3FGNA

Crystal structure of dethiobiotin synthetase in mycobacterium tuberculosis
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
230
Chain Sequence
FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Dethiobiotin synthetase
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 72
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fgnA00
3AF2A 4URZR 1UKVY 4I4LA 1QHGA 4DHEA 1EFTA 1IBRA 2NO7A 1HURA 1NN3A 2PZFA 2GJAA 4IRUB 4ZCLA 2B8WA 4OK6A 5DSZA 3VAAA 5AJVB 2HCBA 1ZUNB 1ODFA 2PCLA 4TL8A 4NMMA 1QZXA 2ZI6A 4LK2A 2OZEA 2GJ8A 1NJGA 1GDDA 1X6VA 2W6JA 1L4UA 1QVAA 4GMXA 4C3ZA 1P2UA 1Z0FA 2E9SA 2RHDA 2ZQ5A 5DIFA 1KSGA 1NY5A 2EQBA 4QL3A 1W49A 1ZJ6A 2YJTD 4JBYA 5KUTA 4P33A 5KDOA 4F4JA 3EARA 2C98A 3RDPA 1YZLA 1ZMXA 2H8KA 1QHHA 4M4SA 2W2XA 3QBVA 1Q1ZA 5FI1B 2QAJA 3A4NA 8OHMA 3QNUA 4L5BA 3B82A 2Q3HA 3KTAB 2ZE5A 2D62A 2JDIA 2KBFA 3NH6A 1IY2A 2IYVA 2IL1A 3UATA 2CL0X 4Q02A 4KCGA 3U3MA 2ZYTX 3UMRA 3TSZA 4YMWA 1HYQA 5FL7A 1UKEA 3IGFA 3QKTA 4JKYA 2L0XA 1XTJA 4K8OA 1E1RA 3K0AB 2FSHA 4XTRA 4DLUA 1HQCA 5G3ZA 1SVOA 2A5YB 3QOFA 3K09C 4YMTA 1C9KA 1P2TA 4OQFA 3P27A 3SHFA 3L2OB 2V7QD 4UNRA 4Z8YA 3PEUA 2GA8A 5FUXA 3WBJA 2GK6A 1UJ2A 3AUXA 2QAGC 5H1YA 5FBQB 2R6DA 4RZ3A 3MCAA 1ZNWA 1TU3A 2FFBA 5FPHA 2GZAA 3ZQ6A 1NBMD 2FFHA 5EXPA 1CEEA 3TSWA 2ZRAA 1QHIA 4M9ZA 4LWZA 1OIWA 1HUQA 2OCAA 3NHAA 3BB1A 1RYHA 4YLGA 2P67A 3SJZA 2LWIA 4C0AC 1F2UB 2WKQA 3CR7A 3IIJA 3J81k 2NOAA 3GPLA 4YDSA 4PPFA 2PL3A 2JLRA 1D8TA 2Z6VA 2GXUA 1AZSC 1WXQA 3LWNA 4NYMQ 4ARZA 2WVJA 4AKHA 3D3QA 1Z6XA 4LBZA 3BOSA 3IQXA 2IUUA 4OI4A 3ZS8A 1IXRC 2IYQA 5C18A 5KO2A 5C4MA 1PLLA 4NYIR 4EPVA 2F3TA 2AWOA 3BS4A 1R5BA 1YHNA 4Q1EA 3ZVLA 4Q1AA 3RVBA 1ZC4A 3TQCA 4N0EA 3E2IA 2G1JA 1T8TA 4EQ6B 3PITA 3B78A 2FSGA 1DG3A 1NL3A 3A36A 1F2TA 5HKKD 1X86B 1UKZA 3FDIA 2RGEA 3WYFA 2IT1A 4U00A 1N5KA 4MYHA 2A9KA 2IEYA 4XD7A 2WWGA 3KZ1E 1J8MF 4FMDF 4DVGA 5BXQC 5TY0A 2BOVA 1T3HA 3EASA 4DCNA 4XVUA 5FI0B 1TADA 6Q21A 1DPFA 1ZD1A 3GJ8A 1OB5A 2IYSA 1EXMA 3FVQA 3QVVA 3EA0A 1N6KA 2YINC 4JYBA 3GLFB 1NN0A 2G77B 4TMVA 2ZJ5A 2QI9C 4JMPA 1X8LA 4U02A 3SNHA 3ZLJA 1FMLA 4BLQA 3DZ8A 3IBYA 2IS6A 2ZR0A 4ESVA 4DDUA 2JJ8A 1Z3IX 5FR2A 2PEYA 5BYKA 1E2JA 2P3SA 4HATA 1I4LD 3VHXA 3QKSA 4EUNA 1IY0A 3RC3A 4LJ4A 3EC2A 4JVSB 1XMJA 4IFEA 4EJSB 2IYZA 5DISB 3P1JA 4ZDJA 4HUTA 3ZVMA 1S4QA 1UKYA 1NNEA 3ZYCA 3QPVA 4KV9A 4NL4H 4RZUA 1FNMA 1XJQA 3UG7A 3TR5A 1CR2A 2QT0A 1KO8A 2WHXA 3K0CA 1US8A 2BWJA 4PO8A 4JBWA 4ZCIA 1JR6A 1KI9A 4FMCF 1IN7A 1ESMA 3RRZA 2GK7A 4DJTA 2IEZA 3BB3A 5KPDA 1D9ZA 1IOZA 4URXR 1T6NA 1XXHB 3E5HA 4PAOA 4OHYA 4TTPA 4LJ5A 4JLDA 4ZPXA 1GWNA 4GSYA 4TT3D 5GJVC 2XITA 5JZVA 2QP4A 1GRNA 1GUAA 2B7CA 1DE0A 5BYJA 4ZI3A 4A6PA 3ZIAA 2H7VA 4DZZA 4TSFA 2QT1A 2ZJYA 1VG1A 2IWHA 2WIBA 1BYUA 4C0BA 2EFCB 2REXB 2BEJA 1YZKA 2ZETA 1H8HA 2QE7D 3NIBA 1DO0A 1SVKA 4PAQA 4M1KA 3AKCA 4FI3C 1LS1A 1MR3F 4GP7A 5E7IA 4KU4A 2F43B 1QRAA 1R7RA 1KDOA 3L82B 2X1VA 2X8AA 1NLZA 4M1OA 4C30A 1HE8B 3QXSA 3WYGA 1G6HA 4NU0A 3PUVA 4EKDA 3L0SA 3FMIA 3MWYW 4HAWA 1G291 2J7KA 3H1TA 3DM9B 1TEVA 1ZP6A 1SVWA 4IDQA 2RGBA 1N5JA 5DI9A 2GAOA 3CH4B 4AYXA 3RC8A 2QP3A 4RSGA 3AKDA 3R7WB 4DLZA 4B75A 3JZAA 4OQNA 5TARA 4BECA 1W0JA 1HT1E 1P73A 2ZU0C 3AGQA 3E1SA 3I8XA 4LYHA 5KNBA 2W2TA 4Q00A 3LQRA 3QJYA 4OKSA 3WHLA 4A36A 1XBTA 1KZGB 3OAAD 4L15A 4Y0VA 3QF7A 1QHYA 1U9IA 2ERXA 3C4JA 3FKSA 3I5YA 1Q44A 2P5SA 2QA5A 1FX0B 1HY3A 2IF2A 1L8QA 2BDTA 5FTNA 2WMNB 1BH2A 5BWMA 1XZPA 4TYNA 2HV8A 3FHTA 3JVVA 5EJEA 5JI3E 3KTAA 1KI1A 4P4UA 1DAIA 2D3WA 4BZQA 3TUZC 1GFIA 1NVUQ 2JJ1D 3EG5A 1R10A 4B32A 2QU8A 2GVZC 4AC9A 4CYMA 1E69A 3SU8A 4LPKA 1FFHA 2PMDA 3SDZA 5DHAA 4O25A 2D4HA 5F98A 1H8HD 4HB2A 3PEWA 3ZS9A 4DLWA 4HAYA 4QRHA 5D3QA 3CUEF 2YYZA 3NC0C 1EX7A 1IN4A 1O3YA 3FGNA 4O3MA 5DYGA 3K0AA 1KAGA 3V4FA 2WAXA 1JNYA 4P31A 1ZVQA 3A8TA 1XPRA 4YONB 1M74A 2IYTA 5FBLB 4AG6A 1GM5A 2PT5A 4LBYA 1EFRA 3L0IB 3QIAA 4QXAA 2F7SA 2QAGB 2D06A 4TL6A 2RB4A 4CVNA 4PTLA 3DOEA 3P20A 3QF4B 5LB4A 4JS0A 2GESA 4B47A 4DLYA 4NCKA 5KSOA 3TUIC 4KI0A 4TN1A 4QJ3A 1JBKA 2XTZA 4RD4A 4KITB 3WNDA 1MT0A 4KVGA 4PO9A 1ZC3A 4G3XA 2Q9BA 2ZRJA 1OFIA 3VKHA 1CRQA 3KXKA 4PHFA 4EDHA 4K46A 2NZJA 2P65A 1W0JD 1N5IA 2HT6A 4OQXA 3W6NA 3THWB 5KNCA 1XWIA 2CK3A 1Q22A 3KFVA 1P9NA 2C9CA 2RKOA 3TAUA 4O2LA 1D5CA 2ZSBA 3THYB 4JLJA 1NVVR 1G8HA 4EPRA 4KLZA 4Z8XA 1VYUA 1IAQA 1U0JA 2ZSAA 421PA 2PH1A 1YR9A 3CNNA 4ESHA 4UQOA 1W5TA 1Z07A 4AKGA 3K9HA 1GRRA 3HU2A 3U4QB 4B6FA 4KODA 3TAHA 2CDNA 2A2ZA 3ND9A 3KUDA 2Q9AA 3EZ9A 3X1YA 1E1QD 1S0UA 1NMZA 4MRSA 4IXMA 4EPTA 3HP1A 2ZYUX 3UMSA 4EQ6A 5EXSA 1HV8A 1R4AA 2ZRHA 5E4FA 5G53C 2O0HA 4TQAA 2OCBA 1TTTA 1R2QA 1YZQA 1XPUA 1CJMA 3NC1C 3WNBA 1M34E 3R20A 3AP1A 4IOMA 3OE7D 2F1HA 1E2NA 1UADA 1EWRA 1OIVA 4KYIB 4TYPA 1HH4A 4Q4JB 3VR5A 4DSOA 1L4YA 3EA5A 4FW9A 4KVAA 2ODWA 2XTMA 3CW2A 3TSOA 1W0KA 4A8JC 5JS8A 3C5HA 821PA 3ICEA 5H68A 3NXSA 5EQTA 3DKVA 4GPTA 2ODBA 3GLFA 4EAQA 4DEXA 5HZHA 2VQSA 1WMSA 3H2YA 4DT1B 3FPAA 1VDZA 3QUSA 1RRCA 3MSXA 4NPHA 2LKCA 4NCHA 3QPWA 3LDAA 3QY0A 2BCGY 2D2FA 5DYIA 3LY5A 1X1SA 2UKDA 2C78A 4EJSA 1R0WA 5A5GA 