2PGAA

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with inhibitor and phosphate and potassium ion at 1.74 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
b'SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
molecule tags Transferase
source organism Salmonella typhimurium
publication title X-ray Structure of the Uridine Phosphorylase From SALMONELLA TYPHIMURIUM in Complex with Inhibitor and Phosphate and Potassium Ion at 1.74 A Resolution
rcsb
total genus 88
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2007-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pgaA00
1PR4A 1RXYA 3FOWA 5CYGA 1Y1RA 1PKEA 1OU4A 1RCTE 1Z34A 5B7NA 4GMHA 4NSNA 1JDTA 3OZDA 4TTAA 3EMVA 2BSXA 4YO8A 3UAVA 1CB0A 1PR1A 5CYFA 1JDVA 3GGSA 3EUEA 1V41E 4E1VA 4TTJA 3NM6B 5B7QA 1V48A 3ENZA 5ETJA 1A9TA 3K8QA 1Z5NA 1SD2A 2A0XA 4DARA 1TCVA 3BGSA 1XE3A 3KVVA 3EUFA 3KVRA 1Z37A 2A0YA 1OTXA 2P4SA 4OY3A 1YBFA 4WKBA 3LBAA 4G89A 4BMXA 1I80A 4L5AA 1Q1GA 4NY1A 5F78A 4WKNA 3UAZA 4L0MA 4WKCA 1VMKA 3MB8A 4DABA 1U1DA 3OF3A 4G8JA 5F7OA 1Z39A 4NS1A 4F3KA 1RT9A 4F2WA 3IEXA 4FFSA 2RJ3A 1ULBA 1Z35A 3UT6A 3NM4A 1LX7A 1T8RA 4D8XA 2QDKA 1Z5OA 1PK9A 3OOHA 3O4VA 3DP9A 2H8GA 3BSFA 3D1VA 4TTIA 1JPVA 3ODGA 1SQ6A 4WKPA 4BN0A 1FXUA 3U40A 3IOMA 1PR6A 2HRDA 3FUCA 3EEIA 2ISCA 4TXNA 5IFKA 4QEZA 3F8WA 1K9SA 4L6IA 4M3NA 5F73A 3PHBE 1A9SA 1PR5A 4BMZA 5F7JA 2QTGA 1Y1QA 2AI1A 2QTTA 3KHSA 3LA8A 5EPUA 5CXSA 1CG6A 3PHCA 1RSZA 5CXQA 4QARA 2HWUA 4OGKA 2OECA 1WTAA 1JDSA 4OEHA 4UC0A 4EARA 3OPVA 1JDUA 1ODJA 3P0EA 3O6VA 1YQQA 4DAEA 4WKOA 4KN5A 3BJEA 4H1TA 3FNQA 4JWTA 4DA6A 4MCIA 1VFNA 1B8OA 3DF9A 4TXMA 1Y6QA 1Z38A 1OUMA 4PNPA 3OZEA 2QPLA 5F77A 4TYMA 5KB3A 3FWPA 4TXLA 1RR6A 1Y1TA 4M7WA 1JE1A 2IQ5A 2QSUA 3OZCA 1VHJA 1V2HE 1Z5PA 1NC3A 1V45E 4F3CA 4ECEA 4YNBA 1A9OA 1G2OA 4TXHA 3ONVA 4R2WA 3LGSA 1RXCA 4LNAA 3SCZA 2HSWA 1U1FA 3T94A 5DK6A 4LDNA 4DAOA 2ON6A 2XRFA 4G41A 2OC4A 3NBQA 1Z36A 1Z33A 5C80A 4R2XA 2GUWA 1M73E 3C74A 4M1EA 3K8OE 4GLJA 1RFGE 4D8YA 4GLFA 5FAKA 1A9PA 1ODKA 1PBNA 4JOSA 3QPBA 4P54A 1N3IA 4RJ2A 1Y1SA 2PGAA 4LZWA 1RYZA 4DA7A 3E9ZA 1A69A 2AI2A 1PWYE 4DA8A 1NC1A 2AC7A 4K6OA 1RXUA 3E0QA 5K1ZA 1TGYA 1B8NA 3TL6A 5JPCA 1U1GA 4U2KA 2Q7OE 5I3CA 1TGVA 3KVYA 4PR3A 3UAWA 1T8WA 1PF7E 1U1EA 4D98A 4L5CA 4YMLA 1QE5A 4QATA 1C3XA 1PR2A 4IP0A 3GB9A 3E9RA 4QFBA 1V4NA 2A8YA 1K3FA 1LVUA 1ZOSA 1ZL2A 5F7XA 4X24A 5F76A 1K27A 5B7GA 5IU6A 1JE0A 1OTYA 1T8SA 2I4TA 3P0FA 4OF4A 4DANA 1PR0A 1PK7A 2OXFA 1A9RA 3FB1A 4R31A 4F2PA 1JDZA 4TS3A 1YQUA 3FAZA 3BL6A 4TXJA 3INYA 5EFOA 3DPSA 1OV6A 4BMYA 2HN9A 4L5YA 2A0WA 4TS9A 1V3QE 1ULAA 1ECPA 4YJKA 3OZBA 1VHWA 1SD1A 5F7ZA 2OC9A 3KU4A 5B7PA 5EUBA 3UAXA 4MARA 5CCEA 1ODLA 4GKAA 1NW4A 1T8YA 1PW7A 4I2VA 1T0UA 4OGLA 4LNHA 1TCUA 3DDOA 3KUKA 1A9QA 1YRYE 3UAYA 3PNSA 2B94A 2AI3A 1ODIA 1SJ9A 1LV8A 3OOEA 1JP7A 1YR3A 5CCDA 4D9HA 1TD1A 3PNPA 4MCHA 4QASA 1RXSA 3DJFA 1OVGA 2I8AA 4OJTA 1Y6RA 4QAQA 1U1CA 3MMSA 4JP5A 4EB8A 3NM5A 3OCCA 4DA0A 4D8VA 4F1WA 1JYSA 4LKRA
chains in the Genus database with same CATH superfamily
2FY8A 4AWAA 1HTBA 1XNRB 2A59A 3LUPA 4MVYA 1MNQA 1S3SA 2X4GA 4DW8A 2FDCA 1EXMA 1HNWB 4JBYA 1JHQA 1ZNYA 5JTTA 4D9IA 3M3HA 3Q88A 1V8PA 1U9ZA 3T5TA 3WOVA 4CF5A 2JFHA 2HW8A 1NYLA 5B7NA 2ZYAA 1RYMA 2Q0QA 3TXXA 4UD2A 3CC8A 3LQRA 1O6GA 4DLVA 3C8UA 1EUQA 5I7RA 4YN3A 3ZHSA 4RKRA 1CEQA 3OU2A 4EHBA 2FPXA 4IRMA 5D5PA 4ZRMA 1D4FA 1GZHB 1RTKA 4RCYA 1N7GA 2YICA 3L0BA 4M7RA 2B99A 4JLBA 3GN1A 2F9LA 4PANA 1XHFA 4F3TA 1KK1A 1X94A 1ZWLA 4MVJA 2NLOA 3COJA 4KR6A 1QFXA 2AX3A 3TRIA 4TVOA 4IXMA 1PQPA 1TECE 1YCFA 3IDZA 2ONCA 4HWKA 1PS9A 3E15A 5HVNA 5KS2A 2ZYUX 3GRAA 2FP3A 3CHYA 1XCBA 3HO6A 3EJWA 4CPDA 4C7OB 1AH2A 5BY2A 4MLPA 2P77A 1U2RA 1P5JA 1RQNA 3KOWA 3L7AA 1W34A 1N25A 1NQUA 3LW7A 4HAOA 2QU7A 3A6ZA 5T3UA 1PL0A 2YRFA 2Q4EA 4N3CA 4RIHA 1IN7A 3JZIA 1AKNA 2QV7A 4TPKA 2YQZA 5F2NA 1FTYA 4RZQA 4YQFA 1LS6A 3HWWA 2ZVJA 2C95A 3L49A 4DIBA 1DAEA 1SUWA 1Z2DA 2ZIFA 5CG2A 5JV5A 2XTJA 4N3BA 1VLHA 3EY9A 4JJ4A 1NR1A 2GVNA 3I9KA 2BPOA 4J0FA 4L5IA 5TXGA 4IG9A 3TSAA 2WIDA 3JWGA 4RVOA 1ID1A 4ZRNA 2JK1A 1O94D 1SUPA 4MI3A 2DUMA 1Z5ZA 4XJXA 4OAOA 3WQQA 4DB4A 1AD2A 3KYCB 5F4ZA 3PNKA 3HUDA 4W63A 4OY3A 4UEOA 1U8ZA 4G89A 3ZHRA 1TU4A 1IUOA 1OJ7A 2IUYA 3KS9A 4JJFA 4QUIA 3BWEA 3VNSA 1U2SA 3ZIUA 3R3VA 1G41A 4JC8A 4MR7A 1X80A 4WAUA 4UXIA 2FNAA 1ZA1A 2DWCA 2GHIA 2I6FA 1ZI9A 1LPAB 4PS0A 1NF9A 1X7WB 1HLPA 1VSBA 4DABA 2PUGA 2H31A 3HDVA 4IIHA 4L95C 1J49A 4MUYA 2O57A 3JATB 4UNNA 1RQ7A 2J7PD 2VP0A 2IY8A 2G9ZA 5SZHB 2CSUA 2K5UA 3IAXA 2FN7A 4AJLA 1DNPA 5IVHA 2X8BA 4FFSA 5AYVA 1LUAA 3QMPA 5KKAA 4F06A 4JT4A 2QBYB 3Q10A 4J0IA 4AM8A 2PFKA 4KSCA 3UXMA 4NBUA 4G84A 4YAFA 1CCWA 3RUDA 4MVJF 3BTSA 4CMAA 2PAFA 1E62A 1Z5OA 5EQDA 4US1R 2VJOA 3G7UA 2D5BA 3QNWA 4OU5A 3VNQA 4XUCA 3PEEA 3DP9A 4DUGA 3NYQA 5LIPA 5FXMA 4EGJA 3VYTB 3D1VA 1QHIA 1M2KA 5IKOA 2XOKD 3N2LA 2QA5A 2ZRDA 1OD6A 4FGWA 5JS7A 5EP1A 2BDTA 4HRYA 1J0XO 1MX3A 1FYDA 3FGNA 3O74A 2NXCA 4D44A 2LWIA 3PUZA 4F4DA 1PUJA 1RE0A 1ISSA 5LWHA 2ZATA 3SSOA 1PNTA 3WISA 5TQVA 2AKEA 3ICOA 3NXKA 1P77A 3VR1A 4U6QA 4FGLA 1E7SA 4Z4IA 