2PGAA

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with inhibitor and phosphate and potassium ion at 1.74 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray Structure of the Uridine Phosphorylase From SALMONELLA TYPHIMURIUM in Complex with Inhibitor and Phosphate and Potassium Ion at 1.74 A Resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 88
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2007-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2pgaA00
4BMZA 4QATA 4DA6A 3E0QA 1Z5NA 3SCZA 2QPLA 3UAYA 3UAZA 4L5CA 4YO8A 1K3FA 3OOHA 4D8VA 3BJEA 5K1ZA 4E1VA 1ZL2A 5F7ZA 4OGKA 5CYGA 4G89A 5B7QA 1A69A 1JDZA 2IQ5A 3QPBA 3KVYA 1U1EA 1TCVA 1PK7A 1VHJA 4TXMA 1OU4A 4NS1A 2PGAA 2QSUA 4U2KA 3DF9A 1RXCA 1Y6RA 3EEIA 5B7PA 4P54A 1PR5A 2A0WA 1A9TA 4WKNA 4DARA 1U1CA 1T8WA 3DDOA 1PK9A 1YQQA 1V45E 1OTYA 4WKPA 4LNHA 1V4NA 4FFSA 1ULBA 4MCIA 3PNSA 3FWPA 4QARA 4F1WA 3DJFA 3TL6A 1QE5A 2ON6A 4L5YA 4WKCA 1YQUA 5EFOA 1JE1A 1LVUA 1RFGE 1PR1A 2AI1A 1WTAA 4TTAA 4YNBA 2OECA 1I80A 1V3QE 3U40A 3LA8A 4RJ2A 4PNPA 4H1TA 4L5AA 2HWUA 3BL6A 2OC9A 2OXFA 3C74A 4R2WA 3DPSA 3OOEA 4DAOA 3BSFA 2RJ3A 4TXHA 1ODIA 1A9RA 4DABA 1RCTE 5ETJA 5F76A 4L0MA 1Y1QA 4D8XA 1U1DA 1Y1RA 5B7GA 3MB8A 4K6OA 5FAKA 2I8AA 2GUWA 3E9ZA 1YBFA 1SD2A 4DA0A 5F7OA 3UAWA 1Y1TA 5F77A 1ODJA 4LZWA 1RSZA 4GLFA 3FOWA 5F78A 3GB9A 4GMHA 1ODKA 4OGLA 4TS9A 5IFKA 1Z35A 1Y6QA 3OZBA 3OPVA 3NM4A 5C80A 4YJKA 1NC1A 1RXUA 1TCUA 3LBAA 4F3CA 3LGSA 1U1GA 3UT6A 1T8YA 4D9HA 1ECPA 3OCCA 3FUCA 4KN5A 4R2XA 3NBQA 1RXSA 3OZDA 1Z5PA 4D8YA 3OZEA 1JP7A 1JDVA 1NW4A 2AI2A 1PR0A 3PNPA 1Q1GA 1K9SA 1M73E 3UAXA 2A0XA 3MMSA 5CYFA 1LV8A 5I3CA 4DA7A 2OC4A 4TYMA 1OV6A 4R31A 4WKBA 1FXUA 3UAVA 4MARA 4LDNA 2XRFA 4ECEA 4DANA 4TXJA 5EUBA 4YMLA 3P0EA 1VMKA 1A9QA 3NM6B 1CG6A 2AI3A 4JP5A 2AC7A 3NM5A 3T94A 2H8GA 3PHBE 4QFBA 4MCHA 1ULAA 1SJ9A 1VFNA 4LKRA 1SD1A 2HN9A 5EPUA 1PR6A 1YR3A 1OVGA 4L6IA 4UC0A 5F73A 3FB1A 1CB0A 3F8WA 4I2VA 1Y1SA 1RT9A 1V2HE 3OF3A 4EARA 4DA8A 5F7XA 1VHWA 1TGYA 2A0YA 1PBNA 4BMXA 1OUMA 1JDSA 1Z36A 4JWTA 4QEZA 1PR2A 1TGVA 3IOMA 2I4TA 3ENZA 5CXSA 4M7WA 3KHSA 4M1EA 1PKEA 3KVVA 4OJTA 4G8JA 3PHCA 3O6VA 4TS3A 4F2PA 5KB3A 1U1FA 1B8NA 2HSWA 1YRYE 4QAQA 1V48A 1JDTA 3P0FA 1Z5OA 4NSNA 3ONVA 4TXLA 3DP9A 1JDUA 3E9RA 2Q7OE 3INYA 3FNQA 1T8SA 3ODGA 1PWYE 2BSXA 3KU4A 3EMVA 2B94A 3O4VA 5CCDA 1ODLA 1OTXA 3OZCA 4F3KA 4JOSA 4LNAA 3BGSA 3K8QA 5F7JA 4QASA 3IEXA 4GLJA 2ISCA 1B8OA 3KUKA 1Z37A 1XE3A 1RR6A 1T0UA 4BMYA 1V41E 5JPCA 1JE0A 4GKAA 1K27A 4M3NA 2QTTA 3K8OE 1N3IA 1TD1A 2A8YA 4TTIA 1SQ6A 1Z38A 3D1VA 1C3XA 1A9OA 2QTGA 4OF4A 1RXYA 1ZOSA 1Z39A 4BN0A 4D98A 5IU6A 3GGSA 4X24A 1LX7A 4F2WA 3KVRA 1JPVA 1PF7E 2HRDA 2P4SA 5DK6A 1NC3A 4IP0A 4WKOA 5CCEA 1PW7A 1G2OA 3EUFA 1Z34A 4OEHA 4EB8A 4G41A 4TXNA 1T8RA 1A9PA 3EUEA 1JYSA 4NY1A 1RYZA 4DAEA 4TTJA 5B7NA 4PR3A 2QDKA 5CXQA 1Z33A 1A9SA 1PR4A 3FAZA 4OY3A
chains in the Genus database with same CATH superfamily
4EP1A 3ESXA 3PDHA 5BOSB 4B75A 3NORA 4CMJA 2D2VA 3PTZA 2EFDB 3LCJA 4PCLA 1JHAA 1XSEA 1ZM4A 4C5AA 1EAYA 3HA3A 5AKHA 5KIAA 4DG5A 3E0QA 4AJPA 2W6QA 4GGPA 1X2EA 1TU0A 2QP9X 2JK0A 4KN8A 2ZROA 4J3FA 4L5CA 1GXSA 1K08A 2ID4A 2DTXA 5IMSA 4DPLA 1E3SA 3S8EA 3E8XA 5KHLB 4PVCA 2IPNA 3F7TA 5JNLA 2J6HA 2H0RA 3O8QB 4E1VA 1T36A 5IDXA 4RTRA 1A0OA 1UBRS 2IYWA 4WVLA 3TZHA 2PZFA 2C8LA 5KTKA 2QIOA 1XXHB 4AT1A 1QVVA 4ITVA 3RF6A 1JBKA 1NW6A 2HMAA 1W75A 4CG2A 3GEPA 5DW0A 5ELLA 4KBFA 2WYHA 1VHJA 4AZWA 5C7OO 4P84A 1EB8A 4D3SA 4GP9A 2A3RA 2XPCA 4D81A 2AC2A 3CZ4A 1UJ5A 2XE4A 1SKBA 4W7HA 4PCUA 3A9TA 5CXXA 3WL3A 5ESXA 3A28A 3BF7A 2ZT7A 4E2WA 4J1QA 1NFRA 3ONNA 3WX0A 5JNUA 1ITZA 1JVSA 1LBEA 4LGVA 5T4HA 2PWYA 2WSSD 3O83A 4LXUA 1A9TA 4GI1A 4YJHA 5F2OA 16PKA 4ANFA 3UCXA 2NU9A 4PSCA 2F00A 1JMKC 4XWOA 10MHA 1GVHA 3TL2A 3ILSA 4R8MA 1LB1B 4M9RA 4OHYA 4NV3A 4WKPA 3DCNA 1F3LA 3QYPA 3KB6A 3WL7A 4YMWA 4ZMBA 1P1JA 4EVRA 4YFYA 1S2MA 2FNAA 2Y66A 1ULBA 1DPFA 2G0NA 3SAJA 4M9CA 3T9BA 4LYYA 3VHQA 1UKBA 4RL6A 3RS3A 1I3CA 3WO1A 3EDMA 3THYA 2K87A 3SEZA 1U0GA 2G1KA 2ZEJA 3AT1A 3PUJA 4G36A 2V98A 1OFUX 4QARA 4AZ0B 1ADJA 2ON6A 4NBTA 2I3ZA 4L5YA 4HYEA 1YS6A 4BVFA 1XDDA 2HO5A 3BOSA 3KZNA 4QUBA 2L17A 2BWJA 2J3HA 3FTNA 3ROQA 5JW6A 3QMMA 3BMXA 3IMCA 2EIXA 1RFGE 3OLZA 4B4OA 4BV9A 1BCRA 3PUZA 1AN0A 2IXBA 3T5PA 2AR9A 4O6VA 1JHPA 2OECA 1BVYF 1F8YA 3X1DA 3ZHSA 5EIBD 4PVDA 2CD7A 1B00A 1OKKA 2VZ9A 3RBVA 2EKPA 3HHEA 4RY0A 3P19A 3X2SA 1KWGA 4OI4A 5F1PA 2J85A 2A5GA 4J0GA 3UK0A 5REQA 3D7SA 2ZPTX 1GTG1 2NXCA 4ICIA 5LQJA 3G5TA 1RJFA 4J2HA 4O4JA 5F5XA 4EUHA 2R00C 3WRYA 2H1OA 1X1SA 1MPXA 3L7DA 4I4LA 3DTVA 1HGXA 3O4RA 3OF2A 1QKIA 2PSSA 5FBRB 1BDHA 4RDCA 3EFHA 1HQYE 2QN7A 4B74A 4AZ3A 4KQIA 1LJ8A 3AI2A 1H8HA 1M2NA 3WNZA 1BEEA 1K66A 1MQ8B 4LF6B 4CMIA 1CY4A 2F1KA 4H7HA 2ONJA 1SUCA 4PRKA 3SHVA 4KOEC 1E7YA 2HQOA 3FRIA 2N75A 3LT4A 1T15A 4X1IB 2K4MA 3AHEA 3SY8A 3DHEA 1NYQA 1WKBA 2AC4A 2GASA 1SC9A 2DPHA 4OQDA 5H83A 1JFRA 1GADO 2RHJA 4TN1A 1CQIA 1CR0A 1FFWA 2OD9A 2RGWA 1UMBB 3E5NA 1YZLA 4HH3C 1JEDA 1Z3IX 3KR0A 4JKOA 5A9TA 2XXAB 4Y2JA 4FMDB 4UHCA 3D1LA 3RROA 1DU4A 4E1BA 2FF5A 