4M1WA 2AFIE 3WP1B 4TYYA 2PJZA 3OEHD 1J7KA 1RW4A 4PZYA 2WTUA 3RLFA 1Z0DA 3ZD6A 4XWAA 1G19A 1ZUHA 3HR8A 2GBLA 2ZYVX 4D4KA 1OH5A 1ESNA 1E2QA 2JLWA 3PV0A 4LGMA 5EZ5A 2ZROA 1GL7A 3VTKA 5DNYB 4IEEA 4JT2A 1FQKA 4FIDA 2JGNA 2FDCA 4PSAA 1TQ6A 2KBEA 2F9MA 3VU9B 1XXHA 4QHYA 2KI5A 1KI8A 2IUSA 1XTKA 3OEED 4CEIB 2Z83A 1CP2A 3KJEA 1OE0A 2WWWA 5J47A 2WIAA 2VL7A 4M22A 4PX9A 2WOOA 5CITA 2J59A 5CYPA 2QRNA 1UBCA 2H17A 4NYJQ 5HE9A 3U7GA 5EE3A 1ZM2A 4YMSA 4AYTA 3PR1A 2GKSA 2IS1A 1UM8A 5FOXA 1M7BA 2WSSA 2YWGA 4LJ9A 2XB2A 4OBEA 4FD2A 4MDEA 2PBRA 1S8FA 4A92A 4MKIA 1CTQA 2AKYA 3B60A 3M6AA 3BD9A 1RE0A 4A9AA 1JXMA 4LBWA 4TQUS 1E4VA 2FSFA 5AJWA 1OXVA 1CR1A 2DWPA 4I1OA 2GF9A 2WBLC 3Q5EA 3W5IA 2R6AA 3B7GA 1U99A 3HR7A 1YRAA 2IYLD 3RS0A 4BEJA 1GKUB 3BXZA 1KI3A 4JLKA 2VYFA 1TU4A 3D6TB 3H4MA 2GXAA 4F92B 3LBNA 3TGPA 3BJIC 4NTZA 4QBHA 3KQUA 1XF9A 4DEYA 3RS5A 1E9EA 1PUIA 1X8KA 2VP6A 3HYTA 1E9DA 3R7WA 5KU1A 1P5ZB 1J8YF 3EPJA 1Q21A 4MKHA 5EE0A 5GVSA 3PXGA 4GFDA 4MDFA 2YKGA 3T34A 2MSDB 3MG9A 4KSBA 4CGZA 3GMTA 4D6PA 2JLYA 1YR8A 3ZJYA 5C2JB 1SZPA 3LH5A 1EFUA 2XSZD 3AVOA 4NBSA 3CF6R 2QPOA 3MWKA 3ETLA 3WMGA 2YOFA 4TWZA 3Q7QA 3B1XA 4BRWA 3BH0A 2F6RA 5JWHA 1P60A 2J7PA 1IJFA 4F4CA 2GF0A 2PZGA 4PHTA 4AIIA 4EFNA 4F4IA 1XTSA 3N2EA 1COWA 1ZM9A 1YU9A 1XX6A 4Q19A 5BN4A 3THOA 3AVVA 2WJIA 2BM1A 2RGNC 2NG1A 4UNPA 2WSSD 1A4RA 1E9FA 4JVNA 1OYWA 5JJKA 3LA6A 1CLUA 2D2EA 5KSYA 3T15A 4DUGA 2O8BB 1GP2A 1K5GA 2W0MA 2W00A 4W7SA 2IF0A 4A2QA 2QQEA 1OXUA 3K09A 3PIRA 2FPMA 2ZR7A 3QI2A 4ZDKA 4XIGS 4HB3A 1P75A 5E7JA 4V03A 5GJWC 3SC3A 3CB4A 3SR0A 4FWIB 4QG7A 1KO5A 1SQ5A 2ZS7A 2W83A 4OI1A 1XEFA 2WJHA 3EIEA 2SHKA 1EG7A 4WW0A 2AKAB 3F8TA 2QAGA 3SHWA 4V0LA 1D2MA 3WYAA 1AQYA 3WRXC 1BIFA 2KB0A 5F9FA 3QF4A 1FP7A 4RFSB 3SOPA 4ZI2A 3H0KA 1Z06A 1DADA 2GCPA 4EIWA 1XB2A 4YXWD 3U60B 1S3SA 4LC0A 3TQFA 1LV7A 3TUJC 1C1YA 5AUPB 1ZCAA 4V0OA 1QG4A 2ORWA 2ORVA 2QM7A 5CB8A 2FX3A 3ADDA 1U8ZA 4N0DA 1AK2A 2NO1A 4RJLA 5JEDA 2EYQA 2WMOB 3GLHE 2P6UA 2XAUA 3B1ZA 3GEHA 3H84A 3THXB 4C2TA 3THWA 1NVWQ 4MGIR 3CRVA 4OJKA 2FEMA 2CE7A 2VF8A 1IJEA 3AH8A 3THYA 4A2WA 1P2SA 1VYVA 4Q9HA 1YJ5A 3B9PA 4NCNA 1QHNA 2V6IA 3KKMA 4DCTA 4KSCA 2YV5A 5GJBA 3TH5A 2A5DA 3SN6A 2WJGA 4E22A 4Q66C 3K0FB 2Z4RA 3U4QA 4DLTA 3MWLA 1COWD 2NPIA 3TBKA 3I72A 3I32A 1WB9A 1HTWA 4M1SA 2N1BA 2CLDX 3B13B 5TXGA 4CT4B 2FE4A 3A1WA 1AQUA 4BFSA 1G8PA 4M9XA 4IOLA 1XJ0A 1UPTA 2BCJQ 4TLBA 1VHTA 4WZBE 2PJRA 2QMHA 3VR2A 1Q1BA 1W4CA 4FXPA 4DUGD 2O5VA 2Q3FA 2VSXA 5DN6D 3CZPA 3B6EA 1BYIA 2W6IA 3W8NA 2DCUA 1KMHB 3MRSA 3BRWD 2EFGA 1OW3B 2AR7A 3KKPA 1XMSA 2JAQA 2V7QA 4RCYA 3P26A 4D4MA 2XXAB 4Q4JA 5J4KA 1FW6A 3WXMA 2QBYB 1KOFA 4Q7JB 4RD3A 4V0KA 1W2HA 2YNMA 4G01B 2QGZA 4PSKA 1NBMA 4AKEA 2VF7A 4N1AA 1N6OA 3RWMB 1LF0A 2RAPA 1M7GA 1RIFA 2XEXA 4HAXA 3ADKA 5FOVA 4ERNA 4DT1A 4M1YA 5CYOA 1T3LA 5JMTA 5KSZA 4OL0A 4X8OA 3SE0A 1KK3A 4F91B 3TLXA 3U7HB 3LRPA 2OSBA 2CCGA 4V0ME 1GZSA 4WXPA 4XSHA 1Z0AA 2RGDA 1Z29A 5CJ2A 2HF9A 1LB1B 1N6IA 2CCKA 2HXYA 2IXFA 2J9RA 4P32A 2QP9X 3G82C 1JQJC 1DARA 5DO9A 3K53A 1M8PA 1HE1C 4JYCA 1EWQA 1XD2B 4BE7B 1DELA 4BLRA 1VMAA 2ANCA 2XTNA 2JLUA 1SKQA 5F3WB 3KUCA 5FTKA 2VPPA 4GBMA 3SS8A 1SXJE 3VU9A 1X3SA 4MKFA 2PT7A 1UEIA 5HKKA 3PEVA 3TE6A 1G5RA 4CEIA 2JEOA 4LHVA 2XNDD 4AI6A 4IOKA 4NP6A 1XCGB 1II8B 4LJYA 2W6ID 1PUJA 2AXPA 3N2IA 4PC2A 3V4RA 3BWDD 1G20E 1JEDA 2CNWD 1IM2A 1R5NA 2ZYWX 4FINA 4GOKA 4HAZA 1RC8A 1XTQA 2CEAA 1XFAA 4URVR 4IVRA 3CWZA 1T3SA 4RKEA 2C99A 4Z54A 3MAAC 4HEJA 3AKEA 621PA 1TX4B 4IDOA 1E0KA 3RNLA 4US2R 3MD0A 1GL9B 3VKGA 2J0UB 4PC3A 2OCPA 3IKJA 1ZAKA 1G8GA 2WOJA 4MYUA 3REFA 2FGKA 3M0EA 1G7RA 4RY2A 4XVRA 1YKSA 3IHLA 3GEIA 4RFVA 2NPFA 3VR3A 4CZ2A 2JLSA 1LF5A 2OAQ1 2ZJ8A 4LX0A 2ZJAA 3A4MA 3VX3A 1AN0A 3IEUA 5JSZB 1GSIA 1UDXA 2CHQA 4MRPA 3SJBA 1OYYA 1SXJC 4CEJB 4C0QC 2GEUA 4P4TA 2GEVA 3K9NA 3EZ2A 2GAAA 4M1MA 2CBZA 1KDTA 4PQYA 4JL8A 3DHWC 4IDNA 3U3OA 2H16A 4MRRA 3WBKA 5B58C 1Z08A 2VA8A 2FZLA 1CJTC 5JJLA 1YZNA 2ZM5A 2G3YA 5K8TA 1UBFA 1XTRA 4GDFA 1TQDA 4JIMA 4LOAA 4RD1A 4OQMA 4Z1MA 1E6CA 1U8AA 2ZRPA 4Q48A 3T5DA 4D80A 5JWRA 2Q9CA 5EP1A 1BOFA 4CDGA 2JATA 2RGGA 2Q6TA 2ZE6A 4TT3A 5FOTA 2K5UA 2WPDD 3IPXA 3NVAA 2DFLA 3C14C 2C9OA 3R8CA 1WDTA 4C9BA 1YQTA 3EWSA 2JLZA 1IONA 3B1YA 4ZV4A 3Q9LA 3CWQA 3U44B 1JXOA 3CO5A 4PPGA 3V00A 1MABB 1XEXB 1KK1A 1UBEA 3C8UA 2BM0A 3GJ7A 221PA 3GFPA 1FMJA 3NH9A 3KB1A 2QE7A 4QBIA 3GLIB 1T91A 2P2LA 4BLTA 3PJRA 1Q3TA 3A1SA 1QG2A 3Q85A 3QPUA 4IVPA 1S9HA 4AYWA 4H1UA 4I81A 4MH0R 5L3QB 2ZSDA 3QBTA 2R8RA 1GNQA 2JLQA 4URWR 2OV2A 1N5LA 3V9PA 1UF9A 4FN5A 1Z83A 2OFWA 3LNCA 2OAP1 4BZPA 1QHXA 4ZDIA 3IDQA 521PA 3AUYA 1TUEA 3ZVRA 1G3MA 1E2DA 3AVUA 5DI3B 1Z8FA 2HT1A 1Z2AA 4WZ6A 4RFSA 2OFOA 4CF7A 2EFHB 1Z6TA 2BEKA 3C15C 1E4YA 2GZHA 4M0LA 3KFXA 2REBA 3PUYA 2V8OA 1KSJA 3G5UA 3LW7A 1ZU4A 2CLCX 2BMDA 2LCFA 2PX0A 2ZJOA 4MQBA 4TLDA 2KWIA 3KJHA 2AD5A 3W3ZB 1I2MA 5KDLA 1JR3E 1P61B 4AKIA 3LX8A 1G4UR 2ORIA 1LVGA 4US1R 1W7AA 3THXA 3OAAA 2FH5B 4Z1MD 1T4GA 2D74A 2O8DB 4IDHA 3ZZTA 3ONWA 3BFXA 2IA5A 3CX7A 3SYLA 1NSTA 1NY6A 2ZI7A 1LNZA 2AX4A 2YWEA 3RS7A 4LSGA 