23A 1RM5A 1N0UA 5H3CA 2OO7A 2ZSFA 5FORA 3IE1A 5KVCA 1E59A 1W48A 2DMRA 1GTG1 2G0NA 4A16A 2XLCA 2HJVA 1VB3A 1UWLA 4YRNA 2Y76A 3LKDA 5EKDA 5SYAA 1XVLA 5YASA 4CWAA 2QAIA 3UGJA 4RJ2A 1NN3A 3X1ZA 1Z38A 3K9QO 4HWSA 2AFIE 2HRQA 3ZGNA 2RB5A 4JL8A 3NPAA 2AEEA 4YRFA 2NP6A 2C61A 2IPLA 3OVMA 4LF8B 2YHUA 5ICSA 1SUWA 1ODCA 1VIAA 1R0XA 1BDHA 2WOOA 5CM2Z 2OUIA 2RGNA 2XUKA 4XVUA 1IRXA 2YKGA 4ITUA 4CPDA 5JS2A 4GP7A 4IYRA 1UZNA 1GZDA 3AERA 1F4PA 1RFLA 2D1FA 1H2EA 4KWIA 4JBWA 1T13A 3U61B 2PEYA 1E6MA 4F9TA 2ECOA 1O2DA 3AHCA 3GEEA 3ORRA 1RJGA 1Q11A 1A9TA 1FFWA 2WK1A 2XVAA 3Q0IA 2E0IA 2CFOA 1ZUD1 2DE0X 1PYDA 5AH0A 2P30A 3UQYS 5BN3A 2AS0A 3M3HA 2YJTD 1II8B 1MT3A 4CU2A 5CU7A 5A7GA 3WADA 1V16B 1GZ3A 1SBQA 1DQPA 1HH4A 3OC6A 3R7SA 2PX8A 3AUFA 3RSLA 1ONBA 1YH3A 1SR8A 2R1VB 3QOWA 2DFPA 3EASA 4HDSA 2BR3A 4R9VA 1G291 4F46A 4KVZA 3W5AA 2W0SA 2X8BA 4EHHA 3WBFA 4FYHA 4HH4A 2Y1EA 5JJ5A 1NI4A 3VQTA 1GGKA 2CHEA 3QMMA 5BSGA 2BGIA 3HFRA 1O7JA 5DHUA 3AFIA 3AHIA 4EW1A 3MJEA 1OVGA 1VHTA 1YB2A 2EIHA 3GWGA 3O8OB 4RY8A 4AW9A 4W9MC 4ZYUA 2MIIA 3PJFA 4Z4FA 1OIVA 2O3SA 2CNDA 3SFTA 4JEIA 4E2YA 4G4GA 1NRJB 2A0FA 3VPFA 3QMVA 4EKEA 4QNMA 4JI3B 4E03A 4KZPA 3TNYA 2Y6UA 3QH4A 3A11A 4X95A 1ODSA 3V4PB 1L8OA 1UMCB 4CMKA 1C30A 1N5JA 4JUCA 2QF7A 4KDCA 4GMFA 4YJFB 2HH9A 3W3AD 1JJ7A 3EF1A 2WUDA 4JLDA 3SF0A 1KK3A 3JAKB 4TKVB 2XWSA 3E9RA 3W8DA 3KJZA 1PJ4A 4X44A 3UJ9A 3G5UA 2XA9A 3O03A 3BUSA 5HWSA 1Z6YA 1Q19A 3OZTA 4HVAA 3PEUA 3H1AA 3IP9A 3V00A 1M1YB 3NYWA 4BBJA 4D9BA 5KYXA 5CVUA 1KJNA 3I61A 3LKVA 4M38A 3AI1A 4XIJA 4QVKA 5A1JA 3HU1A 1V37A 3GLHB 2QRPA 5ILQA 2R6ZA 4RZSA 1FFEA 4KJXA 5HIIA 5AW7A 2FQ1A 2FEMA 1M66A 1ML3A 3SKXA 3T3PB 3M4NA 5KZMB 3NHJA 2GN4A 4DJFC 3W06A 3GEBA 3WGIA 4KE9A 2Q0QA 1VKHA 4W5RA 4GYKA 4RW0A 3WNQA 3AVUA 4Z7QB 1Y33E 2ZYIA 3P26A 4FCWA 3UAZA 2UUBB 1Z06A 3VOSA 4AS2A 1L7EA 2R8PA 5DM1A 3VNUA 4LNHA 2VDVE 3GIWA 2NWQA 4BDSA 1TQDA 3P9KA 1XZBA 4JUAA 5TVGA 5T57A 3JALA 1SU4A 4FFVA 3RRJA 1KVUA 3ELUA 1Z0KA 3ICOA 1PP4A 2B1GA 2QMYA 3PEEA 4LG1A 1MG0A 4UEOA 2NO1A 5FO0A 5H16A 5TLSA 4M98A 3SMQA 1P60A 4X6YA 1GNSA 1Z0IA 3R3XA 2PK3A 3ZWWA 3I6YA 4ZYWA 3MOGA 3EGEA 2Q8PA 3MAGA 1WABA 2YC2C 4CRWB 3IJ5A 3LW8A 3ICVA 4O4JB 2DOKA 3FPAA 3ZDEA 2QMZA 3ICQB 4ZYZA 1Z0FA 2M2IA 1SUBA 3QU9A 4PLGA 5DYIA 5HEKA 3RUDA 3LUPA 4C89A 3CN7A 3H86A 4R1SA 4H6PA 2D06A 1NVFA 1SOWA 3LPDA 4NZNA 5C5CA 3HS3A 1G6OA 3A1UA 1U7TA 1C7IA 4J1NA 2I0FA 3LQRA 1AUPA 3OZSA 4O4IF 3UAWA 5BNTA 1UJ2A 2IFTA 4GZ6A 1UPXA 3IQZA 4HKTA 2H1VA 2V03A 4LJ7A 3VR4H 3ZCUA 4OHYA 2AXPA 1G3RA 2WD8A 3UWSA 2CZGA 3D0KA 1NTRA 4IIDA 2ON6A 2H52A 4G0YA 4L9SA 4M8KA 3WB0A 4HFJA 3WLFA 4BYGA 1CB7A 2DFTA 3LVRE 3O8NA 4QTZA 2VHYA 4HJRA 4II7A 4RGYA 5IT5A 1AUOA 5CCXA 5PNTA 4CMHA 3WJ2A 5JNRA 4G9GA 4DR5B 1NRXA 4RD2A 4B3DA 1UBKS 1RRCA 1DQZA 5K45A 3CXUA 3DXZA 1PE0A 2R00A 3AW8A 1MRZA 1BHO1 3E3LA 2D6FA 1BQ3A 2O1EA 4Q9AA 5CDTA 2TMKA 1JEAA 1XMXA 3EZ6A 2PQMA 2AJCA 5DLEA 2GUWA 5EIAA 3OZWA 4EG0A 2P9GA 5J2TF 3TUJC 4EA7A 4XCQA 1EGMB 1UJMA 2QZPA 2V58A 3NALA 2EWMA 2PSFA 1N8NA 3COSA 3OSZA 5KAPA 2XT6A 4NFLA 