3FGNA

Crystal structure of dethiobiotin synthetase in mycobacterium tuberculosis
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
230
Chain Sequence
FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Dethiobiotin synthetase
total genus 72
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fgnA00
4JSTA 1XEXB 1P2UA 3HJNA 1OH6A 4F92B 5HKKD 4EQ6B 2IYWA 1BMFD 1SVKA 4NCKA 2VP0A 3D7MA 4JLNA 5FTKA 3ZD6A 2DFNA 2OFOA 4G1UC 1XEXA 1LB1B 3SDZA 3IO5A 4DCNA 4FI3C 2RGAA 4B3GA 2QMEA 1TF2A 1XDBA 3EIHA 1YZQA 4B2IA 1KK3A 1QHHB 4KBFA 5FBVB 5FTJA 4MRVA 2C9OA 1E96A 3VHLB 3QQ5A 4N3NA 1PLKA 1G8HA 2CK3A 2WAYA 3PUVA 3CLVA 2J0UB 2JDID 2VL7A 4WW0A 4AKEA 2IEZA 4BE7B 4D4KA 4WZBE 1GKUB 3K0AB 1NMXA 1O3YA 5BQ5A 2AR7A 2JLSA 3QKSA 1XMJA 5KOYA 1M6NA 2QM7A 4B3CA 3EWAA 4JL5A 1GDDA 4D26A 2FFAA 5P21A 2PLRA 1HUQA 4NONA 4PPGA 5CJPA 2E1RA 4BLOA 4NBSA 1ZAKA 4BLTA 3UATA 4YXWD 1GOTA 4LK2A 1XBTA 5FBQB 2ZRLA 2C9CA 3DMNA 4C7OB 3ZZ0A 4J0QA 3THXB 4E07A 1OFHA 1N25A 1ZYUA 2JATA 4Z51A 5TARA 4DEYA 3ECCA 1U81A 4GI7A 5JHGB 1Z28A 1KZ7B 1ZM3A 2MSCB 4OYHA 1G16A 3RS7A 5GVSA 4M1KA 2MMCA 2ZM5A 2DWPA 4EJSC 4A0RA 5DN6D 4QL3A 2XZOA 2IYVA 4Q9HA 2JAQA 4GZLA 1KHTA 1RRPA 1AIPA 1PVOA 5CJ2A 3KQNA 1E9AA 1ZIOA 2AK2A 1VHLA 2VF8A 3PJRA 2IT1A 1U0JA 2F1IA 1KSFX 3T06B 2RB4A 2P6RA 2J9RA 2FU5C 4M22A 2BBOA 1G5RA 4A1FA 1CULC 1SXJB 4AG5A 2OM2A 1L4YA 3L0PA 2HV8A 2QAJA 1E98A 4TWZA 1KDRA 5H70A 1F2UA 2ANCA 4RFSB 3VR3A 1AZSC 3C15C 3ETLA 3L43A 5AJVB 1CR0A 3MD0A 1QHNA 1HURA 3W34A 4B43A 2WIAA 3LXXA 4TMKA 3ND9A 1I4LD 4BRWA 1K6MA 4DCVA 4HUQB 2V4ZA 4DSUA 4MDEA 3OE7D 3ZJYA 4JKIA 1W36D 2WHXA 3QKSB 3U3KA 3GQBA 2O8DA 4XD7D 3Q72A 2DB3A 1ZU5A 3AVPA 2QP3A 4P4UA 2X77A 2YOFA 2JLYA 3ZIAA 3GLIA 1Z0DA 2BJWA 3AF2A 4QOSA 4LJYA 2ONJA 1KDPA 3HR8A 3TUZC 2ODEA 4RZ3A 3OEHD 3FPAA 5EXTA 1E1RA 4N0EA 4EAQA 2ZJ5A 4FINA 3CWZA 3TSWA 1KNXA 2C5LA 1WDTA 3LW7A 5CB8A 1XB2A 2VHTA 3DKVA 3P4XA 4PHTA 2GCPA 2P6UA 4Q1AA 4BFXA 1XEWY 2Z83A 4LC1A 5J4LA 3WXMA 4FWTA 3AKCA 4JSYA 4F7WA 1ZCBA 3U7GA 1D2MA 2O8DB 1N6LA 2CHQA 3EXAA 4U5XA 1XEWX 3QPWA 3C16C 1UFQA 2Q21A 1NP6A 3FTQA 2F43A 5M04A 4CEJA 1J99A 5KTYA 4M1OA 2GXAA 4OI4A 1ELOA 3BB1A 2C8VA 4IOJA 5DH9A 2QGNA 3LQRA 1AS3A 3I5YA 1E9BA 1E1QD 4GMDA 3P20A 3OHMA 2DR3A 3LV8A 1M7GA 4KFUA 4AC9A 3FHTA 4H1VA 4B3BA 3GLHB 5F2EA 1KK2A 1BS1A 1GL6A 2C95A 2JGNA 3AGQA 3UWOA 5DI3A 4DSTA 5JWOA 4U7DA 3U5ZB 3U3RA 3TMKA 2BBWA 2FDCA 2YV5A 5AJXA 1ZU4A 1IN6A 4BQSA 5JLJA 1SVLA 4PAMA 4ARZA 1NN0A 1E1QA 4NP6A 3B1YA 4CGZA 4FMBB 4B2PA 3JVUA 4G3XA 3GJ3A 4MRNA 3A6PC 1M8PA 1Z0AA 3A58B 4M1YA 4V02A 5LB2A 5JEDA 4TL6A 2AD1A 3RHFA 1G3RA 4LV5B 1UBGA 2ZSDA 1FOEB 1U90A 3UKDA 3I32A 2DY1A 1ONBA 2CHGA 1KJYA 3P1JA 1GAJA 2F55A 5F9HA 3E1SA 5FOUA 1HH4A 4QBIA 4CIDA 1E4VA 2NO9A 4B3FX 4LUCA 3ZS8A 2VQSA 3TNFA 4B73A 2CXXA 2DPXA 1N0WA 1VDZA 1MR3F 1KK0A 3B13B 1ESNA 3B5JA 4Q9IA 1Q21A 3RRMA 3TKLA 4BASA 1NG1A 1G20E 2WOJA 2ZROA 2A5GA 2ZJ2A 3CZQA 3GFPA 2R6DA 5C18A 1RJ9B 3H2YA 4U02A 4QKQA 2BCGY 1U98A 2OHFA 3UG7A 1E94E 2QRZA 3WNDA 1CXZA 4G5OA 3VHXA 5L3VA 3W3AA 4ZKEA 4MGIR 4X8LA 3ZYCA 3LO5A 2OXCA 1Q57A 2R6CA 3PQCA 4B3DA 1HY3A 3K0FA 4BFVA 5FUYA 1G6OA 3HU2A 2V9PA 1NRJB 3CZPA 1W5TA 4HAZA 3A1TA 3RS5A 1T3HA 1TNDA 3SOPA 2O8CA 3LA6A 4BZPA 2VH5R 2OLKA 2AWNA 2SHKA 4BPBA 1E9DA 1EFUA 1MO3A 1VYVA 4LJ7A 4W5WA 1DO2A 3B1VA 4UNPA 1A82A 2H92A 4FMDB 5EE0A 3K1JA 4OQLA 2REBA 2UVQA 2YC2C 4MKGA 4M1MA 4RVCA 2RGBA 1W4CA 4Q1FA 2V54A 2BBTA 2O0JA 2QL6A 3T1QA 1EFRA 2FGKA 3Q7PA 3VX4A 4L9WA 3KTAA 4E09A 2KSQA 1RJ9A 1J70A 8OHMA 1E0KA 4NZYA 3CH4B 2FPMA 3SN6A 2YYZA 2GXSA 1F60A 2J87A 4RD1A 1JQLB 4PSVA 4TTPA 1KKMA 2I3BA 1SKYB 1NVXQ 2ZRHA 1E6CA 4LBWA 2WWHA 3EZ9A 2ZI6A 5CK5A 2Z6VA 1KZGB 1OIXA 1XF9A 4M21A 3ZD7A 3OEHA 3PITA 2O8CB 5EJEA 3WY9A 2NQ2C 4QJ3A 1TU4A 1E1RD 2QP4A 4M1TA 5C4GB 3TAHA 1Z63A 5JJIA 2FEOA 2OV2A 5IT5A 5B64A 3CW2A 1TF5A 4PAOA 2OFWA 1Z6TA 3DZ8A 3AV0B 2G0TA 3X1XA 1QVRA 3IPXA 3BH0A 5IHPA 4HB2A 2CCKA 1NVVR 4XWAA 2PL3A 3K9LA 5E3HA 5JWHA 4MRRA 3I62A 4GL2A 1Z6GA 1XCMA 2FFHA 1KDOA 3IIJA 3HR7A 2RMKA 3BBPA 3SJZA 2O8FB 1CP2A 1HT2E 1XCPA 2ODNA 4MH0R 1S3SA 3BJIC 4F38A 1TF7A 2AK3A 3IILA 4Q4HA 4MKIA 5J40A 4AD8A 2OO7A 5A0FA 4HB4A 2BDTA 4CDGA 1KDTA 1P2SA 2HJVA 2PCJA 2WPDA 2FA9A 2XNDA 3AKEA 1G3IA 1WA5A 1JQJC 4Q7MB 4V0OA 1OFUX 1ZJ6A 4R71A 3T34A 2HF8A 2JLRA 3KUCA 3OIUA 4EFLA 2ECKA 2PT5A 3CF0A 2YOGA 3RRYA 1XX6A 2OZEA 1ZNZA 4HLUA 3THXA 1COWA 1IAQA 3WBKA 2ZITA 3ASYA 4QM7A 4LBZA 4DZZA 3MLEA 1VIAA 2ZQ5A 1VCIA 3AVTA 1XP8A 2ZEJA 1R5NA 4XOIA 2ZTSA 3TUIC 3U3MA 1XPRA 2QENA 1F2TA 2FFBA 3R20A 4OI1A 1TQ4A 3OAAD 4D4MA 4FD2A 2H17A 2ZVQX 3HPQA 4OJKA 1P72A 4E22A 4URWR 421PA 3NC0C 1DVRA 2FPKA 1EWRA 2AD5A 2GEVA 4G01B 4IHQA 1F2TB 2IBMA 1JXMA 2OILA 1E79A 5C4MA 1P60A 1IY2A 2BCJQ 3RVBA 4AKHA 4GBMA 2QMHA 2WVJA 1MKYA 3HWSA 5SZKB 5KDOA 2GZHA 2IS6A 4C2UA 4ZDKA 2LKDA 1OYYA 2FGJA 3KQUA 1W7AA 3HU1A 4JBYA 3IDQA 2ATVA 2CJWA 2ZS9A 2GF0A 3A1VA 1Q1QA 1U0HC 2CCGA 4OL0A 1S4QA 1SVOA 1X8JA 1P4SA 3KB1A 4HUQA 1EFTA 1OHHA 2QU8A 2IYTA 3MRSA 3THWA 3AUYA 1QHHA 1WE2A 2R6GA 4ITRC 2NO7A 4NYMQ 3T5DA 4JVLA 4QG7A 1RE0A 2G77B 1HTWA 3CRRA 