3T1VA 4PHGA 2I1QA 2ATXA 4XJXA 2GCNA 3SYKA 3ZDQA 4Q9IA 3SFVA 1NIJA 2IWRA 5L3VA 1M2OB 1MRNA 3GLGB 1N6LA 2JJ1A 2XZOA 3K0FA 3QE0A 2Q0HA 2IW3A 3PUZA 2ANBA 1KSFX 3BORA 3KXLA 3CZQA 2RCNA 5FTLA 1PJRA 2B6HA 2RHMA 1E99A 1G5TA 1XCMA 2FF7A 2CXXA 4KHZA 4JLNA 5CIWA 5SZKB 1RYFA 5LD2C 2DWQA 3GLHB 1H8ED 4JVMA 3UWKA 1KMHA 5FPTA 5FPSA 1E2LA 3U6KA 4XWOA 2ZI5A 1E2PA 3L0PA 4MGYR 2OLKA 1ZD9A 2XXAA 1R5OA 1F60A 3QXJA 2FOLA 1VCOA 3IILA 2P6RA 1D2EA 1J70A 1SVSA 4LHYA 1LY1A 3K1JA 5J4HA 4KXFB 3CONA 4BFWA 2N46A 1KO7A 1A2KC 3DDCA 3QXXA 1A1VA 2YC4C 5HR5A 1SULA 4KFUA 3RRMA 1N0WA 2C5LA 3RYTC 3TMKA 4PC7A 5FUVA 3ADBA 1Z6GA 2QTFA 2O8EB 4AY2A 2ZRGA 4KFSA 5FOSA 2G88A 1PZNA 3UIEA 1T0HB 4LYAA 1MRSA 5DLQC 4YC7A 3P4XA 4II7A 4TLCA 4DXAA 3U5ZB 1CS4C 3VFDA 1VYTA 1YZGA 5KNDA 3WY9A 4JL6A 4RZXA 3MJHA 4UXHA 3UMFA 2FMXA 4ABYA 2J1LA 4OHZA 4LJ6A 1U81A 3X1XA 4B73A 2FN4A 2DPXA 3RRNA 1E1QA 4HB0A 4LYFA 5DHFA 2V4ZA 2NO9A 1TMKA 1N6HA 3K70D 3GD7A 4GOXA 4POAA 2I1VB 4Q4HB 2OILA 1J99A 1GKIA 3L8YA 2XX3A 2OBLA 4A0HA 4JLBA 1SGWA 4C7OB 4FCWA 1ZM7A 2BIFA 1ZU5A 5B30A 1MH1A 1HT2E 1KI4A 1RPZA 3OIYA 3LBIA 1NSFA 2ASEA 4NYMR 3ZH9B 3U3KA 1II8A 4XWKA 4BFUA 3RABA 3OE7A 2Q3MA 2R65A 3EZFA 4RD0A 2J46A 2QSYA 3IIMA 4LDJA 5KSPA 4B3CA 1E9AA 1V5WA 4JLPA 3FKQA 5KYKA 4BUJA 2O8FB 4Q9KA 1FL9A 1AA9A 2WJYA 1C4OA 1E2EA 5FBVB 4HZUB 4LCBA 4O0MA 1JB1A 1D6JA 2J0UA 4TL7A 5DE3A 3WHKA 2OT3B 3U7FB 1ZIPA 2GETA 2FJUA 1CJVC 2GHIA 1JAHA 4TMXA 5CLLA 1EGAA 3VKWA 4C2UA 5FFMA 2A3RA 4E5UA 2XZPA 1E0AA 2X2EA 1F2UA 3RWOA 2OG2A 3OIUA 5D3MB 4CIDA 1AGRA 1E0SA 4YQFA 5JSZA 1VECA 1G41A 1VKJA 1KGDA 2CHVA 4M9QA 4NDZA 4CEJA 3VR4A 2FU5C 1EFHA 2JASA 3OEHA 1E2KA 5H8WA 4A0GA 1FNNA 5TVKA 3SYNA 1MO6A 4D26A 3MJRA 2VP4A 5AUOB 2VEDA 5G40A 4ZO4A 3HPRA 4M53A 3CX8A 1W4BA 3HU1A 2YZ2A 4DWJA 1IN8A 3K0CC 3TVTA 2JLVA 2ZTSA 4Q4LA 3UKDA 2FZ4A 2QGNA 1S3GA 4GP6A 1CU1A 1MO4A 3KL4A 2HEIA 3W90A 1XPOA 1KAOA 4Q4AB 5FPKA 3K70C 1E2HA 3SBDA 5HPYB 3IEVA 3OEEA 2ZREA 4PC6A 1MOZA 1TL7C 2GJKA 3FB4A 1U90A 2P6NA 4QNRA 3BH7A 2IS4A 4HB4A 4DLRA 1XP8A 4BZXA 3JZMA 1TQ4A 4L16A 1TUIA 2V1UA 3U44A 4BFXA 1ZIOA 4Q1CA 1RKBA 1MABA 1XEXA 2DHRA 3E70C 3N70A 4B3BA 3UG6A 3RHFA 4R98A 1JAIA 4WXRA 2ERYA 3O8RA 2VP0A 4MGKR 3GLIA 2WV9A 3QKUA 3EPHA 4AG5A 3L43A 4JLVA 2F1JA 1Z0IA 2PEZA 4P0TA 5JWOA 1AM4D 5JHHB 1W36C 3NTUA 3UANA 1AIPA 2IYYA 4A0RA 4EPYA 1KI7A 4QFMA 3VX4A 4D0NA 2IYWA 2EU8A 3FTQA 2WWYA 4ZDWA 2GXQA 4PPQA 2ONKA 3GFTA 4DSTA 4HLDA 2NMVA 4G5RA 1XNJA 2ZITA 4EFLA 3KKOA 2PX3A 1Z47A 4XH9B 4NONA 2ZAMA 5JCPA 3A1VA 3N5CA 5IK2D 1WRBA 2XJ9A 3FMFA 2ZSFA 5EE5B 3U2QA 2GXSA 3W3AA 4W5JA 3EX7C 1G1MA 3OHMA 3A37A 4LV8B 1SVMA 4W9MC 3ZZUA 4A1FA 2V3CC 3WMFA 3RSOA 4DDWA 1EX6A 1W48A 4F7WA 5F9HA 2XSZA 4OHVA 2O8DA 4PZZA 4D25A 2ZRLA 2VO1A 2BV3A 4U7DA 4B3GA 4LJ7A 2WM9B 4M2LA 4LBVA 1Q20A 3KX2A 4F38A 1W46A 1EK0A 1ZINA 4QBGB 4B74A 2GJSA 2J5XA 4PANA 5DH9A 3GLGA 3SQWA 2VHTA 1JALA 4HYYA 4K81B 5AUNB 1NG1A 4Y0AA 4DLVA 5GVRA 2O52A 4GT1A 4RCZA 1KK2A 1KY3A 4MKGA 3IQWA 5AWFC 4B43A 1Z22A 4Q7LA 3CLVA 4UNSA 3P4YA 5L3SB 3LFUA 1D9XA 5LD2B 1UBGA 2ZJZA 3R9IA 1G18A 4DCUA 2EYUA 4V0NA 4A15A 3CKLA 2C96A 2F43A 5EXTA 3U3JA 1W5SA 2NO0A 2IXEA 2BBTA 2CL7X 1CKEA 4PXAA 1E0JA 3P32A 4IDPA 5J4YA 2JJ2A 3KQKA 3VHLB 5FBWB 2Y8EA 3VMFA 3BERA 4PSVA 1KYIA 4JJZA 721PA 4C0SA 3FWYA 5JI2E 1OV4A 1ZNZA 3QEJA 5JCZA 4BPBA 5CDFA 1AKYA 1JECA 1YZTA 3B1WA 3QQ5A 2YWHA 2BBOA 5ANRB 2VHCA 1T8UA 1ZRHA 5C4GB 2XZLA 4YXWA 4B6EA 3C16C 2Z43A 3CBQA 1KMQA 1RRFA 3WP0A 3G0HA 2O0KA 1WF3A 2XJ4A 5EZ6B 1P2VA 4IJMA 2QMOA 2QORA 2BBWA 3HYRA 3AVPA 4TYQA 5EE9A 5FUWA 4ACBA 2QNRA 1N6RA 1ANKA 1Z28A 2EWWA 2WAYA 5JRZA 1FQJA 4S2EA 1NN1A 1AS3A 2O8EA 1RRGA 1Y3AA 4LV6A 2X77A 5G41A 2ZRIA 1KJZA 1CJKC 3C7KA 1WBBA 4KBGA 4X8MA 5H70A 1FX0A 1SVIA 2IX3A 3RS3A 2HJVA 5E7MA 3EAQA 4B35A 3QG1A 2ZANA 3GJ5A 4UJ5A 4MRVA 3GLFE 3CPHA 2VHQA 1S9DA 1T5IA 2GRJA 3T06B 2FA9A 2BKUA 2AN9A 2A30A 2XOKA 3OIWA 3GJ4A 2WJVA 1RFLA 1CR4A 2XNSA 3RS4A 3WRYC 3REGA 2QEQA 4Q4HA 4UNQA 3BC1A 5BN3A 2VTKA 4BLOA 1F2TB 2QMUA 3RANA 1EESA 4C7OA 1J2JA 1SKYE 2PMKA 4M9SA 5JECA 5DN6A 1F5NA 1IN6A 2QTHA 3IUYA 1NIPA 1RRPA 4CEHB 1U8YA 3CRMA 4IOJA 4R71A 1KK0A 1UDWA 5FR1A 2JJ2D 4E07A 4G1UC 3GJ0A 3VR6A 1M1YE 3UK6A 4RVCA 3ZD7A 1OXTA 1U0HC 4IKEA 1IQPA 1DTSA 1ZM4A 4QNMA 1A82A 3MWJA 3H86A 3T1QA 2O8FA 4NYIQ 3CM0A 1CJUC 4WOPA 1NF3A 4HZUA 3GJXC 3AQ4A 1S2MA 3DO6A 4XSGA 4ASUA 2CHGA 2H92A 2F55A 1TAGA 4BQSA 3A58B 2HF8A 3UWOA 5K8IA 5FTJA 4H1VA 4I99A 2RGXA 2VSFA 4HZIA 2DFNA 5BN5A 3NEYA 1DEKA 5D3MA 1CULC 2ZU6A 2ZEJA 1G3UA 5LB2A 3EZ7A 1VG9B 4CRWB 1TQ2A 3Q8XB 1DVRA 3U6BA 2GWHA 4ZIRB 2IUTA 2D7CA 1HA3A 3RAPR 2EFDB 3LBHA 4PQRA 4GMDA 1VHLA 2FPKA 2VP5A 4HAUA 4L9SA 3PEYA 1E9BA 5CM8B 4H9GA 4Q5IA 2CJWB 1P4SA 2GBLC 2OESA 3F0TA 2NIPA 3I92A 4D81A 4Q1BA 1GL6A 3AF0A 1CF4A 2ZRFA 3NKVA 4UNNA 3K70B 2XOKD 4RKFA 2R6FA 3T12A 5A0FA 2E1RA 5DGXA 1NP6A 4Q4AA 4KLNA 2ZAOA 3L8ZA 4WVFA 2WWIA 1T0JB 2XNDA 3DMDA 4HUQB 1RJ9B 3TNFA 3F5FA 1ETUA 4B34A 3W9YA 5L3RA 2VLIA 1G7SA 5CK4A 3ASYA 2YWFA 2CNWA 4LPSA 5LDDC 1WA5A 1Z6YA 4PAMA 2H1LA 2IYUA 1DAMA 4Q21A 3SEAA 3NG1A 1OH6A 2ECKA 1U94A 2W58A 