3FGNA

Crystal structure of dethiobiotin synthetase in mycobacterium tuberculosis
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
230
structure length
230
Chain Sequence
b'FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dethiobiotin synthetase
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 72
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fgnA00
1G8YA 4Q9LA 4R71A 1H65A 2QQEA 3OEHA 3C8UA 1HA3A 1DG3A 3RSLA 1L2TA 4AYXA 2HXSA 2O8FB 4DSUA 4MKGA 4LDJA 2V8OA 1ESNA 2FEOA 3U7EB 3I8XA 5FFMA 1UBGA 4LZZA 2BJWA 4O3MA 1WMSA 3U7HB 2ZU0C 5JI2E 5LB2A 2J7PA 4R7ZA 3JZAA 1SULA 2VP9A 3RRZA 1CRQA 3QEJA 2ZJYA 3QG5A 2YOFA 1CJUC 1MT0A 2R6AA 4HDOB 2QSYA 1Z29A 2YZ2A 4PO8A 3WP1B 4US0R 3FGNA 4D2IA 2QP4A 3B82A 1E2IA 3F5FA 2OESA 4A0RA 4IVPA 5JEDA 1ZM4A 2UZ3A 4Z8YA 3UMFA 4I81A 4MH0R 3X1DA 4RFVA 2CE2X 1OYWA 1QHYA 2HF8A 1RZ3A 2HF9A 2JLZA 4AYTA 4EKDA 5TVKA 3JVUA 1E6CA 1Z0FA 2C9YA 1FUKA 4HYYA 4FMCF 3L0SA 2ZRGA 1E2GA 1OXSC 2B7CA 2WMNB 2AD5A 2OT3B 4XIGS 4AY2A 1FL9A 1DAEA 3KUDA 4MGZR 1OFIA 2C9OA 1G6OA 4TYQA 4Q9IA 3DMNA 3ZS9A 1EFHA 4NDZA 5F9FA 1EWRA 2PL3A 4PZYA 1V5WA 1E99A 2ORIA 1TADA 3LLUA 3GLFE 2JJ8A 2WJHA 5FPSA 3V9PA 3TVTA 1NG1A 5DN6D 4F4JA 1WP9A 4UXIA 4HLUA 3T35A 3CX7A 3FDIA 2OCBA 2V6IA 3L2OB 3FVQA 2F3RA 1NIJA 3Q72A 3QPVA 3SQXA 3SBEA 1UEIA 4XSGA 3UWOA 4OJQA 2C8VA 4KJZA 1X8LA 1G5TA 4IXNA 3A1VA 4JL5A 3IIJA 4RD2A 3T15A 2D62A 2WBLC 3NEYA 4DCSA 4CIDA 1ZM9A 3R8CA 1YZQA 3GQBA 2AXPA 5DO9A 2JIZD 4BLPA 3VR2A 3AVTA 3D7MA 3W6PA 4CEIA 2XTNA 4TTQA 5FBQB 4TSFA 1KKMA 1FP6A 5G41A 5G3ZA 1U2RA 3CRW1 5L3SB 1YHNA 1XWIA 1A7JA 3TUZC 1NNEA 3SFVA 4GFDA 5IDVA 4B71A 5J4LA 1DAMA 2HDNB 2PEYA 1XMJA 2EFDB 2DFTA 2VF7A 2CLDX 4GP7A 5FUWA 2VYFA 4DCUA 4DKXA 3RS0A 2JJ1A 2A5YB 3DEFA 3CRQA 1GL6A 2DWQA 2X1VA 3LNCA 4M9ZA 5CB6A 2RGBA 2H57A 2RGCA 4FMBB 1HQCA 1ZUIA 4DHEA 2QTHA 4TYYA 3K9NA 4Q4JA 4PAQA 1QVAA 1OXUA 1E9FA 3IHWA 2YHSA 1DO0A 3MAAC 3S1AA 3BAFA 4TTRA 2I4IA 1OHHA 4LWZA 4NH0A 4DLTA 4DC9A 4EJSB 1D2NA 1TUIA 4ZIRA 5D3MA 3TSWA 1RFLA 1CF4A 1E1QA 5KHOC 4GI7A 1TF5A 1TL7C 1NJFA 4B3BA 4LGMA 3ZYCA 1U0HC 3SDZA 2X8AA 1PUJA 4DUGA 4I1VA 4QL3A 4DRZA 4HUTA 1FTSA 1FMLA 4C0AC 2W00A 2YWEA 1JAIA 4BASA 3CKLA 1TF7A 2DFKB 4MUBA 4MDFA 3PEWA 3AVVA 1MOZA 2ZITA 3PENA 4DEXA 1G9XA 2IYVA 4G5SA 3JZMA 4JMPA 2FSIA 2BMJA 4IDOA 2PZFA 1EFRD 1N25A 1CR4A 2LKCA 1TNDA 4ARZB 2JLXA 5DHAA 3U4QB 4DJTA 2NQ2C 1XRJA 3ZH9B 2F9LA 2IEYA 2DFNA 4LJ9A 2OXCA 1H8HA 4Z54A 1OFTA 4BE7B 2ZRIA 2YJTD 5J4YA 5DYGA 1SZPA 5K8UA 4ZDJA 4RFSA 1VIYA 2BVNA 5KOYA 1U8ZA 2IYYA 4BFYA 1E1RD 5L8VA 1AJEA 1U8YA 4HSEA 4Q7LA 4JLDA 1XJQA 3CRVA 4DCVA 3AVWA 4NYJR 3ICQB 4KVAA 5J47A 3H2YA 4W9MC 4HB0A 1NI3A 4NYJQ 1SVIA 1UDXA 2PJRA 2OLKA 4DCTA 3KZ1E 4NCNA 2A5DA 5FR1A 4YDHB 2WOJA 1B0UA 1COWA 4R2HA 3J81k 2Q3MA 4TLCA 1II9A 1Z0IA 3VR5A 4PC3A 2J5XA 1EX6A 4M9XA 2WPDD 4MDEA 1OIXA 4OK5A 4TL6A 2GEUA 3CH5A 4MGKR 1PLLA 5JWRA 2E87A 4PANA 4BECA 3V4RA 1N5LA 2DCUA 2JJ2A 4TLDA 3QKUA 1DAIA 4JKIA 2OFXA 1E2PA 3TAUA 1U90A 3TW4A 3RWOA 2F1IA 5CDFE 3GLFA 4UNPA 4AK9A 3K0AB 4V0OA 1WBDA 2XGJA 3U7GA 1VCIA 5B2ZA 5EJEA 3FKSD 4URXR 4ZO4A 4EPXA 1CLUA 4JLAA 1Z83A 3RS2A 5BN5A 1FQJA 5KU1A 1RRCA 3R7WA 3BFKA 4BLTA 1KI7A 3REGA 1RPZA 4YMSA 4QG7A 3PXGA 2OUKA 2B21A 1AS3A 1MABB 2WKRA 3IIKA 4B3FX 4QKQA 5BWMA 4AKHA 1W1WA 5EXSA 1LV7A 1US8A 1Q3HA 3OAAA 4UNNA 2QE7D 1ZIOA 1E9EA 3L43A 5EZ5A 1JXOA 5EUQB 3PUZA 2FWRA 3B7GA 4D82A 4IEIA 4GT1A 4M1SA 1Z5ZA 2O8FA 4Z1MA 3MWLA 2P6UA 2WJVA 2BHRA 5F9HA 8OHMA 2ZRHA 4RJLA 1YZLA 4WZ6A 3VX3A 4BZPA 2C9CA 3K70B 3PVSA 2ZREA 2ZRCA 1XEWX 2A5JA 5KPJA 3NBFA 5HZHA 1ZIPA 3CBQA 3LRPA 1PLJA 1N5KA 1G19A 2XOKA 5JFGA 2QUZA 5FTNA 2ODBA 5HR5A 4WZBE 3U6KA 1JI0A 3BBPA 1R10A 1G17A 1OF1A 3AEZA 4W5WA 5LB4A 5JJIA 4PAMA 1HUQA 1A5TA 3EZ7A 3I5YA 4OHWA 3KFVA 1E9SA 1E9AA 1NSFA 2K5UA 3F3YA 1VPLA 1Z08A 4OK6A 3HU3A 5BQ5A 2VRWA 2WJJA 3ZVRA 1UPTA 4NZYA 2QGZA 5JCPA 3X1XA 3GJ0A 1XFAA 1IJEA 1P2VA 2OAP1 3KJHA 2OHFA 2W6IA 3AQ4A 4D4KA 1ZU5A 4FW9A 4BFZA 2QMUA 1VG1A 2DHRA 2R6GA 5AUOB 2RAPA 4G5QA 5LPNA 3SR0A 3MG9A 3LQRA 1IN8A 1OXVA 4XOIA 5FL7D 2WSSA 4B74A 3MSXA 3VR4A 4QJ5A 1N0WA 2J87A 3QNUA 3CUEF 5AUQA 3RS5A 4YONB 1T4GA 3WP0A 4L5BA 1JQLB 1AS0A 3VR6A 1JECA 5KSOA 3PJRA 3I92A 1NRJB 3DOFA 1N6HA 3EIHA 4B3GA 1CTQA 2H18A 2H8KA 2ZEJA 3ASZA 2O8BB 2IK8A 5AK0A 5HE8A 3I8SA 1BYIA 2OXRA 4GBMA 4MGYR 2VQSA 3B1ZA 2QT1A 3K8YA 4PFSA 4HLCA 4BLRA 4Q00A 1WE2A 1QDEA 5DE3A 5FUXA 2FPLA 4ZDKA 4ABYA 1VTKA 4YMUA 3U3RA 4Q4LA 2BM0A 3W8RA 3NIBA 4HDCA 5JJLA 3WMFA 3DKPA 2BEKA 4QOSA 3NG1A 1KY3A 1W7AA 2N1BA 2WWGA 3B1WA 2FDCA 1N6OA 1DVRA 2JDIA 2IYSA 2CHQA 5GVSA 1CULC 2BCGY 4PZZA 1HT2E 4GZLA 5L3SA 2EVWX 2RGXA 2WICA 4FCVA 4QNMA 2XB4A 4BLOA 4PSAA 3VQTA 2W0SA 2BEJA 3CZPA 3NHAA 1H8ED 2VPPA 4WXRA 1JR6A 3VKHA 1ZUNB 2QENA 5CIQA 4PTLA 4C30A 5JZVA 1K8RA 4KO8A 3TH5A 1FNMA 4BLQA 3U5ZB 2CE7A 4XTRA 5CDFA 3BS4A 1E98A 4TLBA 5P21A 4EJSA 2CVHA 1KK1A 2WJGA 4AIIA 3T61A 4LJ6A 2IYRA 1CP2A 1NN3A 3V00A 4WXPA 3RC3A 3RS7A 3VAAA 2PBRA 4JZKA 1GTVA 3AP1A 4ACAA 4B2LA 4QJ4A 2XSZD 3B1XA 3AF4A 1EESA 1UBEA 3HJNA 1C1YA 5HCNA 2ZE7A 1F3OA 2GETA 4MGIR 1IN5A 4QJ3A 