2G1UA 2VJKA 1GD1O 3FKSA 3H1EA 5D00A 1W0JA 2DG2A 5A2GA 1FZQA 1T4MA 4OD0A 1CRWG 3JXEA 3PEVA 1EYZA 1XVVA 3SLRA 3LTNC 1W73A 1M34E 2GN0A 2JFGA 3DDWA 4HS9A 4XEUA 2WA2A 2AZDA 2E49A 4DV4B 2X1LA 4IHKA 3ZC3A 1FSFA 2R25B 4LSWA 4DLUA 3ZLJA 1P8AA 1YACA 2G9QA 4Y2QA 3QUAA 4TWJA 1XT6A 2CHFA 4RMNA 2BAGA 4EUSA 1PZXA 2BGNA 3ZHTA 4TVSA 3PEWA 1DCMA 1GNVA 5CEJA 3O2SB 2AMJA 3C6QA 4KPGA 1PJRA 1T0JB 3H5TA 4DWWA 1HLPA 1FFXA 2A86A 1JZSA 4H6VA 1VLVA 1WMFA 2QP3A 3IVGA 5IEBA 1NRIA 2A1UB 1J21A 1CS0A 4JROA 2PMFA 5KYUB 5BXYA 1AGXA 1KR5A 2WE7A 2ROQA 1L7VC 5EJIA 5AVJA 2PRJA 4Z0TA 4CUJA 4XDHA 3QX9A 1BKYA 3CHYA 3C6BA 1V5IA 1ONNA 1R4AA 2JJ2D 1Z4JA 5D2CA 4ML3A 3ZK7A 3ZV5A 4DIBA 3HMKA 4JI2B 1KI7A 1FLAA 3ZDCA 2OK7A 4QPZA 3VSEA 1YFKA 2B8WA 2QE6A 5AVKA 3KB1A 2Z5VA 5CDFA 1X86B 3DGEC 4LHVA 3UB2A 3AVXA 3RRBA 1WUKS 1GGKA 3HUUA 4Q3LA 5GZ1A 3U2QA 3P32A 4BU1A 4EG7A 3DAOA 1WB4A 4ABYA 1ISMA 4GECA 5AUNB 4Z8XA 1YVDA 4FK8A 2HNKA 5EXSA 2CDCA 4AY4A 1NVVQ 1AHPA 1KI8A 1N8SA 2Y0EA 2VSOA 2BZGA 4NCIA 3FAKA 1ATIA 3LQ2A 2JAWA 3FOAA 3RWMB 3U1TA 1GA4A 4US1R 3FFTA 5JU6A 5A9SA 5CA1F 4OHVA 3EBPA 3B3QA 2JLAA 4WCFB 5BSHA 4ZVSA 2OC4A 3GJSA 5CB4B 5KSWB 4J76A 1XLUA 1VIDA 3U7QA 2OBFA 1QTNA 1JKIA 4QBFA 1DADA 1NMQA 1TB4A 4CUZA 1GCAA 2IL1A 5FWDA 4D56A 3MERA 1KZ6A 4EZEA 2VTBA 5KMGA 3ISTA 1UINA 3KQVA 3QPAA 4ECEA 3R7WA 2XHZA 1NUUA 3QE2A 1UOPA 1GCOA 4F72A 2O8CA 5HXAA 1IEVA 1FPMA 5BUSA 4U0JA 1FQJA 1K6EA 3QEMA 4PW0A 1JA0A 4JVMA 2AYYA 4F5ZA 3N0WA 3OEHD 1XZIA 2WKQA 1YKGA 1Z83A 4YJ3F 4BQEA 1N5JA 1GFZA 2BLLA 2J87A 5LYJF 1JSLA 2I7DA 5CVUA 1ZMXA 2H8GA 2P3OA 1KMCA 1V1MA 1M7HA 3GIDA 4H60A 2Q4OA 4QO8A 3DEYX 3PWKA 4R8KA 3REOA 2DZDA 5CDGA 1DXOA 4DMMA 1UZNA 2XNDD 4GDFA 2JLRA 4DNFA 4I0WB 1BVUA 3BJZA 2BSAA 5JXHA 1SIUA 4TWAA 1ZVKA 3OU7A 3AEKA 2G07A 3KOXA 4WOBA 3K20A 3WQQA 3VPSA 3RLFA 1Y9JA 5J2UB 4HUQA 1EXMA 3A4YA 3DWEX 4P7GA 3RFCA 3O94A 3ETEA 4MHSA 4JZKA 2P62A 1TZBA 1G3IA 1G6KA 4Z8YA 4XD7A 3KYIB 2B21A 3D8RA 2W0MA 5B6JA 8MHTA 2L82A 1DO0A 2QMOA 2B2NA 1G291 1HMPA 1ODFA 1YK1A 4ZZ2A 3K70C 4EEZA 5BQOA 2E6UX 2IS4A 4PR0A 5JJBA 2PKQO 2R62A 2HA6A 3NCHA 5CUQA 3V8QA 1QUEA 3P8ZA 1JG7A 4OXQA 1E1MA 3N8KA 3IDAA 4HQLA 4EARA 4AQDA 3ZHOA 1YF3A 3STWA 2ZW9A 2WF9A 3JATA 4H3VA 4HDNA 1A9YA 3TNFA 2IX3A 2YW9A 4RTKA 4IAOA 3E1SA 1TGYA 3E4DA 2ETVA 4MLCA 1RKUA 3B6JA 4Y1EA 1LDYA 4IHAA 1XZLA 1EFHA 2O7QA 1KH1A 1E2EA 1OFIA 2OGTA 4HAOA 2H7CA 3RAPR 3CLTC 1C7RA 2BFAA 4HFMA 4QUDA 3TF5A 2QQFA 4R98A 2ZI5A 1IMOA 3RK1A 2YHIA 2LKCA 1M2OA 3C87A 3JQEA 4GOLD 2GBIA 1N4DA 1RLJA 2YJ3A 1KRWA 3PHIA 1KIAA 3I9V1 1ZC3A 4PEVA 1IH8A 2D2FA 1RLMA 2VPQA 3AY0A 1VZ3A 4B2LA 3PIIA 3OQJA 1UJBA 1TGVA 3AESB 4H4CA 5AH0A 1ZJ4A 4F3YA 1VDZA 3C16C 3S27A 3TOSA 1KOGA 3QOYA 2Q27A 2QUZA 2X2PA 4J49A 4NPCA 1QV7A 4XM2A 3X1YA 1PKEA 3OJLA 3DTNA 3L07A 4YV2A 3KLNA 4LF4B 2PIAA 3JR3A 4BV8A 3O90A 4L4RA 4DCPA 1RZRD 2DUNA 1S3GA 5EEHA 3OUZA 4FR5A 1Q91A 4O59O 2C29D 4WXHA 3PT5A 5CLHA 5CVJA 2J07A 1BXRB 4UVIA 4MA5A 4H31A 5DU2A 3KX2A 3E3AA 3H5VA 4V0OA 3TGLA 3BILA 2QKYA 3IKVA 3TI9A 1E62A 1Z26A 1GNQA 2AJTA 2GBLA 3LX8A 4G67A 1QGED 3AEZA 4HFNA 4L15A 4MQFB 1IUOA 4XUDA 4DPMA 4F91B 3ZJ4A 2X4DA 4P5EA 1U1FA 2YCBA 3BVPA 4KVAA 2ATXA 4HNQA 4A92A 5K6TA 3DTYA 3VR5H 5J4KA 1J8VA 4KREA 1YB4A 1JUDA 1OZHA 2SBTA 4C2UA 5TPWB 1TUBA 1IFXA 1QV9A 4EF5A 3CR8A 4ER6A 5HIJA 2JHFA 1AF7A 3DONA 3MIIA 2AZTA 4KC0A 4TVOA 1WB5A 2Y92A 4MPTA 3X0DA 1R6TA 1QB8A 1TDJA 5FL7A 3PGMA 3INYA 1VI6A 1VGQA 1YR7A 2QN2A 1NZFA 2R8ZA 2VF4X 1JKMA 2VCEA 4OGFA 5L7TA 3RFVA 2C5BA 1Z12A 2UYHA 3MLBA 3IAS1 3VYRB 3NHSA 5LDHA 1G0OA 3QFCA 1FVOA 3K09A 5DN6A 1DJMA 5C34B 5EMLA 1N4AA 1BMTA 2Z04A 4MKHA 3DDZX 1TF7A 3LVBA 4IXNA 4OB8A 2QMHA 1T5IA 1U9IA 3M6LA 5EQFA 1Q1ZA 4MW1A 4UVEA 1T9GR 1AOXA 2E37A 4JOCA 4IH1A 3RS4A 4AIIA 3CJQA 4BMCA 3DAGA 4CL0A 1PDWA 4OL9A 2VDNB 4PNHA 3TIVA 4UVHA 3JD0A 4Q39A 1DCFA 3DZKA 4C6RA 1JQLB 2O7NA 1HDYA 4ZPXA 4YS6A 1I30A 4EG5A 5AK4A 1LPSA 3F6EX 1W25A 3GAZA 4R1TA 3G8AA 2Q62A 1RC0A 3BWDD 2HLDD 1K6XA 3T35A 2N46A 2RSLA 2H57A 1E0AA 5LVAA 1FDUA 2HCBA 2FEXA 2VYND 4QOSA 2WRZA 4HSGA 1VBFA 2ZU0C 1CV2A 4UMEA 2Y67A 5BP7A 3WLNA 4Y9DA 4Q19A 2BFBA 4XD2A 4UNNA 1QU2A 1GV1A 1C7JA 3O3CA 2PKQP 4I50F 5E7IA 2P9QA 1XZFA 5KNDD 1VHQA 4AU1A 4KMMA 1K27A 2N3ZA 2CJWB 4JC0A 5H9WA 5DBEX 4ZCRA 3BCRA 3MS4A 3FXAA 1VCMA 2UKDA 3AUSA 5CU7A 1BXGB 1XDZA 3QY0A 4XYLA 3RARA 3FCYA 3FGOA 1C0KA 3BFKA 2IK8A 3EUAA 2AKAB 3A1DA 3ASVA 2H1FA 1N3IA 3QNMA 4I4TB 4MB0A 3UV6A 4M38A 4BFXA 4BBZA 5IWAB 3ZDBA 2XOXA 4BTLA 5BT8A 4JB2A 1PQYA 5G53C 1ISSA 4PQEA 4AN1A 4IDGA 2FSPA 2AG8A 2OT3B 3FLBA 4ID9A 1KEUA 2YDXA 3BE8A 3LA6A 1XZCA 2ZRAA 1KAQA 3K0BA 2X5XA 3V8EA 2AMFA 2C3OA 1AGYA 1MP0A 1M8FA 1N2SA 3DKVA 4F6RB 4B40A 3VQTA 4F3RA 1CNEA 5JVDA 2JARA 4NABA 1E9CA 3WGZA 3SHOA 2R6ZA 4NS4A 3V1TC 2AA3A 2QTBA 2FXIA 3PHLA 2Q3BA 2J9GA 1NP7A 4Q4JB 4E4RA 3PGKA 1G19A 2J32A 2WTNA 2GK6A 1UC5B 1KSHA 3DE1X 3K8ZA 1EGVB 2A67A 3NETA 1ZUHA 4R1QA 4UCFA 4YYEA 3CF4A 5K0BA 1FDVA 1IY8A 1ULTA 4KWCA 4AXXA 1G2OA 4J7CA 4AO7A 4IOKA 1F12A 2E0IA 3K1TA 2ACWA 2CJWA 4UMDA 4LV5B 5KTPA 3UJ6A 4LOJA 2CXTA 4J0HA 3WLRA 4V03A 1JT2A 5BPFA 3FPFA 2CLOB 1T8RA 1A9PA 4MVCA 5FTLA 