1IN5A 4A8JB 1ELOA 1HQYE 3EPLA 1Z6AA 3TR0A 4GNKA 1KO1A 2LKDA 4NKRA 1W36B 4GL2A 2QG6A 2BVNA 4DC9A 5FH9A 3GJ3A 3BB4A 4P3YA 4ASUD 1DOAA 3W34A 2RMKA 1JPNA 2Z0MA 1R8SA 4QOSA 5JRJA 1AZTA 2IHYA 3EXAA 4JBXA 1OSNA 4URUR 4R7ZA 2R9VA 2ZPTX 3I5XA 1OIXA 3Q72A 3Q7PA 1GITA 1M6NA 1W2GA 5FOWA 1G3RA 4LHZA 2GZDA 1OHHD 3U3RA 4IW3B 2C77A 5HE8A 5LPNA 1SXJD 3KQNA 2J0SA 3ADCA 4TQ9A 3MMPA 2JIZD 1EFCA 3QSYA 4LHXA 1F48A 2FG5A 4NYJR 1XD8A 3DVLA 1AKEA 4MYCA 2X2FA 2G6BA 2PLRA 2OHFA 4HAVA 4ZKEA 3BK7A 4TMTA 4DRZA 1QBKC 1GOTA 1RZ3A 4ILEA 2QTVB 1KKMA 1DO2A 2XB4A 3VR1A 2HYIC 3S1AB 5CLQA 4C0LA 1VIYA 2EW1A 3PG5A 1N6NA 1Z2CA 4GRAA 3EZ6A 4HDOB 4DCSA 1J90A 2WPDA 2ZRNA 4IXNA 3I73A 1E2MA 3I62A 3PENA 3UPUA 2QY9A 5K8UA 4LI0A 2B8TA 2GEDA 3NBFA 3I1FA 4OJQA 2V9PA 4QGAA 5ELXA 3ECCA 5TB5A 1OT3A 4JKIA 2MMGA 3NHBA 4A0FA 4ON9A 1LW7A 3X1WA 4Q1DA 2GILA 3PUXA 3W6OA 1UEJA 3SJCA 1GTVA 2VHJA 3MUFA 5SZIA 1Q1QA 5L3SA 1K8RA 3AB3A 5EP4A 3DZDA 4HLUC 3X1ZA 1GRQA 2MSEB 3K0EA 1JR3A 4JJKA 3AF3A 1S1CA 3TKLA 4BFZA 1OKKA 3KDSE 2QN6A 3TW8B 4C4PA 1OB2A 5TDHA 1BS1A 3MGCA 3GCGA 2ZRMA 2UZ3A 1PLJA 3NBZC 4NZYA 1DAGA 4TLAA 4B44A 4R2IA 4L8GA 1NG9A 3WNCA 4M1TA 4B2PA 1JJVA 1CRPA 3AF4A 4BLPA 4UJ3A 3BFVA 4MITA 4D4JA 5B57C 5KPJA 2DBYA 5UKDA 2OLJA 4RD6A 4FWTA 121PA 3NEJA 2GJ9A 2VP9A 3HDTA 2W6JD 3DPUA 1XD9A 1ZNYA 2ONJA 1SVLA 4D4LA 4DB4A 2B7BA 3AVYA 2ZRDA 1TF5A 1G3IA 2DY1A 1BMFA 2H57A 1G21E 2AD1A 1E9RA 2ZRBA 1GVNB 2QQ0A 1R0ZA 2J45A 1GNRA 1JPJA 2DFTA 2OEPA 4Z51A 3JVUA 2A5FA 2ZE8A 3CR8A 1NBME 4DDVA 2OM2A 4D82A 2OCYC 4BFTA 1O87A 2BBSA 1OFUX 2R6CA 2JDID 1R0XA 2GTPA 4LC1A 4DCVA 1OH8A 2G0NA 5AJYA 4Q9LA 1ZCBA 2CL6X 4Q03A 4QGHA 1Y63A 2J0VA 3ZVNA 4TLEA 2J0QA 2AK3A 3O8BA 2NZ8A 2BJWA 3I4LA 3PVSA 4RZ2A 3R9XA 2BMJA 5FL7D 2VP2A 3EW9A 1Q12A 3CPJB 2IBMA 1VIAA 2C2HA 5E95A 1E1RD 1ZBDA 4LJ8A 3DL0A 1N0VC 1OLOA 2DR3A 2YOGA 3LV8A 1I2DA 2O8BA 4B48A 1JR3D 1S1MA 2HUPA 1XTIA 1H8EA 1NVVQ 4LZZA 4CEHA 1OKKD 2H5EA 4DBLC 1PV4A 3B85A 1MKYA 2A78A 4Q1FA 3OFNA 4E03A 2IC5A 2C8VA 5CJPA 2J87A 4JLOA 5LBIA 4PO1A 3CIOA 4XVQA 4B3XA 5KOYA 4IFBA 3DMNA 4IVQA 3I3SR 5JEEA 3ZZ0A 3M4YA 2AL7A 4NHOA 3T5GA 3OF5A 3BFKA 4BGDA 3GP8A 4G5QA 5AK0A 2KE5A 3AVXA 2ZVQX 3CNOA 1N25A 3W5JA 4YMUA 2C9YA 3DKPA 4Q01A 2QM8A 4MA4A 3UXMA 4X8LA 2F9LA 2CE2X 1KDPA 4GI7A 2YHSA 1YVDA 2ZIAA 1KKLA 3O8CA 1SKYB 2A5GA 1BMFD 3CX6A 4F93B 5IRCD 1AS2A 1FTSA 1L2TA 5HZKA 1OXSC 2GCOB 2REOA 3SBEA 1WE2A 4ZIRA 2I4IA 2WKRA 2CVFA 5J4LA 3QENA 4OI2A 1TF2A 5B64A 3KB2A 4W5HA 5JHGB 4D0LB 1AGPA 2CJWA 2YOHA 3GEEA 2IS2A 2ZRKA 4D0GA 3KKQA 5FPYA 4YMVA 3A6PC 3QVUA 2AK2A 4BRUA 4C0KA 5EXXA 4KBFA 1E3MA 3B1VA 1T9HA 4G5SA 1R6BX 3EC1A 2AFHE 4WAUA 1U0LA 1QF9A 1XCPA 1YR7A 5EP3A 2QPAA 4HUQA 3KKNA 1RJ9A 3T35A 3W8RA 1KTVA 2OO7A 3W6PA 3DEFA 4HSEA 1ZW6A 5K8LA 1NLYA 1E2IA 1S96A 4XD7D 4I1UA 1G5PA 1GKYA 1KDRA 3D8BA 3EWAA 3OFND 5HTKA 3RS2A 3FMPB 1E2FA 3ASZA 2ZUCA 2B21A 1XJCA 3CNLA 3IIKA 4A8JA 3M1IA 2QBYA 4TMWA 3CPEA 4NCJA 5G3YA 4P4SB 2R2AA 1CIPA 2Z4SA 5JJIA 3U61B 1G64A 5B2ZA 2ZRCA 2YC2C 5FBRB 5GADl 3PFIA 4R9UC 5JS7A 1CBUA 4B76A 1Q57A 2P0EA 3LD9A 3QKRB 4GZMA 2F3RA 2W2VA 5AJZA 4A4DA 4OHXA 4QM7A 2ZI9A 2ZI4A 1A5TA 3A4LA 2EWVA 5CK5A 2C95A 4FMDB 2VH5R 3OIVA 2IXGA 1KI6B 2EVWX 1DBSA 1KHTA 5FTMA 1W47A 2MSCB 1UAAA 2NTYC 4TL9A 2ODNA 4AK9A 2HDNB 3RSLA 4TTRA 3HJNA 1NI3A 4M21A 2HLDA 2ZVPX 4NE2A 5CM9C 2AWNA 1E94E 2IYXA 4C0HA 1KO4A 1OXXK 4URYR 1XD2A 2R44A 4R2HA 1RVDA 3LVQE 4TYWA 4OYHA 3S1AA 2OFXA 3PCRB 1I4TD 1NJFA 3K8YA 1U98A 1N3BA 4PFSA 2RGCA 3AVTA 3IBGA 4EFMA 5F2EA 3QEOA 4AD8A 4ZKDA 4B71A 2OBMA 4OK5A 3KQLA 4I1VA 2EFEB 3C5CA 4JSTA 2FGJA 2V6JA 3K9GA 3O8DA 4QGGA 3X2SA 3QXHA 1B23P 1VG8A 2VIIA 4B3FX 3SJAA 4MRNA 1PVOA 3ZIAD 2O8CB 4TSFD 2FNAA 4DKXA 4I1SA 4KO8A 1XEWY 3LVRE 1DG1G 4FMCB 1Z0KA 2FWRA 1WQ1R 3D7MA 4KFRA 2O0JA 4PQFA 4OK3A 5BW8A 3ND8A 1W36D 5A4JA 4QBFA 5BQ5A 4FMBB 5JLJA 3NDPA 2Z5FA 2CMKA 1E9CA 4PHHA 4XTCS 1VPLA 1MV5A 3K9LA 4TMKA 5J40A 3NBXX 2A7QA 3NBYC 5E3HA 4PC1A 1KJYA 2FEOA 1H65A 1SXJB 3LXRA 1G8YA 4Q9JA 1IXZA 3L0OA 1FOEB 3BIFA 5KTYA 1JI0A 4AURA 5IK2A 2G1KA 1NLFA 2WWHA 3FOZA 2HLDD 4D2IA 2DWOA 1QHSA 1P72A 2PZEA 1A2BA 2P5TB 3GJ6A 1AJEA 2A5JA 3CRQA 4QC2A 3LO5A 1XDBA 3I61A 1V43A 3GFOA 1OFHA 2HYDA 3F3YA 3SZRA 5EE1A 4UXJA 3FKSD 4BLSA 2QPTA 1ZNXA 4PZLA 3OESA 3NWJA 1G7TA 4TZ0A 4ZCMA 2FFAA 2HJGA 2UZIR 4OHWA 4JZKA 2WWXA 4JLAA 4EPXA 4KYUA 3D31A 2QZ4A 5GJCA 2RGNA 1T5LA 3CH5A 4NH0A 4DSUA 1ZUIA 4AWXA 2J3EA 4L9WA 2ZJBA 3FMOB 5C46F 2R6GA 3A1TA 3CRW1 4PPNA 3AV0B 3GQBA 1Z63A 2QROA 1KNXA 2GDJA 1G17A 3B8HA 1CR0A 1BKDR 1MO5A 2IK8A 1G9XA 1NKSA 1X8JA 3IPYA 3Q5DA 2FFQA 4TZ6A 5M04A 3VNUA 5TV2A 5L3QA 5IF9A 1R8QA 1OF1A 1ONBA 1GIAA 2NO6A 5AJXA 4DLXA 4E09A 3K0SA 1XZQA 1E9SA 1GNPA 4DSNA 2RH5A 1EFRD 1QVRA 3BH6A 4HI0E 4KJZA 4B33A 1Z0JA 2QMEA 1MO3A 1Q3HA 1FPMA 3AEZA 5DI3A 4QM6A 1P9RA 2ZR9A 5CIQA 3NDBB 3LW8A 3IO3A 1OJLA 3AP2A 2WJJA 1E98A 3R9WA 1VCIA 2VSOA 1FTNA 1KJWA 1XMVA 1UFQA 4A6XA 2IYRA 2G83A 3AM1A 4KFTA 1R0YA 5IHPA 4LJAA 2OXRA 4UKDA 4QJ5A 3MLEA 4WZAE 3U7EB 1XU4A 3CF2A 2G9NA 1QDEA 2CK3D 2N42A 1K5DA 1XMIA 3CRRA 4B3DA 1U9IC 1N2CE 1QHHB 3AKYA 1OPXA 5IT5A 