1BWRA

Probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
212
Chain Sequence
b'ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGSNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
publication title Probing the Substrate Specificity of the Intracellular Brain Platelet-Activating Factor Acetylhydrolase
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 71
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 1998-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1bwrA00
3U37A 3SLRA 4JJ6A 4K3UA 4TX1A 1VJGA 4K40A 1YZFA 1ES9A 1BWRA 1JRLA 4K7JA 4JKOA 2O14A 1BWQA 4S1PA 3C1UA 1J00A 1ESEA 2APJA 1DEOA 3DT8A 1FXWF 3DCIA 2W9XA 5CD9A 2WAOA 4I8IA 4OAOA 1BWPA 3W7VA 4JHLA 3KVNA 3DT6A 4K9SA 1PP4A 4RW0A 4HYQA 1VYHA 2VPTA 4H08A 1U8UA 1Z8HA 4OAPA 3DT9A 1V2GA 3DC7A 4PPYA 4IYJA 1DEXA 3MILA 4NRDA 2HSJA 5BN1A 1ESCA 3SKVA 1ESDA 4LHSA 3PT5A 2WAAA 5A4AA 4JJ4A 4Q7QA 5B5SA 1IVNA 1FXWA 3HP4A 4M8KA 3P94A 2Q0QA 1K7CA 2Q0SA 4RSHA 4Q9AA 4DEVA 2WABA 5JD3A 5HOEA 4JGGA 4HF7A 3BZWA 3RJTA 4XVHA 1ZMBA 1WABA
chains in the Genus database with same CATH superfamily
1HNXB 2Q5CA 2IHTA 2ZAIA 1RKQA 3IIEA 3NX4A 2R6ZA 3B5IA 4UC0A 1QRRA 1RTTA 2COKA 3FD8A 3CMCO 4NNOA 5A7GA 4GNRA 3RODA 1MT0A 1WCWA 4D57A 4D4KA 5B1EA 3GEBA 4G5RA 5E4YA 3B7PA 2JKZA 4BS9A 1ZN2A 4AUMA 2Z09A 2CSUA 4GPTA 2HNBA 3KQUA 2AXEA 2JH8A 1IYZA 1UC8A 2D74A 3PR1A 3TGWA 1J9GA 3OFVA 1YB7A 1GU1A 1SKAA 5J59A 3BJIC 1ZM7A 3BFJA 1KI6B 1ORHA 2FWIA 4IV0A 1DKUA 1T0PA 3G7UA 3JATB 1WXIA 2IYEA 2ZIFA 4BNNA 1JJFA 4D9JA 2Q4TA 4YACA 1YQQA 4WKOA 4F4IA 3OIFA 1VPLA 3DYIA 3OCZA 2AQIA 3B1ZA 3IDSA 1E69A 4PONA 1JU4A 2C9BA 2CLCX 4ZDWA 2P4HX 1K08A 3HR4A 7ABPA 4GDFA 3K4QA 4RQTA 4YAJA 3EUWA 3IE0A 2VJQA 3DO6A 2XTZA 2Q8PA 1MU0A 3IFSA 2I4NA 3LGAA 4E6EA 3UGJA 4LWZA 4WFQA 1KGSA 4I55A 1T6XA 2HMVA 4YT5A 4S04A 5E8JA 2QOEA 3OJWA 5AWFC 1MB2A 3H2IA 1O87A 1N2IA 1Y3HA 3TGLA 4OHPA 3LYUA 3QF4A 4ARBA 2CHQA 1Z29A 1GPKA 2PLRA 4LZOA 1KHTA 4XGNA 3LCRA 1B41A 2I1WA 2Z83A 1GDDA 1NXVA 2J0EA 3ZCPA 2CL5A 2W4QA 3GA5A 1O94A 2GEVA 4HJRA 4I4CA 3L4KA 1Z4QA 1SUSA 4MYHA 5DHSA 1RBYA 2R8EA 2VDNB 3OE7D 4HAZA 4U7FA 3R75A 3UJ8A 1QYWA 2PRZA 2ZITA 2OYCA 1IC6A 4ED9A 2PH3A 4E7OA 3KYCA 1QK4A 4KXVA 1R0KA 4N1AA 3EXG1 2WB2A 3UMBA 2N1MA 2VH2A 2NU9B 4BMDA 4KZPA 4JLJA 4DE5A 3LO8A 4YFYA 2QRJA 1V7QA 1ISJA 1NPTO 2FG6C 4LC1A 5DFAA 4PHCA 1TF2A 2FK7A 3OPYA 3S55A 4XOUA 1MW9X 1LWOA 3PT5A 3TNLA 5AJXA 4DGSA 1M8GA 4W5RA 2RBKA 4ES6A 3IO5A 2W2PA 3HBJA 2OPBA 4OXIA 2W70A 4QTTB 1GLVA 2DF8A 2R6GA 1FW8A 2YC2C 4FKMA 2XUFA 1EWQA 3BCRA 4D6XA 1XZPA 2A7QA 1FSPA 2CXTA 1ZCZA 1EYZA 3PNMA 4L2IB 1Q7CA 4B3DA 2ZWOA 4F5DA 5EUQB 2YMPA 2V9ZA 5CNJA 1P4RA 1ZX1A 1IN7A 2ACVA 1D2RA 3AILA 4U7PB 2OORC 4I4TF 4U2BA 1V1JA 2ODBA 2CBGA 3HWRA 1UF9A 3D3QA 2D0PB 1CJCA 1JQDA 2BGKA 5H80A 1LPPA 2B99A 2VDWB 3A4TA 3TBFA 1P29A 3M6LA 3KJXA 5K6AA 1F51E 1RCTE 1ZPDA 2EQAA 3B6KA 1AKUA 2PKCA 2VUTA 3Q1KA 4X6LA 3HJBA 3RROA 5LNK6 4IYRA 2ZSAA 4G0XA 3BRCA 1JILA 4G1BA 5JCJA 2P1ZA 1YZYA 3AI2A 3LXMA 2QD2A 3LDGA 5CUQA 4ZOLF 4CN8A 4HUJA 5JJCA 5KVCA 3EEOA 3COYA 2W6OA 5AXCA 1M2OA 4IY1A 1EXVA 3LCUA 4NDNE 4ZP1A 2EWVA 4TX1A 3TJRA 3NAQA 1F8GA 1KP2A 1MJHA 3KU1A 5CTJA 1GSHA 1P5HA 1PR9A 4NS1A 4A6XA 1L3CA 3RAFC 1W5TA 4HXYA 1M74A 1Y7HA 4PLGA 4Y2JA 1Y48E 3ZWNA 1EG7A 3IELA 4W99A 3N86A 1Z13A 1V47A 1TKRA 2F48A 4G89A 1UBJS 1BHJA 2HDOA 2CW5A 3C8UA 5MFPA 2O8FB 4Z49A 5IDXA 5JDCA 5ILOA 1JAXA 4B35A 4KAJA 1ATIA 2WU4A 4Q00A 4HG2A 1N3LA 3RS2A 1T2CA 3DFKA 4LMAA 3URKA 5BSVA 3EXHA 1WB9A 3LLUA 5H59A 3RREA 2FUEA 1E3JA 1G9XA 2LZ0A 3A4LA 4GMFA 4NONA 4CLDA 3BMNB 5F76A 5H70A 4KR7A 3AJ8A 1RXSA 2Z3ZA 1AF4A 3LM8A 1J5EB 1Q22A 4OOFA 3D0RA 5FI0B 2AVNA 5G0VA 4CF3A 2OWDA 5FD8A 1T9HA 5JLAA 1QHHB 1TO2E 3RJ9A 2CE2X 2E0IA 3FOFC 3Q3IA 1GAQA 2VATA 1QC5B 5REQB 2H1CA 3E81A 2NACA 4PFQA 5FWNA 2O2EA 2J7PA 3Q85A 3M4NA 4HB4A 4KXLA 4RK1A 4O6VA 4EJMA 2XNDA 2A3NA 5IAOA 2AQHA 4LW8A 2ZT6A 3OTWA 2VCYA 4HGQA 2IY7A 4QYMA 3MWLA 4B4WA 5IEJA 4ZTZB 2X7XA 1V3QE 2VH5R 4B0OA 5JV5A 1C9YA 1VMIA 1A7AA 5F7ZA 1TK2A 1ULZA 2ACEA 3PGJA 2HLDD 4R01A 5C4MA 5M29A 2FAXA 5KYGA 3JYNA 1UKCA 4FFOA 4RDHA 1NONA 2ZR7A 3ZOKA 2JGLA 3EQ8A 1PN3A 1ZC3A 4HLDA 5FBQB 4PWYA 1DPGA 1XQ9A 1E5VA 2QRNA 3UKDA 4C1NA 1A95A 2ZUUA 5JALA 3QBTA 1FYEA 2ZJ5A 5LP6A 1DJOA 1QMGA 2OAP1 1HZZC 1GSOA 2WMNB 3UT6A 4HDCA 2BJWA 2WAAA 4YROA 3LC7O 4D2IA 1V37A 2WJHA 2IP2A 4BO3A 4HNVA 5KYNA 4RTQA 1RXWA 2C8VA 4EYSA 4MUJA 5F52A 5LC1A 3T1HB 1T9KA 1N6LA 2I7CA 1QFJA 3KYBA 3H1FA 4FOPA 4UUBA 5AJUA 5DNEA 1KDZA 3MWKA 3L7IA 4YO8A 4ZDIA 2FPIB 3F2IA 1D2MA 1KYVA 3A8TA 3MRXA 3UM9A 2RH5A 1WF3A 2J0UB 3E61A 1Q1GA 3G0OA 3KO8A 4TQGA 4DTIA 2ZRLA 1L4YA 2IE0A 2Q1UA 3EXIA 1AH2A 4PO3X 2BMJA 2D6FA 1R6TA 3PHIA 3LX8A 1JJIA 1NATA 4O2RA 1BXZA 4CMIB 4LF8B 3UUEA 4RDXA 3PNOA 4BQOA 3NPMA 2H18A 2ZYVX 4IOJA 4WVFA 2RKWA 3HN6A 3T9CA 3W7BA 1E18A 4KGVA 4FWIB 1JG7A 1ZMTA 1FYVA 2IYSA 1JF8A 3BL5A 3NHFA 1OC2A 2KBFA 3GG9A 1NR5A 2NVUB 1RHMA 4XWYA 2H8GA 5DMXA 4W5OA 1FQOA 3EZLA 3V46A 1XXHE 4W9NA 1DO0A 3WYFA 3OIWA 3AV0B 4M83A 3ZHRA 3DLCA 1BVUA 5E8RA 1B3BA 3T5PA 5HKKD 5J3JA 4NCJA 4FCTA 1G2OA 1QZTA 2PGNA 