2PGAA

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with inhibitor and phosphate and potassium ion at 1.74 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray Structure of the Uridine Phosphorylase From SALMONELLA TYPHIMURIUM in Complex with Inhibitor and Phosphate and Potassium Ion at 1.74 A Resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 88
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2007-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pgaA00
1JDSA 4TTIA 4L6IA 1M73E 1OV6A 1TGVA 3NM4A 4P54A 1YQQA 4QAQA 1JDUA 2B94A 4WKCA 4GKAA 3EUEA 5K1ZA 1RXYA 3EUFA 4NS1A 1YR3A 1T8RA 2AI1A 5C80A 4LKRA 4QATA 4DA7A 4YNBA 5EPUA 4OGLA 1Y6QA 4E1VA 1Y1QA 3UAYA 5CCDA 3GGSA 3OZCA 4WKBA 3KVRA 1OUMA 4ECEA 2Q7OE 4QFBA 2A0YA 1LV8A 2XRFA 5F7XA 4F3CA 4WKNA 1A9PA 1OU4A 1RCTE 5F7OA 1V41E 4YJKA 3P0EA 1ULBA 1VHWA 1Y1TA 3KVVA 1NC3A 1TGYA 4DABA 4PR3A 4TS3A 1SD2A 1ZOSA 3FB1A 3EMVA 1PKEA 1V4NA 5F7ZA 1JE1A 2BSXA 3FOWA 3OZDA 3LA8A 4LNHA 3UT6A 1A9SA 1A9RA 2OXFA 4DA8A 5IFKA 1RR6A 1OTYA 1RXCA 2QTGA 4F2PA 3IOMA 2H8GA 1K3FA 3PNSA 1Z5OA 1CG6A 1PR2A 2QDKA 1V45E 4L5YA 1U1EA 1V3QE 2A0WA 4D9HA 3E9RA 3NBQA 1Q1GA 1YBFA 4H1TA 4X24A 1RYZA 3T94A 3BJEA 3F8WA 1G2OA 4JOSA 1Z37A 3PHBE 1VFNA 1YQUA 1SD1A 1I80A 3OZBA 3OOHA 1K27A 4L5CA 4DARA 5EUBA 1XE3A 4TXMA 3KHSA 4PNPA 4EARA 1TCUA 1TCVA 4WKPA 1U1GA 5CXSA 4GMHA 1JP7A 2ISCA 1A9TA 3ODGA 1V48A 4TYMA 5F7JA 4F1WA 3EEIA 1WTAA 1ODJA 4LDNA 4M3NA 1LVUA 1CB0A 4GLFA 4R2XA 2PGAA 5CXQA 3OOEA 3ENZA 4OGKA 1LX7A 3UAZA 5JPCA 4MCIA 2QSUA 3IEXA 3DJFA 1JPVA 3DPSA 1ODLA 4D98A 1Y1SA 3INYA 1JDVA 4K6OA 2QPLA 4MARA 3FWPA 3O4VA 4DAOA 1Z5PA 4D8YA 2RJ3A 1PK7A 3NM5A 2QTTA 1PR0A 4NY1A 1JDTA 2IQ5A 1RXSA 3BGSA 4DANA 1V2HE 1NC1A 4NSNA 2ON6A 3OCCA 1N3IA 1PWYE 5I3CA 4JWTA 4DAEA 2A8YA 4KN5A 3ONVA 3OZEA 1ULAA 4R31A 1YRYE 2HRDA 1ZL2A 1VHJA 1PR1A 2HN9A 3FNQA 1A9OA 3K8QA 4TTAA 4RJ2A 4OEHA 4L0MA 1JYSA 1C3XA 4YMLA 3E0QA 3UAXA 1Y1RA 4TS9A 4BMZA 3DP9A 3PNPA 3DF9A 4EB8A 3BSFA 4UC0A 3O6VA 4OJTA 5B7QA 2I4TA 1OTXA 1PR4A 1RSZA 3LBAA 5ETJA 4LNAA 2AC7A 1SQ6A 4YO8A 3LGSA 1Z34A 5EFOA 3KVYA 2I8AA 4DA0A 4BMXA 4I2VA 1Z36A 4JP5A 4OF4A 5B7PA 2GUWA 2HWUA 3UAWA 1ODIA 1RT9A 4QASA 1SJ9A 1B8NA 2OC4A 1PBNA 3K8OE 4QEZA 1ODKA 1Z39A 4WKOA 2AI3A 4LZWA 1K9SA 1PK9A 2P4SA 3GB9A 4IP0A 3DDOA 3NM6B 3OF3A 5F73A 1JE0A 5KB3A 1U1DA 1RXUA 1T8SA 1ECPA 5CYFA 3PHCA 3P0FA 5F78A 4QARA 5DK6A 4TXNA 3KU4A 1T0UA 4TXLA 4TTJA 3UAVA 1QE5A 1VMKA 3MMSA 3QPBA 1Z5NA 1PR6A 3OPVA 1TD1A 4F3KA 5IU6A 1U1FA 4G8JA 1Y6RA 1Z35A 1FXUA 1T8YA 4L5AA 4BMYA 1T8WA 3KUKA 2OC9A 5F76A 1JDZA 3FUCA 3BL6A 4U2KA 3TL6A 4TXHA 5FAKA 1NW4A 1Z38A 4R2WA 4OY3A 3MB8A 3U40A 4D8VA 1PF7E 5B7GA 2AI2A 4MCHA 3E9ZA 4M7WA 4DA6A 1OVGA 5CCEA 3C74A 4M1EA 3SCZA 2A0XA 1A69A 5F77A 1Z33A 4TXJA 1PR5A 5B7NA 4BN0A 5CYGA 1PW7A 4G89A 4FFSA 2HSWA 3FAZA 1A9QA 1RFGE 3D1VA 1B8OA 4GLJA 1U1CA 4D8XA 4G41A 4F2WA 2OECA
chains in the Genus database with same CATH superfamily
1L5OA 1KZHA 4H7HA 1E3TA 2P77A 1VLHA 2Y67A 4FOPA 2JG3A 4UBOA 4F11A 3I1JA 1CZKA 4D0LB 4BRZA 1V1MA 2CL6X 3HYTA 3KFVA 1AK1A 3L49A 4IJ5A 2IEDA 1L8XA 1VIAA 1H5QA 3U81A 1D7AA 3D43A 1W5SA 1BFKA 1T4DA 2X13A 4QGSA 4NS1A 4L95C 4NMHA 4XGNA 2X7HA 3T5MA 6CHYA 2O3QA 5I9NA 3QI2A 5LQAA 1PJ8A 3FFTA 5AJYA 1E3JA 4FBLA 2AI1A 2BTQB 2NU8A 2Q9UA 4YDQA 4P4SA 2QENA 4B75A 4FLEA 2ZI6A 2FU5C 4QL3A 4IIHA 2YWXA 2JVIA 5IWAB 1NYTA 1H3NA 1Y1QA 2B25A 4CM6A 3HJRA 3OQOA 4D0NA 3LUCA 4KO3S 4IIFA 5IXSA 2W71A 2WWFA 5G3ZA 1MB4A 4QLBA 5JQGB 3DG9A 4DBVO 5JTTA 2YFHA 3S3TA 1JQLB 4ZI7A 3TDKA 4C4SA 1TX4B 1ZKDA 3SNHA 3WJAA 3TG8A 2BEVA 3V2IA 1B74A 3F6CA 4FD3A 1X9IA 1VSVA 5DXAA 4LY0A 4X90A 4P0QB 2PUHA 3SZ3A 4IDBA 3S44A 2P91A 2LCIA 1KZ1A 4HX2A 1NFFA 1RJ9A 1A72A 1XMOB 2UV8A 1RCTE 3HABA 3VDQA 4KQHA 4Q4CA 1YRBA 2JK0A 3A1WA 5C7IO 1WW8A 2RGXA 2NSYA 2VPIA 2WYOA 4ZT2A 3K1AB 4BNZA 2QEQA 4GQIA 3ZK7A 1YZTA 3T1OA 5CLQA 4LWZA 2OG1A 3KVVA 3WB1A 5AXBA 1B2RA 1PQWA 2P5SA 3OSZA 4BKOA 3SXUB 1C3OA 3OE4A 1GCGA 3RUFA 5KI6A 4DMGA 2M2IA 2A9VA 3IC5A 4J8PA 5AIAA 5JI2E 1QIEA 5B30A 2J4FA 1U90A 1ZD2P 2XNSA 3KQOA 4Q4DA 3TD2A 3T3HA 4L2IB 4W5NA 4DKXA 1Z18A 4R6XA 4PFJA 3G79A 3DR5A 5GV8A 2G80A 5B12A 3JQFC 4OV6B 3AQIA 2Q49A 2ZAMA 3DJYA 3PWSA 3EZLA 3GFQA 4BO5A 2VNSA 4DL9A 4B3TB 1PT9A 4AJ1A 2I4IA 1K4MA 1TZCA 3V8VA 4ASUD 2NIPA 1QS0A 3AL2A 1AQYA 4RSHA 1A9RA 3EZXA 2TMDA 1OBOA 3NGLA 2WIJA 3PB3A 3L4BC 1E20A 4FM9A 3N1UA 2PR7A 2AZDA 2AXNA 2GYYA 4BMVA 4B3JA 1NMZA 2XWBF 4G5HA 4PVDA 1JIQA 5A7GA 4MLPA 5FTLA 1RR6A 1WWKA 1ZIOA 3HEBA 4ZRDA 3ZJ5A 4JI2B 1CUDA 1PEKE 1II9A 1UJ2A 1RXCA 2QTGA 4XPZA 5JE8A 3PNKA 4FGWA 3IT0A 3O8NA 3QMMA 2I91A 3DO8A 4QYSA 4NATA 1G98A 2N0SA 3N59A 4R69A 3URMA 3L7AA 2B7BA 2VZ8A 1GNPA 1RAHA 1L5HB 2NLOA 6NULA 5KYVA 5ALVA 2QL6A 5LYJB 1V3QE 1EGMB 3GAMA 1A7KA 4G5FA 4B9EA 1N2CE 2CLCX 3SEAA 2DBVO 2VNKA 4IIVA 5IXYA 1M6NA 1R4ZA 2R97A 3AFOA 3B6EA 1GJRA 1Y98A 2CUZA 3O26A 4QTZA 5B3JA 2P4EA 2EBHX 3A6EA 5ALXA 3BMQA 4B3SB 3LGAA 1ZN2A 1UUFA 5JYBA 1Z68A 2JJQA 4GOXA 4QHSA 1QTIA 2VTKA 4BNNA 4CDMA 1SHUX 4TOIA 2GWHA 3UQYS 4RVUA 4F84A 1J70A 5I7RA 2VJLA 1DADA 2X9QA 1G2OA 4NZ9A 2RAFA 4MUAA 