3A1UA 4BEBA 4C0JA 4LYJA 4J0QA 4L4UA 1F6BA 2GCOA 1G16A 2BMFA 5AUQA 1DAHA 2Q21A 5J4VA 4Q7KA 4A82A 2D7DA 2R62A 4ITRC 4Q47A 4A2PA 1IHUA 2VBCA 5AR1A 2V1XA 3TRFA 3AVQA 3TK1A 3DM5A 1P7CA 1YRBA 2QRZA 3KJIA 3CF0A 1K6MA 2BKEA 4G0NA 3AVWA 3HWSA 2WWFA 3AP3A 2OBNA 4BFVA 1FUUA 2B92A 1P9WA 2AXNA 3FE2A 1FP6A 2QL6A 4ACAA 4TMZA 2V55B 1E79A 2CVHA 1KIMA 2DFKB 1DAFA 1XRJA 3KJGA 3PQCA 3GLHA 5HCIA 2W0SA 3BAFA 3KXIA 4LUCA 2ZI3A 2F1RA 2FPLA 2WZQA 4WIAA 2DYKA 1W44A 4JSYA 1VG0B 2HXSA 5HCNA 4LHWA 1TNDA 3BGWA 4U5XA 2E87A 3T61A 1NMYA 4JT4A 2YVUA 2PLFA 2TMKA 4G5OA 1NN5A 2ZUBA 2ZS8A 2GVDC 1W0KD 4P4SA 5TMPA 3B5JA 1U2RA 2XGJA 2C04A 4DIDA 4BWYA 2ZUDA 5J5CA 3BBPA 3QKRA 4DB2A 4MUBA 2BHRA 2C03A 3RRYA 1GAJA 2BMEA 2ODEA 2ZXUA 1OH7A 5L8VA 1SHKA 4OQLA 1ZD8A 4QJ4A 4ARZB 1KI6A 5IDVA 5SZJA 5FOUA 2PCJA 5EUQB 1L7VC 4WA7A 1IY1A 3QG5A 3GLIE 1II0A 3TIFA 1KZ7B 4QHSA 1M7HA 1DS6A 1TPZA 1G7CA 1NVXQ 4PR0A 4FCTA 4IHQA 3HU3A 4MYTA 4TTQA 3B9QA 1YE8A 1LS6A 3FHOA 1P62B 3LQQA 1W4AA 3AGPA 3LLMA 3QXCA 1VTKA 1WP9A 2WKPA 2J41A 3DOFA 2I3BA 4JL5A 4CT5A 3T1TA 1P3JA 1SHZA 3FFBA 4Q7MB 1DAKA 3Q3JB 3TJZA 2HCJB 2OE2A 4V02A 2WICA 4MGZR 1E79D 2KSQA 4DLSA 3SQXA 1X1RA 4QHTA 1AS0A 1WBDA 1TF7A 4N3NA 1Z5ZA 2O8CA 1CXZA 4V0MA 1NMXA 1XEWX 2QENA 2VHUA 2GNOA 2IHBA 2V54A 4HDQB 2CCJA 1WCV1 4JLMA 1G4AE 1IXSB 4GZLA 3EPKA 4UXIA 4JVLA 1Q1EA 1DAEA 2BJVA 1F3OA 2RGAA 1BO6A 2ZSEA 1KI2A 4HLUA 1ZYUA 5FUYA 5SZHB 1GILA 4MUAA 3KQHA 3HPQA 1Q0UA 1XXHE 4O2RA 4RD2A 2OXCA 2G0TA 3ZGXA 4G5GA 2X19A 1A7JA 4DDTA 2FSIA 1FZQA 4KAXA 2OUKA 3IHWA 4FCVA 3R8FA 4US0R 1PLKA 4BFYA 4QKQA 3TVDA 1E32A 4DIEA 1OHHA 4B2IA 2VRWA 1OFTA 3X1DA 3QKSB 1SXJA 3VNVA 4LV5B 2NGRA 3GLGE 1YZUA 4B2LA 2CLSA 2JIZA 1JJ7A 2BC9A 1I4DD 4QGFA 3BE4A 4OI0A 5KHOC 1KY2A 1JQLB 4W5WA 3EIQA 1VCMA 1KSHA 4EJSC 4LRWA 4WBSA 5KDDA 3ICQB 1G3QA 2ZS9A 5FL3A 1YR6A 3T1OA 2ZJ2A 3FHCB 4YDHB 1LTQA 4HLCA 1US8B 4EPWA 3MFYA 3LLUA 2MMCA 2JCSA 5CB6A 2JLXA 4IEIA 5JFGA 4Q18A 3FYHA 1E2GA 4GOJA 4XOIA 4HLQB 2DB3A 3AF1A 4NCIA 3SFZA 1TEXA 1FUKA 2JA1A 2KJQA 3O47A 2H18A 3I8SA 1G8FA 1VCNA 3LAWA 2QUZA 3LX5A 5P21A 4BASA 4S35A 5CDFE 4M8NE 2ATVA 3VQTA 2J7PD 3PUWA 1D2NA 4CW7A 3EIHA 1E96A 3TW4A 1W1WA 2ZE7A 1II9A 1G6OA 1HEIA 5JBQA 5EUMA 1B0UA 1JEEA 5EP2A 1LFDB 1NKTA 1GG2A 2NQ2C 3SI7A 2AHOA 1NRJB 2QSZA 3C41J 3LXXA 1N6PA 2UVQA 3OZXA 2F1IA 1N0UA 4X8HA 4LY6A 1W4RA 5C1BA 2WSMA 3WMEA 1P6XA 3B2EA 1KNQA 4HDCA 3ZQJA 3FFAA 1ZM3A 3IO5A 2FV8A
chains in the Genus database with same CATH superfamily
3P2YA 3MT8A 1VPVA 2CXSA 3KTOA 1DNPA 4WUTA 1KFBB 1PX0A 3HLYA 3FVVA 3QWHA 1EFTA 2BP7B 1O97D 5JWHA 3UMGA 1PQ4A 1DXOA 2PZFA 3H11B 4I4CA 2REQB 5IS2A 2FWNA 1GHTA 4ZQGA 5DSZA 5IH7A 2HCBA 2FHSA 2ES4A 2AW3A 3ANTA 3BHNA 3GAMA 3OPXA 5CTJA 2PCLA 4JN6B 4LRQA 4EOGA 3PUHA 4EW1A 2ZTUA 2ZI6A 4LK2A 1CUSA 4LYYA 1R88A 1LDNA 2W6JA 3RKRA 1Z34A 1V39A 1J2TA 4NK5A 4YJGB 5DZSA 3NTLA 2XUQA 4H1TA 2Y9MB 4KGZA 5DIFA 4CM9A 2GLUA 2AFRA 3BXEA 5D01A 1LUAA 5C8ZA 2UYCA 2XUFA 3FHJA 3ZV4A 2GAJA 2BF4A 2QYTA 3DV0B 5K3DA 3TLGB 4TVOA 3CU5A 1VZ3A 1YQXA 3UJ3X 3CVVA 5FI1B 1MRZA 2AOWA 2FQWA 2Z57A 3A4NA 3U4HA 1XQ1A 1V4NA 1JIKA 2Q3HA 3IQDB 1MDFA 2FXVA 3GWZA 4WKGA 3SX0A 3KTAB 1YRHA 4BNNA 3FY4A 1VE1A 4K6HA 2B5WA 4RYDA 1GFWA 2JDIA 3UHOA 5E7QA 3OTQA 4MW2A 2ZIUB 2A14A 3NH6A 1J8QA 4YJ2B 1UIRA 1ZN7A 2IL1A 4HNSA 3DWIA 3TO5A 3UATA 1W1IA 1RWMA 2F8LA 2I4MA 1KMIY 3NNSA 4UM7A 3U3MA 3TSZA 1SAYA 2C7GA 2WF6A 3L6DA 2GUGA 4Y2SA 2IX9A 5BSHA 3OX2A 2QLTA 4P5PA 2HC9A 4DLUA 1HQCA 5JZBA 3EJWA 2CMGA 2L42A 1MVLA 1C1DA 2V6MA 1IHYA 1SG0A 5EKXA 4J0GA 4YMTA 3RAFC 1F20A 5L51A 3UO8B 1BSVA 4OQFA 1JHPA 4CG2A 2BFFB 3G2JA 4QPJC 2KS6A 1JI3A 2Q1UA 2X9LA 4OQDA 4DQUA 3GEGA 4LZAA 4UNRA 3DUFA 4J3FA 1FYEA 2V3VA 4XSVA 3DLBA 2VDPB 5FUXA 2GK6A 1UJ2A 3AUXA 2QAGC 3NHSA 1OROA 2XNHA 4X1IB 1NC3A 1TU3A 3OT1B 2GZAA 1JVBA 3TCNA 3FNBA 4L7VA 4PZUA 3DOHA 5EXPA 5IVDA 1NR7A 3VH2A 5KKNB 1YCDA 2QIPA 3KSUA 4G1FA 1CRLA 4HPJB 4JSRA 4LWZA 1OIWA 3CCBA 5CT8A 5IXYA 1XE3A 3EF3A 2VWQA 3IP8A 3W8EA 1SG6A 2LWIA 4BN0A 1F2UB 2G5TA 3CR7A 3IIJA 4RZIA 3J81k 3GPLA 1IK4A 4BU0A 1G5HA 2FK8A 2JLRA 1D8TA 2PL3A 1OU4A 3P9RA 1WXQA 1A96A 4P5DA 3AXSA 5LWQA 1RLTA 5IEJA 4AKHA 3BIJA 3K4QA 1IXYA 2HMAA 1WCWA 1SOMA 2ONYA 2QHXA 4QFBA 1EWKA 2IUUA 1QLJA 2IYQA 1T2UA 1O9GA 2NSJA 3GRUA 3GZNA 1ZK3A 4X85A 4ZVMA 1VSUA 2O48X 2Q28A 4E7OA 1PLLA 4EPVA 2DUWA 4IXTA 3RJTA 5FXMA 1JDBC 5JMPA 1YHNA 2PWYA 4AUMA 3TSAA 4EL0A 3TQCA 2TECE 3LNTA 3IUNA 2B4KA 2WFAA 6ABPA 1DKMA 1FNSA 1Z7YA 2FSGA 3EEOA 2C20A 4R1TA 3WJ2A 1NJ8A 3IUJA 3QLVA 5E1DA 3ZWNA 1NL3A 3A36A 3W06A 3PZRA 1NZFA 4N9QA 1K75A 1ZJZA 1UKZA 2JK0A 1ZSYA 4QULA 2A9KA 3UF0A 1D6NA 4EX7A 1W52X 2WWGA 4LEIA 3KZ1E 4FMDF 3WDLA 4Z53A 5JW6A 4ZAZA 2PH7A 3AEXA 3EASA 3TLKA 2OWDA 3MWEB 3MTAA 4WXEA 4YAJA 5FI0B 3PXXA 6Q21A 2XMBA 2P11A 4UE2A 5HILA 1NW5A 4UE3S 1MPXA 4J0IA 2WHQA 3OE1A 4AN4A 1JB9A 1A7UA 3GGDA 2IIBA 4F4DA 3ITNA 1WPGA 3I9FA 4JYBA 2GTHA 2BGWA 1JQ3A 1VL1A 4EVIA 4TMVA 1SBYA 2VKTA 2CYCA 4WHMA 1Z2PX 4U02A 3JARB 2CB0A 4HDMB 5TLSA 3IBYA 4CM4B 2W6NA 2ZR0A 3Q8KA 3KOWA 4ZQFA 4G5XA 5ITZB 2P27A 4Q12A 1KXJA 2IP2A 1VBFA 1XN4A 2P3SA 