3FGNA

Crystal structure of dethiobiotin synthetase in mycobacterium tuberculosis
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
230
Chain Sequence
FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Dethiobiotin synthetase
total genus 72
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fgnA00
2QG6A 3OE7A 2IUUA 4X8MA 3SHWA 2F43A 2V9PA 5DHAA 1YZQA 2O0HA 3P32A 5GVRA 5KNDA 3CONA 3RS5A 5C2JB 5SZIA 4KFTA 2GA8A 1CJTC 2IYYA 5DSZA 3L2OB 2ORWA 4IDPA 4U5XA 4RJLA 1RZ3A 3K0FA 4LC0A 2FU5C 3B1YA 5FPSA 4JBXA 2ORIA 4PXAA 2C77A 4XTCS 1U9IC 3SEAA 3MRSA 4MRNA 4PZZA 2WWHA 4D6PA 4QJ3A 4BEJA 2UVQA 3RDPA 1N5IA 1D9ZA 4P4SB 1T8TA 5HCNA 4D25A 3NXSA 1P9WA 1E0JA 1O87A 2ZRFA 3KQNA 4U7DA 1UBFA 3EZ2A 3OIUA 3QXCA 1GKUB 1JAHA 1S96A 4G01B 2J0QA 3AVOA 1CR2A 4Z1MA 1NIPA 1XD2A 1XNJA 1W36B 2EVWX 3KJHA 1W0KD 2IXEA 4TT3A 2YWEA 3E2IA 3T61A 3BERA 4LHVA 3ZS9A 1YJ5A 1W7AA 2YHSA 1SXJA 2JDIA 2YVUA 4PO8A 1N6HA 4KBFA 1AM4D 2ZRBA 1QZXA 2ZRNA 4JKYA 4I1OA 5HZHA 2NO0A 5EQTA 2CCGA 2B8TA 3AVVA 4F7WA 3D3QA 5EE1A 3UIEA 1OSNA 1KNXA 2ZREA 5DNYB 4BFWA 4Z8YA 3OESA 3TH5A 1JR3A 2MSCB 2QY9A 1DTSA 2FOLA 4II7A 4W9MC 2CDNA 5FUVA 2IS4A 1N0WA 4NZYA 4LC1A 3RC8A 3KJEA 4DLVA 3MJHA 2PEZA 1US8A 3GMTA 3FTQA 4PANA 1EFTA 8OHMA 3KKNA 3B82A 2OG2A 1DAMA 1JECA 1FMLA 1FX0B 1NN5A 2H5EA 3D7MA 2VP4A 2VF8A 2A30A 2CHQA 4QG7A 4OI0A 3H86A 3IBGA 5DYGA 1FUUA 4PPQA 4DLRA 4URUR 1GSIA 3D6TB 2FSGA 3KB1A 4Q47A 4ZKEA 5DLQC 5L8VA 5JS7A 2BKUA 2A5YB 4EFMA 4XIGS 2E9SA 2ZS8A 3S1AB 4W5HA 421PA 2GCOA 1VG0B 1J8MF 1Q1QA 1KI7A 5TB5A 4F38A 3M6AA 4F93B 1MV5A 4A0HA 5TMPA 1J99A 4C2UA 2PCLA 2VHJA 1PZNA 3NBXX 5JS8A 3LVRE 1B23P 3EIQA 4M21A 3VR6A 1Z47A 5FL3A 3K9LA 1FMJA 2WKPA 3X1ZA 2ZE8A 3THXB 1F60A 2ZRKA 4QBGB 2CL7X 2IF2A 2KI5A 2WWXA 4AKGA 3LBHA 4Q7LA 3TJZA 1ZNXA 1SXJE 1DAEA 5G41A 2G77B 2GTPA 3ASZA 4HZIA 4LYHA 2YNMA 2NG1A 1AIPA 2OXCA 3OFND 1KJZA 2P3SA 4DUGA 1W2HA 5JWOA 2JLWA 4F4JA 2WKQA 1P72A 2I4IA 5GVSA 3B5JA 4AYTA 4FCVA 1DS6A 4B76A 3PG5A 1TAGA 2VHQA 4P33A 4TLAA 1DG3A 3ICQB 1QHXA 3CIOA 5KU1A 2D4HA 3RS7A 1ZCBA 2PX3A 4TYPA 2W6JA 4GP6A 5IDVA 2WPDA 3QUSA 4ERNA 4M1OA 4RY2A 4RD3A 2FSHA 3DM9B 2FWRA 3A4LA 1A7JA 4IOMA 1RW4A 5B57C 5BYKA 4JLDA 2LCFA 3FPAA 3SR0A 2HJGA 3EG5A 4URWR 3VX3A 1LNZA 3PVSA 3CPHA 1QHSA 1TF7A 4YMUA 1A4RA 4Q02A 3W3ZB 5BWMA 1FX0A 1ZMXA 1QG2A 2HEIA 3LW8A 5HPYB 1E32A 3MGCA 4BRUA 2OILA 1RVDA 4LUCA 2IEZA 3TLXA 1E2PA 4AWXA 5B58C 3T1TA 3ZS8A 5UKDA 4OKSA 3BK7A 3SC3A 5AJWA 4BLQA 3SQXA 1RFLA 5L3VA 5CIWA 4D0GA 1IXZA 2ZR7A 1LF0A 1CKEA 1LW7A 2QSYA 1W2GA 4MKFA 2G0NA 2ZETA 2AR7A 3DMNA 3KXLA 5D3MB 4AYWA 4GI7A 4Q1EA 4Q7KA 1Z6YA 1I4LD 3M4YA 4C0JA 1RJ9A 2V54A 3DO6A 4MGYR 1BO6A 5DHFA 3RSOA 3AF3A 4JL6A 4KITB 1U0JA 1UFQA 3SS8A 2J7PD 1P62B 3DVLA 4IEEA 1K6MA 2FX3A 2QENA 2AN9A 1GIAA 4HAUA 1JPJA 2X2EA 4HB3A 5EXTA 4Q4HA 1FFHA 1RYHA 2ZYUX 3RABA 3HJNA 2R8RA 1HTWA 4OJKA 4KVGA 2ZUDA 3PUYA 1FP6A 3GPLA 4ABYA 1OIXA 3TQFA 3ZH9B 3GLFB 2ORVA 1Z5ZA 3ZYCA 4NONA 4BASA 5CYOA 5AUOB 5FOXA 1Y3AA 4H1UA 2OBLA 1ZIOA 2BV3A 1PVOA 3TGPA 3VAAA 2OFOA 1G1MA 3DOFA 2BBOA 2G1KA 1Z6TA 3LNCA 3TBKA 4A2QA 2IHYA 3QE0A 1ETUA 1NSTA 1VMAA 3QNUA 4US0R 1TUIA 1RPZA 4RZUA 3Q5EA 3SYKA 4Q00A 4UXJA 1KSGA 3BOSA 4UJ5A 1N6LA 2F1IA 4IVQA 2Q9BA 3IO3A 2XZPA 4NCNA 2BJVA 2F55A 4LJ9A 3BD9A 4HAZA 5H68A 3GJ0A 3LW7A 2BVNA 4NBSA 3WNBA 4EJSA 2XJ9A 2XAUA 1G7TA 2G0TA 3M0EA 2HXYA 2ODNA 2CMKA 2GVDC 4M1YA 3LAWA 1KSFX 4HZUA 5LB4A 2O8BA 2HYDA 3D31A 1G17A 3DKPA 1HT1E 4NKRA 3AF2A 1NG9A 3L0OA 3KQUA 1KK3A 1GKYA 2H16A 3B1ZA 2ZRHA 4WXRA 2QE7D 3P26A 1N6IA 5SZHB 3IIKA 4DIDA 4PC7A 1HQYE 4JZKA 5HE9A 1KI9A 1KMHB 1XBTA 4YDHB 3ZZTA 4URXR 3OE7D 4RKFA 2ZM5A 2J59A 1R2QA 2WJHA 4IKEA 4BUJA 3WNCA 4IHQA 2BOVA 4KI0A 3VU9B 2FF7A 3ADCA 1AK2A 1GL6A 1NVUQ 2IYQA 2ZRLA 2Q6TA 4ZDIA 2GXUA 2J3EA 1W5TA 3I32A 5EZ6B 1TQ6A 5J4VA 4XJXA 4BGDA 4IEIA 5JFGA 1GDDA 1CF4A 2C95A 1SHZA 2GDJA 1AJEA 2GILA 2MMCA 5CLQA 4LGMA 3CX8A 3GJ4A 3GFTA 1UKYA 3SYNA 1TTTA 2C8VA 1KAOA 4V0OA 1KIMA 4TLBA 4TZ0A 4CEIA 1G7RA 3QF4B 4CRWB 4PZYA 1FNNA 1SVWA 1XEWY 1OFTA 4YONB 3AVQA 5DISB 2MMGA 4HUQB 5K8LA 1ZP6A 1ZINA 1TQ2A 2F43B 3EXAA 1G5PA 4PTLA 4N0DA 2QROA 1KY3A 4RSGA 2P65A 1SULA 2PLRA 3UG6A 4LHYA 3PEYA 1TF2A 1KAGA 2GXSA 4Q4AB 1ANKA 1HH4A 3W9YA 2YOFA 1UPTA 1RRCA 3TSWA 5CDFE 3KXKA 3KQKA 4V0LA 3J81k 4JLVA 1UBCA 2C78A 2IT1A 3RSLA 4B47A 4TYWA 1W48A 4ASUD 3WP1B 3FWYA 5J5CA 1G21E 2VH5R 1WQ1R 2TMKA 2VSFA 1XRJA 4N0EA 4F92B 4R98A 3ZZ0A 3GD7A 2PCJA 1M74A 2RAPA 3TUIC 4KFUA 3F8TA 1P2TA 2WICA 2ZI7A 4PHTA 2GESA 1KO4A 2VP2A 2ZAMA 2JGNA 1GG2A 1VPLA 3C15C 1XEFA 3NEYA 3A36A 2WKRA 1EWRA 3KTAA 4QNMA 3VX4A 3JVUA 3MLEA 1N6PA 4A0GA 4ZDKA 2XTZA 5KHOC 4LZZA 1VTKA 4Y0VA 2XB4A 2V6IA 2J0UB 3CH4B 3ONWA 5KSZA 2VIIA 1G8GA 4RFSA 3TVTA 4B3CA 1UKZA 1P3JA 1B0UA 2AD1A 2ERYA 4W5JA 1CLUA 1XD2B 3THWA 4URVR 1XCGB 2BMFA 4KLZA 3OAAD 4E09A 1DO0A 1KO7A 4FWIB 2REXB 1RIFA 2I1VB 3UMSA 1KI6A 1ZD9A 4FXPA 4QM6A 1D2EA 1CXZA 4MGKR 4DDTA 1P2UA 2O8FA 2H7VA 4HUTA 2IS1A 3MUFA 1DVRA 1XWIA 2FNAA 4LJ6A 2R6CA 4CGZA 1PLJA 4HEJA 4KFSA 4FCWA 5AWFC 4LK2A 4M9XA 3TK1A 2GCPA 4IOKA 2YV5A 5HTKA 3CW2A 3NC0C 2ONJA 