1PK8A 4AUEA 5KVQA 1L5QA 3IDSA 2G72A 4CM4A 2E48A 3T5GA 1YR9A 5KNDH 1I9GA 4J9UE 1NRJB 1B4DA 3BBPA 2A86A 1MABB 1L7RA 2B8TA 3D3WA 3HZRA 4X1KA 3OP1A 2WC1A 5LOVA 2G8NA 2PFGA 3SYMA 2A94A 2C8VA 2XGGA 3ZNQA 4AF7A 1BYUA 3SPXA 1NVXQ 3TLBA 3WWCA 4EHKA 5FO1A 1ESCA 4CGZA 3AM1A 1ZA1A 1M2VA 1QLWA 5C46F 3GLGE 3MLEA 4CLRA 1GGNA 5DBOA 3WNBA 3QW2A 4YJFB 1J8MF 3ASVA 4IHJA 4WKPA 3KR2A 2Z2YA 4FDLA 2HWWA 4ZYVA 4KYVA 4LW8A 3MERA 2FZCA 1RKBA 4F2GA 1H22A 4G5OA 3AFNA 1SCQA 1FPMA 1P4JA 3IR6A 5C0OE 4Z9FA 4ZGBA 1Y6FA 3TQFA 2IXAA 1QHFA 2BV3A 2M1XA 3JVIA 2PU5A 1KKLA 2VKQA 3OIGA 1Y4ZA 1SY7A 1PFUA 3QVSA 4P3KA 3E22A 1NPYA 2L17A 3UJHA 1GFZA 4MWDA 4PZAA 2OE2A 2HSGA 1PJRA 2QRNA 3EOAI 3K05A 1PQ4A 3KQVA 1K7EB 3L3BA 1ZU5A 1JIJA 2UVPA 2HK7A 3OIUA 1FFBA 4RJIA 3RSCA 3UJ8A 2JBAA 1RPTA 3H2JA 3C97A 4PLFA 3E9QA 5FI3A 1VI6A 5AW7A 2ZJ3A 1MVLA 4FZVA 3VR5H 1NVMB 4WOCA 2IHVA 1LRLA 3OF2A 4U2DA 1BHSA 3OOEA 3OQJA 4UU0A 1MC4A 5JPCA 5KWIA 3ER8A 4TROA 1CFZA 4L0CA 3BWDD 1EHIA 4M0MA 3O1JC 1PWHA 4XGQA 4K7JA 2C5BA 1XA0A 3PRHA 1JJ7A 2QN3A 2ZIZA 4KNVA 1W1UA 2XA2A 1NW9B 5EE1A 2IU0A 4B9AA 4EZBA 3PHHA 4B3IA 2EG5A 3ELUA 4FYHA 5ALTA 3R5KA 4R71A 2XTMA 2Y1OA 3RSOA 4R8RA 3UF0A 4JEHA 1TYBE 1YHNA 1RS0A 4DAOA 5EJ7A 5BOVA 1YKSA 3PGKA 3S7ZA 2GJ4A 2GVNA 3DV0B 1FFWA 3KJIA 5K3EA 5IN5A 5M34A 4LJKA 1U2RA 5SY9A 1CRLA 1JDTA 2J46A 2ECOA 3OU7A 1OJLA 1SU8A 2MJLA 2Q9BA 4NMMA 2QUHA 4OVKA 1E1KA 2V0NA 1BWSA 1UFQA 4HP8A 4BVAA 1TU0A 1XO1A 1E4OA 2REQB 3TNJA 1DC5A 3ZY3A 3ETEA 3B2QA 5DU2A 1W6UA 3O83A 5IAOA 1YBMA 1RXIA 4X00A 1SUWA 2CV0A 1H1LA 2PCLA 3FUTA 2IELA 3UJNA 3PD0A 2ODBA 2F1KA 1TTQB 3M1YA 1KAQA 1JWAB 1KI1A 2QX6A 1GNVA 2H54A 4YV1A 1W49A 1XLTA 4GPZA 4GUDA 4OG2A 2B30A 2MIIA 3IERA 2ZRKA 3KM0A 1HFJA 2QRVA 3OZEA 3L6RA 5GQSA 4YRIA 4WK6A 1W581 3L7JA 2NN3C 3KSUA 3O90A 1JLMA 5DULA 1Q11A 2O8VA 2V7TA 4XQ0A 3VR4H 1RRKA 3SY8A 3Q8MA 2P65A 5K8IA 4O4LA 3GQBB 2FK8A 1E3WB 2WABA 3V3KA 1G3IA 1Q7EA 5J2TF 5CD9A 2ZKIA 3KPJA 4EITA 2AFHA 3OY7A 3BWVA 4DCVA 1L7EA 1QCDA 3UQZA 2J6BA 3KSAC 1ABFA 1AS2A 3H05A 3I04M 1T9HA 3WBBA 1E1DA 1YDGA 4PCVA 1UQUA 4D6YA 4DC9A 2AG1A 3NO4A 2DTXA 2NUTB 4KQ6A 4KW7A 1SXGA 2RKBA 5ALQA 3JYHA 4ZCIA 4I4TA 2ADOA 4YCBA 4MQMA 4XB6B 1AD2A 4PC1A 4KR9A 4TSRA 1DQPA 2GA8A 4M83A 3V1TC 3V8QA 4AKGA 2EQBA 4X0EA 1EG7A 1R12A 2H0AA 2Y92A 3AM5A 2AX4A 1O6FA 3E61A 4LZJA 1CDOA 3IE0A 4LXIA 4NJOA 4QUHA 2FAXA 2C07A 4MUNA 4TQGA 3SU8A 3L46A 4KQ9A 4N7JA 3D3JA 2I4TA 3KEOA 3EGDA 3UA4A 1Q0TA 2Z2KA 3DE3X 3W3AA 1AGNA 4JLWA 4S0XA 4D80A 1WMAA 4BWFB 1YDHA 2V7WA 2FG5A 1IXRC 2RHRA 3IDAA 2NUPA 2W8BA 2ZUVA 1LQTA 3K53A 2XVAA 2B1JA 4TMYA 3SXPA 2V9PA 3PUWA 3UMMA 3B3JA 2F6RA 5CEEA 1OIVA 1R4NB 1BXRB 1NVGA 3HKCB 1GL6A 4HGYA 1RQNA 4KGDA 5LQJA 4AUNA 2CE2X 4S2UA 5HMLA 4CTNA 4QE3A 4X95A 3TGWA 2C5GA 3THOA 1S0UA 1Z2PX 2QI9C 3H86A 3P9SA 4EW3A 1FUYB 1F48A 1DI0A 1YRHA 3LLUA 1DO0A 3K0AB 3L6DA 1ISIA 2PNJA 4PC2A 3IB3A 2CLSA 1G7SA 3W2HA 2OAQ1 1FW6A 1TI7A 3YASA 3V32A 1JEDA 3GXBA 2E1RA 3TI7A 4B3GA 2COEA 3E35A 8OHMA 1JKXA 2QB5A 4OGWA 1NXOA 2MR5A 1SJ9A 4G9BA 4L72A 4UHCA 5K3FB 2V7GA 4QHYA 5HKAA 1VJ5A 2IS6A 1S2NA 1PSZA 3U4CA 2V6MA 1TLLA 3X1JA 3WFIA 2K4MA 3ZWOA 1L3CA 3SGLA 2Y0PA 1OLXB 1WA5A 2V3WA 5B7NA 5ITVA 2XMZA 4BQEA 1SPXA 1NSYA 1YC5A 2CD9A 4AUMA 3R6LA 1S9HA 3R3YA 1E89A 2P6NA 3FR8A 3Q8KA 2ZI4A 1TEVA 2VCYA 3KYCA 2IU6A 5KEIA 4F93B 2BR3A 4CM9D 1ZM2A 4U7PB 2ACWA 3I28A 4LX8A 1T24A 4MGIR 4HMPA 1CUCA 3RARA 1LB1B 4M60A 1VJGA 1P7CA 1SB8A 3CGWA 5ALOA 2H07A 4DUGD 4LIPD 4Q4AB 4X3PA 3A28A 3QPUA 1YGPA 1KE1A 4CL8A 1UKZA 5DM2A 3DMNA 4GIBA 1H2XA 3JVVA 3KQSA 4DSZA 1U63A 3QE2A 3R0ZA 3DEYX 3DOJA 4RUKA 1VRCA 8MHTA 3DWFA 2JAUA 4KQGA 4HL6A 2G0AA 1E3LA 1ILEA 1QZUA 3QNWA 4OFXA 3FMPB 3V4LA 2PT7A 4G23A 1NDQA 4HAVA 2CW5A 1I2CA 2XOKA 2XQFA 4KU4A 4XD7D 4K9DA 3B13B 5J1TB 1CB7A 2X1MA 3AVOA 1DJMA 1N2JA 2GRUA 1O58A 2IZZA 2ZE6A 4J0IA 3V9AA 2XDWA 3ZD8A 5IC4A 2KSQA 4TTJA 2H85A 1V16B 2EJVA 3OT5A 4JJZA 3L6EA 4H6PA 4LYGA 2QX4A 4G3XA 3GDFA 4NJEA 1BKSB 3O8BA 3OFVA 4G5SA 4K9PA 4KVAA 4P7FA 4YV2A 2B5OA 1QFZA 1SG0A 3CZCA 4NCBA 1DAFA 4Q9HA 5I7EA 5H3HA 2CEAA 1ZSVA 5H4HA 1T1GA 2CLLB 3ZVMA 1GPKA 2PPLA 4RZ3A 2B4YA 4I7EA 4RMGA 2ISSD 2EJWA 2WF9A 2VZEA 4RMIA 2YHIB 3AXTA 2FX3A 3WISA 2YYZA 2FZEA 1C81A 1M2VB 1YNOA 2GBCA 4XM2A 3ZHOA 2AFIA 2RH8A 3G1UA 3OFJA 3ZJUA 1HOTA 3THWA 4AKEA 1J33A 1DV2A 4DIUA 2VFAA 3T4UA 2HD4A 3QJ5A 3V1UA 2IYYA 3ZE2B 4U2KA 3T0FA 3D2CA 1U7PA 1J1IA 1QX4A 3A36A 3UWPA 3AVQA 3GHHA 1GRVA 3B51X 3F7MA 2WSYB 2VWHA 4NKRA 3AKDA 2C8KA 4QSMA 3GG2A 4HQOA 5B7GA 1VPTA 2EX4A 4FHDA 2YJ5A 3JPWA 3W6UA 1HI9A 2YBDA 4HLDA 4WESB 1MFZA 2BE7A 4ZTBA 5KYUA 3QZUA 4CM8B 3E22B 1ADYA 5CW1A 2O20A 4NF2A 1E59A 3KWJA 1SBYA 3OZIA 4R2KA 4QWMA 4BRWA 4DIFA 5I4KA 1YA6A 4KMRA 3HM9A 3IEIA 5HBGA 4HX9A 4LECA 1E18A 2D5LA 1UBNA 4HRAA 4EGAA 5AJZA 4L07A 5JD3A 4DV5B 2J0SA 2ZUTA 3ND8A 4FDMA 1QGAA 2PEYA 5JCOA 2Z3WA 3BICA 1RKUA 2ZYUX 2BM0A 2PWZA 2ZR8A 3KKEA 2Y1LA 1MC8A 3GK3A 2VEOA 4QOHA 4R51A 3VH1A 1W2WB 3HYLA 2FLWA 1QVVA 3AUTA 1X7GA 1Y3DE 2J9FB 2NVWA 3EGOA 3H13A 3JYLA 1E7YA 2F9LA 4I5DA 3SBEA 4YECA 2CHGA 4BQIA 8LDHA 1CRPA 1F8GA 2IKQA 2QRMA 1KK2A 2BEWA 3N9IA 1G17A 3IIEA 3FUXA 