4LCJA 5JRDS 3QKSA 5AVZA 4JBIA 3RC3A 3LC2O 3EC2A 4R83A 4JVSB 5GZ3A 1W8DA 3GUZA 1XMJA 4FX2A 4EJSB 1DQYA 5ITSA 3P1JA 3CC8A 4KJXA 5EKUA 1V9SA 2GBFA 4WKNA 2CBXA 3ZYCA 1EXVA 2HHHB 4EARA 1PGPA 4FGKA 2QD4A 4RK7A 3WV5A 1S3IA 1CR2A 4BVEA 3LPMA 1KO8A 2WHXA 4EJ2A 5TGTA 2BWJA 3A9CA 5D5QA 2G5PA 1KI9A 1V1JA 1YS4A 1O4WA 4FMCF 4O08A 1FPQA 1KYXA 2AOTA 1ESMA 4LRUA 1GV0A 2GK7A 1FSFA 5DOVA 5EINA 5BSMA 3WOVA 4AN1A 1PL0A 3ABIA 4W5OA 3DLTA 1JDSA 2QN3A 2YV3A 1XXHB 1MLDA 1I3KA 4PAOA 1RXSA 1THZA 2CYBA 3MMZA 4Z3KA 5CLFA 4OHYA 4GLOA 4BJ3A 2M9MA 3C4QA 4GSYA 1HDYA 1BJTA 4TT3D 5GJVC 2C2KA 1D2GA 5JYEA 3R0VA 1GRNA 1XRRA 2B7CA 3ND5A 4LQLA 1MC4A 4P3PA 5BYJA 3ZI0A 1MAHA 4B6PA 4ZI3A 4WGFA 4LY0A 2W43A 3G5MA 2E4AA 1W88A 5AD1A 3M5PA 2QT1A 1VG1A 2NSLA 2JGMA 2I6FA 1KFKB 3L7OA 4C0BA 2Q7DA 4G56A 2OZLB 1DWUA 1RYNA 2BEJA 2JAOA 3P2MA 5AKKA 2WFMA 1H8HA 3HJGA 3SS9X 2H1IA 1XCOA 1SVKA 4PAQA 1H05A 5B1SA 3AKCA 4F96A 1MG5A 1V11B 3C6KA 3AFGA 3EQ6A 5HOEA 1LS1A 1F2DA 2VQ3A 1MR3F 5MN5A 4I6EA 3H5LA 1J33A 4XIFA 3TTYA 1Z7BA 1E5XA 1L5VA 1VGVA 1KP2A 1ZGZA 3FWNA 2GFQA 1BQ3A 1MX3A 4M1OA 1HE8B 3WLHA 1KDVA 3AR7A 3F5MA 4P81A 1DEAA 2XOXA 3CS3A 5PGMA 4E5VA 3JQ8B 1NRXA 2K7ZA 5CYGA 3D5TA 1ZOPA 3ZLVA 4AY4A 1V4BA 1SB8A 3H1TA 3KB6A 1DRKA 4GL4A 2IHVA 2XA2A 2O59A 2PDAA 3WLPA 4O59O 5C5DA 2BP7A 1SVWA 3PQ7A 5TMDA 4DR6B 3QH4A 5LOVB 1JA1A 3F67A 5DI9A 3U62A 5CCEA 3H11A 4BMZA 2REQA 5EEGA 4AYXA 3RC8A 2BH2A 3R7WB 3AKDA 4HXGA 4D9MA 4AF6A 2YBDA 4YAIA 1SCIA 1CUCA 2I8AA 1PF7E 2NW6A 2VBGA 1Q19A 4S1PA 1PTJC 4OQNA 4QQFA 1I3NA 2WTNA 1L5RA 1B6SA 1P2DA 3AGQA 1HT1E 1GLVA 3E1SA 3EDMA 4LYHA 4NBWA 4IUYA 1QANA 1TLFA 3RM3A 4IQFA 4YJGA 2WTBA 4GR5A 1D6MA 3LQRA 3QJYA 1PK7A 4OKSA 2RE8A 4A36A 1LVUA 4DQ0A 1HMYA 2HF2A 1JTFA 1U9IA 2HAEA 3C4JA 3ESRA 3H2HA 4L9RA 1N7JA 3RJ9A 4JK3A 1PW5A 1R0BA 2RH8A 3TLGA 2UZ0A 3DV0A 3IOYA 5BWOA 5M2QA 3GH1A 4ZPJA 4BFLA 2HA6A 3ESCA 1STOA 5C1PA 4UU1A 1MN6A 3BGOS 3D7KA 1M6YA 3T52A 4EG0A 3FHTA 3KOYA 2H8GA 3JVVA 1LDMA 1HF3A 1GGJA 1GY8A 1KI1A 3KTAA 2YW2A 1YVPA 1GFIA 5DEIA 3EG5A 2ZSIA 4PE5B 4BYGA 2QU8A 3T5MA 3H9GA 1U28C 2B98A 4CYMA 1E69A 4YJ2A 2XKJE 3ZE1B 3FB1A 3VC1A 4EA9A 4LF4B 4NULA 4AJHA 3JD2A 5FAKA 3H6HA 1H8HD 5MGBA 5JH7F 2QW0X 1CY4A 4HB2A 3FFTA 3PEWA 2JLCA 3FGNA 1S8AA 1O3YA 4GIBA 4E4RA 1BCRB 1R6VA 5BQOA 3GL9A 4MVJM 4N5DA 2C88A 4U2EA 2X9NA 2C7OA 2X8BA 1MJNA 4LBYA 1TVKB 1O89A 4PGAA 2X22A 2OBXA 1W30A 2BFFA 3QIAA 4FNMA 2F7SA 4FE3A 4FVTA 4XM0A 2DMRA 1PR2A 2C8JA 2HJHA 3AQIA 3MJTA 1CQWA 1TM1E 3DOEA 4X45A 4TS9A 2GESA 2RONA 3TUIC 1HFJA 2CKDA 3DC7A 4LRTB 4X1IA 4FZ3A 4KITB 3OT1A 3WNDA 1LZLA 2A0KA 1H6BA 4MB0A 4PO9A 2QT9A 4DAEA 1MEEA 1ODIA 3I37X 4UMVA 4EYKA 3M1AA 1N9ZA 4ZHQB 2X7XA 3UK0A 4GPBA 2RD2A 4K87A 2F64A 2P9ZA 1N5IA 4KE7A 1YQWA 2HT6A 4D9CA 1DEHA 3JWJA 1D1QA 2ADFA 3M6IA 3W6NA 5KNCA 1XWIA 1VE5A 4O3FA 3PYLA 3TAUA 4L4SA 1G8HA 5AK6A 2DP4E 4DM7A 4YXFA 1N34B 5L4LA 2FPIA 2JFYA 5KNDD 1QVZA 4BVHA 1AKVA 1YL6A 4HGRA 3WHIA 2L19A 3O1JC 1W5TA 5JG7A 1JBQA 1GRRA 2PUFA 3TQSA 3WO0A 4CQJA 1G9TA 2BZ0A 5JNVA 3ND9A 3OJOA 3KUDA 2J6BA 3NM6B 1ZJJA 5JAQA 2Y1DA 1KY4A 3ORYA 4GBJA 5HF9A 1S0UA 2OVFA 2ZZMA 5G0SA 4RA9B 4IXMA 2Z9DA 1OZFA 2ZYUX 2QR5A 3G2PA 5YASA 1CEYA 1RLIA 1JH8A 1AHHA 1HV8A 1RI1A 3CF4G 1U6KA 1W25A 4AIRA 3EN0A 2O0HA 4PFQA 3OX1A 4JGGA 1ULSA 4R41A 4WLEA 3UZUA 4AXBA 4C01A 3GUUA 2NVOA 1TTTA 4EM6A 2XHEA 1NBEA 2W4QA 1X1AA 1TKRA 1KDZA 4WJZA 1YZQA 1XHLA 3RG2A 4BGVA 3GFFA 4OCZA 4Y9UA 3EC7A 4TV8A 3AP1A 4LE1A 2F1HA 4F5DA 3EVGA 1EWRA 2NPOA 1SVUA 2YZKA 3STWA 1UJ6A 3WOHA 1FRQA 2BRUC 4FW9A 1YDEA 2YWRA 3RF7A 4KVAA 3DE7X 2XTMA 3OTHA 1S02A 2VDMB 1FTGA 3ZNOA 4LZPA 4C89A 1FDUA 1HZZA 1OI7A 2L2QA 3LECA 1EGMB 5H68A 2X9VA 3TD9A 3ICEA 3NXSA 1SUSA 4DR4B 5K3FB 1BTOA 1O77A 4KN5A 5B3AA 1ZN8A 4LXIA 3JARA 4HDMA 4UAGA 2PLAA 3SOZA 1WMSA 3H2YA 4CM4A 2JKZA 1G1AA 5KREA 4RVFA 4O02B 1KL7A 3MSXA 4OAQA 5I7WA 2LKCA 2BE7A 3LDAA 1T8PA 2AA3A 2C4MA 1XRSB 3IHKA 3QY0A 5TPWB 2UKDA 5HRUA 4YJ3F 4EA8A 2ZTMA 4YJFB 3HCWA 4EJSA 1MA0A 2AFIE 2KM1A 3RS8A 2PJZA 1O96A 1ZH4A 1MG0A 4DE5A 1GYQA 4EENA 3RLFA 2DC1A 3NHFA 3ZD6A 2QLBA 3H2GA 1G19A 3EZYA 3EE6A 3GLVA 3HR8A 4DLPA 1UJBA 4D9EA 1CUUA 1E2QA 9LDBA 1Y37A 3NT5A 3PV0A 1W94A 3HRHA 2DJ5A 5EZ5A 1XZBA 3HJAA 4R2JA 3R5XA 1GL7A 2YVAA 3G1TA 3KQPA 2ZTVA 2BGIA 4IEEA 4IJQA 3QPCA 2I4RA 2IHJA 2HJWA 2JGNA 3CE6A 4FYHA 5HIIA 3WWYA 2FDCA 4ODIA 4I3HA 3DHVA 2V0NA 3TRHA 3ZWDA 2F9MA 1DFGA 1XXHA 1SIWA 4QHYA 3KEOA 1KI8A 1ODTC 4XM2A 5TE9A 5KNDH 2VXCA 4JX8A 1X7XB 4N7JA 1ORWA 3DL2A 3KJEA 2NP6A 5E6UB 3DR3A 5LA6B 5J47A 2WIAA 5HEKA 4PX9A 5I8ZA 2WOOA 5CYPA 1UBCA 1LW6E 4MS1B 2ADMA 4U9IS 5DCUA 5CAEB 3PC4A 3UTCA 2FN3A 3Q2OA 1EDOA 2B3DA 3EEIA 4E5NA 2GKSA 4UUQA 2XB2A 1M7BA 1S8OA 1ND5A 2HK7A 4QOFA 2OZLA 3KWJA 3MVEA 5TVGA 5FLYA 1S8FA 4MKIA 2QVXX 4MW6A 3PLRA 4PYJA 5BQXA 2FUKA 1V11A 1RE0A 2V59A 1MV8A 2XTAA 3KPJA 4TQUS 1E4VA 5AJWA 1OXVA 3PUJA 4HQKA 2W6MA 4PR3A 5ESRA 4WCVA 1VE3A 1QTIA 5ELMA 2G71A 5KINB 2HD4A 3OO0A 3NC4A 4A15A 2WBLC 1ISPA 3E5RA 1Y0BA 1HTBA 3HR7A 1SH7A 1YRAA 1YRLA 2Q5JA 3AUTA 3B3GA 4X24A 2WHPA 3JQ8A 4BEJA 4JLKA 2BISA 4HNUA 5IW8A 1TU4A 2Y71A 4RAQA 