3EAQA 3KDSE 4V0LA 3GLIE 4JT4A 3GLIB 2W2XA 3QUSA 2YJTD 1GP2A 2HLDD 3FMPB 4UXHA 2F1JA 1YRBA 3NIBA 1G7RA 3THYA 4ON9A 1OSNA 2VPPA 2OSBA 4OQFA 3CNLA 1DAFA 4D80A 1YKSA 1EESA 2BOVA 2ZAMA 3DPUA 1B23P 3BERA 1CR1A 1X8KA 2ZJOA 2X8AA 1OF1A 2IA5A 3M6AA 4KI0A 4PC7A 5FOXA 3SI7A 1UBCA 2D06A 1TUIA 4M4SA 2D7DA 3FMFA 3BC1A 3NEJA 2F9MA 2ZUDA 2IS2A 4HAVA 1D2EA 4JLBA 5B2ZA 5AJWA 4Q7LA 2Z5FA 1R10A 1ODFA 1ZUNB 2NPFA 4C3ZA 4HZIA 3RYTC 5KNBA 4I81A 3LBIA 1W36B 4LPSA 1G21E 3K0SA 4OKSA 3E5HA 2ERYA 4URYR 3K70D 3SYLA 3FOZA 4K8OA 1QF9A 4MUAA 1VCOA 5KPJA 1WBDA 1AGRA 5HTKA 4TQUS 4LRWA 1TADA 1I4TD 2EFDB 2WJGA 2H18A 5J47A 1PUIA 1H65A 1FUUA 1XJCA 1UPTA 4LJ8A 4EJSA 4PAQA 4JLPA 3C14C 3F5FA 1CRPA 4RJLA 1Z47A 4QBGB 3WYAA 3TVTA 4KITB 3BB4A 1N6IA 1B0UA 1GFIA 3VR2A 1HYQA 1ZCAA 3N5CA 1C9KA 1Y63A 4HDQB 2EFEB 2IXFA 1KO4A 4QNMA 3J81k 4DVGA 1NY6A 2LWIA 4MGZR 5DYGA 3V9PA 4BFSA 1BKDR 1IN8A 1AKYA 1C4OA 1KYIA 4ZDJA 5E4FA 4P4TA 2ORVA 3BGWA 3I61A 1M74A 3FE2A 2Q9CA 3IQXA 2QPTA 1RVDA 4ASUA 3W6NA 4TT3D 2R8RA 1U8AA 4XVUA 1VYUA 2XZPA 4UJ5A 1YZNA 3CONA 3FKSA 3H86A 3IBGA 5DLQC 1P9RA 2H8KA 1GL7A 1DARA 4C0AC 4URXR 2GESA 2W2TA 3GMTA 5FL7A 2F6RA 3AVQA 3QXXA 1COWD 3UIEA 4UNSA 3RWMB 4PPQA 5K8IA 2XXAB 3LD9A 1NVWQ 1NMZA 1CEEA 3UMRA 4POAA 3QG1A 3IBYA 3OIVA 4B6EA 2NZ8A 4JBWA 3CRVA 5KUTA 2ZSAA 5CIQA 2HDNB 2QE7A 2EWWA 3VTKA 2P6NA 3BFXA 3NBYC 2EVWX 3NKVA 4PSAA 3K0EA 4ZIRA 3GJXC 2GILA 2J0SA 5JSZB 3QXJA 4P4SB 4XWOA 1JPJA 4L9SA 5DYIA 4MGKR 4TL7A 1NJGA 3OF5A 2ZXUA 4OHWA 1E2HA 1K8RA 1UBEA 5C2JB 1DO0A 5CB6A 5FOSA 1Z08A 3R8CA 1KO8A 3IUYA 3C41J 3OFND 4W5HA 5CLLA 3R9IA 3C5HA 4BUJA 1GL9B 2FEMA 2UKDA 3U6KA 1XD2B 2QT0A 3ZGXA 2D2FA 3RC3A 2YWFA 3B85A 2BIFA 1Q3HA 1S2MA 5JRJA 5B58C 4JLOA 4JYBA 4JLMA 4RY2A 2NZJA 2ZE7A 1W5SA 1Z0KA 1T4GA 2GXQA 1MT0A 4TLDA 3BOSA 1XTRA 2DFLA 1AGPA 4URUR 4BFUA 1ZMXA 5KU1A 4BGDA 2XJ9A 3I8SA 4M1WA 4P4SA 3ASZA 2IYSA 1FNMA 1Z5ZA 4LYHA 1TQDA 2X2FA 4B48A 3ADBA 1OXTA 3ADDA 4CZ2A 2V1UA 4IDNA 3MMPA 1XXHA 5FL3A 721PA 3AVXA 3NDBB 3AP3A 1N0UA 2P5TB 3RC8A 2GCOA 2NMVA 3P27A 3U3OA 4K46A 5KSOA 4JVSB 4GSYA 2WSMA 1N6HA 1ZD9A 2HXYA 4DDUA 2WM9B 2CLCX 2HT1A 2GJ8A 2QQEA 4A2QA 4W7SA 5KDLA 2GCNA 1P2VA 2GBLA 2IYZA 4IVQA 4WZAE 3W5JA 3MWKA 1PZNA 5EP4A 2Z0MA 2P0EA 2P5SA 3TVDA 3K09A 2G1JA 1CJKC 4ZPXA 3W5IA 1CRQA 2BMEA 2V6JA 3AVOA 3QSYA 4CEIA 2RGXA 4D82A 3U44B 1BO6A 4O0MA 1ZM4A 4MA4A 3QXCA 5C1BA 4RZUA 2QSYA 2C04A 5H1YA 1TL7C 2WJIA 3B1XA 2BC9A 4YMWA 2RCNA 3GJ5A 1I4DD 2GJSA 3SHWA 3LLUA 2REXB 3B8HA 4QJ5A 1KI3A 2UZ3A 4EDHA 3UMSA 1LS1A 5FFMA 3AVYA 1US8B 3PVSA 1MV5A 5TXGA 2R62A 3WBJA 1A2KC 4IEEA 4M9XA 3EPJA 4LJ9A 3X1YA 2J59A 2ZU0C 1X1SA 2NGRA 3DDCA 5DGXA 2PMDA 1IXRC 4KJZA 3W3ZB 1OV4A 4FN5A 4H9GA 1R5OA 1SHZA 2PEYA 5FBRB 3RRNA 2ZI4A 3A4NA 1L8QA 2XITA 4HAXA 5JCPA 2ZYVX 1NBMA 4TLEA 2GJ9A 1L7VC 4L4UA 3RSOA 4HDOB 2IF0A 3BD9A 3T12A 4D2IA 3U61B 2FJUA 1XMVA 1KAGA 1SKQA 2JCSA 3C5CA 3KJEA 3BH6A 3PV0A 1T6NA 1PLLA 4NPHA 4B44A 4ASUD 3FFBA 5BYJA 3PEYA 1KGDA 3B6EA 4PTLA 4DLXA 2ZJBA 3NBFA 4KBGA 5EZ6B 2P65A 1W48A 2DBYA 4JMPA 4NTZA 4BWYA 3EC1A 2FSIA 4D0NA 1XPUA 3AVUA 4M9QA 3UWKA 1N5IA 4JL6A 2Q3MA 2GBLC 4DCSA 4PPFA 1WMSA 4KAXA 3DVLA 4Q4HB 4YMVA 2OAQ1 2RHDA 3CWQA 5HE9A 1NBME 4LZZA 2ZS7A 1GM5A 3U44A 2F7SA 1RKBA 3L82B 4LJ5A 4QGHA 1T8TA 3W6PA 4L15A 1A2BA 4M1SA 2VHCA 3LFUA 1QRAA 5LBIA 1DE0A 5LD2C 4Q1BA 1OB2A 3QPUA 1KOFA 2WBLC 3TK1A 3LXRA 5K8LA 3RRZA 2GK7A 3SBEA 4OHXA 4TYQA 4DLYA 1R8SA 1X6VA 4UJ3A 4TTQA 2QTHA 1Q44A 1W4RA 4DIEA 2OUKA 1LF5A 5HCIA 1NN1A 4LY6A 1OYWA 1XTKA 1PUJA 3TAUA 2RGNA 1DAKA 1DAGA 4EPRA 3MJHA 2CBZA 4MYUA 2G6BA 1D9ZA 2Z4SA 2ZANA 1OH7A 4NDZA 2GKSA 2N42A 3KL4A 4LHZA 1W1WA 3M4YA 1YU9A 3PEWA 5HZHA 4FCTA 4GMXA 1HT1E 2F43B 4RD0A 1WCV1 2ZYUX 2J5XA 2KI5A 4V0MA 5L3SB 3ZLJA 1D5CA 4NCIA 3TE6A 3RS3A 3ZZTA 5B57C 4D81A 3B78A 3T1TA 2I1VB 1Q1EA 4Q4LA 4QHTA 2XB4A 4XTRA 1SZPA 2FOLA 2RHMA 2DCUA 2VSXA 4L8GA 4X8MA 1YR7A 1Z0JA 5EE5B 2QBYA 1BOFA 3FMIA 5AJYA 4HZUB 4N1AA 4PQRA 1M1YE 3WNBA 3GLGA 3PR1A 1G5TA 2JA1A 1UBFA 3SJCA 5CDFA 4PC6A 4NE2A 4L16A 1OKKA 4PXAA 4I99A 4TL9A 1OT3A 1UKYA 4F4JA 4C0SA 1XZQA 1DAMA 1JXOA 4TYWA 1NVVQ 1IXSB 3N70A 1GTVA 3WYGA 5F3WB 4O25A 3MGCA 1KI2A 4TYPA 2HT6A 3KJHA 1EX6A 3FYHA 1UKVY 1C1YA 2XB2A 1EX7A 3QI2A 5IK2D 5JFGA 4PR0A 4B34A 4NHOA 1ZD8A 1MABB 1VG1A 1ZUIA 5DI3B 4YMUA 2ZPTX 4PZLA 1TU3A 3HYTA 5J5CA 3U3JA 3EPHA 4M9ZA 2GJKA 4NH0A 4DUGA 4CF7A 5DO9A 3JVVA 1U9IC 3QXSA 4GZMA 1R2QA 2Q6TA 3GLGB 2I1QA 3ND8A 2AWOA 2Z43A 3WMGA 1Z8FA 1UEIA 3QVVA 4OHVA 1UF9A 4RFSA 3NWJA 4V03A 2O8BA 3V4RA 1YJ5A 1Q22A 3LQQA 2IYRA 1KMHA 1P73A 3M0EA 4TMZA 5FUXA 3VU9A 1DEKA 2PX3A 221PA 2AHOA 3FHCB 3UG6A 4NCJA 4A0FA 2AN9A 4C4PA 4JZKA 3TR0A 1XJQA 1SVSA 1JALA 4LYAA 3THOA 2J45A 1P62B 3KFXA 2ZVPX 3I3SR 5D3QA 3KXLA 1FQJA 1JPNA 5C46F 2O0HA 5DHAA 3B9PA 1KI7A 2J41A 3L2OB 3E2IA 3EZFA 2YWHA 3WRYC 5A4JA 5L3QB 1E9EA 4HI0E 2A5JA 4Y0VA 1G7SA 5KHOC 1ZBDA 1I2MA 1MOZA 4KCGA 5BW8A 1SQ5A 2V55B 5J4YA 2VSFA 3KZ1E 2WKQA 5CM9C 1JEDA 4R9UC 1P3JA 2VHJA 5UKDA 4BRUA 1KO7A 1TTTA 2IS4A 1OXVA 5GVRA 1G5PA 4MGYR 2RGGA 1EGAA 3SU8A 2NTYC 4IDHA 4Q00A 4PHGA 1E2PA 3PCRB 