4KWTA 2GHIA 4PTYA 3GLHE 2C2XA 5AVWA 2D00A 3HP1A 4F8EA 1B93A 2WWYA 1KDRA 2J59A 4YUYA 3O4HA 1ZXXA 2QI9F 1CT9A 1YQQA 3CVJA 3HS3A 1J09A 1Q92A 3WWPA 4OQLA 4F1KA 3LQRA 1VL5A 1ZOIA 1U0LA 4E0BA 3L6OO 2YWFA 3RS0A 3C0KA 5JD5A 1QSGA 1T6YA 2G6TA 4FMPA 2JGRA 3JZAA 2ABWA 4PZ9A 4QOFA 1KDYA 3RS4A 1ZVQA 4CLRB 1LJUA 4R9RA 4EYKA 3DAYA 3H5LA 2UUOA 1SK8A 2ZIAA 1S7CA 4IHJB 4PLGA 1OXUA 3LTEA 4MVYA 3F0TA 4A8JB 4UXHA 1Q22A 2A67A 1M34E 2QD5A 1JEOA 1DC3A 3VR0A 2EX1A 3D6VA 4XQCA 3R77A 4ZV9A 4W9MC 1CFJA 2QMQA 3CIFA 2WNSA 4I4NA 1DKQA 4F7DA 5EZYF 7AT1A 1JLKA 5JJIA 1O6GA 4QATA 4OL0A 3UWSA 1MIOB 2G5CA 1Y6QA 4NLLA 3K92A 1Q84A 5L51A 3FCOA 3VO1A 4XYLA 3KWMA 1N5DA 1IM8A 1UDAA 3EF0A 4Z1MA 4QWWA 4ENQA 1SIBE 2C9MA 4WKBA 1SB9A 2RH5A 4G25A 4B4DA 3JQ8B 4XOIA 1N6NA 1QRTA 3DAOA 1MOSA 2NO0A 1JR3A 1L4BA 1TCAA 3MNFA 1FVXA 4OKIA 3UMCA 4FW8A 4CEHB 4GWKA 4GZMA 1XVAA 2AIRA 4JC8A 4RLFA 4NAUA 3GQBA 3LOUA 2UDPA 4AMUA 1O4VA 3MVEA 1QIJA 3CH4B 2R5FA 2Y2VA 2NZ2A 1DCMA 4JI1B 3NXSA 5AYVA 4BNKA 3LVQE 1KGDA 2GBPA 5FR2A 2K6GA 3L0ZA 3T12A 3USCS 2H5JA 3SZLA 2XYQA 4B6OA 3CT6A 2CZCA 1B1CA 3ZDXB 2QTRA 4YJGA 5TSDA 3MGAA 1D07A 5CURA 1QTQA 1CWUA 2GAOA 5FJJA 1TGYA 2I03A 4BDTA 4DR7B 2AF4C 4QFDA 1UBFA 2XYGA 1U0HC 3W79A 2C3OA 3WGOA 2PXCA 5AI5A 1WXXA 2PUEA 3VI3B 3GRVA 1JU9A 4XI9A 1A04A 2GRJA 2WSLA 2PN1A 3N28A 1CQIB 3Q3JB 2WHPA 2XQGA 4PHCA 5JADA 4JUDX 4XZ3A 5AK4A 2ZIXB 1EINA 1UJ5A 4IV5A 4E03A 3ACCA 4IOKA 1CP3A 5B4UA 1WKBA 4UTXA 3D7NA 1CQWA 1V96A 3BG5A 2LP4Y 4L9WA 3UJAA 1ESDA 3NVMB 2IZ5A 1ZITA 3CJQA 5LB2A 3BGVA 2IYNA 4FFNA 3CQ9A 4OATA 1ECCA 1B6SA 1MIHA 2WMDA 4YRFA 1YB2A 3HG7A 1OTHA 3UT6A 4I1RA 4NPHA 4R40A 2LCQA 3AUSA 3L79A 2UKDA 4KQ2A 4Q4LA 1ZK1A 2X19A 1ZC3A 3BFPA 3HA7A 2CLKB 3K5HA 2P67A 4NONA 3KYDA 2UXCB 2DCMA 4HR7A 4LTNA 3I1FA 1OGJA 4AICA 1ULHA 4AY2A 4G4IA 1G8MA 2W6IA 1WAMA 3NC1C 5A0FA 2PQ6A 2E5LB 1NA5A 4TSFD 3TMYA 3VZCA 1DO8A 4F2PA 5LQKA 3T35A 1SCKA 3ORSA 2HEGA 3BRWA 5DHTA 4ZAWA 4ZI5A 2R4UA 1U9JA 2XDQA 4MGHA 2XBLA 3RAPR 2HXYA 2ORVA 2XXBA 3AYXB 2HJHA 4WNAB 4DWJA 1K98A 2I7VA 3G7SA 1CY0A 2BT4A 4L27A 1KEWA 3VU3A 6LDHA 1MPXA 3ESZA 3IV6A 5B5SA 1A98A 2PCJA 2BLLA 3BCSA 4QYTA 3TLKA 5IJ0A 1JA1A 2BH9A 4PYOA 4RPIA 3MIZA 4BVKA 1FMJA 1ATIA 2ETXA 3STWA 1JG7A 1BD3A 2AC4A 3NDPA 5LDGA 1DOHA 1GQYA 1PEDA 3QUCA 2H8KA 3TZ6A 1GGMA 1HDXA 2Z57A 1EK1A 4JKOA 1DV1A 4CIBA 5LDHA 4REQA 3FAKA 1CR4A 4EG8A 1BH6A 2ZRCA 4A6DA 2SCUB 4NEQA 1G5IA 4JOSA 1C1YA 3CX6A 1NSTA 1F3LA 3ZWXA 4BTEA 2G71A 5EIOA 1W88B 4C2UA 4DQDA 2PG3A 3HXKA 2DX7A 3WWOA 4Q12A 2ZTUA 4GOOD 4KIUA 5E4TA 3UATA 2IRWA 3F71A 1N78A 4AP5A 1CC1S 1ND6A 1QH0A 2ZRQA 3MTBA 4L5CA 4TMWA 2ZIEA 4N6OA 3JW8A 2PK3A 4Q66C 3SM9A 1P6QA 1F6WA 2VL7A 1Q91A 1G20A 3QVWA 5CDFE 2J48A 3KVOA 3PPIA 4RF2A 3UJ7A 4Y1RA 3FG9A 5JUWA 3KZXA 5HIMA 4CTJA 4J1NA 3KIPA 2AFVA 4E2XA 2LUOA 2BUBA 2FZ4A 5BV1A 1KK1A 1LLUA 1X42A 2O0MA 2P40A 2OP1A 2BGJA 3AJEA 3FPHA 3UICA 5F5XA 3SR3A 3NOOA 5CXSA 3D4NA 1M72A 1QH8B 3SJ7A 4JJ7A 4OB8A 3TS1A 1K5PA 3E6AA 1SELA 3JCZA 4Z4QA 2D0OB 2R68A 3LCJA 4G5RA 3S2GA 1SURA 4BZQA 1VMEA 3SMVA 5ESDA 3T1HB 4GGOA 3PR2B 4WXHA 1RXWA 3WRXC 1TMOA 4R8VA 1UT8A 3MSXA 3I8SA 4R4JA 4C9BA 3WGLA 1VL2A 1GV0A 4F1WA 2DQSA 1BTOA 2YVKA 3DFFA 4KQKA 4XSHA 3TPZA 1TRHA 3E5RA 3F6BX 2C97A 5K3FA 1W29A 1YKGA 3VOAA 4CF4A 3MOSA 1MQ9A 3W5AA 3JQQA 3AR2A 3BB4A 4TL7A 1K7CA 4WLVA 3M82A 3F8TA 2HEIA 4P98A 2J3KA 1BMFD 3FBTA 4Q3DA 4ERXA 3OG9A 3RTGA 4CTOA 3PDIB 2NZVG 1KMQA 1H05A 1LX7A 3UAZA 1LSJA 2UVDA 4D9EA 1T9GR 3GJSA 1XD2A 2V0CA 4ALNA 3OLWA 3HH8A 1U0TA 3E84A 4IDEA 1JPVA 2ZYWX 1OLSA 5DLQC 1GTRA 2XUGA 1NQOA 1PJBA 1F2TA 1LLQA 3D5QA 3INYA 5D3MB 2OYCA 3RYIA 4D0SA 2AKYA 4K6OA 4OHPA 1GPDG 2HDHA 3FWPA 2R96A 4QECA 5CDGA 3LHDA 4A8PA 1Q3KA 3O8LA 4GZ5A 4MP8A 5B1HA 1GL9B 2PZJA 1CVIA 1EGQA 4ID9A 1PS8A 2P8SA 1MJFA 1XA4A 4XUEA 4J0GA 5JSZA 5EZ6B 4BU1A 4M8KA 3I4FA 3O3OB 3BIXA 4MV3A 3PIIA 1B14A 4MICA 4P33A 1CERA 1XTRA 4Q4JB 4RH0A 5ALDA 3OUZA 2BE9A 1UMDA 3UV7A 3ZYZA 4AP9A 5HQ3A 1XUOA 1VG9B 2PGIA 4NC9A 2H51A 4JLJA 4KQWA 3BJRA 4BHTA 3C39A 1LJ8A 5BPHA 3ZLBA 1IULA 1N3IA 2WWRA 3BWYA 3IT2A 2YQ5A 4WL0A 1X8XA 1RDFA 4ESEA 1JA0A 4F4FA 1RYDA 1EFTA 1ZOLA 2C82A 3HBJA 1CXZA 1CD5A 1UXGA 4RDCA 1Y7IA 1L5SA 4RY0A 4F5EA 3ESQA 3LU1A 4DCPA 2F8MA 4O2AB 3DHNA 1MO3A 2B0CA 3HDQA 4EDFA 1FYEA 4RZQA 4YRZA 2ZDGA 1TA4A 3ECCA 3LNCA 1NJ1A 3H4TA 4KAXA 1C7FA 1Y5NA 2NTNA 1JG1A 5JSYA 2YV3A 1WPGA 1J07A 4UJ3A 3IBFA 5F4ZA 4AYWA 2FEPA 5BWOA 3TZQA 3WKAA 2PT5A 5E2BA 1KEVA 1CJVC 3HZHA 4UMEA 2EP5A 1FSGA 3AL3A 5HUQA 4B82A 2YIMA 1GM5A 1RJFA 5LYYA 5ADUS 1PE0A 4DHWA 4MEAA 3OIDA 2AOXA 2LZ0A 3GFOA 1ABEA 4UREA 2VSNA 3DMFA 5DNDA 3UKOA 3EEOA 1YB4A 3IJPA 3X44A 4C4YA 3K9LA 4KE9A 5DH9A 1H2FA 2R4TA 2RKOA 4J1QA 3I32A 1MIOA 5THKA 3FI9A 5TY0A 4YX9A 3BWEA 1RD4A 1M8GA 4H15A 5JXIA 3WXMA 1ZJ5A 4WESA 4EP1A 4JI7B 2NNWB 3BD8A 1J2YA 4P4UA 2OBMA 3DF9A 2V8OA 3PXGA 3EGXB 3AHFA 5K0TA 5MN5A 4TN5A 3R76A 2NZWA 5JYCA 3RNLA 2WG1A 2OESA 3D4BA 3ZD6A 1Q7RA 3PSAA 3PZRA 2J6CA 1KMCA 2Z0MA 3S29A 2YMQA 1F8FA 3PD7A 3EY9A 1BE1A 1TM1E 1PGNA 3OE7D 4C21A 4ZCTA 1IWPB 1DOZA 2WSBA 2Y8EA 1JG3A 4TRRA 4Z4GA 5E7MA 1QFMA 2X23A 2J9FA 3C3XA 4JUIA 3AZPA 