3KT0A 2XCSB 2ROQA 4PQGA 4FC6A 1QH8A 2QUHA 1U2PA 2H1VA 3Q9LA 4FXOA 4P80A 5F64A 2WWTA 3WMRA 5L4NA 1ZGJA 3EDQA 2MSLA 3QU2A 4GPIB 4I6JA 1IY9A 4LSZA 4PO8A 3HCBA 3K09C 4GICA 2CVQA 1QVWA 4FDTA 4YHBA 4QUHA 1GA6A 3EDMA 4YDRA 5SYMA 3T4EA 4EW1A 3GLTA 4PHHA 4O4HA 4EJSB 4C4OA 4OJMX 4X54A 4PONA 3LA8A 3R3HA 3GROA 3HCDA 1SBQA 3GA5A 1UXOA 4PIMA 1XN4A 2DUUA 1F8UA 3PPVA 2AJCA 3R6GA 4XVQA 3ZXXA 4ZICA 2GRUA 2P2SA 4EBFA 3WWDA 2OBFA 2R8YA 2IA5A 2W2XA 4WN3A 1E2EA 1FTWA 3LBFA 1G5TA 2PT5A 5E3IA 1Q3TA 2C07A 2W37A 2A9QA 1JQ5A 3EF1A 5IT0A 1OXUA 4BQQA 3VXKA 4QT0A 1G5QA 1R5OA 2NV0A 1KS9A 4EUFA 4RK0A 5A5EA 4NHOA 5BR1A 3LLMA 1EVZA 2NU7A 1V4VA 3MCZA 2AW3A 4OEHA 1A9XB 4Q15A 3ZGYA 5JZOA 1C3EA 1G8GA 1Z2AA 3OEEA 1IN4A 2ODAA 3E03A 4GPD1 3AG5A 3WKDA 2X13A 1UIMA 3HJHA 3AOEA 5AK0A 4YRKA 1LJ8A 1QLHA 2P35A 3FR8A 3PK0A 1YNOA 1KZ4A 5AJHA 2O0JA 3Q8WA 5DK4A 3RRZA 4A5OA 2I55A 3IQGX 4WKOA 4HZUA 5FI5A 3HBJA 6LDHA 2VNHA 4FYMA 1YOBA 2YN2A 4AYTA 5EZSA 4YGXB 1GWNA 2I1QA 4AX4A 1QK3A 1KSHA 2QXUA 1THTA 2HXSA 2DFVA 4HHEA 1PQUA 4K05A 4LRSB 1VFNA 1BE1A 1PGNA 1THGA 4L8YA 2ZJOA 3WB9A 1JV2B 3PNQA 3VR0A 4B8YA 4LDZA 4NYIQ 3QPVA 3ZWNA 4O29A 1VHQA 2R6CA 2VHUA 5E8JA 2QPLA 3FZEA 3RYCB 2RAFA 3GMTA 3K5WA 4NF2A 4X97A 1GZ4A 1K5DA 2C83A 2CVFA 3G17A 2NVOA 1JDPA 1SCBA 3AHGA 4HY3A 3SYRA 4DLLA 4YK7A 3EXHA 1RR6A 5K8TA 5FHRA 1DQSA 2A7QA 4K6CA 1KYQA 3C7KA 4Q3AA 4NL4H 5K8CA 2PUAA 1APBA 4HQKA 3HK2A 1BCSA 1HEIA 1QCDA 2ACKA 2R00A 5J9FA 2QSUA 1IWOA 4L9SA 4IL5A 2AJTA 2ZWVA 2HA5A 4NPCA 2FUCA 2PMCA 3I2YX 3U9SA 2MIIA 1BQEA 3H5VA 1IDN1 1OH8A 1CR4A 1YXMA 4IH9A 3U09A 1LI4A 2VG8A 1S7CA 3VV2A 3V6LA 4AL4A 3THYB 1FW6A 3KSZO 2J30A 5CH5A 4CV0A 5EIAA 2X77A 1YF3A 1C9DB 3MWDA 2DHEA 4JC5A 4QLOA 3OD1A 1IE3A 5J5VA 4BKMA 3WGQA 5BMVA 5JJKA 2C3OA 2IXBA 3ROPA 1FIUA 2CLCX 1IC6A 2P2YA 3DEHA 4JSRA 1A76A 1G7TA 3W2EA 1AKYA 3ZD6A 1YB7A 3FSGA 3R9KA 4BE7B 2PU7A 3PJGA 4N3GA 5I47A 2C8JA 2XODA 3WL5A 4CL0A 4FP9A 1YBMA 1ONBA 3GAFA 3CRMA 4JT8A 5JQGB 2XYQA 1M6YA 2UKDA 3OQMA 3L8MA 1NA5A 3PHGA 1ETUA 1SXJD 2JLAA 4OHBA 3KJQA 3FGZA 1E6WA 4FN4A 4MLDA 2GXQA 5DBFA 4RKWA 2PGIA 1YQEA 3ANLA 3E8SA 4P33A 4QXAA 4F3RA 1U9YA 1D4ZA 4AICA 3U6KA 3J81k 4RABA 3P9CA 2LKCA 4BVBA 1QYVA 1SQGA 3IEVA 2QM8A 1FNMA 2WIGA 3AP1A 1EHCA 3GJ7A 3E7XA 4NQRA 4TKZA 3X1MA 1I8TA 4FMCF 1TZCA 1V8ZA 3LC7O 4RL6A 2QP3A 2JKYA 4DEVA 3KPJA 1F4VA 4JBLA 1NVVR 3RH0A 4JLNA 2AOUB 1YB1A 1JAHA 1CIJA 3DZFA 2VWGA 4GECA 4ML3A 4C9BA 5CEEA 1I0ZA 2C98A 5EWJB 1PVVA 1ZJ4A 2IE0A 4F9TA 3ILHA 1WWKA 1TU0A 4MW4A 3CTMA 1CY8A 4ZQHA 3D8RA 3W6OA 1AXGA 1RAIA 4YPOA 3DOFA 3RT7A 3VZQA 4H77A 4RD0A 3IT1A 2ASEA 4K2AA 1DBIA 1FFBA 1ZOPA 4ME6A 4Q19A 3PQ7A 2QLFA 3VTAA 4IGIA 3C6MA 4UHHA 1NE7A 4U7DA 1Q0SA 4GBGA 1N5JA 2R84A 4RJIA 1P7PA 3BXXA 4MVJI 1K89A 1OHHA 5HKLA 5JALA 5TIIA 4A10A 2GBCA 1U2GA 4R40A 3COVA 4WZBB 1E59A 3MSCA 1V3TA 3ISVA 3ZWXA 5A2QA 4XDYA 2QRVB 3HACA 4QTXA 3T6KA 1VOTA 2OCDA 1SVSA 2VF5X 2EBFX 3DD1A 2HBYA 2X0EA 3DAYA 4BLUA 4F6LA 1QG4A 4I4TB 1PWYE 2XDQB 3WO1A 3AVVA 3ANXA 4U9HS 1BE0A 4HG2A 3RHZA 1VDMA 4PPNA 5EY5B 3G82C 4RS4A 3HDYA 4PGAA 2CGEA 1E4VA 2YCBA 2AN4A 1Z6YA 1GFSA 1QCYA 3HN2A 4C0HA 4PO9A 2HBRA 2CBXA 3IJRA 1ODFA 3STYA 1DX9A 2Q2OA 2LBPA 4IDAA 1N5DA 1WULS 3EZLA 4UMDA 3LX6A 3VPXA 5HUQA 3DV0B 1C1XB 3GCGA 3C5HA 4CUZA 4RTMA 1PF7E 3GFOA 5JAOA 3A36A 4RO0A 4BNDA 1TM7E 1T3LA 4D98A 4DM4A 2B1JA 1S8AA 4GUAA 2WINI 2IKQA 4KQMA 2FFBA 2BGGA 3LZ6A 2ZRNA 4BGEA 3VBCA 1QPBA 1RM5A 3V7YA 4EIWA 1WNTA 4LOAA 2Q6KA 1CX9B 2OXRA 5F5LA 1BVHA 1ZQ1A 4YRBA 2F4VB 10MHA 3HM9A 1F17A 4QFBA 2JIMA 2CN1A 1NTOA 5T6MA 5C51B 2IOFK 3SZGA 2A5YB 1X7ZA 2Q50A 3CF2A 5ESRA 4E09A 5IYZB 3EA5A 2GPTA 2PM8A 3PRHA 3A4LA 1ZL2A 1UBLS 5AHXA 1EX7A 1ITZA 1SVMA 1KTIA 2AXQA 4KFSA 1NBHA 3UK6A 1FDIA 2HB6A 2ZE8A 1KWKA 3DHVA 2J9XB 4X84A 2YV1A 2X41A 1ZGGA 2Q2WA 3B6ZA 3D8NA 2XB9A 4LNUB 4X24A 2YYYA 2ZBDA 3BB1A 3A3NA 1PCXA 4YHHB 1EIWA 1X1BA 1DADA 3H1PA 4JC0A 3C7CB 4NULA 2Q3BA 2YWRA 1T8SA 3KL4A 3BC1A 1P8AA 3E61A 2AT1A 2BM1A 4OI4A 3K1YA 5IYZF 3U3XA 4YAKA 4Y6LA 4F45A 4Z9BA 4TMVA 3GLKA 1HYQA 2NUAB 3V00A 3F7TA 1SUFA 3ZJ4A 1A9RA 3O03A 3K6JA 3PVSA 5E1DA 2OYSA 3VDXA 1YS1X 3KQPA 4UTNA 3MERA 1VQ1A 4O1MA 4YDSA 2OCLA 2YIVX 1NLYA 2PLNA 3PQDA 4RDXA 2A0FA 4CLHA 4NJMA 1P72A 1T2VA 2ZPAA 3ESRA 4OUKX 2BLNA 1U3WA 1ZICA 2I65A 1YI8A 2GJ8A 2HN9A 2ZUVA 1DJPA 3E82A 1JTFA 2ZUSA 2HRBA 1NJGA 1Z6ZA 1JSCA 2BC9A 3H1AA 4BNYA 1IBSA 1T4DA 4CI0B 1FSFA 3ED1A 4GWKA 4UBJA 1NMZA 4QNNA 4S24A 3ZWBA 4NJEB 4HGQA 4UEWA 1JBKA 2OMEA 2C8LA 3FYUA 4PYMA 3JAWA 4Q4JA 1UUFA 2FVYA 2H54A 5F7ZA 5IAKA 3N2GB 2GEJA 1LRJA 1LBQA 5IN5A 3RLFA 2JFFA 5KBYA 3VZDA 3HS3A 5AJYA 3KU4A 4HPJB 1RI5A 2V54A 2EP8A 2NIPA 4QYWA 2DUWA 4RTKA 1J8MF 3C3PA 4J1TA 2A1UA 2CBZA 5G1NA 3WLAA 5TS3A 4M4SA 1WBDA 4YYEA 1U8XX 1YDMA 2C4HA 3ILYA 4OGGA 4PYRA 4RJJA 4Y2RA 2QX8A 1SVWA 3QVLA 5HBGA 2CEAA 2JFZA 2VUHB 1XTIA 1DARA 2D74A 2P9JA 3I64A 1L4EA 3B3QA 1M6HA 1N2XA 3KLOA 4UU7A 2XVMA 4IFEA 4BLRA 3DQPA 4DRZA 2HMAA 4NBLA 3MMNA 4C0QC 3U7EB 1USKA 2A0KA 4YXFA 5HIMA 1NRXA 4Z49A 5DDIP 4TWZA 4GX1A 2EZ9A 1O0SA 1A7AA 3EAQA 4WMLA 1KO7A 2FW9A 3UT5B 4WBNF 4YAIA 1QGUB 4JGBA 1J7JA 4DDUA 3ESBA 1XAGA 2I99A 2HLDA 