4DLSA 4IVRA 3QJYA 3W6OA 2ZRKA 2QI9C 2EU8A 4C0LA 3EARA 1E4YA 4US1R 3DM9B 1IXZA 1T0HB 3NHBA 1ESMA 4R2IA 2Q3HA 4CEJB 3LDAA 4RD4A 2OESA 2BM0A 4JS0A 4WIAA 1E0SA 1LFDB 2A2ZA 3H84A 1DS6A 4OJQA 4QGGA 3RS0A 3GFTA 4HB3A 1P5ZB 1SVWA 1ZC3A 2Q9AA 3SS8A 1SXJA 2NO1A 2AKAB 4LX0A 4FMCF 2GEUA 2GNOA 4S35A 3VR5A 4B32A 2A9KA 1OH8A 4IDOA 1NLFA 2ODBA 2GRJA 1IJFA 5BN3A 5FOWA 1DTSA 2BEKA 2V6IA 3C4JA 1V5WA 5JWRA 1W4BA 1E2FA 4DCTA 1W36C 1HE1C 1S3GA 2JJ2D 4RKEA 1E3MA 3AF4A 1WRBA 2IC5A 2V7QA 2W6JD 1NKSA 3MG9A 1OIVA 2BBSA 1J8MF 4PPNA 3QOFA 4B47A 2YINC 3FGNA 4ZI3A 5JMTA 2G9NA 2EWVA 1XEFA 1IY1A 2ZRIA 3QKRB 3ZH9B 3FDIA 3B1ZA 1TAGA 3MSXA 1SVIA 4FMCB 1RYHA 4KVAA 3OE7A 2HCBA 1CS4C 2W6JA 3R9WA 5FOVA 1R4AA 2JASA 3I73A 4DLTA 4XD7A 4MRPA 4KU4A 2IUUA 1T3SA 2CCJA 5DIFA 4MQBA 4HYYA 1Z0IA 3PUYA 2FZ4A 3TRFA 3THWB 1CJUC 3WMEA 4D4LA 5EZ5A 2AXNA 2J1LA 3W8RA 2GVDC 1Z06A 4KFSA 2RKOA 1G3UA 4HUTA 1DPFA 1G3MA 3P26A 4UKDA 1H8ED 1UJ2A 1ZNYA 2PT7A 1DAIA 2AFIE 4A2PA 2CNWA 1A1VA 4PX9A 2OCBA 2ZR9A 1GG2A 5H8WA 1QG4A 2EFHB 1Q1BA 3P4YA 4IFBA 4JBXA 4AKIA 1R7RA 1XTQA 2ZAOA 3I5XA 4GOJA 1R0XA 1QVAA 2FF7A 3AKYA 2IHYA 3AH8A 4DEXA 3G5UA 3RAPR 5GJVC 2IXGA 2D3WA 2GTPA 1AJEA 4RD2A 4DT1B 1SXJC 2AFHE 5FBWB 3U6BA 1ZNXA 5H68A 2A30A 2W6IA 4UNNA 5EE1A 4R98A 2RAPA 2H1LA 2WMNB 2VA8A 4TTRA 4HSEA 2XTZA 4LSGA 2QSZA 4WOPA 4M0LA 5G41A 3R8FA 3A37A 2CHVA 2FE4A 3BS4A 3KKQA 2GXUA 1HQYE 4F93B 4KV9A 4DLZA 1W4AA 2NOAA 2ZRFA 4M8NE 5L3SA 3AP2A 4X8HA 3B9QA 3T61A 1KMHB 4A82A 1FUKA 4TZ0A 2GWHA 1E0AA 4LHWA 4II7A 4ZV4A 5IF9A 3VR6A 4OI0A 2C98A 4BZXA 3D8BA 4LHYA 1TX4B 2FNAA 2IEYA 2OBLA 3H1TA 4OQXA 1E9CA 3VKWA 4YQFA 2C2HA 2IF2A 3MUFA 4TMWA 2W58A 4LYFA 2ZI9A 3BB3A 5DE3A 4ERNA 5L8VA 3QENA 3SBDA 2JLZA 4P33A 4YXWA 4AYXA 3THYB 3WHKA 3EZ6A 4AIIA 2F9LA 1OLOA 4ZCIA 4RZ2A 1YVDA 1W0KD 1FTNA 3DHWC 3KXKA 3TH5A 1A4RA 2ZYWX 5G40A 3QBTA 4ZI2A 4QGAA 2WKRA 5KPDA 1EFHA 1YZGA 2ZIAA 2O5VA 3L0OA 1N5KA 4MYHA 2VO1A 3LWNA 1ZRHA 2JDIA 4PC3A 1W44A 3GLFA 3WNCA 3QXHA 4HLDA 1IJEA 1LW7A 4I1UA 3AF0A 2OCPA 1S1MA 4L5BA 3AUXA 5CDFE 4HLUC 2IUSA 3I92A 3CO5A 1II8B 4G5RA 3JZMA 5FH9A 2VP9A 4FXPA 2QGZA 1E32A 2PJRA 4GT1A 4V0NA 4KFTA 3GEEA 1G6HA 3WHLA 1ZM7A 2ZJZA 1RRFA 3GPLA 4A15A 1SVMA 1II8A 4V0ME 3B60A 2C99A 1ZP6A 3O8BA 5EUQB 4KSCA 4US2R 1E0JA 4Q4AA 4EUNA 4MYCA 4MDFA 4Q4JA 1OB5A 1XD2A 4Y0AA 4B74A 1W0JA 3LVRE 1WF3A 2CDNA 2R6FA 1KI6A 2QPOA 4HLQB 4DHEA 3EASA 4XVQA 1Z3IX 1HE8B 2X2EA 3EWSA 4DSOA 2HF9A 4RKFA 5K8UA 1F48A 3WRXC 1LVGA 4BECA 3D6TB 1T8UA 1TMKA 2TMKA 4IOKA 3WYFA 1E69A 1KAOA 2XSZA 4LV6A 1W0JD 4DKXA 2QA5A 2ZI5A 2A3RA 3U2QA 1JBKA 5KNCA 1XTJA 3IIKA 2IYUA 1P7CA 3QIAA 3LX8A 4EPVA 4TLCA 1WXQA 3MWJA 1N2CE 2GCOB 2N46A 2XTMA 1F5NA 1DG1G 1G8FA 1Q1ZA 2QORA 2A7QA 2VP4A 3GEIA 2CLSA 5A5GA 3REFA 4LJ4A 1G8PA 2OBNA 2NIPA 2FSHA 4B3XA 4FCWA 1FL9A 1TUEA 3SYNA 1YR6A 1AN0A 2HYIC 5EUMA 1E2QA 2WJJA 2ZE8A 1AZTA 2P2LA 2DFKB 1H8EA 3DZDA 3SQXA 2HJGA 3UK6A 3F8TA 5CITA 1XTIA 2QAGA 4RCYA 1S1CA 4AI6A 5K8TA 4QRHA 4B2LA 1XFAA 5GJWC 3QVUA 5IDVA 4HATA 3TW8B 3AGPA 1E2JA 3PFIA 3FMOB 1DBSA 3H4MA 4FCVA 1RIFA 4B35A 4V0KA 2OAP1 2KWIA 3LVQE 4Q47A 1F3OA 3QNUA 3VKGA 2ZUCA 1OXXK 2XGJA 3W90A 3FFAA 2CL0X 1VPLA 1NG9A 4YDHB 2BVNA 3IIMA 5E7MA 4YONB 4ZDIA 2O52A 5LB4A 1WBBA 1WQ1R 1KO5A 3TLXA 4D0LB 1JAHA 1KNQA 4U00A 1R5BA 2YNMA 1MO5A 4NU0A 4PC2A 1WP9A 4M9SA 3SNHA 1Z0FA 4OQNA 2J3EA 2QM8A 4JJZA 4PZZA 4A2WA 4K81B 621PA 4MUBA 4QBHA 3KX2A 1FFHA 1Z22A 4IXMA 1E2NA 1U94A 2BMFA 4IJMA 1US8A 3VNUA 1SHKA 3N2EA 1OPXA 3GLHA 1O87A 3BRWD 4GPTA 4B6FA 3AP1A 3PG5A 5GADl 1D6JA 1X86B 2CK3D 3F0TA 4DSNA 1IN4A 2YZ2A 3IHLA 3VR1A 1U99A 4AYWA 4GRAA 1GNQA 5J4HA 1UKZA 1TQ6A 1XRJA 1VMAA 2ASEA 2WWWA 1YR8A 2P67A 4NCNA 1MRNA 4IXNA 3QKRA 3B82A 5SZHB 2NPIA 4HAUA 1GKIA 5HZKA 1NLYA 2B92A 3JZAA 1S8FA 1DAEA 2OCYC 5E7JA 2FSGA 2BKEA 4Z8YA 5B30A 3RSLA 1PV4A 4JLDA 3VR4A 3UXMA 1P6XA 2UZIR 5TB5A 1HA3A 1AS0A 3U60B 1TQ2A 2VP2A 3X2SA 1NI3A 4OBEA 3A1WA 3PENA 2V8OA 1IOZA 3FHOA 4FWIB 4P32A 3ZVRA 4QGFA 3SFZA 4CW7A 4PQFA 4XVRA 2WKPA 1E9FA 4BEJA 2CL7X 1XPOA 4KVGA 1KK1A 4DLWA 2QTVB 3CPHA 1KJZA 1G4AE 4YLGA 1NJFA 4RSGA 2ZR0A 1KY2A 5AR1A 2A5FA 1VECA 3AF1A 2XZLA 3RDPA 3CX7A 3N2IA 2OT3B 1BH2A 1P75A 1PJRA 2JLWA 4DCUA 1G291 3S1AB 1G8YA 4HAWA 1G64A 1N5JA 3TSZA 2CMKA 2GAOA 2FZLA 2PEZA 3PEUA 4TMXA 4CT5A 3AVWA 3TW4A 1FX0A 1KMQA 4CEIB 3RLFA 3REGA 1S9HA 4E5UA 5IRCD 2OBMA 4JLJA 2JLQA 5FOTA 3A4LA 2CVHA 3LBNA 2EYQA 3QY0A 3K0AA 3LW8A 2FN4A 3BWDD 3EC2A 2JLUA 1F2UB 4GDFA 5JCZA 4MITA 1UDXA 2IXEA 1E2GA 4RD6A 5FI0B 5JI2E 2R9VA 1QDEA 2C96A 5DSZA 3NTUA 1D9XA 1MO6A 3FVQA 5TDHA 2I4IA 4Q5IA 1VIYA 1ZNWA 5KSZA 3EIQA 1ZM2A 3K0FB 1EFRD 2KBFA 2RGEA 1E9SA 1OFIA 4LV8B 4WXRA 1P2TA 3VX3A 2MMGA 1XXHB 3DMDA 4JJKA 2AKYA 3PEVA 2GJAA 4LI0A 2ZI7A 4EIWA 3LLMA 4EFNA 2ZJYA 521PA 1NSFA 1G17A 2RGDA 5CYPA 4F4CA 2EYUA 2LCFA 2ZYTX 3MCAA 3I1FA 1W47A 2YWEA 3QKTA 3UPUA 5F9FA 3K8YA 1KI9A 4GP6A 4AYTA 3EPKA 2OG2A 4CRWB 4EPXA 3GJ6A 2ZRJA 5L3RA 3GLGE 3PUWA 2O0KA 3DKPA 3U4QB 1E99A 4KLZA 2ZSEA 3W9YA 4C0BA 3EG5A 3CF2A 4JLKA 3A1SA 4OK6A 1NNEA 4W9MC 2W0SA 3GJ0A 3KQLA 5DISB 5JJKA 2VEDA 2VRWA 2OXRA 4QJ4A 