4KHZA 3DO6A 1GNRA 2QAJA 1O3YA 3UKDA 3K9HA 5J5CA 2LWIA 2BMEA 1A2BA 2FOLA 4CF7A 3WMGA 4MKFA 3UXMA 1BKDR 1MV5A 2ZUCA 4TQAA 4ARZA 5SZJA 2FH5B 4N3NA 3AH8A 3KJGA 4AKIA 4U7DA 3U4QA 4TMVA 3CIOA 4YDSA 4I4LA 1GWNA 1TU4A 4BGDA 4NYIR 1SVLA 1TPZA 1D2MA 3CM0A 2RGNA 3LXXA 5FOUA 1YR7A 1II8B 3QPUA 4V0KA 2RKOA 4JBXA 4QGHA 5ELXA 1XMIA 3Q3JB 1QF9A 2XNDD 4CVNA 2GK6A 4A36A 5LD2B 3MGCA 4IKEA 3R9IA 1W0KD 2CCKA 4V0ME 4MRSA 2VHCA 2MMCA 3RSOA 1XX6A 4QBFA 1N6IA 2NO1A 5HPYB 4DLXA 4DLSA 1XCGB 1W0JD 3P27A 3IHLA 4TL9A 1VYUA 3FHCB 3H4MA 2WWIA 4MYTA 3U61B 4I1SA 1Z2CA 2IT1A 4N0DA 4XWKA 2WOOA 2KBEA 1VG0B 3TGPA 4KODA 1SXJB 2YYZA 4E5UA 3K09A 2VSXA 2IL1A 1W4AA 4K81B 2IHBA 4Q47A 5AJZA 2HEIA 5JRZA 3OEED 3KQKA 1P9NA 3HR8A 5C4GB 3RWMB 2QPOA 4UJ5A 1NVVQ 2GILA 1D5CA 4KITB 2FU5C 3QKTA 1W44A 3SU8A 1UF9A 4DSOA 2F6RA 3Q7PA 1X8KA 1DAKA 3K0AA 4OJKA 4Q4AB 3QPWA 2AWOA 4TMWA 1CIPA 1AGPA 1QVRA 2RHDA 2P0EA 2A2ZA 3DVLA 4JT4A 3EZ2A 3NTUA 4AI6A 2OBMA 4B2PA 2NZ8A 4R2IA 5L3QB 1P62B 1N6LA 1OH6A 1MO5A 2FPMA 1MABA 1QHXA 2RMKA 4KFTA 1GNQA 3QXXA 5FTMA 3EZ6A 3TUJC 4M1WA 1BH2A 2QL6A 2ODEA 2V54A 2FFHA 2W2TA 2XJ9A 3OIYA 4TT3D 4BFSA 4P32A 1F2TB 3X1YA 3GJ6A 3LV8A 4FINA 1YU9A 1UEJA 4G5GA 2ZRJA 4LUCA 1R5BA 5JWOA 2FSFA 2WWFA 3PIRA 3OE7D 1GL9B 2Z43A 4V02A 3AF0A 4XWOA 3THXB 3PUYA 3OFND 4LC1A 3CLVA 5KDOA 2O8EB 1VCNA 2OFWA 2YC4C 4YQFA 4URUR 3IBYA 1HYQA 2AXNA 2FJUA 4JJKA 2IYLD 1RRFA 1UKEA 5FUYA 4WOPA 1G4AE 4A9AA 4CT4B 2QY9A 2ZSEA 2B7BA 1P4SA 2V1XA 2FPKA 3IQXA 4HB3A 3B2EA 4URVR 2B8WA 1KO7A 3CH4B 1B23P 2PZEA 2JATA 1HV8A 1Z6GA 2J45A 2LCFA 3LDAA 1CU1A 5G53C 2NMVA 1A1VA 4DEYA 4WAUA 3IKJA 3KX2A 1SXJE 4YXWD 4OQXA 4URZR 1SVWA 1SVMA 4HAXA 3T1VA 2G6BA 1ZNWA 2F1JA 5DISB 4F93B 1JQJC 2QPAA 4RKFA 1NKTA 2OSBA 2QGNA 4KSBA 4XSHA 4L8GA 2GCNA 2KE5A 4H1VA 3C5CA 5L3RA 4P4SB 1IY2A 4A8JC 2HJVA 4IHQA 4DLYA 3A4NA 4OI2A 4O2RA 2QNRA 4LHVA 5FPKA 2ZI3A 1QHNA 2O8BA 3KB1A 4XJXA 2XB2A 3RNLA 4DBLC 4TLEA 4PHHA 4ZV4A 3AVQA 1U94A 5JMTA 3QEOA 1D9ZA 3QOFA 4M1OA 4OHYA 4URYR 1W36B 2YC2C 1KI4A 1CJTC 3QXJA 2PMDA 1YRAA 2QAGB 5FBWB 4HAVA 1QRAA 5AR1A 1UKYA 1XEXB 3WYGA 3DDCA 1TMKA 2R6CA 4EDHA 4IVQA 2BMDA 5IHPA 5KSZA 3LQQA 2CNWD 1G7RA 3VU9B 4QBGB 3BERA 2KBFA 1CJMA 4TL7A 3HP1A 4V0MA 1P75A 4TMTA 3T12A 2EWVA 3PEVA 1NF3A 3RS3A 1LB1B 4Q4HA 3H86A 4G5RA 4AG6A 1Q21A 1SVKA 4LBVA 4RCZA 3FE2A 3I32A 3EC2A 2IF0A 5CM8B 1EFTA 1TF2A 1JB1A 1LVGA 4UNRA 5M04A 3SOPA 3WYFA 3BB4A 1AKYA 2GJAA 3WYAA 2QBYB 1OPXA 1A2KC 1EFUA 2EU8A 3Q5DA 2ZI7A 3GLHB 2CMKA 3EA5A 1KZ7B 3LFUA 5B58C 5F3WB 5CYOA 4D80A 1ZP6A 1QZXA 3PEUA 3GCGA 3HWSA 3SNHA 2P67A 4POAA 3MD0A 1ZNZA 2WKPA 3I73A 1WCV1 4PHFA 4C0SA 5EUMA 3LWNA 3D6TB 4Q01A 3QKRB 4JL8A 1DOAA 2F9MA 3VTKA 4ZI3A 2GCPA 5E7JA 5J4KA 2V1UA 1P7CA 4BZQA 3DZDA 2J0SA 1OKKD 4IDPA 1GFIA 2EFHB 4FMCB 4MRRA 2PZGA 3EWSA 4P0TA 1KO8A 3BOSA 5FUVA 3ONWA 4ACBA 1P9RA 3MUFA 1R0WA 5EP1A 4ZPXA 4UNQA 3GLGB 1S1MA 1JNYA 3CX8A 1NVWQ 4IEEA 1OXTA 2J0VA 1RW4A 1NMXA 5DN6A 2FFBA 5GADl 1EG7A 1P60A 4BEJA 2AK3A 3C7KA 1GDDA 3TIFA 1II8A 1EFCA 1OB2A 2X77A 3A4LA 2C5LA 4TMXA 1S8FA 5CK4A 2O0KA 3FTQA 3QVVA 1X1SA 2AD1A 2KWIA 3CZQA 2W6JD 4M1KA 4WA7A 3R8FA 1W4CA 3FWYA 3IEVA 4M2LA 1PLKA 1G4UR 4LRWA 4CGZA 2XAUA 2XZOA 3IGFA 4V03A 3EARA 4PPGA 4DB2A 2BDTA 1N0VC 2ZI4A 3MJHA 4YMTA 1CRPA 2IF2A 2BV3A 1Q22A 2JIZA 1M2OB 2GBLA 2VH5R 4X8MA 4QM7A 4MRVA 2P6RA 1XXHB 3VKWA 4LBZA 3SJZA 1F6BA 4PC2A 2HJGA 4WZAE 3K0SA 3ND8A 1I2DA 4FD2A 4DLWA 1U0LA 4FI3C 2G1JA 4PC7A 1I4LD 5KDDA 1J8YF 6Q21A 1E2MA 1SXJA 1ZW6A 3KKNA 4XVUA 3HU1A 3T1QA 3AKYA 1A82A 2XITA 2OEPA 3PUXA 4ZDWA 1DELA 2QP3A 2WAXA 3NBYC 4HAUA 1DTSA 4M21A 4ERNA 3KQNA 1KTVA 3DL0A 1NN0A 2FMXA 1M7HA 1ZMXA 4JLOA 2O8DB 2ZYVX 3GLHE 1R6BX 2IC5A 2QI9C 1AA9A 2F1HA 3FPAA 3DPUA 4XD7D 4Q4AA 1VHTA 2HXYA 2ZI6A 5CLQA 3DZ8A 4GL2A 4RKEA 2UZIR 2G3YA 2J7PD 3B8HA 3NH9A 3MLEA 3ZDQA 5GJWC 1QBKC 3HU2A 1KZGB 3PR1A 1CS4C 1JPJA 4A2QA 1G20E 3CF2A 1RC8A 5L3QA 3QXSA 1Q3TA 5H68A 5KO2A 5CJPA 5JWHA 1AK2A 3BC1A 4JBWA 1OH7A 4IOLA 2IS2A 4EPTA 2ZS7A 3KKOA 3F0TA 2ERYA 4RD4A 2IBMA 1FPMA 4A15A 1N3BA 4DSNA 4JLNA 3ZGXA 3T1OA 4D4LA 1IN6A 3BORA 2ASEA 4IXMA 2ZR9A 3Q5EA 2ODNA 3TW8B 2FEMA 1R4AA 2HLDD 2R2AA 4FN5A 4US1R 1EFRA 4C0QC 821PA 1YKSA 1E2LA 4ZKDA 4Z51A 2QMHA 3K0FB 3TQCA 5C18A 3THXA 1DAFA 1IY0A 4IOMA 3UPUA 2O8EA 4B6EA 4HB2A 1XU4A 4HZIA 5SZHB 2GCOB 5SZIA 3QXCA 4C0JA 3AV0B 2ODWA 2V4ZA 2J0QA 121PA 4M4SA 2J9RA 4M9QA 1U98A 4UNSA 4CRWB 1AZSC 3CX6A 2ZSAA 4C4PA 1KHTA 4OHZA 3T06B 1XMSA 1E1RA 5CB8A 2JLWA 1UADA 2H7VA 2WWHA 1MRSA 1D8TA 4GZMA 3BWDD 2IYTA 1ZNYA 3OZXA 4M1YA 2CJWB 4CW7A 3F8TA 1KY2A 4O0MA 2ZRLA 2ZVQX 3L0IB 4LI0A 5EE5B 1R0ZA 3TE6A 1X3SA 3TSZA 4DSTA 5BW8A 1WA5A 1F5NA 2ANCA 3QENA 4G01B 2W2XA 4Q18A 1S3GA 2QSZA 4LJ5A 5JI3E 1E0SA 1E9BA 1Z6AA 2BM1A 4NCIA 1VYTA 2WPDA 4P4SA 1P3JA 4G5OA 4TSFD 3NBXX 5AJYA 2C95A 3QG1A 3RVBA 2HV8A 1RJ9B 4F4IA 2VHUA 5DGXA 5F2EA 2FSGA 3QJYA 2GXSA 4AKGA 2JJ1D 3DMDA 3ZD7A 5FPHA 3FKSA 4EJSC 2QAGA 3B1VA 1HE1C 1GKYA 3AVUA 2HCBA 3THWB 1XEXA 4BZXA 1NMYA 5FPYA 2FNAA 4DVGA 2VL7A 4KBGA 3L8YA 4C0LA 3ZD6A 3GFPA 1F2UB 3CPEA 1Z6TA 4ZKEA 1Q1ZA 4Q7MB 3VU9A 1VIAA 1E0JA 3EA0A 