1WUHS 1T2AA 3DE1X 3LBNA 3BJIC 2QRKA 3WFIA 1ZGBA 3HN7A 3P52A 3S28A 4YGYA 1AZWA 2OHXA 2VP6A 3HYTA 5LLDA 2PL9A 4TUYB 3R7WA 1KORA 1LRJA 4P2BA 3UH0A 3BJEA 2ZXEA 1XZMA 2G25A 1SCKA 3N3BC 4MUFA 1XJ5A 3K8QA 2ODTX 4GFDA 4KDCA 3A3YA 3ZGLA 3EULA 1RCTE 1VRVA 3ZNNA 4G0QA 1OGYA 2JLYA 1ZRSA 1C0KA 1SZPA 3LH5A 4N6NA 1GQRA 3NDRA 1WUYA 2QPOA 4BC0A 3WMGA 2YMQA 2YOFA 4NZPA 1U7DA 4RTJA 5JQGB 4HO1X 3B1XA 3JD0A 4UW9A 3W7BA 1CZKA 2F6RA 1ECLA 2ZYHA 1B3RA 3F6PA 2OO5C 2WIKA 3FDZB 3OZVA 4KE9A 1MB3A 4HX2A 3ZWCA 1QGDA 4CV1A 2ZR8A 4M98A 1UP4A 1YI0A 4RVDA 3L0YA 2HLHA 2QLFA 4OFXA 4UVHA 2R7MA 4D6XA 1NVFA 4J91A 3ABZA 4JJFA 5B4VA 4B2YA 2RGNC 2J9FA 4JVNA 4JT8A 2P9TA 4ZQHA 4OEHA 3ET5A 1B42A 2OCIA 1NXTA 2AF3C 1SUIA 3G17A 3TQHA 4DR2B 4REOA 1RYEA 1LX6A 3CRZA 3CEMA 2GS9A 1EHIA 1PT6A 3NASA 1CLUA 2PT9A 4L4RA 4ZT3A 5T4HA 1N8SA 3TTXA 3P71T 1GP2A 5GINE 4QGBA 1BCRA 1K5GA 2C0PA 2IF0A 3MPUA 3GCDA 3V2IA 1OXUA 1CB0A 3SF8B 2ESRA 2WLSA 5EMNA 4XIGS 2RARA 1P75A 5AQEA 3LZCA 5E7JA 4XX0B 4V03A 5K0EA 2GZ2A 2Y4NA 3IVGA 1U1FA 2EAUA 1TVKA 3OU6A 4OI1A 1XEFA 3PHLA 4WW0A 2QUAA 5A7HA 1W5EA 2ISCA 2NYVA 3WYAA 1AQNA 2EJCA 1D2MA 4V0LA 5KYXA 3FM9A 3IAFA 3O4GA 3JWHA 4OBBA 2OL4A 4U6NA 4ZI2A 1T2EA 3PU6A 5G0VA 1QH1B 5AI6A 1XB2A 2FVYA 1EUDB 3U60B 1JQEA 4FYIA 4ZC8A 2WNSA 5CJJA 4HDNB 3UYLA 1K5HA 5AUPB 3Q15C 5DBGA 2BELA 4ZHQA 1PBTA 2BF7A 4V0OA 3ADDA 4G09A 3SLKA 3G23A 3H6GA 3OM9A 1CYEA 5I45A 2EYQA 1G42A 5JEDA 3JSXA 3H84A 2HPHA 3B1ZA 3NTXA 5C8DA 2EL9A 2PQMA 1QQTA 2X0RA 3CRVA 3Q12A 2CXTA 1YA8A 2CE7A 1IJEA 4NOKA 1T8SA 4FHGA 2VHVA 1R6TA 5A7GA 4DLAA 5AVTA 1N5RA 4NCNA 1XQ9A 3GVIA 4NIMA 2YDXA 1FFEA 3HKDB 4E08A 1DX9A 4U1RA 2P1ZA 4WCFC 4A3SA 4HCJA 4KSCA 2NZ2A 5A5EA 1VL8A 4K86A 5GJBA 3TH5A 4C05A 5DM0A 1KH1A 2A5DA 3R3JA 4JBLA 5DXAA 3SN6A 4HQOA 2WJGA 3TDMA 3D2AA 4YJHA 1H0SA 1ZZGA 4UUMA 1HORA 2H07A 3DVAB 3I32A 3VZRA 2FW1A 5CGQB 1L1QA 4AY6A 2EP8A 2Q27A 4LY3A 5TXGA 3B13B 4PV7A 2FE4A 2B8JA 4RA9A 3VOBA 3FTNA 4I7EA 3FWKA 4EECA 2Q1XA 3QU5A 3TL3A 1CK4A 1R3DA 2M1ZA 3ELBA 4WZBE 2PJRA 4BNVA 3VR2A 3ZY4A 3DQZA 1W4CA 4FXPA 5KYWB 4CNBA 1VIVA 3Q2KA 3CZPA 3JQ9C 3DBOB 1XDGA 1U2ZA 3SBOA 2W6IA 4JWKA 5BNFA 4CMGA 4QE3A 1V47A 4YRDA 3MRSA 1C7EA 3BRWD 3IAUA 3INNA 4FM9A 2IV2X 1QH9A 2VFAA 4OX9B 3R3VA 1C3JA 4O4JB 3FAKA 1QFXA 3RNOA 3IAHA 1DC5A 5IMSA 1VJTA 3G9TA 3UEOA 2PA0A 2O05A 4FHDA 1KOFA 3HCRA 4RD3A 3I5UA 3VNSA 1JKIA 2QGZA 1MH9A 4WOBA 3ZWQA 1XNQB 1WW8A 2C7PA 1CUGA 3TL2A 1ECFA 2VF7A 2W6ZA 2HQSA 4IQ0A 4OXKA 5K3FA 3EBLA 2I4TA 5D86A 3T9CA 3VOSA 3CXUA 3KLMX 1M7GA 3G2HA 4HAXA 5CA1F 3ADKA 7REQB 5BMOA 2F4NA 5I47A 5JDCC 3FLMA 3OFVA 2A8YA 1QG6A 3HB7A 5CYOA 1E64A 4OQYA 3U39A 4RY8A 4X8OA 3SE0A 2XCOA 1KOGA 1Y9AA 2RAVA 3DVRX 3F8WA 2GPJA 3S70A 5DBEX 3TLXA 1HI9A 3LRPA 5DFAA 5AM3A 4OHBA 5TPWA 2QQFA 4V0ME 3EDQA 3S2IA 3EH1A 1IRXA 4WXPA 4YJFA 1HC7A 5LJIA 1Z0AA 2DBQA 3VUEA 1RYMA 2RC6A 5EEHA 5BWBA 3JQFA 3S2FA 5IABA 2LBPA 4FYWA 3CBGA 2WUDA 3N05A 3S5UA 2HF9A 1SUDA 1V8BA 5G2OA 4FOTA 2IXFA 2JHCA 3GPBA 3AM4A 3L1IA 4G8DA 2HJRA 4N3CA 1P0IA 1M3SA 3I2HA 4P34A 4P32A 2CFOA 4M37A 5IJWA 1UPBA 1JA0A 1R12A 3IMFA 5ALMA 4LY9A 1XD2B 2PD3A 1DDGA 1QKIA 3UMMA 2G9RA 5ETJA 3I6IA 3Q3IA 2J85A 3OJXA 4U2CA 3SGLA 3KUCA 4DNXA 4F85A 5D84A 4IDFA 3NP9A 5FTKA 4D9HA 2V7GA 3CEHA 1NTRA 9LDTA 3BQ9A 4Q37A 1CCWA 1R5JA 1X3SA 3RVDA 2P5YA 4OBXA 2Q3EA 4UTPA 4ZZ1A 5JZSA 3C7DB 4HBZA 4NG4A 3G3EA 1G5RA 4U9HS 1X7XA 2JEOA 4WX2B 3V5NA 2WF7A 4AI6A 2ASVA 1UDCA 1TCUA 4IOKA 4AZSA 1II8B 1WXDA 4DIUA 3K2BA 2W6ID 3CN7A 3N2IA 4FYKA 4MS1A 3V4RA 1ZRNA 1G20E 1JEDA 2WZCA 2ZYWX 1R5NA 3F2IA 2COEA 1ADCA 2CLOB 2J3KA 4Q3KA 1Y1PA 2BTOA 3ZKAA 1XFAA 1N2CB 2DT8A 4YAUA 3NM5A 1XQ6A 4RKEA 4KUGA 1GG5A 1E3JA 4RXMA 1TX4B 4IDOA 1E0KA 3WADA 4B3HA 3MD0A 1BHJA 1GL9B 2D4AA 2C2XA 1WXXA 1XVVA 2BFDB 2G67A 2VSYA 3GP5A 4PC3A 4QLAA 5IUNC 1BMTA 1QGZA 1PGOA 4DMMA 4UHHA 4RFVA 3GEIA 3INGA 2NPFA 5KMGB 1P0CA 1RJFA 1PV2A 1QQAA 2EFJA 2EGHA 5A1TA 4R1LA 4ZU6X 5C53B 3R0IA 4IZHA 3A4MA 4K9KA 1M1ZA 1CYDA 3I6ZA 3IEUA 3LG2A 1U2TA 3HGMA 3RT9A 1GSIA 3CVJA 4MRPA 2ZIZA 3SJBA 1OYYA 1Z25A 4Y6PA 5FP0A 4FGWA 2AJCA 5I7EA 4NMWA 1OAOC 2GPSA 2O54A 1JJBA 2O8NA 1T8WA 1TZMA 1ORIA 3TRIA 2HWWA 4TUYA 4ZA2A 4YRAA 1R1DA 2V98A 2VSNA 4QYWA 4WKPA 1X8XA 4BQIA 3GIDA 2BI7A 1QZ3A 3UHAA 4DW8A 4JI3B 1P0PA 4G8CA 4Y2QA 1KFCB 3ZEAA 2FX5A 4H3SA 4TXHA 3ILSA 1J0EA 3KQTA 2BLLA 2HTEA 2PR2A 2VPQA 3K6JA 4GVXA 4HJXA 4LOAA 4Z1MA 3ZHBA 3FBTA 4DA0A 3T5DA 1YUMA 2FHPA 4B6SA 3NWEA 5JWRA 4R1SA 1OQAA 4HR7A 2RGGA 2IPXA 4I36A 3VVMA 3L7CA 4GX2A 5CA0B 4PBSA 5JQGA 3IPXA 5JXHA 3NVAA 4OIFA 1QK3A 1ATIA 1WDTA 3MAGA 5A4IS 3FDZA 3K2EA 3DOIA 4M0UA 4RW0A 4PAWA 4UBKA 3U44B 1JXOA 3T7TA 4QGSA 3M6UA 2I6XA 3PIIA 1WXGA 4PPGA 3V00A 1MABB 4DADA 1P0FA 1TMGE 1KK1A 1UBEA 4TM7A 4ZCQA 3GFPA 1NJ6A 1FMJA 2ZBGA 2AOVA 3NH9A 3UUGA 2FI1A 2QE7A 4JI4B 1QYCA 1YC5A 3W2GA 5K0FA 3QBEA 5L4NA 5JSHA 3A1SA 4OLHA 3QPUA 5L9AA 2OYSA 3PDWA 2WINI 3ZCPA 2UV8A 1TQ8A 3O4IA 1QC5B 1R18A 1J7JA 4I81A 4MH0R 5H9WA 4FGSA 4CQLB 5JU6A 1NPYA 3E22B 4EK9A 2RIRA 1PJQA 3SF8A 4HFNA 4KEAA 5CVUA 4CCAA 2OV2A 1JA9A 4RTOA 1GGHA 4XX0A 1UF9A 3LNCA 2OFWA 1J22A 