3FGNA

Crystal structure of dethiobiotin synthetase in mycobacterium tuberculosis
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
230
Chain Sequence
FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Dethiobiotin synthetase
total genus 72
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fgnA00
2H7VA 3QXHA 2B92A 1SVKA 5J4VA 2HUPA 4Q4AB 4C9BA 5KYKA 2OILA 3EG5A 3DM9B 2WTUA 4ZPXA 1MO4A 3ZZUA 4LHZA 521PA 2H18A 1E2KA 1A1VA 4X8LA 5J4YA 4OI1A 1LY1A 4BZXA 4LJ6A 4TLCA 4ZDWA 4RJLA 5FBVB 5JWOA 2NZ8A 3AV0B 3QUSA 2RGGA 2REBA 1AKEA 2DFKB 2HYDA 3LV8A 4XVRA 4FMDB 5EZ6B 5AUQA 2ZR9A 1SVSA 2NQ2C 2AD5A 4MDFA 2OAQ1 5ELXA 2AXPA 4YMVA 5L3VA 4TT3A 4RKEA 1E2HA 4KBFA 4UXHA 4PPFA 2V8OA 3THWA 1SQ5A 2QM8A 2BBTA 3U7HB 1GM5A 2BJVA 1TTTA 4RFSA 5H8WA 2OV2A 1HQYE 2VP0A 2BCJQ 3W34A 4KYUA 1OXUA 3U3JA 1UF9A 1E0SA 4EIWA 2CDNA 3LA6A 2O8CB 1FTNA 4LHYA 2ERXA 4AIIA 3U4QB 2R62A 3I5XA 3AKYA 1GDDA 3I8SA 4JYCA 1OPXA 1GRNA 1KSGA 3MRSA 1BIFA 3C41J 5GJWC 1A7JA 1DPFA 1DAMA 2I3BA 4B2LA 1JEDA 3P32A 3CR7A 3KKOA 1VKJA 1XTKA 4PPQA 2IUSA 2EFCB 1CR2A 4Q03A 5DI9A 1UKZA 2W6JD 2A5FA 2HLDD 2OFXA 2FGKA 1ZM9A 2IYYA 4HB3A 1VCOA 4FI3C 4TYPA 2XNDD 4HSEA 1DE0A 4W9MC 4JJKA 5LPNA 4TYYA 3UXMA 3WYFA 4IXMA 4QHSA 1D5CA 5D3MB 1N6LA 2BCGY 4QBHA 4L9WA 5JI2E 4IEIA 2D4HA 1R0YA 4O25A 3W3AA 5FOXA 4GNKA 1UEIA 1GZSA 4C3ZA 3BH7A 3MFYA 1MKYA 2CL6X 2CNWD 4HDOB 5G40A 1ZIOA 1E4YA 1JB1A 2KB0A 1RIFA 3RS7A 4EPYA 5JI3E 3EXAA 1TX4B 1AA9A 2HJGA 3GJ8A 3AVOA 5B2ZA 2AD1A 2JJ2A 3VU9B 3EIEA 2PX0A 2WMNB 1KZ7B 1OW3B 4TQUS 1LB1B 1IXSB 1ZU4A 1L4UA 421PA 1X1RA 1EX7A 1LTQA 4QGGA 2NZJA 2UKDA 3B1XA 4QBIA 2XX3A 1DBSA 1GP2A 3X1ZA 1P4SA 2EFHB 3BIFA 2XNDA 4B44A 4D82A 5KNDA 1P2TA 1L4YA 5EUQB 4Z8YA 2DWPA 4E22A 3ICEA 4EJSA 2OSBA 3Q7QA 4I1UA 3WNDA 3ZVNA 4MYUA 4MKFA 2FV8A 2WWGA 2CLSA 2H92A 2KBFA 1G8YA 4F91B 1Z0FA 3RRYA 3UWOA 2EU8A 1BKDR 2HYIC 1EESA 4Q48A 1KSJA 5F2EA 1SULA 3BXZA 1VHLA 4S35A 4MKHA 4CRWB 3LD9A 1M1YE 3TW4A 4HAZA 4RD1A 3ZQ6A 1TEXA 4B3GA 2O0HA 3L8YA 4P4SA 4RZ3A 2PJZA 1W47A 1BOFA 1VG8A 1G1MA 4PR0A 1HUQA 2FWRA 2GJKA 2J5XA 2QPAA 3K53A 3Q5DA 1IOZA 2IBMA 2DR3A 3GLFA 4LJAA 4M1KA 4AKHA 3X1XA 4IW3B 4EJSC 4Q9IA 3EAQA 2WPDA 1Z2AA 4URWR 4JJZA 4EJSB 5CITA 4HAUA 2RGCA 2QRZA 1Q21A 4PC2A 1TUEA 1K5GA 3CKLA 3WP0A 5FUYA 2ZSBA 3ZIAD 2NPFA 2ONKA 1KTVA 1E9SA 1SHKA 1W2GA 3CH4B 2EWVA 3DM5A 3Q7PA 2KWIA 2IYSA 2Z4SA 3HU1A 1T3HA 2QM7A 1OF1A 1E9DA 4ITRC 2V6JA 3AVYA 2ZR0A 1P6XA 2IYUA 3AF0A 4TMZA 4A8JA 1E9AA 5BYJA 2N46A 2RGDA 1G41A 3FFAA 3B1YA 4JVNA 1AIPA 5FTNA 2ZUCA 2ZU0C 4B75A 2C96A 3KXLA 2CLDX 2VHUA 1YRBA 1KO8A 2NO6A 4M9SA 2CE2X 1NBMA 3NEJA 3AGPA 3FGNA 1GVNB 3B78A 1W48A 4A0GA 3A36A 1RE0A 1NRJB 2VSOA 3JZAA 4D4MA 1OB2A 1EG7A 2C5LA 4DT1A 3RYTC 4AURA 5EUMA 3IUYA 1KMHB 4RZ2A 5G3ZA 4C7OB 1Q1EA 4OHXA 4GRAA 1CULC 5KDLA 1YQTA 2O8EA 2NO1A 2B8TA 3GLIA 4LJ5A 4BFVA 4Q4HB 1Z6XA 2YHSA 2ZSAA 2QGZA 1FNNA 3DL0A 3GMTA 3FPAA 2RKOA 2OESA 3EA5A 2GF9A 1AQYA 3OAAA 1XXHE 2VRWA 4JBWA 2ZJBA 2XZPA 2NO7A 4BRWA 1OH7A 1XEWX 1XP8A 1MRNA 5L3QA 4G01B 3O8RA 1P5ZB 3RVBA 1Z0IA 4HZUB 2IF2A 4A36A 4TZ6A 1NVUQ 1GUAA 3CX7A 1ZAKA 2JCSA 2ZRBA 3GLIE 4YMSA 4DLWA 4PXAA 2FSHA 4Y0VA 5GJBA 1W46A 1CS4C 4BLTA 1XEFA 2V6IA 3B6EA 2HCJB 1F2UB 2MMGA 3MWLA 3T5DA 4L4UA 1XJCA 2ZJYA 4M1TA 1ZM3A 4Q9LA 2PMKA 4IHQA 5K8LA 2VQSA 3H84A 1UKYA 2JGNA 2PCLA 4P33A 4Y0AA 1G64A 1E79A 2QAJA 2QP4A 3GFTA 3VHXA 3SR0A 3AVTA 2ZE5A 1XFAA 4EUNA 2BKEA 1VYVA 1HH4A 5TARA 1T0HB 3QKUA 2IF0A 4ZCIA 4OK3A 3B8HA 1XEWY 1IXRC 2JLQA 1S8FA 4NYMR 1DARA 3U61B 4HUTA 3IBGA 3BFXA 3SJCA 3OFND 3WHKA 4LOAA 5TMPA 2ZUDA 5EQTA 1JXOA 4AG5A 4BZPA 1KK0A 1M8PA 3O8DA 1MABB 4GPTA 1RZ3A 4WBSA 3SZRA 2XNSA 2VHJA 3BK7A 1MO6A 1YZGA 3AKCA 2C8VA 1FPMA 1UADA 2V4ZA 3TW8B 4DUGA 2VO1A 4ZDKA 2ORWA 5IF9A 2F1IA 3B1WA 4ASUD 1T3LA 2VP9A 4G5GA 4HYYA 3OFNA 4PAMA 2C98A 1FTSA 1US8B 1PUIA 2GAAA 2ZRAA 4KHZA 2HT1A 4Z54A 2GWHA 4DCUA 2WOJA 3BERA 1OIXA 3X1DA 5KSPA 1SVWA 3L8ZA 3A4MA 1G3MA 3B13B 5HKKA 1MV5A 1N6OA 3QPVA 1UJ2A 3THXB 4BRUA 2AHOA 1ZP6A 4KLZA 3U7EB 4LC1A 4QNRA 4AYXA 2AR7A 3C5HA 2ANBA 3MSXA 4I1VA 2GK7A 2F6RA 5CYOA 1M7BA 3EPKA 3RAPR 4C0QC 2WWYA 2GNOA 1I4TD 3UMFA 3TMKA 3QJYA 5JRJA 3NBYC 1XTSA 3PIRA 3T5GA 2CCKA 3PCRB 2Q3FA 4FXPA 4WAUA 2PBRA 1M74A 2ATVA 3T1VA 4D4KA 2ODWA 5TY0A 2ZM5A 3H2YA 1IXZA 3QY0A 4G5OA 1QHHA 3OEHA 4CT4B 5IDVA 4CEIB 3LW8A 2GXAA 3HWSA 3NBZC 2O8DB 3WMFA 1YVDA 4A0HA 4AK9A 1W4BA 1XPOA 1T5LA 2BHRA 2ZSDA 2RGEA 4ACBA 2GEDA 1IJEA 2FFBA 3F3YA 3F8TA 2FN4A 2D2FA 3D8BA 3LAWA 3LX8A 4RD4A 4BFSA 3P26A 4OHVA 2I1VB 2MSDB 5P21A 2OZEA 5A4JA 3OHMA 2JLVA 4OK5A 1DADA 3CZQA 5JBQA 1R2QA 2AXNA 3REFA 5KO2A 1ZC3A 3IPYA 4OJQA 3NVAA 3OESA 4Z51A 1DG3A 1TF5A 3QI2A 1KOFA 1E94E 2HV8A 3BB3A 3PEYA 1T6NA 3ZD7A 2AWOA 3CLVA 3SJZA 3FTQA 2FSFA 1VDZA 3LRPA 1X8LA 2A7QA 3B60A 5LB2A 5FOWA 1Q1BA 2I1QA 2QY9A 2J7KA 3KJGA 1A2BA 2HF9A 3AF1A 1QHGA 3DZDA 3LFUA 4RCYA 2C9OA 5BWMA 721PA 4YDHB 1I2MA 3QKTA 4QJ5A 2Q3HA 2RGXA 3LLMA 4LUCA 1U81A 5FH9A 2AWNA 5K8UA 4QG7A 2B7BA 2RAPA 1YZQA 4HB0A 4DLVA 4V0KA 2GJAA 4YDSA 2GHIA 3A1WA 4HZUA 5FTLA 4ARZB 3PUYA 2J3EA 3AVXA 1KDRA 4HUQA 1N6RA 2K5UA 