3AR6A 4D96A 4JMPA 1OLUA 1VQ1A 4YMHA 5I7SA 3G1WA 5C7OO 3IOEA 1PRYA 3TTYA 5BXQC 1LPSA 4XVCA 3QY0A 2HRQA 2B21A 2P9TA 4LOJA 1CF4A 2AMYA 1KOFA 1JQ5A 2V8BA 2W5UA 5F2NA 3QBJA 5ALIA 2GF0A 3JAKB 3F2VA 4NBKA 4HZUA 4MLDA 1G7RA 3H6HA 3TB4A 5EKSA 1ZSYA 3RKUA 4FSHA 1CS0A 3DE1X 1GD1O 2GM9A 2SHKA 4ND3A 5GAJA 1B8NA 2BD0A 4IUBS 5KSPA 3WO1A 2OC4A 1VIDA 2UYGA 3FPBA 2BJVA 3WIEA 3R3ZA 1DBSA 1NIJA 1G3UA 3KEFA 4IEIA 3HR7A 4DMFA 1DIAA 1YUBA 1YSCA 5CFNA 1OA1A 4Y6RA 1U0NA 2ZATA 3LBHA 2NU9B 3NU1A 4KR6A 4JVOA 3FWYA 4M36A 2CNDA 3H5VA 3KYJB 4CCYB 2ZVJA 4JOQA 4RO0A 3AKEA 1FMLA 1M33A 3DZDA 2OHFA 3AIIA 2P4SA 3BCUA 3KZ1E 1E0JA 3VAZA 4BGIA 1HKHA 1X92A 2EJCA 3NM6B 1U28A 2IYRA 4XTRA 3V4SA 4KWCA 5JH7A 3L02A 1HM5A 1P72A 3B8EA 2XLBA 2D2XA 4QTUB 5BUSA 2HLPA 3JQAD 2JAOA 2BFEB 1P6XA 2CJPA 3ESDA 1TT5A 3I12A 2GQ0A 4M49A 2UYQA 5C3MA 1HNWB 3LVRE 1T8SA 5GOTA 2C54A 2GX6A 4RLHA 2GPNA 5DSZA 1AB6A 1AG9A 1QVWA 3W2EA 5KWSA 3U0BA 1F12A 1U0FA 1J42A 2V96A 3DLHA 4AWXA 2GZ1A 3EHDA 3KUDA 1MG0A 1MX3A 4JZKA 1M7BA 1XRQA 3WZMA 2WWHA 4TL6A 5G4KB 4XQGA 1ENYA 3D0OA 3QU2A 3FI0A 4G0VA 2EGUA 3BK1A 4F2DA 1XWIA 5A6SA 4LJ6A 5K0LA 4RTLA 3TECE 3SEZA 5EI5A 1CNFA 3U1TA 9GPBA 1V4VA 5IYZB 3BC1A 1WZIA 1J9ZA 3SVLA 2WLSA 1EVYA 5C5IA 2ZT8A 2R7MA 1OXKB 2FEMA 3ESXA 4EDHA 3EOZA 1U8XX 2BPOA 1R9JA 1VSUA 3I9V6 4LZNA 4LOAA 1LCIA 1D2AA 3GJ4A 4H6XA 1TZKA 5IAGA 3PQEA 3ROXA 5IU6A 3HLKA 3O4FA 3ISJA 1PS9A 3G9QA 5B2ZA 4A5SA 2R6ZA 3GPDG 3C3EA 2GOYA 2I1VB 2BONA 1D2CA 1QVRA 2SKCA 2AT1A 3IQDB 4XDGA 3NTLA 4V0MA 4GLOA 2A35A 2VHCA 1ZY2A 3ZWVA 5K0JA 1S96A 4J0JA 1OWNA 1O8CA 1STOA 5NLLA 4L4ZA 4YY3B 5KTRA 3FYUC 5JSHA 7ADHA 2EJUA 1XVVA 2IIVA 2GZSA 3BKXA 3VKGA 2PM8A 5B37A 4YP6A 3CS3A 1W93A 4QTXA 3W9SA 3BH6A 4Y9SA 5K3BA 3CKMA 4G8BA 4MI1A 3HU2A 4OY3A 2AD5A 2SECE 1W1WA 4RK0A 4D0GA 2N9UA 4ZT5A 4MPDA 3ISVA 4JT9A 3DE7X 3G1TA 1NJFA 3M83A 3RRFA 1C9EA 5JMWA 4P3OA 2EZUA 1FTGA 3D64A 3RHZA 3WNQA 2Z83A 3UMYA 5CCEA 3C74A 3DE6X 1V8DA 3QYPA 1O0SA 1XZFA 2IZ0A 4NICA 3BE5A 5KVAA 4N6GA 4RVGA 2LV8A 3B53X 1N2EA 3OQIB 2OCDA 1SVMA 1AN0A 3A2NA 3LKDA 4N54A 4PFKA 2AVNA 5EZYA 4F06A 1EM8A 1U4OA 4E7OA 2IY7A 3CZAA 1O9HA 2WTNA 4TT8A 2P9FA 5DGHA 3ZDAA 1BEEA 1GUFA 3G5MA 4EABA 2EFDB 1NFRA 4RD1A 1IDOA 2AA3A 3RBVA 1GAXA 2FPMA 3ZS8A 4QT0A 5A9RA 3E8XA 5ALNA 3PUXA 4HWTA 5FUWA 1EQ2A 2PBZA 3AY3A 2SCUA 3PWZA 4US0R 2Y2UA 5EJ2A 3ZV3A 4G41A 5FEUA 3T7EA 2NZXA 3LQYA 3P4YA 4CF5A 2D6FA 2DSTA 3OECA 3TGLA 1I6KA 1F6BA 2X8JA 1R6UA 5DM1A 1EZ1A 3LW7A 1KYQA 1Z4JA 2MOKA 2NXCA 5DLYA 4JP3A 2JLZA 1NNSA 3I72A 1UBKS 4E08A 3GFTA 3ESYA 1G3MA 1GY8A 3A25A 3IVGA 4EI9A 4CL2A 5C53B 3ELDA 2NZ8A 2DE0X 4RH3A 5JSZB 5EQTA 5JMPA 2O7NA 1WPXA 5JZMA 1E9FA 2DBZA 3CNLA 2MMCA 3PJFA 5K1ZA 2CLIB 3GD5A 2C0PA 2ZANA 1BE8A 3MHTA 1EWQA 3O1LA 3I5UA 3KRTA 4ZOLA 3ZWWA 4OKSA 1F0PA 1XKXA 4DA7A 4YNBA 5EPUA 3PR3A 2I7TA 4KAAA 2VK8A 1TDJA 2H7XA 4KG7A 4RV5A 2EERA 1OXBB 4B3XA 3K8YA 3R9IA 1PNVA 4BO6A 1HZZA 2BM8A 3A04A 3MC1A 4RLQA 4OQNA 2GN0A 3V7NA 3KVNA 2YYYA 5FRDA 4AZ3A 1RRGA 3EZ6A 3KOOA 4CKYA 4H7IA 2A0YA 2Y05A 2POQX 5CEFA 1UT5A 4N01A 5F7XA 3PXCX 5LP6F 4E31A 1F51E 1EBUA 1A5BB 3BWMA 1Q2XA 5HIJA 3SC4A 2MYTA 2NACA 4RSMA 3ZXYA 3ASUA 3KB6A 3PDIA 3SP1A 2HF9A 1DNPA 4EG5A 2ZB2A 3E9CA 3K70B 3B9PA 3MRVA 1DKOA 2DLCX 3NYRA 2A1TS 4LV5B 1T29A 2FUCA 1ZGCA 2V6FA 3ZCSA 1WXDA 4BFCA 1AKYA 1GPNA 5EXEA 4M0UA 1G6OA 3A9CA 4EHIA 2VTEA 1E2JA 2ZJYA 5AHKA 3ELBA 4OGFA 3TUZC 2XCRB 1QK4A 1QLJA 3KALA 4JEMA 1H1TA 1GKYA 3PC4A 1A5AB 3L1IA 2F17A 1JJIA 4DLSA 4WN3A 3T61A 1TRKA 1ONBA 2JEOA 2OV1A 2ENUA 3V8NA 5FADA 3VNRA 1E79D 1XZLA 1RAAA 2A4KA 2FUNB 3CRMA 3PQDA 4EENA 4RACA 1IUNA 1JHDA 3TNYA 4HG2A 4ZVRA 2FHSA 3FPKA 4A9AA 4DEXA 1V4NA 1GTL1 2OAEA 3HSSA 2GYVA 4OQFA 4Z49A 5KTSA 1SKUA 1NVVQ 2WIFA 3UBMA 5B2EA 1GUAA 4RZUA 1ODCA 5AT1A 1ADFA 4BZPA 4CIYA 1SKMA 4N7BA 1W75A 3INRA 2RGRA 2QVXX 3M33A 3T3GA 4PSVA 3HI4A 3EMBA 3PNYA 3ICQB 5AJTA 3HYCA 1XPJA 3DLAA 3T52A 2QR2A 5DNUA 5CMLA 3A2MA 3RU9A 2OXFA 5L95A 2D0PB 3GLHB 1JQEA 2B9VA 2PHZA 3GAAA 2XPCA 2WKWA 2OSBA 3BN3A 4KPUA 4UE6A 2O3TA 2BMAA 4TVKA 2ZWOA 1AO0A 1L5VA 1C30A 2I4MA 3NUZA 3HADA 3P2EA 2VHJA 3D4IA 3CLRD 3LHFA 4WA8A 4DIKA 3ND6A 2WBLC 4NDZA 4D92A 4W1SA 2X0EA 1JIKA 2PWAA 1K0UA 1CS0B 1XNRB 2O1XA 1YDMA 3SEQA 1D4OA 4I9GA 1OFVA 5DM0A 1RC0A 4JB2A 4WI1A 4B6SA 1YFZA 4BP3A 1Z63A 2D13A 4Q19A 4Z51A 1H2AS 2P3QA 5F1PA 4IQ4A 1ANKA 1RADA 5AW4A 1TVMA 3T1VA 3PP8A 1E2NA 4DBLC 1JKJB 1Q1GA 1QOQB 3L41A 1TPYA 2FWPA 2B8NA 3KOYA 1J21A 3B5EA 3QBEA 4H4EA 3WHIA 3BJEA 4X3OA 4U6SA 1ACJA 2QGFA 3E27A 3F8WA 1GGVA 1PX2A 2JI8A 4PLVA 2XADA 3DT6A 3CE6A 1US8A 3MRSA 4K6KA 5EWMA 5T4FA 1QQBA 1HDCA 2HYDA 1L4HA 3VA7A 2QRQA 3MZ0A 1E2MA 2SNIE 2YXEA 1I01A 3LO8A 4DRZA 621PA 1W5EA 1T2AA 3C3DA 4AZTA 1GPUA 1K7SN 1MQAA 3IHTA 4BB9A 2P75A 3DVLA 2VQDA 3EH1A 3MLAA 2P5TB 2RG1A 3DXXA 1UIRA 5KOHA 5KKCA 3UPTA 1UEJA 1XRMA 4CT0A 2RHHA 3JU3A 3RT7A 4RVCA 2CEKA 4CTMA 1PZGA 4ZT7A 1YRWA 2QDXA 2XUOA 4X7RA 5DVZA 1RBZA 3CLUD 1LRJA 4N39A 1Z82A 2HF2A 3A6HA 3OQ6A 2YNMD 1EHCA 4L15A 1AURA 1Z74A 4W8HA 4F56A 4YALA 1W4RA 4FX2A 5JO0A 1GUYA 4IJ6A 3AP3A 2AN3A 2AZ4A 3UC5A 3KKPA 1YCDA 4XFJA 2IUTA 4KQMA 4R1QA 2D3TA 