3LVQE 3FMIA 4NU0A 2QTFA 2ZTSA 1E1QD 2JCSA 1V43A 1YE8A 2GJ9A 2VEDA 1IHUA 4EPWA 1Z0DA 3I1FA 1OH8A 4RSGA 1L7VC 3B1YA 2IUTA 4DUGD 2IXEA 3I61A 1I4TD 2ATVA 2P2LA 3K1JA 2GRJA 1T9HA 4AYWA 3LH5A 3CPJB 4IDQA 1Z3IX 3P4YA 4JLMA 1DAGA 2BBWA 2QBYA 4M22A 3N70A 4JS0A 4LOAA 1ZRHA 3GLHA 2RGNC 2H17A 5GJBA 3W9YA 5KPDA 2Z83A 2ORWA 3JVVA 4P3YA 1P2UA 1PUIA 2NO6A 3NEJA 1W46A 4GOKA 1JBKA 3QKRA 1H8HD 1F60A 4LSGA 2BBSA 1S0UA 3MWKA 1FW6A 2WWXA 1XB2A 2XXAB 3UIEA 4QM6A 4DDVA 721PA 1LF0A 4II7A 3REFA 1T91A 4RD1A 2QZ4A 4LK2A 2J41A 5FL3A 1QHHB 1OXXK 1JEEA 1HURA 4L9WA 5DLQC 4LYJA 1ODFA 3QSYA 1VCOA 3GLGA 3Q9LA 1Z6XA 4N1AA 4WVFA 3K09C 5D3QA 3UK6A 3QF7A 4OQFA 2SHKA 3C4JA 3IPXA 1P2TA 1SVOA 2NO0A 1KSGA 4A92A 3IBGA 4OHXA 1IQPA 1OH5A 2J7KA 3PITA 4C0HA 1MH1A 1E32A 1OE0A 4M53A 1Z07A 4ILEA 2QPTA 2YOHA 1Z0AA 2WWYA 1GKUB 2P5SA 2JJ2D 2FGJA 4GMXA 2CL6X 2Z0MA 5FBRB 1E4VA 1BS1A 4DDUA 2FV8A 4LPKA 3V4FA 4LPSA 1Q12A 2QN6A 1GSIA 4DLVA 3ZIAA 2E1RA 2NO7A 3AKCA 4ZDIA 3T34A 1XXHA 5C1BA 1KOFA 3SHFA 3X1ZA 1J2JA 3GJ4A 5GJCA 2VHTA 3EIQA 2GZAA 5BN3A 5AUNB 4MA4A 2MSCB 3W6OA 3SJCA 1ZM7A 3L0PA 1T6NA 4TYNA 3VNUA 3OAAD 1ZC3A 2Y8EA 3HPRA 3ZZTA 1IAQA 1BYUA 2JEOA 2WV9A 2O8DA 2ZRMA 4KAXA 5AJXA 1XEFA 3Q8XB 1KDPA 3C16C 3SS8A 4ZI2A 5HCIA 2CVFA 1Y3AA 1NIPA 2HCJB 4PPNA 4Q9KA 4R98A 3TJZA 2E9SA 2NTYC 1E79D 1Z47A 4MKHA 2GA8A 4Q9JA 5IF9A 4S2EA 2F7SA 4Q7JB 2IA5A 2HYDA 4D25A 4TWZA 3GJ8A 4H1UA 2XOKD 4LC0A 1OFHA 1N6RA 3T5DA 1FX0B 3W90A 5TB5A 3G0HA 3WNCA 1RKBA 5TDHA 2XSZA 4O25A 4HDQB 1VHLA 4BUJA 4OQNA 2GJKA 4KCGA 3PEYA 1GILA 1YRBA 3SBDA 1XTIA 3A1UA 1DO2A 4U00A 4QHSA 4PC1A 2ZSBA 2W6ID 2C04A 2G0NA 1Z22A 4KVGA 1TX4B 3X2SA 1LF5A 2WVJA 3K0FA 5H8WA 2ONKA 2LKDA 621PA 3I3SR 2VA8A 1C9KA 5KTYA 3EG5A 1L8QA 2GCOA 2PX0A 2ZR7A 4CZ2A 1IXZA 2J0UB 3RAPR 4F91B 3O47A 2NGRA 3L82B 1BMFA 1Z2AA 5J40A 5G40A 2PJZA 5HKKA 1VCMA 4Q1AA 1JR3D 1TQ6A 3UMSA 4BQSA 1YR8A 4NYMR 2VBCA 2AFHE 1ZD9A 2P5TB 2OBNA 2RGDA 2W58A 2XNDA 4NYMQ 1NBME 3CB4A 2WTUA 1N2CE 2ZI9A 2CJWA 4Q7KA 4TYPA 1WF3A 5EQTA 4JLKA 4HAYA 4IFBA 1CR0A 1U9IA 1R7RA 2VP5A 2BKEA 1GP2A 2ZJAA 1KK3A 4OI1A 2W2VA 2ZUDA 3ZS8A 1R0YA 3AVOA 1DG1G 4C0KA 2ANBA 1LS6A 4RZXA 4JBYA 3AF3A 2ZRKA 2ZS8A 2REBA 4L9SA 2JDID 5TY0A 3QKSB 4JSTA 1ZNXA 4LYAA 3OEEA 3EIEA 3LW7A 4HATA 1M7BA 2H92A 5KSYA 3ECCA 4JVSB 2GESA 4ITRC 2YV5A 1RJ9A 2CLSA 3B60A 1NP6A 4NYIQ 3MRSA 2FGKA 3GEHA 3GLIB 2BC9A 4HZUB 3G82C 5FBLB 2GKSA 4UQOA 2ZROA 4A2WA 3TSOA 3W34A 3A1SA 1ZJ6A 2DFLA 4M1TA 5B30A 1XP8A 3E1SA 4EIWA 3BXZA 1WXQA 4BWYA 2G88A 4I1OA 2D3WA 3THWA 2FG5A 1RRGA 4DDWA 3O8DA 2OAQ1 3DKVA 3E70C 4JLBA 1GAJA 3ZVNA 1E96A 1NY5A 3AKDA 4E09A 1XDBA 1SHKA 5DIFA 4A0HA 2NIPA 2GTPA 2MSEB 4X8OA 1Z63A 3WRYC 2BOVA 2XX3A 1DADA 2FX3A 1G7CA 2QMOA 3N2IA 3SYKA 2ZRFA 3OIUA 3HPQA 2WWWA 5FOXA 2YWHA 3LY5A 3Q85A 4LV8B 1OLOA 1QHSA 4F38A 4US2R 3OE7A 5DYIA 3EPHA 4PSVA 1FP7A 2OILA 2ZSFA 1X86B 1VECA 4LY6A 4B32A 1I2MA 2ZSDA 1U99A 2UVQA 4HB4A 1IXSB 2DBYA 5TMPA 2QA5A 2D06A 2F1RA 1XZPA 4R9UC 4W7SA 2IYWA 1G16A 2DY1A 5KNCA 1P61B 2ZU6A 3AF1A 1E69A 5LD2C 1E2DA 2C03A 4TLAA 1GOTA 1M6NA 2XXAA 2R6DA 1NN5A 4MRPA 4NHOA 1G6HA 1NLZA 4ON9A 1ZU4A 1GRRA 3FHOA 3NH6A 1FMJA 5CLLA 1TTTA 4W5HA 1QHHA 1OJLA 2H1LA 1MR3F 1S9HA 1W2GA 4OHVA 3U2QA 1SXJC 4XWAA 5FPTA 4CDGA 2NZJA 3ZJYA 1YJ5A 2IXFA 2QRZA 4NBSA 4DLUA 3AKEA 3BD9A 3K0CA 3WXMA 4NP6A 5CYPA 1G3UA 3CRMA 3PQCA 2BMFA 1OV4A 2PMKA 1CR1A 1T0JB 3FYHA 4HLUC 1PV4A 2G9NA 5KDLA 3GPLA 4B33A 2CCJA 3M1IA 4IDHA 3WNDA 2ZE6A 2IYQA 5JRJA 1GUAA 2V7QA 4KLNA 3C15C 2IYUA 4Q1BA 1G5RA 2F3TA 1E2FA 5EP3A 2B92A 3GFOA 3IEUA 2RH5A 1W47A 3FOZA 4IVRA 4O2LA 4A8JB 3EXAA 2BWJA 2IX3A 1DPFA 4HEJA 2WMOB 4GOXA 4NE2A 3VNVA 5A0FA 2ZJBA 3CF6R 4NCHA 4YLGA 2IYXA 2OE2A 4JVLA 2ZIAA 4JVNA 3SHWA 3P1JA 3QF4B 1E9CA 1NBMA 4NCKA 3DOEA 4JL6A 4NTZA 1IN4A 3DHWC 5EE0A 1JJ7A 2ZJ8A 1NG9A 2XZLA 1JXMA 1T5LA 2ZYTX 3U3MA 4BFTA 3KXKA 4EFMA 1Q44A 1UDWA 1E0AA 2HYIC 4P4UA 2YWGA 5JS7A 1NMZA 2OCAA 3BB1A 1G18A 1R8QA 3RHFA 2DB3A 2QRNA 4KLZA 1N6KA 4AG5A 5IRCD 3FHTA 2R62A 4RZ2A 1FNNA 1KKLA 1UKVY 3OF5A 2QM8A 5EE3A 4ESVA 3AP2A 2FSHA 4PQFA 3ADDA 1NLYA 3CR8A 1M8PA 3U3KA 3ADKA 3BFVA 3ZZ0A 4BEBA 1VG8A 4BFUA 1FFHA 3KQLA 3LA6A 2AX4A 1KI8A 1KAOA 1KI1A 4Q9HA 1VDZA 4EPYA 1NY6A 2GVZC 1NL3A 2YOGA 1CJKC 2Q21A 3U3JA 1FX0A 1XD9A 1IM2A 3X1WA 5CITA 5B57C 5EXTA 5IK2A 1JEDA 1OFUX 3ZVMA 3MFYA 4F4CA 4M8NE 2OM2A 5JEEA 1G3QA 1YR6A 1OW3B 1OKKA 2OZEA 4UKDA 4E03A 4EPVA 3EC1A 4KFRA 2C77A 3BK7A 3RRNA 3MWYW 3TNFA 2FZ4A 1W5TA 2Z5FA 2A78A 4HUQB 1Z28A 3GJ7A 3NWJA 4OK3A 4LV5B 3TLXA 2QTVB 2XTZA 4PQYA 3H1TA 3AGQA 3IUYA 1AN0A 3FKQA 3AM1A 1DAHA 1XD2B 4LHWA 4UXJA 4JSYA 1XPUA 2D74A 5JJKA 2J0UA 4NPHA 2JLRA 4B44A 2XNSA 2G83A 3QIAA 4Q1CA 2Z4RA 4EFNA 1SVSA 4AWXA 5E4FA 2B6HA 2WHXA 4LJAA 1W36C 4LX0A 2G0TA 3FMFA 1QG2A 1Z06A 2AWNA 4ASUD 3H84A 4FCWA 4PXAA 4S35A 1II0A 2R44A 3LXRA 2D2FA 2ATXA 2OCPA 3BH7A 3EAQA 2JLUA 3EZ9A 3ZVLA 2EQBA 5FI1B 2F43B 4URWR 3BIFA 4IOKA 3KXLA 3ZLJA 3FFAA 3R7WB 2IYZA 2VO1A 3IILA 4F7WA 1YQTA 3TRFA 3BRWD 1T5IA 3A1TA 3KKQA 1XBTA 4PZLA 2WZQA 3K9GA 2O0JA 2C99A 4WIAA 3QKSA 4JJZA 3SEAA 3TQFA 4B3XA 1ZD8A 4MUAA 1G3MA 3BFXA 