1J8YF 4MUGA 1IOVA 5EQJB 1U1FA 3I76A 1NBAA 2QN9A 2B6HA 5D3QA 2VRWA 1IHDA 2DQ4A 3WL3A 2HQBA 5A5EA 5BP7A 4JYCA 3H65A 3ZPXA 1UQTA 3GLIE 2HRQA 1LDGA 3G2KA 1I36A 4DBZA 3RGWS 1KMIY 2CEKA 1ZWLA 2VHTA 1NSYA 4W63A 4J0QA 1L5GB 3SE0A 3SX2A 1UT6A 3T4PA 3VR2A 5AICA 5BPHA 4O1HA 1F48A 1QFMA 4LGYA 2HPHA 2J3MA 3V34A 3W0LB 4C4TA 1NY5A 1OV6A 5DYWA 3GK3A 4MKHA 2HLHA 1DAIA 1H8HD 3JVUA 4ZA2A 5JXHA 2Q6IA 3VZBA 1YU9A 3G5AA 3OEEA 3FUUA 4RZHA 3LUBA 2YJ6A 3EPPA 2MSNA 2XUQA 3UWKA 4XVRA 3K9NA 1QIHA 1QOZA 1HETA 5DX1A 1F60A 1JW9B 5KC9A 2HEIA 5CFMA 5GGYA 1UM9A 1H5UA 1V71A 4MO9A 2NP7A 3RC2A 2RD2A 3PWTA 3O4GA 5AW4A 1E2GA 1B8NA 1BNCA 1TB4A 2IXAA 3AB3A 4B47A 3DB2A 3JQGA 4ROTA 4AURA 1RFGE 5F2NA 3KVVA 2PX8A 3O90A 3OA2A 1E1KA 2ERYA 4IQ8A 4H6XA 2PTGA 3X44A 4EVQA 3TLAA 3MJSA 1HLGA 3O4VA 4RHUA 1A9RA 2VJBA 3NTRA 4FINA 4I6JA 1I3CA 1XXHB 1EVEA 2ZEJA 3O9VA 1THMA 2UU9B 1Q0LA 4S0ZA 3NHLA 4ZVNA 4LNUB 2DLCX 1ZDMA 3DWGA 3GLSA 5AI6A 2R7AA 3T7SA 5BSEA 1C3XA 2Q9CA 2OCIA 1TJNA 1TD1A 2HU7A 2RGBA 3R3JA 1US8A 2A0WA 1DVRA 4ZAXA 4B73A 1U9ZA 2VJOA 5I4IA 5LD2B 4Z0TA 2NZWA 3C6ZA 4ZCTA 4BLRA 7AT1A 5DF1A 3BQNB 5E9AA 3SHVA 4UPEA 1GPH1 2P4EA 3JZMA 4IFIA 3VXKA 3WK5A 1E2LA 4DWWA 4EY3A 1XYVA 2QE7D 3KKQA 4Z0NA 1Y4SA 1NYTA 4L02A 3GLIB 3C8ZA 1H4VB 5FV4A 2YRXA 4EK9A 2J67A 1RC1A 1VHLA 3AJ9A 1YQXA 2E1RA 3L06A 1SA0A 2FSFA 1Y7PA 5L9AA 2WHXA 5CLFA 4YAGA 3QEBZ 2NU7A 4J2OA 4BJ6A 1WY5A 2X9LA 3L07A 5EY5B 3WRXA 5AFSA 1JAIA 1ONBA 3AX6A 2XHEA 1X7YA 3EZ6A 3P2EA 4Q9AA 2VN8A 3RIMA 1KKLA 1G19A 3R0XA 3ZBPA 1T2EA 2CDRA 2B4QA 4CMEA 1OVMA 1QSGA 3AGQA 2W2QA 1SHLA 1YRHA 1Q1QA 2Q46A 4AL4A 3OE7A 5A3JA 2H92A 4RO0A 1EX6A 1WOMA 3A25A 3TK1A 4BZZA 3L6CA 4OLAA 4BNZA 4RVHA 1UPTA 2V45A 1MF7A 3NFYA 3OICA 4H0NA 4U0KA 5KX5A 1ZH2A 2VYFA 3E9DA 1T3ZA 2VSQA 3UPTA 4N39A 1CUHA 3U1TA 1C41A 3ZHYA 2WHPB 3ORSA 2C4UA 4Q47A 3D02A 3Q7SA 4ICIA 1RAEA 1NV8A 2P11A 1CRLA 1RZVA 3TL2A 4TWJA 3ZZ0A 4DM3A 4TMKA 3TQTA 2XUHA 5ALUA 2QM0A 4FYXA 4NE7A 5DM2A 5I9MA 5HNKA 2GNAA 2VJCA 1AOXA 4LOLA 4QXAA 4KJXA 4RXTA 5TARA 1YCGA 2HSGA 2JBWA 3N2YA 3URMA 4KC0A 2J0SA 3OH8A 4KRYA 3LE8A 1P9RA 1L5HB 3CF2A 1CB7A 3NC0C 1E2FA 2QQEA 2Z6VA 3IS3A 3CO0S 1AHPA 4P7GA 1KMCA 1WNFA 1QVAA 3N87A 2G7ZA 1V8DA 2OKCA 4ITUA 4YRRA 5E6RA 5BQOA 3D8BA 1ZJYA 3WXMA 4AP5A 2X22A 1A9SA 2GJ4A 2Q6VA 1IE3A 2H4ZA 3OT1A 2GKOA 4UEKA 4ZKDA 3JRXA 3R5KA 5TDHA 4OREX 1SXJC 1D2CA 1T5SA 3B6JA 3M4JA 4YMLA 4UDOA 2Z2XA 3QXCA 4QPNA 4WQMA 3EC2A 4ZAZA 3LRTA 2E1PA 2EU8A 1RSZA 3GRZA 4QXOA 1AQIA 1HE4A 3BXPA 3LQQA 4IS3A 4K05A 3N2GB 4G36A 1Z4MA 4JENA 4QRDA 4CV3A 3IP9A 1VYHA 2HCBA 2VKQA 4O0MA 4TS3A 3O0TA 2IKQA 2B1GA 1UBMS 3DOJA 3H1TA 3ET5A 2XUZA 2IK8A 4Q7JB 1ML4A 1TCAA 1DJLA 1KWGA 3LJKA 4II2A 2VS1A 2P2SA 1AA6A 4FXOA 4R83A 4AZTA 3L0YA 1VHWA 3WKDA 4BU1A 1UBRS 5HWSA 1LNSA 5HZHA 3MILA 4BN4A 4DWVA 3GPLA 2IW1A 3L4SO 5KVSA 4BEBA 4KFTA 3C14C 3OHMA 4ENSA 1HRKA 4G8BA 3M4YA 1OAOC 4RAOA 4WA7A 4O2AB 3H3JA 2Q29A 1W2HA 2E49A 2ZVPX 2D2EA 1R7RA 2FNAA 3JXEA 4HN2A 3BXOA 3WRYA 4DRXB 3H1GA 1T5IA 2FRVA 1G2IA 4RHFA 5B1SA 5KMGA 4PC2A 1ZHFA 3STTA 1JWAB 2IRWA 5JSQA 1I2DA 1U8CB 2QN1A 5FEMA 1O5IA 4FHEA 2EKQA 2A9RA 1WKCA 4J0EA 2WJIA 4LYEA 4LZLA 1W2WB 1ZBDA 1Z62A 4V2IA 3RFFA 1Y1LA 1G16A 2O0KA 4JJAA 4WBSA 3BHIA 2AKYA 3B9RA 2G82A 3W04A 4CE6A 5KKCA 3EHEA 2HL6A 2B2XA 3GRFA 3KEMA 2JK0A 4WFIA 3QIAA 3O21A 3IQEA 1ZQ9A 1YR8A 3HH8A 3Q12A 5D86A 4HXGA 2YN2A 2P9GA 4WOCA 1QDUA 3REOA 3TLXA 5B3KA 4UD2A 3QLVC 1FMLA 1R9NA 4Q93A 1KQPA 3W3ZB 2B34A 2YY7A 3MTJA 2NUPA 1FP4A 2WILA 4D81A 1GGFA 3NHUA 4LI0A 2V0CA 4G1MB 2QX7A 1MB3A 1NQ5A 4BRWA 3CIOA 4Q19A 2HJSA 2P7HA 1XL1A 1T6YA 4ZJYA 3TLKA 3TM4A 2Q6LA 3U4CA 1XF9A 2KLBA 4NWIA 1C14A 3VC7A 4BLUA 3ZJVA 4ISBA 1XNQB 1KEPA 2CXNA 4YA6A 5CVEA 3VU1A 5TS2A 4NXMB 3DDSA 4AUKA 1HY3A 3P71T 3INYA 5BMVA 3HB1A 5TSDA 1T8WA 1GILA 2LKDA 2XDQA 2R60A 3UGKA 4L9RA 3WE7A 5KTYA 4N5NA 3RS9A 3KL4A 4HQFA 4EH1A 1YV9A 1N2EA 1CQZA 4ESHA 2IH2A 1KFKB 1T3HA 2Y71A 3PVCA 3DMTA 2PRKA 4DV7B 1Q50A 1IJFA 4LV6A 1K6MA 1XALA 2FQXA 2QZSA 3MCUA 4ZYTA 1XRMA 2GBFA 3M6MD 4O08A 3QWBA 4PSDA 3WTBA 1TQ8A 2P6NA 2FRDA 4XM2A 1I30A 2ZYGA 1JTFA 3OQIA 4QM7A 3DFUA 2OUIA 4OP2A 4L3WA 3TB6A 4A8TA 4O4IA 2ADMA 4RIHA 2NYUA 2WWFA 3ZGVA 1OAAA 3N70A 4M37A 2B8EA 2ZJ2A 3ZKWB 3QRWA 4BQRA 1TKBA 4F9FA 2W2TA 5DEIA 2QG6A 5D5QA 4DCGA 3OJCA 3CX6A 4EGSA 3JQBA 3X0DA 1QONA 2J1LA 3ON5A 2PG3A 3CYFA 4LECA 1NPDA 2FGKA 4CDRA 1DHRA 1L4KA 2IYOA 3QZUA 3PPXA 4C4AA 2IYXA 4CU5A 5BN3A 4PANA 2GPYA 1DC6A 3VVMA 4XB1A 3I61A 3ZHXA 4N3BA 2GTPA 3O3MB 1KO1A 3QX7A 1OWMA 3HWWA 3OZVA 4KZKA 1FP7A 1E9RA 4JXJA 1WPQA 4JYPA 1JDNA 3KFLA 3LYLA 2KSQA 2VH1A 3UWMA 4CTMA 2Q50A 3PD7A 1LCIA 1NF3A 2JI9A 2NW6A 4A36A 3AKZA 4Z1MD 1HDIA 1WL8A 1BFKA 2ZAGA 4ENVA 5AVTA 3NYIA 2FVXA 4H4CA 1XRSB 4P34A 3QWAA 5DNDA 4D4HA 5AVRA 5IVKA 1C2TA 3BXFA 2OTCA 5FBHA 3L7KA 5JAPA 2A14A 4H18A 1JHVA 4UNIA 2W8ZA 2Z4RA 3F6SA 3M6VA 2CDNA 2MHCA 3QVLA 4CMHA 1K6EA 3DKVA 2CT8A 2VWGA 1E7MA 1XXLA 3OLCX 4XM1A 2A0YA 3PGKA 3E18A 1GPLA 5A0VA 1PFGA 7MHTA 1WSAA 1S6YA 4E33A 2V97A 1RRCA 3EF3A 4DJTA 1GFSA 1NY6A 5BRAA 3PU6A 5HKOA 1LU9A 1NQXA 1EB8A 2CL6X 1Z8DA 2MIIA 2W00A 1V43A 2XB9A 2XMQA 