3GMSA 2O8DB 4Q47A 3KKNA 4RJIA 1ZK1A 1AV7A 3CNOA 4R1OA 1MVOA 2ZIEA 3I0ZA 2RAVA 1FLNA 3DR5A 5CRIA 1IRIA 3C6BA 2Z57A 1ZL2A 3E3OA 2J0UB 3AJRA 4XX0B 1V8ZA 3IODA 2Q3LA 4DLKA 5IF9A 4HGZA 1JA9A 2XUPA 4R1QA 3LL7A 4NEQA 1JG1A 4M1KA 3I04M 5EQFA 5IM5A 5B2EA 4LWQA 5HJ2A 5JE8A 2NUAB 4K9DA 2PUVA 4MPDA 4C4SA 5KU1A 5BSEA 5CFMA 4IOMA 1EFVB 1WKCA 3DAFA 5DWDA 1BZYA 2YIVX 3I5MA 2ZVDA 4BX9A 4E5NA 3PC7A 3WK8A 1X42A 1USKA 2QR3A 3JYHA 1SIWA 3PLNA 2Y0EA 3BEDA 1YBMA 1O95D 3DEHA 3H5NA 3LLCA 5FFNA 4R68A 2AZMA 5KYGA 3B3QA 2NU9B 3PQ8A 2GTIA 1C9KA 3BREA 4CVNA 1A97A 3FA2A 5CFOA 1W73A 3OQIB 4A23A 1NC1A 3LGAA 3T5GA 1U1GA 4IHKA 2VHXA 2REBA 3T3MB 3TRKA 2VAWA 1SXJC 4CQLA 1H9AA 5LQSA 1O96A 3I5AA 3PDHA 2MSCB 4DV2B 3VYRB 3E48A 4CETA 1C4XA 2CDAA 3Q6IA 1C5KA 4HQNA 3TSZA 2CMFA 2Q3JA 3PNKA 2VK4A 1Z56C 1G8GA 2EP7A 2PT7A 4JWKA 4S0XA 5AUQA 1M7BA 2LWIA 2LDBA 4PPGA 5DXFA 3VTAA 3GRAA 4PU0A 4DCSA 4BN0A 2X1HA 5C7YA 2KS6A 4P81A 3WGMA 4TMWA 2VJNA 5FH9A 3O4IA 4LSZA 4G41A 3FVVA 4TRRA 1Z35A 4CM5A 2EGUA 4AF8A 1M2OA 2QLNA 3BXFA 3CZAA 4D4JA 2FZEA 1A2OA 1TF5A 2CBGA 2FPWA 1C3XA 1RR6A 3FJ1A 1V45E 4FINA 4MVCA 1KDRA 2YFKA 4EA6A 1ZUHA 4I9FA 3YASA 4B4DA 2G4VA 1CZLA 4ESHA 3H2SA 1OV4A 3KALA 1C3OA 1Q20A 2GD1O 2Q9BA 3GK3A 1UPUA 3K9CA 3QLUA 4J7UA 4IIEA 4JL6A 1OYVA 5EN4A 4F9GA 4ZV4A 5AFSA 2XCQA 5LFAA 1OX6A 2WYHA 1JJVA 1JR3E 3IPAA 2OV2A 1VIMA 3H11A 3SXUA 4Z49A 3LGXA 4KPYA 3CLHA 5HX7A 1BA2A 3G0BA 1UDAA 3KQOA 4MQ4A 3BFKA 4L4RA 5CDGA 3DFFA 3BMCB 3A3KA 3AVQA 2OBNA 3TXAA 4XD7A 2GBLA 5AM5A 2C3OA 4ZHSA 4DAEA 2E1PA 2B9EA 5B4UA 4BVBA 1I10A 3UHJA 2W83A 1U8EA 2IYLD 3FG9A 3HXKA 1IFXA 4GX1A 3EXIB 2EP5A 2Y1CA 3HXOA 1PSWA 1ACLA 4QXPA 3TSYA 2QRLA 2B4AA 3IHKA 4I08A 4K28A 4MVJM 5COBA 2NADA 3VPAA 4B2YA 2RHTA 1E63A 4L5YA 3P97A 2P3OA 1OLUB 1ZW1A 1Q1GA 2XDWA 3R23A 4W99A 5IK2A 5K8IA 4MULA 4WNAB 1G8SA 3TTYA 1CJVC 1WSAA 5TQ0A 2PGNA 3CVJA 3RBVA 4OFZA 1SXIA 3DW1X 2YJZA 1K9SA 1PG2A 2FMIA 3UT6A 4XWOA 2BBTA 2WAOA 2X0KA 1TT5A 3BBLA 3EARA 4RFSB 1RHQA 4AZWA 2GVZC 1RRFA 4XGNA 5AM1A 3IRVA 3LIIA 4HWOA 1NVAA 4PZLA 5JSYA 4OMUA 3K9WA 1BWSA 4RQTA 5JZBA 3CO0S 3P52A 2VDQB 4BNJA 5LQMA 3TS1A 4TKZA 3O74A 4BJHB 2NQ2C 1ISHA 3KOWA 4J49A 5F4ZA 4UC0A 4OHCA 4CFYA 1ADGA 2WPDD 1FYFA 5FTLA 2QX6A 2AW3A 4LXGA 5AW6A 2QN9A 5DHFA 3ZVRA 4LTMA 1UDCA 1G8KA 2J5RA 2W2XA 2XA2A 3WGZA 1S2OA 3QVKA 3RLFA 1GCUA 3PXGA 3VI3B 3VYSB 2IH2A 3A9CA 1AS0A 4ZCQA 5KC8A 4RZ3A 4BZPA 1GG9A 4B3XA 3DBLA 2XMPA 1M3SA 4IDFA 1BCRB 3VMFA 4QNNA 2Q27A 4F7DA 3S0JA 5M29A 2W2KA 2W98A 5HF5A 1HG0A 4KQ1A 3WV4A 4CDNA 5CDHA 5IUNC 2V7GA 4MGHA 4WAUA 4RANA 4S1OA 3R5JA 3UMMA 5ALTA 3IQDB 1Q1NA 4RJKA 5LZ7A 1M2NA 2YJ5A 4DB2A 4Q4JB 3LQ1A 2PZMA 1NWHA 3WG9A 2FMTA 2A33A 1TO1E 3OQ6A 3V8EA 4HAWA 2UUPA 4P22A 4XDHA 4JLPA 3H4IA 5TS3A 2C0QA 1Z6TA 1T9ZA 1NF3A 4RY9A 4PG7A 1LKZA 2RHRA 2K5UA 4NIMA 2XQGA 5IMBA 3X3HA 2OB1A 4BNGA 2WABA 4KDFA 4JLMA 1OAKA 1JP7A 3IAM6 3QZUA 4V24A 3C41J 3L8MA 3I6QA 1RAIA 4TV8F 3I4FA 2JK1A 4B7ZA 2KM1A 3PNVA 1CE8A 4GYJA 2P1ZA 2G0AA 2WZQA 4Q4CA 1YONA 5K03A 1K5PA 3O92A 3VH4A 1Z15A 3GP3A 1CUGA 4EMTA 4A8JA 