4ZCMA 2VP4A 4TQUS 2QORA 2HUPA 1T3SA 3LBHA 3GLIA 4PX9A 4HZUA 3RLFA 1KSHA 3SYNA 4XD7A 3LLMA 3E2IA 1QHGA 4QC2A 3SYLA 1KSFX 3B13B 3AUXA 4DCNA 3I72A 4GP6A 3IDQA 2GJ8A 4CEHB 2FA9A 1E2EA 4H9GA 1R2QA 4I99A 4J0QA 1XEWY 3C14C 4C9BA 2WIBA 2CK3D 1ZC4A 5JHHB 3AP3A 4CEIB 4LJYA 2VF8A 3WBKA 1GL7A 3A36A 4X8LA 2WIAA 1XZQA 3I5XA 3OESA 3VMFA 4C2UA 1O87A 1F48A 1AZTA 4MYHA 3WHKA 4GPTA 3KXIA 4BLSA 2N42A 2HLDA 3AB3A 1CKEA 1Q20A 1ZBDA 2ZE8A 2KI5A 1HTWA 3B78A 1Q1EA 3CNLA 3FMPB 3G5UA 5BYKA 1W4BA 3VX4A 1Q57A 1QHIA 3OEHD 4AC9A 4EFLA 5BXQC 3ZQ6A 2FN4A 3TBKA 3UG7A 3P20A 2Q6TA 4IDNA 2YNMA 1JAHA 4TTPA 5K8LA 4MYCA 3EPLA 2ZUBA 3KQUA 3QQ5A 2P6NA 4DLZA 4M9SA 3R9XA 2QMEA 2AFIE 2H5EA 4KYIB 2PH1A 4ESHA 2I3BA 3H0KA 3UWKA 1CBUA 1DARA 1JJVA 1KMQA 2ORVA 2BCJQ 3GP8A 1XJ0A 1KO5A 1ANKA 1KO4A 2W0MA 1W48A 2CHVA 1F2TA 3BGWA 5CM9C 3GLGE 2Q9AA 1OT3A 2AK2A 5DI9A 3TK1A 1ONBA 1K6MA 2EW1A 5EE1A 1ZD1A 2Z4SA 5TARA 2QT0A 2J3EA 3BH6A 2O5VA 2XEXA 1AS2A 3OHMA 2OBLA 5HTKA 4C0BA 4U5XA 3TUIC 1YZUA 4HAWA 2GF9A 1X6VA 2X2EA 5BN4A 4CEJB 1G8HA 4PQRA 2ZYWX 4P4TA 3HYTA 2DWOA 3ZQJA 1J99A 4N0EA 1GIAA 4LJ4A 4Q48A 3THYB 3MJRA 1KI6B 3SFZA 1R5NA 1Z8FA 3LBIA 3L8ZA 5KNBA 2UKDA 3FFBA 3GFTA 2VHJA 3GEEA 1NVXQ 1ELOA 4XVRA 1G21E 1SXJD 3N2EA 4BFWA 1FQKA 2PT7A 4L4UA 4PC6A 1ZUHA 3AUYA 3ETLA 2ZE5A 1KO1A 2ZANA 1E2JA 1AQUA 4A8JA 2EYUA 4DT1B 3SE0A 2P65A 5AWFC 3EWAA 1PJRA 1S9DA 1Z0JA 1XXHE 4GMDA 2GHIA 4X8HA 1P73A 2GZDA 4YMWA 1KK2A 3LAWA 5FOWA 1E2QA 2L0XA 4GRAA 1KI9A 2BKUA 5FR2A 3QF4A 1HY3A 1G64A 1KI3A 2O0HA 3B9PA 4NMMA 3RRYA 5SZKB 3W5JA 2EYQA 2RGAA 4LBYA 2WKQA 3KKMA 1G8FA 1DEKA 1WDTA 3IO5A 1FTNA 3GJ3A 4LHXA 4PPQA 4KFSA 3RDPA 3EX7C 3PV0A 2OLJA 3QI2A 3P32A 1G3RA 4TL8A 2J46A 4LYHA 1EWQA 1KDRA 3LO5A 4G0NA 1JALA 3KUCA 4Q1EA 1S2MA 1LNZA 1G1MA 2BBOA 4EPRA 1KNXA 4E07A 2RCNA 1P6XA 3NVAA 1T3LA 2WJYA 2XJ4A 3QBTA 3SC3A 3CW2A 3VHLB 2C78A 1JR3E 4LHYA 1WB9A 5EXXA 2REXB 3T1TA 1VYVA 2VIIA 4Z8XA 4V0LA 2CBZA 1NLFA 1NKSA 2ZI5A 4RZ3A 2Z6VA 3OIVA 1KK0A 1OHHD 1G3IA 2QE7A 2WJIA 2ERXA 3M6AA 2A3RA 3PCRB 3U7FB 4B73A 2NPIA 1UJ2A 2ZETA 3LBNA 4XH9B 4WBSA 1CEEA 1U9IC 4B3CA 1E0KA 3EZFA 1OSNA 5IT5A 4QFMA 1IJFA 1QG4A 2GWHA 1TEXA 3WNBA 4CYMA 4IRUB 4HUQA 3BJIC 4DB4A 4KBFA 2PT5A 1E9DA 2IHYA 2ZPTX 4TN1A 5EXPA 2VTKA 1GKIA 2X19A 4OI0A 2ZS9A 5JHGB 2IS6A 2AHOA 2JLSA 1BO6A 1W5SA 4Q02A 4F92B 1D6JA 1XD2A 2AL7A 3CNNA 3KJIA 2AR7A 4LJ7A 5FTLA 3BH0A 1IOZA 3QY0A 1LS1A 2Q9CA 2V55B 4MITA 3T5GA 5AJVB 5FOSA 3AVXA 1UBCA 2ZXUA 1AIPA 2IS4A 2CL7X 2CL0X 4GNKA 4G1UC 2AKYA 3SJAA 3EW9A 1WQ1R 1C4OA 1X1RA 4Q66C 4B35A 2GVDC 5JECA 2ZAMA 4HLQB 2FE4A 2CXXA 3GMTA 3KTAB 1NVUQ 4DZZA 1Z0KA 4LJ8A 4V0NA 2GXAA 5GJVC 1S96A 4A82A 3B85A 2JAQA 2KB0A 2IW3A 1W36D 4EQ6B 1K5GA 2F43A 5JLJA 3C5HA 4QBHA 1GRQA 1HQYE 1IBRA 2OFOA 4D0NA 5JSZB 2JLQA 2HT1A 5FL7A 1T0HB 4JKYA 1DE0A 1P72A 2CDNA 5LBIA 2G77B 3NDBB 5HE9A 1AM4D 3VR3A 2GK7A 1D2EA 1COWD 1OIWA 1Y63A 3HR7A 2FFQA 3GJ5A 2BJVA 4NKRA 4QGGA 5C46F 3RC8A 1FUUA 3M4YA 1GRNA 2QP9X 2QG6A 3QVUA 2OG2A 3KDSE 2KSQA 3LW8A 3TR5A 1AGRA 5KSPA 2QU8A 1E79A 3KQHA 1G7SA 2HT6A 4CEHA 2VHQA 4D0LB 4B34A 3KFXA 4UXHA 2GEVA 1EXMA 2YKGA 4C7OB 3KJEA 4G3XA 5TV2A 1GNPA 4I1UA 4TQ9A 1SGWA 3M0EA 4A6XA 4OQMA 4M0LA 4A4DA 4B6FA 3U6BA 1NSTA 1T8TA 3PUWA 4FMDB 4TZ6A 3CWQA 4KFUA 5EE9A 1N5IA 3D31A 1G41A 4RD3A 4W5JA 5J4VA 3O8CA 5F98A 1CJVC 2A7QA 2A5FA 2B8TA 1XNJA 1HT1E 1H8EA 2GAOA 3RS4A 2FF7A 2NOAA 5TXGA 1E2HA 2ZAOA 5CIWA 4FXPA 1SKQA 1D9XA 2D7DA 3AF2A 5JS8A 3W5IA 3K70C 1GVNB 2CHGA 1Z6YA 4GSYA 3K0CC 2YWFA 3CR7A 3WY9A 1XTSA 4Z1MD 1Q1BA 2PLRA 421PA 5AUPB 3U3OA 4QHYA 1KIMA 4MYUA 2OCYC 3LX5A 3CO5A 3P4XA 2A9KA 2IWRA 2C96A 2H16A 2V3CC 3TR0A 2ZYUX 2VP6A 3LX8A 4DIDA 2C2HA 1LY1A 2JA1A 3A6PC 1N6PA 2ECKA 1JR3A 4Q21A 3K9LA 3KB2A 3A37A 5K8TA 1K5DA 4FMDF 4HLDA 3U44B 1XPRA 1U0JA 5B64A 5DI3B 3LVRE 2XZPA 2ZJ5A 2J1LA 4LYFA 4RD0A 4FWTA 5GVRA 2GJSA 1TU3A 3TAHA 4LBWA 4KU4A 2NO9A 4FWIB 4DDTA 4GOJA 2DYKA 1J90A 5DH9A 1LTQA 1IN7A 3IPYA 5A5GA 1FZQA 1XTQA 3ZIAD 1G8GA 4Q1DA 4GDFA 4WW0A 4CEJA 2O8CB 2IUUA 4OKSA 2P3SA 1J70A 5FTJA 5FBVB 1KI2A 1E9RA 2QROA 3QBVA 3THYA 3SQWA 1AQYA 1KI6A 4IFEA 2D7CA 1KMHB 4QGFA 1Q1QA 1YZTA 2ZQ5A 2WSSD 3A4MA 2BBTA 5JBQA 1SHZA 4Q4HB 5UKDA 5DSZA 5K8IA 3B5JA 4OBEA 4OL0A 1XJCA 2XTMA 1E2KA 1SKYB 4DT1A 4RZUA 2Q9BA 4QRHA 1T3HA 1IY1A 5EZ6B 2IXGA 1KJYA 1E3MA 4CT5A 1G291 1E94E 1W0KA 2PX3A 5H70A 2ZJOA 4NONA 1Q0UA 2IWHA 4B75A 1A4RA 3WMEA 3UMRA 4QHTA 3QUSA 5H1YA 1W0JA 3FB4A 1GG2A 1NJGA 4C3ZA 2A5GA 2VSOA 1CXZA 1L4UA 4Q03A 2PLFA 2YVUA 2JASA 3UATA 4TMZA 4D6PA 5CJ2A 3D8BA 3Q7QA 2GXQA 4FCTA 3FMOB 2GNOA 1J8MF 2RHMA 2MMGA 5JCZA 3W8NA 3WRXC 4LV6A 1S1CA 4RCYA 4OI4A 1P2SA 3OIWA 1E2NA 5DHFA 2OV2A 1KJWA 4B43A 3A58B 4DLRA 3RYTC 2VLIA 5LDDC 1R0XA 2V9PA 4EAQA 3ADBA 3E5HA 1S3SA 3AGPA 3RANA 4B47A 5E3HA 1AKEA 3TMKA 3GD7A 4PR0A 4A0GA 3CF0A 3U60B 1ESMA 2MSDB 4K46A 2Q0HA 3ICEA 1M1YE 5EP4A 4A1FA 1JPNA 5FI0B 2PEZA 4D4JA 1F2UA 2GDJA 1ZINA 2WM9B 1CR2A 2V6JA 3R20A 1KDOA 4PHGA 4M1MA 3NDPA 1BMFD 4XVQA 5FOVA 3MMPA 4TT3A 5HKKD 4D0GA 1XF9A 1W49A 2NPFA 3EPKA 1ZCAA 2RGGA 1FOEB 1LW7A 2X2FA 4JLJA 2OO7A 1UAAA 1UKZA 4DXAA 1HH4A 