2O8EA 2QAGC 4WXPA 3MFYA 1E9RA 1FPMA 4KYUA 1G1MA 3KXIA 1CF4A 2WWXA 1NN5A 3RABA 3NXSA 2FFQA 1XU4A 3GLHE 3FKSD 1AQYA 2H7VA 4DB4A 2V3CC 4HLCA 1LNZA 3SC3A 2D2EA 2E9SA 2ZJAA 2VBCA 1NIJA 3CNNA 4BLSA 3O47A 2GA8A 4Q4JB 3BK7A 3RS4A 2PZEA 5SZIA 2JLXA 2WPDD 1CJTC 2XNDD 4I1SA 1T0JB 2HUPA 4BLPA 3C8UA 4TYYA 1DAHA 4C0JA 3BORA 4ACBA 5DNYB 2WWIA 2ZSFA 4O2RA 1LF0A 4NKRA 1Z83A 1XWIA 3G82C 1M34E 1NVUQ 1P9WA 2XJ4A 2P3SA 3OESA 2QBYB 1E2IA 3U7FB 3HP1A 1I2DA 2VP6A 1JI0A 2BM1A 2WSSD 3VFDA 4ZCLA 1OFTA 2ERXA 1YE8A 3ZVLA 1CR4A 5FTMA 4EPYA 5G3YA 3QF7A 3GFOA 5CM8B 3A4MA 1U8YA 5ELXA 1U2RA 4G5QA 4LJ6A 1Z29A 2GAAA 2HCJB 3D31A 1K5GA 4FW9A 2AL7A 1Z07A 3MWYW 1A5TA 1ZC4A 4Q19A 4YC7A 1G9XA 3BAFA 4JYCA 1II9A 1HV8A 2W83A 2WSSA 3QE0A 2CVFA 2VLIA 4IOLA 1YRAA 1ZVQA 2HEIA 2J0UA 2CEAA 2G0NA 4RD3A 3KQKA 1BYUA 1E79D 1QHIA 4GOKA 4LBVA 1II0A 2DYKA 4XWKA 5FPKA 4WA7A 1VCNA 3K0CA 3KQHA 3DOEA 2HYDA 2HLDA 1Z2CA 3NBZC 5JS8A 3T1VA 2B6HA 1U8ZA 4BFTA 2O8EB 5KNDA 2FWRA 4A36A 4FMDF 1T5LA 3H0KA 4B75A 2FMXA 4AK9A 1FMJA 1FZQA 3CIOA 3ZDQA 1AM4D 1GRNA 3K9NA 5GJBA 5CK4A 3EIEA 1OHHD 5E7IA 1GSIA 2ZREA 1YZUA 5DI9A 3ZS9A 1W46A 2QMOA 1GNPA 3QF4A 1RZ3A 5TMPA 5FUVA 1CLUA 4BZQA 2PCLA 1Q20A 3RANA 1L2TA 4OK3A 3WP1B 4A6PA 1OH5A 1CJVC 4IW3B 2CE2X 1JJ7A 2BMJA 2VHUA 2VYFA 3D3QA 2WJVA 4ESVA 4TLAA 2ZRBA 1JEEA 3M1IA 2WV9A 5BN5A 3CPJB 2GHIA 3VQTA 2J0QA 1QHXA 3RS2A 1TEXA 3CR7A 4NL4H 1FQKA 1S0UA 3GCGA 2QROA 3PUZA 5G3ZA 4ARZB 5J4KA 2MSDB 1GUAA 1R0YA 3B2EA 1IONA 3IO3A 4CYMA 5KSYA 5JJLA 4AKGA 1IBRA 2G1KA 1NN3A 3OZXA 2C77A 4HEJA 3L8YA 4RCZA 5KO2A 2IYLD 1FW6A 5JS7A 4C2TA 3LAWA 5G53C 5EE9A 4Q18A 2ZI3A 1Q12A 1X1RA 4P31A 3UANA 4XSHA 5L3QA 2REOA 2JLVA 4LHXA 5BN4A 5BYKA 2OE2A 1J90A 5KDDA 2ZU6A 3IEVA 4YMSA 3BFKA 1SULA 1VG0B 4GP7A 1NY5A 1DOAA 1XJ0A 1X8LA 1IN5A 3NDPA 3BE4A 2W2VA 1XTSA 4TT3A 2OCAA 4X8OA 4B33A 2BV3A 2EFCB 5EP2A 1R8QA 1MABA 3R7WB 4DRZA 3CKLA 5FTNA 2F3TA 2QY9A 1G18A 4FIDA 3EPLA 3PXGA 3SJAA 1E2LA 4KLNA 1UEJA 1GRRA 3CUEF 3MWLA 1KSJA 1G4UR 4KSBA 3AF3A 1AKEA 3NH9A 4A0GA 3V4FA 1J7KA 3Q5EA 1Z2AA 4PSKA 3X1WA 5FUWA 4DLVA 1UAAA 2ZETA 2HXSA 4QBFA 2WOOA 3TJZA 4DLUA 1U9IA 4Q9KA 2YWGA 4HB0A 3RNLA 2QE7D 1N6PA 2IWHA 4TQAA 2NO0A 4EQ6A 3CH5A 3SE0A 1YZKA 4QNRA 2XEXA 4QHYA 4TLBA 4LYJA 1KI4A 1VG9B 2J7PD 4PANA 4ESHA 1W2GA 2NG1A 4KHZA 5FL7D 5JSZA 1KO1A 3OAAA 4PC1A 2Q3FA 3A8TA 3VAAA 4GFDA 4MYTA 3KJGA 2RGNC 2XAUA 4Q7JB 1ETUA 2O8BB 2D74A 3R9XA 1NF3A 4BFZA 3TQCA 2R2AA 3O8RA 2QQ0A 1OW3B 2FG5A 2J7PA 2QTFA 4YMTA 2BKUA 4TMVA 3OIWA 2JJ1A 2WJHA 1QZXA 2YHSA 2WWGA 4JLAA 1BYIA 2ATXA 3B7GA 1K5DA 3DEFA 2GZAA 1EG7A 2QZ4A 4OHZA 3AM1A 3CM0A 1E2DA 1M7HA 3AB3A 3L0SA 3QBVA 4LHVA 5EE3A 2QRNA 2KJQA 2ZRAA 2JJ1D 3B1WA 4A8JB 6Q21A 3OEED 1LY1A 2J7KA 3WP0A 2QG6A 2VIIA 1L4UA 4A0HA 1FTSA 3GP8A 2JJ8A 3SQWA 3Q85A 1EFCA 5GJCA 4S2EA 4ZKDA 4OI2A 3KKNA 5J4VA 4D25A 3GLFE 1UKEA 2NO6A 2IYYA 3BXZA 1JECA 4F4IA 3KFVA 3IQWA 3OEEA 2FSFA 1AS2A 1ZIPA 2R6AA 4H1UA 1XNJA 3MAAC 4NYIQ 4I1OA 4MKHA 4O3MA 1M2OB 4C9BA 3HU3A 2PX0A 4NMMA 2PJZA 2ZS8A 2O8FA 2BHRA 1IM2A 1E2MA 4R7ZA 4XH9B 1GIAA 2A78A 2ZRDA 5EP1A 3Q5DA 2CLDX 2GZDA 1G3QA 2WJYA 3U7HB 1E2EA 4HDCA 4Q1CA 4Q48A 3T1OA 3FB4A 3LBHA 1NLZA 121PA 3S1AA 1JJVA 4A6XA 1JR3E 1YZTA 1S96A 3Q3JB 3DL0A 2B7CA 1SXJE 1JR6A 1EWQA 4QXAA 1R0WA 4US0R 5FBLB 4JLVA 3ONWA 2ZJ8A 3VNVA 4LWZA 1SGWA 1N5LA 3ICQB 2V1XA 1KJWA 4UQOA 3ADCA 1QHSA 1FP6A 2C03A 4Z8XA 1YR9A 2G3YA 2CL6X 4AURA 4DXAA 4JL8A 2IYXA 3SEAA 2B21A 2R65A 5TY0A 3RWOA 1NBMD 1S9DA 1JR3D 2KB0A 2Q9BA 4TL8A 4DJTA 2QEQA 5LPNA 3GJ4A 2F3RA 1XD8A 4PO8A 3TR5A 1FX0B 3EA5A 4URZR 4EKDA 3NHAA 2VSOA 4Q4AB 3Q7QA 5E95A 1U0LA 4BFWA 1XCGB 3O8DA 1TPZA 2J46A 3KB2A 4A92A 1XMIA 1J2JA 4IKEA 3QEJA 3SFVA 3K9GA 4MRSA 2AX4A 4C30A 1CKEA 2L0XA 4C7OA 2H5EA 1M7BA 2XNSA 1T91A 1Z6XA 1ZM9A 3LRPA 1VTKA 2IYQA 2XXAA 3PIRA 2RH5A 1Z6YA 4ACAA 2VP5A 3KKMA 2B8WA 2JEOA 4KYIB 1AA9A 1N6KA 3KTAB 2IW3A 3VU9B 2QP9X 4IDQA 1X3SA 3W8NA 3U4QA 1LTQA 4HZUA 5AUPB 4LBYA 4Q1EA 3UMFA 4DDVA 5HPYB 1OXUA 3T35A 2R44A 5EXSA 3CPEA 3O8CA 4OHYA 2X1VA 4LOAA 4ILEA 4CEHA 2YC4C 4GOXA 1NSTA 2FPLA 2E87A 1N0VC 3CR8A 2PZFA 4JKYA 5FPTA 3CRQA 2Y8EA 1LV7A 4LDJA 2ZRNA 4NCHA 4Z1MD 4PQYA 3KJIA 1HEIA 1DADA 4IEIA 4DDWA 3VMFA 3X1DA 4Q66C 3EZ2A 1FMLA 4CEHB 1NIPA 2ANBA 3E70C 2PBRA 2C78A 3HYRA 1KTVA 3K70B 2K5UA 3DO6A 4A9AA 3K53A 3X1ZA 2Z4RA 4OK5A 5HE8A 1OIWA 2D4HA 3SR0A 1KI8A 5FPHA 3PUXA 3LH5A 4R2HA 1YZLA 3K0CC 2BWJA 4Z1MA 1G7TA 1W49A 3BH7A 821PA 2X19A 1SXJD 4TZ6A 1YHNA 4NYMR 3QKUA 1CR2A 2IUTA 4RZXA 3LNCA 5TV2A 1T9HA 2QAGB 5AJZA 3NEYA 3OFNA 2XTNA 2ZRMA 5JEEA 1N6NA 4BEBA 5AUNB 4HAYA 5BXQC 1VKJA 5JRZA 1JNYA 1KKLA 4Q03A 2ZUBA 2ZRPA 5LD2B 1MRSA 4C0KA 1QBKC 1ZINA 3NBXX 2V7QD 3FKQA 2D7CA 4WZ6A 4IVPA 5JBQA 3K70C 3VKHA 3GEHA 5TVKA 2KE5A 4PHHA 5D3MA 4BLQA 4Q7KA 3G0HA 2F1HA 1HQCA 4TSFD 4G0NA 4I1VA 2H16A 2DWQA 2QNRA 2QMUA 4KO8A 4WAUA 4JT2A 2WMOB 1CU1A 2C9YA 2ZRCA 3CBQA 1P9NA 2IHBA 1H8HA 4IRUB 3NH6A 4LCBA 1XMSA 2F1RA 5D3MB 2PLFA 3CB4A 3CF6R 4C0HA 1KSHA 1QG2A 3DOFA 1KY3A 3QEOA 3R7WA 4TSFA 3DM5A 3T15A 1N6RA 2ZRGA 2WWFA 1IN7A 1GITA 3IHWA 1H8HD 4G5GA 5IK2A 5JZVA 1TEVA 4A4DA 