3T15A 3MWYW 4A8JC 1C1YA 2CL0X 1NNEA 3LQRA 2XXAA 1IOZA 1CEEA 2KBFA 3QKSB 1Q1ZA 3BFVA 1COWA 5HZKA 5L3SB 2O8CA 4HDOB 1QHYA 4OHZA 2IS6A 1XJCA 4GOKA 4WIAA 1QHIA 1X8JA 4B48A 4B71A 2QM7A 5KTYA 5KSOA 2JLZA 3L43A 1AGRA 1H8HA 4PPNA 5CB8A 5FUYA 2EFCB 2RKOA 1U8YA 1ZM7A 3U3OA 4QL3A 3CB4A 4POAA 3CWQA 1BOFA 1S2MA 2Z83A 3QKSA 4HDQB 5EUMA 4EPYA 2O8CB 2BKEA 1JPNA 1WRBA 1YQTA 4UNSA 2RGXA 1Z07A 4JLJA 3R7WA 5GJBA 2VLIA 4QRHA 4FWTA 3RWOA 1GP2A 1SKQA 1HT2E 2A2ZA 2GRJA 4LJ7A 4KYIB 1E4YA 2ZS9A 3K9NA 3EPHA 4Q9JA 5BW8A 4JLMA 1QVAA 2VHTA 4DSTA 2FDCA 1YZLA 3I8SA 4M0LA 3FGNA 4XVQA 4DEYA 3LRPA 3JZMA 3A4MA 4MA4A 3B7GA 4NE2A 1Z6XA 5FBRB 3RRYA 4DHEA 1SVSA 1E99A 2OE2A 3FYHA 3W5JA 2ZE6A 4OHXA 1E9AA 3LFUA 4MQBA 1T8UA 1ZUIA 4JSTA 4JVLA 2V1XA 3AP2A 3AP1A 3T35A 1D5CA 4B3FX 3AVXA 1II8A 1GNQA 2PZGA 4BZQA 4K81B 4LV8B 4YXWA 3GLIA 1ZM3A 2HUPA 2ODWA 1TPZA 2ZRCA 1SVMA 1P61B 2VPPA 4JIMA 1WP9A 1U9IA 1S3SA 2WM9B 2R62A 1CU1A 2VP0A 1I2MA 1EXMA 4A0FA 4AG6A 5IF9A 3MAAC 4HUQA 1OH6A 2K5UA 1VYUA 2FPMA 4ZDJA 4XWOA 3NBZC 1IJEA 1SQ5A 2QMEA 1VG9B 4IOLA 1COWD 4IXMA 4M9SA 4A6PA 2CLDX 2LWIA 5HKKA 2GAOA 3I62A 1OLOA 4ZCLA 5E95A 1OB2A 1FTSA 2XOKD 1WBBA 2GJAA 1OW3B 1P75A 2H18A 1OB5A 1VHLA 3O8RA 1DAIA 1U0LA 2YZ2A 3GLGE 4LJ4A 2B7CA 1H8HD 2J1LA 4BE7B 1F2TB 4A36A 1BYIA 1SXJD 4I1SA 1XJ0A 2JLQA 3BS4A 3Q85A 2QMHA 5FH9A 3C14C 4F4IA 2JJ2D 1OT3A 4TLCA 3VR1A 2EFGA 1IN4A 1OFIA 2VO1A 3FOZA 2NZJA 3AKYA 3PV0A 4NTZA 3RNLA 4M1WA 3IQXA 2ZE5A 3ZJYA 1XPUA 4Q7JB 2ZR9A 3Q7QA 3W6PA 4L9WA 4GL2A 2O8BB 4TMKA 4TL7A 1OHHA 2DFKB 2P6NA 3B6EA 1KO8A 2ANCA 2QTVB 4QJ5A 4KV9A 2RB4A 1OV4A 4GZLA 4PSVA 4BFXA 1ZAKA 2CJWA 2R6DA 3KJGA 2D3WA 3ZLJA 2O0JA 1GILA 4PHGA 3K8YA 3DOEA 4DLYA 3BFKA 1KI8A 1YR7A 2RGCA 1SHKA 2IS2A 5DH9A 3CF2A 1IHUA 4V0ME 3U6KA 3FKSD 1W4BA 2WOOA 5FFMA 2QRZA 2W83A 1YZTA 4Q1CA 4CEJB 2EU8A 2QN6A 4C3ZA 5FUXA 3AF4A 1E1RA 2Z4RA 3H4MA 4HAXA 4QBIA 3ADDA 4P31A 1T6NA 5D3QA 3W8NA 2NO7A 2CCJA 4TL9A 2EWWA 2JLSA 4DT1B 1NMXA 3B85A 4OYHA 4A6XA 1QHHB 1YR9A 3KTAB 3UKDA 2WJYA 2OFXA 5A4JA 1P60A 1KY2A 2QSZA 2YJTD 3K70D 1D9XA 1Z0IA 4IDHA 5FBWB 4C0KA 1UEIA 4OQFA 2L0XA 3A4NA 4D0NA 3CPJB 4OL0A 5HKKD 3SE0A 1N5LA 2EW1A 2DWPA 3T5GA 4M8NE 1IN7A 4G5SA 1X86B 5FPTA 3UPUA 1N5JA 1W46A 2F9LA 4DUGD 1EFHA 1XMIA 3HDTA 2R6AA 3BC1A 2WV9A 4JBWA 1NP6A 3ZQJA 2Z43A 1NVVR 1E0AA 1KK1A 5JCPA 3LV8A 1JR3D 4UNRA 3P4YA 1UM8A 4Q4AA 5KYKA 1AN0A 3TVDA 1VG8A 2GZHA 5FR1A 4EPRA 3VU9A 1ZD1A 1M34E 3WRYC 3ZD6A 1II0A 1U81A 1J8YF 2BMDA 3TQCA 1SXJB 3JZAA 3BIFA 1QVRA 1OHHD 4IXNA 4BECA 4EUNA 3AVWA 1XFAA 2O0KA 1OH5A 1WE2A 3CH5A 3A1UA 2QP3A 2XNDA 4FD2A 4EFNA 1NBMA 1C4OA 2ZSAA 2AHOA 3SJAA 1N5KA 1E2FA 4NMMA 4O3MA 1DG1G 3RS2A 1Q3HA 3VR3A 2GHIA 3C8UA 4JLNA 2HLDD 3MMPA 4QBFA 5BN4A 4HYYA 3LVQE 5TXGA 3ZVMA 1AS3A 4A15A 3RS0A 3U3JA 3K0CC 1E94E 2HV8A 4LWZA 2JLUA 3THXA 2C9CA 3T1VA 2CBZA 5CYPA 3NH9A 5IK2A 2GEDA 4DC9A 1CBUA 2DY1A 5AJZA 2JLYA 2MSEB 3QEJA 4URYR 4UQOA 5DGXA 1NLFA 3ASYA 2YKGA 3LH5A 4DSOA 2NO1A 3LBIA 2FGJA 2J7PA 4JJZA 4CZ2A 5JECA 4TMTA 4MRPA 2W0MA 4LRWA 5SZJA 1FNMA 2GCOB 4RD1A 5P21A 5TDHA 2ZAOA 4B32A 1E3MA 1OXSC 4Q9IA 1AZTA 2Q3MA 4TTRA 1KO5A 1RRPA 4JL5A 1F2UA 5JRZA 1QHGA 2WSSA 3MWJA 2J0UA 3GEHA 4G5GA 5L3RA 2RCNA 1SVLA 4PAQA 3W8RA 5KOYA 4UNPA 2B92A 1W0JA 3PUXA 2XITA 5AUQA 3L0PA 3CO5A 3MWLA 4TYQA 4LJYA 4D81A 4ZI2A 1XU4A 4QKQA 1K5GA 1GOTA 1H65A 2XZLA 3Q72A 1X8LA 3ADBA 4I1VA 1KI6B 5KNBA 4A8JB 1OFUX 3WP0A 1IN5A 4V03A 2HF8A 2Z0MA 3SBEA 4MH0R 4ZO4A 3Q3JB 4Z51A 2N46A 4ZPXA 5G3ZA 3ADKA 2WJGA 5J4HA 3GLFE 2D2FA 5AJYA 2XGJA 1G64A 3MCAA 1TU4A 1SVOA 2IYTA 4P32A 1XZQA 2QT0A 1E79A 5FR2A 2QMUA 4TYYA 3AF1A 3SJCA 2G83A 2O8DB 3IUYA 3EWAA 2CCKA 3G0HA 1NBME 1UBGA 2PT5A 4TTPA 2V6JA 4MYUA 5J47A 4EDHA 2BCJQ 3UK6A 2FFAA 1Q3TA 4HATA 4OQXA 4G3XA 3CR7A 2ZYVX 3HU3A 2ZRAA 4QGAA 4Q4HB 1EFRD 2BM1A 3TE6A 5CB6A 4DCVA 1AGPA 3RVBA 2JEOA 1M7HA 4O2LA 1NG1A 2C03A 2DFTA 1XMVA 3FVQA 4V02A 4NYIR 1UEJA 1M6NA 2ZSDA 1MR3F 3N70A 3QG5A 1AQUA 4JSYA 4NYJQ 4YXWD 2ZI3A 3O47A 1MT0A 2CLSA 1PJRA 1E2DA 4Q7MB 1GRNA 5J4YA 1E2IA 2DFLA 1L8QA 4FMDB 3R8CA 5A5GA 1YKSA 3TIFA 3THWB 4DDWA 1T3SA 2J9RA 4DCNA 2YWGA 3BRWD 3B9PA 4OJQA 3CNOA 1Q0UA 3BORA 2F3TA 3G82C 1G8HA 4B44A 1N0UA 3T12A 3QF4A 2BHRA 3U7EB 3N5CA 4JLAA 1VG1A 3FHOA 4D26A 1ZYUA 4RKEA 4TLEA 5C18A 3UG7A 3EPJA 1XTJA 2O8EB 2W6IA 4IVPA 5KSYA 1E9RA 1OYYA 1G41A 1R5NA 2A5GA 4QGGA 4DBLC 2PJRA 4RD6A 2ERXA 5FI1B 1G4AE 3TAUA 1SGWA 221PA 4NCHA 2WWYA 2D7DA 4JYCA 3TAHA 2GJSA 2PMDA 4QGHA 4DKXA 2ZJ2A 4A2PA 1R8QA 2ZRDA 1OXVA 2C2HA 2VP5A 3IGFA 4B6FA 4AY2A 4UXHA 4C0QC 1NKSA 1OIWA 4ZKDA 2OCBA 1EFCA 3ECCA 1ZBDA 1VYVA 1W4RA 5TARA 1ZVQA 5EUQB 2WWIA 1XXHA 5AK0A 2ZS7A 3W5IA 4OI1A 4TTQA 4CDGA 5LPNA 1TX4B 2IWRA 1PUIA 5KUTA 1F2TA 1U8AA 5EE3A 2JIZA 1E0KA 4RD2A 4V0NA 2PLFA 2IYRA 4UXIA 2ZSEA 4HI0E 3UMRA 1W47A 5B2ZA 1D2NA 1TQ4A 2CL6X 4BRWA 2BIFA 1JQLB 2ZSBA 2HJVA 4MUAA 4IDNA 2C04A 2R2AA 2ZSFA 1T9HA 1MRNA 3FB4A 4HLUA 1Z2AA 5L3QB 1LY1A 3UXMA 2WAXA 2JA1A 2OZEA 1RRGA 3ZIAA 1GAJA 4WOPA 2IYUA 2IBMA 4HAWA 1NSFA 3IILA 2RMKA 3CBQA 5CJPA 4GMXA 3OIWA 4NYMR 3IEUA 4MITA 1X6VA 2GJKA 2QORA 5KNCA 2AWOA 