3U13A 1HYEA 3M5WA 1N6HA 1JBKA 3I6ZA 5KMGB 4NENA 1GT91 1H0SA 4QELA 5JC8A 3JATA 4KMMA 3IPLA 3RSGA 2VTVA 4INOA 3NPMA 1KH2A 3D7MA 4IIBA 5F7JA 4XTCS 2Q1TA 2XODA 2PLWA 9ABPA 1YR6A 1QR6A 4GBGA 4BGEA 5DGXA 1WXWA 4DZZA 4BUCA 4HBZA 1FDVA 2F4VB 1G9SA 1O9BA 4IIXA 1ZUWA 2AMJA 1K97A 2XA1A 4LY6A 3MT0A 3I37X 1NR1A 2BKVA 2WE7A 3FKSA 3L0PA 1LW7A 4HB3A 4QDJA 3EW9A 2M6LA 3U7QB 4DM4A 4DXAA 4UBNA 3UAOA 4JJKA 4H77A 3JSXA 4HSGA 1IZ9A 4EG3A 5TLSA 4WZ6A 4MCIA 2QPAA 2J5RA 1QG2A 4M1TA 2WU1A 3B5IA 1AQNA 1AK9A 2CYBA 3WMFA 2FQYA 3EXAA 4HWOA 1RYNA 3A0RB 1XLWA 3BXXA 1XCMA 3ZWBA 4Y0VA 3LYUA 1VYTA 1UWCA 1U11A 1IC6A 5LKAA 4C89A 1WW3A 4HXFB 2G9VA 3COSA 1NLMA 3HEMA 3U9SA 2H4WA 2R5NA 2F3RA 3O4VA 4S35A 4MIOA 1O57A 4UEOA 4XRRA 5ERGB 1XNGA 5TF0A 3FLBA 3S0JA 3MT7A 1WXQA 2P4HX 2BMJA 5G2OA 5C8YB 1QWSA 1PR0A 4A1OA 1UJNA 4HUQA 2XXAB 3ZWKA 2G5TA 1X70A 2PMFA 3HXPA 1PDOA 3W5HA 2L42A 3ZWQA 2LW7A 2Q5FA 1JVSA 4M1OA 4RWZA 4B35A 1X7ZB 3OZ7A 4YP1A 1TIKA 3ZPXA 2Z2IA 1D3AA 1KJ9A 3HLTA 2C04A 4ONEA 4CQMD 4EVIA 4GMDA 3FGNA 2HWXA 2ZYDA 3DTNA 4X84A 4YAIA 1ACMA 1E99A 3PA6A 4G0PA 1IUPA 1IZ8A 1ZD5A 4HQ6A 3VZPA 3GY0A 3IODA 5A1JA 3L9WA 5JS6A 4J1SA 2QTNA 3SF8A 4MTLA 1B1AA 1ZVKA 2DT8A 1Y89A 4AJIA 5B64A 3VVMA 2YFQA 4KXWA 5BN5A 4EW6A 1DJQA 3TMKA 3TW0A 4A73A 2OLEA 3CN9A 3EMDA 5L3RA 2CSXA 2PZAA 1CPYA 1KZ9A 1P1BA 2VRNA 2X8JB 1RAGA 4HQ0A 4M9QA 4WAUA 2PQ0A 3DEZA 3EGWA 2X0DA 4C7XA 1UKVY 1QJCA 2VK4A 3LJKA 1U8AA 1YJ5A 4KN8A 4ZCQA 1QZXA 2ZTSA 2HIGA 3SJBA 3CTPA 3QP9A 4EAQA 4IGKA 4PPNA 3KP1A 1FTQA 3GN1A 4Q15A 3EZ7A 1ZAYA 3HACA 4U2BA 4M1SA 4QODA 4YQEA 3ORRA 3MQ4A 3ORQA 3VNAA 2PSDA 2R2AA 4IDQA 4ENWA 3ES9A 3WIDA 3I53A 4UNRA 5T5QA 3AEUB 1P5RA 1YZHA 1MV5A 3BHNA 4JYZA 2EFYA 3BWCA 4EEXA 1JEAA 3I34X 4ZRNA 4V1CA 4BCBA 1E32A 2NMVA 4L3OA 3FPAA 1Z26A 4URVR 1YB1A 3HVUA 1CEEA 3CZRA 4E5YA 3I2HA 4LFCB 2FLKA 5FUBA 2LR0A 3UHJA 3DEHA 3IBGA 1MG5A 1SQGA 2C92A 2NNLD 3OZAA 1CZOA 4MO2A 4PANA 5WRFA 4BLPA 4MHTA 1U3GA 4DLUA 5I7WA 1W30A 3B70A 2XWPA 3ZU5A 4W5QA 5GJWC 3VHRA 3DYVA 1P4GA 1SKYB 1T2VA 2BW0A 2ONYA 1Z2EA 3STHA 3V8PA 4MV7A 3B6ZA 3OTOB 3WGGA 1R27A 1QFXA 2VP4A 2Z4RA 3THRA 4MQ6A 4BKUA 3NKLA 2VSFA 2HDNB 5IRCD 1H23A 2FRVA 2AC7A 1VL1A 1BDMA 2FZ5A 2H2FA 5LNK6 3WLQA 5ESWA 1OFUX 1SQ6A 2C84A 2Y99A 3FDJA 1ZK4A 4Q1AA 4PG6A 4AXBA 5FTJA 1FSPA 3PS9A 1F4LA 1FX1A 2X9NA 4XQ9A 1C4KA 5C35A 3R5XA 5EFOA 5K3DA 3EVNA 2ZVQX 1E77A 1G1MA 1U8EA 3LY9A 3WIOA 2W00A 3A26A 3G88A 3NWEA 3NANA 3SM3A 3HJTA 1WUIS 3EVZA 2OHGA 3X1KA 2L2QA 2EXXA 2PYZA 1T1RA 4RHEA 3UPDA 4PGHA 3KBBA 1DL5A 2ODWA 4UPDA 4UMDA 2W6OA 1RT9A 3H5OA 2Q27A 2XVYA 1WJGA 2C3PA 2ZRLA 4TMFA 1NVDA 2KMLA 2IZ6A 4X93A 2ZJOA 1SNYA 3C1AA 4B2IA 4KK4A 4PO1A 2X15A 3F7OA 2ANCA 2PVPA 5H5JA 1YCFA 4D97A 4Q0MA 4Z4IA 5K0NA 4EO9A 4K1LA 1OASA 4H3SA 2B69A 1RI2A 3WDSA 1K9SA 2OGUA 3B9QA 1A88A 3UCFA 3HXLA 1JHPA 1J99A 3NWJA 4EMSA 4S04A 1O08A 5CLFA 2R9VA 1QUEA 4JUBA 2GEBA 2YXBA 4OM8A 4OUDB 3AB3A 3HWRA 1NI4A 4NV3A 5I4IA 1LK0A 1RYEA 3AFHA 4PX9A 2X42A 1XTBA 2WJVA 1EVIA 3D8NA 4EKDA 3RUDA 1T1EA 1CE8B 3HYNA 1O5IA 2IH4A 2J41A 2XCIA 5CCBA 3JQGB 1FFCA 3SFZA 4B40A 2C4VA 3F5FA 4JP2A 1GU0A 5BQ5A 1RTTA 4MV5A 1RBQA 3GT0A 1GRCA 3HXTA 1U6JA 2B82A 3VPXA 5FYQA 1I5OA 4XE5A 2NV0A 4KVFA 5K8JB 1T2NA 1XQ9A 1NMXA 5F5NA 3OA0A 1TFRA 2Z95A 4JLOA 2F55A 1RRCA 2GPYA 2P7IA 5JNLA 5EJMA 2YMLA 3FNFA 2IHKA 2NSLA 2YZNA 4L7VA 1LY1A 1EVZA 3FOBA 4BXOB 3UUFA 3VR5D 4M98A 2XE7A 1B0ZA 2QAGC 4DWWA 4TXLA 2ZM6B 1XDSA 2JFWA 3MOIA 4X8HA 1L7AA 3AR3A 3C3KA 1VOTA 3HDHA 3CLKA 3GDWA 3KKNA 2VDOB 1TJ5A 5IDVA 3G8YA 3UY4A 3BE6A 4EGSA 3EIWA 1CR0A 1DMSA 9ATCA 1XTUA 1MDBA 1U3CA 5D6OA 3CXUA 1GO2A 4HCJA 3P1JA 5E95A 2HBQA 1J8FA 1OREA 2GERA 3W6OA 1L5NA 4WBSA 3FCAA 1M8KA 1Z0ZA 2HIMA 2X7JA 2H92A 2P62A 4J16C 5LC1A 1DPGA 1ZMRA 2AR0A 2IEBA 3CUEF 4EY3A 3PJRA 4OX9B 5E6SA 3ZW9A 1T3SA 3DXYA 3D81A 4OQ4A 2VJQA 1R0ZA 3HCEA 2GAAA 1LGYA 4DDHA 1LLCA 1QQ7A 4M8NE 5FUQA 1U02A 2AX3A 4JI4B 3HB0A 3ZCRA 2YHUA 1QDEA 2KLHA 2YWEA 3KDSE 4MW2A 1WB9A 2ASVA 3H18A 4YCLA 1HLGA 2DUWA 2WVAA 5G0TA 3SQXA 2HHCA 3PR1A 2R00C 3MB8A 3FDFA 4RY2A 3DLBA 4QOJA 4K6CA 4FS8A 1P4AA 4MRMB 3RFCA 3BB1A 2QVZX 4NFLA 2JAXA 1GNSA 3FYCA 3K09A 4LDPA 4I1SA 1L4EA 1YE5A 2POCA 3FZYA 3FVRA 3WDMA 2P35A 3SCZA 4EGQA 5BPFA 1MAWA 5FPQA 2A5GA 3TNLA 1USWA 3X2EA 4JLNA 3MB5A 5F77A 1S8NA 3AVUA 2AQ8A 2XTZA 4BN0A 4GDFA 4PAWA 5H80A 3JS5A 4KEAA 2C7RA 2PRZA 2CLEB 2AYXA 2JFXA 4BGUA 4MVJF 4OHUA 3HSYA 1K63A 1CUFA 3NNSA 1L5KA 1FP2A 1M6VA 4HBGA 4K87A 2FJPA 4OI1A 2JHGA 3M6IA 5LUBA 1Q5PA 1SVSA 3CLUC 5JNRA 4HXEB 1WVGA 1N5LA 2ZJ7A 2JJ8A 3IFSA 4LK2A 4ZAZA 4BEVA 4E46A 1H2ZA 1BDIA 3D7LA 4YI5A 4LCJA 4YRBA 3EZYA 1PW5A 3IB6A 3ILHA 1S2MA 4CR7A 2HBZA 4QRIA 3IMEA 3UGQA 5LQMA 2NP7A 4ZOLF 3C6XA 3FTEA 1RRPA 1M73E 2JJ2A 3NM4A 4L6IA 3K6SA 1NW5A 4OAPA 4B0PA 4AY6A 3R0IA 4UCXA 1MRNA 4QUKA 4D43A 4ZARA 1RQRA 4O2AF 5JYDA 3GGDA 1P45A 4EECA 3FZQA 4NV1A 3KSRA 5TDHA 4F9EA 5LZ5A 5KJEA 4WLFA 4LEIA 1K7FB 3T4PA 5JZ9A 4OPMA 4R2HA 1QJ4A 1CV2A 4EHAA 3S4YA 1Z17A 3RQIA 5SZIA 3D8BA 5CB6A 1W36B 2DFKB 4JU8A 3DDHA 3JR7A 4KX5A 2HMWA 1W4ZA 4S1WA 5A02A 1MQ8B 4Z2YA 5JXJA 2ZRFA 1EWVA 2ODTX 3QUBA 2E9SA 2Z9CA 1DELA 3LPAA 