1GNRA 3ZQ6A 4URVR 3ZVMA 2QUZA 3AQ4A 1UDWA 2FH5B 4PFSA 3SYKA 1PLJA 3T5GA 4BLRA 4DLRA 2DWOA 3Q8XB 4G5SA 4IDPA 1G7CA 2CNWD 2JIZD 3CX8A 1VCMA 1XXHE 2GK6A 4Q02A 3KKPA 2ONKA 5AWFC 3KKOA 3GLFB 1A7JA 3EZ7A 4QFMA 3AEZA 3BIFA 5CYOA 3V00A 1CTQA 1T5IA 1RFLA 4PHFA 4ZO4A 4TYNA 3QF4B 2IX3A 1YQTA 3CNOA 2JIZA 3F3YA 1G8GA 2B8TA 2IL1A 3EX7C 3TBKA 1JB1A 1CBUA 2EW1A 1Q3TA 2GETA 1JR3A 2ORWA 4LJAA 3TIFA 5JHHB 4M53A 5FR2A 4DC9A 1EXMA 1R0ZA 1LS6A 1BMFA 3ZVNA 1KI1A 4KXFB 2WWYA 4KODA 1SKYE 1GRQA 4LC0A 1Z6AA 4W5JA 5AUOB 1OXSC 4NYJR 4DDTA 1DELA 2DHRA 2PH1A 4P3YA 1UADA 4Q9LA 4B71A 5LDDC 2WIBA 3ADKA 4E03A 1E2KA 1CIPA 2IK8A 1F6BA 4GNKA 4ABYA 3L0IB 4I4LA 2ORIA 2AXPA 1UM8A 1VYTA 2A5YB 4EJSB 1W2HA 1GILA 5HR5A 3GJ8A 4RFVA 1ANKA 5FR1A 5ANRB 4D0GA 1W0KA 5JI3E 3CX6A 3IGFA 1ZUHA 4KFRA 4NYJQ 5SZJA 1N3BA 3AKDA 4ZCMA 1RPZA 1Q0UA 2CJWB 2BMDA 3ZQJA 2YOHA 1R6BX 5EXPA 2VF7A 3FWYA 1V43A 2B7BA 3NC1C 3QG5A 3TQFA 1MH1A 3ZZUA 5FTLA 3AVVA 1GKYA 3Q9LA 4TN1A 4CT4B 1P61B 1BIFA 5EQTA 4PZYA 2WZQA 4Q21A 5CIWA 4JIMA 1GWNA 1QHGA 1GVNB 1RW4A 3EA0A 3SZRA 3SHFA 4BFYA 4UNRA 3L8ZA 2WTUA 3K9HA 4IOMA 2BEJA 5EP3A 4QC2A 3TUJC 4M2LA 2QPAA 3IPYA 2VHQA 4QM6A 3HDTA 4XIGS 1WB9A 1EK0A 2MSEB 5DN6A 4C0QC 2IWRA 1AQUA 2WAXA 2FX3A 4A8JC 1G41A 2YKGA 3GD7A 4LGMA 5HCNA 4F91B 1XZPA 2QT1A 2N1BA 4PO9A 1KI6B 4QHSA 5AK0A 1NL3A 1OJLA 4JVMA 4TQ9A 4UNQA 3KUDA 5BWMA 1RRCA 4WBSA 5FPSA 1QHYA 5EXXA 2EQBA 2WICA 2XOKD 1IY0A 2GEDA 4Q1DA 1XD9A 2RGCA 1ZD1A 1J8YF 3NVAA 2FV8A 5F98A 3K09C 4Q9JA 2GF9A 1D8TA 1D2NA 2PZGA 3IKJA 4LPKA 1KSGA 4CVNA 1FNNA 2W0MA 4ZDWA 2XSZD 3SJBA 1DG3A 1RRGA 3I4LA 4N0DA 4DIDA 3TSOA 3EW9A 2XOKA 4DWJA 4AY2A 4UXJA 2KBEA 2G88A 2PMKA 2VTKA 3BFVA 1NMYA 2JJ2A 4JVNA 5DHFA 2G83A 5JECA 4DT1A 4XSGA 2ZR7A 1MO4A 1NKTA 2W00A 1GZSA 4UXIA 5FPYA 4OQMA 4B76A 2D62A 1N6OA 4PO1A 3I8XA 4WVFA 1RYFA 2YVUA 3C7KA 4P0TA 1RC8A 4DBLC 2ODWA 2OLJA 3ZIAD 2QN6A 5KSPA 4AWXA 1JAIA 3I72A 1ZW6A 1OKKD 2ZSBA 1KIMA 3TGPA 3A1UA 1AK2A 3P32A 2A5DA 5KYKA 1G19A 4D6PA 1FP7A 2J0VA 2ZE5A 4MKFA 4NYIR 3HPRA 3CRMA 3QPVA 4YDSA 4ZIRB 2DFTA 3A36A 1OE0A 4EPWA 4IFEA 2Q0HA 4DB2A 1CJMA 1VG8A 4D4JA 1IHUA 4AG6A 4EPTA 3MJRA 2GVZC 2W6ID 2ZE6A 2OFXA 2BJVA 3CRW1 4TMTA 3LX5A 5AUQA 4Z54A 3U7EB 2H57A 5HKKA 3GJ7A 3NG1A 2IS1A 3ICEA 5CLQA 2EFGA 4DUGD 2XX3A 4A8JA 4XTCS 3LY5A 4O2LA 2OEPA 3WMFA 2GDJA 1IQPA 1T3LA 2LKCA 5FI1B 3IEUA 4Q01A 1Y3AA 3OIYA 4EFMA 1VHTA 4XJXA 2CE7A
chains in the Genus database with same CATH superfamily
4JSTA 1DRUA 3HJNA 4AUMA 5GTDA 3AINA 5C8YB 4F92B 1I5OA 3AUSA 2PV7A 2QF7A 1SVKA 2D1TA 1YT5A 3PQ4A 1V0JA 4IH9A 3PPIA 3PQDA 1HM5A 4KQCA 4NCKA 1RHQA 2VP0A 3D7MA 3ZD6A 3D7RA 4UDYX 1D2CA 4JWKA 3TOCA 1O2DA 1V7PC 1GCUA 1KH1A 3SDZA 4DCNA 3E48A 1N0HA 4FI3C 5KVQA 2QMEA 2V6MA 3QMVA 1XDBA 1YZQA 3QHQA 5AESA 2AMYA 4Z4FA 3BAZA 4FYYA 3VHLB 3TEJA 3OJLA 4Z9XA 4N3NA 2PUGA 1EBBA 1WNTA 4AKEA 3CLVA 2JDID 4BE7B 4WW0A 5IMSA 1O3YA 4EY6A 3AHGA 1NTOA 2YXPX 2JLSA 1VFNA 1XHLA 3DA8A 4GYJA 4B3CA 1K4MA 4RACA 1QTNA 2C3YA 1BS9A 2PR7A 3F9CA 4DLBA 3UK1A 2ZFUA 3R3VA 2FMUA 1TZBA 1Y80A 5AM5A 2QDXA 4YXWD 3TZ6A 2VAVA 4LK2A 1XBTA 4DLNA 5FBQB 4Y1GA 3ZVKA 1UXJA 4IZHA 4X24A 4WLEA 3RIYA 2LZ0A 5DCUA 1CUBA 1XAIA 3THXB 3GCWA 3N05A 4E07A 2JATA 3BTVA 5IKXA 1QGED 4B6RA 2P68A 3WA6A 3WQBA 3EIFA 4DR6B 5CW1A 2PKWA 1XQ1A 3WL3A 5JHGB 1NUPA 1OWPA 3LUPA 4ETWA 1AHHA 2ZYGA 1IY9A 4YR9A 1GNSA 2X0FA 1WCWA 1OVGA 2DWPA 2PGAA 1PAUA 3D9QX 1GYQA 3FTDA 3Q0IA 3L5KA 3ER8A 2FWIA 4Q9HA 4BO8A 2AW5A 3DWGA 1E9AA 4MWZA 2AK2A 2D5CA 1N2XA 2VF8A 2IT1A 2XCQA 4BQIA 2F1IA 1Q3KA 1KSFX 4OFWA 4ZVOA 4RKRA 3WKEA 4YPVA 4A1FA 3I09A 1N1EA 2L2QA 4PBTA 3L0PA 4KMMA 10MHA 1FQWA 2GGSA 3L01A 3R3SA 4MPPA 2C7GA 1E98A 4PG6A 4YGXB 2B1IA 3VBEA 13PKA 1N34B 3AI2A 3P2EA 1F12A 3CG4A 4P3OA 1TECE 1YR2A 3VR3A 1ESZA 4CL8A 2GK3A 1EFKA 1N75A 2JRCA 4BMVA 2PWAA 3UOGA 1DHTA 1F1JA 3CW8X 3HDGA 5EHIA 4UE2A 1BE6A 2BFFA 3ND9A 1I4LD 4TMKA 5LP6B 3I5UA 4DCVA 2C92A 1FXWF 3SEFA 3E7WA 4D1YA 2V4ZA 1SCNE 3G6KA 2RBKA 3DLTA 4TS1A 1QBGA 2YRWA 4DSUA 3ZJYA 4MDEA 1CC1S 2Q3DA 2JHCA 2R1VA 3I2FA 3GQBA 1SXHA 1KQNA 2O8DA 1AKWA 1SQ0A 1VKRA 1GPUA 1AUPA 2CFCA 4AQYB 2X77A 5JXHA 1LPOA 2X6QA 4U2FA 3WGNA 3GLIA 3L3BA 1XDZA 2FZCA 3AF2A 4LJYA 1ML3A 2GLUA 2AJLI 2JAPA 3ZK8A 1M6WA 5C81A 1BQEA 1KDPA 2YJGA 4EGSA 4MUNA 1H2EA 4HWRA 1OA1A 3UXYA 4EL5A 3W6ZA 5U4XA 3DZJA 1DGQA 1U0NA 4A0QA 1NUSA 2P78A 3ZLTA 4N0EA 3ESCA 5SY4A 4I3HA 2WDPA 3R24A 2NUTA 2I4TA 5AW6A 2C5LA 3Q6IA 4JLUA 4RSMA 1WDTA 3GZTB 1WPGA 4YJ2B 1XB2A 2VHTA 4AT1A 2V0GA 3DS8A 4Y6LA 3M81A 2XUZA 1FDVA 4Q1AA 1SUAA 1YUBA 1XEWY 4LC1A 5AI9A 4E5PA 1IZ8A 2ZBUA 5E2IA 2XMGA 3WXMA 1TVCA 4F7WA 3ZDBA 1Z33A 5KIAA 4LXTA 1T2EA 3PEEA 1EGHA 1Y1KE 4TS9A 3G9TA 2FUEA 3C16C 4IGEA 3FTQA 4HR7A 1ZXLA 3CHYA 3VZDA 5IM4F 1J99A 4UE3S 5KTYA 5JZSA 4QDKA 1Z8HA 5JH7F 2MOKA 1FQOA 5ESWA 5GPBA 1ZDMA 2OCLA 3SQNA 3L1UA 3ZLVA 3HR4A 1HE3A 1KJQA 3WX0A 1WMAA 3F6RA 1QYIA 3RFXA 1LSSA 3FHTA 1QG0A 2CB9A 3NT5A 4RJ2A 1VBNA 3GLHB 2CZCA 1BS1A 1BWSA 2EATA 1GL6A 2R8BA 3AGQA 5FJIA 1J39A 1Z4IA 5DI3A 2XR1A 4CKEB 2VDJA 3LXMA 4HQ6A 1NBAA 2R3SA 2C4HA 1LX7A 2P2CA 4EMSA 3IMKA 1ZU4A 1IN6A 