3IEUA 3IOBA 1OFIA 2UUBB 2NM0A 1LTQA 3LPCA 5ES3A 4UFNA 2ZZKA 3U1VA 4I19A 4GMFA 5CDSA 3TL3A 1QPGA 1WY5A 1P4GA 2H2GA 3LH5A 2PDAA 2WKPA 3PGA1 3P9YA 4RW0A 5COBA 1Y5IA 5HIAA 3B1FA 1JGTA 4H7PA 1CP2A 1K7CA 1OX6A 4RSMA 2OL4A 1ENZA 1I7PA 2CK3A 1KVQA 2O2DA 2PZMA 1Q44A 5HF9A 5DOZA 3M3DA 4HEHA 2BD0A 1D5WA 5L3QA 1MQ9A 2R6FA 4OAPA 2NV6A 5K0TA 4HNQA 2R62A 4XCXA 2QZPA 3M6AA 1E1NA 2VOEA 2FMKA 1RCTE 1XNGA 2ZIZA 5AVZA 2A57A 1TVKB 2ATCA 2V97A 4NSNA 4IH4A 1CBUA 4LOIA 4KXNA 1I3MA 5EUQB 4W9NA 3OMLA 5JG7A 3O2QB 3SHTA 2YY5A 2B7BA 3PF8A 3TSWA 4B6OA 1O97C 2GN4A 3JVIA 1YU6A 3COYA 4MO2A 2DGDA 1SCJA 1RP1A 1WCYA 1Z8FA 4AP9A 5L53A 1QR2A 1P4RA 2QV0A 3HJGA 2YJTD 421PA 2ZE5A 3DOOA 4HQ6A 4LRQA 3CLKA 3OC6A 1JG3A 4LXQA 2WUEA 5G41A 5THXA 2ZRJA 5DLYA 4IOKA 1NP6A 3P0IA 3QYPA 5BQPA 4ZDWA 4BB9A 4ZCTA 2M6KA 1KOLA 3N87A 4MQ6A 4TTJA 2V7TA 3E84A 2Z4RA 1J0EA 3JQBA 2QTVB 4K9PA 1MX5A 4NVRA 1JEDA 1GV1A 1TPZA 3PC2A 4MQUA 2COUA 3ANTA 3TIGA 1C1YA 5CIQA 1NUHA 3E81A 1JQKA 4J4BA 1HE2A 3W6ZA 1JZQA 1WF6A 3RUFA 3D0KA 2H4JA 2FMXA 1WMFA 1MB2A 2XUZA 4C7MA 2G1KA 4TSFA 3H9BA 1QP8A 3WXMA 4F60A 1UBMS 4DDWA 5K3FA 5CCXA 2QD3A 3LF1A 2WJHA 1P2UA 2W4QA 3R0ZA 3ZE9A 2AOTB 4W1RA 1N2CB 1OFVA 1K6JA 1XKLA 1R8SA 1ZW6A 3H5LA 4JLUA 4OXQA 4N9QA 1RRMA 2A1TR 2NNLD 5LP6B 1U8CB 1ZOLA 2TSYB 4MWCA 4OTZA 2VJBA 4NHEA 221PA 4HWOA 1O08A 3I01M 4RK6A 2QVZX 1JG6A 4AJ9A 3L0OA 3NBXX 4CT4B 4FIDA 4DSUA 3CT6A 4ZU1X 2WVHA 2OA0A 4XD2A 2Z1NA 2HQBA 4FYKA 1JYFA 3N8DA 4HDMA 1JR6A 2FXIA 1KHTA 2ZS7A 4CMEA 1QH1B 1GUYA 3EIEA 5IWCA 3V4ZA 2Z08A 1HE1C 2XEXA 5HDBB 3LY9A 2H5EA 4RV9A 2JJ2D 3T5CA 3IE1A 3KXIA 1BC5A 4FE3A 5LP6F 16PKA 1CJCA 1OLSA 5BNIA 4QDTA 1P7ZA 1AXRA 2B98A 4QQKA 4NNJA 1E6EA 4QPZA 4JHLA 4B71A 5HIKA 5KCMA 4ND1A 1CRWG 2Z2IA 4XTCS 2RFLA 1WSWA 3ND5A 1JHVA 2VJDA 4JX9A 5A9SA 3DMHA 3H3JA 4XVRA 1NU8A 2VTDA 1RBQA 4XR4A 1QIFA 1LY1A 3BD6A 3IEXA 4N6OA 4S04A 4FFMA 2YIMA 3HKBB 2W2TA 3X2FA 5IC4A 5LZ4A 2IRWA 1SVKA 2WUDA 5KQSA 2FWJA 3D6UA 3S7TA 5C4IA 4JOBA 2FE4A 2JAHA 3CT4A 3DE6X 4QBHA 2UZ0A 3SQDA 4G5OA 4EBBA 4XKJA 3W5BA 4TMFA 3SBOA 3WWEA 5EJ4A 2A9PA 1ESDA 2V74B 1F38A 2JAQA 4MSUA 5J2UF 3EPHA 1ISGA 4PO3X 1FP2A 2WTUA 1HUQA 1O94C 1WCXA 1PJBA 4V0SA 4TTIA 5J47A 1Z2EA 3NWBA 5CLGA 4KPYA 4IQFA 5JSYA 3RWBA 5TX7A 4K87A 3RTCA 3IEMA 1BW9A 2OQIA 1T2EA 2FKNA 2Y05A 3N75A 1WHSB 3MCVA 2QF7A 3KFXA 2W42A 1E2LA 4L22A 1B2LA 3HUEA 3HXPA 2XE8A 2GI4A 2GTPA 3AHHA 1M2OB 4K1LA 1BGWA 5CLJA 1E3MA 1IJKA 3BJRA 2IU3A 3BN3A 2IDKA 3BJMA 3EE6A 3QXCA 3BRWD 4P1ZA 4QXMA 4U7FA 6REQB 2VSFA 1A77A 2K6GA 1Z28A 1US8A 2EJUA 5HS6A 1WMDA 5FTJA 2W22A 1T5TA 3PGMA 4C1BA 2GK6A 4DGSA 2JJQA 2VHVA 4HS9A 4X20B 5C7IO 4ZVVA 3KELA 4GPBA 4HX2A 4Z9AA 4E32A 1G8MA 4C4TA 4C22A 2QRGA 2PU5A 5E6SA 1TTHA 5HE9A 3HDTA 2COEA 4MPTA 4B82A 1SUEA 4DMKA 3L7OA 4N48A 4Q3LA 1C3OA 1F7UA 5AKYA 2RHWA 2DPMA 2R97A 4P8RA 1P75A 2XYVA 4UZSA 2WMYA 3UJPA 1ZI8A 3ZDYB 1GSIA 3LXXA 3LUHA 5KYVA 2X5XA 3ZE0B 1CYDA 3IP8A 4P82A 5BURA 1RSZA 1EEHA 2FG6C 4CIXA 3N6XA 3NVKI 1PLKA 4P4SB 1EGQA 4FGUA 2EX1A 4Q4HA 2G08A 2J3JA 1JDSA 1GRQA 1ISIA 2VJAA 2IZ1A 1PJZA 1DRUA 3FTCA 4X8OA 5GM2A 4G1BA 3ZWKA 3G7NA 5D51S 4RJTA 2FE1A 2NSJA 4NK4A 1GGEA 1RPTA 3CUSA 3T3GA 1JEEA 2A14A 3PT5A 2YV3A 3O6VA 1NJFA 2H9AA 1MDFA 3R3SA 3OX4A 4WNYA 1PL8A 2SECE 3R5KA 3TUIC 4C08A 1GSAA 2QYSA 1SC9A 1E2BA 4TV9B 5KQGA 2FJPA 4KYUA 5DP1A 5IDQA 4JR1A 4XB2A 2NXJA 1HQCA 1YIDA 4MCIA 2AV6A 5JAUA 2G71A 5FPHA 1IIBA 1O9GA 2HCFA 1LSJA 2VKTA 4DBZA 2FWBA 3MYYA 2C9MA 1L4HA 3Q2IA 5BQ5A 4C7XA 1DFIA 4HB2A 4LHYA 2ZYVX 1U2TA 2UVPA 2WLTA 1V9SA 4NMWA 1HYGA 1Z38A 2YX1A 3GDWA 1YL7A 3QEJA 2IV2X 1TMOA 2GO7A 3RC1A 1XRQA 4CM3A 1M2EA 3K0KA 3THXA 4COKA 1PZHA 2ZQZA 3FAKA 3K0FB 1VCOA 3MWYW 2WF6A 4CG1A 5T4BA 2PQ2A 2CHFA 3PKZA 3E9DA 1EP3B 2O9JA 4C78A 2CUTA 3H13A 1NXWA 3EEOA 4GE3A 3FW1A 4TROA 3R23A 5F5NA 5AKZA 5LB4A 5ALXA 4KUEA 2A6PA 2ERYA 2QLNA 2QMQA 4EA6A 3LVFO 4JLKA 4L4ZA 4OM8A 3I5AA 5ALMA 5LBIA 5T67A 2OGWA 3FTNA 3KEGA 2WPDA 3A3YA 1XQVA 2YVUA 3KFVA 3OIWA 4Z0HO 2IEDA 4BB5A 1OX4A 3FMVA 3OQ6A 3P97A 3H2SA 1ST2A 1ZBDA 1H6DA 3H75A 5H80A 3LKZA 4E14A 4WOPA 3GT0A 2ZPUA 2IY9A 3AVPA 5AM5A 4DQDA 2AHRA 2QZ4A 4NYMR 1V16B 2F59A 2BMAA 4NZ9A 3TAUA 2ZSEA 5IUNC 5IVPA 4IXWA 1BAPA 1E7WA 3JQAA 2OGZA 2VAVA 4JYPA 3K0CA 2PWYA 4R2WA 1GAQA 1GUZA 2FRDC 5ADWA 1GSHA 1QCZA 5GJVC 5EZYB 2A1TS 3I23A 3AJ8A 3QY9A 5KNCD 1WOYA 1B8VA 1DTWA 1NLMA 4RVGA 3U1TA 1XZNA 1JFFB 3LRXA 4I1UA 2PK3A 2ENUA 3T94A 2AG6A 2WTMA 3PPIA 4JA2A 4KXFB 1NW5A 5KTYA 5EHNA 4LTNA 2C58A 2AMLA 3H7AA 3L46A 3OCZA 4V3BA 2VTBA 3E3LA 1Z63A 1KVTA 1T4GA 2IYUA 3KM0A 2C29D 3BCUA 2HJVA 3LUAA 1OZAA 4PG7A 2Y9PB 4RA9B 4EY5A 2YIJA 4Z7QB 2GEVA 2YJZA 1XOIA 4L4SA 4A9AA 5TVKA 2KBFA 4H6VA 3W6NA 2R4TA 1T1SA 3AHDA 3BORA 4G86A 1IAQA 3QVXA 1PWXA 1X80B 4QXRA 5AW5A 1NFFA 3CW8X 4PLYA 4JV5B 4PAWA 4KQIA 4M1EA 3SKYA 1KIMA 5AR1A 3UGQA 2HT6A 1ATZA 1G21A 3B8HA 2ZUDA 4E15A 2F1OA 1AG9A 2HU7A 3SKXA 3OECA 3N0XA 4EF5A 1RFGE 2NWQA 1TQ6A 2QNIA 1N5MA 2JFVA 4E5SA 1FRFS 5C2JB 3S55A 2JLSA 3LQ4A 4GLFA 5CR9A 4XIJA 4Y9UA 3NPAA 4UZEA 1JHDA 3E3AA 2R68A 3PHLA 4IQGA 4NOJA 4ARVA 4B6PA 5L4LA 1YCGA 1G60A 1O7JA 2I6QA 2FOLA 4JXZA 4HDRB 3S5UA 3K70D 3ERCA 