5E3HA 2JJ8A 1DOAA 2QMOA 4NCIA 1GL7A 1E2NA 2Z6VA 3D8BA 2FSIA 2Z4SA 3T5DA 1T3LA 1Z6GA 3WHLA 4KHZA 3RS3A 2CE2X 4BEBA 1MABA 1W4CA 1Y63A 5FL7A 2ATXA 1M2OB 2DWOA 5KDDA 3K0AA 1JAIA 1RKBA 1XCMA 121PA 1E2GA 2WAYA 4B3XA 4GOXA 1ELOA 2PH1A 5BQ5A 1Z8FA 4IVRA 2IF0A 2XXAB 1W0KA 2AFHE 3KDSE 3DM5A 1LS1A 2NTYC 3PEVA 4M4SA 5E4FA 2HCBA 5FOVA 4NCJA 3T1QA 1ZW6A 3U60B 2C96A 5B64A 1R6BX 2VHUA 1AQYA 2AXNA 3W3AA 1BS1A 3HYTA 2IUSA 3MD0A 2W0SA 4WZ6A 3SNHA 4PQRA 3QSYA 3PENA 3V4RA 1E2JA 2QRNA 2R65A 4WXPA 3A8TA 4L9SA 4DSNA 2Q3HA 4TSFA 1U2RA 4DLTA 2ZU6A 3LA6A 2AKAB 3QPWA 4OBEA 2EFHB 1DELA 4OQLA 5FOSA 5DO9A 1G16A 1G20E 4LBYA 3H2YA 1UF9A 3MJRA 3LD9A 2RH5A 3OEHD 3BH6A 4RCZA 2YWFA 4U02A 1G8PA 2ZRMA 2DR3A 4KVAA 2QZ4A 1TF5A 4E22A 4DT1A 1XTKA 1ZU4A 2AKYA 3I73A 1EG7A 4Q9HA 1DAKA 3FHCB 4LOAA 3WXMA 4JVNA 3CWZA 1D8TA 1YZUA 5KPJA 2B6HA 1DARA 1JI0A 4LYFA 3SFZA 2VBCA 2CJWB 2P0EA 2PZEA 2WOJA 4LYAA 5AUPB 3U6BA 4GDFA 4IOJA 4LV6A 5H70A 1AKEA 4P4UA 4HLUC 1YE8A 5KSPA 4ACBA 5BXQC 1H8EA 4IJMA 3U44B 3RS4A 5FPYA 3VR2A 2HCJB 1I2DA 1KKLA 2ATVA 3WMFA 3CRVA 3BWDD 2D2EA 4A82A 3HP1A 1ZIPA 2FG5A 4TT3D 4RCYA 2ZJAA 1U0HC 2G88A 4JBYA 2JASA 1C9KA 3W6OA 4N1AA 2WSMA 2GBLC 4ZIRA 3B1WA 2VF7A 3DZDA 1GRRA 1UDWA 1S8FA 2DPXA 4TLDA 4CVNA 4DLWA 5FOTA 1E9EA 1Z28A 1ESMA 3TSOA 3QKRB 1II9A 4MRRA 3DDCA 4C7OB 2WSSD 1ZM4A 2OESA 2W00A 4DLSA 1J2JA 1T0HB 3AP3A 4OI2A 2BBSA 3TR0A 1DE0A 4HB2A 1T4GA 5E7JA 1XTSA 1KSHA 2GBLA 3DHWC 1IQPA 3MFYA 1A2KC 1KO1A 2QEQA 3AH8A 4HB0A 3WY9A 4MGZR 1YR8A 3NWJA 2C99A 3A1VA 3GEEA 5F9HA 4L15A 4W7SA 3BGWA 3QXSA 2GWHA 4BLSA 2NPIA 3B2EA 2AD5A 3C5HA 4LJ5A 3I5XA 4BLRA 4CEHB 3KJIA 5FBQB 5FTNA 1XJQA 2RGDA 4LPSA 1IN6A 3SJBA 2A3RA 4TMVA 4AG5A 2G3YA 2IYVA 4ZI3A 6Q21A 1DBSA 5HE8A 2YOHA 1E1QA 1RYFA 1IY0A 4LV5B 1VCIA 2XEXA 5DYIA 3U3RA 4CW7A 4B73A 2O8EA 3AVYA 3KKQA 3CPEA 4NDZA 3WMGA 2ZE7A 2FEOA 2YWHA 1E2LA 3GQBA 4WZAE 2VSXA 3EZFA 2X77A 1R4AA 2DCUA 3ND9A 1R0WA 2QNRA 1OKKD 2O8DA 1KDRA 1L4YA 5EP1A 3PEUA 5F3WB 1JQJC 3R9WA 1VCMA 4DJTA 4UKDA 1RJ9B 4EPTA 3GLGB 2IXFA 4OHYA 1CJVC 2GK7A 3GFOA 2VA8A 1KJWA 4QM7A 1TNDA 2NQ2C 5E7IA 1LF5A 4GMDA 1NKTA 4S35A 3QXHA 4HZUB 1L7VC 4YLGA 2VL7A 3OFNA 3FKSA 4IW3B 4P4TA 2CK3A 2YYZA 3C41J 2KBEA 4Y0AA 2B8WA 2OBNA 3N2EA 4HAYA 1DO2A 1VIAA 3BB3A 1EX7A 4RZXA 2BM0A 2ZRPA 2H1LA 2IYXA 4ACAA 1PUJA 2X19A 2J41A 4XVRA 2WPDD 1ZC3A 1OXTA 2ZPTX 2EQBA 1DPFA 2VYFA 2WWWA 5FTMA 4TMZA 1W4AA 5E7MA 1P4SA 2IC5A 4C0BA 4Q1FA 3RRNA 3T06B 2CVHA 2YC4C 3SFVA 2WIBA 3TKLA 5CM8B 3NEJA 4L5BA 3NH6A 2CNWA 3K09A 2I1QA 2QBYA 2G9NA 3IO5A 1PV4A 1E2MA 1NN0A 2W6ID 3C5CA 4L4UA 2GAAA 1Q1EA 2VTKA 3Q8XB 1XZPA 2QGNA 4A0RA 1Q57A 4A4DA 3DKVA 1N2CE 2GXQA 2ZRJA 3BH0A 1R8SA 1Z08A 4B43A 2QUZA 3QIAA 4TMWA 3AVUA 4WBSA 5DI9A 4ZV4A 4Q5IA 1E1QD 4KBGA 1CR1A 2DBYA 2H57A 2JDID 2NGRA 1X1RA 1P2VA 5IRCD 1ZNWA 3EIEA 2P5TB 1RC8A 4CT4B 5K8IA 3B13B 1AS0A 2OSBA 2P67A 2RHDA 2QL6A 1A2BA 4PFSA 1MOZA 1JEEA 3LDAA 4KO8A 5JWRA 1DEKA 3IPYA 1UKVY 3GJ3A 3AQ4A 4ZCMA 1R5BA 4B75A 1Z0AA 1R5OA 3A1WA 3I92A 5EP2A 5GJCA 5KO2A 4US2R 1YU9A 4PQYA 2BBTA 2QBYB 3SZRA 1GITA 1OPXA 2XTNA 3R9IA 1E4VA 4N3NA 4JVMA 3HR8A 4J0QA 1G8FA 4B33A 2YINC 2JIZD 1GNPA 2BJWA 3OZXA 1AS2A 4CEJA 1G3IA 4RZ3A 4G5QA 4M9QA 3GJ7A 3KQHA 1YVDA 1OJLA 2CK3D 2WVJA 3DL0A 3X1DA 4YC7A 2VSOA 3WBKA 1HURA 2OCAA 4JYBA 1M1YE 4BZPA 2MSDB 2ZJYA 3PIRA 4KAXA 4AC9A 2W2XA 1AKYA 5L3QA 1G3UA 1CIPA 2H8KA 4DSUA 3SN6A 4MUBA 3IEVA 3Q9LA 1G3QA 3RLFA 2IYSA 1Q21A 3B1XA 2W2TA 2P6RA 2O5VA 3FHTA 4WVFA 1CRPA 5B30A 1TEXA 5FI0B 4LY6A 2OT3B 3EAQA 3M1IA 4BQSA 4DEXA 4EQ6B 3Q5DA 5IHPA 5GADl 1Z2CA 2Q21A 3NDBB 4HSEA 5EXSA 1OIVA 5FL7D 1HV8A 1BYUA 2C98A 1NIJA 5C4GB 4GPTA 3X2SA 3P4XA 1U99A 3AKDA 4MDFA 4DLXA 2W58A 1QF9A 3BBPA 2GF0A 3FFBA 3CRMA 4Q1BA 3VNUA 4B2IA 4YMTA 3B9QA 3REFA 2HF9A 2WJIA 1E98A 2J45A 4G5RA 3R9XA 5DIFA 4FW9A 3F5FA 3VNVA 4MYCA 3SBDA 4YQFA 1HUQA 2A78A 2NIPA 3QKTA 1FUKA 4MKHA 4AKEA 2F1RA 3NC1C 4TSFD 2HYIC 3NVAA 4A2WA 3TW8B 2CHVA 4ON9A 1JNYA 1V43A 1FPMA 1R10A 5KDLA 3OHMA 4B34A 1YR6A 2HLDA 3K0FB 1KNQA 1KSJA 1ZJ6A 3QBVA 4GP7A 1CJMA 621PA 4BPBA 4AI6A 1Z06A 2R6FA 3CX7A 1GRQA 3K0AB 4EJSC 3I8XA 5DI3A 4Q4JB 2FN4A 4DVGA 2WMOB 4D2IA 5G3YA 5EJEA 4HLQB 3REGA 1E2EA 1XX6A 1NLYA 3NIBA 4Q66C 4URZR 1JEDA 3BB1A 1S1MA 2FA9A 4XSGA 4C0LA 3IHWA 3WYGA 4I4LA 2OO7A 3FMFA 1Z63A 2PBRA 3U7GA 4AKHA 4QHSA 2ZI6A 2J7KA 1X8KA 1MRSA 1SKYE 1H8ED 2Q0HA 5JCZA 2NMVA 1HEIA 4AIIA 4A8JA 2E87A 1GL9B 1U8ZA 2N42A 4BLPA 1ZU5A 1KTVA 3H84A 3RC3A 3SYLA 1IXRC 2YC2C 1HY3A 4NH0A 4I99A 1NJGA 4QOSA 5JEDA 4DXAA 3SU8A 1R7RA 2AXPA 4GT1A 3IBYA 3ZZUA 1W0JD 1XEXB 2OM2A 4LJAA 3WMEA 1XPOA 1CJKC 4G5OA 3EA5A 3OIVA 3VFDA 1KK2A 4PC6A 2CEAA 3C16C 2FFQA 4OHVA 1S3GA 2ZUCA 3G5UA 4R7ZA 2CHGA 3KKOA 2I3BA 3HR7A 4FN5A 2AX4A 4GSYA 5BYJA 1PLLA 1VECA 3QKRA 2KSQA 3TRFA 2ZJBA 2PMKA 4GBMA 3THYB 2F3RA 2FFHA 2VP6A 3SDZA 3TSZA 1A5TA 2J0SA 1QBKC 4R71A 2SHKA 1EX6A 3KL4A 3AGPA 1TEVA 3VTKA 1BH2A 3A37A 2DWQA 1GNRA 1W44A 1HYQA 2WMNB 2FMXA 4D0LB 1QG4A 2ZIAA 3PJRA 1LB1B 2BC9A 1P73A 1LS6A 1E9DA 1KK0A 1G6HA 3VHXA 5C46F 3EW9A 1XDBA 1P9RA 2IUTA 3FFAA 3TW4A 3UWKA 4GNKA 5FTLA 4TQ9A 2VEDA 