1SHUX 2R6HA 1X1DA 4LQLA 2C4NA 3ESRA 1NN0A 2H51A 1E1QA 4MR8A 4NP6A 4PZDA 5KTKA 4CGZA 1GRCA 4G3XA 3NLLA 3GJ3A 3L7IA 4MRNA 4J7CA 3A6PC 4B9EA 4V02A 3P8ZA 1TK9A 1WVMA 5DTRA 3CEJA 3TD9A 1TJ4A 3RHFA 3IT1A 1BNCA 2XUKA 1U90A 4GM4A 3WLEA 1ESCA 1PD0A 3IAEA 2RC6A 1EUCB 3QVWA 5F9HA 2IX9A 2WZDA 2GFHA 4HSGA 3TTVA 3NHSA 3LUFA 3DCNA 1MJGM 3E1SA 3GO4A 4ZEXA 3GRKA 3BHJA 3AV3A 5ALJA 2ZTUA 3UCXA 1HRKA 3LLCA 4KE8A 1SCJA 4D9BA 3EEQA 1RNLA 3IUPA 4D79A 2NV6A 1V37A 2X8WA 5BOSB 1EM6A 1K0UA 1A9YA 3FM9A 3OM0A 4K9NA 4RHEA 2H2WA 1MR3F 4B87A 3TKLA 3H2HA 3T7RA 1Y3BE 1CY6A 4BASA 4FR0A 2O06A 2ZJ2A 2A5GA 3KETA 3WGMA 2Z8XA 4DNXA 5C18A 2I7TA 1F3LA 4FFMA 4KR7A 1E63A 3T3MB 4QKQA 2OHFA 4OVKA 3B1JA 3DEZA 3C5WP 3BCSA 1SG9A 1E94E 2VDQB 5D01A 5BUZA 5HIIA 4G5OA 4WACA 4V2UA 5L3VA 1YRYE 2JIRA 2G4CA 3A6ZA 2I2FA 4I55A 4LVNA 3ZYCA 1DQPA 4C1BA 3LC7O 3P52A 4BFVA 4W5OA 1RI5A 1G6OA 3L8FA 3FOCA 4RETA 3CZPA 1E3WA 5FD8A 4R8LA 2JFUA 4HAZA 4CUKA 2ODTX 3HXTA 3ROTA 1TNDA 3IYLW 5KVCA 2L17A 2QRLA 3V34A 2AWNA 1V16A 2SHKA 4BPBA 1UMBB 1MO3A 2C2WA 1QP7A 4JR1A 1ZL0A 4IIYA 2HSJA 1PYOA 4HNAA 4L57A 3LC2O 4UHHA 2FDXA 1NE2A 5EE0A 4KL8S 4FYKA 3E18A 2FRDA 4QPCA 4M99A 2Q0QA 2W8ZA 2HIMA 2YC2C 3CW9A 1C30A 2EEPA 1TW2A 2YL2A 2WMDA 4GPZA 4OH7A 5JBIA 4NULA 1L3CA 1O58A 3MZ0A 2RGBA 3OPMA 4Q1FA 4XSVA 3O4FA 1YU6A 1X7YB 4I08A 4BVGA 1DWOA 2VDLB 5JNWA 5K0GA 1TZCA 5BUQA 2GH1A 2HZ7A 2O0JA 4F6LA 2WHQA 4N9QA 2FGKA 3X1MA 3VX4A 1UMCB 2JI8A 3KTAA 1Y8QA 2KSQA 1RJ9A 2Z3ZA 3BXOA 4QXMA 5C7LO 8OHMA 5GM2A 2EJTA 4YP5A 5LC1A 1NJ8A 3F5DA 2ZT6A 3F96A 4DQUA 5I51A 5DBIA 5JCJA 5IUNC 3KWFA 4QOGA 3NKFA 1ITZA 1F60A 1JR2A 5CVDA 4ZC1A 2XCRB 4OYRA 4X7BA 5C53B 1IOWA 4MJ7A 4KH1A 3GJYA 3P0IA 5D3KA 1NVXQ 2ZRHA 3D8TA 3OTHA 4LF9B 2FN9A 2OV1A 4KLAA 3MYYA 3WO1A 3OTIA 2Z6VA 3FOEC 3NOVA 2WJZB 1BROA 1XF9A 3JQ6A 1YS6A 3PNLA 4IJUA 2IZ7A 3OEHA 1LXCA 3PITA 2X0RA 1I51A 3UH1A 2NQ2C 5FNVB 1BFDA 1TU4A 1NONA 2QP4A 4I5EA 4M1TA 4X63A 3TAHA 3DVAA 2FEOA 3PXXA 4IGIA 4KQKA 4Q39A 1AG9A 5J58A 3K1AA 2OV2A 5IT5A 4I9HA 5B64A 3CW2A 4PAOA 2OFWA 2ZPAA 3ADOA 3I1IA 1N5OX 4BO6A 4MZDA 4HCJA 4L8WB 2J33A 5EKXA 2M1ZA 3DDSA 2X0EA 5IHPA 2CCKA 1ORWA 1NVVR 1B3RA 3WLJA 1TGVA 4MRRA 5DH9A 3HBNA 1NW6A 2P6PA 2B5OA 3O4HA 2QR2A 4LTMA 2P9EA 4QUHA 2NXJA 5CT6A 4J49A 1L4KA 3KHTA 3VOAA 5K0JA 1XCMA 1D1QA 1DT3A 1PYGA 1Y98A 2FFHA 1KDOA 2FETA 2Q4TA 3EE6A 3IIJA 3U7QA 1GGJA 3SJZA 4ALIA 3BTOA 5LKRA 3DP9A 1CP2A 1XMXA 5LQMA 1HT2E 3QWAA 2ECQA 1XCPA 3K7EA 1SHJA 4M6WB 3RFUA 4EH1A 3PWSA 4H31A 1KQOA 4F38A 1DDGA 1USGA 2AK3A 3RJMA 4Q4HA 5DCYA 4GGOA 4MKIA 1VBKA 5J40A 2CUKA 2Z9CA 3PHJA 5SYNA 3IRVA 1JILA 4CDGA 1U3GA 3D8HA 1XLVA 1ACLA 3AKEA 1FFSA 2XMPA 1WA5A 2IE8A 2XYQA 3L49A 3ZWBA 4B7CA 4BGEA 4EAAA 1IBLB 3JYHA 1E3LA 1ONPA 1YCGA 2X22A 1RFGE 2DLNA 4G8JA 2I33A 3T5MA 3T7JA 1FRVA 1GPKA 1OFUX 2XUFA 3UYLA 4R71A 3T34A 5KTRA 4B8WA 2JLRA 3HBJA 2B2NA 4JKOA 4XEHA 2PT5A 2QT9A 4Z86A 2VTBA 1FJXA 1VJGA 2AE1A 1IJKA 1ZNZA 1EBFA 3A9WA 3THXA 1COWA 1IAQA 5AK4A 1KE2A 4G67A 5I7FA 4QAJA 5CA1F 2ZQ5A 1SY7A 2GM3A 5EJ6A 1XZGA 4XOIA 3GX1A 1PEAA 3OHSX 4KN9S 2QENA 1FYXA 1S2NA 1F2TA 5CVVA 4D8UA 5BMVA 5KJFA 2XQGA 3NTOA 2JGDA 4HWGA 1QDUA 4NBUA 5K8JB 2WY2D 4FD2A 2R79A 1I7SB 2ZVQX 4OJKA 2O5CA 3RQIA 4YYZA 2OZKA 4URWR 5AW1A 2WE8A 4L95C 3IR6A 1DVRA 3NC0C 4IHQA 3MWDA 3H9CA 2OILA 2Y1XA 1JXMA 1JQKA 3FPLA 1P60A 4EKYA 1AXEA 3VTZA 2ID9A 4KPGA 4XWGA 3HB7A 1T9ZA 2QMHA 3RYCA 1MKYA 3MQ4A 2B1JA 5SZKB 1JRLA 3N8NA 1I3MA 2GZHA 2ZSHA 4FHDA 1ECLA 5F1OA 5GQSA 4C2UA 1OYYA 2FGJA 4TWIA 1UOEA 4E3WA 3HU1A 2BISA 3IJ5A 4QBTA 1VE3A 3AO0B 4QXOA 5HDBB 3ROZA 5KNDD 1Y1PA 4LTDA 1BQ4A 1S01A 5HZMA 3DF7A 4RF4A 4O4IF 3A1VA 5CLGA 1NUAA 1OBFO 1QTRA 2CCGA 1XK7A 2CXUA 2OHOA 1SVOA 3UCEA 4CR8A 4O2BB 3FPEA 1FYEA 2FW0A 3CUYA 3F4LA 4OUKX 2OK7A 1E6WA 3QEKA 1JAXA 4L8LA 1OHHA 1ZIDA 4RYDA 5ITZA 3IOMA 4YP0A 3MRSA 2J4CA 4B80A 2ID7A 4P9NA 1YL7A 3ONFA 3THWA 2IUYA 1XA3A 2QSJA 3FRHA 2M1XA 4JYMA 4JVLA 3TVYA 2QS9A 3E58A 1RE0A 2G77B 3EH2A 3IR7A 1NW3A 2C4KA 3L8HA 3ROEA 2GZ3A 1UXOA 3RODA 4ZI7B 3A9RA 3CRRA 3P9CA 1CUEA 1CDEA 3FZYA 3A4TA 2H4XA 3GLIB 4JGIA 2W2XA 3QUSA 2YJTD 1PK8A 3TIXB 4UXHA 1HNXB 3ZUGA 3TZLA 2BGGA 4EZEA 3WHIA 2C7PA 3OZCA 3THYA 1ZCJA 4E5KA 3VU1A 3GLRA 2OSBA 4KXNA 1V2GA 1DAFA 3MM4A 4NV1A 1Q0RA 2BOVA 3WLNA 2BFNA 1E7SA 3DPUA 3PNQA 4DHWA 1NXVA 3BERA 2X8AA 1H2WA 1YFKA 1FCJA 1YR1A 1FXUA 2OTCA 4KI0A 3R7LA 3VJLA 4ZYVA 1E89A 1UBCA 1ZI6A 4F72A 4MQFB 4AJ2A 1K7SN 4PFQA 3B6IA 2FPIA 3HKEB 4KNYA 3A1DA 3NEJA 4RLHA 3KTOA 1IM5A 4JD5A 5DK6A 5DTEA 5F2KA 3U37A 3U39A 4HAVA 1D2EA 5B2ZA 4DPLA 1VRCA 3HBLA 5BWLA 3T3OA 2A0KA 1R10A 2PGNA 2NPFA 2BFCA 4HZIA 4AS2A 1RI4A 3LBIA 1W36B 5IJ0B 1TOAA 1MP0A 3FUUA 2XVMA 3PNMA 3NX4A 2WM2A 1KGSA 1U3FA 4BTLA 4MUAA 4YX9A 4EHJA 2PS9A 1VA5A 1WMBA 4MR9A 1WBDA 4DANA 1ZJZA 1XZLA 4MSUA 5REQB 4OLAA 2X6TA 3KQMA 4FQ7A 2EFDB 1WZEA 2H18A 3EFEA 2VPQA 3F7TA 3QUBA 5LZ8A 5J47A 4LJ8A 4EJSA 2XQJA 4PAQA 1ZCZA 3C6YA 1EE1A 1XV5A 3F5FA 1RWKA 1ORIA 1WXWA 3BIJA 4RJLA 3STTA 3UHJA 1CRPA 2C97A 2MJLA 1L6IA 3MGAA 2WG1A 3BB4A 3IDFA 4QFCA 3LTEA 2XYRA 1B0UA 3H18A 2Z58A 3MS2A 4L5CA 3N0WA 