3EDMA 5FWDA 1P61B 2EJTA 4D6PA 4B34A 3IKTA 4DMLA 4D82A 4DNPA 5CA0B 3AO0B 5A4AA 3ELUA 1A7UA 3H8WA 4G1CA 4UXIA 2GHIA 2WIKA 1VE9A 2FPPA 4NARA 4RD0A 1K7YA 4KQ1A 2X9NA 3ZG6A 8ADHA 2H1RA 5EMHA 2OAEA 3PXAA 4W6QA 3ANSA 4J03A 2BBSA 1W76A 2XYGA 4DR6B 1VIVA 2HV8A 1NVGA 3T95A 4Q3KA 2D1RA 2PMBA 3HVIA 3ASYA 3DFFA 3DKIA 5F3WB 1PS8A 3HABA 4GOND 4AZWA 4F85A 1KJIA 1K2VN 5LU8A 4XSGA 1GKYA 1WBBA 3GUCA 3PS9A 1NRXA 4JGGA 5BNWA 3ELDA 4GXNA 4H7EA 1EE9A 1GGEA 3I64A 4FW8A 1S4QA 4I6EA 2B30A 4QRHA 1K63A 5B4TA 3ICQB 2YR0A 2A9QA 2ZIZA 2AUNA 4CM9A 2XWJI 1DAHA 5AVSA 4NMLA 1RWOA 3IPLA 2OV1A 1G4HA 4WBXC 3SM3A 1TKCA 2G09A 1T5BA 1UZLA 4EHFA 1VG9B 1RMTA 4D80A 2EBHX 4AF8A 2HDHA 4BTLA 5JSYA 3HBMA 3T5MA 3WKEA 4D45A 2BEVB 1IJBA 3AWIA 3LSYA 2E18A 1OTHA 2PD4A 1EM8B 3HL0A 5B3AA 3GBPA 2QN8A 3H9UA 4KXYA 3NHKA 3HVHA 1EU1A 4JIMA 3UMVA 3BWMA 2B1JA 2F1JA 1YJQA 3BWEA 4G56A 1BU5A 3F47A 3V8NA 1P2GA 1PF7E 3DEAA 1EA7A 4CR7A 3E8XA 3I01A 4UHBA 4KO3S 2L18A 4LJ9A 5KTTA 1Y9AA 3NOOA 4IKOA 5A2QA 1ZJ4A 1MEEA 3BSFA 1Z6YA 1RQ2A 3RJZA 1DEOA 6LDHA 4CKCB 5I7OA 3TF5A 4PLWA 4DDMA 1UADA 4ZAYA 5EIEA 1K3TA 4F4JA 2F6RA 4MIYA 5GONA 3E5HA 3RYHA 1YL5A 2PZFA 4B3GA 4X44A 2I2AA 1RAFA 4ZYVA 1TVMA 2E21A 5IM4A 1N2CA 2QX8A 4BCDA 3MNFA 4WKNA 2B3DA 4BX2A 2BFCA 3K1ZA 4PYMA 2ZBFA 4JI2B 1JPNA 3K94A 4HXEB 1GSIA 3BZUA 2H17A 2VZLA 3U3DA 1DMSA 4KE7A 5FNVF 3RK4A 3T12A 2WE8A 3U13A 4EHJA 4R8KA 3HYTA 2I2CA 2HADA 8GPBA 4FW9A 1D03A 2YXPX 2XRFA 1ZRMA 4WXRA 3B3QA 1U8UA 2DFLA 3OJ0A 2VF7A 3ZD9A 3DC7A 1E1MA 3WQBA 5FUMA 4AB1A 3CUTA 4ZHQB 1FRFS 3FHCB 2M6LA 4BBPA 3NH6A 3A1TA 1TYEB 4CEHB 2O6LA 4MYSA 1CUDA 1HDYA 1HEIA 4RA6B 5AH0A 2G9VA 2XBLA 4X91A 1TUEA 3ISJA 4DM7A 3LCJA 4HWSA 4ZVLA 4BVLA 3R40A 1PL7A 3ND9A 4N7JA 5LYJB 4IIGA 4FZVA 3E3OA 1G3IA 3SF8A 1D09A 2Z5FA 2Z95A 2XCOA 4HK4A 1KY2A 1JHYA 1YIOA 1OI7A 1U2DC 2RKBA 2UYOA 2HMAA 4M4SA 4PGFA 2PGOA 2Q5OA 4BO5A 2BUCA 3V1TC 4E46A 2ORYA 3H5RA 2GCEA 3EMKA 2VZ0A 2AJ8A 3GIWA 3MXTA 4YJ2A 1FXWA 1O6BA 3I5UA 1II8B 4HYEA 3WGQA 2ZJZA 4WJZA 3ACCA 3BX1A 4O25A 4ASUA 1GPNA 1J0CA 3ZW8A 2X4IA 1HYEA 5B6IA 1TLTA 3JQFC 4AJPA 1JAHA 2ZBEA 1RJWA 2DWQA 1E58A 4Q9LA 3ZE1B 1I32A 1MIHA 3HXPA 4QC2A 4RTKA 4XGIA 4GUDA 4MDHA 3IULA 2JJQA 3N3BC 3F9CA 5JRJA 2OCKA 2YZ2A 3K32A 5LZ7A 3TMKA 5E7JA 4UOQA 3WYNA 3NOVA 1O58A 1Y1SA 3ZLTA 1Y98A 4FONA 1RHQA 3LBYA 2AS0A 2V7QD 4YJFA 4BX9A 2ZWAA 5HA5A 4LFAB 3L0BA 5BV7A 3LWNA 1JKJA 1OPRA 2YHIA 2CYCA 1EDBA 4G2NA 4UEQA 5JAQA 4A0GA 3D43A 1L5KA 1PD0A 3MZ0A 4AICA 2HT1A 1KVTA 1LPAB 1PQPA 1OX4A 1Z5NA 3CA8A 3DL7A 3FJOA 1Z0IA 1T9GR 3FPFA 3GT0A 3LCCA 1ZUHA 2VPQA 3FHLA 4K86A 4HEA1 2FEXA 5LUBA 1HQCA 3DMHA 4JIGA 1RJDA 4M9XA 2JAPA 2RIRA 3ZEIA 4MW4A 2SKDA 3A0UA 2XZPA 1XP5A 4GL2A 2EZTA 3C1UA 2BT4A 2R62A 4BXOB 1Q11A 3SZRA 3PEYA 3B6MA 2BSAA 1M2HA 4R3UC 1LQTA 3A1FA 1W88B 3MRVA 4EG1A 4CLOB 1JQEA 2C97A 2JLUA 2FSVC 4YMHA 1O5OA 2O2DA 3JASB 4TYNA 5CFNA 5KCMA 1U0EA 1ZUNB 2AD5A 3IUNA 3JQ7A 4ITVA 1YDWA 2NTNA 2JDID 2XD9A 5K0FA 1FCJA 2VXOA 3OM9A 4BLTA 1ELOA 1YDEA 2EW1A 3RRJA 3ZV6A 4YMVA 5DM4A 2PD3A 4L75A 2OD9A 1HOTA 2QAGC 1KFEB 1MV5A 3F3KA 4ND1A 4YK7A 1TZCA 3VNSA 2WNHA 4G0QA 5AI0A 3ZQ6A 1F1BA 2C2YA 2AN3A 2ADOA 1E94E 2R8BA 2AK2A 2XVZA 3AIMA 5DVZA 1ODLA 2JAQA 1MNAA 3CR8A 1FFAA 1VPTA 4KNWA 4OBXA 3O8RA 4RW0A 1FFYA 4BO6A 2YDYA 1CVLA 2O3TA 2ZRCA 1J33A 1JE0A 1P6UA 4I99A 4WERA 1I0IA 5ER6A 1SCNE 2H4JA 5LKAA 5L4NA 2FN3A 4JR1A 4PRYA 5CJ2A 5HJ7A 3QXGA 4QICA 2O4UX 3ADDA 1CR2A 3WQHA 2C84A 3JWGA 2CLIB 2XMRA 3GFSA 3QY0A 3K0AB 3IB3A 3FYDA 3OBBA 3OT4A 3P2JA 2HXGA 1HZZA 3NR2A 2OE2A 4WNYA 1P4JA 3HB7A 1YR7A 3WZLA 1STOA 2G08A 2R1TA 2GUGA 4HWOA 4Q1BA 1GQOA 1XHLA 2X4DA 4Y6QA 2O3QA 2ERXA 5KS2A 1OI2A 4L74A 3UG6A 3VR0A 5L4SA 3DW3X 4JQOA 3QSGA 3S5JA 2AEFA 5BWLA 4PNHA 4NJEA 3HS3A 2B6NA 1X9HA 3PUVA 4F3CA 5BYBA 4ZMSA 3ZYCA 2VCEA 1CBUA 4PX5A 1JXAA 1Y3BE 5I7SA 3D0KA 3M82A 4EG0A 1LNQA 1YZGA 4PNPA 4RA9B 3H6GA 4AYTA 4YRZA 2YTZA 4ZICA 2OHGA 2O8EA 2A3RA 4HGZA 1DAOA 1KSFX 2YJTD 2V6JA 3PDWA 1IK6A 1OAKA 4MLZA 3LD9A 4WOBA 1DOHA 1GRRA 3AERA 5EWJA 5BT9A 3T1QA 5BVGA 2H2IA 1CJMA 2I7DA 3QKIA 3M3PA 3V9PA 1U4NA 2QPLA 4IIJF 3KB8A 3PRYA 4TLEA 4KIJA 2FKAA 1XKTA 2ZYAA 4JDPA 1TVEA 4DEVA 2QR2A 2Z3WA 1CZNA 1A2BA 5JSKA 1DXYA 2O3UA 3VNAA 5JS6A 3FFXA 2O7SA 4R2MA 3FVRA 4TMYA 4P2GA 3TS1A 1M75A 1GCUA 2AMFA 4JT4A 1SWWA 1G5QA 4MQ4A 1BCSB 4R9SA 3NG1A 4HNTA 2H9AA 3WNZA 1S3FA 3Q2IA 2PVCA 4ZOCA 3DD5A 4B33A 4XIFA 1BSVA 3TMAA 1Q0RA 1JZQA 1R12A 1V1RB 4GQAA 4NQZA 4O2BB 3P0JA 3RR2A 2C2KA 1FYDA 2HSDA 3IJRA 3RVOA 4U2EA 3D4PA 5BV8A 1GNRA 2P2DA 4J29A 3RTEA 3BB1A 2PRSA 3WIBA 2NSYA 4AQYB 1KKMA 2C3MA 3KTAB 5FBKA 2NTVA 3OOHA 2JIPA 2AOTB 3GD5A 5D01A 3ZE6A 4P8RA 4AYXA 5ELLA 2ZRIA 3TLGA 1KR5A 2HO4A 3N0XA 5C3UA 3TJZA 3TRKA 4CM6A 4OJQA 3HU5A 3MC1A 1SNYA 1J0EA 2CXRA 2VWQA 3HE3A 3PK0A 4ADSG 3L8GA 5HUJA 5IASA 2H7XA 3ETGA 5BYJA 3WGIA 3PNBA 1JT9A 2ODPA 2PMCA 3ZUPA 3IJ5A 2RK6A 2UYQA 3NHMA 5CBPA 4PRKA 5IWAB 3RBVA 1E2HA 3FFWA 2XT6A 4LF4B 1DU4A 1TFRA 2A5YB 2X7HA 2PHZA 4PQYA 4REMA 4BLSA 4C14A 4WOJA 2OCBA 2J9RA 3L5KA 3VSCA 2H2FA 5U1PA 1FTSA 2CFSA 1CR0A 4Y6LA 1MV8A 4YPVA 5HZGA 4A9AA 3HLYA 1GFIA 1LPNA 2HJ9A 4NI5A 