1YZGA 4B35A 3QJYA 4C9BA 5JLJA 2ZI4A 2N1BA 2VRWA 3C4JA 4NL4H 4TWZA 3ZDQA 4D82A 3QPUA 3F0TA 3GLHB 3IQWA 4FMCF 3GJ8A 4JJKA 1EFRA 1G4UR 3QPVA 1MO5A 4AKIA 2QAJA 3UWOA 1OXXK 5BN5A 2GJ8A 4MRVA 2FH5B 1E6CA 4RD4A 3CRRA 1N6RA 1Z22A 4BFZA 4Q1AA 3AEZA 1JR3E 3L8YA 5AJVB 1NMYA 1OFHA 1GUAA 1E9SA 3LX8A 2Q3FA 1CS4C 3CZPA 1E9BA 3IIMA 4JVSB 4B3BA 4FMBB 3AGQA 3U2QA 2J46A 4BWYA 4MYTA 2QE7A 2ZROA 4L8GA 3BAFA 4KU4A 4OQMA 5JZVA 1TMKA 2ONKA 4H1VA 3QOFA 1VIYA 5D3MA 4BFYA 5F9FA 4A92A 2FV8A 2IX3A 3BE4A 5CIQA 1K5DA 1VDZA 1KDPA 4A1FA 4DLZA 4DWJA 2WTUA 1Z83A 521PA 2UKDA 3EARA 4EPWA 1KDOA 1E2KA 1RE0A 2P2LA 4Z8XA 2QTFA 2IWHA 2AK3A 3LX5A 4Q18A 3PUVA 1ZNYA 4OK6A 4D80A 3AV0B 3IKJA 3T1OA 4M1TA 3EWSA 5JRJA 1WXQA 2C5LA 1FP7A 1S4QA 3OIYA 4PX9A 3P1JA 2GF9A 4NCKA 1LFDB 2F1JA 1RRFA 1Z6AA 3KZ1E 2ZUBA 1JALA 1W36D 3K09C 3K53A 3LBNA 1P6XA 4IRUB 4LI0A 5ELXA 2H92A 1U98A 2Z5FA 2F7SA 3LQQA 4ESVA 2V1UA 5LDDC 2JAQA 4KYUA 2X1VA 1S9DA 1CP2A 1KJYA 2ZJ5A 3BB4A 4ZIRB 1Q1BA 5KPDA 1W5SA 1J7KA 5IT5A 1NF3A 1FZQA 1P2SA 4K46A 3O8CA 1Q22A 3FMIA 4YMSA 5CK4A 1TU3A 3GEIA 1NLZA 2IL1A 3LLUA 2WWFA 1G9XA 2X2FA 4V0KA 1F48A 4D4JA 3ZQ6A 4ZDWA 2WJJA 2QGZA 3CLVA 4E07A 1XP8A 2GJ9A 1NI3A 2AK2A 3CRW1 1L4UA 4UNNA 4D4MA 4NYMQ 4S2EA 4KCGA 2GVZC 4LSGA 2ZI9A 4DB4A 1UADA 2IYWA 3E1SA 3PXGA 1L2TA 4Q01A 5DE3A 2EYQA 5FBVB 4TQAA 3BH7A 3QVUA 4QGFA 4HLCA 1UJ2A 3GJ6A 3VKGA 1XTIA 4KLNA 2ECKA 2ZYWX 2IW3A 1E2HA 3RYTC 3QG1A 2FFBA 2WIAA 4QFMA 3IPXA 3U5ZB 1E9CA 1VKJA 4KSCA 4M2LA 2XSZD 1HE1C 3RWMB 4ARZB 1KYIA 3K70C 3WYFA 2G6BA 3A1SA 4P3YA 2Q9AA 3O8BA 1QRAA 3I4LA 3K70B 1ZCAA 5CK5A 3PR1A 1T5LA 4LHZA 3RANA 1Z29A 4TZ6A 1GFIA 2A5DA 2UZ3A 5LB2A 3V00A 2ZJZA 3GCGA 2REBA 4IDQA 4CEIB 5JI2E 1E9FA 3FMPB 4K8OA 1CTQA 4XOIA 3WBJA 2C9YA 1NVXQ 1BKDR 3GFPA 4XD7D 5H1YA 3K0SA 5F2EA 4LYJA 3KFVA 1KOFA 3PUWA 1V5WA 4O25A 1KI4A 1WA5A 4NU0A 5M04A 1NY6A 1WB9A 1D2MA 3K9HA 1Z0DA 4HAVA 4DLUA 3UMFA 3V4FA 1FQKA 3EC2A 4DCSA 2GZDA 3SJZA 3EC1A 2BMJA 2QA5A 1G19A 4BLOA 2ZITA 4QBHA 5JI3E 3T34A 4CF7A 4YMWA 3QXXA 1IM2A 4M1MA 4Q1DA 5LBIA 3OEHA 5DN6A 2RHMA 1DADA 2FGKA 5FOUA 3ZGXA 1GTVA 3IHLA 4KODA 3QEOA 3QVVA 2ZQ5A 2QP4A 1G3MA 2GNOA 2BMEA 2QU8A 4A9AA 3FMOB 1KHTA 3BFXA 1CJUC 3EZ9A 2RGBA 3VHLB 3OEED 1OH8A 4PC3A 3Q7PA 1GVNB 3K9GA 4B74A 3NBFA 4PAMA 1SZPA 1UKEA 1E69A 1QHHA 2ZI5A 1JBKA 3QY0A 4C2TA 3NHBA 3VMFA 4EJSB 4RFVA 2ZVQX 1WCV1 2WBLC 2ZR0A 4C0AC 1XPRA 2CXXA 2WJVA 2LKDA 4XSHA 3W6NA 5J4LA 2XNSA 1G5TA 2ZEJA 4GFDA 4OK3A 4B2PA 2OEPA 1ZUHA 1D6JA 1MO4A 3CM0A 2OAP1 2Y8EA 3TUZC 5H8WA 3ZVRA 1GWNA 1XTQA 2PX0A 4GZMA 4WA7A 2AL7A 4EFLA 2RGGA 3BJIC 4Z1MD 3X1YA 2YOGA 1G18A 2UZIR 2IXGA 3HU2A 3N2IA 1G8YA 4DRZA 2PZFA 1LVGA 3KX2A 2DHRA 3WRXC 3NG1A 1AA9A 1NN1A 2DB3A 3KKPA 4Q4JA 3LO5A 4EIWA 2VQSA 1XMJA 3GJXC 2IA5A 2W2VA 3I1FA 3PITA 3X1WA 1Q20A 3B60A 3B78A 3CR8A 4M53A 4X8LA 1Z0FA 2C9OA 4DDUA 2ZYTX 5JSZA 1HQCA 1GKIA 1F5NA 5J40A 3OF5A 4E5UA 4ZCIA 3E70C 5C1BA 3GLHE 1QDEA 4JKIA 1Z3IX 5G53C 1TQDA 2OLKA 2VHCA 2RGEA 3KUCA 2W6JD 4IDOA 4QHYA 2QP9X 4GRAA 4BLTA 4EAQA 4CYMA 1NBMD 2ZANA 4NPHA 2V55B 4QC2A 2FPKA 4PHHA 2ZJ8A 2P6UA 4JLOA 4PO1A 3LXRA 3SI7A 4DDVA 2QAGB 2A7QA 3U7HB 2QQEA 3V9PA 1ZRHA 4PSAA 1OKKA 2WWGA 4PO9A 2JJ2A 3AVTA 1E79D 4W5WA 2GETA 3K0CA 4QHTA 3OEEA 2PT7A 4XWAA 2IYZA 1OE0A 3JVVA 2KWIA 4UNQA 5IK2D 1S0UA 4KXFB 4KFRA 5EE5B 5JSZB 1EGAA 4IFBA 2GKSA 4JT4A 4XH9B 3GLHA 1ZUNB 2X8AA 1IY2A 4O2RA 2LKCA 2NO9A 4AK9A 5CM9C 2ZU0C 4PSKA 4C0HA 4C4PA 2ZXUA 3B8HA 3NTUA 1FOEB 4R2HA 1JR6A 1TUEA 2NOAA 1KZGB 1M7GA 3VR4A 3E5HA 1JXOA 3O8DA 4XTRA 1GZSA 3ND8A 1NMZA 1Z0JA 2B7BA 4Q9KA 4OHWA 1P5ZB 2REOA 2GXAA 1MH1A 2HT1A 1P7CA 3FKQA 5JEEA 5FBLB 3X1XA 3U7FB 3ZD7A 1SVIA 2RGNC 1W49A 2ODBA 4MGIR 1ZC4A 2ASEA 3CNLA 1NL3A 4JLPA 5DI3B 1E1RD 3HPRA 1IN8A 4AD8A 1N6OA 2XX3A 1GM5A 3QBTA 4G0NA 1R0XA 3A1TA 1OYWA 4ITRC 2OV2A 2QM8A 2QQ0A 3I72A 3RHFA 2FZ4A 4PHFA 1JJ7A 2OFWA 2V8OA 1A82A 1ONBA 2PEYA 1KDTA 1N6KA 3GP8A 1VCNA 2QPTA 4B3DA 3ZVNA 3LLMA 4V0MA 3QENA 1T5IA 1XD9A 4LJ8A 1EFUA 4BFVA 4TMXA 2G1JA 1G7SA 4ILEA 2J5XA 4YMVA 4H9GA 4LBWA 4Q4LA 4KJZA 3PFIA 4O0MA 4IFEA 2JATA 4JS0A 1XF9A 3CF0A 3THYA 4PZLA 5FTKA 1U94A 2ANBA 2GCNA 3R7WB 3B1VA 4MRSA 1SXJC 3CF6R 3L0IB 2BCGY 3U3KA 1X3SA 3PUZA 3K0EA 4Z54A 3HWSA 3AB3A 2D74A 3CUEF 2JJ1A 3RRZA 4WAUA 2F1HA 1FQJA 2IEYA 1O3YA 3U4QA 4Q19A 4P4SA 1G7CA 2BWJA 3L8ZA 2F9MA 3MG9A 4TN1A 3LWNA 1EWQA 1VYTA 5FPKA 2QPAA 4BFUA 5HCIA 2OAQ1 4F91B 1JJVA 3QQ5A 2NZ8A 1UDXA 3PCRB 5K8UA 1BIFA 4PR0A 5EZ5A 3RAPR 4CT5A 3SQWA 2V3CC 4FI3C 1XEXA 3DEFA 1MKYA 4B6EA 4HB4A 1M7BA 1WMSA 3R20A 3CRQA 3OAAA 1JXMA 1NVVQ 3QKUA 1NY5A 1VHTA 3EA0A 1DAHA 3NKVA 2DYKA 1FW6A 3EPLA 2IHBA 2XSZA 5LD2C 4XWKA 1WDTA 2EFEB 2GZAA 3AUXA 1S9HA 1UBEA 1WF3A 3GJ5A 1G6OA 3HYRA 4Q03A 2V7QA 2OCPA 1Q12A 4LHXA 2ZTSA 4TL8A 1IY1A 3TMKA 2QPOA 1MO3A 4Q9LA 3SHFA 5G40A 5JHHB 1E0SA 4PPFA 5EE0A 4B2LA 4DB2A 2QT1A 2FE4A 3NHAA 1NJFA 5F98A 4MKIA 1OF1A 1ODFA 3SOPA 3GLFA 4U00A 4DCTA 4LX0A 5JHGB 4Q21A 4JMPA 1OH7A 1T3HA 1FL9A 2FEMA 3HPQA 4LBZA 1IAQA 4XD7A 5CLLA 5FOWA 2EFDB 2JLRA 2DFNA 4QJ4A 3GLIE 4M1SA 1SKYB 2AWNA 1TADA 1EK0A 1XMSA 2HDNB 4I81A 4RZ2A 2OHFA 