1I4DD 5EXPA 4QL3A 2IWHA 2C03A 1Q3HA 1V43A 5BXQC 5AJXA 1E9EA 1XJ0A 1G8FA 3QEOA 1E1RD 4LYFA 4Q7LA 4MUBA 3T06B 3WP1B 2G77B 1R6BX 2GETA 4MYCA 3U7GA 5EE9A 3P4XA 2PH1A 4M53A 5C2JB 3R7WB 3PR1A 4A2WA 3AVVA 1J99A 3M4YA 3KB1A 1ZNYA 2RH5A 5EE0A 3U2QA 2EYQA 2YV5A 4HAVA 4EFNA 4Q66C 4IFEA 3EZ7A 3WXMA 5L3QB 3U3KA 2QMEA 2HDNB 3U60B 1GSIA 4Q1EA 2YVUA 5FBWB 2ZIAA 4JLOA 2QPTA 4PZLA 1HV8A 1YR9A 3TIFA 2IEZA 5FFMA 2ZE6A 3UIEA 4JVLA 1KO1A 2HT6A 4DLRA 4WVFA 3GJXC 4YMTA 2NPIA 4GI7A 1G3UA 5L3SA 5IRCD 3R9XA 3DMDA 5BYKA 4AG6A 2R6CA 1OSNA 3EWAA 2ZYVX 1AQUA 4Q7MB 2WWIA 4YQFA 4DLXA 2JLZA 4DIEA 4OHWA 2GCOA 4JT2A 4UXJA 1NMZA 1QHXA 4LJ9A 4RD0A 2QBYA 3KUDA 2IYLD 5C4GB 4DRZA 4XVQA 1W7AA 1JALA 1U8ZA 1EGAA 4BWYA 3KKPA 2X2EA 4DC9A 2NG1A 5AK0A 2PT7A 4FD2A 1JR6A 3C16C 4Q7KA 3DOFA 2WICA 3NDPA 4RY2A 1VCMA 4QFMA 1D2NA 4EQ6B 4A6PA 4PHHA 5LD2C 4PC6A 3RWMB 1OHHA 2G1KA 3JVUA 2Q3MA 1KYIA 1QVRA 2FGJA 2GCPA 2BC9A 3NG1A 4UKDA 4WZ6A 3ZJYA 1RC8A 2EFEB 1EFUA 4LC0A 2D7DA 4O0MA 2A78A 3KDSE 3GLGA 1BMFD 4JSTA 1GNQA 2GF0A 3WMGA 3PXGA 2GZAA 3JVVA 1FUUA 3SOPA 1KJZA 2CL7X 3SDZA 4II7A 3H86A 4QJ3A 1BO6A 2ZI3A 3TSOA 5BW8A 1G8PA 2OCPA 1ZMXA 2V1UA 1XCMA 1L8QA 1G5PA 1P7CA 3BH6A 1U8AA 4EQ6A 2BEJA 1T4GA 2IXEA 4TT3D 3LLUA 1EFCA 1NMYA 1FQKA 3TKLA 4RKFA 1LS6A 2ZETA 1KI9A 1OYWA 4CIDA 1KO7A 2SHKA 2AK3A 1TF2A 4NP6A 3BS4A 4JMPA 5GJCA 2G3YA 1TQ2A 2VIIA 4UXIA 4IDPA 4I81A 3SS8A 3TLXA 3MCAA 1XMJA 2OEPA 4XTCS 1II8B 2KJQA 4MGZR 3TJZA 3ICQB 2RB4A 3LXXA 4PZZA 4TL9A 1ZNXA 3AP1A 4XIGS 3VNUA 1XDBA 4GFDA 1OFTA 4JL8A 2QT0A 3IHLA 1J2JA 1OXTA 3K70D 4EDHA 4F4JA 4EPVA 4C7OA 2J0QA 1Q3TA 2BDTA 4QM6A 2J0SA 3ADCA 1NN0A 4UNQA 5G53C 4A0RA 3E5HA 2ZRMA 2CHGA 3QSYA 1NMXA 3SE0A 4KV9A 4NH0A 1UEJA 4M1OA 3CNOA 4DDTA 5SZJA 1K6MA 4A2PA 5FL7D 1D9ZA 5E95A 4BLQA 5F98A 3QKRA 3EA0A 4TMVA 3TVDA 5BN4A 3U6KA 5GADl 4KVGA 2OE2A 2IS1A 1ZUNB 4UNSA 3PUZA 4XOIA 2GJ8A 2XZLA 5IK2A 3CRMA 4P4UA 4URXR 1FNMA 5FI0B 3SQWA 2PX3A 1KJYA 2QSYA 1KNQA 3QVUA 1H8ED 5DH9A 2GXUA 3MUFA 3N70A 4W5JA 5JS7A 2ODBA 3K0CC 5HZHA 1CJKC 4FMBB 4LBZA 3RWOA 4DDWA 5HKKD 1VHTA 3CWZA 4C30A 4GSYA 1NY5A 2ORIA 2VF7A 1N6KA 3LBIA 3PEWA 4GZMA 4TLEA 3CW2A 1MOZA 1HE1C 2ZRJA 4GP7A 4PANA 3TAHA 1FZQA 3R9WA 2Q0HA 4QGAA 3AUXA 3F5FA 2JJ1D 3B9PA 4IDQA 4JLNA 4OI4A 4CEJB 1Z5ZA 4MH0R 5FTKA 2FSGA 2R6AA 1VTKA 2ZXUA 3NIBA 1QRAA 3UWKA 3QEJA 3ZQJA 2FNAA 1XEXA 1IN8A 4DLYA 4KSBA 4IRUB 3EC1A 1VG1A 1ZYUA 2BIFA 3PUWA 1NKTA 4IJMA 1DAHA 1G7SA 2QENA 1Z6GA 1LS1A 4EPRA 1A2KC 4AKGA 1KI4A 1YZTA 1JJVA 3B1ZA 3DPUA 3GEIA 4BE7B 1A4RA 2O8FB 2X77A 5A5GA 1XNJA 2BJWA 4CYMA 3QPWA 4TYNA 2QAGB 4FCWA 4DKXA 5GVSA 1E98A 2REXB 1KKLA 4GP6A 2YOGA 2ANCA 4NCIA 4GL2A 3TR0A 4M1WA 3CONA 2ONJA 3SFVA 5JLJA 5JECA 1UDWA 2ZITA 1KHTA 1ZC4A 2HF8A 3B85A 5JWRA 3EC2A 1F60A 3NH6A 1W36D 4HEJA 5HTKA 5H1YA 4CT5A 4A6XA 2OXCA 3S1AB 1GOTA 2WIAA 1YR6A 4DBLC 2W2VA 1J8MF 1P73A 3AUYA 4LZZA 4C0KA 5SZIA 4ZKEA 2QORA 3B82A 2B21A 3AVQA 3ZVRA 1KI3A 3DHWC 3W3ZB 3QPUA 3TR5A 4OK6A 3MWKA 2ZI9A 4RFVA 5JEDA 5FPKA 3ZLJA 4H1UA 1ZBDA 4DLTA 2GZDA 3OAAD 1SXJD 1KI6A 2WJYA 1R5NA 3RANA 3RS0A 1W0KD 3IEUA 2LWIA 1BYIA 1RVDA 3K70B 1ONBA 4M1YA 1GRRA 1YR7A 4R9UC 2ZJ2A 4FW9A 3BE4A 4OHYA 1NSFA 2O8BA 1OKKA 3QG1A 4DJTA 1QHHB 4JLKA 1QHIA 1ZIPA 5CYPA 5E7MA 4YXWD 2CMKA 5DI3A 3CF0A 4B47A 3BGWA 1DAGA 1Z6TA 2OBNA 2VEDA 3Q85A 4GOJA 5IK2D 2NOAA 2H16A 1FW6A 5HCNA 4BUJA 2GXSA 2BMJA 5B57C 1N5LA 4Q5IA 2O8FA 5AJYA 4TLAA 1NY6A 4US2R 2QAGA 3HR8A 5JJKA 4UJ5A 2WPDD 3QBVA 3L82B 3RRZA 1KNXA 5E3HA 2G1JA 1ZCBA 4IDHA 3LQRA 1YZLA 2VF8A 2ZE8A 3GJ4A 3CH5A 3RSLA 4BLSA 3A1SA 4NYIR 3OIYA 4D26A 4DSNA 4CGZA 3K0EA 4JYBA 1BMFA 3TUJC 3EARA 1U0LA 5TV2A 1NVXQ 5CK4A 2VL7A 5FOSA 1LW7A 4QRHA 3CX6A 3S1AA 1ZM7A 2A5DA 2V54A 1ZM4A 4D81A 3AVUA 3EPLA 1G291 3KJIA 1EWQA 1AK2A 2P3SA 2P6UA 4B32A 4IVQA 4B76A 1XBTA 1Q0UA 2J41A 4MRVA 1EFRA 2YC4C 3DO6A 2QEQA 1MO5A 3OEEA 3GLHA 4OHZA 2LCFA 1KIMA 5JWHA 4OYHA 4TWZA 1UBGA 3KB2A 2ZE7A 1J7KA 3GLGB 2P0EA 2CVHA 1C4OA 2DWQA 1H8HA 1A82A 4Q4JA 3GLIB 2UZIR 1NBME 3WMEA 1Z0DA 3CRRA 1FOEB 1US8A 1XX6A 4MRNA 5DIFA 1XZPA 4EPTA 2BWJA 2YWFA 3K9GA 4OQNA 3NKVA 2W83A 3MWYW 2XEXA 4JS0A 4Q9JA 4C0JA 4FIDA 2P67A 2QMOA 2PZFA 1W44A 3GLHE 1T8TA 3TUIC 3KJEA 2A5GA 1SHZA 2GJ9A 4LWZA 2YNMA 3CM0A 4D80A 4DDUA 4TMXA 1KK3A 2GVZC 3KXIA 1OE0A 2YWHA 2ZI5A 4MRRA 2IEYA 5AJZA 1VG0B 3GFPA 2WMOB 1E0AA 1COWD 2AKYA 2IYZA 1P3JA 2CCGA 2QL6A 2R9VA 4L15A 2NMVA 1OV4A 2F43B 4EPXA 4NHOA 1KAOA 2F3TA 3EASA 5HZKA 3FKSD 4YLGA 4BFYA 1KGDA 1GILA 1YE8A 2XAUA 2XOKD 5J40A 1UPTA 4TMWA 1XCPA 2QPOA 4TLBA 4DEYA 4QM7A 1SZPA 2P5TB 1E1RA 2ZRKA 4WZBE 4WXPA 2DPXA 5DN6A 2J87A 1DELA 2CNWA 4QOSA 4JVSB 2JASA 4NU0A 1MR3F 3ND9A 4G5SA 1G19A 3TGPA 4U02A 3IHWA 3P27A 2QZ4A 4JIMA 4NBSA 5DLQC 4QKQA 3RHFA 2Z4RA 5FPSA 2KI5A 3JZMA 1U0HC 5F9FA 1DTSA 1E9FA 1I4LD 1SVIA 3I8XA 1E3MA 1JQJC 1XEXB 1U94A 2Z5FA 2C99A 3A4LA 1GL7A 3WYAA 1AJEA 3QNUA 1T5IA 2BKUA 4Q9HA 2QP3A 2AL7A 1JJ7A 2FEOA 3I4LA 1Z28A 1CLUA 3CB4A 2WBLC 1TQ6A 1SXJE 3W6NA 5JJIA 2VP6A 3SN6A 4F4CA 1G3IA 5FL3A 4AC9A 4EFLA 4R2HA 4KI0A 1IN7A 4LYAA 4LBWA 5DO9A 1E2NA 3K0FB 3BOSA 4I1SA 1XMVA 4DEXA 