4TWIA 5IKMA 1LVUA 2IIBA 1GTG1 2FEOA 2Q2NA 4JU8A 1WEKA 4BGUA 721PA 1VL6A 1W49A 4RNDB 4F1KA 4EI8A 3KQNA 2YMMA 1J90A 1SVKA 5KC8A 3E3AA 2WUGA 4KKXB 3OF3A 5LQMA 3OQBA 2IWRA 1DBRA 3AUJB 1NNEA 4G24A 3TVDA 3OQVA 3X1YA 4A26A 1HFEL 2FR0A 4WY5A 3CW2A 3DAHA 5EE3A 4RTPA 1UBUS 1TA9A 3PC7A 1L9KA 4RS4A 2RJNA 1Z28A 2DBYA 3AVOA 5J5CA 3W05A 1CRPA 2NWQA 4FS8A 3W7AA 5HM6A 5F1PA 3UGTA 2B37A 2WPNA 4ZO6A 5JCPA 4RGVA 5ECGC 4UE2A 1JJBA 4MVJI 1WXFA 1AXRA 1ESDA 4C9BA 1R6UA 4FS3A 5FPQA 5EZYA 1IM5A 3DYBA 2JVKA 2PKXA 1BN6A 1VLLA 4N0MA 4RC9A 1JEYB 4HVCA 4IHKA 2SKEA 4F46A 3LU1A 1UBCA 3PYXA 4RJ2A 2WWWA 1ZK4A 4ZVPA 2CSXA 1A9YA 4LYHA 1KDVA 5B5SA 1K8RA 3ZE0B 2VPWA 3G8YA 4PLPA 3N6XA 3TZEA 4TWZA 4B6QA 1NUPA 4QBHA 2HWXA 1UPUA 5EE1A 3UAZA 1N33B 3FVVA 5F5LA 2A0FA 3BMCB 3K8YA 4JQSA 1BU8A 1XJWA 4DR2B 3Q1LA 5I4CA 1XE3A 2O2SA 4PG5A 3RUCA 1AHHA 3GLGA 3ZBUA 3AEUA 3T0IA 5FLXA 1M1YA 3CGWA 2EHJA 2PGXA 2ODEA 3EEQA 3GLRA 1F8YA 1P7PA 2A5GA 1J20A 1S0UA 3D4LA 2TSYB 1EGQA 4GSYA 4A3SA 1Y3FE 5I7VA 3SC2A 1M5UA 4FEGA 1HFJA 2WUVA 2Y1DA 2W0MA 3ML1A 5DCYA 5LM3A 3EDQA 4HEHA 3IDQA 4QDZA 2YFKA 2B8TA 1Q0HA 1Y8QA 4MZDA 5E0KB 3ABQB 4LDNA 2BRUC 4H7KA 2NUAB 4G0PA 4L95C 3EUFA 4GOOD 1B8PA 1Y5NA 3TIXB 4H0CA 3ZLBA 2DTEA 4FIZA 4MPRA 4DZZA 4F0JA 4B3XA 1IQUA 5EXEA 2G28A 2OM2A 4QJIA 3RUPA 4OA5A 3BA1A 3E7XA 4IIUA 4CQMA 3G2HA 4KK3A 3SXUB 4LJSA 1C1XA 3H9GA 1QJ4A 2KI5A 3ZD8A 1PKXA 3VJLA 4KMOA 1XTIA 5KKAA 1AGRA 1XT6A 5IN4A 1PTJC 4DA7A 5JCZA 2BE9A 4RVCA 2JBAB 1WZ2A 3OIVA 1UXOA 3ZJ5A 5DIZA 4X8OA 1SCIA 3W8DA 1U1DA 2Y0BA 5FORA 4CV2A 3RYIB 1WW3A 4TXNA 1I2BA 1NOIA 2H9IA 2X5KO 3BK7A 2BGUA 1SXJA 5F1OA 2FV8A 5EG5A 4E4RA 3R0ZA 2W2KB 3QNUA 3FWZA 1Z68A 2N1BA 4QLBA 4B0PA 2NV0A 5CH8A 3AJDA 1R1DA 2EKZA 3MYYA 3H8SA 2W8BB 3WBBA 4BFSA 3WB9A 1J7KA 4ZI7B 2WJJA 2WYOA 1BWPA 4ZI7F 3CW9A 4E5SA 3MGCA 2H16A 5CNMA 4MS1B 1HQKA 3VZPA 1L5QA 2JGDA 3DDOA 5CFRA 4RWZA 4DZRA 2EFYA 1FLDA 2NXNA 1RYNA 2FUKA 2OQ2A 3S1LA 2BBTA 2QZ9A 1FNBA 3GFRA 2AJCA 4B3JA 4KWCA 1V8OA 1EVYA 1X7XB 2F3UA 1EX1A 2WZCA 4GVXA 5C52B 1UAAA 4BRSA 2WJWA 3OFNA 1IUNA 1OBHA 5DTMA 2FEMA 2Y4NA 4Y1EA 4B3FX 4MKFA 1QH0A 2Y0CA 3MTGA 3N05A 4PYQA 5A3RA 1ZGCA 1KOGA 4LE2A 2IHJA 1RXYA 2C42A 3I04M 1A9PA 5LMUB 4JYZA 3AFIA 5L3QB 3EA0A 3PHCA 4FMPA 2QUIA 1ESCA 4IOKA 4BJ1A 1Z7WA 3CONA 4PLCA 2R6DA 4YLGA 1S3GA 3F3YA 1NT4A 5KYUA 2M32A 3TR0A 5SYAA 2QMHA 1LDEA 3BRWD 3K09C 3OQHA 3PC4A 1KYZA 3PI6A 4J7CA 3H1AA 5DJ5A 3L8ZA 4GKAA 4TS1A 3A3NA 4BP9A 3WLRA 5JWRA 3H11B 1J2JA 3IR7A 4JT8A 5EOVA 3E8MA 4P38A 3F6YA 4Z4QA 3DHYA 5FQNA 1JHPA 4OGFA 3VU9B 1PLJA 2HLPA 4TM8A 2NPIA 3QLVA 4ZMRA 4QNRA 4C21A 4KXQA 3A9TA 1XMPA 4AUEA 4LZNA 1FU8A 1MO4A 5FI5A 5IBQA 4G07A 1P2DA 3K70D 3B78A 1VJ1A 3RS5A 1A97A 2VDOB 4JB0A 4JI6B 2QTVB 1N9GA 3IPCA 5FOQA 3UK2A 5KJ1A 1AV7A 1Z6TA 4O4JB 4YXFA 2YWDA 1N9ZA 1PG0A 1UFVA 5G1OA 2ICAA 4LWPA 4O4JF 4URWR 3FI9A 5E2AA 3F4BA 4GPZA 3B9PA 1UM8A 2IYFA 3WGZA 2I4LA 3G49A 4N7BA 1J70A 4YJGB 3STVA 5SY9A 3UMRA 4KNYA 4ZCRA 1QF7A 2FHPA 1RJEA 2VYND 4HQLA 2RSLA 4IIDA 1SURA 1YBFA 2PXAA 2WAXA 4RCZA 1XIVA 4B85A 1GNTA 5TPZD 3ZNOA 1C3OB 3KPUA 4DB4A 3LY5A 4IQ0A 1YRYE 4ARSA 4AZ0A 2B94A 3L40A 1VJDA 3GEMA 4MW2A 3RKSA 3U3JA 5CB0A 3HLKA 2EKDA 2GD2A 4MVJA 3SYRA 4IV5A 1I5EA 2MSKA 1NZDA 2YCLA 3QPAA 1Y9JA 5AUPB 1GHTA 2H11A 3GVPA 3KVYA 4FBGA 4M7OA 4CG3A 3R6LA 5AIBA 1IN1A 1MHPA 4JL5A 5A1TA 1IM2A 1IXRC 4J4BA 3RM3A 4FI3C 3PFWO 2AMJA 4R2XA 4IFTA 1OXTA 3C43A 5T4BA 3DE6X 4RX1A 3X1KA 3OETA 1WB4A 2HJRA 1V4BA 3ESCA 4KQGA 3VOBA 5AR1A 1Q95A 3DHWC 4Q9DA 4BASA 4KIGA 4A8HA 4AX8A 2ZQZA 3ZWQA 3EMBA 4G4JA 1E6UA 2C9MA 4ZANA 2NZVG 5KYYB 3SFVA 2H54A 4B3SB 5KJCA 4DQLA 2PWPA 4FYKA 3ONFA 1JPJA 3MWEA 1I14A 1Y1KE 4DYDA 4C3OB 5GVRA 1HNZB 5HF9A 1I0ZA 4TTAA 1NVFA 1CSEE 1PL8A 3HUUA 1LSUA 2X58A 3WLQA 4FGJA 4DDVA 2Z2ZA 3DDWA 2H5IA 1T29A 2O7VA 1M2VA 3BWVA 4TTRA 3ABOB 2CJWA 5CR9A 1VE6A 1KQ3A 2VT3A 3LVBA 4HUTA 3EQ7A 4CKBB 1FNMA 1ZD1A 1DKNA 2EBUA 3ZX5A 1OIXA 1MT3A 3KFXA 3KWMA 1RYZA 1K98A 2QTRA 5TQ0B 2DHCA 4BCCA 4ENTA 5JRDS 4B8ZA 2VDKB 3KHKA 4RF2A 2C4TA 4QGHA 2QHXA 3E53A 2G70A 4FDTA 4OCZA 1DC3A 1Z4KA 2GXUA 1ZC4A 1EXMA 4RACA 3JTEA 2Z2JA 3H9EO 3NAMA 2IYQA 3PGA1 3JX9A 4OH1A 2XH8A 2P67A 3TSZA 4C07A 4ER7A 1D2EA 3SFTA 1AKVA 2JJMA 3G17A 1ZXBA 3ANXA 4QO7A 3D31A 4FR5A 4HDRB 2JB9A 4J07A 4EQZA 1E4OA 1FMCA 2ILTA 5H0IA 3STWA 4ETWA 2JCVA 5CH3A 1NXTA 2Q3DA 2YV1A 4FEEA 4WN9B 1NIJA 3QQ5A 2C4NA 3T3IA 3G5TA 4RH1A 4L22A 3OKAA 3W3AA 5ENVA 2WFMA 3T6KA 4MLCA 4DUPA 5AVVA 5DGHA 1XP8A 3P0EA 4TZ0A 3E22B 3IUJA 3HGQA 4MYTA 2CLLB 2HCRA 5HUHA 4P5EA 2NU6B 2OB1A 3ICWA 4NATA 5K51A 4QOIA 3SIPA 1XZ8A 3DB1A 3I9NA 2P0YA 1BKDR 3QOYA 3ESRA 4LJRA 3MOGA 1EFCA 1W52X 3DWFA 3DXXA 3U31A 3VPFA 3WMRA 2BTEA 5AKKA 2WP8J 3U5ZB 1SCAA 3L8FA 4EG5A 5AI8A 3QPUA 4DR5B 4ZEWA 2RONA 3VTZA 3QSYA 4PFSA 2VNJA 1SD5A 1FSZA 3SE7A 4R2IA 3ZVRA 2YV5A 3Q8XB 1CS0A 1MABA 3NUGA 4C7JA 1CNFA 3H4VA 3KYIB 1EVZA 4IOMA 4LVCA 4CL8A 4ZOQI 5AM3A 2PFSA 3FCOA 2R84A 1ZIDA 1RKVA 2I2DA 3ZWPA 2Q5JA 4FFDA 3K2BA 4PGHA 3TE7A 1KI2A 2LP4Y 4TLLB 5LIPA 4AF6A 1C4KA 2A0UA 1L7AA 1ZSNA 5LZ8A 1PFYA 4RY8A 1E9VA 3ZGXA 5JAIA 2ECKA 2PANA 4RVNA 3AVVA 3SQNA 4L78A 