5IW8A 5JCJD 3ZDDA 2WNSA 5HFJA 3R4VA 4HLQB 5BYKA 4I4IA 3LX5A 2WT8A 3EH1A 2Q1WA 3JAWB 3PD1A 1E99A 1FPQA 1T8PA 2WIJA 4J4BA 4R8SA 4LOLA 5ECGC 2QMYA 1IZYA 3T3EA 3ZV6A 5C1OA 4B3MB 1A7UA 1C1XA 2B0JA 3L8EA 4FFBB 4P4GA 4HSEA 2O05A 4JYBA 1KEZA 1L8AA 4L50A 4MINA 5JLAA 4B8WA 4PHCA 4NZMA 4WY8A 1JJFA 3LVQE 4Q9IA 5ICCA 2P2SA 4F5EA 3PRHA 4G84A 2QI9C 3ENVA 4XLLA 4P3PA 3RB8A 2UYCA 1SU4A 1Z47A 2A9FA 3DHYA 1YZQA 2ZWVA 4YMSA 5FNVA 3W7BA 1JA1A 3Q0EA 1TO2E 1DUVG 2VK1A 2H0AA 2V65A 4QQ8A 4Q3EA 3LCVB 4M8LA 5IKMA 2AK3A 2V7GA 1QIFA 3TQIA 1GAWA 3BJEA 3QUQA 1MTOA 3GNQA 1MJFA 2ZVQX 1J2EA 3JWJA 3K96A 4GWLA 4W1PA 4D82A 3KTOA 1NXXA 4YMUA 2C00A 2YHSA 5EMNA 4HDMB 1ZL2A 2G28A 3NVMB 4D9IA 3EVZA 3FNFA 2FETA 1H6DA 3D6AA 4HNAA 5CGZA 3IC5A 1M6YA 3GK3A 3H5AA 4XB1A 5K4AA 5JQGF 2JGMA 5CIQA 2XNCA 4QU9A 4W5JA 4Q18A 1O95D 1XDGA 1RWWA 4LF5B 2EBWA 4E7OA 1WCIB 4UNSA 2IXGA 1E77A 4MP3A 4R01A 4XQCA 2UVPB 4CLRA 5A1TA 1J33A 1Y9ZA 1DGQA 1O54A 1E79A 1ZFNA 3ANYB 3GJ5A 1J90A 1MJGM 3WLJA 3QA9A 1I1QB 3SSOA 4XB6B 2A0WA 4BXOB 3EGVA 1EBFA 2DPYA 2SKDA 1GAJA 1XRNA 1ZOPA 1TVEA 3ZGZA 3ROXA 5JSQA 1Z0FA 4XX0A 2FFRA 4X95A 4MVYA 1AURA 2V7VA 1CKEA 4IQ0A 3IFSA 1SVUA 3W5BA 1LZLA 3PJGA 1WXGA 1OV4A 4LY9A 1AXEA 3WWYA 5DX0A 1SZCA 1CFZA 4RJJA 5KAPA 4YCDA 1EGMB 1V39A 4YCJA 3VPDA 3MOGA 1XKLA 1EWKA 2W2NA 4C21A 5KVSA 4US0R 1ACMA 1V37A 1I2AA 3P2IA 2FUKA 3T4XA 1FP2A 3WLSA 3C48A 2ZCVA 5AOCA 5FR1A 4BV2A 1BA3A 3P9KA 3HB7A 1OXKB 5F52A 2IZ7A 5TQVA 1MA3A 1Z5GA 2JH8A 4XASA 3T34A 2CEKA 1KK3A 4TLBA 3ZS9A 1LY1A 4S0XA 1SXJC 4I3FA 4MR8B 1FMTA 1Q1BA 5CB4A 1SCUA 3H8SA 3UANA 1VGVA 1VJ5A 5JPDA 3R4CA 4F8JA 4AJ9A 4XM1A 2RHBA 3OPXA 2B7CA 3L0ZA 4GYWA 4TYNA 5L8VA 1H1DA 3V48A 2XKJE 4O4LB 1SQ0A 5I7EA 1RJ9B 2Q1TA 2JJ1A 3IP8A 4BZWA 1U5AA 2GEUA 4EG6A 3TUJC 1BC5A 4PLCA 1GG5A 2IXDA 1BWPA 4AWBA 3PXBA 4G1CA 3UNXA 2GZHA 2WHRA 1T1EA 5JJKA 4XUGB 3ZCRA 4AM8A 2I4NA 4DAOA 4B6QA 1VPVA 3AIIA 4FNOA 5TS3A 4HXFB 3R7AA 2VUSA 5A3SA 3WOHA 3KVNA 2FSUA 1YMQA 1QVWA 2IH2A 4AFNA 3I83A 2VF8A 2PUHA 3M3DA 3UPUA 5DDIP 1I6MA 4BO1A 1V6CA 4G1UC 1EA5A 4X8LA 5EHIA 3AWIA 4BYGA 4I2NA 1HV8A 4GQAA 3IPAA 5FPTA 3TO5A 4L16A 1VRCA 1N5KA 5COBA 3JQ9C 1GEEA 3C8MA 2IFTA 1I4TD 3BMNB 3NVAA 1VE1A 3OX2A 1FSZA 3EK2A 5CVVA 4N6GA 2CV1A 3QK7A 2WM9B 2L19A 4M86A 4YRNA 3GUVA 1MDFA 1PT9A 1X80A 4PO3X 3FNIA 4IIXA 4YRSA 2BP7B 4H9GA 3DVQX 1CY0A 4PSKA 4WZBE 2HJRA 3I04M 4P82A 1ODSA 5AI5A 2RB5A 3VR6D 4FS8A 2YY5A 1ULHA 4WCFA 5H80A 1ACJA 1OBFO 1YONA 2CKMA 2GJ8A 4IMPA 3NYWA 3RCBA 4ASUA 4F4FA 2A9VA 3UXEA 5ALZA 3PR2B 3VR0A 1Q0RA 1U2SA 2PH5A 1NPTO 3WKDA 5IJ0A 1KBZA 2WB2A 3SZOA 1KPHA 2J9XB 4YDHB 3VYUB 1L4LA 4ZT7A 5DIZA 5KOIA 4K3UA 3L7MA 4KPEC 4TGLA 3QF4A 2NYAA 3OZTA 4IGFA 3SSNA 5KTMA 1I94B 1R1DA 3F8TA 4U3JB 1EGHA 5AJXA 1AV7A 1PR9A 2WPDD 3KSAC 2LDXA 3OLYA 4RDIA 1WUTA 1W30A 3LCCA 3OZBA 3R09A 3HJTA 1NJ5A 1A5TA 1AHHA 1SUIA 3KETA 5KPDA 2ONYA 2YNMA 3FCAA 4UTRA 1VSBA 2PYIA 4XPIA 3WK6A 5A06A 3Q8KA 3QOFA 2OXTA 2RHGB 3MQ2A 3ZJUA 3SE7A 4ESVA 2ZTLA 4LTDA 4KR9A 3UC9A 3ZW8A 1L9XA 2GMWA 4KU4A 2I2CA 3I4FA 3NBFA 4PAWA 4TL8A 3ZCTA 2PMKA 4B7XA 2D0DA 1W6RA 4P5PA 3OU2A 2C2MA 4JUAA 4KYIB 5H16A 1NKTA 4J94A 2C3UA 4QYWA 4RKFA 4YI5A 2D62A 4LJ7A 3GT4A 3WV5A 4FB5A 4QUAA 2ID7A 1ZISA 2B4TO 5DP1A 3FLAA 3PHGA 5FLKA 3IHWA 5K5EA 2EGGA 1XFAA 1ABEA 2IHYA 3ZK8A 5HQTA 3EXFB 4KDFA 2OHFA 1EZ4A 2AJ8A 2CZGA 1B0AA 2HQSA 3AW8A 3MSXA 4A0SA 1Z0SA 4PQFA 4ARZB 1JEAA 2G76A 5D51S 5K3BA 1NR1A 2WQ6A 3WICA 1JDVA 1BXRA 1YRHA 1K9VF 2GAAA 2P1DA 4UE3S 1JTFA 3FYHA 2P3SA 2F1IA 5ALRA 4P34A 4LQCA 2W43A 2JL1A 4NBLA 1BRMA 2ZDGA 4HUTA 4H0FA 2QR3A 3ELDA 3OPYI 5CH8A 3Q0IA 3FNRA 3W04A 2R1UA 3R74A 1J49A 3F67A 5TMBA 2OCIA 2RH8A 3WGYA 4N8SA 2BMDA 2IA5A 4WUVA 3S5UA 1M6HA 2QZZA 2WJIA 1OV6A 4BKOA 5L53A 1UEXC 3JU3A 3FTEA 1DOHA 4IJKA 2Z57A 4KFRA 4RPLA 2OGZA 2JFFA 2XEXA 4RNCA 2P6RA 4G4IA 3RVMA 4B7CA 2FPRA 3VNUA 1WDWB 4A5SA 3RO7A 1Q6YA 8ADHA 2UU9B 1E6MA 3GUCA 3QW4B 4ZZIA 3PXCX 3D7LA 2LP4Y 3LF2A 4TTRA 5TVKA 4C4RA 1Z4IA 4X94A 3S55A 5JD6A 3Q3JB 3K5IA 1G5IA 3JQ7B 4X8MA 1GKIA 5JXJA 1BH6A 1OT5A 1C9EA 3UJ8A 5K4HA 2IDJA 1XLTC 4MTCA 1XN4A 1HE5A 5AXAA 3GCZA 1E2NA 3O1LA 3HJCA 4UDOA 1M10A 2AC7A 2HV8A 3HDTA 4R1LA 1Q1EA 1N5OX 5LZ2A 3VVBA 4MCHA 2ZTHA 2ZREA 4GGOA 5FFMA 2QD1A 2XMPA 3DYIA 3S7TA 2WT4A 3N6VA 3UF0A 1CW2B 2IC5A 1Z4PX 4LKRA 4YAOA 1M2KA 3PXEA 3MEQA 1T9KA 4JQOA 3UMFA 4YCNA 3NHZA 4D96A 3WE7A 2RAPA 1V1RA 1PR6A 2XHEA 3L1VA 1TAUA 1PGJA 4OJMX 5FT9A 1Q2XA 2BGGA 3WRWA 3VC2A 1EP1B 1S3SA 5GVSA 3GJ4A 1S8AA 3EPHA 3N2GA 3OE7D 3MRSA 2AEFA 4AY6A 1QIMA 2HHAA 4IDCA 3DFIA 4UC0A 5H4HA 4XTRA 5EWLB 3WLKX 1VJ1A 1P61B 2FN9A 4NYJR 3KFLA 3CH6A 2VRCA 2HDWA 3D8HA 1V2HE 2W2XA 2ORED 1Z2DA 3IUYA 3DFFA 4NFSA 1FJ2A 4RA9A 1JG3A 3VC7A 2ZRQA 4KQHA 3P96A 5DGIA 5ENZA 5J5CA 1MC1A 2DHQA 3E3OA 5KQGA 3HJBA 1COWD 2FMFA 3RC2A 2XDQB 1J42A 1WY5A 1LQTA 5EXDA 3TTTA 2H2AA 4QECA 2VLBA 1JA9A 1U3FA 1Y98A 4Q34A 1G5PA 5NLLA 5FTMA 2HOQA 5GV7A 1SHLA 1ZLYA 5ITZB 2HIAA 4ZIRB 4C88A 1US8A 3KAPA 4J2OA 5FKJA 4Z4IA 3LWZA 4V2IA 1U6JA 1C41A 3SIXA 2WR8A 3E22B 1GU1A 4M1ZA 3I5YA 4M6WA 4EHBA 4RVHA 1CRLA 3HA2A 5CXSA 1UQTA 4IJWA 3HXPA 1ODCA 4W8GA 1NRWA 1O89A 2H1VA 