1K3UB 1SH7A 5FADA 3DHNA 4Z3DA 1ZVVA 1EB9A 1Q16A 4BEBA 2IYUA 4IY1A 5JY6A 1DC4A 3AUTA 5HIAA 1R0YA 1NASA 2CF5A 1KH2A 2AF4C 4H27A 3H5LA 3L4BA 4M0KA 4BTEA 2AD5A 3THYA 3ORHA 3NEYA 5L4LA 1ESZA 1WG8A 1E3SA 2VH1A 2H1SA 2P2NA 1S1MA 5GV7A 4D79A 4S1TA 5HCNA 4AUMA 1XLUA 2ICAA 4GLLA 3SAJA 4FYWA 4EYSA 2OSBA 4NDAA 4Q1CA 3BSFA 2CUNA 5C4GB 6NULA 4FWBA 3SEZA 2VSNA 3ZGOA 5ABPA 1XEXB 1U9IC 1L7AA 1ZH4A 2VSFA 3B5JA 1L8AA 4LVNA 4CKEA 4ER6A 3CJTA 3LLMA 5FI1B 1DAOA 2FFQA 4QASA 3A2LA 2HRDA 1U2PA 5LBIA 3SC3A 5JQWA 3JQPA 5E7QA 2ILTA 2AN3A 1OTYA 4GI1A 4HATA 4DREA 2R65A 3ENVA 1P2GA 3VGJA 1XELA 3N2EA 4CIYA 2QD5A 4DVJA 2WBLC 2NN3C 2PCLA 3DNFA 5DCWA 4WCFC 2X6QA 5DDIP 1L1FA 4X3PA 3T95A 1ES9A 3T5TA 2QXUA 5BNIA 5CITA 4KRXA 2IP2A 1UZMA 1BX1A 3K6SA 1CCWA 3VDQA 5JC1A 5DIFA 1UP4A 2GJ9A 4HAOA 4HWGA 3T1HB 4QOIA 5ICMA 3VVCA 4PICA 2PSEA 4DFDA 1XOIA 1SVNA 4OP3A 2SCUA 1Z13A 2VBGA 3KT8A 1XTJA 1H4VB 1NMSA 4A92A 1LX7A 3BKWA 4WUVA 3PX7A 3WNZA 4NZPA 4HZUB 4PG4A 5ALSA 2A78A 1QV9A 2L0XA 4TMYA 3WGGA 5LLSA 1RJFA 2OAP1 1BJRE 3JPWA 4KUHA 2BD0A 5EJIA 2DG2A 3E1SA 2AWOA 4FMDB 2HYDA 3MHPA 4XIGS 4BLWA 1O94D 1RQPA 3EGWA 1TW3A 3U17A 2EW8A 3S2GA 3H7AA 2J6IA 3BWCA 3IOCA 3KXDA 3RS8A 1PNOA 1Q0ZA 2OFPA 4GR9A 1YU6A 2O20A 4FQ7A 4CIWA 1QH8B 4GX5A 3R44A 3HXTA 4GZLA 3JATA 2GZ2A 2ISSD 3FUTA 3UICA 5IFLA 2BKUA 4RA6B 3P9PA 1KDVA 2C9MA 3LP5A 2JASA 5U4QA 4FSXA 4RVGA 4G0XA 4GOND 2AOXA 1J00A 1UR5A 2X19A 4UVEA 3LVFO 2HWXA 5INTA 2JI6A 4OGWA 1NXOA 4KPGA 4NNJA 2V0CA 3DAOA 4A5OA 3KWJA 3AP2A 3HUEA 1JLKA 3V4ZA 2Q46A 1XRSB 2QL7A 4Q18A 3RWBA 3SDBA 1G17A 4YP1A 3VR3A 4HNVA 3NG1A 1W76A 3BL8A 1Z2EA 4FNGA 3A6JA 4E0BA 1O89A 1P2BA 4CG3A 4DRXB 3DBIA 1CHNA 3RR2A 2PH1A 3EPLA 3V8RA 3MSXA 4HJXA 2PYDA 4QUJA 3ZE7A 4H59A 4FD3A 2FA9A 3WLNA 4CR6A 2X5KO 5K4AA 3T52A 1VGVA 2H7XA 1PS8A 5FYQA 1PTKA 3CRZA 4GP6A 2C94A 4GVPA 4WVLA 5JAIA 3EJ6A 5L4SA 3G0IA 1ZICA 1JKJA 1TEVA 2FZLA 2WHEA 4G0MA 4FDVA 4CMEC 3QBDA 5EWMB 1HK7A 4FOLA 2XEXA 2WIDA 5ES4B 16PKA 1KXJA 4PLPA 4DR3B 2BEVB 1PL7A 2VDMB 1EVKA 4M87A 2Q1UA 4YQEA 1UIRA 4QGSA 1XQ1A 3RK1A 1QFSA 4TZ6A 1THMA 1V43A 3GZNB 2JW5A 4EH1A 2CEAA 2RC6A 2HMVA 1G18A 1E6CA 1JS1X 3DZBA 1ZPDA 1X80B 2PFKA 1LLUA 3CPSA 3PTLA 4V0RA 3W78A 5H83A 1QDLB 1ZSYA 4AMZA 2YL2A 3BKXA 3B70A 2YXNA 4C0WA 3RJZA 4JN6B 1Z88A 3E8XA 5EE9A 2FPIB 3QYAA 2C5SA 4IIJF 4I55B 4MWOA 5LQNA 4F2PA 5D00A 2HK6A 5IKPA 3UWOA 5CHEA 1IN8A 1AH2A 3TZCA 4C78A 1Y5LA 4N4AA 3WGLA 4BO0A 4DQKA 4F2GA 3DZJA 2FZ4A 3DMNA 1ZK0A 3U0VA 1T6XA 3F49S 5F51A 3VDRA 4EEZA 4EECA 3E22B 2QQ0A 3SPXA 4OD0A 5LZ8A 1QGUA 3Q40A 4JX9A 1E3WB 3N70A 4TSFD 4UZFA 3H4TA 4G0PA 3CLRD 4BKRA 6PFKA 2PKYX 5I51A 4UD2A 2ADMA 1YACA 4WW0A 1KE2A 5LBTA 2P9BA 4MIYA 1DQYA 1HYEA 1WOMA 3AILA 2QU7A 3Q3GE 3C3MA 3RBAA 1WBDA 3OJFA 5IAJA 1N33B 3H2YA 4HQKA 4C6TA 3EOAI 3L93A 1MX3A 1RYDA 1KIFA 1TZMA 1R8YA 3LDFA 4FCVA 4WOBA 5H68A 4RHXA 3KEGA 4MGZR 3CXRA 3NOVA 2UYOA 1ZA1A 2OZPA 4GPTA 1ZC4A 4KLNA 4AJNA 5KYYA 2QVYX 4ZZ3A 1E99A 1F4LA 1W1UA 4FFLA 5EXTA 3W4IA 3FYCA 3PGMA 3C6ZA 3HDYA 5JMTA 3WL7A 4ND8A 5D3KA 1CY0A 1DKUA 4FSDA 1JSRA 2FRDA 