1M7GA 4FIDA 1ZVQA 1N6NA 3DM9B 2IEZA 3ND9A 5E7MA 4ZCIA 1PVOA 1G5PA 1ZM3A 3OFNA 1KJZA 4A2PA 4EUNA 1ZM2A 1M74A 1RIFA 2ZR0A 1S4QA 3QXHA 3B9QA 2TMKA 1G8PA 1TEVA 1SKYE 4B2IA 2R9VA 4KV9A 3NHBA 3O8BA 4RD6A 1NN1A 4OQLA 1XTRA 2R65A 1VKJA 4IW3B 1BIFA 4Y0AA 4RVCA 1TQ2A 3W6NA 2CLCX 4KXFB 5EP2A 1NVVR 1LFDB 3W3ZB 4OYHA 2Q3HA 3QE0A 5A4JA 4Y0VA 3C41J 3NKVA 4AD8A 4BFVA 4TMKA 1U81A 3ZZUA 1KYIA 4NL4H 2QEQA 4MKIA 3PUVA 3KTAA 1G7TA 1UFQA 2ZJZA 1KGDA 3D3QA 4QGAA 1UM8A 4PO9A 1UBFA 1X8JA 2R8RA 2GBLC 1HE8B 3I62A 1ZAKA 1XTKA 2ZRBA 3HYRA 1W2HA 1DS6A 4EQ6A 2NG1A 3VHXA 1GM5A 4YXWA 2ZRAA 5JSZA 3MCAA 3GJXC 2C98A 1MO4A 3VKGA 1MRNA 3IO3A 3CONA 3CRRA 3N5CA 4TZ0A 1YZGA 5AJWA 2ONJA 5KYKA 4E22A 4JYCA 1E4YA 2D4HA 3GLIE 2YINC 3K0EA 3CWZA 5FOTA 4Q19A 2D2EA 3HDTA 4DWJA 1J7KA 2BIFA 4K8OA 1OIVA 3WHLA 3BB3A 1N0UA 3KKPA 1MO3A 2VP2A 3EASA 2CEAA 1GZSA 3L0OA 4JLVA 4A0FA 1W4RA 1R5OA 2ZVPX 3DM5A 3W3AA 1EX7A 3K53A 3GEIA 4D4MA 3CNOA 1XCMA 3NBZC 1RE0A 221PA 2GXUA 4QNRA 1XD8A 4C7OA 1RYFA 4JIMA 4A6PA 1BOFA 3UANA 3AVYA 2VSFA 2GAAA 4Q4JB 2N46A 4PHTA 4AURA 1VMAA 4B76A 4UJ3A 3S1AB 3LD9A 2CNWA 1EK0A 4ZIRB 4KI0A 4KYUA 5D3MB 3ADCA 3ASYA 3O8RA 2WSMA 2ZJ2A 2RB4A 1YZKA 2DWPA 1YVDA 2IS1A 5G3YA 1KAGA 1YZNA 3SI7A 1XTJA 2JGNA 2F55A 1XPOA 3A8TA 4P31A 2EFCB 1TUEA 2I1QA 4KSCA 2ZRPA 4L15A 1R8SA 2GZHA 5CK5A 4YC7A 2GEDA 2AN9A 4P33A 5HZKA 2JLYA 3R9WA 1TAGA 2DR3A 4JVMA 2EWWA 4IJMA 3TVDA 1IXRC 3MWJA 3KL4A 3RABA 1PZNA 4YMVA 3CPHA 3WBJA 3NXSA 3K70D 3A1WA 4HI0E 3IQWA 4LCBA 3VFDA 4TYWA 2W83A 5C4MA 5J4HA 3NC1C 2ZM5A 4HAZA 3SJBA 4IOJA 1U8AA 3U44A 1MKYA 1TQDA 3I4LA 5DI3A 4ASUA 2V7QD 4JLPA 4Q5IA 1TQ4A 1XCPA 2FZLA 2REOA 1RVDA 1YR9A 5ANRB 4RFSB 2J59A 5E95A 4D26A 1MO6A 5KNDA 2FFAA 3UG6A 4BPBA 1HEIA 3NC0C 2G1KA 1ZYUA 2I1VB 2R6FA 3SZRA 4JYBA 1L4YA 2O8CA 1OYYA 1IONA 3SN6A 2VP0A 2A30A 4MRNA 1KDTA 5BYJA 1NBMD 4C2TA 5C2JB 1VG9B 5E7IA 2EFGA 1WRBA 1KMHA 1N5JA 1RYHA 1KSJA 4JT2A 4LHZA 3B6EA 4PAOA 1ZCBA 3TKLA 5DNYB 4QXAA 3PG5A 4U02A 4XTCS 2Q3FA 2ZRDA 2EFEB 4L16A 1GITA 2QQ0A 2W6JA 4QBIA 3VR1A 1P9WA 4B48A 4DIEA 2AKAB 4RY2A 2QAGC 4BRUA 2GF0A 2PCJA 3GLFB 1SQ5A 2PCLA 4BFXA 3EPJA 2JLVA 5L3VA 3PFIA 1XMVA 1M34E 4MQBA 1T8UA 1RRPA 2CK3A 3AVPA 3BE4A 2CCGA 3IIMA 1ETUA 3P26A 4Q1FA 521PA 2ZRNA 3RRMA 4D81A 4PPFA 2DPXA 2QM7A 2WAYA 1DBSA 5FTKA 4ZCLA 2IUSA 1OB5A 1P5ZB 4B3DA 1I4DD 2RGEA 1KNQA 2O52A 2KJQA 3THOA 1WBBA 1US8B 4BRWA 4PO1A 4PSKA 4NCJA 5IK2D 5KUTA 4AKEA 1EGAA 5FH9A
chains in the Genus database with same CATH superfamily
1FMTA 2NTEA 3CZMA 3F7TA 3PHCA 4Q9LA 3M3HA 3E1KA 3OEHA 5GY7A 2C07A 1DG3A 5KTTA 3QEBZ 4JI4B 2HXSA 4P93A 1YVUA 4LDJA 2V8OA 1A3CA 1D2RA 5AW4A 3OJLA 1S2DA 4X1YA 5FFMA 1UBGA 1VL0A 3GT4A 4LZZA 4AP5A 4CQNA 3PQ7A 3RFVA 4O3MA 4HC4A 4PG4A 3EEBA 4MEJA 5LB2A 3CLRC 2WG1A 2Y27A 3ZLTA 5J1TB 2OG1A 1GQSA 4QFBA 2IV3A 4GQAA 2OENG 2VP9A 4KQXA 3BSWA 3PNMA 3MILA 2IOQA 3ZLVA 4DIKA 4X5OA 5CA0F 1RTTA 4E5VA 1SBZA 4ETIA 1HDXA 1UEXC 4G36A 3CXRA 4RVGA 3LU1A 3TCKA 1D6SA 3KDAA 1P1RA 2R6AA 2OCLA 1SOVA 2QSYA 5TC4A 3WP1B 5I7RA 1T0PA 3PRKE 1P0QA 1T2VA 3IYLW 5DX1A 3N05A 4QO8A 3P0FA 5I8PA 5JEDA 2JA2A 1ZM4A 1BJRE 4KPUB 3KVNA 2HIAA 3X1DA 2GAFA 2Q4BA 3RM3A 4OYYA 3RADC 1B14A 1NBOA 4HQ6A 3TLAA 1WXDA 4AYTA 3MT8A 4LHEA 4WJZA 3JVUA 5DGDA 4IKOA 2A9JA 4UPEA 4UD2A 4FMCF 3QVKA 2E4ZA 5B3KA 1EFDN 5K3OA 1OXSC 4OQ4A 4AY2A 2OT3B 1I2ZA 1QTNA 1FL9A 2JJQA 4AY6A 1JDPA 2H00A 3KUDA 3I52A 4MGZR 3TAXA 2C9OA 4D97A 1GD1O 1V16A 4TYQA 4Q9IA 4FZ3A 2VPWA 1YRYE 1GUYA 4HRAA 2OCXA 2IXDA 4L4YA 5ULLA 4NMHA 4YVFA 3W2GA 3NO4A 3PPXA 4HN2A 5ER9A 5F4BA 1NG1A 5CDUA 3TI9A 4QUAA 3G7UA 1WY7A 4O4HB 4MMZB 1GA4A 1OVMA 2W6ZA 4IH4A 3FDIA 5HG0A 3D2BA 1YR2A 1AC5A 3DWFA 5ALHA 3BGVA 3L2OB 2EJUA 5K1ZA 3SKVA 2F3RA 1NIJA 5A05A 1W4LA 2Z2ZA 4D0RA 4A10A 2C7BA 5JCOA 3ESBA 1GV1A 4OJQA 2C8VA 1EAMA 1G5TA 5JPIA 4QUEA 3A1VA 3UUGA 2P78A 2RHCA 2YFHA 2WHEA 2WBLC 3IIJA 2XHEA 3NEYA 5HDQA 1ZGZA 4ZO7A 3THRA 3ZCUA 3PDJA 1XQ9A 1ZM9A 2ZVJA 2AXPA 3EXG1 4CHTA 1MJNA 2JIZD 4MVJM 4X1KB 2OXTA 4BLPA 4Y9SA 3FH0A 3WDSA 1WHSB 3W3AH 4MZDA 1BD4A 3OOEA 4TSFA 3MFQA 3DZFA 2A5LA 5G41A 1N5OX 1G9TA 4J4HA 1GFWA 1UINA 3EGCA 5F2OA 1XWIA 5G3ZA 4KQ9A 3TUZC 5J4LA 1DAMA 2PEYA 1XMJA 2DFTA 5TE9A 4IHAA 1F7UA 1HLPA 1IIBA 5JSHA 1N2EA 1EU1A 3PHBE 2A5YB 4EB0A 1MX3A 4PLHA 2DWQA 2ZIUB 4U4AA 5DBHX 1ZIXA 2MU1A 3Q3GE 3IESA 1QP8A 1AKVA 2F3QA 5SYNA 3E3LA 4TYYA 4BIMA 1IWBB 2E21A 3NCTA 4A0SA 3DG9A 3MAAC 5KQGA 2BEWA 4OAPA 4UPDA 1AB5A 1NTOA 4M46A 4DLTA 1LC0A 3OO1A 5LXTF 3BTVA 5D3MA 3TSWA 1NGSA 1RFLA 3PGVA 3U13A 4FR2A 1E1QA 4OFBA 3FHLA 3OCCA 1C3OA 2LRHA 5TF0A 5IX8A 1TF5A 1EFLA 1CF2O 1KVTA 4NZZA 4QARA 3UPTA 1UMCB 2PLAA 4YHHB 3PPIA 3QELB 3EH2A 1U0HC 4LGMA 2X8AA 1FYEA 4LDNA 4QL3A 1T24A 4DRZA 3RIHA 4C87A 3SSAA 2R2GA 1EJ0A 1U1FA 1ZBQA 3PWSA 4GXRA 4MAMA 3RJ9A 3E2MA 1FMLA 2YWXA 4B7AA 1Z4JA 4I5IA 4R0MA 2HBYA 2QRUA 4J4TA 2JFUA 2ZBPA 2DHQA 4HFNA 1O57A 1X1AA 1FFGA 1O6CA 1TF7A 3G1TA 4MUBA 1HQDA 3A6FA 3PEWA 3AVVA 3PENA 1NAIA 1F0KA 2D8MA 4FD3A 2FSIA 3RIXA 2BMJA 2IFTA 2OYCA 1EFRD 1N25A 3OMXA 5JNRA 1TZMA 4L1KA 1TNDA 3RIMA 2GO7A 2AV6A 2QTCA 2QVXX 2HJHA 2NQ2C 1SFRA 1NBEA 