5ILOA 2Z9DA 1FLNA 4UUOA 2RJNA 4DR4B 3MWFA 4QDZA 4FMPA 4I6EA 1YI8A 2QXUA 4RF3A 4L07A 4WEOA 1GUDA 5I9IA 5AK6A 1N57A 4JH0A 4RK6A 2OCLA 5JO9A 2C4WA 4B79A 5AHKA 2XE7A 1XD8A 2M1XA 5BRAA 4PPYA 1CTQA 3G0IA 5G0VA 5LP6F 1NF9A 1Q14A 2FSHA 2ZCJA 1YKFA 5FQNA 2UZ0A 4MRRA 2ZIZA 1C2TA 2DH5A 2VRBA 5EJ4A 2I91A 3O6VA 1KZ1A 1NQWA 3O4HA 2A4MA 2O0JA 1XN1A 2RKWA 1BROA 1ZH8A 4LDAA 4JLSA 2PX8A 4J9UE 1XPOA 5CBKA 3KM0A 2GLTA 3KHKA 4W5NA 3COVA 3Q1LA 4KIGA 4G23A 2X19A 3CPSA 5JYCA 4LQ4A 3QV2A 5EIXA 1EVQA 1S1CA 3EFEA 3MT8A 1RQPA 1QF9A 3W9BA 2J4DA 3S2UA 1MV5A 2WMYA 3B9QA 1D1TA 1KZ9A 3KVOA 2W2KA 3ZYCA 3IMGA 4GO1A 2YW2A 4AL4A 3GLRA 2EEZA 4BLSA 3WGUA 3WI7A 2OQIA 3F9CA 3PEFA 2V6BA 3RVBA 3NPAA 3PGJA 1DTEA 1O5OA 1XAIA 3DEJA 3H5WA 4B6GA 3WFIA 1D7OA 1T0PA 2GLUA 3AIOA 3I32A 3ZDFA 1KI6A 1NG1A 2A57A 2RE8A 4UPDA 1LTHR 2JGEA 2JIPA 2JLXA 1OH8A 3SEAA 1LNSA 1WPXA 2Q29A 1P80A 1ZN7A 4GU5A 1DJLA 1MJHA 3H99A 5DRYA 3W4JA 3OFND 4CXMA 1B42A 1W5SA 1T2AA 4N39A 4DWVA 2P9YA 4W1SA 2BSQA 1G4AE 4BNXA 5JE8A 3FVQA 3M4ZA 2OFXA 1KOJA 4JA2A 1NF2A 4ZO6A 3VTFA 2AN9A 2R6R1 4DDWA 3O26A 2R79A 1VCHA 1W0KA 5AW8A 2ATIA 3TCNA 1QX4A 1L7PA 4TLAA 4EJ2A 3MUOA 4HJXA 4M1QA 4RLQA 2NVWA 3ABSB 4UZSA 5CEEA 3WR5A 4GKKB 4ND4A 5LBUA 5GY7A 3LUGA 3Q9UA 5A6SA 3SFZA 3EFOA 2YVUA 5AVRA 4DUGA 1Y6JA 2PL5A 5I9SA 1EUDB 3TB6A 5BMVF 5BORA 4PG4A 5LNK6 4MNTA 3DMPA 4IXWA 2YY7A 3VMMA 3A2KA 1XHLA 1FJHA 4GKAA 1RQRA 2WZDA 4Q9DA 3RKUA 1BVRA 3NBZC 5KNDH 3GFOA 3VJRA 3TKLA 2E87A 2A2ZA 2NO4A 1W88B 2H29A 2F4NA 4NU8X 3I5XA 1G8PA 4IWNA 2QRQA 2PX0A 5JAHA 4E08A 2DFVA 1KDOA 1K88A 2YS6A 4WJKB 2C2BA 1SQ6A 2H1RA 5TJ9A 3CH5A 4BB5A 4ZYYA 3GAMA 3TSZA 2IYFA 2V6MA 5AWFC 1N36B 1UUFA 4MHTA 3TDNA 3G0DA 2ORIA 3IV6A 2OCBA 2YMMA 3MXTA 4Z2YA 5B30A 5BUQA 4B71A 1PYGA 2RGNC 2RHDA 1SCQA 3ENKA 1RXYA 3IA7A 4UUQA 3RC1A 4EHDA 5HJ7A 2ZIEA 4D98A 3BHMA 4XR9A 3EQ6A 1QG4A 1HE3A 3N7UA 3GGSA 1YA6A 3OBBA 3QWAA 1ZD1A 3KSDO 5FOTA 3WGGA 2OHGA 5FIUA 2WJPA 2PL3A 4YT5A 3RVJA 4BQSA 2POCA 1ESEA 2I62A 2IYAA 3GBPA 5EFZA 3WQBA 2DERA 1JYFA 1MX1A 5C8YB 2QZJA 4OLAA 1KDTA 4PXSA 4S1OA 1ZK2A 2WKWA 3ET4A 3NHMA 4HB0A 3ZQ6A 1W5EA 3NBKA 4W9RA 1HLFA 3FNEA 1VMAA 2WIDA 3GHYA 4IZHA 2XD4A 4RD6A 3I45A 1Z6ZA 1KETA 2PS1A 3BIFA 3FMVA 4ZAZA 5JLJA 1G16A 5DOVA 2ZJ2A 4KRXA 1RRVA 3L04A 4M2LA 4R6WA 1FRVA 1PQUA 1RYZA 1T8TA 4AYXA 3B2NA 2FP4A 3GT3A 1MEJA 4LOKA 5AKXA 4P3KA 3WB0A 4GPD1 4CM4A 3R2JA 2YZGA 4DAEA 3KPWA 4FM9A 1ZNYA 4PR3A 1VL0A 4YRAA 1XQ1A 3UJNA 3GPDG 5I9BA 4JV5B 1UOQA 2ENWA 1JWLA 5JMTA 4EAAA 5KMGB 2OSVA 3T5TA 1NAIA 2QX9A 1HTBA 1SELA 2QAGA 1IONA 2B6HA 4HJRA 4BMOB 4ER0A 1I3OA 2QRMA 3AW9A 3BJMA 4RA6B 4ZCQA 2VXBA 4OOFA 4OO3A 2XODA 1U8ZA 2PD6A 3AUAA 2C4TA 5CT8A 4YRFA 5FBLB 1SO8A 3UOWA 3PEUA 2VCYA 4EB6A 4FD3A 3CVOA 3NJ4A 2B78A 4KGXA 5JS1A 2IEZA 121PA 1CQWA 4B80A 5I7HA 1UZUA 5HTKA 4XWKA 5IYZA 1D7AA 1N6LA 4F21A 1TK9A 4QXRA 1APBA 1NMSA 2J59A 2LZ0A 5CK5A 3SNHA 3D64A 1QG0A 3PZBA 5EWLA 1ES9A 4B7ZA 1FLVA 4MWOA 1HL7A 4O4HA 3F1LA 1WP9A 2PAFA 3OBIA 3QBTA 5BQFA 3SVLA 2Y9MB 3QWHA 3KKKA 4UU8A 2GCEA 1UANA 2ZSUA 1V7ZA 3MWGA 3MA0A 4MUYA 3KVYA 5DNYB 5K3OA 4WOPA 1I4OA 4ZVPA 3Q8WA 1Z82A 1CY1A 1D2RA 3EUWA 3KJIA 4W9MC 2QU7A 4Z9AA 1JHUA 3PD0A 3AVWA 2P2DA 3L5KA 1RXCA 3LXUX 4MVJD 2QTNA 1LBHA 3QBDA 2YZKA 2NT3A 3F9IA 1ZI9A 3OLWA 5F12A 3CCCA 2YQ4A 5HBRA 1OB5A 2F3QA 5G40A 2GI4A 4JLAA 1OX4B 2VDVE 4M21A 1JSXA 5IC5A 3ZVLA 3DLAA 3EWSA 3W8DA 4JQSA 2V7XA 3THWA 4P8RA 5DNAA 3I5MA 3AKYA 3L4BC 3GRCA 2YUIA 4P38A 2JGNA 1H65A 5D87A 2HRZA 4CG1A 4E5PA 5A03A 3AERA 5C51B 1J5EB 5HM8A 4RFSA 1AQLA 4ZCLA 1YCFA 1J8DA 4UM8B 1IZ7A 1KI3A 2AD5A 4FEEA 3FYTA 1K98A 3UJCA 1ZJWA 2WTAA 3M6FA 3OSUA 4J29A 4QTZA 4LJ6A 4UKDA 2Y9PB 5MDHA 1T9HA 1K7CA 2QU8A 2Q9AA 3GW8A 2FPOA 4IIGA 4P31A 2B34A 4S3MA 1DT5A 2ORVA 3HP4A 4FGWA 4N82A 5KWEA 1E63A 4OFZA 1OWOA 3OQHA 4N6NA 3CCBA 3AKDA 3SZLA 1CRPA 2CXQA 1GU0A 2CUKA 2VTVA 1ORRA 2XWBF 3HC7A 4RIGA 3VFDA 1O8CA 1VIMA 1AE1A 4R68A 3JQ8B 4B34A 2HA0A 1MABB 3MBKA 4Q48A 1C1HA 3OSZA 3EY4A 3NW9A 2VSQA 4YV7A 4DJEC 4GPIB 5IK2A 2AG0A 1VXRA 3KOZA 3V00A 3F5QA 4QEKA 3G9QA 3DZHA 4C43A 5F5NA 1NUAA 1PVDA 3HCWA 5G3ZA 4XGNA 5JHGB 4ZU6X 1JQ3A 5MHTA 4A6EA 2B0CA 4KLRA 1F9EA 1Q20A 1SG6A 1VKJA 1XZJA 2XLCA 5JDCC 4C1BA 2RGAA 4O4JF 3UGKA 3K9BA 3C3BA 5IARA 3CLUD 3PQ6A 1BX3A 3C74A 3G85A 1CUJA 5FUQA 4LMRA 1HX7A 4CKWB 3L4JA 2DHCA 2XKBA 1GL3A 4FFLA 4X7MA 5KOYA 1XPRA 1IXYA 3BKWA 3FI9A 2EKZA 4MUMA 3JVUA 4IJ5A 2Z6VA 5LXTF 1E9EA 3LCRA 1ABBA 4E5YA 5SYNA 4LMAA 1AUPA 4CKXA 2IHUA 3O47A 1EXWA 1KF0A 2H2DA 2VATA 5CLQA 3TBFA 4BASA 2GVDC 4FB4A 1CEEA 1X9HA 3IE0A 4JOBA 3NGLA 2QJTA 2WVAA 4XDYA 5I9MA 1B6RA 1L7QA 1T0BA 1WHTA 2LIVA 2WTEA 3PR1A 4JB8A 1TIKA 3PFNA 3TB4A 3IPLA 5T4FA 3CS3A 3DNPA 4YRJA 5KWSA 1K8XB 1LQUA 1V7PC 1VSVA 2I6FA 2I2XB 2Y8EA 3EDYA 4IX9A 4K6OA 5AW9A 3UXHA 3N2KA 3BTUA 4BP3A 3NR2A 3LNTA 1W2HA 2NZYA 3I2IA 4FIZA 4NJOA 1E3WB 2WPNA 4M8IA 5EYPA 4ER5A 5LBIA 4A2WA 4IXTA 3QUTA 3AF0A 5DYGA 1CD5A 4DADA 3WB9A 1EVLA 3FOWA 5E7QA 2EF1A 5HKKD 4NWIA 1KAHA 5FP0A 4PNEA 1CQJA 4WTOA 2FUG6 3P5SA 4JLVA 1R15A 4JX8A 3T5GA 3D8BA 2CLCX 5I9LA 1CLEA 2EP7A 4YRMA 3NZEA 2J3KA 5B3JC 3F5FA 1W4ZA 2O19A 3F6SA 