2GLTA 1Q7GA 3N9IA 5KJ1A 3HEBA 2A9VA 5LXTA 4UATA 4KU4A 5JMWA 2IH5A 4BLOA 2G76A 4PBTA 2Q0HA 3WIOA 2WM3A 4JT8A 3WRYA 4D92A 5EJEA 1PHRA 3B53X 3H1PA 2N0SA 5KTRA 1NMYA 4TYQA 3S3TA 2WA2A 4AL4A 5ICFA 3ZY3A 5A9SA 4X7PA 3B9RA 1H2HA 2O23A 3WGKA 4E7PA 5I7UA 1NQUA 1SOVA 3NOQA 1FDOA 3I01A 4O25A 1FCJA 3VISA 3ZCXA 1L4KA 1AQYA 5AWFC 1C7ZA 1MA3A 2G82A 2WSSA 1Y4AE 4GLOA 1UBFA 3GF4A 2C97A 4FR5A 1ZQ1A 2JJYA 1U9YA 4RS4A 3AL0C 2QG4A 1J2YA 2INGX 2JJ1A 3ZNQA 4MGEA 1LH0A 3DHVA 3ZCTA 2FEKA 3U60B 1GQFA 5JAQA 4GWGA 3V7WA 1VMEA 5DGDA 2YV3A 1JIIA 4YUVA 1RS0A 3OTIA 2FOXA 2YV1A 1I8TA 5AVSA 2Q5EA 1F48A 3IP8A 5L53A 1W0KA 1RYBA 1PEDA 3E58A 1KXZA 2MHCA 1ZSVA 4GQBA 1JSCA 2GPNA 4UFOA 4QYWA 4PY2A 4TS3A 2P7HA 2GARA 4G1BA 2F9FA 1CQWA 2Z5VA 2ZTSA 2W6ID 2FPXA 1LSJA 3M81A 3C6QA 1M54A 2GJKA 5FV4A 5IZ4A 3OD1A 3ZV3A 1DBQA 3L0YA 2W6ZA 2ETVA 3U31A 2H11A 2OWEA 3NDRA 2X8JB 1UPTA 1DSSG 3EODA 4KMSA 4MINA 5KS2A 1N5OX 5AHRA 1MGOA 1R0WA 1ZDMA 4KQFA 1ZGZA 2XJ4A 4F8JA 2W6JD 4U2DA 4DGQA 1MABB 4WJLA 5LIRA 1IQPA 5E1DA 4DSTA 1PFVA 3C98A 1W36C 2VJYA 2OK7A 4CODB 1KO1A 2HOQA 1SQFA 4WA8A 5K4GA 1EHIA 2VIIA 5HW0A 4YX9A 1P7ZA 1G1MA 1ORDA 1NVDA 1O5TA 5AVQA 4X0EA 5G0UA 2K2QB 3LKZA 5D5HA 4N0DA 2H7VA 2ARKA 2ZVPX 1WD5A 2WTMA 1GL6A 4HEA6 4X3CA 5BN4A 2HNBA 4ZYLA 1F2TB 2BP7B 2Q2NA 4YEDA 4N03A 4AY4A 1QF9A 2YZKA 2CXNA 2VWPA 3F90A 3MUEA 3PUWA 2YW9A 4GYYA 1XL1A 4HNGA 4L0MA 4M9CA 4N76A 4MWGA 1SBYA 5A5EA 4YRMA 5FWAA 4N0EA 3CR7A 2XGOA 3EZNA 5H5JA 1C1DA 3BXPA 3KTFA 1NQAO 1ZMRA 2ZSIA 3FYHA 2VG8A 4QBFA 1NVEA 1PUJA 3KLOA 4M0LA 4OREX 1QANA 4N5DA 3UO8B 4DM3A 1ZC3A 5JYDA 3GJ7A 2VYND 1D03A 5B3JA 4N3BA 4UHBA 3B6KA 4QGGA 3H18A 2BZ1A 3BFPA 3OLYA 4KREA 4NK4A 3UOGA 1T3ZA 1ZGCA 2IZ7A 3N2YA 4TQUS 3ZCQA 1UKYA 4TWZA 1H2BA 1DO8A 3GH3A 2ZRBA 5LMUB 1WZUA 4TWBA 3D7NA 3FNBA 2C1XA 2GD2A 3LY7A 4ZZ2A 3DM9B 3IIKA 4S24A 3HCOA 1KGSA 4YJ3B 3QBTA 3QY9A 5AKYA 1E1KA 1WO8A 1XZDA 1ZA2A 1N5LA 4XVCA 3DOFA 3ZJVA 2BTQA 1RXEA 1RZUA 1I4TD 1L7BA 2KX7A 2NNWB 2JFHA 2BEWB 2X22A 5C7IO 1Z4PX 2CXSA 3DPSA 2LIVA 2PZFA 2WYVA 1L8LA 2DR0A 1NKTA 1UMDA 4LYAA 2VYVD 2IVZA 4XQ9A 3D5TA 4OLBA 1YRBA 3A27A 4X1YA 4KSYA 1B73A 1UJNA 1ND6A 1ZI6A 2HA5A 2XTZA 3AY3A 3HNPA 1GR0A 3H0CA 4MUMA 3DMDA 1CLEA 1NBMD 2CLHB 1Z4QA 2R48A 2P0AA 5G0WA 2XYHA 4ZPJA 1A9ZA 2HLNA 5K6AA 3TZQA 1SG0A 2C9CA 2WU1A 4R69A 2JG3A 3UKOA 1DKNA 4MV7A 4MDYA 1YD7A 3VSAA 2GKOA 1T5SA 2VEOA 3C1UA 1Z29A 3R3JA 5AI9A 3OLVA 3T3NA 2BFCA 2IW1A 2XRMA 3AEUA 4UBOA 4PPNA 5CTAA 5DRYA 1M6EX 5CT4A 5TPWB 1DS6A 3V1UA 4TYWA 2AYZA 2C84A 3AUUA 1MPXA 2OK8A 121PA 2C3PA 3WJ1A 5JASA 4EI8A 3ZU4A 1NNEA 4M7PA 1POWA 4DSAA 1K86A 1R6BX 3BA1A 1MX5A 3QV1A 3R3SA 3RYIB 3PTZA 3ILSA 1TZCA 3B8EA 3NTQA 4DA6A 3B7PA 4HH1A 1JQEA 4KN8A 2OGWA 2BZGA 3HZRA 4EPYA 3QNMA 5AJHA 2BI4A 2QNIA 4LOHA 3GNTA 1WE2A 1KNXA 2ZUEA 4E2WA 3D0OA 3F5MA 3HDHA 3NCTA 4A82A 4A8TA 5HKAA 4KX5A 1UANA 2PBRA 2R8ZA 1I80A 1QOPB 2F7SA 3DMFA 3EISA 3L1HA 2CJWA 4GE0A 4PYQA 5G53C 5EXDA 3F4BA 3ZWAA 1P4AA 1CPYA 2CNKA 4RKWA 5DI9A 4B40A 3D2BA 4X9XA 1AU9A 3HY4A 4Y6GB 4BFWA 1R66A 1JX6A 1VKJA 4GEKA 5CGZA 1CY1A 