2F9LA 2NO5A 5HDBB 2GBFA 2IEYA 2DFNA 2QRVB 2VT3A 3TDNA 2QW0X 1H8HA 1T3TA 4FYMA 3UHJA 4HADA 2HMVA 1SU6A 1ULHA 2CDCA 2YMMA 4C76A 5AW6A 2OQVA 4GLLA 4HUTA 4GR4A 3PEEA 2A1TR 5K8UA 3IVGA 4ID3A 4DNQA 1F1BA 3A9CA 4H1HA 5DSTA 1SU7A 3ROMA 1VIYA 4FBLA 4X20B 4OAOA 1KL7A 1I0LA 4F6CA 2WLSA 1PJAA 3EISA 4BFYA 1E1RD 2ONCA 1AJEA 1G0NA 3KB6A 3FVWA 2AG1A 1AT1A 1SD2A 2CFOA 4V0QA 4A91A 3TFOA 3CRVA 1L1FA 1HF3A 3M9XA 1UJ5A 2G25A 3ORFA 4ZC8A 3OURA 4UW9A 5AKEA 3ICQB 3A1NA 4TVSA 4TUYB 1NI3A 1PT9A 4NYJQ 3TOVA 1SVIA 1UDXA 2P5UA 2IEAA 4JJEA 4JJGA 1RPAA 1G98A 2Y71A 5FR1A 3UAWA 3UHFA 4EVQA 4DOMA 3GGOA 4LF7B 4DA4A 1D5WA 3WFZA 1Z0IA 1QBGA 2NYVA 2J5XA 5FWXA 5AXAA 5KEIA 3IAS6 4AJ2A 2HL6A 3CH5A 3V4RA 1IBMB 4BECA 2BGMA 2DCUA 2JJ2A 2YIJA 3Q10A 3QKUA 4P7KA 2XQKA 4DG5A 3ETDA 5CDHA 1DBWA 2OFXA 3U5TA 3G0GA 4WXYB 4TWBA 2YW2A 6PFKA 3ZBUA 1DEXA 3D54D 3HJHA 2C5BA 3GLFA 1UXIA 1ZVJA 4HDSB 4U7HA 1MIOB 2BISA 5I48A 3HYCA 3K0AB 2V6BA 4YRJA 4FDVA 5ERYA 5BQOA 4TTJA 1T1SA 5EJEA 2OD2A 4KX3A 4Z9FA 3TTSA 3BDAA 4FR0A 4JLAA 2ISCA 5BN5A 3BJEA 1CERA 3MD9A 5KINB 1E5QA 2O7RA 4BQIA 3REGA 4RQTA 1NOIA 2IIPA 4D8UA 2XVYA 4AKHA 3GRYA 3MRVA 3BG5A 3PE3A 2PGNA 3WYEA 1GAXA 2W8BB 1BHSA 3H11B 3VZQA 3L49A 2VOEA 1UJMA 3O8QB 4KXXA 5EUQB 4AICA 4B3TB 3P96A 1ZR4A 1GCIA 3G8BA 1T2FA 2C29D 4M1SA 1SQGA 1JLHA 3BD8A 5IHXA 4Z1MA 1EWTA 3KKZA 1VL5A 5EAIA 4S04A 4OLJA 1LD3A 3HUEA 2WJVA 1YNSA 5F9HA 4LZAA 4RJLA 1XDGA 2A0UA 4WZ6A 2TECE 4O29A 4BZPA 3VSEA 1WTAA 2QJOA 4YH1A 2C9CA 1KH1A 3PQ6A 4ZZ2A 2A5JA 1NF2A 4LISA 3DFIA 3BMOB 3FZYA 3CBQA 4CPDA 3ADBA 1BOOA 1EQ2A 4PW0A 1QH0A 5JFGA 1WDLA 1SAYA 5FTNA 3ZE1B 3U6KA 1U2SA 4WZBE 1JI0A 1QF6A 1ISMA 1D4ZA 3WLFA 3CLRD 3ZWVA 1R10A 1ZITA 3AEZA 2NPOA 1OASA 1V1MA 2D5AA 4GECA 1SG9A 3EZ7A 1GQYA 1T1JA 4OK6A 1E9AA 3K1ZA 3ZVRA 3HU3A 3UOGA 4MPTA 3AJRA 3MINB 3VRHA 3GJ0A 1XFAA 2HSJA 3MB5A 1RAHA 2B2CA 3AQ4A 2JFFA 3SWWA 2AMVA 2IGBA 2JRLA 2PSDA 2Q2WA 3OT1A 4MARA 4D6YA 1JZTA 1HDYA 2RK6A 4FW9A 4FOSA 3KVRA 5AUOB 3HY3A 4CCYB 1DRJA 5LPNA 4W6ZA 2R84A 3GA0A 1ECGA 3NTRA 1ZL0A 4ZAZA 5JZMA 5L7WA 1YL5A 3P2KA 1MFZA 3BTOA 2WSSA 3H2JA 2CLIB 1C7FA 4QJ5A 2FR0A 2J87A 1U3GA 1NVFA 1RYYA 3E27A 3H05A 5ERGB 5B5SA 5FYDA 3WP0A 1CQJB 4L5BA 5AVXA 2OZVA 4AS2A 4M3NA 3DHNA 2GN0A 3N0XA 2DERA 5JIBA 2X8BA 3DOFA 3HUDA 3PHJA 1Y6JA 3EIHA 1CTQA 3OM1A 4OATA 1H5UA 1L8AA 2XQIA 4QOJA 3WK9A 4RTQA 2D5CA 2IK8A 2X8WA 4V0SA 5AK0A 1Z7GA 2VNKA 3I8SA 3WE7A 1QK4A 3IDSA 2QT1A 4MAFA 1WWKA 4Q00A 3A9WA 4AZ3B 1GYRA 2FPLA 1YDFA 5KWJA 1U65A 2EIXA 2MINB 2WU8A 3EZXA 4YMUA 3FOEC 2X5NA 4Q4LA 3DMRA 1AUQA 5H16A 4PONA 4DBVO 4M88A 3NG1A 2RH4A 2V3WA 4CMIA 2H1RA 2O3JA 3IOBA 1DVRA 2JDIA 1BRMA 1CULC 5K0EA 4HOYA 1F4VA 1K63A 3HDHA 2RGXA 3RF7A 4QNMA 1IWOA 1I7LA 2JGIA 1PT5A 3UFXB 3ZEAA 2BEJA 2O7VA 3STYA 3SPXA 3WWPA 2WWVD 4CTNA 2VPPA 3CISA 1QO0D 1P4HA 4OLHA 3VTFA 3E6AA 4MWSA 2QENA 3E18A 5AO9A 1QFXA 2WTXA 3CWCA 2OUIA 4ROTA 1HYBA 1I5EA 2P4QA 2XI4A 3MOIA 3D8NA 2Z04A 1IUOA 1PP4A 1H6DA 5CM2Z 1CQIA 1JG2A 3Q87B 2OKCA 1WL8A 5EUBA 5G0VA 1F8UA 3IDFA 4XZ3A 5G4KB 2JGFA 3BS4A 4ITUA 3RYIA 3VNRA 3LKBA 5BPFA 1NJ6A 2W2OA 2Q3LA 4IJWA 4MUNA 4OMCA 2CVHA 4EJSA 4R68A 4QDZA 1NUHA 1RWWA 2IOFK 3G8DA 3LUAA 4L51A 4PLPA 3T61A 2V74B 1DV2A 1RXWA 3V00A 1NBAA 1V7CA 3QGMA 1RLOA 3I12A 5IAAA 3LY8A 1Z4PX 5G02A 2DY0A 3HRIA 5AJTA 5A1TA 1NXQA 1XZKA 1MZVA 2R8BA 3P2JA 2ZAIA 3PQ2A 3KAJA 5FO0A 4X63A 1MD9A 5CH3A 1UBEA 3G0IA 1MW9X 1OA0A 4RFLA 5HCNA 4MNTA 2ISQA 2GETA 2X22A 4KHZA 1X8XA 1OU0A 1RBYA 2QAJA 3CZCA 1W30A 4O8CA 5BQ3A 4LOJA 3E0XA 1YJCA 3ILHA 3K9HA 2VZ9A 3EBLA 3LM8A 3Q88A 4K3UA 4K8RB 4WNAB 3ZQUA 3E0QA 4CUZA 4AB1A 3N6VA 4MQFB 1L4LA 5ED4A 3UXMA 1MV5A 3HHPA 2NZ2A 1KMCA 2GM9A 4N3NA 2AYZA 1IHOA 1CT9A 3AH8A 3KJGA 4KQFA 4D1YA 5LIPA 4JODA 1IEXA 2GBIA 4TMVA 1MLDA 3CIOA 2CXTA 4I4LA 4ARCA 2NZUG 2P5YA 5F3RA 4BGDA 1GEGA 2Z9DA 1A5ZA 2FQXA 3FFXA 4NYIR 3ZOZA 5MGNA 1M54A 4L4SA 1WZ2A 2VZEA 4I4TB 1SBYA 3E7WA 4UU1A 4M83A 1YR7A 3OZVA 1II8B 4ZT3A 1NW3A 1BN7A 1NV8A 2WZCA 3RFUA 4OHBA 4EMUA 1XMIA 3QK7A 5KNLA 5C51B 1Q92A 5A02A 1EVEA 3RASA 4RL4A 5BQFA 4FGWA 1ZISA 2HGZA 3ZJYA 1OZFA 3KT3A 4CVNA 5JUWA 1QU2A 2DG2A 4IKEA 1QUEA 3ENQA 1R74A 1W0KD 4IDCA 4V0ME 1H4VB 2F17A 5CRIA 4D3YA 2A9OA 4Z0TA 1JF8A 5DBOA 3WKBA 4ZK6A 5ICSA 1N6IA 1AXGA 1WCWA 5HPYB 1SXQA 4DLSA 4B80A 13PKA 1JA9A 3ZE9A 5CA1A 3IHLA 2EJBA 3V7UA 2PXCA 3OQ1A 1V5GA 3I9NA 5CLHA 1BJKA 1MC1A 2ADFA 2DPGA 2PMFA 1LRLA 1J25A 3FHCB 4KWTA 3RR2A 4MPJA 1P9OA 2QNIA 4XWKA 2ESRA 4FM9A 3EPRA 3K6RA 2ARKA 2VSXA 3BF7A 4Z1OA 1W4AA 4K81B 1FDSA 1A69A 2IHBA 2HEIA 3S2FA 3OEED 5AVTA 1P9NA 1PFYA 2ECFA 2FQ1A 3RWMB 2QPOA 4UJ5A 5DN9A 1JXQA 2QDKA 1DUSA 2VAMA 3QKTA 3A26A 3C85A 2F6RA 2JAHA 5THKA 5KJEA 1GCGA 1KH2A 1ZOSA 5DXJA 5HKLA 4DCGA 3CEJA 4TPKA 3QPWA 1W94A 2AWOA 2VWHA 3FTCA 4MO9A 4TMWA 4UTRA 1R4NA 1LPAB 1CIPA 2QTZA 5NLLA 2Q3CA 1CDOA 1PEDA 2QG9A 4B4UA 2VG8A 4ZYTA 2PS3A 1ZHHA 4URFA 1FA9A 4CLOB 1R88A 2PYZA 1P62B 1N6LA 1OH6A 5CDSA 1MABA 4P8RA 1K7XB 4Z3DA 3ABRB 3QXXA 3OPYA 4BVEA 4YUYA 3TUJC 3K15A 3FXAA 4MUJA 4P4NA 3UNXA 3ZWCA 4BWGA 5IUJC 3TQHA 1Y6ZA 1MRZA 1RTKA 2W2TA 3OIYA 4KGXA 4TXHA 2RGYA 2QL7A 