1KDOA 4JGIA 3T61A 2QW1A 1UADA 3EISA 1ADBA 4GSKA 1U0RA 5ELLA 3UFBA 4PX3A 4A23A 1Q12A 3COZA 2H59A 1NGSA 1EM8B 3D0RA 2WP0A 3A4VA 4NFHA 4O5AA 4O3FA 4XIFA 2H5IA 2YZNA 2C5FA 1GPAA 1Q0UA 5AKEA 1HNNA 2BGLA 4MUXA 3E6AA 1UINA 1KYVA 1OXXK 2DM6A 1RXUA 1PJ3A 2IYTA 1Z45A 2PLRA 2XGGA 3OURA 1AO3A 4KDCA 3H8WA 2Z2XA 4NR0A 3ZY4A 4UCXA 4EJMA 2PTGA 1KKUA 3PD1A 4WTOA 1I13A 1UP4A 1TVCA 4WRRA 5DF1A 3RV4A 4H7IA 3ZV7A 4G5HA 4IJMA 4W4TA 3CX3A 2QVCA 2DULA 3AM4A 4J7CA 2P9BA 1GGKA 3LW8A 2I67A 2IHBA 3WMWA 4MR9B 1CLUA 2AG1A 1O6BA 4LZAA 4Q3CA 1LDNA 3T0FA 1OZHA 3MQFA 3W4KA 1X92A 1FFGA 3C8ZA 2A4KA 3N2KB 4MV9A 1TM4E 1J9EA 4RAQA 5G0UA 4X95A 4ZC1A 1AQJA 4H0CA 5CK4A 3MJHA 4OKIA 1YHYA 4IP0A 1PL7A 3GB9A 1PD0A 4PRYA 3KOUA 1M9NA 2PQ6A 3CW9A 4D4HA 3D64A 2FSHA 3U7FB 1N0VC 4ZYVA 1F14A 1VKJA 3BFVA 5KSPA 1Z6XA 2ZUUA 3EFBA 1I30A 2H4ZA 5A06A 3KIPA 1Y5LA 4DEXA 4JBHA 3FCEA 6REQA 2X3YA 1L1QA 1I2CA 3JZMA 5AKJA 5EZ6B 1E5LA 1KRHA 1RYEA 2TMGA 4GGOA 4RZ3A 3R3XA 4EGCB 1AMUA 4C5BA 2M98A 1T3GA 1XZGA 2IPMA 5H3LA 4U5QA 1JECA 2XRMA 4IIJF 4K2HA 1PUIA 1W6UA 2P9ZA 5FL7D 5MFZA 1LBIA 4Q4CA 1CJKC 5D01A 4MV8A 3H1TA 1I24A 4UFOA 4DQXA 3FMGA 3LCMA 3I0ZA 3AERB 4AF7A 3CH5A 3GJXC 3NH9A 3G6KA 3WWOA 3A0RB 4O4JF 4W7SA 4DG9A 1BD3A 3NGMA 4MGEA 5ICMA 4DMCA 4EVRA 3CZMA 4KMRA 2OXFA 3TS1A 3X0DA 1UPTA 3FMPB 4CN9A 4MS3B 1XPUA 4XJSA 1DKRA 1MRSA 1Z8NA 4RPJA 4X41A 3FNRA 4CI9A 1QIMA 1QO9A 3HHPA 4V0QA 1KE2A 4GGPA 3PT9A 3MW8A 5KTOA 3HBLA 1FRZA 1E7RA 1OYOA 3NHWA 4FFNA 4P3YA 4MWOA 3DW1X 4M22A 3QEOA 1ZN2A 1EFTA 3A4NA 2A1IA 1E3TA 1SIWA 1DO0A 1Y3HA 3WK4A 1YZQA 4J29A 1LSUA 2X7JA 4C2TA 3VDMA 1XVIA 5BUZA 4CR8A 1CZNA 3GLUA 4QBIA 3KKKA 2F3QA 3IL2A 1OLSB 1FPQA 4PQYA 2P2GA 2PO7A 4JT9A 4WZ6A 5TEWA 1VHWA 4EG3A 1ULSA 1MB3A 1RABA 3JPWA 4N9WA 4GI3A 1JKFA 3H6GA 2AJLI 1HTTA 1RDFA 2PVSA 2AOWA 2IXFA 2XF2A 2ZYSA 3ABZA 4TVKA 4Y6GB 1W4AA 3BGWA 1VB3A 5AM0A 2JF0A 5B7PA 4HLNA 2ADMA 3HV2A 3R7DA 1XWWA 2DH6A 2FVXA 2EJTA 3B3FA 2YJ6A 3OWHA 3O1IC 4PLPA 5AVJA 3CX8A 4B17A 1W8DA 2XAAA 3LX4A 5GWXA 5EJ5A 4B34A 4KREA 2EQ5A 5K5EA 2NU9A 3KNZA 3RYFB 2LVBA 4PINA 1MAAA 2VNKA 1JA9A 2XAUA 1HK7A 4HSGA 4OOEA 4WI1A 1D6NA 3QX3A 3OOWA 4U7JA 4E33A 3K8ZA 1JUDA 1ZINA 3JD2A 4LYDA 5AQEA 2ONKA 1XJ0A 1MO4A 2G5TA 3GVXA 4NV3A 5EJMA 1YR7A 3HMQA 1VJ5A 2WOOA 4IS3A 4NAHA 2P68A 3IPAA 4PWYA 4JVSB 2VCHA 3UKOA 2A5DA 1OI3A 2ICAA 5GZ1A 1A4RA 4EPVA 3NTXA 4Q7LA 1CHNA 2I8AA 4JNCA 3T7CA 3L4SO 4WLUA 4PCUA 1XVVA 3EPKA 1WSAA 4A82A 2O05A 1QQAA 4W5HA 4I08A 3BGIA 5FUXA 2GB4A 2AZMA 2W00A 4E1BA 5KU7A 2GN1A 1R8XA 1BWQA 3UCFA 1Q5PA 2AL7A 5BVGB 4EAAA 4UAJA 3MWEB 4FYJA 5JMOA 3GRVA 3QGMA 3HJTA 3VNUA 2GT1A 2XIQA 3OESA 4HSEA 1K7FB 3QM1A 4MR8B 4TM7A 4W5WA 2R0QC 4M83A 4LAFA 1OQAA 4LKRA 2A5LA 5EIWA 1KYXA 5ELMA 3WNVA 3UAOA 4DBVO 4JL5A 3HYTA 3QNMA 3OY2A 4EA8A 1H3NA 1ZCAA 3JAKB 3N53A 2DEUA 1GG5A 1OA0A 4IDCA 2GCOB 4LISA 5IKEA 2ZIGA 3RG2A 4GG1A 3HY4A 2BOVA 3KQYA 2E37A 1HDCA 3G5UA 2RH9B 1NUQA 3FVVA 3P2EA 4HLCA 5CW1A 1Z15A 4ZT2A 1UFKA 1BFUA 1YVRA 2W6CX 3HGQA 3SR4A 3VFDA 4E30A 1YFJA 1R8YA 3IAHA 4L28A 4BFZA 3LLVA 4OHVA 3I3OA 4QRHA 5AJTA 2W6PA 5TC4A 5TMPA 3DNMA 3OI7A 1UBRS 1R0XA 3RJMA 4UQPA 1U9IA 4QGSA 1FFEA 4P7FA 3RC8A 1YDEA 1EUDB 3IERA 3PYLA 5G1OA 3EGVA 2R85A 2O5EA 1OBFO 2OB1A 3RS5A 5HFAA 3HNOA 1H2EA 2QUIA 2W6JD 3EUEA 5AW7A 1V41E 1W30A 3MVEA 2CLFB 4CKWA 4CCYB 3ZOZA 3ZQ4A 2FW7A 4QX6A 4W5RA 1N3YA 4JROA 2ZR0A 3ENZA 4XJTA 1A95A 2HQSA 1CETA 3MUNA 1U2DC 1YRLA 3DZIA 1JFLA 5FBQB 4ES6A 2J45A 4H31A 5AOAA 3DLIA 5HOQA 5L9AA 3CXUA 3GLGA 1K88A 1OFUA 3I61A 1MCZA 3A1DA 2H0AA 3VR3A 1AGPA 2CK3D 1CS4C 4QBTA 4K86A 4XQEA 4BX3A 2AOUA 2QRPA 4YRMA 1E2UA 4KV7A 3BGSA 4HRAA 4XUEA 3S27A 4BTVA 5JW6A 2ZWIA 2XTZA 3NBZC 1E3QA 2UUPA 3LY7A 4FOSA 1N6PA 3S70A 3TWOA 4H4CA 3BRQA 1ZGZA 4Q48A 2QT0A 1DFGA 4KQXA 5E38A 4PHFA 3X1WA 3ZY5A 2GFQA 2RGDA 3GC6A 1NI4B 1NMQA 3PZRA 4PLZA 4R69A 1Z37A 1RAHA 3AJ9A 2CD7A 5ER9A 2H1LA 3WK7A 4ETWA 1ZAYA 1F3LA 1U8EA 2YMLA 3C45A 2J46A 4ZT4A 4LOHA 3N7UA 3FLAA 2FUNB 3KWFA 4WUTA 3EAFA 5HJ5A 4GF5A 4IS2A 5E8RA 3ZWMA 4B9EA 2XZTA 4UCWA 2IHJA 5JS6A 3KQKA 1ZSYA 1F0KA 3STUA 2JRCA 2FPIB 5L7TA 3HYSA 1SH7A 3SY8A 2JD1A 3D43A 1BCRA 3MB8A 4C6RA 1LV7A 1Z39A 4QREA 3LBYA 3TPCA 2YJ4A 4JODA 3RASA 3QEMB 4UU8A 3MBIA 1RT9A 3CLHA 2DETA 5JARA 1TUBA 5HEKA 2PX2A 1WDLA 1L7NA 5TSDA 1G2IA 1NBOA 1X1RA 3IUNA 3X43A 4JLVA 5TE9A 1PQWA 3P2MA 1U8AA 4UCQA 1XRMA 2HPVA 4XE5A 3WGKA 3WNQA 1U7ZA 3ITKA 3FWYA 3G1TA 4OXXA 4B4OA 4DN6A 4E70A 2BKXA 2EARA 2HU8A 2QORA 5CFQA 1WA5A 1JSRA 5CM2Z 5AIBA 4AJKA 1OKKD 2FV8A 3AR5A 4CDRA 1Y80A 3WYAA 3GPDG 4OQLA 3NB0A 3EIUA 2VTBB 1G291 2WNSA 3AUJB 4HGPA 4R9UC 1SWWA 2X0KA 5DCUA 4DUYB 4ZCRA 1SG0A 2EQBA 2GKOA 2J5BA 1FLAA 3C8HA 1QOPB 3ODGA 4QRIA 5AI6A 5FAXA 1XMQB 1LSOA 3RSGA 4WACA 4IF6A 2WSLA 4RD3A 2BR3A 4WZAB 1LJUA 4AY6A 3WMFA 4X1KB 3V7WA 4UAVA 5E6RA 4GNRA 3IHTA 5BSEA 3PG5A 4WK6A 1WABA 3NEPX 1ZIPA 4NCXA 5FLYA 4AY4A 1P0FA 2QXYA 1N1MA 3IP9A 1CUJA 2Q28A 4XFKA 3MWLA 5ECYA 1Q15A 2C9OA 4QU0A 4CG2A 2LR0A 1VLLA 3U7RA 4QD3A 5FNZA 2C7BA 4AJEA 1V39A 4HCJA 4L6IA 2PY6A 2VRCA 2X5OA 3GLHA 4MQFA 1DX4A 2L17A 2VZLA 4YONB 4DMFA 1D6MA 1KO1A 3MZ0A 1OGYA 2EEZA 1WZCA 5EIBC 4M36A 5DU2A 