2NZ2A 2CGEA 3BMQB 3O2JA 3WKBA 1DC5A 4ZRDA 2FDXA 1MR3F 4WY2A 1E77A 1NWHA 2B3TA 1XZFA 1VIAA 3KXIA 3MJHA 4RY0A 3ETJA 1EFRA 3M70A 3K0CC 3QXJA 2O23A 5FAKA 4TYMA 4BC1A 4JUBA 3NOXA 2XZDA 1PJ8A 3BGSA 1J2TA 5I4BA 1XBTA 2ZUBA 2WKRA 4UBMA 1HSOA 2GASA 3ESZA 4MV3A 2H06A 5AVWA 4K87A 4ARVA 2B5WA 1Z18A 1CUGA 3F98A 3LTEA 4PSVA 1KGDA 2IEBA 3GDHA 4P3OA 4HQKA 4KRGA 4IHJA 4Y2UA 2AOXA 4YLYA 4P2BA 5TMBA 4MH0R 2EERA 4M8LA 5KQLA 5CEEA 2QTGA 3AJEA 4PE5B 3WL6A 2GK3A 4BVHA 3CF6R 4HRXA 1YCHA 4D41A 1QCDA 4OHZA 3LDUA 5AK5A 2FP4A 2YZNA 2LIPA 4BVAA 3PVZA 4QPCA 4YJHA 2V1UA 1KL7A 3L84A 4HGNA 1XZKA 3GAZA 4MWTA 5HIIA 4EW1A 3MCVA 1UXKA 2CHUA 4YRCA 3ZHQA 3HXKA 5G0UA 4W1SA 3E6AA 5IDYA 1VE7A 4C2TA 3O7MA 4FUTA 1ODKA 1T36B 4XX0A 4C0KA 1FNNA 4OX9Y 1BROA 4X66B 4JLOA 1W9HA 1QGOA 2AE2A 2G1AA 1V2GA 3NJ4A 1SZDA 1PSWA 1ZGGA 4A8PA 1UEXC 2F1RA 2HCJB 3EA4A 3ZUGA 1I2CA 4NENA 5I9SA 4EWLA 4QTUB 3NBYC 4JEHA 1QH1A 2DERA 1U3UA 4AU1A 1U2DA 1H2RS 1P39A 1YKFA 1XTVA 1TJPB 1R8XA 1N2GA 3L46A 3NVAA 2I3DA 1Z3IX 4DCVA 3SVLA 5PGMA 3L1IA 4A91A 2QN7A 4JJGA 5EESA 3RV4A 4JA0A 3C7AA 2JAWA 2UKDA 2X0IA 3RO7A 1QBGA 3ENKA 2OV4A 3PJRA 1J97A 3JQFA 4UBLA 3ITKA 4GC5A 4Q66C 3HB5X 1WCIB 4B83A 4BO4A 5I8PA 3BIOA 4H0FA 1NF2A 3FNFA 4GAEA 4QL3A 2ZANA 4Y67A 1ZESA 2H5EA 2OHHA 4AIRA 3QOFA 1PT9A 4DYVA 1G1MA 5EUCA 1YS2X 2NAFA 2HEGA 4TUYA 4AMUA 1GXSA 4ZXPA 3LGSA 3F0TA 4MW7A 5FX2A 1WNTA 1AHNA 2QYOA 3M1IA 5AKHA 3KPYA 2QIOA 1ACJA 1WTCA 3I9KA 3VM6A 3ETDA 3ROGA 3KLOA 1IY8A 1U2EA 1FS5A 3EZ7A 3PKIA 1IHUA 3PUYA 2DPLA 2SCUA 3NEYA 3HY4A 2P8JA 1NHGA 3TX6A 3TG2A 2YC4C 2F3TA 1P81A 2XTJA 1YA6A 2DE0X 2R8PA 5K2OA 3N0RA 1JA1A 3HA5A 3HA2A 1SAYA 3HZRA 5IFLA 2WJPA 2NVBA 4G1VA 3CLRD 5DSZA 4RQUA 2CMDA 2HIMA 4YP5A 2FW7A 3FAZA 4P80A 3VTAA 1ZLXA 2RJ3A 1WXHA 1L4EA 3HJNA 3EPHA 1VKJA 4H16A 2D5AA 2PZBA 1PV1A 3IDZA 4TQ9A 1M6WA 4XQCA 5C4GB 4DEXA 3GDFA 2ZS8A 4CTNA 4HP8A 3BF8A 4PSCA 3ROXA 1BMTA 4OQNA 5EEHA 4GR5A 2F7SA 5FBZA 2R48A 2ECPA 3Q5EA 2HU5A 4RH3A 5ESDA 2ZTHA 1F2UA 4PBTA 5ADUS 5C8YB 4GC9A 4HQ0A 5IAKA 3M7IA 3UJAA 5JLJA 2EAUA 3C24A 4NMWA 3UXHA 3F2VA 4WZBE 2FSVA 2PRYA 4BFUA 3O84A 2JLSA 3Q15C 1QCCA 1JR4A 1K7XB 1XCGB 3EXFA 4WFKA 3N0WA 1A5SB 1DQNA 2WYHA 3CPSA 4G63A 5SZHB 3VU8A 4RTSA 3KZNA 4HC4A 1TK3A 4NAVA 3V9AA 5IAEA 3A6LA 1G8SA 3BA6A 3UTDA 2QAGA 5L45A 4Z7QB 1N2JA 3SSAA 3B3JA 5C8DA 3OZTA 1JFSA 1FUKA 1G63A 3O95A 4LHWA 4U7GA 3NDIA 1EFTA 4ZCIA 2JRLA 1BE0A 5HMMA 3VHQA 1THGA 2H00A 5ECWA 3TB4A 4EL5A 1RQGA 3ZDAA 4G0UA 4N41A 1G0OA 3X1WA 4N8EA 2Q07A 3NKVA 3T38A 3CUUA 4PS1A 4CXMA 1J8DA 2ZCUA 2Y6VA 2G77B 2GXSA 2A1UA 4A5SA 1VLVA 3QELA 2VYNA 4GOJA 1P4HA 1MKYA 3PUKA 1BVRA 1D3AA 2I80A 3N59A 4FGKA 1OYWA 4IO0A 3ID6C 4MULA 4MV5A 1XTRA 2BELA 3P9KA 3RUIA 3BWYA 1KRHA 4ITRC 1JLMA 4N40A 3IOMA 3DC2A 4H08A 4KAXA 4PZDA 4JJEA 1UJ2A 2QV7A 4G5HA 2E7ZA 2CL7X 3IE2A 3NOQA 3QITA 3G0DA 4HDNB 1MHTA 1BD4A 1VPWA 4PLTA 2IA5A 5SICE 4GOXA 1UMCB 3CT6A 4Y30A 3TQIA 4BKOA 5KYKA 4CQLA 4FE7A 1P7ZA 5LL6P 2WMDA 3QVWA 4JXXA 3OPMA 1UQRA 3Q40A 1OGJA 1DIAA 4I14A 3HI6A 3UAVA 1XU7A 3NETA 1TMKA 2ES4A 2H2GA 1E4EB 4HZUB 2IOHA 2XY4A 4PZ9A 3C5WP 4YJ3B 4XPZA 5JE8A 4C30A 4I66A 4MWGA 1PR5A 3ORFA 4KQIA 4WZBB 2XKJE 4Y6SA 1IUPA 2WOJA 4OMCA 5ALDA 2VC2B 1AQJA 1WETA 1E7QA 4RSGA 1UBHS 5H68A 4S0XA 2FZCA 2BKEA 3HPQA 4K88A 4C5CA 1X1AA 4XB6B 4NVRA 1FVFA 4OTZA 4RL4A 1PI3A 1IULA 3GLQA 5CJJA 2WAMA 4F38A 2F9MA 1DXHA 1Y5MA 3IMEA 5ADWA 1WBDA 1OE0A 1AN0A 1LBTA 4P4SB 3GA0A 1VA5A 5IUJC 3SZUA 4UCFA 1R5BA 2GZHA 2QX6A 2X9GA 3KOYA 1ZM2A 3IP5A 1TMOA 1XPJA 5A4FS 4JLAA 3TUIC 3FPGA 4MGIR 2FWRA 3AF0A 3KQWA 4YHBA 1E2JA 2UDPA 4NZYA 3T3MB 1A1VA 1EFHA 2WHRA 5A0FA 2WRZA 5I7FA 4XRGA 1C9JA 1L5MA 3GJRA 3RVLA 3FRHA 4FR2A 3B85A 3UUWA 5A3SA 2XMDA 4NAUA 3SOPA 2UUCB 3KZ1E 4NZPA 4A6EA 5CG1A 2PRIA 3N3AC 3Q3EA 2PQ2A 3DLHA 4RFSB 4ZALA 1C30A 3U3MA 1E7SA 2VNKA 1CULC 2C8KA 4EW6A 4U3JA 5EXPA 4C7MA 3QVGA 4Q0MA 1H1LB 1RRPA 1M6HA 1XQVA 2JKVA 5IARA 1N36B 1K86A 4MRSA 7YASA 5FOWA 2H65A 5CVCA 2Y0PA 4Q6BA 2F8TA 5T4FA 2XNKA 3EWIA 4L7VA 2O14A 1V5GA 2RFLA 3DULA 5D5HA 3K9BA 5E1BA 4GRAA 4H7JA 1U5BA 1PEDA 5CCXA 3L8YA 4EKGA 4LVNA 4MMYB 4DTCA 3ZW7A 3E84A 3UANA 2WZQA 2F17A 2JW5A 3OZ7A 1R37A 3QEJA 4ZRMA 3TXAA 1J25A 1U94A 3EJWA 4FOSA 5A4DA 1U2QA 1AB5A 2NV2B 4R1UA 1CQWA 3P0FA 3H87A 4JJ8A 1YT5A 2QDXA 1W4RA 5CX1A 2O8CB 3FIJA 4DLLA 2FPRA 2H07A 4B43A 1QQ5A 3R7SA 3UMCA 4B32A 5F98A 4EUFA 5K0EA 2Z4TA 2PD6A 3V3TA 1N0UA 3AXTA 3N39C 3R6TA 4UHHA 4UMEA 1R6AA 3KRTA 3IBFA 4ZYXA 1XHEA 3JSXA 1Y37A 4L27A 4ZU3A 4EGJA 1Z7BA 1C9EA 4PX9A 1VB5A 2SKCA 3TRFA 2XWPA 4M9ZA 4E5MA 1WZUA 2X1MA 2D13A 3ONNA 1GA6A 1BGWA 1RI3A 2XR1A 3A3OA 4FOOA 4P7JA 3RLIA 3WGYA 2DR3A 3KB2A 4BQEA 4ENWA 2FFQA 4GUAA 4IVNA 1CLEA 3PXEA 3PUXA 2Q1WA 3WLTA 3FTDA 4CCSA 2WJGA 2NGRA 2VWPA 3GN2A 3NEJA 1XHFA 4MW6A 4X1KA 3BIJA 4C05A 4ACBA 5EHZA 4ZQBA 2Q0XA 2RK4A 3BGIA 3RWMB 2VG8A 2PEZA 3KIPA 4GH5A 4MKRA 4OK5A 5GV7A 5JXJA 3TUZC 1ZJ6A 1UXGA 4XCVA 3VZDA 2M6KA 4Y2HA 2C78A 3PB3A 3PTAA 1AN9A 1U2TA 4LBYA 4WV3A 5JZMA 3QVTA 1FC0A 2D0OB 3U0VA 5EJ2A 4EAQA 1JP7A 2X9VA 4FEAA 2WU8A 1PLKA 3NM4A 4HSEA 3RRMA 4DKXA 4FYVA 3R77A 1OILA 1YVDA 2AEMA 3C41J 3OE4A 