3RHSA 1QM5A 3X1YA 5ITWA 1K97A 1UQUA 1WD7A 1WMAA 1YU9A 1UEJA 1ZI6A 3IPCA 4HPJB 1B6RA 2M98A 4NE9A 4RPHA 1EP9A 1CDDA 1UT5A 5SYMA 1JHQA 3IDAA 5JWOA 1WUJS 4YCBA 3RYCB 1DI0A 4P86A 3ZV6A 1M0TA 1BROA 2HMUA 1F3LA 4RWEA 4WTOA 2Z43A 3HCNA 3KG2A 1LK5A 2I3DA 2I8AA 3P2OA 1QGED 3TR6A 4TXNA 5KDOA 1YE3A 1A7KA 2YC4C 4DRYA 3QNMA 2P35A 3IBYA 4E5DA 3BWCA 4IYJA 4UUBA 4D44A 2CBXA 3QX8A 2FJUA 3DKRA 2IYLD 2MYTA 4WLOA 4CF4A 1YJAA 1BCRB 1G4AE 2CVQA 3H83A 4WOPA 4CT4B 2HDHA 4I6EA 5KWSA 1KEWA 5JH7F 1RYMA 4RMJA 3DE3X 1HNNA 1K7FB 4I55A 1XJWA 3B2EA 4OGWA 5CD1A 1Q16A 2CWDA 2X9LA 2J45A 4TV9F 2FJPA 5DOVA 3W2FA 2N75A 5C7LO 1K8XB 1FYFA 1E61A 5IN5A 2C7RA 3R7FA 3IKJA 3DXYA 3KX2A 4FDMA 1ODIA 3GCZA 1SVWA 3Q8MA 3TMAA 4ITVA 4LQDA 1ZNWA 5B1IA 1AV7A 2NN3C 2PANA 1JQJC 4RKFA 4RSHA 1NKTA 4XSHA 3V2HA 4L8GA 5A6SB 3WK4A 3R75A 3FZQA 3C5CA 2HJVA 1C4KA 1P7VA 2JCGA 4KRYA 1VSTA 2WUWE 4ARBA 2PX8A 4DLYA 4LRUA 2V6GA 4FLEA 3EQ7A 5FPKA 2V0NA 2B98A 2R6HA 4NY1A 4XJXA 4PGGA 2XYGA 3RNLA 4DG8A 3IUSA 3SE7A 1LKZA 3IP3A 1U94A 2DCMA 1D9ZA 3W3AD 2E82A 4M1OA 3ZNPA 3I9V6 4URYR 2YC2C 3ANSA 2QZPA 4FFVA 5SICE 1W36B 1O0SA 2CNBA 1KI4A 2QLNA 3UUEA 4P5EA 5HSGA 3RBAA 2AF3C 3ENNA 4QREA 5AR1A 3SHFA 1WW3A 4BGVA 3KZCA 4P7FA 2COEA 2C88A 1XLWA 5K09A 3C3YA 3CN7A 4DMHA 2ZKLA 3MMNA 3MJSA 4TROA 1OC2A 2CNWD 2EXXA 3J7AC 3DBVO 4QBGB 3Q3CA 5HZGA 4DV0B 3LHKA 1IBKB 1CJMA 2QR3A 5C7IO 2OAGA 3QPBA 3PQDA 3BPSA 4URHA 5TGZA 4TMTA 1GZVA 1RE1A 3ZWAA 3QV1A 5JAIA 1DIHA 5CNMA 5ITZB 1LB1B 5C1PA 3H86A 2H29A 3BRCA 1X14A 3QE4A 1SVKA 3JPYA 3MAGA 4P98A 3ZD9A 1OD6A 1QWSA 1OA1A 3SY8A 3L7YA 5B4TA 1TC1A 2FZEA 2IF0A 5JE8A 1JB1A 2BY4A 4UNRA 4J4BA 2QN3A 3ZGNA 1JIUA 1EUDA 4BNGA 4PCVA 1P91A 3QZUA 2GJAA 2JAWA 16PKA 3KT0A 5JO9A 1A2KC 1ZLYA 1EFUA 5AKLA 3U7RA 4FNOA 4EOGA 3QWFA 2Z3WA 2QD5A 3UMJA 3NM5A 3LUBA 4D5GA 2QLMA 4TKUB 2PVSA 1BXKA 2Q5JA 2ZWVA 1UXOA 4F5WA 3PA8A 2G08A 3RF6A 3S70A 4RXUA 4BATA 3M82A 3I73A 1WCV1 2E5WA 3EDQA 4ZAFA 3H0EA 1VQ1A 3LWNA 5HA5A 3OZIA 4YRZA 3D6TB 2AG8A 2GN6A 1MT3A 2F9MA 3BSYA 3II6X 2I62A 3PR3A 4IDDA 1GPJA 4G2TA 2CHEA 4C03A 1H9BA 3NTLA 4MIYA 3QLEA 1KFKB 1GSOA 4HTFA 1KYWA 4IMPA 2QJTA 4Y9UA 1BXGB 4HRXA 3G88A 4D8TA 3BMNA 1R9NA 4E30A 2O23A 4ZVRA 1MJHA 4FMCB 1R18A 1Y34E 4M54A 1DT3A 3C8HA 3FSRA 1OBVA 2XODA 2GF2A 2WM8A 4N54A 2ZB7A 3BOSA 3K1AA 1N2ZA 3ONWA 4MMYB 1P9RA 1DDOA 1R0WA 2NT4A 1GDHA 3QP9A 4YJHA 5EP1A 5IS2A 2QJFA 1JNYA 4WLUA 2D59A 4Q4DA 1NVWQ 2GJ4A 4IUYA 3A2MA 1OXTA 1P6QA 4A23A 4B83A 5AKIA 3OLQA 1E7SA 3WWEA 4EHNA 1P77A 1YQXA 3OPQA 3C8ZA 3EMVA 4YACA 1KS2A 2O3RA 1NDHA 1AB6A 1V7PC 2J08A 3D59A 5U4QA 5GADl 1VLZA 1ZGJA 5I5GA 1R9GA 4I0WB 2CSXA 1BCSB 3HCCA 1NJ2A 2C5LA 2IP2A 4HMQA 1C8VB 1XQVA 4H1TA 4R8KA 1EGMB 4WA7A 1RHQA 1JI3A 4NBLA 4MUMA 3IQZA 2PMWB 3UK0A 4ALLA 1AG9A 2YZMA 4ZI7A 4CGZA 4XDHA 3IERA 4RABA 2ZIXA 4DDHA 3TB4A 1ULSA 2XAUA 3AHGA 4UCXA 5JNWA 4RVOA 4WDRA 2EKPA 2BEUB 5DOZA 3W5DA 2HPZA 3S1SA 1N3YA 1N0VC 5H7XA 2ZI4A 3PQ4A 4ZZ0A 4Y1GA 2FPPA 1Q22A 3I9LA 3CS3A 4LMPA 3V1UA 4MRVA 4B1FA 2P6RA 1A9TA 1F6BA 3KTDA 4ER5A 2JKYA 4DA7A 1WUTA 4BNLA 1I2DA 3QU4A 4FD2A 3N3AC 5BN3B 2LBPA 5F21A 3LT0A 3VYVA 4PC7A 5JCJA 1I4LD 1UFKA 1J8YF 1JG4A 1VMIA 3OETA 1NZFA 3SEFA 1ZW6A 3KKNA 4ZVOA 2B99A 1LLDA 1M2FA 2I2AA 2W2NA 4XVUA 1A82A 3LLCA 1KBOA 2OEPA 3PQ8A 4IINA 4M89A 2C0PA 2QP3A 2FHSA 1VDMA 2X7HA 5E6UB 4BBPA 4KXYA 4R8LA 3T0FA 1EFKA 2EFYA 2FMXA 4JLOA 1XQ6A 1O7JA 4PU0A 2IC5A 3N2GB 1Y0BA 1AA9A 5JZBA 1EBFA 1YZHA 4U6NA 4I5FA 4DV6B 2FX2A 2XMPA 2HXYA 1NJSA 1SBNE 4G0OA 3IEMA 1JFSA 1YXMA 2O2ZA 1M6VA 5A9TA 3HN6A 3HU2A 3HYNA 1KZGB 3PR1A 4YV0A 1CS4C 2C2OA 2DUMA 4YX9A 5IJ9A 1PNVA 3CF2A 1WV0A 1QV6A 1QK5A 1DKOA 1M8FA 2GBGA 3NI2A 4F3YA 4F5ZA 1A76A 2IZ7A 5JFTA 1CFJA 2DGDA 2V45A 1AK2A 4JBWA 3LP6A 4KWCA 2NU9B 4QPJC 1OH7A 2WUVA 2XD4A 1JHOA 2IS2A 1N4DA 2JCVA 3LC7O 3TZKA 1VSBA 1JFFB 3MVEA 4UTPA 5ICMA 2AEFA 2NO4A 2PZLA 3R44A 5EJ2A 2IBMA 1Z74A 2B3DA 2R8YA 1C41A 5GPBA 3W9SA 4A15A 2H65A 2UUCB 1M10A 2YUIA 3ZGXA 3B52X 4QQKA 2C61A 3TW8B 2ASEA 1YIOA 2ZR9A 2EG9A 2FEMA 3PU6A 5DGTA 4Q82A 1J49A 3SC2B 5ISMA 1V8ZA 4US1R 2V7XA 3E3OA 3THXA 3I2JA 4EO7A 4EG3A 3TRIA 4REOA 2O8EA 3PZBA 1TVMA 5AOCA 3TKAA 2WUEA 2PKWA 4HZIA 1I6LA 4DIBA 1D07A 1U7DA 4FYWA 3EYWA 3ETJA 1YBVA 3AV0B 4EVIA 2V4ZA 5BMVF 5A9SB 1F7VA 3H6KA 5C37A 3UV6A 2HUNA 4LX8A 4BV3A 1ZN2A 2QYHA 2CFTA 4XFKA 1IH8A 2M6RA 2Q1UA 2WZBA 3CX6A 3GCWA 4PVCA 3UTDA 4QD3A 5FUBA 3TOCA 4C4PA 2VZLA 1E59A 3T06B 4C4YA 1WZNA 2Z2JA 1HM5A 2JLWA 1UADA 3PNLA 3AFMA 2JFVA 4HQFA 4Z9XA 1CY8A 4G4GA 4LXXA 4Q24A 2ZRLA 2ZVQX 3DCYA 3TE6A 3TTXA 1DRVA 3VAZA 3KOZA 4N8DA 3A06A 4GIBA 3AL3A 3HMKA 1WA5A 3I8OA 3W8DA 2W2XA 2UYYA 1FLAA 3DWEX 4UM7A 2Y66A 3VTZA 4F9GA 1YIDA 5FNVB 2QSZA 4ZVSA 1E9BA 2FMFA 3EAFA 2BGNA 1VYTA 2WPDA 2DM6A 3P0IA 3QFSA 4AZVA 4IQGA 1COZA 1ES9A 2R7NA 3MNFA 1QB7A 4TSFD 2R8XA 1UOOA 3H9QA 5AJYA 3QG1A 3RVBA 4UD6A 2HV8A 5A1JA 1GRCA 2VHUA 1EYZA 4JASB 2FSVA 2XQGA 3A25A 1HFKA 4QECA 4DY4A 3ONDA 4AKGA 4XM1A 5TJ9A 2V8BA 2OP0A 3EXHA 4OREX 3IT2A 4YWJA 2FMIA 3QW4B 4H08A 4EJSC 3AB7A 1IU9A 1IG3A 4J6EA 5JANA 2A9VA 2QAGA 4KQ1A 3AVUA 1POXA 3F6YA 1Y33E 3HXLA 4JHXA 