1R0XA 4IGIA 4K26A 2I67A 3DUFA 1A88A 2ARKA 2J4CA 1F2TA 1WCXA 4CU2A 4R41A 3IS3A 2HSEA 4EVIA 5B2FA 4RD4A 2JGDB 4HHEA 1RRMA 3OETA 1KO4A 1ZGHA 2QZSA 2HJGA 2JLBA 2ZVDA 3OWOA 3P2JA 4DSUA 2EF0A 1G66A 4MKXA 4NZPA 3FZQA 5BURA 1L8LA 3VTAA 1JSRA 3BBLA 3DHWC 4DIOA 1IVSA 5DWQA 1VKRA 3G9TA 3SS9X 4FSHA 3QQPA 1M0SA 4NH4A 3F90A 3N5CA 4NOLA 4Z2AA 5JXIA 4N3CA 2XXJA 3UGJA 4H7IA 4I99A 3M9XA 1G98A 3T7CA 1K97A 1JHQA 4G5HA 3JAKA 4L9RA 4DLYA 1XVTA 5HRUA 4LBYA 1EE9A 4RGQA 1Y8AA 2PUTA 2ZK7A 2FOXA 1TU4A 1Z18A 4IRMA 3PDIB 4J43A 3V97A 4BLQA 1BMFD 2VOEA 4Q82A 2C5HA 3B51X 3CN9A 2Q9UA 3IAXA 3DVRX 3O9ZA 3R8XA 1I6LA 1QP8A 4Q5IA 1V6SA 4FTWA 4LJ8A 1XXHA 4WHMA 5EE5B 3C4QA 2W2LA 3TZEA 5AJWA 1MTZA 3BEDA 4N7RA 1NLYA 2F1HA 2FPLA 3KEOA 1SN7A 3EIOA 3FCSB 3MJEA 3R6WA 4G97A 4P36A 5G1OA 3EQZA 2PYZA 4K1LA 1U4NA 2V7BA 3ELUA 3TBHA 4K8RB 2PS3A 2QVLA 5A4JA 5M34A 5BV2P 1QHGA 3DWIA 3KL4A 3MGAA 1XB2A 3Q12A 4UTZA 2JHAA 3QWIA 5IJAA 5KOHA 2XCSB 3RWOA 8ABPA 4CIAA 2FUNB 3ESZA 4WOKA 4RS3A 4M54A 5IXSA 1C7EA 4DA7A 1QGUA 3C7AA 3KJQA 1Q1AA 3TSCA 4B3SB 1TT7A 3BDVA 4MYCA 4PE5B 4ZOLA 2FWAA 2SNIE 3PUKA 3R24A 3R7BA 1U11A 4MARA 2HRCA 3ASZA 3O9MA 3GZTB 4S0ZA 2PT6A 1MOPA 3HWWA 1UPXA 3W5IA 5CFPA 5K01A 3FNBA 1MB9A 1H3EA 2RGBA 1QRTA 1E9DA 2FWJA 2UYOA 2OV4A 4F97A 3ZGXA 4EKDA 1OXVA 1J8QA 1QYRA 5JNRA 4WZBA 4MH0R 3ME5A 3Q2IA 4FLMA 3ZWQA 1BE0A 1QF6A 3U4HA 5K2OA 4EYOA 4HPWA 4KXYA 4JCCA 4NFYA 2O2YA 5JXWA 2BMEA 2Z3VA 4J7XA 3CA8A 5KX5B 5AD1A 2VZLA 4UU0A 1DARA 3BSSA 1UDRA 3OIVA 4JP5A 4JK3A 1O8BA 1XTZA 1JWAB 1G20B 2J3IA 4KWIA 2QN9A 1ILEA 3NDPA 4MUKA 5TS2A 4RV4A 3D3WA 1HE4A 5D8DA 2ZSEA 2FZGA 4BNWA 1P5JA 6YASA 3T7TA 1SJ9A 2GD1O 5A5VA 2HREA 4H7KA 1G21B 1KMHB 1PW5A 5CITA 1CR2A 2OFPA 1M2VA 5AXBA 4G5QA 1AQNA 5E4JA 1XLTA 4BKQA 1UOOA 3CZRA 1G17A 1O0CA 1ZHOA 4QICA 4XJSA 3C5WP 1XA0A 4MV7A 3QHPA 4MS1A 1BDBA 4GL2A 4KUGA 3NNSA 2NUBA 3EIHA 3L6RA 1CUYA 4FUQA 2VP3A 4PX5A 1AUVA 2XWJI 2ZRPA 1BVHA 3WSWA 1NF8A 2VHTA 3OKAA 1O94A 2G40A 2WSLA 1C9NA 2NSJA 1YDMA 3JQGA 3NWPA 3OCVA 4RULA 3M5CA 4B73A 4Q02A 4CKWA 1AF4A 3ZW7A 3IURA 1JH9A 1W49A 4MROA 2A9PA 5AI4A 1JQ5A 1IJFA 1HF3A 3V7YA 4KKVA 3BRSA 3M70A 5EWMB 4PG5A 1ZY2A 1DS6A 2I34A 5KX5A 1F14A 3AXTA 4XKJA 4DXHA 2ZUCA 3W5DA 1ADGA 2C5FA 5ERGB 3RADC 1B41A 2JLCA 3NBXX 4S35A 4AMZA 5IANA 2BR3A 2FVYA 1Y9DA 2Q2WA 2VAVA 3BL5A 2ZR7A 1HOXA 3AY6A 1DBPA 4YHHB 4C22A 1KO7A 4S2UA 4ZANA 5ECYA 1GYRA 1WOMA 3TAUA 3A58B 4W82A 4EI2A 3ORQA 3RYHB 2G36A 3TW8B 3PHHA 4RANA 5AOVA 4E51A 1HT0A 3BPSA 4NMLA 4OJQA 3OFKA 1SKUA 5JC8A 2PWPA 4R51A 3NEPX 4ESEA 5F4ZA 3KHSA 3TQRA 1WW2A 1CJMA 4ZT4A 2O8DA 4ABTA 4L8FA 2KSQA 2NG1A 3CVXA 4K9SA 5E95A 3TJZA 3M6VA 3OURA 3DL7A 5E4YA 3RRMA 3VSCA 5JCPA 5HHTA 1QB7A 1P4SA 1SXJE 1WQ3A 1EWYA 5LQMA 1UBSB 1VE7A 3HA7A 3WYNA 3UTDA 2WHPA 3KVVA 1NJ2A 1NV8A 3L02A 4KLCA 2W6OA 4DMRA 4US2R 1XNJA 2NQ2C 1RCFA 2ZYSA 3IILA 4FWBA 3K6JA 4NZZA 4HNUA 4R1SA 4JYZA 5K05A 1ESMA 2GXUA 3HCPA 3FTPA 1BHO1 1KBOA 2FKNA 3LFTA 4ZRNA 4JENA 5IYZF 3HUFA 4FBLA 2QT9A 2CVQA 2QUHA 5IBCA 5JAUA 1TPYA 3G7UA 4C0WA 4UJ5A 3U7IA 2NYRA 4JUBA 4RF2A 5F64A 5B1SA 1SC4A 3DL2A 3Q72A 1BN6A 4OUKX 2A9RA 3C6XA 4RKQA 4D5GA 5AQ1A 2F4VB 3RK0A 1MX9A 3NHWA 3HEBA 1Z5OA 2IGTA 3ONVA 1T1JA 1VBMA 5LYYA 4KO1S 5HCIA 3A1CA 5KI6A 4OFXA 4GI3A 4D4GA 3OKPA 2UUAB 3I61A 2WLSA 1A5BB 1SPXA 1RYYA 1Y6ZA 2NO5A 3ODGA 3SK0A 4B17A 4UEQA 4LFCB 3VH1A 3KCQA 1XD2B 3KU4A 3FMGA 3MS7A 1I5RA 4YQEA 2WUFA 4DDTA 1Y3AA 2Z3ZA 2YJ5A 1HYHA 3KE9A 1CVIA 1QH0A 1RM4A 2Q8PA 4YMIA 7MDHA 2AT1A 4X91A 3PEEA 1EDBA 3DVSX 1Y6FA 2DBRA 2KHZA 1Y5MA 3OZCA 2IXEA 4WQMA 3WWEA 3ROMA 5FWNA 1RHQA 5FUWA 4C7VA 1L4UA 3MNFA 3NALA 4QU0A 1IG3A 3G5UA 3WLHA 3P0JA 1V8DA 1RIIA 3C3XA 3FX2A 2R5WA 4DV0B 4FONA 5CFNA 5CFLA 3CUSA 3A7EA 3FWKA 5HFAA 2YY6A 1OYVA 4Q03A 1J9ZA 1EPUA 3L82B 2ZYWX 4QASA 5EXXA 1Z0JA 3E2IA 3E2PA 3N0VA 1RVDA 2ADFA 1J4AA 2XUGA 3FGZA 4IIJA 3G9UA 4CNBA 4ETMA 1N2JA 4EH1A 3M8KA 4HWTA 4JFAA 1I1NA 1OBVA 2REQA 3HWSA 1NX9A 4L2IA 4V0QA 3ZI0A 4H4EA 3ONWA 2PJUA 4CM4B 5KYXB 1W29A 1F6BA 2GHRA 1DQRA 1ZNXA 1PX0A 1WVGA 2D2XA 2OCAA 3D3NA 5FBKA 3VYSB 3JPWA 3ZZNA 4XSHA 1OMOA 2IPLA 3LPLA 2NAFA 2WWXA 2ZYRA 1NKSA 3BE5A 3AR4A 3FCUB 4HAVA 1RM3A 1KI1A 5LA6F 1F4LA 1EHIA 5AVZA 3KQUA 1RPTA 1Q2UA 1DMRA 1ZZGA 2P91A 3N70A 1KJNA 4FEAA 2O48X 4CIBA 3GJXC 1O57A 2PHZA 4RVFA 3TZBA 3SJ7A 1SBIA 2LCQA 1I1OA 3WIBA 1Z5WA 1BFKA 5IT4A 2Q3FA 2ZSDA 4MWZA 3CBGA 2HJHA 4YP0A 4CL8A 1ANKA 4TTIA 1JEYB 5K0GA 4K6CA 2QSZA 2JKVA 1CERA 1K4YA 3HDQA 3NWEA 2QR5A 1GQFA 2BRUA 4BO6A 3C8UA 2OM2A 1X1RA 4IUCS 4PTYA 3ZNOA 4DIEA 4H7DA 4Q24A 1K5GA 1Z39A 1AKRA 4YFVA 1Z7WA 4RAQA 1XF1A 4JP1A 2NNLD 3MJHA 1UXGA 4GX2A 5H59A 1YJQA 4FDAA 2PDAA 2Q1YA 3LUFA 3X3HA 4ZCTA 5JAZA 2WVGA 3QF7A 2JIOA 4M9QA 4EQ6B 4JVNA 2QM3A 4KV9A 5KQPA 1IBMB 2C2WA 5B1YA 4RENA 4E12A 1TKBA 2ZE5A 5I47A 4X71A 1L5HB 4GXTA 1E94E 1X42A 3CO5A 4TM7A 4DSAA 2XMBA 1KYIA 1ZESA 5CD1A 3IEMA 3KB8A 4TTQA 3CF0A 1G8GA 1P9RA 3LPAA 2J45A 3QU5A 4NBUA 1NLUA 4A0GA 4EMTA 4ZVMA 4OREX 1Q0TA 1ZSYA 3G82C 1PYDA 1M66A 1YFZA 5E6SB 4BYMA 2PXAA 4GYKA 1VJDA 2FK8A 1MF7A 3EUEA 2V4UA 4F4JA 4O0LA 2HSJA 1LX6A 4YP7A 4GRAA 4MQEA 2IZ1A 1O5TA 4FJ2A 2ZBQA 1D0SA 