2KI5A 4JLBA 2B0CA 2VPXA 4NG4A 1IZ9A 2EJUA 5HCIA 2I9KA 4Q12A 3BWVA 3BXOA 1LF0A 5BSHA 2QW1A 3GD5A 2AG8A 4R1MA 5FNVA 4D3XA 1AKQA 3O0DA 3QVLA 1QR2A 2K4MA 4HH3C 4KIUA 4XFKA 1LFAA 2ZP1A 4X1KA 3JQQA 2WKSA 1Z45A 1EB8A 3IP1A 3PITA 4PC6A 1NUAA 4QE3A 4S2EA 3QLVA 1KBZA 1W1IA 4EA9A 1QWOA 1F12A 1TNDA 3NAGA 1FOEB 3OJEA 4MW1A 2FWRA 4O0MA 4CM8A 4O4JF 2REQA 3DWEX 1E98A 1SBZA 5F1OA 4IPTA 1JBKA 1DFIA 1KTVA 2NV2B 3KT3A 5F2KA 5JLAA 2J31A 4X41A 4IEEA 2EIXA 4MJLA 1W30A 4Z99A 1U8UA 5F3RA 1HURA 4C4RA 1BN7A 5JI2E 2QY9A 1JQKA 2J3IA 5K0JA 3ID6C 1E3LA 1WW8A 3OTHA 4DDMA 1IHUA 4L07A 5KNDA 1RKXA 1D6NA 1ZIDA 3HV2A 4INZA 3FFXA 4DLBA 2VPWA 2OC4A 1OXUA 5FQNA 4E1VA 2V7TA 2FLWA 1YFKA 1NUPA 1F51E 2QE7D 4KBFA 4O2AB 5IYZF 3RROA 1PVDA 1YR3A 4OTZA 2EFEB 5LL6P 5FBQB 4FZJA 4Y2GA 1HE5A 4ZANA 1U9ZA 4LBVA 5JFOA 3ZX4A 5ED4A 1KBOA 1UDWA 1E2MA 1P33A 2PX2A 1JNYA 1W44A 4YS6A 5DBEX 1AURA 5M04A 4HPXB 2J9FB 1P4JA 3LDAA 3GT0A 4BLQA 4F4DA 1V1MA 3ZJUA 1TUBA 1DBVO 3UXHA 3G6KA 1ZNYA 3LY5A 3AF3A 1HWYA 1JPUA 3BRSA 4L2IA 4DV4B 2NXJA 3NHMA 1G2PA 3LF2A 1YS7A 3U6KA 1KAQA 5KWVA 4ZK6A 1NSYA 4KQ2A 3LA6A 5JVDF 1K2VN 1ODKA 3NJ4A 2LCQA 1FVXA 3B8HA 3IAUA 3VNQA 1GRQA 3WGNA 3LFUA 5GIPE 4IEFB 1NPDA 2O2GA 3E5NA 1J0DA 3KM0A 3KJXA 4IIVA 3DUFB 4V39A 3SP1A 3AKEA 3OQ1A 2GHTA 3QOXA 4PWZA 2FFBA 4D8YA 2ZYUX 1Q7BA 9LDTA 2VP4A 1E96A 3ABSB 2D1SA 1DX4A 2BFPA 2ZUUA 3H83A 5AM0A 2XCLA 3O2SB 5EGNA 3IKTA 4KPUB 1MAWA 1UOQA 4U63A 2FFAA 1VPTA 1S02A 3DAGA 1T2UA 2E3JA 4PYKA 1NLUA 4RD0A 4R2LA 4XB2A 4FZRA 5AJUA 2QMOA 1PTJC 2OV3A 1DC7A 1KYWA 3NDPA 3WX0A 5BNZA 4LX0A 5JFGA 1N75A 3R9KA 4M37A 3Q7RA 1C50A 3FFAA 3R75A 1H8ED 1G3MA 1XDGA 1ZHHA 3OZDA 1O57A 1A9YA 3ONEA 5FOTA 3I6ZA 2B21A 3ONFA 5ERXA 4W8OA 5EZYA 2QAGC 3T7TA 4B4KA 4HXYA 5AKGA 5B2FA 1LLDA 5J4KA 2CHGA 3SEQA 4YUYA 3SJUA 2Q1SA 4DUGA 3FPEA 3JVUA 3LIPA 2VAMA 3GCWA 1H69A 2CLCX 2J5XA 3QW4B 4BECA 1C7JA 3V7YA 3PHGA 2ONYA 3TTXA 4W5NA 3BSYA 1ODIA 3F7NA 3B3AA 4ODIA 5D51S 3ENQA 2JCXA 1MOZA 1UPCA 1ABEA 3AM4A 4R54A 3IT3A 2GM4A 2D7CA 2X3FA 5KAMA 2C83A 4BCDA 4PG8A 1N1DA 3QUBA 1XIVA 2XT0A 4IDPA 2QRUA 4MP6A 5H80A 3DV2A 3WFZA 4GXTA 4DHWA 5JNVA 3OPQA 4JNCA 1QP4A 3E61A 4YP6A 1NG1A 3BJZA 3GA5A 5F7OA 2VHQA 1EK5A 1COZA 1MJFA 2JZOA 4ZQEA 2AE1A 5CXSA 2ZAMA 3VA7A 2YNMD 3FDXA 2UXDB 1QV7A 1I4OA 3E9YA 1GAQA 5I4CA 4RVFA 3O8CA 3M5DA 1JJIA 4GZ5A 3A9WA 4I4TB 3KYDB 3U5ZB 3M33A 2VEDA 4UM9B 3S7TA 1TIPA 5FBKA 2OZKA 2VC2B 1JLRA 4TLMB 1IXSB 2EX1A 5GONA 1YZHA 3KJHA 4F3TA 3ESZA 4JJAA 4O2BF 3NDIA 1B1AA 1J8YF 3NC4A 1PVOA 3ETGA 4JSYA 4WY8A 4OH7A 4G86A 1FJGB 4ZCPA 3JQAA 3A32A 4Y2YA 1EGHA 1ZZEA 2FFRA 3M9XA 3P2IA 3CUSA 2VHVA 2H59A 1OF1A 3FH0A 3PFNA 3PDIB 4B32A 2DWCA 1JSLA 2YJ3A 3S1SA 3CISA 3WOHA 2FG6C 3NH9A 1X9HA 2FOLA 2RHBA 3BXEA 2CNOA 1FIUA 4PZEA 5ALKA 2G8LA 3DA8A 1L5SA 1NXTA 4JJ7A 3SFZA 1R6DA 3HY3A 4BZWA 1YS6A 2HRCA 1TE2A 1GQSA 2IY7A 3RU7A 3X2EA 3OIYA 4O5AA 3UCEA 1L7MA 3H9GA 1VL6A 1OBOA 2O2IA 1KMMA 4I6JA 4Y6PA 1SVWA 2WVHA 1LPAB 4JU8A 3AGPA 4LGMA 4P0TA 2HJSA 4Y30A 3TQCA 3K20A 5KO2A 4Y9SA 2RCNA 3VH2A 1EUDA 1T0PA 1RC8A 3EMKA 1NNSA 