1KVRA 1R88A 2V7QA 4KRXA 1DKOA 5DYWA 1FYEA 1E1LA 3QMWA 1ZOIA 4TWBA 1EDEA 4XSVA 4AJHA 1EFAA 1G4AE 5CLQA 5IVDA 2X0IA 1SCAA 1C30B 1I4TD 3NO4A 3UCEA 1V5IA 2ZUTA 5KTMA 4XWWA 1SKUA 3M1LA 2WKWA 3RUCA 4GBJA 4J0JA 3ZHUA 1R66A 4L2IB 4D96A 2VNSA 3LC2O 4J03A 4R83A 3WAGA 1UMBA 1E5XA 1RLIA 3TLGA 4Z7NB 4OUDA 4FUQA 4ZT5A 1LU9A 5LLDA 2IXAA 3ZI0A 4ALLA 5KJ6A 1SIUA 1WXFA 4PPGA 4Y6QA 2AJ8A 3MWEA 5D1NA 4B85A 5EP4A 1X0VA 3K0HA 3PLAE 2EIXA 2EZ4A 4LDJA 4F86A 1BXGA 3USES 1N2EA 2V9PA 1EM6A 1CD5A 1CR2A 2B0CA 2D2XA 2HKIA 2R00C 3BH0A 3K73O 2C1ZA 4HLQB 3CZ5A 1VM6A 2YMMA 3HKCA 4P92A 4UTZA 4XDGA 4JXKA 1NNUA 3OHSX 3DT9A 5HCNA 1YQGA 3ZHXA 3SC4A 4CKCB 3UGJA 4DLBA 1GCOA 3IIJA 3P2JA 3PC7A 3PC4A 3R5FA 1N3LA 1K97A 1AUQA 1J8YF 3PWZA 1ODCA 821PA 1M2VB 4H1TA 3RK4A 3TZHA 2RAVA 5BN5B 5MF6A 2C2OA 3GT4A 2VBFA 4UU0A 4C4AA 3RC9A 1Q3KA 2XCQA 1NR5A 3PGJA 1CYEA 4JP2A 1UDCA 2Y1CA 1Y82A 4WUVA 3AU9A 1DIGA 3LE8A 3N3BC 1SULA 2B9EA 2WTNA 5ILGA 3TOVA 4HADA 2HTEA 1WSBA 3MQ4A 1AZTA 3OJXA 1UMCB 4FX5A 2F3PA 4IWYA 5BNZA 2I3AA 3DZ8A 3N2NA 1SOUA 2CE2X 2YBDA 2PX0A 3D7SA 2ERXA 4IMIB 4AD8A 1XTTA 2C8KA 1QZUA 1XCGB 3QX7A 4DBLE 5I7FA 4C2UA 2W48A 3FHCB 2Q9UA 1DV1A 2JGEA 1P5ZB 3OTHA 5KB3A 2OFXA 5CXXA 1Y1TA 3M2PA 3PGKA 2VLBA 2Q2NA 2V59A 3EVNA 3GJ5A 2BL4A 3PDIA 1KFBB 2QK4A 4FU0A 4HH3C 4RFVA 3A1SA 5BW5A 2FPGB 4XI9A 5LLSA 4HEA1 1P9LA 4R3NA 2XE7A 4OSEA 1SCDA 2NO0A 2WT4A 2XA1A 3F6BX 3UV3A 3AVXA 1E32A 1GFIA 1SKAA 3A3OA 4X6YA 1HWYA 3WYCA 1TC1A 1WPRA 1P6QA 3C3XA 1V6CA 4F3CA 3NKLA 4IO1A 7REQA 4E4RA 2OG1A 1ZNZA 2MYUA 2UUOA 1TRHA 3JATA 4LJ8A 1KDYA 3F7MA 4X3OA 4I6GA 1NUTA 1J00A 3E58A 3F6RA 2IYWA 1JFSA 4D3XA 2VCYA 2JIRA 4LXIA 4II3A 1UBEA 4WK0B 4JI5B 3ZS8A 4AAYA 3M6IA 3HEAA 4BZWA 5KJCA 1U5BB 3T0IA 1MHTA 2BONA 5EHQA 5IXJA 3G2LA 5DJ5A 5HCIA 4DGQA 1MRZA 1T36B 4OHYA 3JD1A 1OOEA 4DIEA 3OM9A 1UKBA 1WX1A 2VDNB 1D2CA 4CTJA 1THZA 1XZMA 4G1EB 3HR7A 4DRYA 3WLQA 1XFAA 4MUNA 3BGOS 2GBGA 2OHOA 4ZO7A 2CF5A 2BP7A 3BCRA 3NT2A 1UP7A 2O1EA 3ROGA 2QYTA 4JUDX 1SU6A 1NRJB 1TVKA 2VBGA 4Q1BA 5JCJA 3UV7A 1CUWA 3L40A 4I8XA 4WA7A 3R3WA 3NDJA 3LKBA 2VZ8A 4OQFA 1P18A 2FOXA 2LE0A 3PJEA 2IIPA 2ODBA 1UT8A 1LQUA 3P8ZA 3TQHA 3ZLUA 2Z6UA 4GLJA 1X70A 3CBQA 4IX9A 1EU1A 4M98A 3ZDFA 2C0PA 3G9UA 3IVCA 2GVDC 4K9QA 4AX8A 1V9LA 4BVHA 4MKRA 4YUVA 3VO1A 1TYDE 4B2YA 3G88A 6ADHA 5J2UB 4D9FA 4EG8A 1HBJA 2AIRA 3NX4A 3BTUA 3IO3A 4OLAA 3ZDBA 2WICA 2CEKA 3BA6A 1L6IA 2G25A 5AWFC 2EHDA 3WLNA 4ZMRA 3ME5A 3QPBA 4JDPA 1Z8DA 1E1QD 4P4NA 3A9RA 2E6KA 3CH4B 4ETIA 4U4AA 1P17A 3OUTA 3REGA 1XPOA 3UW1A 1KZHA 1E2JA 2GBFA 1TCBA 3QBVA 1MT0A 1ZDMA 2I7TA 3GJ6A 1BGVA 1RQRA 5EP3A 2PS0A 5ADUS 1JPUA 4OHCA 2F8TA 3ZUPA 4YRCA 3PXEA 3AETB 2Z2JA 1TTQB 3G0DA 3O4IA 4DLWA 3WA6A 1DC7A 5EG5A 3WIOA 2JHPA 3QK7A 4I4NA 4PPQA 4XX0B 2P90A 7MDHA 2ATXA 1KP3A 2AC7A 3A9CA 4KITB 4NAUA 1CV2A 1N1EA 2XOXA 4XYLA 4LYGA 1ZXXA 2P0AA 3CU5A 3LV8A 1V71A 3T1VA 1YVPA 5C4GB 1UQUA 2NU7B 4UNQA 4F5WA 1KERA 3R5TA 3VPSA 4ARBA 3U6BA 4NMHA 3ESAA 1X7HA 3AKZA 1KEUA 2RCNA 4GQAA 4OLFA 3VMMA 5BQXA 1EVKA 3RRMA 2O8FB 2JANA 3DA8A 2FZCA 3DXXA 1ULUA 3A05A 3IPYA 1CR6A 1EE9A 1S2MA 3FWKA 4TRJA 5K8LA 1TJNA 5EHIA 3DF7A 1SBYA 1RBMA 1T8WA 4M21A 5DGCA 3K9FC 3BL8A 1L5YA 1U3VA 2ZRGA 2IGTA 4TN1A 5J4VA 4LE2A 3IDAA 2JDIA 5CB4F 1TOAA 4AQDA 4J0EA 1UP6A 5HK9A 5HRCA 3Q85A 4MS3A 4JLJA 3FJYA 2GCPA 4ITUA 5JXIA 1YH3A 1VLZA 1XZKA 5F5XA 2QM7A 5KCZA 1T9GR 2VN8A 3H2IA 1U63A 1FYXA 5BVHA 1TIKA 1UMBB 1Z6GA 4GH5A 3N07A 1X2EA 1ORWA 2JGDB 2QP9X 4XLZA 2NO9A 4XEHA 1BEUB 2WDZA 2PKRA 4KQ2A 5CEJA 2C5SA 3PVZA 2ZJ6A 4EFKA 2NYVA 3SIXA 1R27A 3A8TA 3AB8A 1R6DA 4OB7A 3RBZA 2GZSA 2Y1DA 4JX8A 4WJLA 5ALGA 4F2HA 1E2GA 2FW8A 1RWXA 2R6DA 4RMNA 2REBA 1KAHA 4UULA 3GMDA 1YKGA 1GNRA 3KP1A 5FPYA 3ENKA 1BA2A 5DTRA 2RGWA 4IIFA 3CRVA 2QQGA 3WNBA 5B30A 3FB4A 1KDTA 2B20A 4ALMA 4ZHQA 2JIPA 4URYR 5I7AA 9LDBA 2GD0A 5JE8A 1NLZA 4KQKA 3L3BA 2QPTA 4JEMA 3H6HA 2AKYA 3I2IA 2Z83A 1NXQA 1E9EA 2PIDA 2Q4BA 3V42A 3ZXSA 5KX5B 2GCEA 1E0JA 3GVCA 4G8CA 2WYUA 3DHEA 4KU4A 4R31A 4EO7A 1GZSA 3K9CA 1V1JA 1DVRA 1XTRA 2P30A 1ZMOA 2PT7A 1FFXB 4K26A 7ADHA 3HEBA 5DV9A 1W36D 5ARCA 3F1LA 1WDTA 3S2GA 3VC1A 3FYCA 3P32A 5CU7A 4M8SA 4Y2HA 3I4FA 1W94A 4C5CA 5JDCC 4G09A 3ADDA 4DFDA 2FSFA 1PG5A 2H2HA 2BGRA 1YJ5A 2NTJA 2VDPB 3IQWA 3MLAA 2YWFA 4OXIA 2ZI7A 3UOWA 5ENZA 4AY5A 4DC1A 1DBRA 1QZXA 2V6FA 2LIPA 4INOA 4DUGD 1G9XA 2JIOA 4KH0A 1A4XA 4QHYA 1P4SA 2VJPA 4WCFC 2Z5FA 4B7XA 1N9GB 3CUVA 1X7WA 2FWPA 1B2RA 3AZOA 4MB2A 1CZUA 2X7HA 4AJPA 1G2QA 4TV8B 4X63A 5D1HA 2QX7A 3HJBA 3EAGA 2G70A 1FNDA 4MWDA 1BH2A 5JSKA 5BN5A 4KQJA 1HFEL 8ABPA 1I7QB 2W8BA 3BWYA 4IRUB 1G59A 1EX1A 4JR0A 3FE2A 2Z09A 1TCCA 2R96A 2CLOB 4OHRA 1LI5A 4JC4A 1B00A 4ENTA 4EHDA 1PWEA 1TUBB 2HIGA 2BCEA 5ESDA 3ZGLA 3I5XA 3O7MA 3U5TA 3GG9A 4DDMA 5LR6A 3QVGA 2EWVA 2WNIA 3G49A 5CPFA 3I52A 4IZ6A 4WNAA 3EOBI 1D6SA 5BO5A 2I6UA 2AMFA 3E5NA 3A6HA 3LCVB 1EFLA 1NBWB 2XNKA 4OK6A 4BFYA 3CGWA 3OOEA 3B9RA 4H6XA 4RVCA 4P36A 3I9JA 4BNWA 3E8MA 4DKJA 2X86A 3DT8A 3DE7X 4XM0A 3A14A 2DLNA 4G0ZA 3ESQA 3TG8A 2HOQA 2OK8A 3WXBA 4YACA 2AWOA 2O0MA 2QTMA 2Z57A 2PNJA 3U3DA 3ZWDA 2V1UA 4BE4A 3FMIA 5BSWA 3PFNA 4A92A 4HDAA 1EDDA 