1MNAA 2FLVA 2YHIB 4LC0A 5TMPA 1MXHA 2QR2A 4LIPD 5CA0B 2ZIXA 3MTJA 1YS4A 3DKKA 1LW6E 5CGQB 4OY3A 2OCDA 3NP9A 3TLAA 2XTMA 2VC2B 3EXEA 4PWYA 4D02A 3ZBUA 3EZYA 2I4RA 2PD4A 2GCOA 2QZPA 4ENRA 1W85B 2J6CA 1ACLA 3ZGLA 2BGWA 3PDUA 1GKUB 3R9XA 1DVRA 2QVCA 5LP6A 1PFWA 4B85A 4R1NA 3TQFA 4B45A 1O95C 2W93A 1MABA 3VKFA 1IBKB 3UB3A 4Z7QB 4NEHB 3PC4A 3ACDA 4X8OA 2RBGA 5CG2A 2FJ0A 2KE5A 3I1YA 1EZZA 2HAEA 4D9JA 1UJMA 2Q6TA 3OWXA 4O2BB 4LF9B 1N5MA 3TRKA 2DPMA 2GJ4A 2CFTA 3UMVA 5CYGA 5JDIA 1I9CA 2IH4A 4X1OA 2ACVA 3ICCA 1T8UA 1P7YA 1RZ3A 2XT6A 2Q5OA 1NJ6A 2YN4A 3PLRA 5KNBD 1EQUA 4F71A 4BB6A 4TXMA 2YWEA 3HS3A 3PICA 1OU4A 3P9QA 4UXJA 1YRBA 4ER7A 3TIIA 2QN6A 1I2CA 2GN6A 3AJDA 3B89A 4PM4A 3MCAA 4RCZA 2HWKA 2ZI3A 1RBQA 1XFDA 2YJ6A 2JLSA 3KU1A 3VVMA 1GGNA 3N0XA 4I9UA 3S68A 3VO2A 4E88A 5AW6A 2JGKA 1ZA2A 4MP6A 2IHJA 3QP9A 3CIOA 4XIJA 3F4KA 3LUAA 4Z0HO 3BKXA 4MWDA 2OOKA 5HOQA 5H8WA 5ERYA 5KSOA 1N3YA 3JD4A 2GCNA 2QM7A 3CSSA 2GAIA 4HDQB 1HDOA 4L9SA 4QREA 2OEPA 4Z7JA 1MUUA 1PEDA 1UP6A 4MMXB 3C1AA 5JC1A 2C1ZA 3W0LB 3HLYA 1G7SA 2FOIA 3H5NA 5FUMA 1AXRA 2FWIA 1GGFA 4HWSA 4ZGWA 1ZEMA 2PTHA 1CT9A 3R9WA 1P9NA 3LKDA 4MCIA 2GM4A 3EGCA 2EJBA 1E5VA 3HCFA 3JYHA 2EQAA 5LZ4A 1EEHA 1UBEA 3DT6A 5IJ0B 1ECJA 3GZJA 5HA5A 5KJEA 1NVAA 1FP7A 3MT7A 1TXGA 2O3QA 1FFSA 1B1CA 4AZTA 3SR4A 1TO1E 2QNRA 1PZEA 4ZOCA 1JLMA 4YT2A 4CDGA 3SDZA 2Q4RA 3D5QA 3WWZA 4P5DA 3P9CA 1USUA 2YWRA 2ZQYA 4GMKA 4MYRA 4DR2B 2RGEA 1ZVVA 1N78A 5TSDA 4ZAXA 4AS2A 3QXHA 3KOYA 1OLUB 5EKTA 4CQNA 2G7ZA 1AGPA 1M8JA 3M9LA 3G2IA 4ZO7A 2OYCA 4YUXA 1DKQA 3ORSA 2AOTB 1B2RA 3K0KA 3NMUF 2JIZD 4QGHA 1EG2A 1RBMA 3LQYA 3RTEA 3ADCA 2I78A 3TKYA 2CNBA 3DV2A 5JEDA 4L5AA 1Q21A 3IE2A 3LQ4A 3I9OA 1QJ4A 3TLEA 4XLZA 5A3VA 5LNK1 1KDRA 5CXUA 3ZY5A 1DC5A 1JR3E 2X9LA 3KJNA 2QRVA 5EJ5A 3GP3A 4GI2A 3AM4A 2W2VA 1GN8A 2RJ3A 3SOZA 3WXMA 2GM3A 3RIHA 5C7IO 3B8HA 4CMKA 1QH1B 3B52X 4U6SA 3R44A 4F5DA 4BNHA 4ZI2A 1CFJA 1KDVA 2IPOA 3AYXB 2MSEB 1K6JA 4EW1A 1ECFA 1I51A 2XOKD 2ZTMA 4XGQA 1LRKA 3DBOB 1PGOA 1EUCB 2WYOA 1U81A 3TTUA 4BNKA 6NULA 5HMLA 1U7TA 4IDAA 1W9MA 2Q45A 3SYRA 4YRLA 5DX8A 4QA9A 4BJHB 2W2OA 2VDOB 1SCUB 2QPTA 4R8VA 2FTKE 3SGLA 2M98A 1DSSG 4BNZA 5A4AA 1XX6A 3X1KA 1KP3A 2C4HA 1M33A 2A5LA 3LUDA 1KWKA 1YBFA 1FX1A 4DA4A 4KR6A 1YZVA 3I04A 1X13A 2FWPA 2GRJA 5DLEA 4DRXB 3EFBA 3GY0A 3FR8A 4MAMA 8GPBA 1SXPA 3MJFA 2GSDA 4M7WA 2MSNA 1KXZA 4PG6A 1D6JA 2EQ5A 2X14A 3C3WA 3HM2A 3ZU5A 2YOHA 4F2GA 3FCOA 2AHRA 3EIQA 5AKYA 1TJYA 4OP3A 5F78A 1ZK0A 5C3UA 3E9QA 2VJQA 1QE0A 2FE1A 1KMQA 1O3YA 4PGHA 4EJSB 3JRWA 1COZA 1JIUA 4BNTA 4PFKA 5A0FA 4XYGA 3R9IA 3DZFA 3IQXA 1I1HA 1TA4A 1WQ1R 1HG0A 1A72A 1M76A 3ND6A 3EB9A 4HZGA 5A3JA 3WQHA 3RVQA 4ND5A 2MMGA 2ZWIA 1E1RD 4A8JB 4FP9A 3ITKA 3WLAA 2Q7XA 2RI1A 4IEIA 4C0KA 4RGBA 2XQIA 1SEVA 3DEZA 1RNLA 4UMFA 5C0OE 4EKNB 3QTLA 4C87A 1L8QA 3SIRA 3FMPB 5GM2A 3PFCA 1RXUA 1ZH0A 2BTOA 1TCUA 4HC4A 3VVLA 5C1PA 3SYNA 3DR3A 4EO9A 3CY6A 3UH1A 3VNBA 3UT6A 2PS9A 1SU8A 7ADHA 3EDOA 5U4QA 1Z0DA 5F4BA 1OC2A 4PCVA 1UKAA 3WNDA 3AEQA 4MGHA 1JJAA 5CT9A 1OXXK 2IY9A 1MZPA 1E6EA 1GGVA 1ZJ5A 2V7QD 1KVUA 1A9ZA 1Z7YA 1L4MA 2R84A 2VBIA 3DQQA 1VHLA 4KWEA 2HSGA 1JLLB 4ZAVA 1NBHA 2JVJA 3TXYA 1JP7A 4M9ZA 1UQUA 3BORA 3VTZA 3ER8A 4YJGA 4HPXB 1NAHA 3H1PA 4K40A 3RVOA 3L0SA 5KC8A 1CJBA 2JAQA 2WIKA 3DTVD 4PSDA 4S05A 1T3ZA 3FMIA 3TX2A 2A30A 2DQZA 4YTEA 2YYSA 3BXXA 3LKVA 2ZKLA 4BZXA 1VJTA 2YFKA 1H0SA 1XPUA 4AKIA 4JJ8A 4MYTA 1KC1A 2GPAA 2HBYA 1KK1A 1Q57A 4YUWA 1IOZA 4ZEMA 2QAGC 2YZ7A 2Z09A 1WNFA 3NC4A 2CUNA 2JGIA 3LGXA 4L4YA 4R31A 4NZOA 2V4ZA 1W34A 2CVPA 3A2MA 3MINA 1R0YA 3WYEA 4DVGA 1PP4A 1XTSA 2P6PA 2G70A 3FHOA 3L0CA 4ZTBA 1QDUA 3ZZUA 1DWQA 3ORFA 5ALKA 2QN1A 4X63A 3AM3A 4WERA 1JQEA 4Q21A 1WZCA 2YWHA 1ECLA 1VIAA 3NXKA 4JLNA 2AEJA 1GG8A 1D1SA 1UJCA 2RARA 2IODA 2A5FA 2NXNA 1J1ZA 2QVZX 4ARAA 4DLSA 4LHSA 2QRZA 4QYMA 4KPFC 4N9QA 3GLFE 3FKSD 2ZANA 3FHTA 1XZNA 1ZH6A 4BKRA 3LUKA 2VSXA 3DL0A 5SV2A 1LF0A 4MZXA 4OQXA 4QM6A 1YJAA 3NH6A 3JSAA 2JASA 4Z0PA 2NO1A 3LIIA 3NHBA 4AJJA 1ND6A 1OPXA 2PNFA 3NT4A 3IUBA 5A4MS 3UKJA 5KKNB 2VKTA 2BZ1A 3AI7A 2EYQA 4MVJH 1OHHD 5ANRB 1VFNA 3EGIA 3RU3A 3UOAB 2BTQA 4IFEA 2EP5A 2JIQA 2QMQA 4RK5A 721PA 3NFYA 1SHZA 1QRDA 2XXBA 3ZX5A 3K4QA 3LRPA 1XAGA 2XX3A 3MTAA 4Q3BA 3VKUA 3BCSA 2ENUA 1D2MA 1RPAA 4M6WB 4DYHA 1ZVJA 2NV6A 2F64A 3QYAA 2FZKA 2GGSA 3EODA 1DMSA 1IWPB 3AJ9A 2HHLA 1EEXB 3BB1A 3HU3A 3L4BA 3S2FA 3VR4A 4D1YA 1JI0A 1A3CA 4O1IA 2ZYDA 5HF5A 3A04A 4YMTA 4DCMA 1HH4A 2JH9A 5CVDA 3AB8A 3VDXA 2JJ2A 5AK3A 5ICFA 4WBXC 1BWRA 2F17A 1J2UA 1BXGA 2D1QA 5D5QA 2FG7C 3L8MA 1QK3A 4F86A 1P0IA 3C45A 4JHLA 4O1HA 2AJDA 4Z0NA 2Y6VA 4P22A 1D6NA 4KXNA 5B3AA 3T4PA 3U9TA 3Q8MA 5B64A 1EVYA 4G9BA 2NXEA 1FYWA 4JVOA 1O6BA 2Q1XA 2ID8A 2BE9A 2MR5A 3BZBA 1X9GA 3UUGA 4C4YA 5A7HA 2WDZA 4PICA 3VNRA 2HRBA 4Y98A 3UMGA 4V1CI 3QE3A 4KXWA 1IWBB 1VLZA 5F23A 3LIPA 3ZOKA 1KFBB 2H1LA 2V3WA 4NE7A 5E1DA 1ZRMA 5CVTA 1E0DA 1Y7IA 2H2IA 3NOQA 4L78A 5BN4B 4DZZA 2JLUA 1IN6A 3FMFA 3WRXA 1MR3F 4B3IA 1V47A 3G2MA 3COPA 3H6GA 4DYVA 2WFLB 1QGZA 2P68A 3FD8A 3ZKWA 1JEQB 3I01A 2PUAA 2DJIA 1OH5A 1DC7A 1SOUA 1I7LA 4EAQA 