4XSGA 1NG9A 3FVQA 1Q12A 2XJ4A 3PITA 4ERNA 4JLJA 3PEUA 1JNYA 1R0ZA 2UZ3A 3SC3A 2ZVPX 3GEEA 4HLDA 3TBKA 4M8NE 3AB3A 5DYIA 4ARZA 5E4FA 2ZRNA 4C0BA 3QQ5A 3A1UA 1XMIA 1Q1QA 3SBEA 2ODNA 2IWRA 4Q01A 4BECA 4JVMA 2PEZA 1P60A 1XD2B 1ZUHA 4F93B 4PHTA 4DSTA 5IHPA 1ZUIA 2OO7A 5FBLB 2CHQA 1W5TA 1YR8A 4W5WA 3VFDA 1YRAA 5C18A 3I92A 5EE5B 2XSZA 1AGRA 3PENA 3K0FA 1GITA 1EFTA 1TPZA 2X2FA 2G9NA 1SVOA 2FMXA 2VPPA 3IIKA 3TQCA 4Q9KA 1G6OA 5KTYA 1OKKD 4CEHA 2WV9A 1QF9A 5DHFA 4LPKA 3T34A 3SHFA 4PSVA 2X19A 4LRWA 1ODFA 4UNPA 4XWKA 4V03A 4KLNA 2Y8EA 3QG5A 4KYIB 5B58C 5E7IA 2ZPTX 3LBNA 4ZDJA 5CJ2A 4R2IA 3AGQA 5JCZA 1N5JA 2XGJA 1E2GA 2OCBA 3C14C 1NJFA 3OE7D 5AUOB 3CPJB 2GTPA 3R20A 2CVFA 2HXSA 1HTWA 1P75A 2CK3A 2G83A 2L0XA 3THYA 1IM2A 1N6NA 1ZM2A 1P9RA 3BAFA 4IFBA 3KKNA 4JBYA 4NZYA 4ILEA 4D0NA 3QXCA 3ZZTA 4JBXA 1U0JA 4AKIA 2PMDA 2WSSD 3MWJA 4G0NA 4M1SA 1P2VA 4M0LA 1KZGB 3OF5A 4LYHA 2WM9B 3FYHA 2A5YB 4HAXA 4NYMQ 4ZCMA 2Z43A 2GILA 4N0DA 4URVR 3TK1A 3PQCA 1ESNA 1N5IA 2O8EB 3KQUA 4C2UA 1PUJA 3RC8A 4TQAA 2C9YA 2O5VA 4YXWA 1G4UR 1OB5A 4EAQA 2WJVA 5LB4A 1E4VA 1GL9B 1S1MA 1Z06A 1M6NA 2QU8A 3IDQA 4I99A 1WP9A 1KSFX 2I4IA 3KXKA 3NBXX 1S96A 2J0UA 2FX3A 4V0MA 1NF3A 3ZDQA 4A92A 3CRQA 3SQXA 4XWOA 1R4AA 1JAHA 621PA 3FFBA 3GLHB 2ECKA 3IGFA 1XXHA 1ZCAA 2BM1A 3BFKA 5JZVA 2GJSA 3P20A 3PV0A 5J47A 2EWWA 1HURA 5HE9A 4DB2A 2QNRA 5K8IA 3U4QA 2F43A 3FKQA 1G18A 3ETLA 3D7MA 3C4JA 4MKGA 4NYJQ 5FI1B 4R71A 3PEVA 1X86B 4TYWA 4P0TA 3CWQA 5FR2A 3HYRA 3OIUA 4A1FA 4V0ME 2DFTA 3CNNA 2ZEJA 4CF7A 5FOUA 2C9CA 4ZKDA 4DCVA 1FX0A 1GKYA 2J7PA 1XZQA 2W0MA 3FDIA 4XD7D 3CNLA 3FWYA 2YC2C 4E09A 3BWDD 1GG2A 1G3QA 1P2SA 1WRBA 3BB1A 1MT0A 2D7CA 1F2UA 1QG4A 2JLRA 2IC5A 3NH9A 1S9DA 3EZFA 4LGMA 5FBQB 2OCAA 3KQKA 1F2TA 4LHWA 4LY6A 1HYQA 4URUR 1SVLA 5FUXA 1KDTA 4LV5B 1IN4A 2JAQA 4BFUA 1S3SA 3CPEA 2FOLA 4AYTA 1II8A 3X1WA 1KI8A 1DG1G 1U8YA 1OFHA 3QF4A 4V0LA 4U5XA 3DKPA 4MITA 1JAIA 5DGXA 5EP4A 5CM8B 4KU4A 1CJVC 1IY0A 3KJHA 5G41A 5FUWA 3D6TB 1SXJB 1LNZA 2IYXA 3SU8A 3RRNA 1G3RA 1FMLA 5JJLA 2ZS8A 4JL5A 4MYHA 2B7CA 4N3NA 4NMMA 4O2RA 4IVRA 3U6BA 4P4SB 3QBTA 1W36B 4Z8XA 1NJGA 1L2TA 2F9LA 3VKGA 2Q9CA 2JJ1A 4KXFB 2CK3D 5A0FA 3NHBA 2Q21A 2QMUA 3W5IA 3THXA 3C5CA 5DE3A 2ZI7A 5JRZA 2A2ZA 4Q21A 2QE7D 1Q57A 2AX4A 2BMFA 4PQYA 5DISB 4HDCA 3UG6A 1U2RA 2WSSA 2EQBA 5TDHA 2IHYA 5CIQA 4L16A 4XVUA 2FFHA 4MYTA 2CJWA 2KSQA 1XJQA 4GOXA 1JXMA 2UVQA 4JSYA 1Q44A 3FE2A 4MUAA 3UMRA 5C1BA 5AJVB 1Q20A 1K5DA 4RZUA 5JEEA 2IS4A 2AFHE 1T3SA 2NGRA 3A58B 3H0KA 1R0WA 2F9MA 2HEIA 3GJ7A 3ZIAA 2VYFA 4A8JB 4LSGA 1ZNWA 5TB5A 2IYWA 2N1BA 5C4MA 4GMXA 1FP7A 4YONB 2ZSFA 4Z1MD 4OJKA 3RS4A 1ZVQA 2ZJ8A 2FPLA 1R10A 5JS8A 3GLFB 1DAFA 1NSTA 2VP5A 2QP9X 4Q1CA 1Z2CA 4J0QA 4B2PA 2XSZD 1KI7A 4ABYA 3B1VA 4DLZA 4ZDIA 2J9RA 2XB2A 5H70A 2W58A 5EXSA 3I62A 4TYQA 1NBMD 1Z0KA 3AKDA 4K46A 5JFGA 3CUEF 4JKIA 3TH5A 4E03A 1VG9B 3IO3A 2JLUA 1OHHD 2OM2A 2FZLA 1DAKA 3RS3A 1DAIA 4C0HA 1N0VC 4RFSB 4BLRA 1W0JD 4PPGA 4PAQA 3ADBA 1PJRA 5M04A 1TMKA 4B34A 2FJUA 3GPLA 1PLLA 3A4NA 1VMAA 4XWAA 1AM4D 4OQXA 1J90A 2JATA 4Q4JB 4D0LB 4W5HA 3LVRE 2ZSEA 2HCBA 1RPZA 1H65A 2FEMA 3MLEA 4HAYA 3SNHA 1MABA 1UKEA 1UDXA 2ZAOA 3VR3A 3GCGA 2B8WA 1G4AE 1F48A 3CBQA 4MKIA 1E0JA 4TTQA 1CP2A 1EWRA 4RD6A 4D0GA 4Q1BA 2XXAB 1P72A 2EFDB 2QTHA 3OIVA 1KSHA 3N2IA 2FH5B 2TMKA 4A0FA 4TTRA 4DIDA 1CJTC 4GDFA 4AY2A 4D2IA 1KMHA 3GJ5A 3NC0C 1JPNA 4TL8A 3NEYA 4IOJA 1OFIA 1G16A 2NO9A 3ND8A 2VHTA 4KODA 1NKSA 3MJRA 3GJ0A 5HCIA 1II0A 3TQFA 1X6VA 3V4FA 1D8TA 1OYYA 1KI6B 1Q22A 3ZS9A 1G17A 1Z83A 5CB6A 3C7KA 4HLQB 4Q00A 3SFZA 3EPHA 4HAWA 3TVTA 3U3OA 3T61A 3AVWA 5D3QA 5BN3A 3FKSA 2JLYA 3GD7A 4B71A 2PL3A 3WRXC 4L5BA 2GA8A 2BBOA 4YC7A 3QOFA 3E2IA 1T91A 2R6GA 4QNMA 3O47A 1G8HA 1T9HA 2W0SA 5CDFA 2IUTA 4KFTA 4Q4AA 4C4PA 2Q6TA 1W4RA 4DCNA 3ZVMA 5KSZA 1UBCA 5FUVA 1G8GA 5DN6D 3IILA 1KY2A 3MJHA 4R7ZA 3KQHA 4NKRA 3IKJA 1NI3A 2PLRA 5AUNB 221PA 4FMCB 4RD3A 3GEHA 2F7SA 1G21E 2J0UB 3B2EA 4KFSA 4OQFA 3K9NA 1E99A 3SYLA 3G82C 1CJMA 1ZRHA 1RW4A 5SZHB 4AKEA 4P32A 2GEUA 5CB8A 4DLUA 3EW9A 4W7SA 3EIQA 2BBSA 3RDPA 5CDFE 1COWA 3EIHA 2WAXA 1CRPA 3VKWA 4LI0A 1NN3A 3D3QA 1W1WA 1IHUA 2YZ2A 4FMCF 1H8HD 2EVWX 3A1TA 4DSOA 4F92B 1SKYB 1S4QA 3W9YA 2J46A 1NLFA 4CEIA 1KO4A 2J0VA 2IS2A 3FMOB 2CBZA 3GJ3A 1NP6A 1S3GA 4X8HA 1YJ5A 2ORVA 3UATA 3VR1A 2W6IA 5KU1A 4LYJA 1HY3A 2VP2A 4BGDA 3VNVA 1OXSC 4ZI2A 4BFTA 4M9ZA 4OQMA 2IYTA 4BFWA 1G5TA 4C2TA 3REGA 2HJVA 4R98A 3WBJA 2OAP1 4HLCA 2C95A 2PEYA 1JQLB 2D3WA 1AKYA 1CR1A 4HATA 4UQOA 5DHAA 1BYUA 3K0SA 4B6FA 2J45A 4L9SA 2ZYUX 2HLDA 2EYUA 2Z6VA 3WY9A 1ANKA 1TQDA 4G5RA 3ZVLA 5JSZB 1Z0AA 2FU5C 3AVPA 3QF4B 1NVVQ 4PQFA 3VHLB 2WIBA 3RC3A 1ZJ6A 3KKQA 1JI0A 1TUIA 5H68A 3M6AA 4XH9B 3T1TA 3HP1A 3R9IA 1RKBA 4PQRA 3J81k 3V9PA 3GLGE 2E87A 3I3SR 1M34E 4X8OA 1P9WA 5CM9C 2Q9BA 4Q1DA 2F1JA 1PV4A 5UKDA 2H1LA 4GOKA 4PO8A 4FCVA 4B3FX 3TE6A 1NLYA 3BFVA 5HR5A 5FPYA 4V02A 4A8JC 3CX8A 5KNCA 2R65A 2BEKA 2MSEB 3HR7A 3AH8A 3IIMA 4LHXA 2V7QD 5JSZA 3CRVA 1LF5A 1JEEA 1N3BA 3PFIA 3RS2A 1KDOA 2LKDA 3IQXA 2R8RA 4QGFA 3HU3A 3M1IA 1G5RA 4ZIRB 1SKYE 