1VJDA 2G9RA 2ZZMA 3G2MA 4BX0A 5GJBA 2O0KA 2C5BA 1O6ZA 1WV0A 4OMFG 5CM8B 4UARA 2HYDA 1O3YA 3CPEA 1KMNA 1W9MA 4DNFA 4EUNA 3BFXA 5F2OA 2VHCA 3TE7A 1Q7GA 1V9CA 1M66A 2AC4A 2RGAA 4MAFA 5CNMA 1TT5A 1D3AA 5KTPA 3U44B 2QR5A 4HI0E 4YY3B 3E9NA 1YA8A 3SSMA 4QECA 4CMGA 3Q7EA 1HOXA 1JHYA 1NP7A 2AZTA 4O2BF 1G4HA 3B52X 2VA8A 1I2DA 2F9FA 1JAZA 3KOYA 3ZGVA 1GP2A 2C4TA 4LW8A 3V8EA 3NFRA 4D0RA 1VHTA 4EFMA 5CLIA 2EF1A 3GW8A 4I55B 1Q7TA 2VT6A 3I3SR 3KSBC 2QROA 2HMTA 1KI7A 1PLJA 2YL2A 1YZGA 1OPRA 1DC8A 2C2MA 3FYSA 1MXHA 1ZMXA 4R84A 3BZBA 4CFYA 2ZIEA 4ZGGA 4YLGA 3TFOA 1JEQB 4HVLA 4B75A 3WGJA 1UZAA 1XXHB 4MLZA 4IZHA 4WDQA 4CKBB 2IEGA 3W5VA 3NP7A 1NUSA 3RADC 4R8VA 2BUCA 2JLXA 4Q9DA 4YJ3B 1O54A 2CF6A 2OZKA 1G6KA 4F72A 3R1IA 3OEWA 1YFZA 1C7QA 1O96A 4AMUA 1PJAA 4RIEA 4WDRA 4ICIA 3C70A 3UB4A 2PL5A 5BYAA 1O9BA 5JPIA 5H3HA 4EA7A 1PNRA 4UXHA 1B0UA 1A9TA 1P4AA 1BCRB 4BGUA 1R3DA 3KR1A 3QVVA 5D3QA 5ILQA 2I7DA 2WD8A 4ESOA 6Q21A 3GNSA 3OE7D 4Q1AA 5KWSA 1G63A 1W0JA 4PSKA 4EAQA 3IVMA 4GWGA 4U8HA 3HJUA 3E22B 4Y1EA 3WLPA 1EK0A 2GPSA 4ENQA 3W04A 2PXAA 3R6TA 1XU7A 3FUXA 3KXLA 4G25A 1XTJA 3SI7A 2H57A 3PXCX 3QU5A 3CF4A 4L75A 5AJZA 2Y4OA 4MINA 1U3UA 4J6EA 1U0GA 5DNVA 2MINA 3KVVA 4ND3A 5CB6A 3FSGD 4PLCA 5MN6A 4QNMA 3QMVA 3VPDA 1ZRHA 5BP7A 1MC4A 5J3JA 1CZLA 1VBFA 2A5GA 2IIVA 2FJ0A 1L5RA 1A0OA 3KRTA 1WO8A 3P71T 4CMKA 4ZREA 3FOAA 3KCQA 3CVWA 2O3TA 1T0HB 5AVWA 1G8SA 3M83A 4YT5A 3ZQ6A 3LU1A 4L6AA 1Q1GA 2FPKA 4UTRA 5JCZA 4KXYA 4FW8A 5ALVA 3NIDB 4NU0A 2WF7A 3LCUA 4TZKA 2B61A 4WKNA 5CLLA 3TSOA 4LFBB 1DI0A 1PEAA 1NY6A 1QYDA 2ORWA 4L51A 2X8WA 3KJGA 5F12A 3NDBB 5K0ZA 1KZ7B 4ZN6A 4RE6A 5AUPB 1TEXA 3G0BA 2DT8A 2GLXA 2J3QA 3GO4A 3PD0A 2WOJA 1QVRA 4BOYA 3SE0A 4J0KA 5HKKA 2JEZA 2YS7A 1MFZA 2ZYDA 5L40A 2WE8A 5B1DA 1YCHA 1A88A 3HI4A 4NBVA 1F5NA 5FTKA 3HA3A 1EXDA 5E6SB 3UWMA 3H1BA 3K35A 3I6BA 4GVPA 4HDSA 5TPWA 3SZOA 5JO0A 2XKKA 1PK9A 4LWQA 1U7DA 1NASA 4PGMA 3SC2B 1OVMA 2E55A 1UM9A 2HWWA 1Q6YA 1XQ1A 4M9QA 1XU4A 4EDHA 3FKJA 1N6NA 1S3GA 3H2ZA 1ZJZA 2BM0A 3PFIA 1ONNA 1IUPA 2PZBA 2FKAA 4V1CI 5KREA 2SKDA 4P4GA 2QJRA 4Q1EA 4P22A 3ZNPA 3UGKA 3DZJA 2HCJB 3AZQA 1ZHOA 1UBKS 5DN6A 4POOA 5B3JC 4BS9A 4A0FA 3DB1A 7ABPA 4ZQBA 4M99A 4FNGA 2QRHA 1E6LA 2EW2A 1E20A 4HDCA 2X1HA 3FPHA 3STTA 4G3XA 4CM9A 5K3OA 1XVLA 2G4VA 4IGEA 3MF4A 5AI0A 5GM1A 3PR1A 1BXKA 2EOAA 3Q7SA 4O8ZA 1P0PA 5G02A 3FPSA 4ZOQI 4MUHA 2O8DB 3MPUA 4URWR 1E96A 2NAFA 1CUBA 5LMZA 3T5PA 1X7DA 2QMHA 3V1NA 5KWVA 4FEGA 4QOJA 3D5QA 1ATIA 2QXTA 3EZFA 4J1SA 4H6PA 3AT1A 2FWNA 3OJ0A 5J5AA 2D8MA 3F9IA 5FI3A 1I51A 3Q4GA 4W82A 1GQSA 1PR5A 4JBNA 2JEOA 3WG9A 2L0XA 4RTSA 1I5OA 4IV0A 1FMTA 3NEJA 3QE3A 5TGDA 4U7WA 4HEA6 1UQTA 4PX2A 5JY1A 2VRBA 1KYZA 1XMIA 2B8EA 2FG7C 2V0NA 4MS4B 4BMOB 2D06A 4L8WB 1OI7A 4M0FA 5NLLA 3ZWVA 4CIAA 4JBGA 1RMTA 3JZDA 3HFGA 1I9GA 3BSSA 3I4LA 2HSDA 2NG1A 1XD2A 2PBZA 3QJGA 4MEAA 4Q3BA 2FHPA 5ED0A 3IR6A 3NYIA 2X42A 2FPLA 2FUG1 4LYAA 1GGNA 4TMYA 5IYZA 4PZDA 5HE8A 4DLAA 1Q11A 1R9NA 1QGED 1W4BA 2WY2D 4RF5A 3TBFA 5CD1A 5H70A 4LOJA 5JHHB 3ANSA 4F5ZA 1HZJA 5JNVA 2CNBA 1QJ4A 3Q8LA 3G9QA 4KIFA 1RKXA 1XCPA 1C14A 4AO6A 2FA9A 1KSFX 1NQTA 2F62A 1UDWA 3D3QA 1ZMBA 2LCFA 5KVAA 2BEVB 4PM4A 4CQMB 3PFWO 1ZRMA 2F43A 2QRNA 5EIXA 4W5TA 2QL7A 4XA8A 5FULA 2CUNA 3U3OA 3OVMA 1S2DA 1LPMA 1O03A 3Q5DA 3T7SA 3TTXA 1PE0A 3AM3A 3FHLA 3PENA 2Q1UA 1H5QA 5H9VA 2ZCVA 3VDRA 4EYKA 1QF6A 3L5OA 4L72A 4PLGA 2JFQA 3AUYA 1JS1X 4PYIA 3FOCA 1U5CA 2A9JA 3KG2A 4W1QA 5CJJA 4DBLC 1I4LD 1M5UA 2JG3A 4DXDA 5I7UA 4JCCA 4OHFA 2C20A 1OIXA 1N2BA 4GIBA 2PGOA 3M33A 5AK3A 3VPCA 4WASA 3EVAA 4DZRA 1TVEA 1ZN9A 3NHUA 4IMPA 4BFTA 1Z2CA 3MPOA 3WKBA 4D1YA 4BECA 3RSHA 1LJLA 3KEQA 4D42A 3CEJA 4GZ5A 1H9AA 3LUBA 5KTSA 3H8JA 1KOJA 3R5SA 5JVDF 3GZTB 2IEBA 3A6FA 2LZ0A 4K9KA 3WX0A 4CDNA 4G81A 3OZCA 4L07A 2C9CA 1K2VN 4NATA 5EC8A 3TAXA 3CUEF 1ADCA 3MJRA 5JYDA 1LDYA 3VAZA 2F67A 1QB7A 2FR1A 3E9EA 2I9KA 2OV6A 1NL3A 3AERA 1FX1A 3WFIA 4CTMA 2C3UA 3ONDA 1OH7A 4DV2B 1GYRA 2VAPA 3UPUA 4LXTA 2O3QA 1QRUA 4MRPA 3T5AA 1NW9B 2C5GA 1DINA 2JHCA 1FBTA 1JSZA 1LC3A 2SBTA 5HTKA 5L3RA 4WFKA 2IXGA 5KQLA 4AJ2A 2ONJA 8OHMA 3O73A 2F3RA 2YOHA 5BR4A 1KXZA 4CKYA 4F9EA 3KQWA 2HPZA 2NNWB 3LDAA 4H3VA 4Q7MB 5DBIA 4B73A 4EUSA 4DLYA 1HLDA 3Q5EA 5LZ5A 1HDEA 4CNQA 5HQ3B 1YZNA 1PJTA 3S6JA 1MQ8B 1Q91A 4GLLA 1E9DA 5CTAA 3MWFA 1ZJ5A 5ITZB 3TRHA 3ZDQA 2R7LA 4NBTA 5EJ6A 1T0JB 3CV3A 5CVCA 2X8AA 1KK3A 2O6HA 2ZRHA 3L7JA 2YJ5A 1OHHD 1BRMA 3N58A 1GL9B 4P4TA 4QFDA 2ECQA 2UYGA 1E1YA 4RK1A 5FHQA 4DNXA 3EQ8A 3FFAA 1Z7BA 3B13B 3H0CA 2C59A 1TTPB 1OB5A 2BFPA 1Z8HA 4LX0A 5EVJA 3ZV6A 3PC6A 1U2DA 1T9KA 3CRZA 2H29A 4INZA 3G0CA 1H6BA 2FQXA 2Q45A 3OEED 2J3EA 2X5JO 1QGAA 1ISPA 2PVCA 2B35A 5L6LB 2HLDD 3SNKA 3BRSA 1XD9A 1KR5A 4B6JA 4WL0A 1PTJA 3B20A 1EK5A 2H8KA 5AW8A 1GTSA 4JI1B 4BWVA 2WYHA 4WGGA 3PDHA 4W8GA 5CRIA 1YVEI 2GBLA 4L8GA 5FLXA 5GJWC 4KACA 1ZRNA 5J23A 2D5IA 4ZEXA 1W4RA 2PGDA 1MVNA 2UYCA 3TRKA 1V43A 1MO6A 2XLBA 5IT4A 3QXJA 1PBNA 5C9ZA 4EUHA 4V03A 5JCOA 1TQDA 1MC5A 1N8NA 2Q2VA 1VPLA 2WBLC 3QKWA 2VP4A 1JEAA 1HDYA 1RAEA 1BGXT 1VL8A 2G0TA 2H7XA 1JEJA 4GX2A 2C4UA 3I2JA 1H05A 2FAXA 1JL3A 