2RCNA 3AIMA 3S2IA 3T5CA 2PL9A 5C32A 1OFGA 4LN1A 1XXHA 1M7HA 1TMYA 2G08A 2XT6A 3BWXA 4DSAA 5KYYB 1UM9B 1WKVA 2QN6A 3BRWD 4KXFB 2E4WA 4MW0A 4X8MA 3OT4A 1M6YA 4B33A 5E1OA 2MR6A 2RCYA 2VDKB 4TT3A 2JIZA 4C1NA 3KQUA 2RAVA 4H16A 5KYXB 3IUSA 3RRZA 3MWJA 3NMUF 4LE2A 3K0CC 1C7ZA 4RHTA 3W1WA 2HLDD 4F3CA 1XDBA 4C05A 3DOHA 4HKTA 4HGNA 4IJWA 1F1JA 4IWYA 4TS1A 2H7CA 1CUYA 4ZN6A 2C9ZA 5BYKA 3ETLA 1RMYA 2QZJA 3GG9A 3M4NA 1OU4A 1NKVA 4RF4A 4L78A 4AG3A 5FUXA 1JVNA 4L4YA 1E7RA 2V7XA 1YBVA 4YJKA 3P0EA 2LWIA 1QU2A 2R3SA 1JHZA 1Z3IX 2RHJA 4G26A 4CFYA 1W5AA 5CA1B 3HJUA 1REQA 5HKKD 4V39A 1OZHA 4TS3A 4N0DA 2YW2A 2DQ4A 3R74A 3SC3A 2BAGA 2FUG1 2YWBA 2ID7A 3EFBA 3H3XA 3QTTA 3STXA 1SC6A 3V80A 1JIVA 2AFRA 1QAMA 3KUCA 5KNCA 5M2QA 1NU8A 1SKQA 4XX0A 3R8CA 4JV5B 3LE8A 4OXNA 4R0VA 3PDUA 2AEJA 4YCNA 3E5MA 3P9CA 1M1ZA 1XEAA 4GH5A 4MYSA 4TWJA 4J0EA 4EY8A 1VPLA 3OPXA 2V4UA 1JAXA 1N8TA 3V2GA 1RAEA 3IPXA 4MW4A 3HKDB 3D4OA 4H7EA 1RC1A 3SDBA 3NHFA 5K2OA 4O8CA 3O2JA 5C1IA 5EERA 3AUAA 3QFSA 5IMBA 5KPDA 3QLJA 1B8PA 5T4HA 4EG0A 3L82B 4GOJA 4DT1A 2Q8QA 4D3XA 1U7WA 3MTAA 2HH9A 1NQXA 1O03A 1YOVA 4KGVA 4II2A 3RB8A 2FKAA 1AS3A 2MU1A 2Q5IA 1JHRA 2I34A 2N46A 5D3MA 5FBQB 1AC5A 1A76A 3Q85A 2IYSA 3KKQA 1K68A 1KEPA 2A84A 2J9XB 1FQOA 2Y76A 4J90A 3ZIUA 1UCFA 2QS9A 3QBDA 3TZKA 1F3OA 3NHMA 4B3DA 5AUNB 1FZTA 4JBWA 3AF4A 3UJBA 1QHGA 3TINA 2BP7A 2QR5A 4EATA 3WAJA 3B1VA 8ABPA 3OZSA 3L0CA 2R8YA 1HDYA 2YWCA 3DM9B 1SOVA 2VYNA 1GOTA 1KR2A 4X71A 1JTFA 3P52A 2OPBA 3VC3A 2A4MA 4KK3A 4GMGA 3EARA 4XWGA 4FYPA 2PKRA 3JARB 2H59A 5EEGA 3JVDA 1JMKC 5AMXA 5DGIA 3AR9A 1ST2A 1CJCA 3CN7A 3KYIB 3N6XA 2O6LA 5E9JA 1QH1B 3HRHA 1ESEA 4YTEA 5GJBA 1UPCA 3WV5A 3GRPA 4JL6A 3EW7A 4EMUA 2BISA 3UCEA 4BBZA 3A2KA 4ND6A 4QQKA 1XCJA 3EN0A 3UJDA 4I1OA 1RQXA 1U8CB 4OUDA 4WDQA 2WUGA 3ABOB 2QZ9A 2HADA 2SKDA 1XHFA 4NJMB 2XNCA 2I22A 1EJBA 1IHYA 2VYQA 4CM4B 2NU6A 1ISFA 3G2NA 2UXBB 1G5TA 1VFNA 1P73A 2ZJ0A 4WUVA 1IOZA 1YQUA 5ESXA 2OOKA 5TEVA 4CMEA 4ZEMA 1B6RA 3C7DB 5KYKA 3RC8A 3OZBA 4BVFA 3DEAA 4I08A 3GGCA 3CU5A 5K4HA 4P6VF 1T3LA 1W0JA 1I6LA 1RE1A 1K27A 1M2JA 1MO2A 2AZMA 2J5BA 3OKFA 2GEUA 1TAQA 1XTKA 3IUMA 5EUBA 3NOQA 3WL4A 3HRIA 4UMVA 4YCSA 4EKYA 3HVIA 3Q1LA 3WYEA 1A8UA 1JG6A 2PPVA 5AICA 2ORWA 4UBLA 4TYPA 4KKVA 1DEHA 4F6RA 5TIIA 4BXOA 1CIVA 1J8YF 4OAOA 4J43A 2W6NA 3OJLA 2G1PA 1VHTA 4TV8F 3R9WA 1LBQA 1W4BA 2FG7C 2AXPA 2ZSAA 2C4TA 3G2QA 1NVVR 1YA8A 3MJVA 1J2TA 4D4KA 5CFMA 4DIMA 5HW0A 3GQVA 5KREA 3OPNA 3PUKA 3D8SA 3IPYA 5TPWA 721PA 1JHOA 1TL7C 2WAXA 1UK9A 1HEYA 1OFUA 1ZQ9A 2WD9A 3CIOA 3ET5A 4MWCA 4WCVA 3UFXA 4OB7A 3A7DA 1NUAA 2BMFA 3KR1A 5L3ZA 2GTIA 3X1MA 4B3HA 5MN6A 5IT0A 4D82A 1IHXA 3EUAA 4GLLA 5F64A 2Q5HA 1XZCA 1YVPA 5CDFA 5AKIA 4JFRA 5BR8B 2CL0X 2D1TA 4LSGA 5E6SB 1W76A 4YYZA 3ENZA 2CXXA 3K9QO 4G4GA 2ZTHA 2JD2A 3EF3A 5AO9A 3ZD9A 4KYIB 3UBTA 1GGFA 3JWGA 5JDCC 4NBUA 3TCKA 3K73O 1D8TA 3TLGB 2AJ8A 4B3BA 5CFPA 1WOYA 4P1ZA 3O21A 1BWRA 2AG8A 4RTMA 4DA4A 1NPDA 2QP4A 3T3OA 3WB2A 1GLGA 4XUGB 2F7SA 5EMMA 3BFJA 5EJ5A 5KTYA 3PX7A 1NSFA 3DE0X 5AXAA 4LJ5A 4M0DA 1OH6A 1R2QA 2BIFA 5TX7A 5EJ4A 2WD7B 4RPGA 4DDKA 2Z2ZA 2F3TA 4HJXA 4L9SA 1OR8A 1SXJB 3U3XA 1GLNA 4JC4A 2BHRA 1C7JA 4S1TA 3UOWA 1QDUA 2Q21A 3RHTA 4QBHA 1Z7EA 1HDZA 3OX4A 2C9OA 1Q6ZA 4Y0AA 2R79A 2VI5A 1VECA 3EGEA 3RVQA 4R1MA 5BR4A 2LD4A 1TM7E 1V2HE 2CKMA 4XDZA 3TGPA 4AJNA 2ONKA 2YOGA 3WNZA 2ZBPA 4RE6A 2DXIA 1K6MA 1XI2A 2BFCB 5ILGA 1CF9A 1CUUA 2QJOA 3T7DA 1IRIA 3WLKX 4EJSB 1DIGA 3T5PA 2XGMA 4FNOA 4EX6A 4DCJA 3H87A 4N47A 3WLMA 3E1SA 3UHFA 5KUTA 2CLDX 1E1NA 3VYWA 5BSEA 3QVLA 3TFQA 3H9JA 3DE2X 2DBYA 4A7PA 1YRYE 2FN7A 1Z06A 3AFGA 4D4GA 1DLIA 1SXJE 4IKOA 2OHOA 5AW0A 3VNUA 4JCCA 2C2OA 3PNBA 3X1YA 1ZCBA 4NULA 1R37A 1N6IA 3FYTA 3O2QB 1FUIA 1G291 3D6NB 2HGZA 3HI6A 1DAPA 1EX7A 3IQWA 1DAOA 5EP4A 5AJUA 3PGJA 2C59A 1UKCA 2GNAA 3AB7A 2PD3A 1O97D 5DJ5A 1N5MA 1RP7A 3ZYCA 2O8EB 1Q0UA 5G4KA 1JH9A 2LTAA 4UBMA 4NFSA 1VJTA 4IHQA 1BFUA 1E3QA 3GYGA 2V74B 2P69A 1ZH6A 4RTSA 4BX0A 4EY5A 1PZHA 4BUJA 3ETDA 3LC2O 2YKGA 1AHNA 2BGRA 3SEFA 3AHEA 2RHBA 4ALLA 2HUPA 1XXHB 2LXNA 4RA9B 4BCDA 4EFMA 4DGSA 1SBNE 6REQB 5HZGA 4Z86A 4R1NA 2G9ZA 2PSEA 2V45A 4A16A 4BMZA 2YJ3A 1V11A 1E7WA 2EQAA 1NDUA 5ES4B 5AOAA 1KJZA 5C52B 2W2VA 4YGXB 1UXIA 1TZ2A 3T9FA 2RB4A 4CF3A 4OHZA 4KE7A 2J3IA 1IY2A 7YASA 5AVYA 1WP9A 3PFWO 3HKBB 3SHOA 3AX6A 3Q11A 1VP9A 2H2WA 3HEAA 3NAZA 3T6KA 3LECA 3DKIA 4RCYA 4PYNA 4Z5XA 3M6MD 2IHUA 1SUIA 4X1YB 3ZJ4A 4MDFA 5HGXA 1BVRA 3J81k 3WTBA 1ML3A 1J1ZA 4U7JA 4YP9A 4D3FA 5F4BA 4Q24A 4U9IS 1C0LA 4A92A 2QVCA 4D7AA 2CSUA 1QHEA 1M34B 3VC2A 3JALA 3CX7A 4Q3AA 3HJGA 1T4CB 5T3YA 1ML4A 3S6JA 3EXG1 1F9EA 4BFVA 3E23A 3JR3A 3ZC3A 3FVTA 3X0DA 2ILTA 5JZOA 1YWGO 4KUEA 1G5FA 4LX0A 3CNOA 4RHFA 4DTCA 4OGGA 3FCEA 3ZLVA 2X6RA 2WYIA 1AGPA 1AF7A 1FYXA 1GKLA 5F2EA 3UN1A 3L6UA 1BEZA 3DEFA 4E11A 1UKEA 1XELA 2WZBA 1FFYA 3R7DA 2PD6A 4IVPA 5AD1A 3KR9A 4XUCA 3B6JA 2B7LA 4ZP1A 2VYCA 3SYKA 4OHKA 4G09A 2CVFA 1J2UA 3WQRA 5EZYB 4EYSA 1J90A 1U0JA 2YR0A 4X63A 3N5CA 3VKUA 4PC7A 4Y6GB 3A9WA 1N92A 1OCEA 1AKUA 2QTVA 1Q7TA 1N2IA 1Y3HA 3DBRA 2PSFA 3IAHA 2VOEA 3ITKA 1SZPA 