1ESNA 2JLXA 1NRJB 3S1AA 1MO6A 4EPXA 4QNRA 4X8HA 4OQNA 1LV7A 4ARZA 1E96A 4CIDA 1W36C 3LY5A 3P27A 5DN6D 1YZNA 2ZVPX 5AR1A 5JWHA 1J70A 4QXAA 2ZRGA 2OXRA 3EZ7A 3DZ8A 4LHWA 2BEKA 4WZBE 3UATA 4I1UA 2QAGA 1UAAA 3W90A 1QHNA 1HE8B 1ZNZA 2HT6A 3FDIA 3AUYA 4JLBA 1YZKA 4RFSB 2QI9C 1KKMA 2XB2A 5TVKA 1KI1A 2E1RA 2XJ4A 2F6RA 2D62A 4LCBA 3HU1A 3CKLA 1FTNA 5FUWA 3WYAA 4Q48A 2A5FA 2P5SA 1CULC 3AKCA 3ZIAD 4CEHA 3U61B 4DZZA 4LPKA 4BFSA 4F4CA 4RD0A 1LTQA 1U90A 5EXPA 5CDFA 5J4KA 1IONA 1J90A 2FZLA 1XB2A 2GK6A 3LXXA 1N3BA 5EP4A 3U44A 4NP6A 5HR5A 3KKMA 4UJ3A 2EYUA 2ODEA 2R9VA 1YHNA 4BFTA 4M1KA 4EPVA 2KJQA 4G1UC 3QF7A 4GOJA 1NVWQ 4EKDA 5JBQA 1A1VA 5AJXA 2V7QD 4YDSA 3GLIB 3P20A 3ETLA 4LBVA 1S1CA 1X1SA 1R0ZA 3RRMA 4M9ZA 2JCSA 1N0VC 2FJUA 2CVFA 4NHOA 1XTRA 1F2UB 2FPLA 3IIJA 3THOA 3BXZA 2BEJA 5FPHA 5KDOA 2GEUA 5EE9A 4R9UC 1KI3A 5ANRB 2QAGC 5TY0A 3H1TA 5BN3A 4BZXA 5JMTA 1T91A 2QTHA 3NBYC 5EXXA 5JJKA 3EASA 1WBDA 2R6GA 4DCUA 3KUDA 4FINA 1US8B 1IBRA 2OCYC 1PLKA 1XD8A 4B3GA 3QXJA 4OK5A 2A5JA 5EP3A 3KQLA 3H0KA 4MYHA 3AKEA 1ZD8A 2A9KA 1XEWX 3DPUA 1ZM9A 4FMCB 4TL6A 4PC2A 3VKWA 2O8FB 4ASUA 2HXSA 1XCPA 1P9NA 2CLCX 3PEWA 3CNNA 1F3OA 4HDCA 1R0YA 2WHXA 1XXHE 2RGAA 3AVPA 5AUNB 4M22A 2IK8A 5JJLA 4D4LA 4PPGA 3VQTA 4E03A 3PQCA 4C0SA 1Z0KA 1I4TD 4C7OA 4PC1A 821PA 2J0VA 2OUKA 5SZKB 1EESA 1BMFA 4P0TA 2XTMA 1KMHA 3FE2A 3DMDA 4HLDA 4ESHA 3UANA 2H17A 5L3SA 4JLKA 2BBWA 2WZQA 3TNFA 4PQFA 1CR0A 1YRBA 3EX7C 4L16A 1K8RA 4TQUS 3L0SA 3EPKA 4XVUA 3KXIA 2NPFA 4EQ6A 1T0JB 4MDEA 5CITA 3EIHA 3ICEA 4D4KA 3I61A 5FTJA 4DIEA 3WHKA 1KGDA 2D7CA 3I3SR 4C30A 3W34A 1DAGA 2V4ZA 4PAOA 2KB0A 3KB2A 1M8PA 3CZQA 4FMDF 3U3MA 4FCTA 4R2IA 3QI2A 2XZOA 5GJVC 3R8FA 1CR4A 1E2QA 3NDPA 1KI2A 3AF0A 2OLJA 1OXUA 1ZM2A 1II8B 5K8TA 4WW0A 2JLVA 1NN3A 2FSFA 3L82B 1Q44A 5CJ2A 5A0FA 1CRQA 3AM1A 3A6PC 1G291 1HA3A 2ZRIA 1N6NA 1AZSC 2RGNA 1JB1A 1N25A 4US1R 721PA 3GLGA 1XXHB 3A58B 1MABB 3F3YA 3VR5A 3TR5A 4KSBA 4NYIQ 2O52A 1IXSB 2GEVA 4AYXA 2B21A 2CNWD 2Q9CA 1IJFA 2CE7A 3KFXA 4X8OA 3ZVLA 3TUJC 2AFIE 4OI4A 2KE5A 2XOKA 2ZJOA 2EWVA 1G3RA 1W1WA 1SVKA 5JJIA 4RVCA 3WNDA 1F6BA 2PL3A 1I4DD 4LDJA 4JT2A 1KZ7B 1DAFA 1G5RA 3EZ6A 3MWKA 3CX6A 4MKGA 2D06A 2R44A 3IDQA 5GJWC 3MSXA 1BMFD 2J87A 5TV2A 4TYNA 5LD2B 4AURA 3VKHA 2XNDD 3I5YA 2IYLD 4NYJR 3U4QB 2BDTA 1KMQA 2VP9A 1TL7C 5C4MA 2JJ1D 3C7KA 2NO6A 3K1JA 4FIDA 1YRAA 2PJZA 4JL8A 1VCOA 2OBMA
chains in the Genus database with same CATH superfamily
4CKYA 4TPKA 1WVGA 2Q50A 1MXFA 3D8TA 2F43A 3V2GA 5JAQA 1JRLA 4RKWA 3P32A 4PSDA 2OZPA 5KNDA 2DXIA 3CONA 1Q83A 3QE9Y 1QYXA 2PX4A 5THQA 2JCVA 4B0OA 2ZT7A 1LKZA 1L7OA 1EH5A 3LUAA 2AG6A 3L2OB 4IDPA 3ZKAA 4YO8A 4U5XA 4RJLA 4DUZB 1U1DA 2A9FA 2FU5C 2VJBA 3EFOB 1NVBA 2X7HA 4I8IA 3VJMA 5KSWB 1NVEA 4XTCS 1O58A 2DVMA 1V0JA 4C87A 4MRNA 1M8GA 4PZZA 4W5NA 4NZ9A 4ZMSA 1S8OA 3AHHA 3SYTA 1D9ZA 4P4SB 3CSDA 4Y9TA 1FRFS 4IV8A 4PN7A 5HCNA 1JWBB 1R18A 5EHGA 5CA1A 1UBFA 4Z2YA 3D5QA 3KVRA 4MAAA 2R66A 1GKUB 1CHNA 1Q16A 4CLOB 2VYNA 5HOQA 2YRXA 1N7HA 3A3NA 3G8BA 1WMDA 3MCUA 3T9CA 1CR2A 4YDRA 1TEHA 3SQLA 1CZKA 3LUPA 3PNSA 4J90A 1A9OA 1W36B 1YQXA 3KJHA 1DC4A 1M2OA 4IDGA 4LTNA 4I08A 1PT8A 2O3JA 4TT3A 3E2IA 2FQXA 2J67A 2OO5A 2BGUA 3Q6IA 4LHVA 1NP3A 2P69A 5DCLA 4LS3A 4JB0A 3L3BA 5LSAA 1RBYA 2JDIA 2YVUA 5JZBA 1QRTA 5KTTA 4FK8A 3FNQA 4KBFA 1SD5A 3PXBA 3MTQA 3RIGA 3UF0A 5HZHA 2NO0A 3ZU6A 3D3JA 4RJTA 1OROA 4ZWNA 4K28A 2CCGA 2FPPA 5E2IA 5EE1A 3B7WA 1RACA 3FR8A 4N5NA 4Y2HA 2DQSA 1UJ4A 1JFTA 1OSNA 1ACMA 3L49A 2G1PA 4L5IA 4W9MC 1PT7A 4Z49A 1P1BA 2FY8A 2NUBA 3OZRA 4UULA 1NLMA 6NULA 4W7HA 3K72B 2IS4A 1KZ6A 1BA2A 3GOHA 2HOQA 2QTZA 1Q6YA 3KJEA 2QOEA 5GIPE 1LLFA 3AUTA 3MJHA 3QVJA 4PTZA 1X7WB 1EFTA 5FV7A 2F3QA 4EKEA 2DULA 2H4JA 2OG2A 1FMLA 1FX0B 1NN5A 3D7MA 1VB3A 4ZYXA 2VF8A 2YRFA 3VVLA 1FDVA 3I0NA 1UDRA 3EBPA 3WZLA 4OI0A 1FUUA 1QGUB 1QPBA 5T6BA 4DLRA 5IM5A 5FNVF 1P29A 1UAYA 4FFBA 4UAVA 1Y6FA 1ID1A 1WD7A 1DBRA 5L8VA 3BWBA 4ZEVA 1M0WA 2AEJA 3WMXA 1B8OA 5LIPA 2ZS8A 1EHCA 4XA8A 4Z0HO 2F67A 4E2FA 2VPIA 4NG5A 5JZSA 4F93B 3RJTA 1Q1QA 3GUCA 4JIGA 3OEYA 1MV5A 1T35A 1W75A 1GGMA 2AMJA 2XHEA 4F85A 4ER5A 2VHJA 1XROA 5CT6A 1M5UA 1T9BA 1XAGA 4MS3B 1FLNA 1NQXA 4M21A 3UH0A 3PJFA 3OJXA 1FMJA 5FULA 2YQ4A 3OFJA 4LMRA 4AF7A 5AW6A 2CL7X 5G0UA 4UAGA 4M0PA 3LIPA 3L1HA 3FCEA 2WWXA 3C1AA 2J48A 3TJZA 3GGCA 1NPTO 1BD3A 1SXJE 4QTYA 2G77B 2XDQB 4XGNA 3V32A 3ASZA 1HQDA 1SKMA 3UCEA 2NG1A 5SY9A 4EZEA 3KQPA 3OFND 1SBIA 4DUGA 1WTAA 2CVZA 5JWOA 1UXHA 5L40A 4D9JA 1E3WA 2DUJA 4AYTA 1DS6A 4RC9A 1JDSA 3PG5A 3T7KA 4TLAA 1ZHHA 4P33A 2BGMA 4REQB 1E3TA 2D4HA 1RADA 1ZCBA 4AJLA 2RI0A 3H75A 2X5JO 1MZVA 1SCUA 4P93A 4RU1A 4TXNA 5ICFA 3PL5A 3HCAA 4Q4CA 3QY9A 2WPDA 4M1OA 1ZY2A 4RY2A 4EY4A 3ZJ4A 3DYBA 3PX7A 2L17A 5HFJA 1C9YA 4LY0A 2FF5A 2Q5OA 5BYKA 1Q1AA 2LCFA 3FPAA 5DEIA 4B6QA 2RK6A 4URWR 3ZU2A 4PZUA 1N1DA 2WV7A 2Z57A 1XQ1A 4X6YA 1QHSA 5DLDA 3FYDA 3B1KA 1A4RA 5BQPA 3UJCA 3W3ZB 5CD1A 1WETA 3PDIA 4AZ0A 3O4VA 4HDAA 2O2GA 1SQGA 4Q4DA 4BRUA 1P5HA 1MB3A 4JBIA 5LOVA 2IHVA 1RVDA 4LUCA 2AUMA 2IEZA 3BE6A 4KO1S 2NW6A 4MSUA 3BSYA 3TLXA 