2XOKD 1RWNA 1UEJA 2X4LA 2WTNA 1ZCFA 2ZAMA 1EJ2A 1N5RA 2XEDA 2ZI7A 3CLUC 4HGPA 4OKSA 2GPAA 4RQAA 4E15A 3NW9A 4ALNA 2L19A 4UCQA 1DCFA 2VDRB 4JITA 3USES 4MUEA 3IVMA 3QMVA 4L9WA 1ZN8A 5FPKA 1RYYA 1ADYA 3G13A 1E32A 1UKVY 1LRKA 1LLQA 3KQQA 4C1BA 2HOQA 1IONA 4D42A 2BRUA 2VP0A 5A62A 5HJ2A 4WK4B 3UTCA 3VZCA 5EHQA 1U7HA 3VU0A 4F3KA 1TT7A 6REQB 4Q3DA 3KSAC 4JI1B 3S1AA 1U28C 3WGHA 5DI3B 1B43A 3FPLA 1PVOA 4AP9A 3L9XA 2WOOA 4H35A 2IH4A 5K4GA 5LQRA 1N0HA 3L8MA 3ZK8A 4F5EA 1VL8A 4JR2A 4YUWA 1Z37A 1B76A 1PTJA 1E2MA 1F0YA 1PR3A 4FSHA 3LC2O 2JLYA 4V1CA 1ONPA 3GNLA 2JFBA 3HKDB 1OFTA 5DI9A 4Z0PA 3KT3A 1LBSA 2V5UA 2BSXA 1NRJB 1FBNA 4BWFB 1UKEA 3D8TA 4XWKA 1FMTA 3A6HA 5BUCA 3NHPA 2PGJA 1O97C 1EZZA 2VPYA 3K9LA 1B42A 1E3TA 2QG4A 3FOBA 2WJYA 2YZ7A 3V4VB 2QUBA 5DGTA 2MOKA 3SYTA 5KSWB 2WWYA 3K5PA 1TM3E 4RM2A 4W9RA 1KIAA 3MUNA 3O8OB 4FFWA 1TXGA 3D3EA 4M1WA 3UJHA 5T7BA 1GYRA 4X92A 3V8MA 1RCUA 3EULA 2PPVA 4EATA 1JIQA 1NTOA 1YGPA 2ONZA 2ZI4A 3MWJA 1JT2A 1B73A 4MQLA 2ODQA 4ZQGA 1YONA 1ADGA 3A3YA 3WP0A 4DEYA 3I37X 2WF5A 1U7OA 2JLCA 3HXMA 1ZMXA 2YMLA 3DOIA 2W83A 1TQHA 3L8CA 2NVWA 1J09A 3DMNA 4XUGB 3U7HB 3BK2A 3L0ZA 4PFKA 1JR6A 1V7CA 3LF2A 3V80A 2R6AA 3WS7A 4HYQA 1PT7A 1NVKA 3HDVA 4EELA 4JKIA 4IRMA 4NLLA 4OHXA 3W2FA 1P0FA 1SKBA 4OJNA 3OZFA 3VKWA 4DLBA 2VT6A 2ZROA 2LBPA 4HVTA 4F4DA 3JS5A 2DC1A 5AXAA 3SYKA 1OLSA 4I1YA 4R2WA 4EX7A 5JC1A 1U1GA 2YHAA 2B2CA 2CJXA 2PT7A 1HG1A 2PLNA 1L8LA 3BH7A 3K09A 1GUZA 5EN4A 4PGMA 4TWBA 1Q17A 2J4CA 4HO1X 3TZHA 4KQJA 3WWZA 2JFPA 4I55F 1WDKA 3M4XA 2H2WA 4DV3B 1U81A 1SBYA 3FNBA 1Y9DA 1VP3A 1D4ZA 3QF4B 2BISA 2CFIA 1H85A 3ADOA 4NULA 4MPJA 4R9RA 5ADVA 3WWDA 5K8TA 2FUG1 3CLVA 1Q3TA 3PJEA 3OMWA 5TQVA 3ZWYA 3BJMA 4FOLA 4Q15A 2PSFA 2GF2A 3A05A 4E09A 2H59A 1IZYA 1I51A 3GHHA 3OX2A 5CA1F 4AM8A 2Q8QA 1NULA 4IUBS 3ZQ4A 3W2HA 3TEMA 3RRNA 4CZ2A 1SQ6A 4MAMA 1DCKA 2PMKA 1ZN9A 3ZU3A 1B0PA 2V3WA 2XCTB 1O3YA 1Z08A 1Z3CA 2BR3A 2FGJA 3LQFA 1OZ0A 1VKZA 2F2TA 1Z2EA 2ONCA 1JQKA 1SHZA 4P98A 1PJ3A 4TM7A 3G6KA 3HCPA 3OPYB 4YALA 2DPMA 3UUFA 4N7MA 2H7VA 3IURA 3IAXA 4A10A 5JZBA 5EMMA 3ZU4A 5J43A 1K5PA 3N1UA 1CCWA 1LDNA 1R6BX 3IOCA 2JLVA 5AHWA 3W8FA 3SLKA 1SOUA 1MVOA 5A3VA 3MJRA 2GCNA 3C4VA 1ISHA 3HC7A 4KL8S 1IVYA 3CLKA 5B1YA 5DNYB 5JQGB 4JXZA 3ANTA 2VAXA 2SNIE 2D2FA 1QRAA 3EY9A 3THXA 5U4XA 3P20A 4ZO7A 4TVSA 4DA4A 2BGJA 3RVDA 3GROA 4H6VA 2ZREA 5CLLA 5KREA 4KSYA 2NQTA 1EFPA 1U0FA 4NHEA 3K0KA 1JBKA 4NBKA 1EDOA 3UV7A 2YHBA 3KJNA 3I04A 3W5VA 1DBPA 3ZHVA 1IN8A 3B53X 1BYUA 3ND5A 2K2WA 3EXEB 5HIMA 3RU3A 1RT9A 3K53A 3EC1A 4GYYA 3U4IA 1S3SA 2DJIA 2ENUA 4HDQB 5DHQA 1QV9A 3B7GA 3GJ8A 3RRYA 4L72A 1U2GC 1CY4A 3VDMA 4FYMA 5DSXA 1JXQA 4B3IA 4EJ2A 3DZHA 4L8GA 4C4YA 1Y3AA 3JWEA 4DV6B 1V9CA 1XJQA 2Z9BA 4BQIA 1A2KC 4EX6A 2PX5A 3J7TA 4IDHA 4X9XA 2G04A 3H5OA 3OEHA 4HBZA 4F6LA 1CERA 1I3KA 2W6NA 1MGPA 3D6MA 2IXBA 2JHAA 3DO8A 3K20A 4X6YA 3UH1A 3OD1A 4EF6A 4F04A 4F4HA 2WINI 4DLYA 1HSZA 2G6BA 2XUAA 3TTYA 1WD5A 2ALJA 2EYUA 2Z8XA 4HFRA 4LV5B 2PKQP 4NBTA 4Z2AA 2DTDA 2P9HA 2JL1A 3EVNA 3FCYA 1D1SA 1XN4A 3NGXA 2PCLA 4RHEA 2G3YA 3AI7A 3O1IC 1VP9A 4NBUA 5L3ZA 3AG5A 4FN4A 1HDGO 1NMQA 4DSNA 3RVBA 1NBHA 1OWOA 2ERCA 1C1HA 2HPVA 3CLTC 3EXHB 1TRHA 3B5JA 4RPJA 3E70C 1OMOA 4PN7A 5JZSA 1QMPA 2M9MA 3PKJA 3Q5DA 2Q1YA 5EJFA 3TSAA 3V2GA 1WU8A 3PWSA 5H82A 3L8HA 4BHTA 3DR3A 5JY1A 3AR3A 2AG6A 1MZPA 2HQSA 4EHIA 2Q5IA 2QENA 1BDIA 4GMGA 3G9TA 3K1JA 2Q3CA 4EI2A 2RIPA 4BUCA 3ZZUA 2EDAA 4Y2TA 2YIMA 3T9AA 1VMDA 4YP9A 1ZP6A 2D06A 4PRZA 5CDSA 1UFOA 2JJ8A 2W7TA 4Q3BA 2IV2X 1DLJA 2IC5A 4HAIA 4F2PA 3FDJA 4DUGA 5LVAA 3KD3A 2GAIA 3KR1A 4JXKA 5ISMA 3PEWA 3NIDB 4YCAA 4YTEA 1TQ2A 1X8JA 3GJ6A 4E4YA 4U2CA 2ZJ7A 1D6NA 2OY0A 3VHRA 2PAFA 5TJ9A 1L8XA 3BM5A 2FQYA 4D0NA 4DA0A 4F97A 1P7WA 2QGZA 4RY9A 3WB1A 3BVPA 4GSKA 4Q4HA 1RR6A 1Y6RA 4U9HS 4E30A 2I8LA 4MQFB 4NZZA 1TAQA 1Z6PA 3A31A 4G3XA 4GBED 1IQRA 2PM8A 5EWMB 4CI0B 4NCAA 2W6MA 2X0JA 3IUMA 3HDGA 1O89A 4Q4AA 3FPSA 5EGNA 1KAEA 4OV6B 4OBEA 4FMDF 1W85A 1R18A 2A86A 3DP7A 5FJJA 3A1NA 5LP6F 3KBOA 5TEVA 2WD8A 3F7OA 2EBFX 4AY6A 3HMQA 1QP4A 3DNMA 2CXOA 5CB4A 3A6FA 3JZDA 2I76A 1GZUA 1XVIA 2P3SA 1B23P 5IUNC 3B3AA 3HCDA 2BBWA 1JPUA 3WYAA 4BMCA 3HO1A 1T8UA 4M36A 3QFCA 2LCQA 4PF1A 1ENPA 4EA9A 1CTQA 5CM2Z 2ZJOA 1JDUA 1NBMD 2JGJA 4HNGA 4PIPA 3VZRA 4RK7A 3MSCA 5G0WA 4KWHA 2RI0A 3FN4A 5FBLB 2Q7DA 1P3JA 5DE3A 5J2UA 1QHIA 1KDOA 1ACMA 1PDWA 4EABA 3T7RA 4EG8A 1AKNA 1XEWY 2QVYX 3AF5A 5JSFA 4YP7A 3VDRA 2V7WA 1K97A 4REQA 2ZYIA 3AVYA 1A9XB 4KGXA 5LQUA 3BTOA 3OFKA 4AJNA 2WMYA 2XOKA 5K6RA 1N3IA 1F06A 1W8IA 2VHVA 2H4HA 4LYAA 3QPCA 4B4VA 3E4CA 1A4XA 1WU7A 3A4MA 4M54A 4B6SA 1JBQA 3DXYA 4XQ9A 4QNMA 4ER3A 5BN4A 3GLFA 1QPBA 3QWFA 4M0PA 3CSUA 4UHKA 2CNNA 5LSAA 4URXR 3WYCA 1M6NA 3ETLA 5JS2A 2GD6A 5BURA 1MMFB 2BI8A 2IPMA 2FN9A 2WZBA 3ICEA 4ZT2A 2GBCA 4IIXA 5TIIA 5DMHA 2BEKA 4X6XA 4ZD6A 5E6SA 1LW7A 3B89A 4REOA 4M1SA 4M6WB 1T91A 2X19A 3MOIA 3WNQA 2OVFA 4IWNA 2PJRA 2VJNA 1TCVA 4OM7A 3WDSA 4D4LA 3ENQA 3TECE 5EUBA 1DJNA 4OB6A 1COZA 4Z1OA 4YCDA 1AGPA 4FB4A 1JUDA 3EXG2 3RI3A 1M3SA 1VYVA 3C85A 1Q74A 3H2ZA 1DP4A 2D3TA 4M1QA 2FJUA 