2IT1A 4B73A 2CLCX 1F3OA 4URYR 4IDOA 2ZROA 3D31A 2WAYA 4B3XA 1QVAA 1VYUA 4ZV4A 1CRQA 2ZYTX 3K09A 3SJAA 4MA4A 2IUUA 1M2OB 4OI0A 2H17A 1R8SA 1WXQA 3PJRA 1JPJA 4X8MA 1SGWA 5FOTA 2DWOA 2VHQA 3I32A 3TRFA 3UANA 3VMFA 3EZ6A 2D06A 4LHVA 3FOZA 1BH2A 1YZKA 3E1SA 1RRCA 1E96A 3X2SA 1KDPA 4LK2A 2R6FA 4KVAA 3QVVA 4B74A 2O0JA 2JDID 3BB4A 1G7RA 1T0JB 2XOKA 1FP6A 1N5KA 4FMDF 3VX3A 1OH6A 2F1RA 2WZQA 1Z29A 3HPQA 3X1YA 4YMUA 1E32A 4NYJR 3K09C 1ZU5A 3Q8XB 4ACAA 2YWEA 1IN5A 1YKSA 4US0R 1AS0A 4TSFD 2XJ9A 1RRGA 2ZJ5A 3L43A 1R5OA 3WRYC 1XU4A 2ZVQX 4PSAA 1R7RA 1WE2A 1XTQA 2WJJA 4QC2A 2ZQ5A 5CIWA 1ZINA 3U3RA 2EFGA 3MD0A 2C77A 2KE5A 1W36C 4BASA 3Q72A 3Q9LA 4PFSA 1DS6A 1GL6A 1LVGA 3DVLA 1OJLA 3L0IB 1Z63A 1KI1A 1TU3A 1X1SA 2WWWA 1NVWQ 1TL7C 1OT3A 2B6HA 2J59A 1E0KA 3ONWA 4TL6A 5GVRA 2O8BB 1E79D 2PT5A 3HDTA 3H4MA 2JEOA 3RABA 3I5YA 2P6RA 3F0TA 4HUQB 4XD7A 5EXTA 1ZW6A 2V1XA 2CEAA 2DFLA 2X1VA 1A5TA 5EP3A 1BS1A 1S0UA 5FOVA 4ASUA 2BOVA 4LCBA 5L3SB 2QRNA 1W0JA 3ECCA 3G5UA 5JHHB 1CR4A 3UG7A 3C15C 3O8CA 1MO3A 3KX2A 3L0PA 1CJUC 2GESA 2VSXA 1K8RA 2CL0X 1DAEA 4E07A 1XCGB 3N5CA 1NG1A 2GRJA 4DT1B 2PLFA 2C2HA 4A9AA 2Q9AA 1IQPA 4BFZA 1Z47A 1GKUB 2IYVA 4DSUA 4JLVA 1HE8B 3ZS8A 2CCJA 3T15A 6Q21A 1F5NA 1CBUA 5G3YA 4MDEA 1UBFA 1L7VC 4IEEA 1O87A 3A37A 2H8KA 2X8AA 3M0EA 2PCJA 1PZNA 2YKGA 1QZXA 1GAJA 3MAAC 1CTQA 1X8JA 4FWTA 1VCNA 2J1LA 1N6IA 2KBEA 3L0OA 1ZD1A 3OEHD 1Z08A 1QBKC 5DNYB 4QBGB 2IYQA 2DCUA 1QDEA 3CF2A 2YOFA 2BMEA 4DLSA 3GFOA 1E9RA 1P2UA 3VR4A 3EX7C 4PTLA 1FL9A 3HPRA 5FTMA 4FINA 1YZNA 2JIZA 2IW3A 5FL7A 3KFVA 1U99A 2QBYB 2O8CA 4WW0A 4EKDA 2CJWB 3O8BA 4RD2A 3A6PC 1QHSA 3NTUA 2QI9C 3LWNA 3SBDA 4A15A 1W49A 3Q3JB 1NIJA 5EZ5A 1XWIA 2FE4A 2MSCB 2C78A 5AWFC 2CXXA 1EXMA 3PUXA 3U3MA 3CR8A 3U5ZB 2JLSA 3FHOA 1E2QA 1KJWA 2ZTSA 2DFNA 2OFWA 3ASZA 4XTRA 1AS3A 3VR6A 4U00A 4B2IA 4B43A 3TSZA 2ASEA 2OHFA 2ZRIA 2W2XA 1P9NA 3N2EA 1G6HA 5IT5A 4LJ4A 4KBGA 3KKMA 2XZOA 1Z0JA 1OXXK 4ZCLA 3WBKA 5BQ5A 3BH0A 1LV7A 3GP8A 2NIPA 4CW7A 4POAA 1I2DA 4B33A 5J4KA 3GJ6A 5ANRB 1RJ9A 1N25A 3DEFA 5FR1A 3K70C 3NXSA 1LF0A 2A30A 2ZI6A 3LH5A 1GIAA 1GRQA 1KO5A 4QGHA 4JT4A 2A3RA 1CU1A 3I1FA 5LBIA 1FX0B 1RRPA 3TAUA 3VQTA 1NLZA 2GDJA 2NTYC 4RVCA 1F2TB 1YU9A 2XITA 3BJIC 3CPHA 2WSMA 1IJFA 2EW1A 2ODEA 2VTKA 3KTAB 2FF7A 4B3CA 1VYTA 3U44B 3V00A 5J5CA 2ZRCA 1EFHA 1QHNA 1CEEA 1D2MA 1N0UA 1OIWA 1JR3A 1RJ9B 1W4AA 2ZYWX 2GCNA 4MRSA 3T35A 5JMTA 1B23P 1G7TA 1TADA 4WZAE 3NC1C 3LNCA 3GLFE 3U7FB 1XPUA 2JJ2D 1TEVA 3FB4A 2QTVB 4KSCA 2J7PD 4Q4HA 5KOYA 2F55A 2ZS7A 1FQJA 3OZXA 1P62B 4LV6A 2ZRHA 1S9HA 3K0AB 3T1OA 4D6PA 4IXNA 2VBCA 1JR3E 1RRFA 4OKSA 3QKRB 4CDGA 1Z8FA 3NWJA 4IOMA 4IVPA 2IXFA 4N0EA 2OCYC 1OH5A 2R6DA 5C46F 2VSFA 3K9LA 4M2LA 1IBRA 5J4LA 4AD8A 4DB4A 4B35A 4G5QA 4IOLA 3OIWA 3LW7A 1XD2A 1WA5A 2PZEA 1U90A 1XXHB 1N2CE 1NL3A 2FA9A 4TMKA 4OI2A 4BLOA 2D2EA 5D3MA 4Q1AA 1XPRA 4ESVA 2JDIA 4LBYA 4GT1A 2ZS9A 3VR5A 3VAAA 3ZGXA 4M9XA 4P4TA 4TLDA 1Z6AA 3SYNA 4LX0A 5AR1A 4DCSA 3ZD6A 3BBPA 4MGKR 2FDCA 2IX3A 1CR0A 2ZJAA 5LD2B 5KSOA 4QHYA 2QG6A 4V0OA 2A5JA 5L8VA 2YYZA 3RS5A 3EZ9A 2H57A 2IS6A 3BD9A 4C0LA 1PLJA 2ZI4A 3I73A 3FMPB 2MMCA 3OE7A 3L0SA 3MGCA 4PX9A 2W6JA 2O52A 4PO9A 5KUTA 4JKYA 4Q7JB 4JL6A 4DWJA 5F3WB 1KK1A 3AF2A 2RMKA 4A4DA 4TZ0A 2V7QA 2QROA 4PPNA 1NN1A 1HA3A 2JLWA 1G20E 3W5JA 3CF6R 2LKCA 2GKSA 2CHVA 2O0KA 1VCIA 2WHXA 4NONA 1X8KA 2RGAA 3A1VA 4PC1A 4F4IA 4DHEA 4JLBA 3UKDA 4ON9A 2GAOA 2FSIA 2CE7A 1W4CA 1OXVA 3W8NA 2WJGA 1HQCA 4K81B 4PC7A 1U9IC 4I1OA 1EFRD 4IOKA 4KFRA 4O3MA 3P1JA 2OXRA 5CLQA 2QQ0A 4M4SA 1OIVA 3C8UA 3CRW1 1OFUX 3CO5A 3IO5A 3THWB 3MMPA 4B48A 2FPKA 5KNBA 3DZ8A 2RHMA 2GVDC 3FMFA 2QT1A 4NYIQ 2OLJA 1UAAA 1F6BA 2XTZA 3B7GA 3I61A 5DSZA 5CLLA 4DDVA 4KCGA 1AS2A 1OH8A 4JLAA 2RHDA 4MRPA 4OQLA 3AM1A 4KJZA 4KITB 1J8YF 1B0UA 1EK0A 4UJ3A 1W5SA 2IA5A 1E9BA 2WKRA 4HZIA 5HPYB 1U9IA 1D6JA 3LX5A 3K8YA 2AKAB 4RCZA 1ZNZA 3ASYA 2XB4A 3IBYA 3QE0A 3SYKA 4JZKA 1E2IA 4DXAA 4M21A 1DEKA 2QMHA 2W6ID 2W00A 5TXGA 3SEAA 4C0AC 4QXAA 3V4RA 2O8DA 4AYWA 2QUZA 1Q1ZA 4ESHA 3T1QA 4G3XA 4BZQA 1R5BA 2ZRGA 4Q1FA 4PSKA 4NDZA 3PG5A 4CEHB 3IPXA 4BEJA 4LJYA 2ZU6A 1RFLA 1OLOA 2IL1A 2ZJOA 2FG5A 821PA 4CEJA 2IHBA 2G0TA 1AZTA 2P2LA 1KI2A 3BC1A 3RNLA 3QF7A 2Z0MA 5J4HA 2P65A 4XJXA 1VECA 2N42A 1Z6YA 1Y3AA 4HDQB 1WQ1R 2G0NA 4GZLA 4LJ8A 3T12A 1NVVR 5KDDA 4N1AA 1XMSA 3KZ1E 3R8FA 3EZ2A 2YJTD 2A9KA 3LO5A 4URZR 2IYRA 3UPUA 2GXQA 3LBHA 4G1UC 1TNDA 4KAXA 4P3YA 4US1R 2ZR7A 4RSGA 1MH1A 2JLXA 1XF9A 1KY3A 1QHYA 5DYGA 2XTNA 1FFHA 4NCHA 4NCNA 3NHAA 2GCOB 4GMDA 3NDBB 2HXYA 1WDTA 3UK6A 1WBDA 2OFOA 1UFQA 3W8RA 1PVOA 4F38A 4DCTA 1JECA 4OL0A 2WOOA 2VP4A 2WKQA 3K0CA 4IDNA 2GBLA 1QG2A 1GFIA 4JLPA 2W2TA 1KAGA 1G9XA 3K0AA 4K8OA 3AF4A 2WVJA 1NN5A 3TUZC 2P5SA 2D74A 2BM0A 5JCPA 2BMDA 4O2LA 1DO0A 2GK6A 4LV8B 1YZUA 3PUVA 5GJVC 1W2HA 2WWFA 3FMIA 4BQSA 3W6PA 4H9GA 1WMSA 2ZRLA 1E2LA 2QGNA 2OLKA 1P61B 2RGNA 4QHTA 1Z3IX 4A2QA 1N6PA 1ESMA 1T8UA 3SHWA 4D25A 1DO2A 1YHNA 4BFXA 2GBLC 1FUKA 4DVGA 1CF4A 1G7CA 1C9KA 2ZANA 3QXJA 4PZYA 4PC3A 1GTVA 4WXRA 3AEZA 5B64A 121PA 1UBEA 4KO8A 5FTJA 5AJWA 