1MNAA 2OAP1 5DP1A 2EL7A 3FJ1A 2H4HA 4I4IA 1G3MA 4L02A 3ZVRA 5GGYA 3S68A 5E1BA 4FGLA 4CLEA 1CS0B 2CLFB 1Q83A 2ZXFA 3BA1A 5E6RA 2AYXA 1H23A 2OFOA 5EN4A 1VZ2A 1RQPA 2I3DA 3M2TA 2ZAIA 1M6HA 1Z6TA 2BEKA 1LSJA 1R0RE 1QH1A 3C15C 3PPWA 1Q74A 1EUDA 2ZUEA 1KRXA 3QUBA 4TWRA 1ICIA 3M1YA 4LJLA 4YIKA 3ZBTA 1QRDA 3OQNA 3G5UA 1ZU4A 3KHKA 4HDNA 1Z4PX 2AGVA 2D7JA 5KDLA 4E6PA 1VLHA 3NNDA 1WDLA 3LX8A 4AZ0B 3A0UA 2QW8A 1JFTA 1RLUA 1XNHA 3VPFA 4Z1MD 4K5QA 4FFMA 3LSYA 2ZT7A 3ZZTA 2VXYA 4YUXA 5I01A 5EVJA 3O8QB 2G5CA 4QTUB 2JCGA 1NY6A 1KC3A 2EHDA 2AX4A 1GZDA 2ETXA 3HKDA 3LOUA 4WN3A 3UC9A 2UU9B 4S24A 5DU2A 1U6JA 3ECAA 5IX8A 3MJEA 4NK4A 4RVUA 4F2PA 2YCLA 1N6LA 2JFGA 2X0DA 2DPMA 5EFOA 5JCOA 1M8KA 1M0EA 3FIUA 1KSFX 5A1JA 5TNXA 4LZJA 3DVAA 1T9GR 3WGLA 2IYFA 2H1HA 2R6JA 1CF2O 4FOLA 4XE5A 1NRWA 2WJZB 2B6HA 4JLSA 1G5TA 2FF7A 2J9XB 3OZEA 3WL7A 4ND4A 3ZG6A 5BURA 4JLNA 3R09A 2AG6A 4RIEA 5SZKB 1EUZA 2A88A 1MX9A 1OV6A 1BXGB 3IR7A 3D0RA 4U7FA 1ACLA 1G8AA 3UWKA 4D46A 2Q50A 4EB6B 3TX6A 1PZGA 1YF3A 1HYGA 3L0PA 1ENYA 3OZDA 1DKUA 1PJ2A 3Q7SA 4O4JA 2ODQA 4PYRA 4RHFA 5DRTA 1XROA 3UJ9A 2FOLA 1VCOA 1YAHA 5L4SA 5KVVA 1UMBB 1D2EA 1J70A 5JPCA 2YHAA 1CPYA 5KYYB 3L1VA 4AN0A 3HCFA 4EF6A 1GVHA 1I9CA 2XQVA 1P4JA 2WVHA 3CONA 1ZVMA 1W4LA 4Z4IA 2FVXA 2UYGA 2EEPA 3DDCA 3QXXA 4RSMA 2YC4C 1FUEA 1SULA 4J7CA 5H59A 1LH0A 2ZZKA 7REQA 2LCIA 3RYTC 1PL8A 1IZ9A 1XIVA 1FS4A 3GFQA 4J7UA 4PC7A 3D6UA 5FUVA 3UCEA 2OMKA 2WA1A 2QTFA 2RHCA 2CNKA 4FUTA 2ZRGA 5DGDA 5DTMA 1PZNA 2FEAA 3DDZX 3IAS6 3IR6A 2OGWA 3C6YA 4MUGA 4B6JA 5A2QA 3QX8A 4BAUA 4GH5A 4YC7A 3IEPA 2B36A 4IH4A 1K7YA 5FPQA 1MB4A 5JFTA 1L8LA 1DCFA 3U5ZB 1H9CA 1VYTA 1ZI9A 2P2GA 1E1DA 1UP6A 3EGVA 3F90A 3HYCA 3WY9A 3W5DA 1V16A 4JL6A 1XNGA 4FP9A 1FJ2A 1K7CA 4RZXA 1VBNA 4TTSA 2MSNA 3V1TC 4ABYA 3OOEA 5LYYA 5AFSA 5HWSA 3D4BA 4LJ6A 3HY6A 1A7AA 1N7GA 2Q5FA 2Y0EA 4EW6A 3P97A 2ECFA 3H6KA 2FETA 3DBLA 3RUFA 3FGZA 2FR8A 3ONFA 4J03A 1N6HA 3H2SA 3K70D 2MHCA 4Q4HB 3QOWA 3B48A 4BBZA 1J99A 1OFVA 2XX3A 1IJBA 2OBLA 4GXRA 4EYGA 1C5KA 4JR2A 4FCWA 2BIFA 4LZWA 1AZLA 1HT2E 1QIFA 3RU7A 1L5HB 5B3KA 4LQ4A 4JGBA 5K1ZA 2HQOA 2VBFA 1LGYA 1II8A 3FPKA 3G88A 2VDVE 2CJYA 1ONOA 1V37A 1D1SA 3DDSA 4J76A 1N2CA 4U7GA 3B70A 3VC3A 4YALA 3ZLTA 2MSKA 5KYKA 1SN7A 4IH1A 1AA9A 2JIPA 2PKYX 1PVVA 2WDPA 1F0KA 1QPGA 2WJYA 2WWTA 3IP6A 3Q1LA 4XYGA 5FBVB 4O0MA 1JB1A 5DGTA 5F2KA 1DCKA 5DE3A 1GTZA 2BFDA 5JO9A 3WHKA 2P3LA 1NV8A 4EBBA 1HDEA 1UJ5A 2GETA 3ZDXB 5L6MB 3ZQKA 2EZ9A 4PTYA 1JAHA 1YGYA 5CLLA 2ZSJA 2FK7A 3LFTA 2A3RA 1R0CA 3LHFA 5KMGA 1GDHA 3W5BA 3EVDA 3VSCA 4BX8A 2HRCA 2A84A 4BNIA 1E0DA 3BSSA 4FIZA 3ELDA 5GAJA 1JBEA 4TSRA 4EMBA 2I2CA 4NPCA 3QV1A 4M9QA 1KQ3A 3I6BA 3U7QA 4YCCA 2R96A 4FTWA 2FU5C 1EFHA 3OEHA 5G0WA 4G25A 1Z5WA 3GT0A 4MUMA 5EKTA 2JI4A 1A9RA 3LJKA 3L0CA 1V35A 1G20B 2VEDA 5MFPA 2YJ3A 2PX6A 4ZO4A 3WAJA 3PRKE 3HRIA 3CX8A 4MQFB 1PK8A 1P4HA 1W4BA 1UZLA 3HU1A 2NZYA 1IN8A 4DWJA 3WLIA 3ZX4A 2QX7A 3K0CC 1L4FA 3T6KA 5JVDB 2XDWA 3I42A 1FSGA 2D2IA 1GO2A 4GMGA 5D5PA 2PQ2A 5KQMA 4GP6A 1S3GA 1MO4A 3WBFA 4ARCA 3ZHVA 1ZITA 1YOBA 4IGEA 5FPKA 5ALLA 1RWPA 1KWKA 3GA5A 4NECA 4BQQA 1B8NA 2B5VA 2HBYA 8LDHA 5LM3A 3LU1A 5EIEA 2GJKA 2VHXA 3FB4A 3QFTA 1D6SA 3WTBA 3JYQA 1XDZA 1QIHA 1VYHA 3H2IA 2B83A 3LP5A 4TZTA 5EZYF 4RE6A 2HB6A 4XLZA 2XUAA 3GB9A 2GN6A 2ICAA 2JEZA 3U44A 4W5QA 2V1UA 4KVZA 1CY6A 2AQ8A 1Q15A 2P68A 4QPZA 4AX4A 1YMVA 1ZIOA 3BDIA 1VHWA 3QE3A 4XPIA 1VJ5A 1MABA 3E70C 3DL7A 5DYWA 3N70A 1U02A 5LQSA 4TTAA 3UWPA 4B3BA 4F7DA 4R9NA 3UG6A 3U19A 4MP6A 2QN2A 3RHFA 4WXRA 1G4HA 2ERYA 2Q8PA 4MGKR 3QVWA 4YV7A 3IVMA 2WV9A 3PC6A 3PGVA 4K6CA 2P2DA 3ZXYA 3EPHA 3L43A 4P54A 4DABA 4JLVA 5AHOA 2PEZA 1T2NA 1U80A 2BMWA 1W36C 2EIHA 1QC5A 3G2QA 4C4TA 5EJ6A 2ZKLA 4ZARA 3RQIA 3W6ZA 4CQLA 2IYYA 3E22A 5AKXA 1LPNA 4EPYA 4HH4A 1KI7A 4FFVA 2R11A 3G8BA 1BDMA 4K0RA 4QFMA 4QPCA 4BNUA 1LSUA 5A5FA 1Y7TA 3R24A 2IYWA 3HE3A 4RZHA 5AW8A 5C7OO 3Q0IA 3FTQA 4CDRA 1E1YA 4ZDWA 3T94A 2SKCA 4LGVA 3AJRA 1NHWA 1EGHA 5EMJA 3WRXA 4LA4A 6YASA 4HFRA 5COBA 1FJXA 3WR5A 1LBEA 3UJHA 1YNOA 3C5WP 4M99A 1CS0A 1J9ZA 3KKOA 5F4BA 2M2IA 3UAZA 3VU0A 4B09A 4EFLA 3DMRA 1QO0A 5CB4B 4WEOA 2AB0A 4BNKA 3KPVA 1WRBA 2YIMA 3EX7C 2H1FA 1JS1X 1UC4B 2VDJA 4UASA 4DCPA 1TOAA 4G0VA 3OCJA 4BHTA 5DYNA 1HE5A 3R0QA 1V0JA 1EPUA 2FKAA 4AZ0A 2ZUFA 5DT2A 4DDWA 4P83A 3E61A 4BLWA 2XSZA 5F9HA 2AYYA 2FE1A 1SG9A 4D25A 5BR4A 1WDWB 2ZWAA 1KYZA 1RRMA 2WJ3A 2QRUA 4MEAA 2GPNA 5EJAA 4NFSA 2VDNB 3O2SB 3O8QA 4F9EA 4B3GA 2WM9B 2B61A 1FSPA 3HI4A 1XU9A 1LLDA 2CLHB 3K05A 3NKFA 1Z37A 2FN9A 3PNSA 1WVMA 4BIIA 3EVNA 2V74B 4MGEA 1FCJA 3FI0A 5HMLA 5LBUA 3STUA 1V3TA 5JMOA 3O3CA 2J5XA 4PANA 3GH3A 2Q4EA 3RVOA 4KXYA 2R60A 2VHTA 3ANXA 1JALA 4D4IA 5A3JA 3I8OA 4K81B 3OKAA 1V6AA 4QUGA 1U3CA 4D1YA 4PLGA 5B7GA 1PZEA 5JIBA 1YS1X 3PXAA 4GT1A 2GQ0A 4XB1A 2E4VA 4JU8A 1FDTA 4FFDA 4MKGA 4BWGA 1Q92A 1A9SA 3CLVA 3PQ6A 3P4YA 3ET4A 1SRQA 4FHZA 2C7RA 1GPMA 2W93A 2EBHX 4J16C 4DREA 4F11A 4KDRA 2DH6A 5HXAA 4FFWA 5EXTA 5FADA 3U3JA 4CM5A 1W5SA 1POWA 3VC2A 1Y4UA 4MINA 1V8FA 2CL7X 1CKEA 3AIIA 3KKKA 3VOAA 3AUAA 5J4YA 1GCUA