4C4ZA 2MSLA 3PV0A 5ALNA 3L7AA 2ODBA 4PLTA 4TWIA 2DP4E 2XQKA 4EFLA 5IKPA 2IPMA 2A92A 3FE2A 3UUEA 2C4UA 3NV9A 3UMSA 4JEMA 2LWIA 1QANA 2PV7A 1A2BA 3SZ3A 5K8JB 2FGJA 3ABZA 3UV3A 2VDQB 1BX1A 3L7JA 3PGLA 2Z6AA 1KGDA 3PHCA 4L08A 4FXOA 4F11A 5EOVA 1O0BA 3NI2A 4TS3A 2PGXA 3LP6A 4HDMA 3NHLA 4D57A 1KQOA 4M55A 2ZUDA 4JT9A 1HFKA 2COKA 1YVPA 3UJAA 3LFUA 4M0KA 5KYWB 4B6JA 1PQWA 3HP1A 3QKSA 4I19A 5CA0A 2Z9BA 3IESA 1ICEA 5LIPA 2W00A 1DV1A 3NAQA 1N5DA 3OJXA 2XNDA 3WRYC 4A23A 1SH7A 1Z2NX 2A1TR 4LAFA 3JD3A 4TRNA 2ODEA 1PHPA 3D1JA 5KTOA 2H06A 1JDUA 1MIHA 1I0ZA 5KQSA 3D3JA 1DKNA 2ID9A 4IBOA 3FNQA 3JZDA 1KKMA 4IINA 4MJ3A 3ZY3A 1N6IA 1ARZA 4KXFB 3R76A 4MRMB 4DWJA 4CM7A 2B1IA 4UHFA 3QPDA 1A4UA 1NQOA 2V7EA 1NY6A 3KYJB 4IJMA 4KXLA 2PLNA 3W4KA 3EPPA 3S1AB 3I2YX 3GA0A 4LGCA 4ZAYA 1Y80A 1UR5A 4ZCMA 4DV3B 4JI0B 1E9FA 1P0CA 2QQGA 3KHUA 2O7VA 4H3HB 4RBNA 4UTVA 2QUAA 3HZOA 5EUCA 1NULA 2UXDB 4JASB 4JR2A 4MICA 1GTSA 3PWZA 2QRKA 3GWGA 3R3JA 3VZSA 1VKHA 2BFCB 4OIMA 1OYOA 4C2TA 4FDUA 4JOSA 1V5EA 5FWAA 4NX2A 4ARZA 4QLBA 3RKSA 5CURA 2TYSB 3BXFA 4X3CA 5KX5F 4HDOB 4GLJA 2OBLA 4WK2B 4AJKA 2O54A 1Z06A 4LC9A 3OJ0A 4GBMA 2X4GA 4B76A 1VBNA 1VHDA 4HQFA 3JY6A 5B57C 2I80A 3QMVA 4IF4A 2LCIA 5I7AA 4DQDA 1M8KA 2ZZMA 1LRJA 3QVKA 3QG5A 4ZU1X 1SHKA 1RR6A 3ZLUA 3JQ9A 5ITVA 2PUDA 4N9WA 4POOA 1XZDA 3EGEA 3WIDA 1SKAA 2ZVJA 2BJWA 2G9VA 5B1DA 3T1NA 3KQTA 2ODTX 3AZPA 5J5AA 2PBRA 2XUPA 3MUEA 3TZLA 2Z1MA 2HMUA 4QDKA 4L8LA 5KTYA 1RI5A 5EGSA 4UREA 3WHIA 1XR3A 2GA8A 2NUAA 2RGUA 3AGQA 4U2DA 4AP9A 1RZRA 4KI0A 4MW5A 1E98A 1XP8A 3SM3A 1YJ5A 1HFWA 1C14A 4EY6A 5AM2A 1SR8A 4C0LA 4CLXA 4D74A 1AKYA 1SCKA 3IDZA 4C01A 3U61B 5IT5A 1N8KA 1TI7A 2WAAA 4Q4JA 3VZPA 1N25A 1ZWLA 2RK4A 2FJPA 4Q3AA 3TRDA 2WF6A 5A5GA 3K9CA 3QHQA 1TYEB 4IYJA 2ATVA 1NT2A 1PL6A 3MTIA 3DLTA 4JP8A 5CPBA 3FF1A 3UM9A 3LCMA 2Y76A 2OBNA 3IUSA 3WB1A 4NJEB 4UD2A 4BQPA 4Z49A 3T3PB 1PF7E 3V5NA 2QM8A 2RHOA 3HEAA 3RVRA 4OQNA 2VWGA 4PZPA 3DZDA 5U4XA 1BDMA 3DE2X 3EA0A 3UBMA 1XCMA 1WWKA 1X7WB 1GXSB 1K2WA 1H6CA 4NBSA 1PW7A 2ILVA 3VAZA 1NHGA 3WSTA 1LLUA 1W1IA 1UEIA 3IPXA 4MQ5A 4CGYA 3FR7A 1FYDA 4MIEA 5EP1A 3F47A 1T6YA 4DY6A 3KKPA 3H9JA 4E3ZA 1QORA 4NNOA 5EE1A 2BGLA 1IM8A 4GNKA 2V5UA 3BE6A 4LRXA 1P7VA 1L4BA 1TAGA 3MRVA 4YAWA 5AUOB 1YCGA 4OPMA 3SFVA 3OM8A 3TW8A 5E38A 1DOAA 1E3TA 2ZB2A 3W1VA 3TLBA 2NQ8A 1I3MA 4XLTA 5JWOA 1X2BA 2H8KA 4D41A 5H4GA 2P8SA 2BVNA 4R7ZA 1M7GA 2WD9A 4MW4A 2GT1A 5AM4A 4P3YA 3ZV3A 5AW1A 4U7DA 3I2KA 2R0QC 3QVGA 4BMZA 3KPJA 1P62B 3AV3A 1G21E 1L4YA 2W6ZA 3IAAA 4Q1EA 3SQOA 3N0RA 2ZAGA 3ZG6A 3DVAB 1FCJA 3HP7A 2CLDX 2QT0A 1GGHA 1QHYA 1BW9A 2W2MA 5JV5A 1H4QA 5J1SB 3GDWA 4E7PA 3RIGA 4MS3B 3ZBQA 5ALLA 4YBRA 5BSGA 3UAZA 5BMVB 3LKZA 3TFWA 5BYJA 1XCPA 4FFOA 1K2VN 1PT5A 1YOVA 5ESRA 3RC9A 4W99A 3KYBA 1FBTA 4D8VA 4B3BA 1TVKA 1KARA 4Z54A 2WFZA 3MWKA 1E2PA 4DCVA 1Y8RA 2WKPA 4HNHA 3DMHA 1PJSA 3Q7IA 1GCGA 4BIMA 2ZOSA 2WD7A 5KJ1A 1H8ED 4QBKA 3IEKA 1DAFA 2FE4A 4E2ZA 2IF0A 2GYYA 4GPTA 1UMKA 2Q5QA 4P3XA 3E7DA 4MVJM 3TNJA 1SWVA 5JARA 1Q12A 2QMZA 1FIUA 3FZGA 1O6FA 5IH3A 5LA6A 1IJEA 5KPJA 1Y8QB 3L49A 4DHEA 5HPYB 2O1XA 2O52A 2FJUA 2A1IA 4HGYA 1NOJA 8ATCA 1O03A 2H4FA 3NBUA 3MTBA 3SC3A 4NC9A 1KA9H 5ALDA 4PN7A 4CM1A 3FFXA 4YRZA 4HB2A 5IFLA 2GN1A 3EVDA 3TOCA 1WTCA 2QS9A 1IXZA 1GCIA 2HLHA 2NUPB 3DZCA 2CSUA 2AB0A 2X2OA 3AVPA 3A3OA 5CDHA 1HE1C 1LD3A 3T6KA 1E5DA 1JR2A 3WMXA 2XQFA 1W36C 1T8WA 1KFEB 1M0TA 4NONA 5HVNA 2BGUA 1PK9A 1GRQA 2ZETA 4NIMA 5AJYA 1IN7A 5AUQA 5FOQA 2EHDA 3WFZA 1OASA 2DQYA 2X0FA 1XVUA 2WMOB 4WAUA 4U7WA 1L1QA 4F6LA 4O02B 4LECA 5F9MA 3EVCA 3QZUA 1GGEA 1NBMD 4XVCA 2H65A 1GPMA 1JBEA 1SVSA 1AK9A 2I6XA 1JXAA 2NZJA 1QS0B 3NT2A 3OM1A 4B82A 1MQ9A 1MA0A 2O2ZA 2KQUA 5JS6A 5LA6B 1T13A 1LU9A 3HGMA 4ENTA 2WYUA 1K89A 4FYJA 4MV6A 3HJHA 1SHJA 4KKXB 2EJTA 1EK0A 3TW4A 2YZ2A 1TQDA 3P20A 2XYPA 3HLTA 4GAEA 2HX1A 3NKFA 2VJOA 2AI1A 4FFWA 1NV9A 1KVSA 4Q9JA 2PQ2A 1WU8A 2VXCA 4F4DA 5BMVA 2XB4A 3I0ZA 1KNQA 4DV7B 1VZ2A 1X7ZA 4QBHA 5BQ5A 1EIZA 3LC1O 4FEYA 1YB1A 4MIYA 3WAJA 2V3CC 2P5UA 2QRPA 2BIFA 4N7MA 3GARA 1J00A 3NC1C 3OICA 4AG5A 2DM6A 1CUDA 421PA 2MIIA 4KR7A 2BCGY 1Q3HA 3EH2A 3HKBB 3MYYA 1SIBE 3NU1A 4KWTA 1JFLA 4MWEA 3SJBA 2XRYA 4Q3OA 2BFPA 4ZQIA 4GHWA 5TB5A 1NLFA 2OFOA 2PVCA 3QVOA 4YJ2B 4FYPA 5BN4A 1U3CA 1WG8A 3AQ4A 2COUA 4J0JA 3VTKA 5K0JA 3PT9A 1PU2A 3V1YA 3NRCA 3CN7A 5TGZA 3H17A 5SICE 4RQBA 4REQA 3TVYA 1WRBA 2PUJA 3LUPA 4XM0A 3OQ6A 3KQOA 1YQ9A 5AYVA 3DLBA 5KWIA 2ZB8A 4ZOLB 5B6PA 3TG2A 2H9YA 2VPTA 3N58A 3Q2OA 3WGHA 1ECCA 1F8FA 2HHJA 3RUHA 5TC4A 5K9ZA 4FCCA 4PO9A 5FLXA 3ST7A 2XI4A 1QYXA 3RT7A 3HM9A 2AUMA 4YCCA 5KU1A 4EKYA 4ZV7A 2O8CB 5KOHB 4B8ZA 4BQOA 3HU1A 1T34A 1L4GA 1UEJA 3EXIA 4PTLA 2XB2A 3TXXA 3DB2A 1Z9BA 5KO2A 2ZRDA 1QJCA 2G63A 3LYHA 1WMAA 3U7QB 4M4SA 5A4DA 1JPJA 4A9AA 2ZJ4A 2M32A 2C94A 2BCEA 1Q0UA 3NHJA 4JIMA 3OQ1A 4LSGA 1RPJA 1JG2A 1NVGA 2OXCA 4GLFA 4QFCA 3T9AA 4CDNA 3K2QA 5JT1A 1U2GA 1VE6A 4NLLA 3JQQA 3DAYA 3AG5A 1IZ8A 4LX0A 4C7JA 4ERXA 3G1TA 4MI1A 1Z63A 1UBKS 3GB9A 3LG2A 3HPRA 1EHCA 3AUJB 2VDJA 3CINA 2YBEA 3UYKA 1U9IC 1UBGA 3QXJA 1JMVA 3V8VA 3R3WA 2WJVA 2PWZA 4B46A 