3KQNA 4M1MA 2FPMA 4IKEA 1HEIA 4NCJA 3IIJA 4BEBA 1E2DA 2IXGA 2WJHA 5FPTA 3HJNA 1XD8A 2R2AA 1XTRA 4Z1MA 1DOAA 5E7JA 1RYHA 1IY2A 2RGNC 3KL4A 1Z22A 4ZO4A 1XTIA 4FCTA 1IAQA 1WF3A 1JR3D 4M9QA 4ZIRA 1GWNA 3VX4A 5FPHA 1UM8A 4M22A 4Q18A 3RRMA 1LFDB 1TF7A 4NE2A 2ZREA 4FWIB 3OEED 3I72A 4D4LA 3KFXA 1S1CA 2QTFA 2Z83A 1II9A 2VH5R 2VA8A 5KDOA 2C04A 4NPHA 3TSWA 3WHLA 2BV3A 4EFMA 2E1RA 1CKEA 2V3CC 2NO0A 5CJPA 1PLKA 2V9PA 3QXXA 1ETUA 3NBFA 2V55B 4UNNA 1H8EA 5EP2A 1SXJC 2WWHA 1WB9A 2BBWA 2OBMA 2WWXA 2ZUBA 2G88A 1N6HA 3MG9A 1N0WA 4HI0E 1Z07A 4E5UA 1IY1A 3QIAA 4ZI3A 3VU9A 3THYB 1XB2A 4PO1A 3DOEA 1KK2A 3FHCB 4DZZA 3KQLA 3AQ4A 4L8GA 2ZRFA 2E9SA 1IONA 2XXAA 1VPLA 2ZAMA 3R8CA 3AKEA 2YWGA 1M7HA 4HB4A 4XSHA 1HT2E 2R44A 3RLFA 4CVNA 2QE7A 1W0KA 5TVKA 3WYGA 1VIYA 5EE3A 1SXJA 4B6EA 4PHGA 4WIAA 4Q02A 1JBKA 2OT3B 1AZSC 4AWXA 2GZHA 2DB3A 5EP1A 1U98A 4NCKA 1R8QA 4U7DA 1RYFA 3THOA 1TAGA 1X3SA 1XD9A 4TMTA 1Y63A 2FFAA 1V5WA 2OG2A 3LXRA 2QAGC 1GNRA 3DMNA 5LDDC 1XTJA 1WBBA 4BPBA 3L2OB 3IQWA 1CXZA 2JIZD 3IEVA 5L3RA 3B5JA 4PHFA 1XRJA 4P31A 3TNFA 3SJBA 1AN0A 1E1QD 1TQ4A 3QKSB 5SZKB 1E69A 3E70C 1GKIA 4F7WA 1CIPA 4B3BA 5FBRB 4EPWA 1E9CA 2F1HA 3DDCA 2ZRDA 4H1VA 2AFIE 2ZRPA 4Q47A 4S2EA 2OBLA 2YOHA 3Q5EA 1KMQA 2G6BA 4QBFA 2GEVA 3VTKA 2ERYA 2PZGA 3RSOA 3ZH9B 4DUGD 5AUPB 5JHGB 4BLPA 1MRSA 2DHRA 4RZXA 3CZPA 3KUCA 3KTAA 1ELOA 3W90A 3ADDA 4QJ4A 2AN9A 1KKMA 1O3YA 3H1TA 3W6OA 3CIOA 2YINC 3PVSA 3U44A 4JLMA 1EX6A 2ZJZA 1GNPA 2DY1A 1TU4A 3LQQA 4AI6A 4NTZA 5KHOC 3QENA 3AP2A 2DYKA 1E2FA 3ZZ0A 1HT1E 2H5EA 1NNEA 2WKPA 3VR2A 5KSYA 1E2MA 4Q4LA 1SKQA 2WJIA 1E2EA 4MGYR 4TN1A 4MGIR 4Q19A 4I4LA 5F9HA 4TSFA 3LDAA 1SVMA 4V0NA 3HYTA 5EE1A 2D62A 3GQBA 1DVRA 2AK2A 4MQBA 3UMSA 1E2PA 4LPSA 3AF3A 4OBEA 5CK5A 3VKHA 3HU2A 1ZD8A 4UNRA 2FFQA 4HLUC 1UKVY 1D9XA 2QQEA 2QN6A 3LY5A 1VIAA 3BORA 1E1QA 4C0SA 2P6NA 4HB2A 3FHTA 5BN5A 1D2EA 1NIPA 3SI7A 4TL7A 2QA5A 1FMJA 5B30A 4JLDA 2JJ8A 4YMWA 4WA7A 5EXXA 3BRWD 1J70A 4CZ2A 8OHMA 1WCV1 2DBYA 3A8TA 4WOPA 4TQ9A 4PAOA 5HE8A 4D4JA 5KPDA 2VHCA 3G0HA 4KFUA 3WNCA 1AGPA 1S2MA 4HLUA 2RCNA 4TTPA 3R7WA 4A82A 2OUKA 2VLIA 5KPJA 2REOA 3K1JA 3QKSA 2JA1A 4NL4H 3WNBA 5K8TA 4B3DA 3QXSA 5DI3B 1E6CA 1M7GA 4LBVA 3EWSA 4FN5A 3P4YA 1IN6A 3EPJA 4GBMA 2FZ4A 2XTMA 4LJ7A 3ADKA 3ZYCA 1R0XA 1C1YA 2ATXA 2IK8A 1E2JA 3LVQE 1ZD9A 3K9HA 2F3RA 3B9QA 2BVNA 4LDJA 3DKVA 5EJEA 2RGBA 2QSZA 2PJRA 3AP3A
chains in the Genus database with same CATH superfamily
2O5RA 3GVPA 4ZZ3A 1DHRA 1M67A 2B92A 5J4VA 1WDMA 4IIBA 2Z3VA 2FRDA 5KYKA 5EXDA 5AQ1A 1NPDA 3HBNA 2WTUA 1Y7TA 3DM9B 1R4ZA 2NQTA 1LKZA 4HEA6 4PHCA 4LHZA 3EY4A 3L5OA 3HNPA 4IDAA 521PA 1EM8B 1E2KA 2H18A 4KQCA 4Z0HO 3ZBPA 4BLVA 4WJLA 1UKBA 3B8EA 4V1CI 4F11A 1B6RA 1VKOA 3RVPA 4M9RA 2ODAA 4TLCA 4RJLA 4ZDWA 1R6DA 3AV0B 3RFCA 4NH4A 5DLYA 1WDKA 1PDOA 2RGGA 1BA2A 1UKCA 2P9CA 2WP0A 1ENYA 1WD5A 3LV8A 4K6HA 4OP3A 4TVBA 3JU3A 1AQLA 2ZR9A 2ZZKA 3M1LA 5H9VA 3GFFA 1FDRA 2YXBA 2HFKA 3MUEA 4N8DA 2OAQ1 3PI6A 3SHQA 2AXPA 1Y4UA 1X7GA 3BTUA 5L3VA 1Z15A 3QWIA 4RKEA 1E2HA 4JSRA 3MTEA 4LNUA 4UUPA 3I9OA 2ZB2A 2LE0A 1UOPA 2BFEB 2JLCA 3L4BA 3SXJA 4X9XA 1ZR2A 4NAUA 2JGDB 4ZVSA 3KHTA 3O2QB 3AK4A 1P74A 1GAEO 3PBKA 2AG6A 4RKWA 2OPHA 4BP1A 4XQ0A 4D5EA 3IP3A 5C80A 4RSHA 2XE8A 1LBTA 3S1SA 1OXUA 1JYSA 3AXTA 1UF9A 4OOEA 3U3JA 4WVLA 2CDNA 1HI9A 1FTNA 2TECE 3D1VA 3DLCA 4M1EA 9ABPA 3CH7A 4HQOA 3T3EA 5K8LA 1AB6A 3LGAA 4KPUB 3VRHA 1BIFA 3R41A 2FKAA 3A6JA 4JI1B 2QTGA 4LTDA 4B2LA 3P32A 1Q19A 3TRKA 3CR7A 3WGIA 4P5DA 4C7MA 4OLFA 3OPNA 4RH0A 3T5TA 4ZAZA 2EFCB 3OP1A 1CR2A 5DT2A 2PV7A 5CVCA 1XTBA 4ROSA 4ZK2A 1ZK1A 5F2NA 1UKZA 2W6JD 1Q0LA 4B7UA 2XVZA 3T3DA 2QW0X 3LIIA 4KMRA 3STXA 1VCOA 3JQAD 3RG8A 5IMSA 4O4IB 3ZX4A 1S7GA 3UYKA 2FPIA 4DBZA 3OLXA 1CUUA 1NRXA 2B9EA 2HGZA 3NEPX 4ETIA 1PQPA 1JA1A 5CCEA 4JOCA 5D3MB 5TQJA 4TS1A 3AETB 1N6LA 2BCGY 4QBHA 5DTJA 2NM0A 3R6DA 3CW9A 2FTKE 3SIPA 4IEIA 2D4HA 2Z58A 3EAFA 2WC1A 1GZSA 1T35A 2ZWOA 1UIRA 2HA0A 5LR6A 4XIFA 5D8DA 4MLDA 3RIXA 3DLAA 3IKMB 1R66A 1MKYA 4LF7B 2WJAA 4KEAA 1FP4B 4NY1A 4P7KA 5G40A 4UMFA 5C5IA 3N6VA 1E4YA 1JB1A 3KIPA 2EJBA 2V7XA 1Q6ZA 3IESA 2VAPA 5JNSA 1USVA 4CBVA 5ULLA 1PGJA 4BDSA 2BGRA 4YRMA 4BNDB 1GCGA 3GJ8A 4FB4A 3H16A 3ORHA 4UZFA 1LB1B 1IXSB 1T3GA 3PNBA 2REQA 3GGJA 3PPXA 4RK1A 5KCZA 1X1RA 1EX7A 3ZWOA 2RBEA 1Y4DE 3C4QA 3OZTA 3VBEA 4DV0B 1XTUA 3WL8A 2UKDA 2FW8A 3DPIA 4WCVA 4B46A 2XX3A 1GP2A 4H7JA 3X1ZA 3LYHA 2XNDA 5KNDA 1Q15A 3F6CA 3K2EA 5EUQB 1MX3A 3EBOA 3WV4A 1KJ9A 4E94A 4KXMA 4OREX 2OSBA 4MUHA 1NI5A 2X4GA 3Q7QA 3T3PB 2BN4A 2GHTA 4LNHA 4MYUA 2FV8A 3DV0B 1F8UA 4K9SA 1R50A 2KBFA 3TOXA 1G42A 3EVBA 1Z0FA 2NAFA 4WKBA 1BKDR 1ZXXA 4UUNA 1EESA 3IOCA 5F2EA 1LX6A 1SULA 2J5BA 3EFOB 5A3QA 5KQSA 2Z8ZA 4MKHA 4CJXA 3NHYA 4WACA 2VDUE 4TV8A 4ZTZB 2PGXA 3R3WA 1M1YE 4NU8X 3ZQ6A 1KU6A 1F14A 3HVUA 4TXNA 1W47A 5KS2A 2ZB8A 1UBMS 3A9RA 5T4EA 4UHJA 2GJKA 1YCHA 3FGZA 2IBMA 2DR3A 3K16A 3NTXA 3VPBA 2FWMX 1NJSA 1KBZA 1TUBB 3N8NA 5LZ5A 3M3DA 3LKVA 2C3PA 3R3SA 4OHMA 3DVAA 2YFQA 1A9ZA 1LBIA 1SCDA 2G0AA 2XGSA 3I9MA 4PYLA 4V3CA 1K3FA 2ARKA 3CUTA 2JIBA 3ETGA 