4WFKA 2BONA 4OFXA 2VVTA 1GPDG 3PTLA 1JSXA 4RPCA 1VIMA 4YQYA 5I3ZA 3ZGLA 4N8EA 1SKAA 1I32A 4BN5A 1T2DA 2PXXA 4MGZR 1ZUWA 1C7RA 5DYGA 4BFSA 1IN8A 2IY9A 3ISVA 5M29A 4I55B 3AM3A 4F7DA 1AKYA 4QTUB 1FTWA 1UWKA 1JKJB 4GG1A 2YMMA 4YMGA 4JJGA 3OLXA 3I12A 4QEDA 1EVKA 2QPTA 1RVDA 4NZNA 4PZUA 7ABPA 5B3LA 3LDFA 4MPJA 5AW4A 1VYUA 2XZPA 2ZAGA 4RTPA 3H86A 1RXVA 1HDYA 2LE0A 1GL7A 4URXR 3ZWVA 2W2TA 4H59A 4HNAB 1Z16A 4Q3BA 5FL7A 4JXZA 3AVQA 1VE7A 3DMTA 3UIEA 4YHBA 1K5HA 1T0PA 3C7DB 1R4MA 2XNKA 1I30A 4UNSA 1SCUB 2JEZA 5K8IA 1SOVA 1BU8A 3LD9A 2XXAB 5EWLA 2X5OA 1NBHA 3EXFA 2R751 1XDDA 4MVJA 1NR1A 5KTNA 5AW0A 1CEEA 3UMRA 2GF2A 3GA5A 4POAA 3IBYA 3KE8A 3IULA 3OIVA 5DNCA 1FUEA 4B09A 1AQNA 2NZ8A 4A03A 2IYFA 3H99A 1QO0A 2VNAA 4KDEA 1X38A 1NE7A 1GTRA 5CIQA 2P6NA 3AJ8A 5ILQA 4BMNA 3BFXA 3FLMA 3NBYC 4X20B 3RCBA 3PIIA 5C8ZA 2BFMA 1NATA 2GHRA 2HR1A 1E7WA 4JWTA 4MVJD 5A0TA 1POXA 4WLOA 4MI1A 4B4KA 5BR4A 3VGPA 5DYIA 4MGKR 3NYQA 4TL7A 5BQXA 5F64A 5ETJA 3OF5A 4DWVA 5KWSA 1Y9EA 1P7PA 4W9RA 2Q2NA 2E55A 2HHLA 2NZWA 4UAUA 1QRDA 1N9KA 3TEFA 2CFTA 1K8RA 3V9AA 5C2JB 1DO0A 3AERB 3KJQA 4RTKA 1VDMA 3R8CA 3A9UA 1KO8A 1A9RA 1WR8A 3IUYA 3BCHA 3CX3A 1KZ6A 5CLLA 4KQMA 3AM4A 2EP5A 1GL9B 2FEMA 2VJOA 3AJ9A 2OLEA 2QT0A 3ZU3A 1VL0A 3CGWA 1R8YA 3FPCA 5ERXA 2IEAA 3AB7A 1E1CA 3ZHYA 1ADFA 2HA7A 4JYBA 1QR6A 3FPSA 4JLMA 2NZJA 4RY2A 1LNQA 1YRHA 1T4GA 1VE9A 4MZXA 4TLDA 3KV1A 2DFLA 1L4MA 1PSZA 4HC4A 4URUR 4RWEA 1ISGA 3LUHA 3CH6A 3O21A 4CQMB 3GCDA 2RGWA 4BGDA 1DJOA 5DJ5A 2YIDA 2RH9B 4M1WA 3ASZA 4P4SA 3UWPA 3AXSA 4LYHA 5DM2A 4CF6A 1JQBA 4B48A 3SDSA 4E1AA 4F5DA 3EAFA 4NARA 4R1UA 4U0KA 3SZOA 3FNBA 3H1EA 3I9KA 3SCZA 1ZMOA 4MB6A 2PUBA 3OQIB 3N8GA 3NDBB 3AP3A 3U7JA 2P5TB 4DR1B 4B0OA 2BW0A 3EUFA 3LQ4A 3AETB 4K3VA 4JU8A 3MELA 4OU4A 1CB0A 1EM8B 4JH0A 4PO9A 2WSMA 1IDOA 3OQMA 3K8QA 4FFWA 2JGMA 4DDUA 2WM9B 4Z53A 1JVBA 2GJ8A 4LMPA 3W9BA 4W7SA 5KDLA 1C29B 2C00A 3RM3A 2IYZA 1RAGA 5HJ2A 3U26A 2GTHA 5A02A 2UXBB 3GJZA 5EP4A 3PRJA 1ZK2A 2JNWA 3A1FA 3BMOB 1IEVA 2X86A 4FBGA 4GMKA 4ZOLA 4BP8A 4DR5B 5T8KA 3QSYA 4CEIA 2ZDQA 4D82A 2JL1A 3U44B 2JCGA 4L4RA 5C3UA 3LMKA 1ZM4A 1BN6A 3IX7A 4L5YA 3QXCA 1HQKA 4MA4A 3RGGA 4ZHQF 2D00A 5A3QA 4HDRB 1KBZA 3E23A 3H6KA 4UTZA 2GJSA 3EEBA 1TM4E 5IZ4A 4BNDA 2AG1A 2W2OA 3PC3A 5A71A 2QLMA 2UZ3A 3HCPA 1LS1A 1Z2DA 2BGUA 2C3PA 2QN1A 4ZV7A 3AVYA 1HDXA 2MWMA 2PWPA 3VH2A 1JDBC 4ARAA 2P3OA 4DQLA 5IT9A 2R62A 1QE3A 3AEKA 3WBJA 3SR3A 3OZDA 3JWPA 2XUAA 1P7YA 4IEEA 5ICCA 2QUIA 3B6KA 4I1IA 4P58A 2NGRA 2F3UA 1LVUA 1IXRC 3DFKA 3N8KA 1BWPA 4CGYA 2ERCA 4TKVB 1SHZA 3AEXA 3MILA 1XHFA 2BEWA 1J1UA 1L8QA 4L7VA 3EOBI 3CLTD 2OYSA 5I7EA 4E14A 3CLSC 3DBOB 3LT5A 5B6JA 5FOQA 4GPAA 4L4UA 3QTBA 5JNTA 2GN6A 4MICA 2IF0A 1YXMA 1O5IA 3K2QA 1H0RA 5ED4A 1U8XX 4KUEA 4RQTA 5BMVB 3KVOA 1A71A 2VSNA 3KJEA 3KQSA 1KETA 2ZZKA 3O4JA 1OMOA 2GFIA 1PLLA 2BSAA 1RYYA 1AE1A 1Y7LA 3A1CA 3ANYB 1HDCA 3MIZA 4RE6A 4UZEA 3SGLA 3A3KA 3HEBA 1R0LA 1GSOA 2FEKA 4MAFA 3KTDA 3JALA 5CA0B 5FV4A 1DZ3A 2NWQA 3KZOA 1QLHA 1Z2EA 4WOKA 1YO6A 3MK31 4KQJA 3GLUA 3IP8A 3Q40A 2ZJBA 3O9ZA 2QD4A 4FILA 2P65A 4KBGA 4QOJA 1K7YA 1RAFA 4KMSA 2OXTA 2I71A 3EAGA 1NAHA 2A58A 3EC1A 3FBTA 5KZMB 3M1AA 1RWQA 1XPUA 3O8OA 2HLHA 1KEEA 3AVUA 4M9QA 1DEAA 2YH2A 4RHFA 3MTEA 1Y1QA 3HNRA 3OTGA 4DCSA 2GN0A 4K6FA 4IR7A 4Q4HB 4QULA 5TNXA 4YMVA 2OAQ1 1PNOA 4M8LA 5EC8A 5EMLA 3RUEA 4X60A 4OATA 3N53A 2BUBA 1P0MA 2ZS7A 5FHQA 3RT7A 4CLRA 3TOZA 4JOBA 2XCTB 1N1DA 3CKKA 3HVKA 2XNHA 4IX1A 2PN1A 3U31A 1A8QA 2GNAA 1TCUA 4IIEA 3V2UA 3E3OA 2QYHA 4IZ6A 2VHCA 2Z9DA 1QRAA 3AHJA 1YDWA 4I36A 1DE0A 2C59A 1QIDA 4MVWA 3T4XA 3QPUA 4AP9A 4RY9A 3PI7A 3WBFA 5K8LA 1IVSA 4ZI7A 4OHXA 5LNK6 1CQXA 2H1CA 4DLYA 4G4IA 4UJ3A 4XUCA 2PV0A 3DKRA 2RK4A 4TTQA 1AGYA 1CETA 2VNSA 3MTQA 5ULLA 4DIEA 5HCIA 4UU8A 2ENWA 2VJMA 3O7MA 1OILA 4INJA 3IIEA 4GD3Q 3RTAA 3SZLA 1O1YA 3HJUA 3T9FA 5ARBA 3NVMB 4ZEMA 4I8XA 1DAGA 5FT9A 1YB4A 2WFLB 2C4WA 1FUIA 3A10A 2JD1A 1YMUA 2BFBB 3DE7X 1WDWB 2B94A 3N86A 4WNIA 1ZOSA 4ISCA 2FTKE 3ZV6A 1T5HX 2N42A 3KL4A 1I5EA 3M4YA 3PEWA 4R2JA 5CB4B 2VJKA 4DMKA 4C5CA 4GMXA 1SU8A 2OA0A 2F43B 3KEQA 4PX2A 4CFZA 2J5XA 4V0MA 3OQ6A 2QTRA 1D5CA 2V7WA 3G23A 3ZZTA 5AKEA 3HKCA 1TB4A 1RWBA 2XB4A 4AY3A 4XTRA 2FOLA 2VSXA 1YZFA 4L8GA 1SZDA 3ELWA 4M49A 1I01A 1N2GA 3FKJA 3MS4A 4P5PA 5AHWA 3E9EA 4HZUB 4N1AA 3EHDA 4LDAA 4W8OA 1UBFA 3DEYX 3UN1A 3UAZA 5CDFA 4PC6A 3U1TA 1WSWA 5CXQA 4AUNA 5JSQA 4CKCA 3T1NA 1OT3A 3VZPA 4C0SA 1EA7A 1JXOA 5JANA 4X6YA 3WK7A 2I8LA 2NN3C 3N70A 1RQGA 1JFFB 2RFLA 2WT4A 4INZA 5BRNA 3U1VA 1B76A 1BXKA 1K89A 3IOYA 5AKZA 4KPFC 4XCQA 3CSSA 4MCHA 5AVWA 5A6SB 1HNZB 2C9BA 2PD6A 2VHVA 2JS7A 3KJHA 3TLMA 2HNAA 5J2TA 1UKVY 2XB2A 1YCHA 1YNOA 1MOSA 3WNZA 3AU8A 2GEKA 2DZDA 2ZAIA 1MABB 1ZUIA 4FDUA 4RHXA 3WADA 3RKSA 4PZLA 3W06A 1Z15A 1UPCA 2LD4A 4FYWA 2GJKA 3O82A 4JB0A 4I6GA 4NH0A 1N7GA 3TNDA 5CD9A 3JVVA 4XX0A 4FLMA 1CQIA 1V7CA 3NDIA 2G8LA 3QXSA 1BHO1 4GZMA 2XE7A 1N3IA 4KQWA 2XI4A 4RL4A 2NVUB 2YWXA 3HHEA 2AWOA 4Z0PA 2Z43A 2Q4BA 4KO1S 4DNQA 3NVDA 5CDHA 4XXHA 4RFSA 3NWJA 1V7QA 3F78A 4V03A 1LDMA 1Q22A 3LQQA 