2YZGA 4LBVA 3QE2A 5I5GA 3I09A 2TMYA 4G5QA 5AI9A 3JAWB 3AHEA 4HBGA 3B6EA 1ZAKA 2AI2A 1TA9A 2ZTLA 1MGPA 5SICE 3CE6A 3P19A 4ER7A 1HV8A 4TWJA 3UIEA 1QHXA 4JFAA 3RYCA 2QVXX 4YP7A 1RM4A 1DRVA 4RPHA 1PJCA 3E1KA 1C1DB 1D2RA 4JUCA 4BYMA 2FB9A 4MUKA 1MP0A 1W88B 1O6CA 1QONA 1WB6A 3WRXC 5ITVA 4GRIA 2RARA 1UEIA 4US2R 1UK9A 2HMWA 4HEJA 2XIJA 2HRQA 1XMJA 5FYQA 1Q0LA 3F5FA 2JZNA 3ZNQA 5K20A 5K4GA 1B3BA 4JQOA 4BDSA 1FX0B 4PR3A 5IEJA 3UAWA 2AVDA 2ZJ3A 1P1JA 3D6JA 1U9JA 2I54A 2A94A 4RHFA 1SHTX 1EA5A 1UFOA 3QVMA 2BM9A 4L5CA 4ZT7A 4P0QB 2J0VA 2ODEA 2IS1A 2IDZA 5CVEA 2OBNA 4GDFA 4RTQA 2NZUG 5C34B 1YJBA 4DMUB 1XJCA 5LP6A 3QKIA 2PD6A 2XE6A 1VRCA 4C21A 2O7RA 1QG2A 3IT3A 2ZAIA 2OPHA 1AZSC 1S96A 4OFBA 4BAZA 2VUTA 3ZCTA 1E2QA 1NJ5A 1KPHA 1JLKA 2YC2C 4IHJA 5J1TB 3WHIA 3LQ2A 2PZGA 3UOAB 1IJFA 3B60A 2V7XA 4D5EA 2EZUA 3IOEA 2FX2A 1IZ8A 3CX6A 3O95A 4HF7A 4M1KA 1KKLA 3GL9A 4P84A 2XVXA 3C15C 2Y1KA 1Q7EA 2OXCA 3ER9A 4AI6A 2HTFA 3PHIA 3X1DA 4JI3B 5K3CA 4J90A 1H85A 4KDFA 1J9GA 1PJ4A 2W2KB 3R4VA 3TJZA 2HAEA 3QYAA 2WF9A 5LQUA 4LZNA 4M8KA 2GSDA 1MIHA 3DLAA 3EGXA 1DCMA 4N18A 4MR9A 3UPDA 2I3BA 2GAAA 1YK0A 2QL9A 4LE1A 2BMEA 3UQYS 1TK9A 3P0FA 4DJFC 4YT4A 5JFOA 4L0DA 1WEHA 2RB4A 3LDHA 1UOQA 3P2KA 2C2GA 2RHJA 1PJ2A 2I1VB 4YT8A 3HUTA 1PS0A 4GX5A 2E7ZA 1KAOA 1XEXA 1JAXA 1XTVA 5EIHA 4F2PA 3SZMA 2CNNA 3X1XA 4B3HA 4P08A 3Q72A 1KSGA 2EXXA 3FAZA 3LT5A 1NAIA 3L93A 1WUKS 3R0VA 1L7MA 2VK2A 3DAHA 1C80A 3INYA 2Y1OA 5EFOA 1E7YA 3BB3A 3I53A 4FQ5A 3DO8A 3UO8B 1FVOA 1HG0A 3AR8A 4YRAA 1UPAA 2HRRA 4IYJA 4EL5A 4TYPA 1M0WA 2Z6QA 1KETA 3DEKA 2HLPA 1RI3A 3OCUA 4OL0A 3GDGA 2R44A 4MYHA 2X6RA 1J39A 4UASA 1FK8A 2FR8A 1UPUA 3ETLA 5BV2P 5K6RA 4NG4A 1GTJ1 2EFDB 4WLNA 3CVYA 2VZEA 2BVNA 4EF4A 2ZDGA 2D3WA 4NOLA 2ZYHA 5KJFA 1AQYA 5CGQB 1BX1A 1L5NA 3DCNA 4AS1A 3G9TA 2VK8A 1XTKA 3D3NA 1R0CA 2VIIA 2Y0BA 3F6PA 3COSA 4X71A 2ZBGA 5F33A 5JD5A 5DISB 5C53B 3F74A 4IJWA 3FOZA 3VUFA 1XZPA 3PPYA 3W4JA 4UPEA 2AN9A 3Q7RA 1HMYA 2J3LA 4RSHA 3I39X 1T1RA 2BZ0A 1HNZB 3LQQA 2Q0SA 3Q3VA 2C04A 4NENB 4D9BA 5KOHB 1K8RA 4CTNA 4LNHA 4HWTA 1K4MA 1HC7A 1Y48E 2F8LA 3LYAA 3IRUA 3M9WA 2L42A 4OXYA 4PR0A 5H4GA 2H63A 2DERA 2I0FA 4BKRA 4IDPA 2H1RA 3RABA 1L8QA 2G82A 4OQXA 3VUEA 4EKNB 3L6OO 4G5RA 2J3HA 1FJHA 1SXJC 2ZXEA 1ILEA 2PIAA 1Y9EA 1DJQA 5K0LA 4D6XA 2X0RA 2REQA 4O4IA 4YRTA 3N8GA 4DSAA 4MIKA 1C8VB 1JKMA 4PZ9A 3TDMA 2B5WA 3GFPA 3VSCA 2ISSD 2XT0A 1RAFA 3WIUA 4B3DA 1ECLA 4HNHA 4EW3A 3GA0A 1A3CA 1N0UA 1FNCA 2PANA 5HCUA 4LF8B 3L1VA 1RADA 3OFND 2BDEA 1UWCA 1A2QA 5DTIA 2HA2A 1U2ZA 3DGFC 1EMDA 1NFRA 2O7QA 2P2LA 2QIPA 2LW7A 1RXIA 3H11A 4HNGA 1TMGE 4XR9A 3QKSA 1EUDA 1V8OA 1XD2B 1YVDA 2GF0A 3K2QA 2PCJA 2QTLA 4PYKA 4S05A 2I2XB 2QUBA 1CFZA 1MDBA 3IGFA 4QUDA 5A9TA 4MHTA 1VL1A 3UNXA 5CW2A 3WZLA 4C4RA 4LRXA 3OPNA 1XLTA 4C29A 3DL4A 4NFYA 4KXLA 3UK7A 1QIIA 3U3KA 4A03A 3WLMA 3D4PA 3TDNA 3LKVA 3E2IA 3UWDA 3LP6A 5KJ1A 1IN1A 4LZPA 2NU6A 3H5OA 3H05A 1TF7A 1GXSB 1F3OA 3AF0A 3LWZA 1JPJA 4MA4A 2OT3B 3HWRA 5E9JA 2P2DA 3O93A 2NVWA 1T43A 1CNMA 2PV7A 1XIVA 3AVWA 5LOVA 2QAGB 1KYIA 1GL7A 1SN7A 4GBMA 2P62A 3BAZA 1E77A 6CHYA 4CEIB 2DP4E 5IC6A 4XQ9A 2QG4A 2QPOA 4IHJF 5HW0A 2UVQA 2C94A 5KJEA 4JVOA 2FHSA 1C50A 1R6XA 4JB8A 5DHRA 5DT9A 1B6SA 4ZA2A 1W52X 3RVBA 1Q7CA 1CB0A 4H9GA 4AB1A 2DPGA 1XFDA 2E3JA 5A5FA 1PG0A 4N82A 5JNTA 2A5FA 4Q3NA 1Z6TA 1CUVA 2BI8A 2IHZA 2JI7A 3OZ7A 3QU7A 4KO8A 4RMIA 2HR1A 4B79A 5DP2A 1HYHA 2PGLA 2OFPA 1YVUA 2R6ZA 4BDTA 3EXHB 4FGKA 2JGIA 1IWPB 3QFHA 3FETA 4RF2A 3R75A 4XRGA 3QUQA 2X1VA 4LPSA 1BVYF 3EQ9A 1NVBA 5ETJA 1GYPA 1H2HA 3FOEC 3QQ5A 1DCFA 1WQ4A 2XRZA 5D7BA 1Z7GA 4B32A 1XVTA 4E21A 1Z5NA 1JTEA 2J07A 4AWXA 3JALB 5DHUA 2FZGA 1SD2A 3R5HA 5FOWA 4CMIA 1E1CA 4RFSB 5IAEA 2D1YA 4UUNA 2H7VA 2C4KA 2ZXUA 4KUHA 5IUKC 3UJDA 3LRPA 2IODA 1F60A 3A1TA 1FQJA 1NX9A 3ELYA 2D5LA 2NSDA 3H42B 4PSUA 1USUA 3I9MA 2ZI4A 3E8XA 2O23A 1E5DA 3ROZA 2C2KA 3GJRA 4P4SA 1PGQA 4DIFA 1LLFA 2CXQA 3ZLJA 1Q19A 5C7YA 5A03A 5ALFA 2A0YA 2F3UA 2QQFA 1Y4DE 4CUJA 1PL6A 4MV6A 2V0GA 1YDHA 2QQEA 3EFOA 3KK0A 4WJZA 1EFCA 2E9SA 2PNFA 3BQMB 3K0SA 1T5SA 2RKOA 4C7JA 2G1AA 4TMKA 3ICCA 1R0BA 2C0QA 2DB3A 4U2EA 5GQSA 4BGVA 1I1HA 1TM3E 2ZB4A 4KR2A 5FUQA 1CNFA 1C9MA 3KJIA 5I45A 1S4QA 3OHPA 4WKCA 4R01A 3UYKA 2IX3A 1A5TA 1CUEA 1XPJA 2BF7A 2CMHA 1XRPA 2NPIA 2X2FA 3HCEA 4NJOA 4DMMA 1T91A 3WNCA 3GMSA 5FLEX 3ZJTA 4X1IB 4FQ7A 3ROKA 4CEJA 1E3EA 1J06A 4U9IS 4KVAA 2I7XA 5IT5A 2QEQA 2QOEA 4GXNA 3ABOB 1I1OA 3TSZA 1EBBA 2EWMA 4RHEA 2GZAA 4XB6B 2VDWB 2VF8A 4UQOA 1ZD2P 5U4XA 2RJ3A 3VYVA 5HQ3A 1Q21A 1CDEA 2ZJ1A 3MJDA 2WVAA 5COQA 2PKWA 5IJWA 4N54A 2BEWB 5EMLA 4I14A 2WTBA 1LX7A 4BFVA 3QWHA 4MRSA 2RGCA 4CL2A 4QM7A 2I78A 2RGGA 3MAAC 4KVZA 4W5OA 1GZ5A 2PMKA 3ESXA 3KQLA 1SBTA 5JY6A 4PIVA 4CZ2A 3OPYA 3OPYB 1Z0UA 4B76A 1YE8A 1Z7WA 5I9IA 1ORIA 1BOFA 2GDZA 3CURA 3LP8A 4RHTA 4RV4A 5EXEA 3VSBA 3BEDA 3ZEIA 4U2GA 3NAGA 4LZZA 4D9KA 2EFJA 1T9HA 4KYIB 2GRAA 1E98A 1P6UA 1RACA 2BGJA 2CHGA 3PNMA 2YC4C 4I8DA 3JRXA 4JQSA 1X1TA 4Q9HA 3U40A 4IPTA 3EBOA 3H2BA 1MAWA 1D2EA 3WGVA 5KX5A 4CM8B 3HYRA 2J3KA 2PGXA 3CPHA 5TMBA 5KNLA 3GOHA 4NPAA 2OLEA 4L5BA 2KLBA 4K5QA 1QANA 4WVFA 