2DX7A 5CITA 2QOEA 2XZOA 3Q0TA 4FT4A 4ZANA 1J8VA 1K63A 4BO6A 4PC2A 2WB2A 1K5GA 1ST2A 1W87A 3N2KA 1JFLA 4LHSA 3OQPA 4UEKA 3NTLA 4JT9A 1CY1A 1ZI9A 1YL5A 3DM5A 3EXIA 2AOUA 4F4DA 2IYSA 3EXHB 2KHZA 1T3HA 2OCKA 4Y8VA 1WPQA 4ITRC 3U5TA 2ZR0A 2IHKA 2IYUA 4GP9A 5TS3A 1XC7A 4A8JA 1H4SA 1VGVA 3BG5A 1M0SA 2V3WA 2RGDA 3CTMA 4JVNA 3FFAA 4PFKA 3KXLA 1K7EB 1V7CA 1JWBB 2OO5C 1GTZA 1W34A 2CE2X 3C6BA 3V2UA 3LT1A 2OORC 1ODJA 1ATIA 3ENKA 1RS0A 1FVFA 4EWLA 3B78A 2BZ1A 4CCWA 3JZAA 1Q74A 3H75A 3ESCA 3GW8A 4M9CA 4BGUA 1X7ZA 4AN1A 2DRIA 4RY9A 4JI5B 2C5LA 1ECBA 3U44B 4F3CA 4ISBA 4KKXB 2IYFA 4RZ2A 1QGUA 5G3ZA 4Z49A 5EMKA 4FXOA 4K9NA 5EIXA 1U7OA 3HI4A 3ZLTA 4BKOA 5LQCA 1EFAA 2XOXA 4WXEA 3U49A 2O8EA 4UE6A 1QO0D 4W8GA 2P30A 2ZBUA 2WAMA 5ALRA 5KCMA 4WE3A 3ER9A 2PSDA 1XVTA 1IXYA 3R7DA 2R3SA 3QFRA 3GMTA 3BEDA 4Q37A 1ESEA 4GBJA 4DG9A 2GKOA 1M0WA 5BN4B 4MUIA 2RK6A 1XXHE 2ZJBA 2VDWA 1G8MA 1IY8A 3SX4A 3R7FA 1FUIA 1XEWX 2JZOA 1GD1O 4X7RA 1RHQA 3JQ9C 1P4RA 2HU2A 4G01B 5CTAA 4NE9A 3O8RA 1GLGA 1QC5A 3C0KA 4C1BA 5CFQA 3OLCX 3IEXA 4A36A 2QZ9A 5B3JA 5CAEB 5BR8B 4PXAA 3RBVA 5IZCC 1IL0A 5KBYA 3V8MA 1XEFA 4J16C 3RARA 2BFDB 3UM9A 3N59A 1QUEA 1RM5A 1IBMB 2HCJB 1VJ5A 4M1TA 3TQHA 4HK4A 3UFXB 3A27A 3O8QB 2G07A 2PMKA 4IHQA 3F1LA 1UC5B 2I4NA 2VQSA 2XIQA 3KR9A 2HWUA 2PH5A 2N9UA 1ZD3A 3G8DA 3D1LA 3H83A 4M7RA 3I2YX 4Y2JA 2YXDA 3VHXA 3T3OA 2O2HA 3SR0A 1T9AA 4IPTA 5CHEA 4KH0A 1XFAA 2XY4A 2E4XA 4IEFB 4IKOA 4D8YA 5KTRA 1K2VN 2BKEA 2WM3A 3ZWVA 4MTLA 1BKSB 1UBRS 2PR2A 3H7AA 3W79A 2GPYA 4PRLA 5H81A 3ZGZA 2C2MA 1CLEA 1IXRC 1S8FA 2GEBA 3E3LA 3IV7A 1DARA 1GYQA 3FSEA 4PZAA 1ZJ5A 1XDGA 4H3HB 2CVOA 3PFHA 3WHKA 2QVXX 4XDZA 5KQMA 2PSFA 1SIOA 3FR7A 5DEIA 2Q4RA 1E89A 3DV2A 4LC9A 3WZ2A 4GR5A 1DKQA 5LQJA 3O8DA 4KN6A 2P9FA 4GPTA 1DWQA 4WBSA 4P0QB 2XNSA 1R74A 1QGUB 3AKCA 2C8VA 1UADA 4DUGA 1J9ZA 2OZKA 1T29A 4ME6A 1T5BA 1C1XB 2JI4A 2GTIA 2R1TB 5LU8A 1SBHA 5FAXA 5LQRA 1JEYA 4IILA 1E61A 1VKHA 3ZU5A 4HCJA 3WDLA 5FWNA 4Y0NA 4O4LB 3WA6A 4PAMA 1TGYA 2PWBA 4U9IS 2IPLA 3ZDEA 3FFTA 2GLXA 4EHDA 3QFTA 3PZRA 2ZRAA 4KHZA 4CQLA 4CTJA 4R0MA 2IHVA 3INRA 3W6ZA 3P2KA 1UUFA 3ZCUA 3CLUC 5I9TA 1EVLA 1BHQ1 1JPVA 3RK0A 1SA0B 1GV0A 1JG1A 1QSGA 1KOLA 3FBGA 3JD4A 1UT5A 3FOBA 3A2MA 2P7HA 1XALA 5LWHA 1LI5A 2HB6A 3A4MA 3B13B 1XTZA 4L0DA 4I14A 4LY9A 4QXMA 4BEVA 3THXB 1JLSA 2VK2A 2HMWA 2XMRA 3LLCA 2X42A 3QE3A 4KLZA 5HJ5A 3U7EB 4QNRA 2WHQA 4TUYF 5EUCA 1T9CA 4GGOA 3QZUA 2W8ZA 3MN1A 1KRXA 3T7EA 1EAYA 2AF3C 4HQRA 4ZOCA 4UE2A 2CLOB 5CDTA 5AXBA 4CLXA 2A57A 4YFVA 2VDJA 1VKRA 1U0FA 1N77A 3RAPR 3KOZA 4RO0A 4EGAA 2WWYA 1I4TD 2VXYA 4FM9A 3QJYA 2I9KA 5U1PA 5CXQA 5C8DA 3B3FA 4GBGA 4OPMA 1Y7LA 3PCRB 3QUBA 4LXYA 5JCJA 2WVHA 2QTTA 1E6WA 3DWEX 2Z2ZA 1FJGB 3DMHA 3QRWA 2Q3FA 1RM4A 3KEFA 3H4IA 4GBED 3TLMA 4Z7JA 1M74A 2HL6A 3AFMA 3HDQA 4X41A 3I6MA 4GZ3A 3ZWXA 2ZM5A 4OOFA 4UCQA 2PVSA 1LWNA 4OKIA 3RYFA 1IXZA 2RG1A 1QHHA 1NMSA 3NUQA 4CEIB 2SBTA 3ZWBA 4LMPA 3URKA 1Z2NX 1NLMA 2KX7A 3JWPA 1YVDA 3U4GA 4O3FA 1OFGA 3KAJA 3KV1A 3B7WA 4A0HA 1XPOA 3Q7SA 2ZSDA 5LMUB 5I7HA 1YUBA 4CI0B 1IBLB 2Y92A 1V1JA 1F8FA 1L5YA 5IM4F 1V7QA 4B6QA 3LPDA 1LPBB 3ZJTA 3FZEA 1U0BB 1C8BA 3PFFA 4F71A 1C9EA 3KZOA 5P21A 4BAUA 2Q28A 3RHZA 4D7AA 4WBNA 1SRQA 4AJEA 1R2QA 2L2QA 4EKIA 1EJBA 2J9FB 3OESA 4HH0A 4WQMA 2R5NA 4IHJB 1KOFA 2G1AA 4BS9A 1ZKDA 5LQMA 3BB3A 1NUUA 3R7LA 3E9ZA 1VC2A 4M8IA 2Q3CA 1KFJB 3CLVA 4INPA 1EFPA 3G02A 3LRPA 3B60A 3BQNB 3DE5X 1E62A 2PTGA 1K6XA 2QY9A 3WGQA 3EVGA 3IEIA 4KXVA 2B20A 3AF1A 4FYKA 1UJ4A 4UBLA 3I01A 2PS9A 3GA7A 2BEVA 3GLSA 3LFUA 5FBKA 4C06A 1E7MA 3GOQA 3FVVA 3O1JC 3G68A 5ERYA 4Z4IA 1UZUA 3IUBA 4CMGA 1GNTA 2RGXA 3A7DA 3LLMA 1KKUA 1DQZA 3QNMA 1RR6A 4GNRA 1OA1A 4MVXA 4D79A 4RXUA 4N9WA 4UQPA 1JH8A 2Y6VA 3ZWQA 1DKNA 1YB1A 1BJTA 3KQSA 3KE9A 1AHPA 3AFHA 2PGNA 3ZNPA 4V0KA 1IUKA 1BU5A 2GJAA 2GHIA 4HZUA 4YDSA 4MX8A 1WZ2A 2VWHA 2Y1LA 2XCSB 4IP0A 3BJMA 2FZGA 4BTEA 2N75A 1WUJS 2ZT5A 2IWHA 2C03A 1EFPB 4ND8B 4OQPA 1V43A 3TOCA 2P9BA 1BX0A 1MZPA 5AJXA 4CMIB 4MVJP 2B4QA 1W88A 4GPD1 5ADUS 2BEVB 4MUBA 2CJXA 3GCWA 4PNZA 3C7CB 3QU5A 2G77B 1R6BX 1MEOA 4MYCA 5DHTA 4RPHA 3MPUA 5CCDA 3ZQ4A 2PD3A 4KO1S 1ZHFA 5EE9A 5G1OA 3U26A 3R7WB 2GYUA 3PR1A 2PBLA 5JASA 3UC5A 3AVVA 3M4YA 4UPVA 1EJ2A 1AV7A 3K71B 2D2XA 2V6BA 1I3CA 1YQWA 1IMJA 3GAZA 4GG1A 5EE0A 5GPBA 1DL5A 3TIIA 3U2QA 4EYGA 1RZUA 3GDFA 1QOPB 5JSHA 3LP5A 3EC7A 4HAVA 1PO7A 4UVDA 2RHRA 2VBIA 4AZVA 4DBLE 1X80A 3U3KA 4EMBA 5L3QB 3A7EA 5ITVA 1I7LA 3FY4A 1Y81A 2RI0A 2IYOA 5FBWB 3WK5A 3CZ9A 3TIFA 3CXRA 4Y67A 3IE2A 5KNLA 1IZ8A 3L02A 4ETMA 2BRUA 2XMZA 3DVQX 4IRXA 4CKXA 1BWQA 4WVFA 1JDBC 4ZQHA 2HQ1A 3WB1A 4BIMA 3ML1A 1AHIA 4GI7A 3ENZA 3FPGA 1F8YA 1WW8A 3R9XA 3AHIA 1KXZA 2OWDA 1WS6A 5CW1A 5BPHA 4JC5A 3K0BA 5D00A 3T1NA 2WWIA 4OMUA 1NWHA 1P1KA 5JH7A 3QELB 4GLFA 4YS6A 5EJIA 1ZK0A 1YMQA 2GCOA 2VF5X 4JT2A 4RD0A 1R9JA 4UXJA 3DO5A 3SBOA 4J1NA 3VOBA 2QBYA 1XDZA 3QU9A 4MQLA 2ASVA 4XVQA 2PZJA 4YMLA 2B5OA 1IOWA 1U8ZA 4R0VA 5KQPA 3RJMA 4BAGA 3U9TA 2X2EA 6REQA 1FS6A 5AK0A 1RWPA 1UMBA 1VKNA 4FD2A 3I76A 2IEGA 3C16C 3OCJA 1HKHA 2P8SA 4MLPA 