3EWNA 4LJYA 3F8SA 3U7EB 3DHVA 4K0RA 4CKEA 3GRRA 3CISA 5CR9A 3NVAA 2NUAB 5DF1A 5FBVB 3KELA 2NTJA 3QFCA 1JZQA 1NZDA 3TBKA 5J47A 2B1GA 1D1SA 3KYCB 1GRRA 4AF6A 3UT5A 2JLWA 5AVUA 3RVDA 3A6KA 3LKBA 4NZPA 4NYJQ 3QKRB 2J32A 1NMSA 4ZICA 3E05A 2WJ6A 5LUAA 4RKFA 4ZDJA 1P2GA 1T25A 4FC7A 3NX4A 4WEOA 2J30A 1J8DA 3L0BA 4NS4A 3N5KA 3SQWA 2HM7A 1F4VA 1DU4A 1O3YA 4I5IA 4ZT4A 4HGQA 5BNFA 3I5YA 2BY4A 1DWQA 2O2ZA 1K8XB 1P2FA 2OORA 1BGXT 1KZYC 2VDVE 3NEYA 1E2HA 3QTLA 3CUKA 5CIQA 1O94A 2C2MA 1WR8A 2EL7A 2RI1A 3B3FA 3FMGA 4QARA 2CUTA 3V8MA 4ZIRB 3AEXA 2EW2A 4XQEA 1JLRA 2P6UA 3URKA 2D2EA 4F91B 4A15A 5HJ7A 3L7IA 1UIMA 2HV9A 1V5FA 2XJ4A 2E4XA 4C0QC 1SVNA 2A9RA 2FPLA 3U61B 1K06A 2EIXA 4LDJA 4M89A 4B48A 1I0ZA 2DBQA 4NOLA 3HC7A 3NCTA 2A5YB 1V16A 1J23A 1FMTA 1O7JA 2IUEA 2R11A 3MELA 4ZYYA 4O3MA 2P2GA 1PWEA 2B4TO 3RTCA 4B3RB 2PUGA 2A0FA 1G8GA 1Z5NA 2GKSA 5CPBA 3F78A 2P0YA 3MYYA 4XX0B 1H8EA 2O2GA 2V65A 5FBLB 2R85A 2PY6A 1W8DA 1N5OX 5DWDA 2JLRA 4FGJA 3BGIA 2IUFA 4XARA 3SWWA 4BX8A 4ZV7A 2DERA 1UPUA 2E4AA 4QUDA 2I87A 4DKJA 2JKVA 1I1NA 1QFSA 5KNCH 4MV6A 4G8JA 3FBGA 2ANBA 4ZOEA 5E6RB 4Y6PA 2PKXA 4X91A 1BZYA 1T26A 4E13A 3WB9A 2AFIB 3KV1A 4JNCA 3H16A 4FBMA 1EUCA 3UTCA 4DT1B 1QU3A 1GUZA 2CL5A 4FJ0A 3NBKA 4XYGA 4DLLA 2PIAA 1CVLA 1WNTA 4JOCA 2GXSA 3RK0A 3FUCA 2Q5QA 1TC1A 3NTOA 2B0JA 1YS4A 3V5NA 3SBXA 3L7DA 1NLYA 3IH5A 3T5AA 2GN9A 1MAAA 1G16A 4QSHA 3PTAA 3NASA 4LYJA 4MPRA 1TVCA 3E03A 2C96A 1JAYA 3NEAA 4D74A 4MYTA 5KYUB 4RDIA 3BCRA 1M1YA 1PL6A 3BL8A 5ALYA 2B4KA 5ALKA 5C3UA 3OWHA 3SIRA 3SZOA 2QGZA 3F74A 4DV4B 3AI7A 3ZGOA 1PVOA 3QPCA 1Y9ZA 3LPLA 3DXZA 4LY9A 3TCNA 3T9DA 2AFIE 4FMCF 5BWCA 1E2GA 1V7ZA 1KC1A 3PTZA 2Z1DA 1A0OA 1BFDA 3EQ8A 4JBXA 4TVOA 4U7DA 4AN1A 1HTBA 2ONJA 1A69A 4C7BA 1N3BA 4XASA 4DWVA 2FWJA 1PR5A 4K9NA 2JD0A 1NURA 3DW3X 5CYGA 2NUBA 5TMBA 2ZR0A 5H7XA 2EHDA 5EP1A 1TZBA 2OCIA 2FE1A 2HNKA 4BMPB 2YUTA 1H2EA 1IG0A 4MV1A 4BO3A 5IX8A 3KOXA 3F1KA 3VPAA 4ESVA 1FU7A 5EJFA 4QYIB 1R8SA 1RWPA 3GW8A 4UU1A 1B8OA 1A8QA 2FWBA 3UXYA 4CDRA 4RELA 3CX3A 3GEPA 4XRGA 1XQVA 1VDMA 2AW3A 2Z9BA 1WF3A 3HYRA 5HFAA 2G1UA 3UUWA 3LX5A 3VDXA 1J5PA 3RABA 3P0HA 4AYTA 4KHPB 1PT6A 1M6EX 5TPWB 2XNDD 4MRNA 5ER9A 1SHTX 3IP6A 1HRKA 2CJYA 4G01B 4MIYA 5K3OA 1YDWA 2CHUA 3DZIA 5FI0B 4XM0A 1NULA 3CLVA 2O2SA 3EEFA 5A9SA 2V7QD 1T35A 5DEIA 1Z6AA 2C1ZA 4D57A 2BWJA 4GFDA 3GEBA 3V4OA 4OUKX 4FDVA 1S3SA 4JEUA 3T0IA 2Q7DA 2ZYIA 5CDSA 1GG9A 1KSHA 3WK5A 3WWEA 5D00A 3TF5A 3WLOA 4G97A 5FFFA 3DYBA 2HCFA 4F6RB 3LXUX 1YQXA 3MMZA 3JWEA 3NZEA 4YQZA 4O4IF 1HUQA 5F9HA 3A4TA 1ZDMA 4F2HA 5DO9A 5F1YA 3TOZA 4BX2A 1M5RA 3W8FA 2CVHA 4Q3OA 1WCYA 2OGWA 3ROGA 3S2YA 4PGMA 3VUFA 4LVCA 4J6FA 1U2QA 2ODEA 4K1XA 4Z9BA 4G4JA 3BSSA 4PAMA 2HCTA 3ILVA 1FNDA 1QPBA 2ODQA 3OPYI 2YDYA 2JIMA 3LSYA 4N6NA 4KACA 4Q00A 5HF6A 5KNBH 1VCHA 3U4QA 2B4RO 4Q7MB 1NZFA 1XJ0A 1Z62A 4GNRA 2FV8A 3COZA 3OF5A 4PSDA 2YWGA 4BB0A 4ARIA 3RIYA 1XAJA 3LM8A 4D5EA 4CMKA 5AM3A 4QFBA 2WK1A 1TJYA 3VSDA 2QD1A 2HLHA 4L51A 1UBLS 1L1QA 2X41A 1NR7A 4JUCA 2PKYX 2X40A 4KLCA 1M8PA 1ZICA 3HY3A 4QYWA 4CJXA 5KOHB 2FN8A 3R3JA 3MINA 4MKRA 3L8DA 1K86A 1H0HA 5B36A 2JDIA 5DX8A 3EBPA 1RIFA 5DE3A 1KI9A 1OAOC 3HB9A 3TLGA 4BVEA 5C8VA 4I8DA 3WQQA 3TQHA 3DDCA 3GHYA 2CNLA 5H4GA 4Q9DA 2H9IA 4FOTA 1RCUA 2QBYA 3QHQA 1ILWA 1AHIA 2W2QA 4B73A 3BXOA 4BJ5A 1AY0A 4GKKB 4H2DA 5IJ9B 4MMZB 3JQ6A 3LY7A 4Q34A 3EJ6A 4J16A 5AW9A 3CEMA 5HKOA 2NO1A 1BX3A 2XKAA 4DM7A 1OAKA 2YFKA 3B82A 5FA6A 1ICIA 2EFEB 2E49A 3LGXA 5LCXA 3S55A 2YWHA 3TSAA 1WBDA 1QP0A 2OCKA 5HZKA 3COVA 2R8ZA 3HKBA 4MYUA 4X8OA 1PJ4A 2UU9B 2A9PA 4KP7A 4ZZIA 3C6YA 4JX8A 1MGOA 4HWGA 4QDUA 3S1LA 4ZOBA 4H59A 4A8JC 1TOAA 3QKTA 3RAGA 4DJAA 3D5TA 1PD1A 2NV2B 1B15A 3FPLA 4NBSA 5AP9A 4HT3B 1Q0QA 2HBYA 1WHSB 4ND5A 1HE8B 3P27A 1X15A 4LNHA 1LEHA 2RAPA 2CBXA 4GP7A 1KJNA 2ADMA 3MAJA 5ITSA 4P38A 4CFZA 4YMSA 1V35A 2GVZC 5DV9A 3PCXA 2OPHA 3Q72A 1Y7PA 2BI7A 2FMKA 1P8JA 1MGPA 5HILA 1EJ0A 1NBWB 4GYKA 3GUUA 3L05A 5ULLA 3TUJC 4CNBA 1NVFA 4DQKA 2ZE8A 1G2PA 4J29A 1QO0A 1NT2A 3KWFA 2X1LA 2OFFA 4LYEA 1UFVA 4O33A 2YIVX 1QKIA 3IOMA 3I0ZA 3PNQA 3V7YA 1GXSA 5KDDA 3WGUA 2RGBA 3ZWYA 2I9KA 3CCFA 2QDKA 4Q18A 4KB5A 2Z43A 3DBHB 1ZCZA 2KPOA 2X2EA 3QWIA 4G2NA 4MITA 4UBKA 1T5TA 5AK5A 2OWDA 5LB4A 2IV2X 3RRYA 2NG1A 1DIRA 2IA5A 2YTZA 3WKCA 5IT4A 3OMLA 1OX5A 3HBMA 1X7ZA 4C2BA 1E2DA 1IN1A 2BBWA 4JQCA 5FEMA 5GGYA 4ZOQI 3IHKA 1F60A 4BLWA 4PLZA 2IHYA 1IPEA 2PDAA 4GL4A 1XVLA 4KBGA 1NG9A 1U0BB 1ZD8A 2F64A 1PJSA 1H6AA 4JQSA 1WHTA 5CT9A 3WLNA 4CKEB 2NXNA 2PZKA 4DLRA 3G0OA 4GQAA 5D3QA 4TV8B 3W7VA 4ENUA 4RA9A 4MB0A 4QG7A 3UV3A 2GS9A 1K5GA 4LDQA 4BLSA 4BNTA 5IVKA 2QT9A 3HN7A 1V1RB 4LHXA 4K6FA 4ZVSA 1QNFA 3DONA 3ODPA 2VT2A 4JVSB 1XU4A 2QN7A 4LPKA 3RYHA 1W5BA 3EDRA 4E09A 2XCSB 2B35A 3GLKA 3AO0B 1WTCA 2E85A 1PVVA 1BW9B 1T9CA 5ADHA 2YX1A 3T1NA 3NVDA 3ROQA 2O52A 3OCXA 5BSGA 3H0KA 3OOHA 3G89A 4BUZA 1JKIA 5U9CA 3Q2OA 3ABIA 1KDTA 1XAGA 3FJ1A 4GI3A 2GK3A 1IZ7A 2NVOA 1P9WA 4ZVLA 3BUSA 1RPZA 3T3MB 1BWQA 4YV7A 4C88A 1XWWA 3DL7A 4TWRA 4N18A 2B37A 5HS4A 3KTFA 1BX0A 5CITA 2O0JA 5JDIA 1IQ0A 4JXXA 4HUJA 2VJNA 1GKUB 1VLMA 4BRUA 