5LMZA 2HRZA 3MFQA 4OP2A 4A8HA 1T8PA 3ABIA 4MS1A 4LYGA 4OKSA 2BTEA 3HCWA 5AJWA 5AKZA 5CIWA 2WKWA 2QVZX 3P7MA 3QFTA 1UZAA 3OG9A 1IXZA 4MQ5A 1LF0A 1J7JA 4D0GA 2JK1A 1OA1A 2UYQA 1L4MA 2PPVA 2X15A 2PWZA 4GKAA 2X5XA 1FP2A 5EKXA 1NOJA 2O0LA 2W5UA 4K9SA 5D3MB 3KXLA 1MW9X 1NGSA 3PPWA 4G1VA 5A5DA 4Q1EA 2YZNA 2EJTA 2WD7B 3QUQA 3OE1A 1EP9A 4WNYA 2VSYA 1XTVA 4G0WA 2V54A 5CCDA 3RSOA 2PIAA 3AF3A 3P71T 4KITB 4KPFC 3NALA 4TWIA 4KNYA 4D3XA 1NOKA 3GU3A 4IEEA 2Z6UA 1JH8A 3HCDA 1GIAA 4KMSA 4XJTA 3EZNA 3P9CA 3QE3A 3WFIA 2YXDA 1JPJA 4GDMA 3JY6A 1YE5A 3UOWA 2N0SA 3QELA 2FUKA 3ZIDA 4D7AA 3L7KA 5DF1A 4DTIA 1CY7A 1HTWA 1T3GA 2HFJA 1NBOA 2ZUDA 4NLLA 3C3DA 4OSOA 3SIRA 1RWBA 4AVYA 2FPWA 2YASA 3NWBA 1OIXA 2FFRA 3RUDA 1JSCA 1Z5ZA 4HPJB 4KIWA 4WNCA 1E8DA 4AN1A 1FTWA 1XKLA 3B6IA 2HNKA 3H9CA 3WL5A 1UMDA 1E6WA 1W6UA 2Z5VA 2XCQA 4P3KA 1ZN8A 1EMDA 1PVOA 2BV3A 1MLDA 3TGPA 3VAAA 3MTJA 3E27A 3M5PA 4P82A 5LA6B 3WI7A 4CF4A 1MXHA 4YRGA 2A59A 1QHFA 4HX5A 1ETUA 2Y0PA 1Z5UA 2Q5EA 1R4MA 3RAEC 3QNUA 1JHZA 1QWSA 3TOCA 4RZUA 3RUAA 1MAWA 1JIQA 3PQ3A 2WU0A 4Y30A 4Q00A 4UXJA 3THRA 3GRYA 5LQDA 1DGQA 3KYDB 1M1YA 1ORTA 2Y2VA 4WY8A 2QL7A 4IVQA 3CEAA 3QWFA 1EYZA 2XZPA 4ES6A 2F55A 3UUEA 4LJ9A 4EI2A 1I6KA 1HE3A 2R60A 3AEUA 3BD9A 1CQXA 3GJ0A 2ECQA 2J3KA 4G4GA 2BVNA 2RH4A 3GRVA 4UUQA 3F9RA 2XJ9A 3C7CB 3MPUA 2AIRA 2JNWA 3T9FA 3Q3EA 1L9KA 1J8DA 4WLFA 3SZUA 4I9FA 5JXGA 3LAWA 3QTTA 5T4BA 4F3KA 1YNOA 3E0XA 5BRJA 5HZGA 3PKZA 2I6QA 1V9CA 1BDMA 2NZVG 5FO1A 1T9DA 4QUAA 3PIIA 3D31A 4JEIA 1AQLA 1E3JA 5DBIA 2Q8PA 4NZZA 3HFRA 3EXEB 2X0NA 3T5CA 1NQWA 5B1IA 5CDSA 2YWDA 3ZGOA 5C8XA 4EW6A 3UEOA 3P26A 5C4IA 3IIKA 2FSVA 4XR9A 3IR7A 4NFSA 5G4LA 5H82A 1EDOA 1Z4QA 2JJMA 1KMHB 3E4CA 4URXR 1ZN7A 2Y9MB 2C4MA 1AGXA 5K3FA 2IPOA 3LC2O 2J59A 5FX2A 4YAWA 4PG5A 2OMKA 2ZJ3A 2VUIB 4JUFA 1R2QA 1E3SA 2WJHA 3KZNA 3KT6A 2PGXA 5CNIA 4A8PA 3HADA 3K6KA 4MV8A 4GX0A 2OGWA 4C5AA 1O5TA 1X94A 1JQ5A 1GL6A 1NVUQ 4YIHA 4QYIA 2IOQA 2ZRLA 1FXSA 1HWYA 1D2GA 2PRZA 2J3EA 2Q6TA 5DDIP 4N47A 2BE7A 1JIVA 3F7TA 4UFPA 1UJMA 2K2QB 5EQDA 2C95A 4MV4A 1AJEA 4K9MA 2O2ZA 2OZLB 2MMCA 4QEDA 4DBVO 2VQDA 4YP0A 1FUYB 3PTAA 5A4KA 2H3EA 4WLNA 4YJ2B 3SYNA 2N3ZA 2D8MA 4RACA 4V0OA 4MR9A 4TLBA 2BFAA 4TZ0A 4CEIA 3K1AA 1YUBA 4HCJA 4EG6A 4TVSA 3K9FC 4CRWB 5AXCA 1DIOB 2ZDHA 3L5KA 4PZYA 4RVHA 5REQA 2YIVX 3V8BA 4YONB 1RLIA 1UZNA 1ZXLA 2BFCA 3AVQA 2XH8A 5EWMA 5LJLA 2VUHB 2MMGA 2Y05A 4ARAA 4NAVA 2H59A 2HO5A 1C1DA 1LBSA 1I2AA 1ZINA 3EXAA 4HQNA 1SK8A 2V8BA 2XE8A 3GZNB 1ZGCA 2E49A 4Z3KA 4G0YA 1L4LA 2ZQZA 1V1JA 3LOQA 4RSGA 2P65A 1SULA 3UK2A 3UO8B 5A04A 4L3VA 2Q0QA 1VRVA 4NU5A 4XB6B 5DM2A 5TPZD 1PWZA 3H13A 1JKFA 1KAGA 3HABA 3MM4A 5JSQA 5JSUA 2VDUE 2KS6A 5DXAA 5E6SA 1D1PA 1HH4A 3AR3A 1GU7A 1ADYA 1LLDA 2ZJ0A 2GPWA 3BWEA 3E9YA 3NFYA 4DCMA 5GZ1A 3UBTA 1RRCA 2ZXEA 5CDFE 3KQKA 1BE6A 3M1YA 3F5MA 3NBAA 3RSLA 5AIBA 3GBPA 2YY6A 2CLMB 1C30A 4X6LA 1PR1A 4CL0A 4WCVA 3BMQB 3PGMA 2YBDA 1C4KA 1RWMA 4K40A 1CE8A 2VSFA 3SKYA 5FPPA 1V9LA 2QG4A 3FAZA 3I58A 5BN4B 2W71A 5JSYA 4YUYA 1XGKA 2K2WA 3GD7A 1R9MA 1YS1X 1E7QA 1UPBA 3TUIC 5LUAA 1ISFA 3EZLA 3ORQA 2WICA 4E4YA 4KZKA 5I3CA 3L6EA 3DFFA 4OB6A 1E2BA 2Q0XA 3HKCB 2VP2A 2ZAMA 1GG2A 4HDNB 2IW1A 3NI2A 3NEYA 1KOGA 1OAAA 2WKRA 1BWRA 2I6TA 4KPUB 4ZDKA 3DE2X 4Y0VA 1VTKA 3FF4A 5AVTA 2XB4A 1C7RA 1I4EB 2J0UB 4G0QA 4IS3A 4KTVE 1B00A 1FNCA 2WWVD 3HH8A 1KP3A 1SIOA 1EEHA 3H4VA 5EIAA 1UKZA 2P4SA 4D41A 4W5RA 5T5QA 2IHZA 4O1MA 4DYHA 1KF0A 1WX1A 3KALA 4JXJA 3UJPA 3THWA 1XCGB 2BMFA 3B5EA 3OAAD 4KLZA 5FEMA 3VR6D 3FSEA 4RM3A 1N2CB 4D56A 4EUFA 4FWIB 3HB9A 4F7DA 3SR4A 1A5AB 2SCUA 3GPLA 2I1VB 2G28A 2M6SA 1WQ4A 3OPYI 4R6WA 1D2EA 1CXZA 2J08A 3K0KA 4K9NA 2REQA 4XXHA 4M0UA 4C78A 4B5KA 2JD1A 1Y1LA 3L8DA 4E1VA 4MWBA 2FNAA 3OCCA 3KU4A 4CGZA 1A9QA 3KR2A 3ESBA 1LDEA 2WLSA 1JSLA 3AIIA 3FYTA 3O31A 3G0IA 4KFSA 4O4LF 1MVLA 4LK2A 1XZEA 4KI7A 5C51B 2GCPA 3OC6A 2HCFA 1K6EA 1E64A 1L8XA 3NC0C 5BPHA 3A11A 1ZLXA 3IV9A 3VYVA 1H94A 2GO1A 2H9YA 3OQ1A 3CPSA 1AUQA 1SCIA 4PONA 2FZCA 1FDTA 1COWA 1NM5A 1W1IA 5IXSA 1AKUA 5KINB 4OHZA 3INYA 4LQLA 3RU3A 1UM9B 3LYAA 2NXWA 3DLCA 4B71A 1HRDA 3AX6A 3HM2A 3ZE1B 4AUMA 5KSOA 1TCBA 3P5BA 4ALMA 3S2IA 2GEJA 4YRRA 5GPBA 3GP5A 3HVRA 3CW8X 1OBVA 2BFNA 4UBMA 2WM2A 2HZBA 1U8YA 3KYIB 3VBEA 5FT9A 5KTRA 2GSDA 1BOFA 1S2MA 2VOEA 2Z83A 2ZB8A 3S8YA 1TCUA 3ED1A 3OFSA 5EUMA 1SBTA 1M6WA 1VJRA 1AXGA 2P2SA 1I24A 4U2EA 4FOOA 3HJFA 1VXRA 1JPNA 1YQTA 3UGKA 4F6RA 2H1VA 1M2KA 2W2PA 5THKA 1T4CB 1EQAA 1W96A 3WDKA 3BDVA 4N41A 4QRHA 5D2CA 3RWOA 4LF8B 1W59A 1DT3A 2N1MA 3QBDA 2HA0A 4EDFA 2R84A 2QR3A 4LJ7A 3IP3A 1YGPA 1FLVA 1QH9A 3INNA 3RLIA 2BH2A 3EPHA 5BW8A 1QVAA 4DSTA 1EFDN 1YZLA 1GJRA 3O3OB 5EWLA 3FGNA 2BGLA 1BMQA 3ILXA 3LRPA 3JZMA 4I50A 5FO0A 3I9MA 4MA4A 2QIPA 4NE2A 4TTVA 3E9NA 2COUA 3AG6A 2PBZA 3FYHA 4ETNA 2CDBA 5HVNA 5J2TB 3E5MA 3LVFO 1ULTA 4OHXA 2ONZA 3KR1A 1T8UA 4QUKA 3T35A 4CLRA 3AP2A 3Q2IA 3AP1A 4I1PA 2NACA 4CQNA 2EBFX 1YR2A 2AZMA 1YQ9A 5H59A 1ONSA 3KEOA 4BZQA 1AV6A 3O1JC 4YXWA 2ST1A 3RIYA 4B8WA 1CDDA 3H5RA 1ATZA 4J91A 4O4HA 1TPZA 1Z25A 4LRTB 4XUCA 