3IDZA 1NYQA 2RBGA 3BVPA 4RY2A 5B4TA 1X14A 3H3XA 4EQ6B 5A0TA 4PC6A 1SKBA 4BLUA 3PHBE 5DYWA 4W1RA 3ESAA 3JVUA 4E7OA 5CA1B 4W5OA 2GCPA 2FGJA 2ZYIA 3L04A 4BQEA 1U5BA 2GHQA 2ZJ6A 2UXDB 4Y18A 3VR6H 4CM8A 4LC0A 4E5VA 2FUG1 1BMFD 2VRCA 3GUVA 3KLMX 5AM1A 1UFVA 1PYOA 3S28A 4PRZA 3STVA 1CUZA 1WCIA 3PXGA 4IV8A 4QDUA 1FUUA 4L76A 1WNTA 7ADHA 1CVLA 2VAWA 4II7A 3H86A 4L7VA 3TOZA 1B93A 4QJ3A 5BSVA 2BLNA 1NQVA 1XJWA 2WD7A 2UV8A 3IEKA 4GC9A 4KOAA 4O2AA 3NCHA 5CXSA 3ELUA 1ECFA 5BW8A 2OCPA 4AVYA 6REQB 4DR1B 1WXDA 3ISJA 2JJQA 2V1UA 1T26A 1G5PA 1NWCA 5CCBA 2W2MA 3BH6A 2QX6A 2EJCA 3QE2A 2AFHB 1G60A 1EX9A 1QFYA 3SQLA 3T41A 1U1DA 1EFCA 1YA8A 3M8KA 1B1CA 1J06A 1K7XB 1JSLA 1VSTA 2ZCVA 3NHMA 3MQFA 5IAOA 1LS6A 1HT3A 3HA7A 2XMPA 3TZLA 4CLRA 1GARA 2AK3A 5FT9A 2ZSHA 4AUKA 3VH3A 4H31A 1XFDA 3NUGA 5CT6A 4LJRA 2JLBA 4B3TB 3N2YA 3WLFA 3OSZA 3RS9A 3FH0A 2VIIA 1NLUA 1Y5LA 3A9VA 4I81A 4I3GA 3MCAA 4EY6A 2EZ4A 4WN9A 4UCWA 1T1RA 2CFRA 1OI3A 1YJQA 3P7MA 1ZUNA 4LA4A 2PZ8A 3TJZA 2KJQA 5B36A 1TO1E 3WK4A 4EG3A 2Q62A 5IW8A 4X62B 1L7AA 4PZZA 1DCMA 4AS2A 4CKYA 1ZNXA 3GHYA 4XIGS 1XDBA 2GWRA 3U3ZA 2R48A 4GPZA 1CSEE 2RHOA 1T6BY 2QT0A 4JL8A 1J2JA 1OXTA 2HJRA 2OVFA 4NK5A 4QYIB 2C4WA 2PQ6A 5KI6A 3TLYA 4EDHA 1C9MA 2DBQA 2BDTA 4L4XA 3IJRA 4I4TF 1SHJA 3HVIA 4UNQA 9LDTA 3BXPA 3E5HA 1TA4A 1UK8A 4K3UA 1NMXA 5KJFA 2B4TO 2LDXA 4CFZA 3OTWA 1QO0A 4J91A 1X70A 4FNGA 4QEKA 5DM1A 1Z56C 1Y5MA 4A2PA 1TO2E 1ZXLA 5E95A 3FOEC 3EZYA 4B6JA 4PLPA 5FFFA 2YFHA 1U7HA 4LQDA 5BN4A 1J5XA 3HG7A 1DBIA 4KVGA 1ZUNB 4ZVLA 5BQ3A 2GJ8A 3COVA 3O2SB 2FB9A 3PYXA 4V0RA 2FZ5A 4NG4A 4F12A 1CETA 1KJYA 3RGGA 2A0XA 2QSYA 4FS3A 5L4LA 3S8YA 1RKXA 3FDZA 2QG9A 3OVMA 2GXUA 4RW0A 3MUFA 1E1CA 3GAFA 2DFDA 3N70A 4W5JA 3L8DA 5DEOA 2ZYGA 4LBZA 2NZVG 5KYXB 3SG0A 1UOOA 1C9JA 4OA5A 4V0SA 2CGEA 4C30A 1TJ4A 3UZUA 1NY5A 4H2DA 1AF7A 1DIHA 3HN6A 3LBIA 4LDNA 4U0JA 2D2VA 4MWDA 4TLEA 3EXHC 1JU4A 4GP7A 1GQQA 4PANA 4FK8A 1VGQA 3R9WA 2Z9DA 1QLHA 3D3EA 3GFBA 1U9YA 4IDQA 2QT9A 2EJWA 5F4BA 5IDWA 3B1KA 3D4LA 4FHZA 1YACA 5FTKA 5DWDA 4AUNA 3P96A 2VS1A 4IM7A 1VTKA 4WOBA 2W2LA 2ZXUA 2FNAA 2IOQA 1IN8A 4DLYA 4NC9A 4O5AA 4BNFA 3GBSA 4DTIA 1QU2A 1VG1A 2F8LA 2RGYA 3PUWA 3UF0A 4C05A 3H1FA 3E53A 1ZOIA 4NOLA 4M8SA 4LZJA 1KYQA 1Z6GA 3T9BA 4FYXA 3AI3A 4WBNB 2Q2QA 1GQ2A 3H8JA 1A2KC 4HTAA 4O0LA 1KI4A 3AF5A 1QR2A 1OI4A 2O8FB 2OA0A 4TSKA 2SKDA 3FOZA 2YDYA 2R68A 2QAGB 4FCWA 1PHPA 3W05A 3WGNA 2CL5A 1A8PA 1EFVA 2CNKA 2YOGA 2UYCA 3BA1A 3K6KA 3PQ3A 2BMVA 3O84A 1XZNA 2A94A 1J24A 3VNSA 1NDHA 2GCGA 4M0KA 4RL6A 4UU0A 2ONJA 3ZWAA 2IEAA 5CBPB 2EBUA 1KHTA 1ZC4A 4BOYA 1MB4A 3RBAA 5ADVA 3J81A 5IJ0B 3W3AH 3ST7A 2HF8A 2J08A 3BCSA 3MTBA 4KAFA 3EC2A 4QUAA 4OLBA 4G86A 1GCUA 4BNYA 3PPVA 1PBNA 3TZEA 1SPBS 2VH1A 3SZLA 1J8MF 1P73A 4IDEA 2YQ4A 4R4JA 2I99A 3R23A 1BFUA 1RTKA 4ZKEA 5EJ7A 3G88A 5DW3A 3TECE 1SN7A 4DCGA 1KXJA 1PEAA 3VDNB 4XCVA 4F3TA 4QPNA 2NO5A 7AT1A 3FFXA 3RJTA 1JL3A 3QPUA 4HH4A 4ZPJA 3RVLA 3WB2A 2DTEA 3ORRA 4OK6A 2ZI9A 4RFVA 5JEDA 1VMIA 2VJPA 3AEQB 1MAAA 3OQIA 1NPTO 3EA4A 3QTLA 5KC8A 2O0LA 1KI6A 2Z1NA 4JP5A 4UU8A 3RS0A 1AXEA 4FFBA 2ABWA 2J6IA 4RBNA 4ND4A 2OHHA 2Q5JA 4RZIA 1NUTA 3K70B 4UPEA 4O4HF 1GRRA 1YR7A 3IS3A 4P80A 4EA6A 2X5OA 4FYYA 1QH8A 3BE4A 4UNIA 1SD5A 2AOXA 4UHHA 5EIAA 1F4PA 3V1UA 1O2DA 4OHYA 4DJEC 1U9ZA 3ZR4B 1W1UA 1T2EA 2XZDA 1PX2A 4JLKA 1QHIA 1ZIPA 5CYPA 3TD2A 2RD2A 4IXWA 5DI3A 3N6XA 4B84A 3RO7A 2OBNA 1Z6TA 3UWSA 3PGKA 3OPMA 4E1AA 3CU5A 1RAGA 2QYTA 3M9WA 2X9LA 3TSCA 1M1YA 1XQXA 3CLHA 2O8FA 1HL7A 2A9QA 3Q3IA 4XB1A 1NY6A 4UU1A 3OZUA 4US2R 5LP6C 3N86A 4UM9B 4AS1A 2XNCA 1HDZA 1I36A 1XRNA 3CZCA 3L82B 2HRRA 3QBVA 2CUKA 4IDHA 1G2OA 1NZFA 3OG9A 4EYQA 2ZE8A 5BUZA 5I9NA 2C42A 2BONA 1LRKA 2A9VA 2HBQA 3B1FA 3LA8A 1J39A 4G09A 4J76A 4NYIR 1YI1A 1RP7A 1YWGO 2WYUA 3OIYA 2NVOA 4NFHA 2VPIA 3QMMA 1PWXA 4JYBA 1BMFA 2VRCD 4QVIA 1K9VF 1N7IA 3SIRA 1FIUA 3FROA 1MJGM 1XNQB 2CUZA 3GRAA 3BK2A 4XPIB 5HMLA 1LW7A 4QRHA 2LDBA 3CX6A 2QPLA 3AXSA 5IMBA 3HY4A 1ZM4A 3S1AA 2JZCA 1YA4A 1CB0A 1G5IA 3QKWA 3RUDA 3VYWA 1AC5A 5M29A 1MB9A 3P9SA 2P3SA 1Y4ZA 3ZHTA 4B32A 2X0FA 2B1QA 4AMGA 1Q0UA 4MRVA 1DINA 2YC4C 3DO6A 2MSLA 5EZYB 1PT7A 3FCCA 2IXBA 2W42A 2HRBA 1KIMA 4OYHA 1I51A 1UBGA 3KB2A 3LECA 1WXIA 5KNDD 3OICA 2ZE7A 4OHPA 1J7KA 1RC1A 4G0UA 3EXG1 3TTWA 1DHTA 3QFFA 2VOJA 5C8YA 4C4SA 4FHGA 5BVHA 2HUNA 1C4OA 4NBRA 5AM4A 4FLFA 3GLVA 4Q4JA 1G0NA 1V1MA 3DFFA 3OKCA 4F1WA 5JFTA 3GLIB 3FGOA 1US8A 4D3ZA 1QRUA 1FB5A 1NU6A 5JQGB 2PJUA 3WC4A 4XQEA 4ZICA 3GZTB 1V9SA 5FTLA 4MUKA 2W83A 3MWYW 2XEXA 2CD7A 2HGSA 2XCLA 4C0JA 4CR8A 1Q6YA 4CMEC 1W44A 3GLHE 1FVHA 2HX1A 2VK1A 3TO5A 5A02A 3KJEA 1T3TA 2COUA 1MJFA 2A5GA 4R1MA 1LH0A 4G0YA 2BGGA 1EE1A 2PZBA 3OIFA 4D80A 2JH3A 5CEJA 2ZTLA 4O2BB 1MIOA 5L4SA 1FFDA 4AN4A 4D0RA 1S2OA 5TQ0A 3MUOA 4CM9A 1P7PA 4WNAA 5AJUA 4RVHA 5AJZA 1JTFA 1WKVA 2HHJA 4IXTA 5AK5A 5M3BA 3GFPA 3G9TA 5CPFA 2AKYA 4I4TA 4AROA 4NG5A 3DUFA 3WHIA 4YT8A 1P3JA 5E7QA 5EJGA 2ZP1A 3SVLA 3STTA 1K08A 1KAOA 1ONPA 1GQFA 3EHDA 1L5LA 4BFYA 4BQFA 4YJGA 2BH2A 4UFNA 1P0PA 3I34X 1XQ1A 3CLSD 1ULAA 3SHVA 1ULBA 1PFWA 