1W8DA 3UXEA 4V0MA 1HGXA 1DPGA 2JHCA 3IIMA 3Q7TA 5AICA 2UVPA 2DUJA 3AF0A 3ASYA 3I4CA 4JP8A 2RB4A 2UZ1A 3CNHA 2RH4A 3VNSA 1EVIA 2AKEA 2QR5A 1DIBA 1VLLA 1V5FA 3QXSA 1WF3A 3NWPA 2PUBA 2H1WA 3IALA 3PZBA 4OJYA 5CH3A 4XJXA 4ZAFA 4RD1A 4P3OA 1UP6A 3K09A 5GY7A 1JHXA 4KV9A 3RTDA 4ZDWA 2HUNA 4MMZB 1R00A 1ZKMA 4P5DA 1E0DA 4FUTA 1G4HA 2HRBA 2Q0SA 2WIFA 3EVTA 3FHLA 1RVV1 3DZHA 2J5KA 3KZCA 4NYJR 3D1JA 1LPPA 3GXBA 2EJBA 3C7AA 3VU9B 1SFRA 1I0LA 2O2ZA 3DL7A 2G9QA 3PA6A 5I7FA 1T5HX 3E1KA 2O14A 4Y2TA 3M6AA 4QZVA 3IAAA 4N8EA 3WQBA 1H6DA 1Y37A 4UXHA 4DR6B 4EEXA 1O4WA 1MB9A 3L7LA 3MINB 1XQVA 5HFJA 4FFWA 4QELA 1PWHA 4X00A 2PGLA 3E84A 3OKAA 1FXUA 3ST7A 1WW3A 1IN7A 2HU7A 1OXTA 2QJWA 2XBUA 2B5WA 3QWHA 3E27A 3WXMA 3RD5A 5DTJA 4R9SA 2P75A 3IVXA 3L6RA 4LRTB 3WGQA 1R4MA 3GLIA 3ZDBA 1CQJA 2VOEA 2JHGA 3MWFA 2QPAA 5CT5A 2D5BA 2WF7A 5KSWB 4FTWA 1SN7A 5IMSA 3IQHX 2I7CA 5HE9A 2ACEA 2C2OA 3ZY4A 1A7KA 4CKCB 3MQ4A 5DNVA 1VCIA 4MTCA 1TEZA 3DVRX 3E0XA 3BJEA 3K5WA 4AJPA 1NW9B 3ZU3A 2VQSA 4F4FA 4OJKA 1TKBA 1WPQA 4RABA 2CK3D 3SQMA 4PINA 2QLMA 3STTA 4LE2A 4E09A 3TIXB 4CV3A 4FBMA 1L7OA 1TUGA 3H8JA 3RFVA 4BLVA 4DY4A 1D09A 4QM6A 4H0CA 4H3SA 3SF8A 5D7NA 5T3UA 2R4QA 3AZOA 4E22A 3HACA 3FYDA 2VTBA 2Z6VA 3N58A 2FETA 4L8YA 2IYXA 1AUVA 1XD8A 2JRCA 1RAAA 3CJRA 3MCUA 2QRNA 1ONSA 4PSDA 4ES6A 5D7BA 2NUBA 3SZLA 3PCXA 3AF6A 1DCTA 4LDQA 2ZR7A 3VR4D 2MSWA 3EDCA 1C2YA 1QNLA 1X1QA 2YY7A 1G7TA 1NE7A 3V1LA 3GLFB 2OZEA 4KAXA 5BW6B 1YZVA 2H18A 4UU7A 5EAIA 3NV9A 3MCTA 3PHLA 3BDVA 4YFVA 3JS5A 4FGUA 2V1XA 3B60A 1O95C 1OQAA 1A2KC 5CR9A 2ATEA 4Q66C 3W5HA 1E9EA 1BQ4A 3LLSA 3OLZA 5IN5A 2IZOA 1DUVG 3AUXA 2YXEA 3O4VA 2GEJA 3O8LA 3PYMA 1V1RB 2W37A 4EG4A 4Z1MD 4M0CA 1I3CA 2FUNB 5JSHA 3EE6A 3H2GA 3OQMA 1EEHA 1IMOA 3AL3A 3EDMA 3D5QA 1H6CA 1KEZA 3H9JA 4PZPA 3T9AA 3W8RA 3ZW8A 5A06A 1MKYA 3MB8A 2GEKA 4AKSA 2G67A 3RK0A 2PUEA 1CR6A 1ZH8A 3CN9A 3DYBA 3SQDA 1IEVA 2J9GA 2PD4A 1CEQA 2H7CA 4C4XA 1JKFA 2OESA 2OPHA 5LZ9A 3ZH9B 3SWWA 4F84A 1KKMA 1F6BA 1L5WA 3FSJX 3TVYA 1B8PA 4B4VA 4AP6A 1UKZA 3K31A 3IE0A 1R1DA 1HLPA 1UMBA 4KAJA 3BGSA 3OQBA 3Q9LA 4WECA 1CULC 2ACVA 4KIFA 2I87A 4JA0A 4OHPA 1KRXA 2QROA 3IXMA 3KELA 4M0MA 4NJEA 3R20A 1KAGA 1T2AA 2AMLA 2DF8A 3V2UA 4E46A 2NXWA 2AZDA 4ZIRB 1L8QA 3QHPA 1W88B 5K8TA 4UOZA 5FULA 4QOSA 2Z2YA 4G0NA 4LIPD 4MK4A 4IUYA 3IT1A 5CJ2A 2D62A 4EB0A 5DE3A 3OJ0A 5BV1A 3RUCA 1U8AA 4YAJA 3V97A 1PKXA 3NS7A 4IDDA 3T7RA 2GS9A 5DM2A 1ZIPA 2BFAA 3GCXA 4DL9A 4EG7A 1SULA 1VOTA 3ESXA 5BR8B 2ZDGA 1B0UA 3KZ1E 1YUNA 1F38A 1SD5A 1UAGA 3UAOA 5LOVF 4Q4AB 3AESA 4DMRA 3BIJA 1MG5A 1WA5A 5ADWA 3MA0A 2NYRA 2ZBRA 4LZOA 5DPMA 1G2IA 4NENA 4F5EA 2IGTA 3P9QA 4QFBA 3NYIA 3H99A 3IKJA 4Z7JA 1MRSA 2FJ0A 2ZYDA 2IZ0A 3IBCA 4LDNA 3GW8A 1OAOA 4NU0A 3TINA 4OQNA 4JB3A 4HSGA 4BMYA 3L0CA 4HRYA 4U9HS 1ID1A 4MUFA 3T61A 2PZBA 1XX6A 3F3SA 3K94A 4HQ0A 5HDQA 1P5FA 2OYSA 3CUWA 1X15A 3PUHA 1JT2A 2JFUA 2C82A 3WB1A 3U3OA 4TMKA 4UARA 1QWSA 2X9LA 3VNBA 1DG1G 1OKKA 1M8FA 2WSLA 1T9KA 4L74A 1YFLA 1TCVA 4R71A 5CA0B 3AW9A 1WZIA 3N75A 2PZAA 2VPIA 4LJYA 4XGIA 3VSEA 