2IOFK 1UPFA 4RDXA 3H0CA 5C8YA 1SVMA 2XCIA 5EKDA 1P61B 3AJDA 3F74A 3U3XA 3HA3A 2OECA 3EEIA 3D7KA 2CB0A 5FOQA 1ST3A 4AWBA 3HS3A 4UEOA 3K0HA 3HUUA 2PGDA 1F06A 5C31A 2WM9B 1E1NA 2ALJA 4OPMA 1QGOA 4NH4A 2YBEA 1EXMA 5I47A 5TQVA 3HJAA 3MAAC 3ELYA 1QGZA 3UPTA 3SMQA 1CZHA 3CUKA 1U1GA 2K5UA 2WP8J 4EFKA 4BNZA 1FLDA 4NMHA 1WOYA 1IJEA 1JE1A 2B4QA 3W7BA 5HKKA 2LWIA 3EA4A 4XYBA 1KTIA 2UVDA 1UKBA 5A71A 4RLSA 2DKNA 1T5OA 2WTMA 3FIJA 3GJQA 3L1UA 1NHGA 1GPWB 1FTSA 3TIGA 1WBBA 4DWWA 1OW3B 5BT9A 1ZNQO 2H18A 1I80A 3PP8A 3ZV4A 1H23A 1ZK1A 1ZN2A 3O4IA 4KLAA 1EIWA 4L4ZA 3N2LA 4EW2A 5JASA 3M4NA 4FGLA 4NCXA 4Z4EA 1S01A 2WSIA 4EGQA 5JD6A 3C0KA 1F2TB 3JWIA 1BYIA 1SXJD 3HMQA 4A36A 1VKRA 2JLQA 3BS4A 2G17A 3O8QB 3C14C 1GAQA 1L0BA 1URPA 1WXFA 2JJ2D 4EKYA 5T41A 3C1UA 1QX4A 1GPMA 4TLCA 1MZPA 1PJTA 2NZJA 3AKYA 4NTZA 4YAFA 1GV1A 1PQPA 3CLRD 4KX5A 4WINA 4Q7JB 4C22A 3UK1A 2VF5X 3Q7QA 1KIAA 3WBBA 3RU2A 2MHCA 4TL7A 3WWDA 3AC0A 3NAGA 2FRXA 2AUTA 5BV0A 2EHDA 3B6EA 3BDIA 3G79A 5DMXA 4OB7A 4YGYA 5HRCA 1OV4A 4GZLA 3O5AA 1GU0A 1ZAKA 2R6DA 3RIMA 4BN4A 2E85A 3ZLJA 1NNI1 3V1YA 1VM6A 1YRLA 5DRYA 1LCIA 4ZOEA 3EZGA 3BFKA 5KJFA 1P7ZA 1IHOA 2PS1A 4KL8S 4AZWA 4O4JB 2A4KA 2RGCA 1SHKA 1U8CB 3EMKA 4R4JA 5DNCA 3U6KA 4KVZA 2B4AA 2WOOA 1LJLA 4MQUA 3ESCA 1GY8A 2O59A 5TQJA 2E5FA 1ECCA 1YMQA 2JK0A 3I23A 3RRXA 4BV3A 5FUXA 4BQPA 4IJWA 4DNPA 5LBUA 3AF4A 1N75A 1QP8A 1YL5A 2VN8A 2XEDA 3ADDA 1DEXA 3B7PA 4GX2A 3FGZA 4P4NA 5D3QA 1RE1A 3AFHA 4ZP1A 2LCIA 2NO7A 4TL9A 1IM8A 4DT1B 2R8EA 4R2LA 5DGIA 2OM6A 3HHPA 4OYHA 2YZMA 4HGRA 1QHHB 4X7BA 4BAGA 1CW2B 4F1WA 1Q0HA 2OHHA 4EEXA 2AG0A 5HJ2A 1FDIA 1DNPA 1VB5A 3ZK8A 2QSZA 1KY2A 3A9VA 2OWEA 1I3OA 1T0BA 3L01A 3OJFA 1Z0IA 3R6TA 5LN1A 1CUFA 1V45E 5BUCA 1T1JA 4OQFA 1L4GA 2QRQA 4KRXA 4RVUA 4PNHA 3U4DA 4EHNA 1QP7A 3R09A 1IN7A 2PY6A 3QTLA 2NU6B 1T1EA 1X86B 1VFPA 1G2QA 3UPUA 2PT9A 2GT1A 2E18A 5ALLA 1DWPA 1EFHA 4MV3A 1KFEB 5G1OA 3HDTA 3VNQA 3BC1A 3NX4A 4K05A 4R9VA 2O8EA 5AKEA 4IDCA 4B7XA 5CBKA 1O95A 4MGEA 5ENZA 4X84A 5BY2A 3F6EX 1M54A 4WZBA 3RVDA 2Z2XA 4A10A 4XQCA 1UM8A 5LQMA 1ADFA 3N3AC 1DBIA 1NC1A 1WV0A 2XMRA 3PHIA 4FU0A 3E9DA 4FTWA 3LQYA 1YBHA 1ZD1A 3G2HA 5BSKA 3WRYC 3WIBA 2XOEA 4I19A 6GPBA 3TQCA 1VGQA 2E4YA 3JZAA 1B41A 3BIFA 3DEZA 4YEDA 3UWDA 3ZD9A 5CB4B 3ZDDA 4LVNA 4TTSA 4FI3F 4B8ZA 1XFAA 1P77A 2O0KA 4X95A 4YVFA 2JI9A 3N0XA 3JAWA 2ONYA 2IOHA 2QTLA 1B3RA 2QP3A 2XNDA 4U2CA 4NBRA 4K03A 4YJKA 4EFNA 4UZFA 1D8AA 1N5KA 1J56A 3RSGA 1DG1G 2A92A 1WDMA 1E8MA 1O77A 4HXEB 4NNOA 2VDWB 3C8UA 2VAVA 1EFPA 5DBOA 1IWPB 5DTEA 2CJPA 2HLDD 5H16A 3RTDA 5BN4A 2JLCA 3WVNA 2BTQA 4B4DA 4PNPA 3PPYA 3EHDA 1GPNA 4QVKA 3U3JA 1YTLA 1DMSA 1N9ZA 4WFIA 1CDEA 2XWSA 2XGMA 2YYAA 4HTFA 1RD4A 4LWZA 1LPPA 1GTJ1 1UEXC 3I28A 5AQ1A 5C8DA 2CBZA 3I83A 4I50B 5AKIA 3TTYA 3NH9A 2GEDA 4G63A 1U7OA 3O2NA 1T6ZA 5GZ3A 3H9BA 4R0MA 4HNUA 5GOTA 3PFWO 5IBPA 2MSEB 3QEJA 4URYR 4X3CA 3HYCA 5DGXA 4Z0TA 1RZRA 4U7GA 2IDZA 3W9BA 3KL2A 4C6RA 4LTDA 4ZU1X 3LH5A 2UZ1B 1POXA 1P2GA 4DMCA 3NIWA 5HP4A 1RMTA 5DJ5A 5A0TA 2ATEA 1W87A 2E4UA 2GCOB 2VVTA 2ZBFA 3C4VA 3HXLA 4RD1A 5P21A 3HRKA 5TDHA 5DSXA 1MAAA 5C8YF 2EGUA 3TJMA 3A9UA 1FFBA 2CF5A 3L4EA 1RXWA 4NSNA 2YL2A 1M34B 1V8OA 2ERCA 1HT3A 2GN6A 2ISCA 2WSSA 5LYJF 5L3RA 1SVLA 4PAQA 3GNLA 3AY0A 3NASA 3W8RA 2PU7A 3IV6A 4OJNA 4UNPA 2XITA 4BFCA 4MOWA 3L0PA 1Y1SA 1V4BA 2GN2A 4QSHA 4ZI2A 3TPCA 1OWNA 3GAZA 2CWDA 4QKQA 1K5GA 5JQGF 3IT1A 4RK4A 4BNKA 4BGEA 1NMEA 1OGJA 1SBQA 3OOEA 3ADBA 1Y4AE 3O38A 3GBSA 4V03A 5DNWA 2HF8A 2D6FA 5U1PA 1PN3A 3IAM1 3PVZA 1X13A 4B3HA 1XRSB 4IXDA 5B3KA 1WOMA 4ZO4A 3Q3JB 3IJRA 3NNDA 3PNLA 4MX8A 4S2UA 1U65A 7REQA 1NNUA 4KSCA 3IE2A 2HBZA 3MOIA 5LIRA 3H8WA 3CSSA 3N6RA 5I48A 3GLFE 3D7SA 2XGJA 3Q2OA 3W8EA 3MCAA 1IWOA 1EWYA 1IHYA 1UC5B 2QT0A 3GUYA 5K3SA 1IPHA 1GN9A 1F0NA 2QMUA 3J7TA 5EJ2A 1O8BA 3SJCA 4BO7A 2AQHA 4BN0A 1ECLA 4QUIA 2G83A 1L5GB 2O8DB 4YPOA 2DT8A 5E1MA 1DOZA 2J6HA 2RC5A 2PT5A 4BEVA 4EHBA 4Z7JA 1DKOA 2HIGA 3BFJA 2CDCA 1ZD4A 2J8ZA 1X19A 4A5OA 4H6XA 4EDHA 1O2DA 3PDCA 4FZ5A 5F73A 2QZJA 3TE6A 4PLGA 4F45A 3EH2A 4RYLA 4CKEB 5GZ6A 1JP7A 4L7VA 4N3AA 1Y1KE 4DCVA 3TSCA 3EOAI 3VZDA 3NP9A 1M7HA 1Z2PX 2UV8A 3FVQA 2CFSA 3VO2A 3O92A 1H1DA 4HFJA 4YAKA 3OZWA 4FOLA 4DDKA 3QMWA 2I7TA 4MR7A 3VV2A 4BB6A 1ZCZA 5SYAA 4EYOA 2AN3A 2CLSA 4JZYA 3FOBA 4WZAB 1AURA 2XMZA 3PQEA 2QRMA 2DFLA 2VDRB 3GT3A 4N5IX 2Y4OA 3WNZA 3R8CA 4OQ4A 1SPBS 5A5GA 2CBGA 1PHPA 2HGZA 2BPOA 1MT3A 2JIMA 2AVDA 4ZOQI 3FVTA 2PZLA 3AERA 1Z8NA 3RAGA 3V4PB 1FP1D 3MINB 4OJQA 2HWXA 4BX8A 3G82C 3QU9A 4WACA 4DEVA 4F3NA 4B44A 1N0UA 2IYEA 2R00A 3N5CA 5I9LA 1O95C 4TGLA 3IE0A 2HU7A 1HOTA 4IYRA 3OA0A 3DP9A 3NORA 3UG7A 4EVQA 1NXSA 3KIPA 4RA9B 5IJ0A 2Z5GA 3DVAA 3L6BA 4MR8A 2O8EB 5AW0A 2CLKB 3T95A 4D46A 2G9QA 3DOOA 3ZYZA 2PJRA 2AFHA 4QGGA 2EX1A 3BHMA 4MVWA 2ERXA 5JY6A 5FI1B 1G4AE 2WFMA 5JCJD 1SGWA 2CLLB 4PLZA 4NCHA 4QWMA 4X62B 2WWYA 3TAHA 3HCFA 2D7DA 1V11B 2HSWA 1ID8A 4KR6A 1TJPB 2ZJ2A 1DOHA 3SQNA 1OXVA 3H8VA 1D07A 3EIUA 4ZRNA 5DM60 3L4BA 3STVA 2PRYA 4KG7A 1OIWA 4ZKDA 4U3JA 3FSRA 1M1ZA 3ECCA 1ZBDA 4ZOCA 1GGNA 3UXHA 