1KYQA 2O0HA 4F45A 1WBJB 2GO7A 2PGDA 2G1JA 3QWIA 2NPFA 2TMDA 4G25A 1AKQA 3LRXA 3TIGA 3OTGA 3OQNA 5C34B 3HNOA 3T9FA 5KDDA 2WNIA 2ZIGA 5MFZA 1T4CA 2RAPA 3HJAA 2EGGA 3DTYA 3CNOA 4FNMA 5HK8A 5B30A 2OXFA 4UCWA 2ODNA 2JF0A 4NG4A 4E2XA 3B8EA 3F6PA 1NJ8A 2X0FA 1UDAA 1XUOA 2OT3B 3OLZA 4KVZA 1ULSA 4UUAA 1P75A 3BH6A 1W2GA 2LXNA 1C9MA 3L3BA 2IBSA 4K9DA 4G1EB 1RHUA 2JZOA 5FWYB 1CUYA 1W36C 4EPXA 2G5CA 4MS4B 3RG8A 2PKQO 4IDFA 4YRNA 2LGJA 3JQGB 1D6JA 3DCJA 2VAPA 3NXSA 4OSEA 5L3VA 4BDTA 1HKUA 1GVNB 1OH5A 2HMTA 3W5CA 3MUFA 1PNTA 1ESNA 1M2GA 2QD3A 3FSJX 1YZHA 1KFBB 4R54A 4S1OA 2BTQA 1MOSA 2G80A 2PQ0A 2B1IA 3A36A 2OB2A 3DZFA 3P19A 4NEHB 4YR9A 4FFNA 4FT4A 3FRJA 4UHDA 5CVJA 1X94A 1C0EA 2G63A 3SNKA 5LN1A 2GSWA 3BQMB 1OB2A 1Y3CE 1XAIA 4QREA 3LKDA 1XQXA 5BNTA 2QM3A 1EZ4A 3H2YA 4RY2A 4IMRA 3VPAA 3WO1A 4DMGA 9GPBA 3G9QA 2Q6TA 4AZVA 5JJBA 4WLEA 1T35A 3F73A 2YW2A 2PT9A 2IYZA 3LHSA 5A7HA 2YHUA 3LQ4A 4S1NA 2VEDA 3AHEA 1Y63A 4HQNA 821PA 2FDCA 1IAQA 3ZDBA 4J49A 4YAWA 1R0CA 4GT1A 3ZK9A 4NCBA 1ZITA 2IXGA 4UVGA 4EG6A 4WUTA 1K75A 5EKUA 4DUYB 2QNBA 4U7TB 4FHFA 1UK9A 5IHXA 2J7KA 1OBFO 3L8EA 4FR0A 5IABA 2FPMA 4BPBA 2BMFA 4HX5A 1X7YB 1TUBA 1A9ZA 3DD1A 1W0CA 3ORRA 5THQA 1EK0A 1HE5A 1I2AA 4IXNA 2PX4A 2QF7A 2YBDA 2GTHA 3AHIA 1JRLA 3O8QA 3PHLA 4OGKA 4ZAVA 4H59A 1BQ4A 4C89A 4EJSC 2WG2A 3FGPA 4A4DA 4HS4A 5CW2A 3AR6A 3F8WA 2IITA 3ANYB 5IBCA 1M8KA 2FSUA 1YVRA 2DKNA 3NTXA 4NCXA 4QNNA 5IANA 1H2AS 4EGQA 5KX5F 2HHJA 2IXDA 5FB3A 1NQOA 1TM7E 2HBQA 1OJ7A 3AP3A 4GF5A 1T3SA 4HH3C 4I1OA 3N2NA 1GPYA 3L02A 3QKSA 4J2TA 2HTFA 1IPEA 2CHVA 4R8LA 4N6GA 1XRQA 1Z34A 3K15A 3ETHA 3VH1A 3UAOA 3JWIA 3REQB 2FMXA 3KPJA 3AG6A 4BECA 4GQBA 1KQNA 5BY2A 1UDXA 1RQRA 4KFSA 1CQIB 3E2PA 3L05A 3JD4A 1MIOA 2A9KA 2CNLA 3EVCA 1XF1A 1BRTA 2CV2A 1EP1B 3AP1A 3VDQA 2IXTA 4QBFA 1ODSA 1RC0A 3IIKA 4C76A 4DPKA 2MCFA 1QR2A 2H2DA 2Y1XA 3I4LA 2O5VA 3H1PA 4QEDA 1OFGA 3DT9A 2BHTA 4MQEA 2XCQA 3OZSA 1SVWA 3ROQA 1SOVA 3R3XA 1WMAA 3L0PA 4OQYA 4YDSA 3EGCA 5ENDA 4ZCPA 4LS3A 4H3SA 5T4HA 4DV2B 4NRDA 4CV0A 2MYPA 5D5PA 2WW8A 2YOGA 2ID9A 1TKAA 1W6UA 2L17A 1G7TA 4IEEA 4INAA 4QOJA 5B37A 2R9VA 3ISTA 4DY4A 1CR4A 2HRRA 3UHPA 2XMGA 3A1SA 3UJCA 4QPDA 1TECE 3L7MA 4PZUA 2VZ8A 1PV2A 1LV8A 4QDOA 3OZIA 3TIVA 3TQRA 1M7BA 1CW2B 2OR3A 2Q3HA 1IEXA 1SKUA 3B7WA 4U7JA 1QDEA 2BH9A 4ZGGA 1J8FA 4C4XA 3PEVA 4JUDX 3RKUA 3GFVA 4FFVA 2WIAA 3HJHA 2IZZA 2Y9PB 3N2ZB 1DJQA 4EG3A 4X5OA 2M2IA 3G7SA 4O8CA 4D5EA 2BFDA 4DARA 3F67A 5F9HA 4AAYA 3UFXB 3GLVA 5K0TA 5EFOA 5T6MA 2PQMA 4J7AA 5I47A 1EUQA 2YVAA 4KE8A 4ML3A 2O8BA 4BKUA 2GBLC 4MHSA 5JSZA 2HIAA 2ZRHA 3U09A 2E9SA 3P2YA 2QM8A 5D8DA 4D9KA 1DV2A 1PGPA 3SBEA 4DCSA 4FYYA 1QO7A 3CF4G 3MB5A 2GJKA 2ZBQA 5IT9A 4H1TA 5JPDA 4V03A 5LA6A 5J5AA 4FX2A 1C7FA 1SXGA 2IW3A 2DYKA 2V4ZA 2P40A 3OTHA 1CDOA 4FJ0A 5I8WA 1G20E 2NU8B 2ZCJA 5E3HA 1QV6A 1VJ5A 3E3NA 1A5TA 1PUXA 1BMFD 4CUJA 1V1MA 3LBAA 3NO4A 2AI1A 1SULA 1ULHA 4FM9A 3RIEA 2ZRFA 4XJSA 3E8SA 3QXXA 1LTQA 2NUPB 4JX9A 4MDEA 1TTPB 4F21A 4FLMA 4PHHA 1ZH8A 1BRMA 1YR3A 2GZSA 4NBRA 1PD1A 2CVPA 2OD7A 3W06A 1BOOA 3MLBA 1PJSA 2HO5A 3TEJA 4X93A 2B36A 3ND6A 4J0KA 1WVGA 4YPFA 1LS6A 3V4PB 4X20B 1DCMA 4UPDA 1L7PA 2FLWA 3M33A 3R24A 3CE9A 1S2LA 2ZBDA 1M1NB 1BHQ1 3QI2A 5BMVF 4IKEA 5JXGA 3PQ2A 4OK3A 1QU2A 5CW1A 3QPWA 1R4ZA 1WPRA 5BW6B 1EXDA 1O95D 1PAUA 2C98A 2OQRA 3I2KA 5CVVA 1AV6A 3TOSA 1CUUA 3NJRA 3IMGA 3HYSA 3ONDA 1N9KA 1Z2DA 4N4AA 2X6RA 3X1DA 1RPNA 3ROMA 4KPEC 3PYLA 1SIOA 3HI4A 1D7AA 3OQIB 2FCRA 3WGMA 4E51A 4O4IF 2CMHA 5JVDB 4HH4A 4N3CA 4RV5A 1KK0A 1NF8A 3GDGA 3Q87B 1PG2A 1P1BA 5I6DA 5HF5A 3TQFA 4QFDA 4HXFB 2B8WA 1QQBA 2GWRA 1BA2A 4WCFC 2P6UA 1NYLA 1VZ3A 1G20B 1NRWA 3OCVA 4KI0A 5BN3B 3TR5A 5AM4A 1X7GA 5FWXA 3C6XA 2C9ZA 1H69A 1L0BA 3G5MA 5FYQA 4WLOA 4B09A 3TLZA 3H5WA 2YV4A 5JXIA 1Z75A 2IQIA 3IEPA 3COWA 2YS7A 4HD8A 3IGFA 1F38A 1XDWA 4QX6A 4X7MA 1RC8A 1M2EA 4LHZA 1PYOA 5KNCA 1I9CA 2OM6A 4KTTE 1VBMA 2XHZA 4BNUA 5LNK1 1JIIA 4OX9B 1JDZA 3S68A 1WWKA 4QVIA 2ASVA 3H2SA 1D9ZA 3U4QA 2QJWA 5LBTA 4EJ0A 2SBTA 1GIAA 4IXTA 3SHTA 5SYNA 4N0EA 1SB8A 2BGNA 4MA4A 2WV9A 3FLMA 4EFKA 3VNUA 4U8HA 1YL6A 2Q9UA 1B2LA 1U28A 4NU8X 4JCCA 2FQQA 2B98A 1X8XA 1SXPA 1LSSA 2VUHB 3AEZA 3FR8A 3EVDA 1S5PA 4ER6A 2R6CA 2XDAA 1WMBA 2Y92A 3IQFA 2MR6A 4RPLA 3X3HA 2G7MC 2X8BA 3B1JA 4Y0AA 1SD2A 1Z6AA 2O3SA 4KYIB 4EFMA 1WMFA 2MYUA 1Q6ZA 2FA9A 2ODWA 4K9MA 3GUHA 4Y1RB 4ZT3A 4DNXA 5KTPA 1M5RA 1FNSA 2Q7XA 4XYBA 4XTCS 4AJ4A 2P62A 2Q28A 2BCEA 2AWOA 5TEWA 3CZ4A 3EGDA 3VDNB 2I99A 5B55A 1GN8A 3W5IA 2WKSA 3U9SA 1N6IA 3M9WA 4LNAA 3OZDA 1E20A 3B38A 1JYSA 2AIRA 2P0AA 3GZNB 3IUPA 3QBJA 1SWVA 3R41A 1BW9B 4K3UA 3T5GA 4FKZA 5E9QA 2WHYA 1NBWB 1L4LA 1YZFA 1SK8A 3Q10A 2QVXX 4M1TA 1AB6A 3OZWA 3P2OA 1SVMA 2IZ7A 2AOUA 3CURA 3QW4B 3QYFA 2F4VB 2MWMA 1UC9A 3HDQA 4PC1A 1SHTX 1UPFA 1PL0A 2EJBA 1T9AA 2NYRA 1MO2A 1W36D 3BFXA 3UVEA 1Z74A 2DQSA 4HVLA 1KNQA 4N65A 3RU9A 4QULA 4EY6A 3KLBA 3MWDA 1WUTA 3AYZB 1QVWA 1FQKA 2OVBA 3GGSA 4CVNA 4CWAA 1E6CA 2AH5A 3IR6A 1RRMA 3GCGA 3IV6A 1N3YA 3LX5A 5DISB 3GNSA 5IKOA 3SEFA 2UZ1A 2CVFA 3A28A 3OAAD 1YJBA 4PAQA 1PW5A 1CXZA 1RKBA 2AN5A 1XDZA 