1M8KA 4EENA 3JQGA 4BB6A 4GOOD 3FPKA 2J87A 2VJQA 2CNWA 5ALYA 4CKBB 3SM3A 5J63A 4QNNA 2I6SA 3ND9A 1G19A 1ZKMA 1MP0A 4U02A 3UMYA 5DLQC 3LSYA 3WK7A 4QDOA 3T7IA 2Z4RA 4F8EA 3ESBA 2WB4A 1U0HC 2QV7A 3JZMA 4K87A 1MU0A 1DTSA 5C7OO 2VJNA 1E9FA 5GP1A 3OTGA 4LRTB 3I8XA 3HXMA 2HK6A 4O4JB 1E3MA 3BMNB 3HFJA 3S6JA 5C1OA 2W6OA 4M46A 3SJUA 1GL7A 4LFAB 3RVNA 7REQB 4PG6A 4HD8A 4E3ZA 4XQ9A 1ZJZA 4YUAA 1V0JA 4YDRA 2VJOA 3OKFA 3ZLVA 4O4IF 4Q9HA 1JTEA 5F7ZA 4LKRA 3GZJA 3ZC3A 1JJ7A 2VTBB 1P5JA 2DKFA 4KQFA 4ZV7A 2FEOA 3A6FA 2K87A 3CB4A 3QA3E 4OGKA 4JJAA 4P7FA 1TQ6A 3A3PA 1SXJE 4QOHA 3A9CA 3W6NA 3ABRB 4J2OA 2VP6A 4H77A 4MAMA 4IGFA 4F4CA 1HEUA 2PJDA 1XRMA 2I4RA 2QTAA 4IQFA 4GUDA 4CM8B 1TZBA 1P1IA 3QMWA 4UE3S 3JY6A 1DC3A 1JG4A 2ADOA 4XSGA 4WOCA 1NG9A 1JZTA 1WSBA 4R9SA 2JI6A 1Q12A 1GXSA 1MAWA 1PR0A 2XJ4A 3N75A 3F4BA 3PITA 1SQFA 4DV4B 4FW8A 4RNCA 1R0ZA 4ZYVA 4KDRA 3NOQA 3ND6A 2Q0QA 4HLDA 4OFZA 3RV4A 5L7WA 3PT5A 1M3SA 4ARZA 4JK3A 3O4VA 4MUJA 1Z4IA 1DRVA 3A1UA 4XR9A 3UMBA 1W8DA 2CZGA 2FQ1A 1U80A 4Q01A 2IWRA 1IVYA 3LG2A 3QHPA 4W6QA 1EFDN 4JVMA 3FB1A 2IPMA 2PUDA 1W35A 1Q50A 2I2AA 4DJJA 2ONYA 1XD2B 2BFCA 3X44A 3ELBA 5LB2A 4DXHA 1XCOA 4EVSA 4DSTA 3CMMA 4RHXA 3IVGA 4CU2A 1ZUIA 2OO7A 4RORA 3BJZA 3PXBA 4W5WA 4V2IA 3I92A 2HIGA 2EWMA 1NXOA 4GWLA 3PENA 3P0RA 4MYDA 4LRQA 3BWBA 5I7UA 3RCBA 4IH9A 1LJUA 1YVEI 2DG2A 2B9VA 3FTCA 1SCUA 2VPPA 2BFDA 2XUDA 4JP1A 1QGOA 1QS0B 3V7YA 4JA0A 4LZWA 3L7DA 4HGYA 3TM5A 4CEHA 5IABA 1QF9A 3SHFA 3AI1A 3DJFA 4BCCA 4DNQA 3KD2A 3WFJA 1BHO1 1J22A 3KRTA 4HX9A 4C6TB 1LD3A 1ZOSA 2XWJI 4ZT7A 4GXNA 2ZPTX 2HA6A 4C43A 3PICA 2Y1OA 4R2IA 4Y6PA 3RUFA 4DQ0A 2HU8A 3DNFA 1B15A 3DZJA 4DPMA 4MI6A 3IFSA 5HQTA 4Y1GA 2FSPA 1JKJB 3R20A 4N0QA 1T4MA 1P75A 2DFPA 1H1LA 4MP3A 3VSAA 1V16B 3A6LA 1HE3A 1ZM2A 4KRXA 2CSUA 3BAFA 3BICA 4DW8A 1WPGA 2Q49A 1D3AA 1VM6A 5AI9A 3FWKA 4ILEA 1RMQA 3NJRA 4ZOLB 4D0NA 3UJBA 2WSSD 4ERXA 3U09A 4F5EA 4M0LA 1H1DA 2I9PA 1GNVA 1E1DA 3EQ2A 3H2KA 3NJ4A 2PRSA 2Y4OA 3FYHA 2H0QA 3HB5X 2F3QA 2J3IA 3I4CA 3PL1A 1QX3A 3VTZA 3P0IA 4A2CA 2Z43A 3EIFA 2EZTA 2GILA 1KJ8A 4CL0A 4URVR 1VL0A 4D3SA 3NCTA 2C9MA 1KVRA 3HEMA 2FR8C 3A0RB 2FAXA 4DRXA 3NNSA 4D3XA 5L51A 5J1SB 1UPBA 1IOLA 5A1TA 1BEEA 1B7GO 1DIAA 4TQAA 3D4BA 4C5AA 3RC8A 2X0KA 3TG2A 1KA9H 1G4UR 1OB5A 1FW8A 1T5SA 3P45A 5AESA 2RB5A 3RE1A 2FW7A 3AWIA 3RFXA 3PFNA 4NQZA 4D44A 4Y2VA 2WJVA 2EBFX 3Q2KA 2EL9A 4AX4A 5A4FS 2C5BA 2PUBA 4MARA 4WHMA 1YRWA 5EFZA 4YAUA 4O1IA 3QVWA 2E18A 1KSFX 3RUHA 4DV6B 1WCYA 1RPJA 3RH0A 2FX3A 4GMFA 4V38A 3SS9X 1GZ6A 3ZDQA 4A92A 3CRQA 4KQ6A 1DEOA 4HNUA 2QSUA 621PA 1ODCA 4ZZ0A 1E20A 1VI5A 3IGFA 4GQAA 3BFKA 4I4TB 2BGTA 2GJSA 3PV0A 2FR8A 4CLHA 2EWWA 4EG6A 5J47A 3HQ4O 2BGLA 5KOHA 4K6FA 3DBLA 5K8IA 3U4QA 4TTAA 3GRYA 3FKQA 2MWMA 2GZSA 3LHSA 3N9IA 1DJPA 4A6EA 2UZAA 4Q3KA 5HQJA 3HL4A 4MKGA 1Z88A 3M81A 2YIDA 3EH2A 3MTJA 2PX2A 3KPWA 3WA7A 1L5FA 1X86B 4TYWA 3R4VA 2Q3DA 3HN7A 3MINB 4PYKA 5FR2A 1XZBA 3OIUA 3PS9A 2VBFA 3DO8A 3AJEA 4N5MA 1XVUA 1O5TA 3SK0A 3OF2A 1QAMA 4BX2A 4Y2QA 1VFPA 2CHEA 1H2ZA 4QBKA 7MHTA 4YI5A 4X6UA 4I3HA 3BSWA 5DCYA 3N8GA 2VHZA 3FDIA 4MJLA 4UAVA 3JAKB 4MS3B 3ZGVA 5HUQA 3ZXYA 1JKFA 1OXMA 4FCCA 3R8FA 3JCZA 1PWZA 1MT0A 2JLRA 3STUA 1O95A 5FBQB 4MJ3A 3O8LA 5I7WA 1F2TA 3KQKA 5SY9A 5LBTA 4CLEA 4TKUB 2J3KA 3ZZNA 2XT9A 1KDTA 3HM2A 5BW6B 4GKJB 4XGRA 2JAQA 2CMDA 3CPEA 2FOLA 1EUCA 5CHYA 1NE2A 1U8YA 3GQVA 3HCAA 1B8VA 3BE6A 2PUAA 3MAGA 1ML4A 4MQMA 4V0LA 5JAPA 3EFEA 4C22A 1L7DA 4B45A 4GKKB 1C4XA 3P4UA 5F77A 2R60A 3G7NA 3HCCA 2WJWA 3L9WA 4MITA 2FW6A 5EP4A 2PGIA 1HORA 3QLUC 5CM8B 5BNZA 1IY0A 3LK7A 1G66A 5G41A 3V8EA 3WBFA 3NATA 1P5HA 5KWSA 1BW9B 2IYXA 4M98A 3SU8A 3RRNA 1OPRA 5JJLA 4TV8B 4N3NA 1O95C 2B7CA 1SEPA 1P1JA 3QVGA 4ZYUA 3U6BA 3RSCA 4BRZA 4C4RA 5AK6A 4AO7A 1SUFA 1DJOA 2F9LA 1L2TA 2GASA 4Z8XA 3UW1A 2Q9CA 1E1KA 3DKKA 2O6LA 1USUA 3K35A 4A5SA 5AW6A 4NJEA 3NHBA 3RRJA 2J5RA 4H08A 2FY8A 2F4NA 3C5CA 3LY8A 2JCBA 4QUGA 1NVGA 3E1KA 5HBRA 2X0IA 3U1TA 5JXHA 2DQZA 1K4KA 1T9DA 4D6YA 4D41A 2GAJA 1EKXA 2ZQYA 4EB6A 2XYGA 1WZUA 2QI9F 3KVNA 3OZRA 4K03A 1J33A 1V3TA 2VXOA 2CLIB 2MTBA 3HKBA 4XVUA 2AIRA 4EI7A 1ZN7A 2KSQA 1BWSA 3UMRA 2P5YA 2YJ5A 3QK7A 3PT9A 3ZI4A 2N3ZA 4ZVOA 4R1PA 1VYHA 3CBGA 3UAYA 5EA2A 2CSXA 2IS4A 1C8LA 5J59A 2IZ0A 4AZTA 1JG2A 2F9MA 4BL5A 1WXXA 3ZIAA 3OFKA 4YGYA 2WU4A 3DAHA 1YIAA 1ZNWA 2IYWA 4NOMA 2FYTA 2DPYA 3ZI7A 3WQHA 4C6HA 5C4MA 3HY3A 3LHDA 5CGZA 4OJKA 4Z1MD 3DLBA 3IQZA 3OHSX 1XA3A 4F2WA 1X0XA 4DIBA 3M4XA 4QICA 5AKJA 2ZJ8A 3AI2A 4FJ1A 1F0YA 3JATA 1DAFA 2VP5A 1RLTA 1GTL1 2JFNA 3H2JA 3KG2A 3C7TA 4EBFA 2WLTA 3N76A 3OZGA 4YACA 2HFJA 2O2DA 3HJUA 4J16A 1Z2CA 1UDAA 4MWEA 4ML3A 4QU8A 3ZCPA 1W75A 2I0FA 5IF9A 2RK3A 1TZKA 1KI7A 4ABYA 4TKVA 4ZMRA 3PNKA 4RIGA 4N18A 1JIVA 5H70A 4J7AA 5EXSA 1CQZA 3O8QA 2JBAA 3HI6A 3AKDA 4OQEA 4JKIA 1ZRMA 3MT8A 4E03A 1VG9B 3IO3A 5JAQA 2DU8A 4PQEA 2OM2A 4CM7A 1DAKA 3OZIA 4JYMA 1PS9A 4DNPA 3H5NA 2VFAA 4DHWA 3NORA 3ZNQA 5C34B 5GIPE 1PCXA 2FCRA 3G2KA 4S0XA 5CVEA 3TTVA 4Z9BA 5HIAA 3DLTA 4UD6A 1JVSA 1VMAA 1K0UA 5ITZB 5JTTA 1BE1A 4XWAA 5LZ9A 1AM4D 4Z1OA <