3CU5A 5G0UA 2NUAB 5FEUA 5KYTA 2Y93A 5BR8B 1U99A 1GN9A 1AV6A 2O6HA 1BHJA 1QV6A 1FDIA 4PLWA 1QP7A 5L3RA 2G5TA 4NL4H 3G3EA 2IUSA 4IDEA 1FTQA 4MQ4A 4EO7A 4BE9A 3UT5B 3DE5X 1WB9A 1P0FA 2GKSA 5T4EA 5JH7F 4L0DA 5TPWA 3UMBA 4ARUA 1GZ3A 4KV7A 1ORVA 1T6NA 2FG5A 4YXWD 5B37A 4BQRA 4JFRA 2IZ0A 4DBLC 1T8YA 4LFAB 4D9HA 1YVEI 4LCJA 1IXKA 1CVRA 3MJSA 5C37A 4C7OA 1NBIA 3TOVA 1GOTA 3ND5A 2BFNA 2ZI7A 1IHYA 3FPHA 3ED5A 3IIJA 2C2YA 3NBQA 3DNMA 1NU8A 3HDYA 4J0FA 4P08A 4RXMA 2Y77A 1WQ4A 2JJ1D 4O08A 3KPUA 4Y2XA 1LCIA 4D8YA 3IYLW 3R20A 4CLEA 4KMOA 3U1VA 3UQZA 1VKNA 3UGTA 4Q66C 2DBQA 4YJDA 4DSNA 1PWXA 1CZNA 1GKKA 3PNLA 3IB6A 2GZAA 5F1YA 4Z6KA 1Q1GA 5JZSA 4PIPA 2RG7A 1M5RA 2V54A 3FG9A 3IXQA 4G0MA 4MRSA 2GDZA 3L4SO 2ZE7A 1O4VA 1E7SA 1XDSA 2FR0A 3ZEIA 3K6SA 3MMSA 2UZ1A 5BQXA 1NYLA 4CJXA 1F8GA 2BR5A 1HK7A 4GS5A 4J6EA 5IF9A 2CL5A 3KD3A 2WILA 1SXQA 4HGOA 3RC8A 4Y6QA 4IVNA 1GZSA 3E7FA 4KYUA 1GU7A 3AF4A 3O4FA 3GH3A 2P1RA 5ER6A 2YXPX 4RD1A 4RKYA 4D5EA 1PWEA 5MGNA 9LDTA 1N0HA 1H05A 2C7PA 4C30A 4MQMA 1R9MA 1AS0A 5DBGA 3RSGA 4IO0A 2WWFA 1E66A 3SX2A 4AC9A 1CETA 4JI4B 2OZLA 1QFSA 3K5WA 1XZHA 3T9DA 5E6UA 4A27A 3M83A 1BQ4A 3PSAA 3FTDA 2G25A 3CR7A 3OUTA 5K8UA 1R6BX 2JFZA 1YRQA 1CR6A 1CG6A 2GN4A 3VPCA 2YHUA 2W6JA 2PRZA 4MUIA 2CC2A 4XQ0A 4MYUA 2Q5HA 1GUAA 2YL2A 4HB4A 3IULA 3LL7A 4P3OA 5GADl 3L4KA 3WYDA 1AUXA 3SR3A 1QZXA 2JPDA 1EFLA 4HFJA 1E7MA 4XVQA 1DQSA 3TSWA 4FLEA 3L2OB 3L43A 4KXVA 2QL5A 4J6FA 3ZI4A 1AG9A 1PG0A 3CPHA 4UHJA 2DLNA 3SPXA 3WK8A 2I71A 1PT6A 1P9WA 3U4QA 3MILA 1G7TA 2BYTA 1JIQA 3PNMA 3A14A 4K8OA 4MS3A 3F74A 4ZP1A 1CUVA 1P1RA 2ZBGA 1Y3HA 5IH7A 4IJ6A 1NSTA 4A2PA 2PLAA 3HCOA 2ZJAA 2EATA 3JWEA 2Z83A 3PQ7A 3S2SA 2R85A 4X64B 5F73A 1IHDA 3GFBA 4Y6GB 1KQGA 2HIMA 1XTQA 1Z2EA 4Z1MD 2DWPA 2J6IA 4XW2A 2XTNA 4FZRA 3B1VA 4I55F 4QODA 4JJGA 3Q7QA 4FGKA 1N7HA 1V16A 4R54A 5CPFA 4E07A 4PYMA 5BY2A 1YB7A 4G5GA 2QUJA 1T1IA 2QYSA 2YJ4A 4DA8A 4KACA 5KTSA 3F5DA 1PJZA 4G5RA 4AB1A 5HIKA 1I13A 3G7NA 2HWWA 4TUYF 5DH9A 1R66A 2ZIAA 3LHSA 1LPNA 3GR6A 4M83A 1J9EA 2GO1A 3DLHA 2ATCA 3O31A 3SP1A 4GOJA 1PBNA 3IHLA 4C29A 1QH8A 3HU5A 1A71A 4A03A 4DLTA 3ETCA 3HNRA 2CBZA 3CURA 1BDIA 2P4UA 4PXAA 1PYOA 1GLGA 1WHSB 3TLXA 4N12A 4Z51A 2ZRGA 1H2BA 1O2DA 3WBFA 2WUEA 4YCAA 4D0GA 3REQB 1D0VA 2CJPA 5I5GA 1EI9A 3RW9A 4ES6A 1DLIA 4WOCA 1NPYA 4R2JA 4HS4A 4PIVA 4X20B 2NU9B 1W4LA 2HK6A 4OHRA 3U7HB 1RAHA 4RSRA 4TKUB 5IDVA 4R4JA 4H7JA 3F1KA 3IAFA 3WYFA 4O4LF 4NK5A 4UAJA 1POWA 1J1UA 3D31A 5C8DA 1T6BY 1E2DA 2HYDA 2LR0A 3KXIA 3T3OA 1GQ2A 1CSEE 5TF4A 3DMDA 1MT3A 3EOAI 4A91A 3O0DA 4DM3A 2Y2VA 4FYYA 4N5NA 3EGDA 2HA5A 3K5PA 1QTIA 2QD4A 2QL9A 5UKDA 1G5RA 2F3TA 3ICWA 4D44A 5LXTA 3ESBA 4AJ2A 1U7OA 2FPPA 3NP7A 3QU4A 4PYKA 3IT0A 3PVSA 3IXMA 2WNHA 3LZDA 3SWWA 4RELA 3OH8A 3N7AA 3L0IB 4KDEA 2PMWB 3GRRA 2QZ4A 5BN3A 1JWBB 4JC5A 1J06A 2GILA 4E32A 4OBBA 5DHTA 2NM0A 1VHTA 4JDPA 3PITA 1RFLA 3LJKA 2WWYA 2V3VA 3P2EA 3WZ2A 1R3DA 3AF3A 2CE7A 2VHQA 3GFGA 4O3MA 1CS0B 5KYUA 3DFZA 4BJ6A 3HJNA 1ILWA 1DIAA 1JR4A 1O6CA 5FHQA 1OB2A 4RHYA 3VYWA 1ST3A 1OREA 1ZM3A 1BFUA 1H93A 4EZBA 1ZM9A 2D59A 4EY8A 3L01A 1NASA 4IV0A 5ALGA 3G5LA 2REXB 3OMWA 1G42A 2BZSA 3QEJA 4UBIA 3VI4B 4CEIB 2XDQA 4OM8A 1D2EA 1N2IA 1JFSA 1W87A 2PD3A 1FFBA 2C9ZA 4XFKA 1CUXA 3IKLA 5DM2A 1G4UR 5BWLA 1EUQA 1BE6A 2HK7A 3EPLA 4RHXA 1Y4AE 2JIMA 4F3KA 3KKQA 4G37A 1E3JA 3OTIA 1IOVA 2OPHA 1V8BA 2PT5A 3CRW1 3FSEA 3C3MA 1EE1A 3LGAA 2FMTA 1P2FA 3JASB 3MWDB 2MSKA 4MWCA 1KZHA 2QW8A 3ZWBA 1WMDA 2CF6A 4QUHA 3PU6A 4FFVA 3DA8A 2EYUA 4F56A 2GAOA 4DLZA 5JQGB 5DO9A 4RD0A 3EVAA 2B25A 2MSDB 1IE3A 5EE3A 2IQIA 1XTBA 2XE8A 3ESRA 4ZT3A 2WU0A 2FSFA 3L8YA 3LYLA 3HB5X 2VT6A 3RDPA 1RAGA 3IQFA 5DCUA 1TYDE 3OA2A 5JAOA 1JKFA 4ZC8A 5TE9A 1E32A 1ZK3A 4G9EA 1ZINA 5M29A 3WDMA 2GARA 1KBQA 3HXKA 2WABA 4QOGA 3N74A 4YXFA 3W7VA 4DR1B 2VUUA 3B38A 4LS3A 5DGCA 5EKDA 5L4NA 1BD3A 4J4TA 3B1WA 2OVBA 3SQMA 1V5WA 4M3NA 1I3NA 3HL0A 4H35A 3TECE 3WKCA 4H15A 4HUJA 2Z2KA 1ESNA 1WULS 1IUNA 4PHTA 3UN1A 4A8JA 3W2HA 4EYSA 1XTIA 2HJWA 3FCCA 3VXKA 2H4XA 2XVZA 3K0CC 5FWYB 5MN6A 2IS1A 3UK2A 2JCVA 4BAUA 4LXHA 3ETGA 3EZFA 2ZXUA 5DASA 3UWOA 4QUIA 3ZUPA 4R69A 4BS9A 4C0QC 3RABA 1GR1A 3U16A 5BNWA 4K81B 1CY6A 4OA8A 3NEJA 5AESA 3PK0A 1F1BA 1ZN8A 1KJJA 3CMMA 3GZNB 4QNRA 3UW1A 3BRWD 2CN1A 4EHHA 4NNJA 5INTA 1R16A 1XTRA 4ZVRA 3P9NA 4UCWA 3RYFB 3SZUA 1U3UA 3M1AA 3NG1A 4OQMA 4TL6A 2VF2A 4HLUC 4OXNA 4K2AA 4RJIA 5DLPA 3ZKWB 4W5OA 3IT1A 3ZY2A 2YWDA 2DKOA 4OTZA 4Y9UA 2ANBA 4JMPA 4UM7A 1KZYC 3CNHA 3IE1A 4AVYA 3V4ZA 3QPCA 1HDEA 4MUNA 3M6AA 2LXNA 3H8WA 2M6LA 2WQ7A 2ES4A 2JBAA 2FSVA 5FPQA 3IEIA 5CTAA 3UJBA 2O3RA 3ENQA 3HYNA 1XQYA 2OFWA 4W9NA 2XEDA 3H3XA 3N8IA 2FW6A 1DEXA 4A15A 4WW0A 1OA1A 5KVAA 2DTEA 1ND5A 1JHZA 3IAM6 2VK4A 1JYSA 1X39A 1YR1A 2SCUB 1JPUA 4PG7A 2XECA 4NY1A 5GONF 4EYGA 1E5TA 2WIGA 3U3ZA 2YFHA 2YH2A 3BMNA 1EFKA 2OR3A 2WMDA 2ZB3A 3AUFA 3N7TA 4G86A 3M4XA 4TTJA 5ICGA 1CZHA 3WGTA 2A3NA 5LP1A 2FRVA 2EGHA 4GP6A 3T9EA 1P2TA 2QJRA 1V1JA 3H18A 1L5OA 1Z3CA 3JYNA 5KHAA 1UPAA 1W59A 4BWYA 2IUYA 4CV0A 2FP3A 5BW6B 4YT4A 3GF4A 3N3BC 3PFFA 1YXMA 5I45A 4RABA 1BZYA 3ETNA 4INOA 1MDBA