4JH0A 4O1IA 4PYNA 5SZJA 3IQHX 1TU4A 2VK1A 3FM9A 3EMDA 4B3HA 1FSFA 4QODA 4BWVA 2D8MA 1AKWA 2DUUA 2P77A 3BE8A 1XL0A 2D0DA 5JBQA 5KYXA 2XCLA 4BVFA 1J56A 3PENA 2WYUA 1JIUA 4ND5A 4F3RA 1KTVA 2HK9A 4R1NA 3THYB 1EX7A 2A84A 5C18A 2H6EA 1P2UA 2VQDA 3R7BA 3F90A 2D1TA 2AQ8A 1TX4B 1TYDE 4NZMA 1M0SA 3DUFA 3ZTYA 1VI2A 4IJVA 1M7HA 2VRCD 4NIMA 5GONF 2VBIA 1PNOA 1AU9A 1NMSA 1YZNA 4FCWA 3QLTA 3U81A 1DKLA 1RQNA 5IM4F 4BE7B 2XBMA 2PA3A 3HDHA 3VR5H 2NO6A 2Y8EA 2YVUA 2QMOA 1NW9B 3VYRB 1L4BA 4E1VA 1E60A 4ZZIA 4KCGA 3B13B 1JKFA 3SSNA 3T7CA 5IF9A 3KXDA 2QR3A 4L4UA 2GMWA 5FV7A 1GT91 2IYPA 2WUEA 4J91A 4L0DA 4BO0A 3ZDEA 4OQXA 1E2NA 3SX4A 4P54A 1K4YA 4K46A 4JJFA 2HI0A 1SC9A 2J5BA 5AKZA 5K45A 1BE1A 3N75A 2AQKA 2YUIA 4OJTA 3RQIA 1OYOA 4KWEA 3L49A 1VE3A 2A78A 4R5HA 2X3YA 2OOKA 1FW6A 2FLVA 1EG2A 3O4RA 2GT1A 3HKCB 1OFVA 4F2WA 5JEDA 1UT8A 3BT7A 2GR9A 2IU6A 1NQAO 1SG9A 2W90A 3SF8B 1KWKA 1J24A 3SBDA 5JMOA 1U8YA 4RMIA 4C3ZA 1KDYA 1J42A 3R3YA 4XVCA 3L41A 5FNVA 1H94A 2TMYA 3MGAA 1S9DA 4NFHA 1DIBA 3RTGA 2NTEA 3OIUA 2G9NA 5K7SA 1F9EA 3JVEA 3L7AA 3RUEA 1HK7A 1TJ5A 1EJ0A 5I01A 1LQ2A 2E89A 3MBOA 4WXMA 4YJ2F 3CWZA 3P9ZA 1UL1X 3NIGB 2AOWA 5GVSA 1A72A 2WTUA 3N7AA 4KAFA 2H1FA 4I19A 4TV8A 4TSFD 4CKWA 3QG1A 1Q0TA 4Q3CA 3RFTA 5H3LA 5FR1A 4QWWA 2NUTA 3K5HA 2OHVA 4YRQA 1U2GA 3G2PA 1P5FA 3KXLA 4KUGA 4P82A 4Q18A 5LLSA 4E7PA 4DT1A 1NL3A 2I34A 4IDPA 4N7RA 1NI4B 1UJ5A 5BRNA 5DK6A 4LY9A 1EEXB 1GAEO 3RAGA 1KH1A 3JAWA 5FPHA 3D6JA 3OUZA 4YJFB 1Q1AA 4L4YA 3M3DA 3VR5D 1U2SA 2RB5A 5CVTA 1GGKA 2CXUA 1UK8A 3ZVNA 4E2WA 1O1YA 3GQVA 3LAWA 1KMQA 4X41A 2FXVA 4JSTA 1JEOA 1U0HC 3TLEA 3VHXA 2E4ZA 1BQ3A 4TZ6A 5HGXA 4XARA 4HNUA 4PBRA 4EZBA 4EHKA 5HKBA 3GG2A 3KHSA 3QHQA 1IUOA 3IVGA 2XQGA 3L7DA 4IZOA 4Z53A 2Y68A 1AJEA 4PYJA 1QE0A 2FPOA 1L7DA 4LDZA 2WU3A 4R0NA 4V0NA 2H0RA 4MUBA 3TXYA 3FDIA 4NE9A 4X1IB 1X8KA 4IDDA 3G1TA 4V1CI 1BMFA 3CVXA 1FDTA 4D3ZA 2X86A 2BGIA 1M7GA 2Y0EA 3MG9A 4UU1A 5BRJA 1VGVA 1WG8A 2ZWVA 1GQ2A 5TMEA 2CV0A 5FHRA 1DPFA 4ZVTA 3A6KA 1R0YA 3T1OA 2HWYA 3JQ7B 3KAJA 3O9MA 5JYDA 3AB8A 1G7SA 3U7QA 4UD6A 5BWNA 2QVLA 5FADA 1H6DA 2CVOA 3VPCA 4FUQA 4D0GA 5GMOA 2C1ZA 3PICA 2VP4A 2QUKA 3DV0A 2VYVA 1JQAA 1BJTA 5IWCA 4Y3UA 3BB4A 2FWMX 3K71B 4DR7B 2Q3LA 2ID4A 2V6GA 3EIFA 1E0JA 5CFLA 2V6FA 2FMTA 4NP6A 4NZOA 4CLRB 1JIVA 1GPWB 3K2QA 1JH9A 5EVCA 3NTLA 1ETUA 4UUOA 1GRNA 4ZHSA 1B1CA 4K5QA 4WINA 4C4RA 4TXMA 2PZKA 4W7IA 3NVDA 1GKLA 2I7XA 3L18A 4LQCA 4MKGA 2DBQA 2LVBA 3KEGA 4MV6A 4R31A 1T5HX 2ZW9A 1L1EA 3VO9A 1U4OA 1E64A 3T3PB 3MHTA 3DBRA 3NTVA 3W8NA 3SX0A 3T3DA 1QUFA 4PO8A 1GGNA 4BX0A 1T1RA 5BW8A 3I30X 2AFIE 1E1CB 4L4XA 2VSFA 1DARA 4UM5A 5JG7A 5LXTA 1CUSA 4J90A 1DIGA 5EIBD 5JSUA 5J2TF 1M34A 1P19A 3A1UA 4HWTA 3OPNA 5HQ3A 5LR6A 2L0XA 3O5AA 4ID3A 1G8MA 4PIMA 5YASA 3ULKA 5B7QA 2XRZA 4NCIA 1T3TA 5LYJF 1DINA 1II9A 5H5JA 3ERCA 3MCZA 1YMVA 4IINA 2NIPA 4KXMA 1DTWA 1M66A 2JEZA 2P9JA 4F91B 1RACA 3HCFA 3AVXA 4HJXA 3SIWA 4J0CA 2AW3A 4GOLD 5JS8A 1UUFA 3EZNA 1RCFA 1NKSA 1WDWB 4H7DA 3CEJA 4Q1AA 2J59A 2XCUA 3DBLB 3M6AA 4A7PA 5EWJB 3T0GA 3TTTA 1LNZA 3GGGA 3IEUA 5JRZA 5DT2A 4BE4A 3NRBA 1S8FA 5JO9A 2YN0A 2HJGA 2IUYA 2QLTA 3T3HA 2Q9BA 3GNQA 1PVDA 2CB0A 2PUWA 1COWD 5A6SB 4QELA 4PZCA 1B6RA 1ISGA 4C4PA 3HR8A 1J2EA 5KVQA 5LJIA 1G1AA 2DFKB 4J4TA 2H4YA 5CDGA 4IXWA 1DAGA 4HBGA 1QGZA 3DMYA 1RS0A 2QXUA 4E2YA 4ZAWA 1JA0A 1KVRA 2P5SA 4FGLA 2IE8A 4JLUA 2IHYA 2G4LA 1VYUA 4WNAB 1CP3A 2CD7A 1NBOA 2EV9A 1DAPA 3VR3D 5LMCA 2GLXA 1WD7A 2RC6A 1QB7A 2BHSA 1GQFA 3E9YA 3KK0A 1T4BA 4V3CA 1I0LA 3TSYA 1NR7A 1E7YA 4RFLA 1Q44A 3H3XA 5DRYA 2OFOA 3BOSA 5HZMA 2XGSA 3I6IA 5BV1A 3LUHA 2AFIB 3TVYA 4MITA 1TRKA 4BLOA 1VHQA 5C1DA 3PIIA 4EEZA 4Z4IA 1NXWA 3R5HA 3WLPA 4FB5A 4YT2A 2O7QA 1J22A 2Z04A 3DOCA 4US2R 1E3SA 5FEUA 2ZB7A 3TIIA 3K0SA 1IAVA 3U62A 2A4MA 2E87A 4EUHA 5IXYA 2I8AA 1G18A 2ZBPA 5CBPB 5JY6A 1L5WA 2C9DA 1MAVA 4YP6A 2WIDA 4KR9A 3WMGA 1WZEA 3V32A 1Z8HA 4QUIA 4LHYA 2D3WA 3OSUA 1JFFB 4D98A 3O47A 1TT5B 3QUSA 4ZT5A 2J41A 3M5DA 1UZNA 4DLRA 4DHWA 5TVKA 2EKLA 3OFSA 4EFDA 1AT1A 1VJCA 2RGEA 2JC3A 1Z2OX 1QQAA 4JFRA 1H2BA 1S2MA 1ISPA 1UKZA 5SV2A 2W6CX 3EQ9A 1FFDA 1QG2A 2DFVA 2PS0A 2LCIA 3ILXA 3ZHOA 4XWGA 4GSLA 3QA3E 1TA0A 5ALKA 1SBCA 4PZ0A 4IGKA 3VTFA 3EPLA 3DOUA 5AD1A 4KDEA 2JGMA 1YJ5A 5DGCA 5EGSA 2G88A 1TMYA 1B26A 3TI7A 3THRA 1VYTA 5JS1A 1FJHA 4AK9A 3SQOA 1SR8A 3OO0A 1P9OA 1U3FA 3TTWA 4AZ3A 4CEIA 1R0ZA 1R66A 2C7QA 3D7KA 3CX3A 2DR2A 2XNSA 3TINA 4ABYA 3RHFA 2FPSA 3DZGA 3OJEA 4IDOA 3DSRA 2QPAA 4IUDS 2BFBA 3PJFA 2XCRB 2GEDA 2WSBA 3HPRA 3HP4A 3IDFA 4QHSA 3HDYA 1ZR4A 4V0MA 1HNNA 4GP9A 5FTKA 5C7OO 4UASA 3EFOB 1SBNE 5F33A 4LJKA 3PPVA 5E1OA 5EZYB 1SQ0A 2HB6A 2IQ5A 1H2FA 1PQUA 1T6ZA 2RHGB 3D9QX 1EGMB 2I33A 3BIWA 4FD3A 4HTFA 2IU4A 4V0QA 5EZYF 4NC9A 2DH5A 2LUOA 4FVTA 1FF9A 3H2HA 2JCSA 1GKIA 4HAYA 3PXBA 3PD1A 5A03A 1IBLB 2W2MA 1U7UA 1U63A 4RZIA 3VPSA 1W87A 4RULA 5F2OA 1Z4OA 2IYRA 2QU8A 3MOSA 4UMVA 3S2IA 5LPNA 2ZTMA 4S12A 3SQLA 5IZCA 4EJSA 5J1TB 2R7NA 2UUBB 3WI7A 1M6VB 4OFXA 2I5PO 4AJEA 2ESRA 3F46A 4ER0A 5TS3A 6GPBA 3USZA 3KKZA 3Q41A 4DCCA 3W5DA 4RVOA 3LY7A 3JQQA 1HYHA 3O7WA 3SC2B