5JAHA 1E6UA 4S1PA 2XMZA 2ES4A 3BIFA 1A77A 4FNOA 3UW1A 3KOUA 3V8QA 2J33A 4EKGA 5BNFA 2R7LA 1KMHB 4Y1RB 2W2QA 2NZ8A 4ZWNA 3X44A 4R0NA 1LNQA 1GQ2A 1RYYA 5DCLA 4AYWA 3C3CA 4Q9JA 2PAAA 4GECA 2W71A 1J8FA 2D5LA 2F2TA 1ILWA 5CA1A 3O31A 3OKCA 4ZRDA 4UTRA 1BVYF 5AKEA 5SY4A 3C4QA 2LE0A 1B0ZA 1V25A 5DHTA 2X2OA 5K05A 4WEQA 3ZNNA 3KKMA 5HFAA 1CEXA 3BWBA 3ZQ6A 4E51A 4K26A 1W6RA 3CT6A 4D9KA 1GOTA 2C7BA 4B7CA 3T1TA 1U0OC 3EPJA 3QVXA 4IHJB 2G1JA 1XCOA 3GU3A 5TQJA 4PAQA 5EJ6A 1TCAA 4KQXA 5KTYA 4MRPA 4PE5B 4K9MA 1JJAA 4WACA 2YFHA 1THGA 5AI6A 4YRZA 4IDAA 1ZN2A 2FPGB 1Z5VA 1RLIA 1WSBA 3E23A 5TS2A 5A9RA 2VI5A 3DNPA 2ID4A 2R3SA 1HOTA 4L16A 1NBME 1UBGA 3AXSA 4N7BA 4OUDB 3S5UA 4LFBB 1AZSC 1RHJA 1UK8A 5E1OA 1XO1A 5CIYA 1W4AA 2KLHA 2ZG6A 2ZFUA 2C7OA 2Y1GA 4MYUA 3H4VA 4QAQA 1EXNA 1KVTA 2JAOA 3LH5A 3PS9A 5EXEA 5FOWA 5JS1A 3UK2A 5B3LA 3ZI0A 3DDZX 1Z75A 2FLKA 1A5ZA 4L5BA 1AQNA 1H2XA 4Q1BA 1WQ3A 2RGWA 3VNRA 4HX9A 3OFND 1PUXA 4DIKA 4K9NA 3IL2A 1PRYA 1CJBA 2H4ZA 4QJIA 4EY7A 1JB9A 1SURA 4YCMA 2VAXA 3KT0A 3QM1A 3K0CA 1J24A 2WUGA 1VDMA 3OIGA 3NP9A 4LGCA 2F62A 5CB6A 1QHGA 1L4FA 2HXGA 1IHYA 3M89A 4DJDC 1JH9A 2GASA 1FFGA 3IIEA 1VL1A 3BAFA 3LBFA 1QE3A 3GLHE 3DL0A 5BW8A 3HUTA 1QRDA 2B37A 3L07A 4MUEA 3AETB 4Q7LA 4NXNB 2XAAA 5E9WA 2PUAA 3I53A 2YQZA 1U8FO 2RHHA 2W4IA 2P62A 1TVEA 2ZBQA 5AJXA 5GM2A 3HA3A 2B5OA 5L7WA 1IXYA 1RADA 2NVWA 1JG4A 1XNJA 3PQ2A 2O8EA 4PAMA 3TKAA 4DEVA 1OTHA 1AA9A 5CVCA 3VHQA 4CGYA 3MWYW 4FBGA 1L7XA 1EWKA 3D8SA 3FWHA 1V3UA 3OEYA 3N53A 2ZJ3A 3CE9A 1X7XB 5J40A 5FA5A 5KYWB 2Q2VA 3AHDA 3SU8A 5BN3B 2YWCA 3D4NA 3HY6A 3DL2A 1E89A 2W4MA 3NQ41 3AIOA 3Q7SA 4QOGA 5HA5A 3RK4A 3ZHRA 3RS5A 4R3WA 4EM6A 1XYVA 4JJFA 1UC5B 4UAGA 1K1EA 2P2CA 4XUCA 3D81A 3P9NA 3I12A 4HDSB 4AJ9A 4P35A 3PICA 1R6TA 5FFFA 2G1PA 4N18A 2PRIA 1LVHA 4KGDA 4D9GA 3EIEA 3QFSA 4KO8A 3SC2B 5HZMA 4JI2B 1ZNXA 1X1SA 1YJCA 2EZUA 2XY4A 3CF2A 2WFLA 3OJCA 1NI4B 3AWDA 2AOWA 2PNJA 2NOAA 1UDRA 2XIQA 4Q9DA 4WY5A 2C8KA 2ET6A 1GNQA 1G2OA 4OM7A 1Q92A 5F33A 5FWNA 2FUKA 3LYAA 2WUWE 3BYZA 1EQAA 4H18A 2NVUA 4YPOA 1QX3A 1XKXA 5T3YA 4IRXA 1XTPA 5CB4A 1M0TA 5F3DA 4C0JA 4J76A 3QU5A 3RSOA 3BHJA 1ESCA 3TQQA 3VR6A 3ZHYA 1U7XA 1C30B 2AR0A 2DBYA 3F6PA 1EFAA 3CTMA 3DGEC 4FFBA 5H81A 4KQKA 1P6XA 2WILA 2EVWX 4DLRA 5EJMA 4JI8B 4CGZA 4E5DA 3R2JA 4EUFA 3L6BA 2G9VA 3INNA 4XIYA 1HQCA 3A3PA 3QF4A 3HM9A 3FGOA 4ZCIA 3GUHA 3JQ9A 3AI3A 4FONA 4UVIA 3BHMA 1F6DA 4O08A 1O94C 2O6LA 3RBXA 1NQ5A 2VK8A 3Q3IA 5EIHA 3ICCA 2GTPA 4MI3A 5A4DA 1R6UA 5KYXB 1SQSA 1ZLXA 3EVGA 4FWIB 1E2PA 3BQNB 1A88A 4RJTA 4QUDA 3B2NA 3V6LA 3D6HA 1FDRA 2VZLA 2ZWMA 5FR1A 3ROFA 3TQFA 2ZXEA 4DXHA 5B7PA 4KTTE 2R6GA 4BXOB 1UIMA 4MZDA 1WSWA 2FQQA 1R3UA 3MC1A 2NVOA 4YRLA 3H9CA 5ETJA 2XZTA 4BVLA 4CEIB 3UH0A 5FHRA 3WL5A 4HEHA 4H0NA 2PGOA 2QA5A 1E7YA 2GJ4A 2QWXA 2RGYA 3SJAA 3S29A 1GNLA 3AMVA 3TLEA 1VI6A 3ROGA 1VE6A 1WLSA 2IUTA 5KJCA 1P5RA 5C4IA 2LNDA 1I13A 1SBHA 3NHLA 3OOSA 4HNRA 2M1XA 3WLHA 4B3RB 4IV5A 1B4DA 2B4KA 4GXQA 4HPWA 1U1EA 4H16A 1T2DA 3CEPB 1WB4A 3JALB 3GDFA 1LDNA 1LC3A 2HJHA 5ALYA 