3ZCTA 3DLTA 4E7PA 4R2WA 5KTMA 2H3HA 5AVSA 4X41A 2DQZA 2YHIA 5FUQA 3AR9A 4OI1A 3T5TA 1MH9A 1E89A 4YRMA 4CDGA 1ZMTA 1A69A 1M6HA 3PR2B 4BP3A 3DUFA 3M6WA 1VOTA 2IXAA 2NPOA 4ZQCB 1YUNA 2CMFA 4R2KA 5DTMA 2IWRA 3CFYA 4YV2A 1J2RA 3AB8A 3R9XA 2AN5A 3L0YA 2JIZA 1J2YA 4OHMA 1Y4SA 5KB3A 3PXUA 1N92A 2RH9B 5IVPA 3WLHA 1W47A 1BFUA 1GPUA 2JCYA 2BIFA 3UWMA 2ZSBA 3UZUA 1PT9A 1M0TA 4CM4B 3OKCA 1LFAA 1XZIA 3GR6A 2QG9A 3FB4A 3W5SA 2Q1WA 1AZWA 2WG0A 1SQFA 2JI8A 3DEHA 3IMCA 4RSRA 1USKA 1J9EA 2AXEA 2JFPA 2QTNA 2IBMA 5DTRA 1NSFA 3IILA 3MTIA 1E5TA 4O4HF 4P3OA 3RU9A 3CBQA 3U7QA 2XRYA 1DU4A 1T29A 4R69A 1SHUX 3ZV5A 5G02A 4BVFA 2P9FA 3EVGA 2AWOA 2OV8A 2RAVA 2JJ8A 2QMOA 5IAEA 1W76A 1VA4A 1PRYA 3D8BA 2FSIA 2I65A 3WHLA 1T3LA 1Z6GA 4ECEA 4KACA 4KHZA 2BR3A 4XDYA 4JT8A 1KZ9A 4A6DA 1WW2A 4C03A 3NT4A 1ODLA 4MRMB 1UPXA 1DJNA 5KDDA 3K0AA 4XR4A 1N34B 2O6LA 1F4PA 1E2GA 3KLBA 5GM1A 2HJSA 5BQ5A 3CH6A 3G2LA 2IF0A 1OVMA 3NJRA 2HHJA 1IK4A 1LGYA 1XMQB 4CKBB 1APBA 3IYLW 1JAYA 1MDFA 2JH3A 4X54A 2I54A 3LPCA 3T1QA 1LC0A 3HA7A 1R6BX 3OOYA 2ZUSA 4CCWA 2AR0A 3IODA 3ILHA 5IEBA 5GV7A 5M7EA 3FPKA 3R7BA 3ZU3A 1KJQA 2E2WA 3PENA 2AJDA 3M4JA 3TGWA 4YJGB 4PNEA 1M3SA 1UP6A 3I4FA 3PE4A 3A8TA 4XLTA 1ISIA 4YRPA 3CA8A 2NUAB 2PZMA 4TWRA 2ZU6A 1TYZA 3MHPA 1CUHA 3LA6A 3H5IA 3QPWA 5A1TA 4XPIB 4OBEA 2EFHB 4PLFA 3VUFA 2C59A 5BSRA 4BX2A 1C8KA 3N39C 2C2BA 1ZISA 3OX4A 2ZUUA 1MX5A 3H2YA 4MV0A 1QMPA 2WTNA 3EVEA 2DP4E 3K9BA 1WHSB 3LD9A 3EDCA 4ZYZA 1T36B 2W2KB 3O2JA 3OEHD 1AK9A 2J5BA 3GGJA 4U02A 4KH0A 1K68A 2ZRMA 3IUPA 5LBTA 1X8XA 2QZ4A 2VF4X 2PL1A 4O29A 1H5QA 4Q12A 4TYMA 2OO5C 1TF5A 3D8RA 3OKFA 3A9RA 4ZVPA 1DAKA 3D0RA 3IP1A 3LSTA 4LOAA 2AQKA 5FNZA 3R8XA 3K9CA 4JVNA 1IVNA 1CY1A 4OA5A 5E38A 2B6HA 3UJ3X 1JI0A 2QXYA 5K45A 2P0EA 2PMBA 4H7DA 4KWEA 1Q11A 1N7JA 4LYAA 4GDFA 4E13A 3EFOA 3S8MA 4M7PA 1CUWA 1CUBA 2OQVA 4DPLA 3QX7A 3FHLA 1YE8A 1C3OB 2B25A 1VE7A 4KE8A 4FX5A 4GYJA 2C29D 2ONCA 3VR2A 2Z08A 1H5UA 1PR3A 4YI3A 4BZZA 4HADA 3NWPA 3T4PA 5L4LA 3WMFA 2RBEA 1SU7A 3H5WA 4IIEA 4Q6WA 1TYDE 4TKVA 5I7SA 4CQJA 3BIOA 4TT3D 3STUA 1H2WA 1H69A 2GJ4A 5SV2A 1C9KA 2B20A 4UEJA 4N1AA 4UUPA 2VH2A 2VF7A 1UDWA 3C7DB 1DKLA 5FOTA 3Q3CA 4X1KB 2HDOA 2WI8A 1JLSA 3QKRB 1R0SA 1II9A 3HDQA 1W35A 4QQNA 1CUUA 3W6UA 2PUDA 1UCFA 2WSSD 1DIRA 1Z6PA 2JAPA 5JVDF 2BH9A 3IAAA 4JI7B 1L5YA 1XRLA 4JQYA 2JEZA 2LVBA 2HRRA 4JITA 3TR0A 4WZAA 5KAMA 1E59A 2Y1OA 2YQZA 3OCXA 4Q3DA 1IQPA 3RE1A 3HBFA 5HDBB 3EEBA 2Q46A 1JFFA 2WSLA 4XB2A 1YR8A 1JDBB 1U2EA 2F64A 2JIRA 3NDIA 2ZIZA 5TPWB 1KVRA 2PTHA 3TEMA 1LSSA 1U7TA 2ZAYA 4BLSA 2B0JA 5AVQA 4D8UA 2AD5A 4G5YA 3TM5A 3KJIA 3KPVA 1KBZA 5FBQB 5FTNA 3TTUA 4CT4B 4JXKA 2CNOA 5B5SA 2A3RA 2G3YA 2JHPA 4IV0A 1RCFA 4ZI3A 4L4XA 1RPAA 1N2OA 1MX1A 1VHQA 4NOMA 4WGFA 2BFWA 1U8XX 1NV9A 4WGGA 1N8KA 1QU3A 1PVVA 1IY0A 4N4AA 2PLWA 4N7MA 5DYIA 4HGYA 4B73A 4E6PA 3M4XA 1FSZA 5IFKA 3KKQA 5BQXA 4NDZA 4IIJA 1EAMA 5CXSA 2XVYA 2FEOA 1H0KA 4CQLA 4YT5A 4JP2A 1E2LA 4XLZA 2J32A 8ABPA 1ZRNA 3B52X 1T24A 3EZFA 3F73A 1OYVA 3RF7A 1BFKA 1KU0A 1R4AA 2PUTA 3ND9A 5IAAA 1JU4A 2QNRA 3L6OO 1YL6A 2O8DA 1KDRA 1L4YA 2C2KA 2ZOSA 2R48A 3M1LA 4UU7A 5EP1A 5F3WB 1JQJC 3R9WA 5HILA 4DJTA 1KS9A 4UKDA 3GGPA 2DHCA 1ULAA 2C0QA 3BGDA 4M0DA 2IXFA 1Y3BE 1CJVC 1KOLA 5K20A 2HDWA 3CLUC 3N1UA 3ZWPA 5HKBA 3G5TA 2CJFA 4Q7EA 1JEOA 5BQOA 2P9GA 1N7GA 4GMDA 3O91A 4CE6A 5C7LO 1SD2A 3CVVA 4JBHA 1CE8B 2ZBQA 3RUCA 3ADOA 5CA0A 5A2GA 4R5HA 1JEYA 1EE1A 4IW3B 4P4TA 1KS2A 2CK3A 2IIPA 5IVIA 2JFNA 2KBEA 1NI4B 1Z5NA 2W6MA 4IH9A 4QT0A 3KOZA 2B8WA 3MMNA 4K6KA 1N2GA 3O9MA 1Q15A 5JRDS 4U6SA 1AB6A 2OBBA 1MG5A 4ID3A 3QIVA 2AC2A 1J0AA 1H2HA 3PXDA 2ZRPA 2WEKA 3JVIA 1QH1B 1HGXA 3SXPA 5A2QA 2K6GA 3R0IA 4P83A 3TMAA 2WPDD 1YRWA 2IYPA 2IQIA 1UC9A 2EQBA 5DB4A 5CEJA 4MJXA 2WWWA 3LPNA 3N7UA 2VJDA 3PC7A 3RJ9A 3IE1A 2R2GA 3EB9A 4F2DA 3AIKA 4GKKB 2FEKA 1SCQA 3MJSA 8MHTA 3BGVA 3BE8A 1FFCA 3ZI7A 1NUAA 2QRUA 4NFYA 1NXWA 3ICCA 2IIQA 1VLVA 2Q6LA 2VATA 2XE7A 4GEGA 1DTEA 2G9NA 3OTHA 1AB5A 1TUGA 2EKBA 3IO5A 4IZHA 5CP8A 5B7PA 1AC5A 3H1FA 4FBLA 3SK0A 3Q8XB 1RPJA 4A0RA 1KVQA 3HLYA 4CUZA 3T0FA 2E4XA 1TEZA 1YL7A 5D1HA 4BNMA 3GMDA 4D5GA 2ZRJA 3O83A 3HB1A 1Z08A 1W73A 4B43A 4ZGGA 2QUZA 1KYQA 4XRRA 1GCAA 4KXVA 4MV9A 3I39X 3X2FA 3WLPA 4WBSA 4GVXA 4UBNA 5DI9A 4ZV4A 4Q5IA 1E1QD 1QFMA 1CR1A 1KAMA 2H57A 4KBGA 1X1RA 4D0LB 1TXGA 4H0FA 3A1EA 3WQSB 4F96A 3PPVA 1RHMA 1Y5IA 5K6AC 5KYNA 1U7ZA 2H4WA 1AS0A 3B13B 1G55A 1ZSYA 2OSBA 4NDNE 2P67A 1I3KA 3UGTA 5CA1B 2RHDA 2P9ZA 3IERA 4FFVA 4C89A 4CKBA 5CUQA 2ZZNA 1PT6A 2AFVA 5EIXA 3K1YA 4YREA 5JWRA 1GFSA 5IMSA 2R4UA 3AQ4A 3K92A 2O7NA 4MVXA 1Z0AA 3P9PA 4ZCMA 3DDWA 4OJTA 1YU9A 2GCEA 5ALXA 3E22B 4EUSA 2OXTA 4ND1A 3RO7A 4TXMA 1K7XB 4LIPD 4AECA 5KTKA 2BBTA 2BEUA 3SZRA 1U7XA 3R9IA 1EVIA 2W70A 3OX1A 3VXKA 2VNHA 4XQ9A 1G8AA 3KJXA 4KQKA 1GNPA 2BJWA 2X8BA 3E5NA 2X6TA 4G5QA 1ZN9A 3PHHA 3GJ7A 2WVJA 1C5KA 2FR8C 5K3CA 4D97A 5ABPA 2O7RA 1UR5A 3DW3X 1Q0TA 5JE8A 2XKAA 2CHFA 1CIPA 4BBJA 4OXRA 1KMCA 3Q9LA 4EWLA 1G3QA 2C2YA 4MO2A 1Q21A 1L5HA 3FLEA 5BR1A 5C1DA 5I8WA 2CF6A 2O5VA 2Z9CA 1Q50A 3H1BA 4Q3LA <