4UUPA 5CT5A 3RVQA 1SOVA 2WYVA 3O3OB 3EVGA 3DBRB 2QN3A 3GLFB 1DV2A 2XW6A 2WT9A 1J2EA 5EINA 3DS8A 5JEEA 1M34B 2BGMA 2VBIA 2Y1GA 3FDXA 3CH6A 1Z0DA 3C5CA 4Y1RB 1SXIA 4FOOA 1FUIA 1F4LA 3H04A 5JVDA 1G3QA 4NBWA 1L7XA 1QC5B 3GLGB 4YCCA 4GPTA 3CGGA 3AETA 3TVTA 4D0LB 4BFCA 3TZCA 3PQ4A 1T6YA 1UXKA 3DMTC 4G63A 4LUCA 3V33A 4LJAA 4ZEMA 3G0GA 2BKVA 3PXDA 2OBBA 4KQ1A 2XWSA 4MGKR 4YRPA 4EHNA 4MGYR 2J32A 2QL5A 3L07A 4MJ7A 3VU9A 4DCSA 1YQWA 3PTZA 4MHOA 2RJNA 3WGOA 5BMOA 3R9WA 3SM9A 1DG9A 4OQ4A 4M0PA 1JWAB 3MTQA 1R4NB 1QLJA 3D2CA 4OA8A 2VSNA 3UK0A 2ZUWA 3C5WP 3OHMA 4JDUA 2IOYA 1AUVA 5ALHA 4EZEA 2JLYA 1IBCA 1ADYA 4N49A 1JDUA 2GAOA 1W4ZA 2Q8NA 3DLCA 3T06B 2VZ0A 4XRRA 3P0EA 4Q05A 1ZD8A 5JJBA 1IRXA 1PYGA 4FQ8A 1YIOA 1ACMA 3L8EA 5ERYA 1G5FA 1Z08A 4IY1A 2ZRMA 3WTCA 1LW7A 4RACA 3FYUC 1WXHA 5FL3A 4EMBA 3I9LA 4X6LA 3M4ZA 3R40A 3AKEA 1QMPA 3NTVA 5BV7A 5JSHA 4F7WA 4BATA 3W1VA 3UMMA 3MJFA 1TO6A 5PNTA 1GKYA 2DUNA 1XA0A 2AR9A 3E2PA 1S8OA 4JENA 4DSNA 3MOGA 3OT4A 2SNIE 1NXTA 4XEUA 2AE1A 4Z1MD 3SX4A 1P45A 4XGNA 3M6XA 4O2AA 2NSLA 2DHRA 5LXTB 2XWBF 4L08A 3FBWA 5CP8A 2CB0A 3BRCA 3FDFA 4G5XA 2DPXA 1XMXA 4P4LA 1JFTA 4FCTA 5FEMA 4RVHA 3T3HA 1O9HA 5IABA 3PFCA 4NP6A 3SHOA 1JE1A 1P4HA 2YHIA 3B82A 3ISTA 4V0NA 1JLMA 1N6RA 2G07A 3ZH9B 3BMCB 3GJQA 3GRFA 5GGXA 4S2EA 3S1AB 1PGJA 1H0SA 3KUXA 4JSTA 2C2XA 1JJIA 1XKTA 2RC6A 5AOBA 1FSSA 1QX3A 3BKXA 1KY2A 3JALA 4I55A 5HGJA 4CMIB 4EEKA 2GJ9A 1P9OA 5EA2A 1PDVA 4ER0A 4TLMB 3SQNA 3HJFA 1SVUA 4PC3A 3STWA 5JH7B 5JH7A 1BE8A 1PYDA 3VJKA 1A9OA 4NAVA 3FF1A 4Z54A 4RZXA 1QKKA 1WMEA 3O3NB 3ONVA 4LDQA 4RTOA 3P96A 3R3JA 5C31A 1Z4IA 2Z5GA 4LWZA 1Y5NA 2NU9B 1JQ3A 4GQBA 3BHJA 3AR3A 4YRLA 4BB0A 5KTNA 1SOAA 3JQDA 4C0KA 3GAZA 3DDSA 3TN7A 1K68A 4R2KA 3ZD8A 3VVBA 3PQEA 4CMHA 4UAGA 4OJYA 1FDTA 1O95D 3SIWA 2ZTMA 5IBPA 1XI2A 1R9JA 3F96A 1CE8A 4DMHA 3HYLA 4D0SA 1WB9A 3IKJA 5JH7F 4ZARA 3OKCA 3RS0A 5EJEA 1GPWB 1U7OA 5GVSA 3LZCA 5HPYB 1NX6A 4LMBA 5ERGB 1BNCA 5IJXA 1NULA 1RCFA 3EXEB 4J16C 3GDHA 3M70A 1W47A 4GD3Q 4UM9D 1YFKA 4WBNA 1QS0A 3GLSA 1SU7A 4DUZB 4HK4A 5C80A 3O1LA 3HJCA 3IDQA 4YMIA 2OCYC 3QA3E 1T2UA 2PSDA 2NYUA 2R6R1 1B26A 4BMVA 4WEOA 3R6DA 4DVJA 3VPHA 4KQCA 1DAKA 1EP9A 5K6AC 2BEWA 2BHLA 2H1IA 2HF9A 3BDIA 3DE5X 1Q95A 4PZ0A 2VT3A 3BMNB 2DOKA 1XYYA 3SX2A 2O07A 5ULLA 2F55A 1L5HB 4R1NA 1VIAA 4AUKA 3B2NA 3PE4A 4NCKA 1R0LA 4GP9A 2Z2YA 5EJAA 4BNKA 2EBUA 3K0AA 1P61B 2WMNB 3L6DA 4DT1B 1NI3A 4BLTA 1ID8A 3W9YA 2Y9MB 2X8JB 1XMOB 3AKYA 3LRTA 4KQFA 4AKEA 3R8FA 4GL4A 1E6KA 5EMNA 2RHRA 5ADVA 2HA0A 4XOIA 3NAMA 1LVGA 2B2XA 4L3VA 3VOBA 1GY8A 1DAOA 1D1SA 2PH5A 3PC3A 3DMPA 4FE4A 3UBMA 2I6SA 3RVPA 2RGUA 3OZGA 2ZBVA 2P3QA 4LZWA 4J16A 2QN2A 2WUWE 1C7ZA 1U6IA 2XTNA 4QYIB 2RK3A 1QHFA 1XRRA 2KI5A 2ODNA 3EEYA 3HC7A 3NIGB 4MWZA 2IH2A 3CLUC 2F8SA 5G40A 3O1HB 2IEZA 1YBHA 3O3MB 2EJVA 1HEUA 2HNKA 3DDUA 3GCZA 3JWIA 3KKMA 2VPYA 3L2OB 4PCAA 4QELA 2WA1A 2CMGA 3HJAA 4Q01A 4R1OA 5SZJA 1C0EA 4RE5A 3WP1B 3AI1A 4TSFD 2AH5A 3D7KA 4LQLA 2J85A 1OLXB 2QTBA 4R16A 1LRKA 1M34A 1MN6A 1HF3A 1DUIA 2IEAA 3JV7A 1LXCA 1VJ0A 4JP8A 4X1OA 1I6KA 4A6EA 2OBLA 5JPCA 1R64A 1SMKA 5HOEA 2BAGA 4AROA 1QAQA 1R50A 3EPLA 2GF2A 1C3OB 2NQ2C 3PXUA 3TLYA 3JYOA 1W44A 5DRTA 3JQQA 2GESA 3RS7A 2O2JA 3PFHA 5JBQA 4AY2A 5BUQA 4OBEA 3M34A 2Q07A 2W5UA 1XDZA 1ISFA 3QRWA 3RBAA 1L5FA 1ZM7A 4LK3A 1L2TA 3AIMA 3OX2A 1DS6A 3W3ZB 4BVAA 2G06A 2N46A 1HH4A 2V8BA 3KUDA 5EIFA 3L0CA 2NU8A 3LUGA 3W7VA 2WFAA 1OH6A 4D74A 3JSXA 3AZPA 3IEPA 3IODA 3OZAA 3SF8B 4G0PA 1N8SA 1KU0A 3GJYA 5K6AA 1PT8A 3V8RA 1KDZA 3W8RA 1KI6A 1S1CA 4TKVA 4M54A 1OV4A 3FSEA 3ET5A 4FFDA 1EGVB 1G5IA 1UR5A 4LGVA 2CLKB 3UC5A 2QE7A 5AXDA 2LTAA 1H22A 3EC1A 2CDAA 5BSFA 4DR3B 5D87A 2APJA 4IILA 3SSAA 3IA2A 4C0WA 4H4DA 1JN0A 2G17A 5F7XA 5F76A 3ABRB 5FBWB 4PHGA 1K27A 2Q6IA 1JU4A 5AKGA 2XOEA 4RKEA 2CC2A 3EYAA 2IBTA 2WT8A 1P0CA 3MCUA 1ZZEA 4Z0NA 4RVFA 2FZKA 1USVA 3ZTTA 1ZISA 2GYUA 2JL1A 3CONA 4LGYA 4EEZA 1FTNA 1LLDA 2D7JA 4IKEA 4QBFA 1S01A 2J3IA 1LPBB 2F17A 4IJVA 5DX0A 5GONA 6GPBA 3SHFA 2MR6A 3TTYA 5AI8A 1GNTA 1SQFA 1CEXA 4X94A 5JRDS 1DOAA 4YALA 2JGFA 3T4PA 4DIKA 2PBFA 1FYVA 4RLQA 4AIIA 5DM4A 1VG0B 1P29A 3HBFA 1WW2A 1OPXA 2D8AA 3HCPA 3QLVA 3BL6A 5KTKA 1IQRA 2O2HA 4D9EA 2VPQA 3FM9A 1CHDA 2Z5LA 2GNOA 1X9IA 5DCYA 2C0CA 4ZPJA 4YJGA 1V6SA 1R0SA 3BBLA 2MYTA 1OIVA 3UOGA 4G4GA 1FUEA 1J5EB 4LBZA 2GXAA 4HV4A 1CW2B 1G17A 2VJLA 3F67A 4RWZA 5D5HA 3ZZNA 2JFBA 3ZGXA 3UHAA 4ND6A 4BLVA 3ORYA 2WEKA 1NPTO 2O8NA 2B6HA 2V96A 2XUGA 3C6XA 1N6HA 4C76A 1JKIA 4YAUA 4Z4QA 1WUYA 4LJYA 3KV1A 3W9SA 4DDHA 2J9FA 3OIYA 1MGOA 4KUGA 4LXGA 4H3SA 2R5WA 1WP4A 1D04A 3P4YA 4IOMA 1RHRA 1UMDA 3PFFA 1MFPA 3AJRA 4XCVA 4L4XA 4H7JA 5BV8A 3SZ3A 2W8ZA 1G2PA 4FLMA 1SB9A 3JQAD 3MWGA 3SJCA 5I9LA 1NNEA 1A8SA 2QY6A 3C6YA 1GR1A 2JCSA 2CKDA 2MDTA 1CQXA 4HATA 4EGSA 4JMLA 2XDAA 2PSHA 1NJ2A 4R1TA 5ALQA 4DQKA 3UAYA 1RHUA 2FQYA 1XEFA 1GSOA 3PNSA 5ALWA 4DQVA 1ZR2A 1T10A 3U4QB 3N5CA 1W0CA 3NHZA 3K5PA 3WBFA 3AUSA 4KLRA 1LV8A 5DT2A 3IMKA 3CNEA 2WIFA 3GFQA 3P4XA 1PYOA 1DQNA 1M67A 2F3TA 2ASVA 2ONZA 1ICEA 3CUTA 3JYLA 4GAEA 4K9LA 2I4RA 2JFGA 4ZXFA 4B4UA 1RJ9B 4X91A 3LZDA 3V7UA 5HILA