1O54A 4TZKA 4X3OA 3JQBA 4MV1A 5FPYA 4DVGA 3PE6A 4U7TB 1D0IA 4LY3A 4AQDA 3L8YA 3GFPA 4RLFA 4ZKEA 1VIAA 5B7PA 4XWTA 3IVAA 3ETEA 4E2FA 2QTFA 3G5MA 1P7WA 1E1QD 1V43A 3UT5A 8ABPA 1LSSA 4YO7A 4RBNA 4WJKB 1OH8A 4OCZA 1L7VC 3PGMA 1WXIA 3B1YA 4CN9A 1Q5PA 4ZICA 2C4TA 2YCLA 4RK1A 3ZNQA 1ZOPA 4HFJA 5T67A 2XDQB 1SUPA 1KARA 2PS9A 4AYWA 1EVIA 2BM8A 2EQAA 2VYCA 2ZYRA 3CPJB 4PQEA 3WFJA 5A06A 1EM6A 2LPMA 3IVMA 3SVZA 5GGYA 1FP1D 3LGSA 4KE7A 4F2PA 2QBYA 3LUKA 3N70A 4Y6QA 2B1JA 3VDXA 4HGOA 1O9HA 2I66A 1NVBA 2PZMA 2H17A 1RQGA 1ST2A 5THQA 4XIIA 4MUGA 2ORWA 3LL4A 4RPKA 4UQPA 1HX7A 1OYVA 3HGQA 1PQ4A 4QA9A 4WEQA 5DTRA 3JVVA 2AC4A 3HXOA 1YGYA 4MDYA 3WK7A 4NS1A 4Q3DA 2JGEA 3RQIA 1T2NA 3JATA 1CYEA 3EBPA 2Y0BA 4GOKA 5K3FA 3N75A 4KLAA 1JBKA 3QKRA 3SZOA 2XCIA 1H8HD 3HCOA 3TZCA 3UWMA 1F60A 5IG2A 1KEUA 2BBSA 2HXGA 2JVIA 3HO8A 6AT1A 3QLJA 5TT0A 1XB2A 2HA2A 4PZPA 2GOYA 5EPEA 721PA 4YCDA 4YRRA 3EUEA 3GQVA 4H7KA 2FWAA 4YRQA 2B0CA 3REFA 4DJ5X 5A0TA 4RD1A 2YMPA 3DDOA 4HS4A 1QHHB 3CH6A 5DWQA 1HURA 3CYFA 4L9WA 4G1CA 2OCDA 3KBOA 5DLQC 3RVOA 4I36A 4LXUA 2AE2A 4ZT7A 3QM1A 3GLGA 4WVFA 1ISFA 5CVTA 4TSKA 3JPWA 2W4IA 3NEPX 3NPMA 4X7PA 2SHKA 1HI9A 1E64A 4UHHA 1SKUA 3PEFA 3BJZA 4W8HA 4OH1A 2HRZA 2OC9A 5CXSA 1DBPA 2M32A 5LNK6 1MDFA 3N3BC 1OE0A 4PZAA 1Z07A 2XA1A 3EFHA 2YOHA 2WWYA 3R0QA 3L1JA 4ENWA 2JJ2D 1LZKA 4DDUA 5ALWA 4CUJA 1E4VA 5KYXA 3KB8A 1QNLA 5ALOA 4BO1A 1NW7A 1O03A 1Y80A 4WFKA 4MLCA 2EL9A 5FP0A 4JJAA 4MUHA 4C3VA 5IXSA 3ADOA 1YB2A 4DV4B 3V80A 2Q28A 3THSA 2QL5A 5L6LB 1ZOIA 4ZDIA 2WD7A 1A77A 1T2EA 4IIVA 1RKVA 4ZC1A 3GT7A 1KOFA 2IUFA 3ILXA 1SH7A 2P9QA 3EY9A 4MTLA 3JAKA 4XE5A 3SEQA 3FIJA 5AUNB 4MA4A 4R05A 4BX3A 2MSCB 5E1OA 3KLMX 4D79A 4RJTA 1SPBS 1XMXA 1B0AA 3L0PA 4MIEA 1DCKA 1J7JA 4UDXX 1EDBA 3VNUA 3AR7A 1KP9A 3D8UA 3URKA 4OXKA 3ZZTA 3HPRA 3UTCA 1OBOA 5HRAA 2IYPA 4MWBA 1BYUA 2GEJA 3QNWA 3JWGA 2BGWA 2O8DA 1GZ7A 4KAXA 4L0DA 3L77A 1RLMA 2QZJA 5BV0A 4HZGA 1KDPA 4ZI2A 2HCJB 1C7QA 2WT4A 4GZ5A 2E9SA 2VQDA 2RBKA 3KLPX 3BA1A 3WL3A 1E79D 4JY7A 5HEKA 1QANA 4O2AA 4Q9JA 3IE1A 3BK1A 2FCRA 3JZIA 2F7SA 4L50A 2HYDA 1W29A 3LBAA 4TWZA 4ANFA 1F8GA 3GJ8A 3KRTA 4H1UA 4RVNA 1JG6A 5C8ZA 2Z6UA 2R7MA 1NI4B 1PW5A 3MJEA 1Y9JA 5E9QA 4BBJA 1FX0B 2WAOA 4HL6A 4W7HA 5TB5A 5TDHA 3W90A 1IVSA 2A9FA 3KL2A 1UPXA 4YRLA 4CM9A 4CN8A 1U7WA 5DT9A 2BLNA 4XGKA 3AW9A 1ADCA 1Q11A 5E9AA 2PWBA 3STUA 3OQHA 3AM3A 1XTIA 4KTVE 2QGFA 4REMA 1AKTA 2X9GA 4QHSA 1I7DA 5AXBA 5FHQA 1RM3A 3M6IA 1J07A 1YFZA 2NU6B 3SF8A 1U4SA 5JASA 1XN1A 3K5HA 5JDCC 3VDQA 1Y37A 3D4LA 2PD3A 4UBOA 1ZGGA 5H8WA 3FCEA 4S1PA 2IV2X 2VA8A 2W48A 3Q9SA 2AOTB 5KTYA 5T4FA 1NSYA 4FFSA 1NYQA 2GCOA 2PX5A 2ZR7A 4KW7A 4DR7B 1B7GO 1VLLA 2B30A 3CUKA 3TXAA 2AUMA 3GG2A 5EINA 4BNVA 4G5HA 3AI2A 1DT5A 2NGRA 5LZ4A 2C4NA 1Z2AA 5H9VA 2JCYA 2H3EA 1T6BY 3RTAA 1ZESA 2PJZA 3NTXA 5WRFA 2UUAB 4Q1AA 2SKEA 3UMSA 2VBCA 2IIBA 2P5TB 2RGDA 2RBGA 1N2CE 1JGTA 1KFEB 4IWNA 4UZEA 1P3Y1 8ADHA 1I7QB 2X6QA 2Q6KA 5CVDA 2CXOA 5EQTA 4DZTA 4L76A 4RVSA 5CJJA 2FZ5A 3OT4A 2F90A 2BFFB 4TX1A 3SAJA 1R7RA 2C58A 3ZCSA 3DP7A 1GP2A 4LF5B 1IWPB 1I80A 4ZVKA 5BR1A 4O33A 4DUZB 4Z53A 1T6ZA 3H2ZA 2ZUDA 3GVXA 3ZS8A 4C0KA 4X66B 4FJ2A 5IVKA 3EFBA 4JBYA 1Z68A 1R0KA 2IOFA 2JDID 3B5EA 5TY0A 4F12A 3EQ9A 4WACA 3TDKA 4A2CA 4HATA 4ENTA 1N78A 5KSYA 3ZY2A 1UH5A 1CZHA 2V7EA 1RJ9A 2CLSA 3DLPX 4F3CA 2XLBA 4QDKA 3MRSA 4ALIA 1DIOB 2C5HA 3VJKA 5JD4A 4JXKA 3GEHA 3GLIB 3RKUA 2QY6A 4QPCA 1PK8A 4UMVA 3AWDA 2GKSA 2ZK7A 5FBLB 2ZROA 4XPIB 1PZEA 3DTNA 3I09A 3QSGA 3ZI4A 1AHPA 1G59A 4U1RA 4JI0B 2RIRA 2FG5A 1MU0A 2BR4A 2HU5A 2JANA 3G17A 3GNSA 3D8RA 3LC2O 3OHPA 3X2FA 1WOMA 3DKVA 4HDAA 4JLBA 1GAJA 4BDSA 1AKWA 1M67A 4E09A 1G8SA 3H2SA 3ZHQA 5DIFA 2GTPA 1QIFA 2MSEB 3C3CA 4HFRA 4X8OA 3AR9A 1IZ7A 3QHAA 1LDNA 1LRJA 2XX3A 1DADA 1RXYA 3H1GA 2FX3A 1G7CA 2O5RA 3NJ8A 2XDWA 4LVNA 2B5OA 2WTMA 3MWEA 1YE5A 5HKAA 2C3UA 1SOMA 4NE7A 3UUFA 1QG0A 5LYJF 1XQYA 1MP0A 1TOAA 4CLDA 3COWA 1E5LA 1W88A 4HN4B 4PSVA 1X7WA 1K0FA 1TZKA 2YY6A 3KV1A 3O7WA 1OLSB 3B70A 1H6AA 4KXVA 1WZCA 5KHAA 5IU6A 4KXMA 4U0JA 3UT6A 4EYGA 3FETA 2ZSDA 4YRNA 1U5BB 1UBJS 4FVTA 2G1UA 3PX3A 4EUHA 4HB4A 4XR9A 4EW3A 4LGVA 4MP8A 2F1RA 1X7XB 3ADPA 2IU4A 3LRTA 4B7XA 5FF9A 4R9UC 4W7SA 3DBLB 4GDMA 1UBRS 4Y2XA 4RCVA 1UCFA 1QTIA 4N03A 3R9XB 3AL0C 1P61B 5JH7B 2ZUEA 3AF1A 2HPHA 2P9ZA 4Y2SA 4TWRA 3X1JA 3L8HA 1ZA2A 1I5RA 1FBNA 3JR7A 1GOTA 5C4IA 3BEDA 1PGPA 3AETA 1XHEA 4XWWA 1H6BA 1NN5A 3LOPA 4MJLA 1EDZA 4MRPA 1LSOA 1NLZA 1JFLA 4GF5A 5SYAA 4B6QA 2CZQA 4K40A 4KOAA 1K8ZB 1WKBA 1FRQA 1OJLA 4ZQFA 1W2GA 2HIHA 4OHVA 5AI4A 5TMDA 3O73A 3HTXA 3T4UA 1YCFA 2NAPA 4P80A 1EA5A 4CDGA 3OSUA 1EZZA 1FX1A 1B93A 1PWXA 1QH1B 2IXFA 2QRZA 2G6TA 3HE3A 3BD9A 4FS8A 5ALMA 3CRMA 4MSUA 2G70A 3U9SA 2FKNA 4FFBB 1OV4A 1WNFA 2PMKA 1CR1A 1T0JB 1FEZA 3FYHA 4WFQA 2G9NA 4CKYA 1QGUA 4L9RA 2CCJA 3FNRA 3M1IA 4IDHA 3KEFA 5CG2A 3ZHOA 5AW3A 3H9GA 3T5AA 4NU5A 1YJBA 1MTZA 2V7QA 3C15C 2IOHA 5A4FS 3PDIA 1LQ2A 4OJNA 3MM4A 4W5RA 2RH5A 4ND7A 2Y0EA 1SZDA 3FWHA 3K1TA 2P7HA 3KJZA 1RI4A 3MTDA 5AW7A 3DDUA 2QX7A 4HEJA 1XZAA 4GOXA 1EUCB 2Q4OA 2SBTA 5F1OA