1AM4D 1FB5A 2HYIC 1P0PA 4UUBA 4Z54A 4FPXA 1JP7A 2ISCA 4WD3A 2PV0A 5ITZB 4RZ2A 1TKBA 1XHLA 4CKXA 2MSKA 3HRKA 3K0CA 4FHCA 4QPJC 3SSMA 3VOSA 1A9TA 3WIBA 3NWOA 5A7FA 3EEIA 3H19A 1L6RA 1OFIA 1Z2OX 5K0SA 3QVKA 4DYDA 4RXUA 3E7PA 1ODTC 1TZMA 2XNKA 2FW8A 4HH0A 4J3JA 2EDCA 5BWBA 5EHXA 1LVUA 4Z7JA 1BQEA 2YC4C 2QTCA 2H48A 4I5GA 1DKPA 4DJDC 4EK9A 5J4YA 1D2GA 2I2XB 2PZ8A 4KTVE 4L8VA 3JQ7B 4LHWA 4R2XA 4B31A 2XKJE 3HDJA 3T9CA 1GYRA 2X76A 4X1IA 3BVPA 3VDNB 4EF5A 1SUCA 3L4SO 2C2HA 4YMIA 2QSZA 3U31A 3VSEA 4CKWB 5DYNA 3OZWA 4BQQA 4CMJA 4D98A 3ZIAA 2FVXA 3K9HA 3LPDA 3D8HA 2IXBA 3HBAA 5FV7A 1QHNA 3WHPA 1XRJA 2Q6VA 3VV3A 3Q3EA 3VR6D 2XXJA 3KB8A 3ANYB 3BZWA 3K1ZA 2FPGB 4B71A 2XI4A 2F3UA 3CWZA 4AM8A 1NDHA 3F5MA 3E1KA 4TRNA 1YF3A 1QHHA 2DQKA 3X1WA 2ID4A 5CBKA 1AX9A 1XEWX 3PZBA 1S5PA 4MKGA 4MUFA 3ZZMA 3U44B 3QOXA 3GFBA 2ZSFA 2WKQA 1BCSA 1TPZA 2WHYA 3IDZA 4BECA 2DWPA 3UKDA 1FFHA 2IYEA 3EEYA 4Q3BA 4XPIB 4BCCA 4DC0A 3AHCA 2V98A 5FP0A 4JYCA 3F4BA 4DB2A 2OSVA 2VDNB 3GBPA 4M0LA 4U6QA 2I5PO 4I81A 2P6RA 1YTUA 3AVXA 4PV7A 2CMDA 3KB2A 2IYOA 4OO3A 4MS4A 1NE7A 3TTWA 1FW8A 4CCYA 1OXSC 4TL9A 4HXGA 5CA1F 3ZDRA 4UTOA 3ET4A 5BVHA 2IOYA 4B5KA 3ADDA 5K5EA 3PDJA 1TEZA 1J49A 1FU4A 1SA0B 1Y42X 2WU4A 2NPFA 4UXJA 3A6GA 3H2GA 3PVSA 5AW6A 4BDSA 3JQBC 1CZLA 1ZNQO 4JI3B 4R31A 3VVBA 4CG0A 1USKA 4N5MA 4RM2A 1NJGA 3WGZA 2B4QA 5JARA 4S1NA 3W8NA 6ABPA 1KEZA 2QUIA 3TYXA 3BIWA 5KBYA 5E6RA 3KTAB 1T4BA 5EEHA 3W0LB 4D3DA 2CCJA 1M75A 2W98A 5EZSA 1KJ8A 1MA0A 1TXGA 1TIBA 1X7XA 1VHLA 3A6ZA 3K9GA 5AHXA 3RKRA 2WOJA 3FJOA 1E6MA 1Z5GA 2H4HA 3PL1A 5D5HA 5BRNA 4EEKA 5A5VA 1F0NA 5CB4F 1WCIA 2QAIA 4LHSA 2C2WA 2VPXA 3TJRA 4C3ZA 4ND7A 4AS3A 4YRAA 3W5DA 4EEZA 4YONB 4YAFA 1AA9A 4KN6A 1JYSA 1RXEA 2VP0A 3MW8A 2CE7A 4LYDA 4WT7A 3OKAA 1JLSA 5J4VA 3HUEA 1T2CA 4OK6A 4IYRA 3RIHA 3P20A 1GCIA 4AI6A 1H42A 2WG2A 2V5VA 4MS3B 4PYLA 5E1DA 4UPEA 1N5RA 4TS9A 1R00A 4W99A 3SOZA 4QOSA 1FVFA 3ROEA 3ETHA 2PSSA 1XZDA 3KAKA 4IDNA 4B6JA 5HTOA 3OY2A 1AV7A 4TMXA 1M83A 3TK1A 2IDKA 4Y7DA 4LXXA 2A78A 4JBIA 3B52X 4L16A 4QJBA 4QLOA 1N6PA 1Y7TA 2FSPA 4ZHQB 2D2IA 2IE0A 4D26A 1QR2A 2I6XA 2PMKA 3DAHA 3JQRA 1FQWA 3M49A 3M5PA 3OLVA 3U3RA 1HYQA 1ZJJA 2VR1A 2OHJA 5JATA 4ZAFA 4INPA 5DGCA 5HFJA 5FQNA 5JFGA 4P5DA 1C41A 4BMCA 1UXKA 4EO4A 2QRUA 1X7YA 3JYOA 1OLUB 4KVZA 1AUPA 1P33A 3U6KA 1RPJA 2FCRA 3I6YA 1XJ5A 3N53A 4MEBA 4F96A 5KQLA 1OB2A 5ALEA 5SYNA 1LA2A 3KVYA 1JQAA 3QRWA 4MVJP 4D4IA 3CVUA 2H2AA 5IM4A 5IVIA 4I2VA 4YJ3A 2Q3HA 1I36A 1EB8A 1SULA 4E5DA 1IN7A 4RF5A 2FEWB 2IUSA 1I3NA 2XD9A 2JI6A 3FRHA 1RQ7A 3FRJA 4FOSA 3LI2A 3ENQA 4HRVA 2D4HA 4I1UA 4QBKA 5CA0B 2V6JA 3GBSA 4NK5A 2P2NA 1RU3A 5A4IS 3NTVA 1RQLA 1H2BA 2G67A 4HWSA 4S3MA 2I2AA 1YONA 2J85A 2ZQZA 3DDUA 3DZJA 3ENNA 4PPFA 2JFFA 2W8ZA 3NAGA 4XIGS 1GADO 4LAFA 3W2IA 3WLLA 4MRPA 4AULA 1IUKA 1J25A 1Z4NA 3GH3A 3CVXA 1EXMA 5EE3A 1Z4KA 1ZQ1A 1L4FA 2Q3BA 1IN5A 1KQOA 1WHSA 4OIFA 2OO5C 4WKOA 4YDRA 1BXGA 2HQRA 5DM60 3KPWA 5KQPA 2Q41A 4OHOA 5C51B 4HX5A 3RWMB 4E4TA 1DDIA 2QVYX 5BYJA 3PU6A 3L93A 1NF8A 3AW8A 1H9AA 2WFZA 3NHJA 3KZMA 4ZQFA 2IT1A 2YJNA 3HWSA 4TS4A 2DHCA 5HIKA 1DJOA 1KRXA 1CW2B 1MCZA 3R3SA 3OCVA 4IRMA 1WL8A 1BA2A 3EAGA 4IS3A 1M0WA 2FMXA 5FWXB 1KRHA 3GFRA 1RC8A 4Y2RA 3KE9A 3I2JA 2JIQA 5IUKC 2Z8YM 1V6SA 2A14A 1A50B 4HGOA 2QLBA 4QO7A 5JBQA 1BO6A 4F86A 1EVLA 2FFJA 2X3FA 3M1AA 4JROA 4OFBA 1ULSA 3IV7A 3K7EA 2UZIR 1TQ4A 4PCUA 4RA6A 4UAJA 1GQSA 3OEED 1NONA 3M89A 3SD7A 4MCJA 4DGQA 1UEIA 3E2IA 5L45A 3L5KA 4IZIA 3BMOA 2W0MA 5C7LO 3VTZA 4M9ZA 3BTOA 4TMZA 5DHAA 4QUAA 4PLTA 3HU1A 7REQB 4P4LA 1BDHA 2O8CA 3ZU3A 2WIBA 1C1XB 3OPYA 2BI4A 3VMFA 3ONNA 4LZOA 2ECQA 2WJZB 4JLSA 1AU9A 2IUUA 4C6TB 3H9CA 2IXFA 1K8RA 3UAVA 2XUZA 4J0KA 4N1AA 2XAAA 2ZUSA 3I4LA 2VJPA 3MMSA 4K26A 4AX4A 5IJ9A 1E8DA 4FT2A 3GVXA 3DFZA 2O07A 4DCOA 2VA9A 3RGGA 3V2HA 3IBYA 4TWBA 1AXEA 4ZEXA 4BZWA 5CFQA 3ZHTA 4KI0A 2OV2A 1TK2A 2C0CA 3WE7A 3JQAB 1QP8A 2IV7A 2WHXA 2WILA 2DLDA 4PHTA 1EVKA 4I19A 4YCCA 1NXPA 5KNBD 3KZKA 3VISA 1MA3A 1R0CA 3WP1B 4A6EA 1E9SA 3BIJA 3N2YA 4QGGA 3I45A 3X1ZA 1PNRA 1QO9A 1C80A 1DT3A 5BT9A 2ZBQA 4KREA 3QFTA 4L5AA 4DA9A 4CNQA 4PSAA 3F97A 5TQVA 2ZETA 3EXEB 3N0VA 1O95D 2AVDA 2GKGA 4TWZA 5EMJA 1RVV1 3GRCA 4FFLA 3IUBA 4RWEA 2VQFB 1GTJ1 1USGA 1ZRHA 3D4PA 3BZUA 1Z6QA 3DVAB 2HZBA 3PA8A 2LRHA 5TQ0B 2HHJA 4YAUA 5L7TA 1OWLA 4FZRA 3F73A 3L1UA 4KQ1A 3JD1A 5LN1A 1P8AA 1NASA 1ZI6A 3WL3A 4C01A 1DBIA 3PRYA 1V25A 2AG6A 2CDRA 3ZXUB 5BV0A 5IKMA 4EUKA 4RULA 4YAOA 5IAKA 1Y8QB 4UUAA 1FFAA 1SN7A 4MUXA 2I7CA 3QX9A 4U9HS 4D02A 3K3PA 1XDDA 5D51S 1SZCA 1RHQA 5C5EA 1Z73A 3C3WA 4QA9A 3NOVA 2GD2A 4I2NA 4ZVMA 1X1DA 3N74A 4AKTA 3W9UA 1I2AA 1SRRA 2GM4A 4HV4A 3K94A 5K51A 1XVUA 4MA0A 4FX5A 3ANMA 1D4ZA 1KOLA 4JYPA 1Q15A 3HBLA 2ADFA 4ND1A 5KKAA 1KY4A 5K3SA 3RJZA 4YS6A 3O1HB 4JBYA 5TQJA 5IHPA 3FLEA 4QPPA 4BNHA 1ZD9A 5FTNA 4BBJA 3KBOA 1V5EA 2C58A 3E3AA 3WI7A 3ZWNA 5GZ1A 3SHVA 4DR2B 5IJXA 4QICA 1U1CA 3ZE0B 2XMDA 3N76A 5LIPA 3GLIE 1I1QB 4DHEA 3FRIA 3IP1A 5IFLA 4D4LA 1Q57A 1SCIA 4RHUA 1YO6A 1YV9A 2IEAA 3BB3A 4XIJA 1W6RA 5TE9A 5M29A 3VH4A 4QM6A 5K8VA 1M8JA 1OV6A 1PP4A 2A2ZA 4R3WA 3QVJA