5HBGA 2FSVA 2I78A 3PP8A 4ZZ2A 2Q5LA 1P73A 3O83A 1QU3A 2TMDA 4JI8B 3ULKA 3UG6A 221PA 2AHOA 5TGZA 4CJXA 3ZDFA 1F8YA 1R3UA 3GUZA 4R9RA 4R68A 2XNJA 4INPA 4BKQA 4S05A 2MSLA 3V33A 4LYAA 3THOA 5HWSA 4BO4A 3VNQA 1CDOA 3FWHA 1P62B 2CUNA 3M6UA 4JXXA 5HRUA 2V5UA 3HY4A 4O4JF 3B5IA 4YUAA 1DBWA 4GO1A 3WL6A 1JIQA 2ROQA 4MEAA 2OENG 3L2OB 4QX6A 3SQDA 3EZFA 3JZDA 3GC6A 1FF9A 1N5MA 3LHFA 3FVTA 4C22A 1UXGA 2NVBA 3T7SA 2A5JA 5LCXA 4EG0A 3DP7A 3IVMA 3A0RB 3RHZA 1ZBDA 1I7QB 2ZPUA 3H2JA 1MB0A 1C1XB 2G5TA 4NZOA 3VVCA 1B93A 3M34A 1C0KA 4ZOBA 4XIYA 4GUDA 4L3OA 4Y98A 1JEDA 4LRTB 2W90A 2PX2A 3EC7A 2HDWA 2NPOA 4ILKA 3DF9A 1KFEB 1P3JA 1V48A 1X1QA 2NXEA 4R9UC 4CIWA 4BRUA 3UBTA 1TTTA 1WXGA 2IS4A 2G36A 2VT6A 3AETA 2RGGA 4KXVA 5E0OA 5KYGA 2NTYC 3E5RA 2HMUA 4Q00A 3GARA 4PHGA 1O94C 3BEOA 3PCRB 1CRWG 4IVRA 4C05A 3OOSA 3L1VA 4JEHA 1VXRA 4X3CA 2NU6B 1VE6A 3EARA 1C3OB 5BSWA 1QUFA 4DQVA 5LQCA 2NU8A 2Q3HA 1XLWA 2I2CA 1KJIA 2OESA 2YY6A 1QQ6A 3OZTA 4QQNA 1DS6A 4L7QA 4EY4A 4OB8A 3GFTA 4BKPA 1YE5A 2Q9AA 2OGWA 1WVIA 5KYYA 4NSNA 3ZE9A 4YB8A 3WXBA 2AKAB 3DCJA 4FMCF 4LKOA 4S35A 1VJRA 2GAIA 2AC4A 2H1IA 2R86A 3OFSA 4M88A 4R0VA 3LYLA 4YI3A 4IDOA 1JG4A 1I10A 5K3FB 5BN3A 3X43A 5JRDS 3PLAE 4H17A 1XDSA 3C4JA 3LPNA 1CY7A 3OOWA 1MEEA 4LXHA 5DIZA 1G55A 4DCTA 3DNPA 1J42A 4RKEA 4EHAA 2ZIUB 2C7RA 4DAEA 4XE5A 5JBNA 4YCNA 3D7KA 3IAS1 3MG9A 2XKJE 2HA3A 3TB4A 2QN8A 2AN5A 1J8MF 2YINC 2HMAA 5JMTA 3NHPA 1IY1A 1WLYA 3WK4A 1GJRA 4GWKA 3ZH9B 3ZWWA 3AW8A 3B1ZA 1XE3A 3AZOA 3MSXA 1L7DA 4R1QA 4REOA 3TXAA 5HF9A 3WOVA 2HCBA 4D56A 3RC2A 4DMLA 2RI6A 2FCAA 2D7JA 4IKOA 4DLTA 4FS3A 4XD7A 2RBGA 4EW3A 3GXOA 2IUUA 2ZKIA 3D3WB 2IEBA 5DIFA 3S2FA 2O23A 1ZJJA 1YASA 3MFQA 2FZ4A 4JUCA 3TRFA 1CJUC 5DTIA 3WMEA 2AXNA 1FU8A 3KYDB 2XT6A 4EEKA 1AX9A 2H0RA 2WTAA 3W8RA 2GVDC 1Z06A 4FYPA 3IAHA 3V4OA 5J2UA 2IIPA 1OC4A 2EFJA 2AFHB 4HQFA 1VPWA 1NW4A 1QR2A 2QHXA 1G3MA 1L5FA 3P26A 4F6RB 1AK9A 2XGSA 1UJ2A 1E8MA 1MTZA 2PT7A 1N8NA 3EYWA 3NQ41 3I6BA 5F35A 5K0NA 4HNRA 2ZR9A 1TU0A 3EJWA 3P4YA 5TRTA 4CKWB 4XB6B 4A23A 1XTQA 2X0IA 1XA0A 2P4QA 4NICA 2NXCA 2QMZA 1YZYA 3CT4A 3WWOA 5KC9A 3SIXA 5ALUA 1H2RS 3DWIA 4FDVA 5DGHA 4GVXA 5F4ZA 3AH8A 4PR3A 3MWEB 3CPSA 3DZBA 3RAPR 5D5QA 5GJVC 2KM1A 4GEKA 5KNCH 1QH1B 1J2TA 2D3WA 4Q3KA 3ON5A 2GTPA 3KQWA 1K97A 5LXTA 1Q17A 4RD2A 4DFDA 1AJEA 1MVNA 1UIRA 3HFJA 3NAGA 4EK9A 2DUUA 4XI9A 5FBWB 3U0BA 3U6BA 4ZO6A 3HFGA 1QV6A 5I4KA 4FVTA 4PYOA 1NYQA 3CJQA 4PM4A 2WMNB 3OKFA 3K9CA 4HSEA 4OB6A 1R6VA 2QSZA 4J0HA 4M0LA 3R8FA 1UWCA 4M55A 4F04A 3KKQA 1B6GA 2RHTA 2A84A 2P75A 1F20A 2PYIA 4NENB 4FJ0A 1X74A 3WIOA 2XODA 5CFNA 4YO8A 3FWNA 2NOAA 3HK2A 5CP8A 5L3SA 1ENOA 3T61A 5KNBH 1BVHA 1FUKA 2OECA 1ISPA 2GWHA 3PQ7A 2P9QA 4MOWA 4B84A 4PG8A 1F9AA 4IM7A 4ZV4A 3LY7A 3CCBA 1IHYA 2C20A 3ZQUA 2AKEA 4BZXA 1HK7A 3COWA 3D8BA 1JVNA 1HE4A 1TX4B 2FNAA 1PG5A 4JELA 4B6QA 4YQFA 4YFVA 1P5JA 1PEDA 4IIVA 2ZBQA 3JAKB 4ERNA 1JU9A 2WUWE 3QI7A 1UBRS 5CT9A 2UYCA 3HJFA 3FSGD 1JMKC 1ZRNA 1YJ8A 3GFGA 3ST7A 2N75A 5IBPA 3OQJA 3ZIDA 4BB5A 5AXDA 1YVDA 3TH5A 3DHWC 2WJWA 3KXKA 1PJBA 2HPAA 3QBTA 2EOAA 3TZBA 1NQXA 4WDRA 1N5KA 3GRFA 2VO1A 3LWNA 4K6GA 4YALA 2IIVA 4D6YA 1XAGA 5IXJA 4M54A 4B4DA 4OD0A 1JA0A 3FNIA 3O2JA 2JIPA 1EX9A 3BE5A 3MJEA 4HLDA 3WNCA 1OXMA 2NYAA 2YW2A 3VYRB 3BWVA 1JLLA 2ZBDA 1KPIA 3LOQA 4L5BA 4B4VA 4YV1A 2IHNA 3VAYA 3AUXA 3WGHA 1OBOA 4J1TC 4P6VF 3OCWA 1D2GA 3DFIA 1XU9A 1V1MA 4FXPA 1P1BA 4GT1A 4V0NA 3TW6A 2JANA 3IVXA 2FRDC 4LZJA 3W3AD 1EJBA 3WHLA 3DV0B 3ZWMA 3KLMX 3FWKA 4C2BA 3AEQA 4P3NA 3NVKI 2ILVA 1II8A 1SU6A 3RIGA 3GQBB 1G9SA 1YR3A 2QW1A 1KYZA 1N2HA 2CB0A 1E0JA 4UFPA 3RVSA 4U1RA 1T2VA 2QTBA 4EUNA 5JFTA 4MDFA 4MI9A 4Q12A 2CWWA 2XF8A 4BRZA 4I9NA 3NNNA 1EJ2A 1I6KA 2CDNA 3LVRE 5TS3A 1AKMA 3C45A 1HE8B 4WSOA 4YCAA 5AI6A 5HYVA 3GPLA 2J9YB 2NYVA 5JCOC 3LUJA 2FFRA 2C31A 3D7NA 3GLSA 4TSKA 1AV7A 2ZYAA 4BECA 4CMIB 5K0LA 2TMKA 4IOKA 4WKPA 3WYFA 3HM9A 3DE0X 3MTDA 3WL5A 1KAOA 3L6RA 1V9SA 3HNPA 1KJNA 2AB0A 4DKXA 2QA5A 2A3RA 1DT5A 1FRFS 1DUIA 3LPMA 3E22B 4KXXA 4PXYA 4HDNA 3N75A 4G1FA 1ZK4A 3BWCA 3ZY2A 4DQ0A 5ISMA 3NV7A 1UFRA 1FNSA 3NWOA 5A6SA 5KWIA 1P7CA 1Y4UA 3QIAA 4MR8B 4XFKA 5DNVA 5LNK1 2VSQA 3MJSA 4U7FA 4TLCA 4FZJA 4KI7A 1IHDA 1N2CE 2C0QA 2GCOB 3DLIA 5CHYA 2XTMA 3TTXA 1F5NA 3K9FC 5THQA 2A7QA 4LRSB 3G2NA 4M98A 4FPXA 2WZCA 5T4BA 3ZY5A 3IT2A 3MUEA 2FKNA 3HKBA 3OMLA 4D9CA 3HJCA 4YCCA 2G80A 4XM2A 1X77A 2VCEA 4AZ3B 3QNMA 2HMSA 1DRVA 1NRWA 1FL9A 2P27A 1TUEA 3JD4A 4MUYA 3SYNA 3QEAZ 1S2GA 1BU5A 3R7FA 1LLCA 1TMOA 2HYIC 1E2QA 4J16C 2WJJA 2ZE8A 5B55A 2VDNB 2B1RA 1WB4A 4NNJA 2IZ1A 4WA8A 3SIWA 3HDVA 1Q91A 5D85A 4FB4A 1RRVA 2FQYA 4QOHA 4QUEA 1U0FA 3SS9X 1I33A 1RLOA 4J7AA 4B2LA 5TLSA 1XFAA 2O2CA 3D1LA 5IDVA 3AGPA 3O4VA 3B36A 3LDHA 3NT2A 1DBSA 2XOEA 3H4MA 2D6FA 4B35A 2OAP1 3OJFA 2ZZNA 2KWIA 3LVQE 4MQEA 5WRFA 1CY1A 2GLTA 5EIBD 1Q0ZA 1RMYA 1WB5A 4D3FA 2XGJA 5B7PA 1PJ3A 3LT0A 4PLCA 2FDRA 3FFAA 1CK4A 1WTAA 4C1NA 5C34B 3DVAB 1B8UA 4QVIA 1DHRA 5DNEA 4AY5A 2C1ZA 3T41A 4KC0A 3PUJA 2A5LA 3MPOA 2VRBA 2Z1DA 3PNBA 5LB4A 3H5RA 1CFZA 1WQ1R 1QOPB 4LISA 4D0LB 1NDQA <