2GAJA 1UP7A 5CDSA 1NDUA 2FMKA 2IYPA 4UE6A 3WYNA 5C1DA 1XXHA 4W6ZA 2ZUDA 4C1BA 1EX7A 3O1HB 1FTGA 4KC0A 3QX9A 4PSKA 3VKFA 4N54A 2ZU6A 3IILA 3MMNA 5FJIA 4NU5A 2A59A 2CL6X 1W94A 1EXDA 1OH7A 4Q9NA 3QWBA 3UWDA 4HYTA 1NJGA 4GBMA 1DTSA 1VZ3A 1JXOA 3ZE9A 1H05A 1Y3HA 2GETA 4KN5A 3A4TA 4LV6A 4D80A 4NCIA 4YMWA 5KVAA 1JH8A 1HE2A 2ZEJA 4YWHA 4KQ9A 1IZ0A 4RZXA 2GBGA 1YVDA 1VI2A 2N9UA 4GD3Q 3BOSA 4OP2A 2OGZA 4OFWA 4D2IA 4YAUA 1AZTA 1Z4LA 2JCBA 4IIYA 2QAGA 3R7LA 7REQA 3ZV5A 1F7UA 1QLJA 2OSVA 4IVPA 5I9NA 4RTNA 3HB7A 5DM60 3F4LA 4CF6A 4CMBA 4DC1A 2GEVA 1P1HA 4H1UA 3LCJA 2FZ5A 1Y1KE 4L85A 4BRSA 3IVMA 2JZNA 4S12A 2EKQA 5FOUA 3UC9A 5ITSA 2J4CA 2CV0A 2ERCA 4R1UA 3U5TA 1P2DA 2LTAA 2WFMA 3IC5A 4TTVA 5ECGC 2PIAA 4II3A 3Q8MA 1QMGA 1J90A 1T9BA 4I19A 3I2YX 4HQOA 2VDOB 4R7ZA 4V03A 3W2GA 3CLRC 4NHEA 4A2WA 4CG2A 5FUMA 5CYPA 5JSZA 3CUKA 1MN6A 2YHAA 2Z2KA 3VAZA 3RARA 1Z2PX 2P27A 2QRQA 5AKLA 4AP5A 2YWEA 1K3FA 1XB2A 2QUHA 4Q48A 2HJGA 4PR3A 1NA5A 4X94A 1CZOA 3VHLB 2OTCA 2WD9A 1QFMA 4JYBA 2BUCA 1KJQA 3IYLW 4N3CA 3KOOA 1FTYA 3C2QA 1YZYA 4NBKA 5DSZA 5DBFA 1H6AA 4HVCA 1P9LA 2RHWA 1JDBC 5E38A 3DXYA 4NESA 3PQ4A 3ZY5A 5JAPA 1NDHA 4I9GA 2PD6A 1Q6YA 5JRJA 2V9PA 3CY6A 4NBRA 4LJLA 5TR9A 3T7CA 2X58A 1MORA 4TT8A 1VLMA 5TGZA 3KJFA 2PVCA 3H84A 2OEPA 3FIJA 1Q1EA 3KO8A 5EIBC 1BH6A 1SBCA 4U7DA 3JYQA 2XPCA 4ALLA 1QK4A 2B30A 2WUFA 4UMDA 3SOPA 5EE5B 5AI4A 1ZGGA 4M46A 1X9GA 3R5SA 4BMCA 4G0ZA 3T4EA 1Z18A 4Y1FA 1D9ZA 1WCXA 3JWPA 1XBTA 3UUFA 1XCPA 1TL7C 1FZQA 4NZYA 2GVDC 1QRRA 2LV8A 4EARA 2R5WA 4B87A 3FMVA 4LYYA 4EHFA 2XUHA 3UQZA 1L3BA 3SHOA 1VECA 2E1RA 4I1VA 4MS4A 4BMVA 2EZ9A 2WMDA 1W85A 4RKEA 4Q15A 4IH4A 4RY2A 4W7IA 3SQLA 4W5WA 2DFVA 2WJGA 1I6WA 1WCIA 3PI7A 1A9XB 2FZCA 2ONKA 2AZTA 2GX6A 1T15A 1O96B 2CBXA 4MV4A 3ROZA 3GDOA 1QVWA 3GGSA 5IC4A 1XFAA 2VDNB 1M1XB 2WSIA 4RD4A 3RJTA 5DISB 3HB4X 4TSRA 1L0BA 4X20A 1QONA 4OHUA 4Z9YA 4EGJA 2H6EA 3O8QA 1YB5A 1J22A 2FSSA 4QGFA 5E9JA 4P4TA 3UFXA 4K05A 1EESA 2VJCA 2IU4A 3G5AA 2IW3A 4MIOA 4ZV7A 3M6UA 1Q1AA 2QJFA 4KQWA 1CDDA 1PLLA 5E8RA 4GOLD 1X2EA 5M5BA 1VMKA 1W5FA 1C80A 2CHUA 3HKCA 2FY8A 2IIQA 1AG9A 3FDIA 3ZHOA 1P3Y1 3QLJA 4QUAA 1VSUA 3GJ8A 5IFKA 1E5VA 1R9JA 3G2MA 2BFDA 3O82A 5CHYA 1G2QA 1C3OB 1JU4A 3F3YA 3FBGA 3PGXA 13PKA 4KWCA 1WB5A 3GAMA 1U3TA 4HDQB 5A4MS 1O08A 3IPLA 4K8OA 4ZRMA 3JYNA 2HSWA 1L9KA 1HE1C 2XB2A 3H11B 1TU0A 2W2PA 2B98A 1UJ5A 2BDUA 5JBQA 5K8VA 1IG3A 4BO7A 1E1QA 5CEFA 1GNTA 2EEPA 5JQGA 4XUGB 3OHMA 4RXTA 3M4XA 4W9NA 3M1LA 3RYFA 1Q7RA 1GITA 1R27A 1PF7E 1EK0A 3T35A 2RK6A 1H0KA 2HSDA 2VTEA 5ALEA 5FR2A 4TS1A 3CWCA 5JI3E 1XZIA 3TPFA 1TRHA 2AG1A 1Y8QB 4KXFB 5COAA 5EYPA 5A3RA 4KRGA 3H0KA 3NUZA 3QUAA 1DEKA 1L5KA 1QQBA 5E6SA 1V47A 3ZYCA 2BCGY 2QSUA 4B2PA 3ILHA 1Q0TA 1WD7A 2VRNA 4HNAA 3W6ZA 2WM2A 3MUNA 1Z12A 4QJ5A 2HLDD 2XUQA 3K53A 5BO5A 3TAXA 3FWPA 1TD9A 5TQ0B 1O58A 1CRZA 1ZIYA 2O8FA 1XAGA 1W5AA 3SXPA 4KSCA 2CT8A 1E20A 2QM3A 1DVRA 3FIUA 4BC1A 4UTXA 1YQ9A 3KQLA 2O19A 1HT1E 1JQ5A 4IIBA 1TT5B 5BSRA 1C81A 3GL9A 4HB3A 3X1XA 3IVGA 4FMCB 4CEJA 2YICA 3GLGA 2ZRAA 1F3OA