4QE3A

Crystal structure of antigen 85c-h260q mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
277
structure length
267
Chain Sequence
LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTQSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 105
structure length 267
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qe3A00
3BJMA 4W63A 3VDXA 3O4IA 2GBIA 5A71A 4KJXA 4KE9A 1R88A 5CT5A 4D9JA 5DYWA 4BVKA 3FSGD 3QMVA 5JD6A 2QRUA 3WL8A 3FCXA 4UFNA 4QWMA 2OAGA 2ONCA 3WQHA 5AKKA 1K4YA 1JT2A 5ALDA 1ZOIA 3B12A 4DSAA 1VZ2A 4MWSA 4DYHA 2X76A 3ZV7A 3WKEA 5E4YA 5FP0A 2OLEA 2OGZA 3NOXA 1LZKA 4UFOA 4PNZA 4Y2PA 3STXA 4LYDA 1UK6A 1DINA 4OB8A 4OYYA 4B0PA 4UBOA 3D4LA 4ZWNA 2WJ6A 3IUNA 1QIKA 4MYDA 1YAHA 1OILA 4X94A 4G9EA 1QIFA 3OOSA 1AC5A 4ZXFA 1A7UA 4NVRA 4OPMA 3V1MA 5HF6A 5CBKA 3OURA 3ANSA 1FFBA 1QIEA 1ZICA 1WPXA 3IULA 5H3HA 1SFRA 5K3AA 4BBZA 3SX4A 4AMYA 4P92A 4FBLA 1VE7A 1PFQA 4BCBA 3WKBA 2X8BA 5K5EA 2DSNA 3GFFA 4H7JA 5LKAA 3QPDA 4U2DA 1N5RA 4EHBA 3WYDA 1THGA 1LBTA 3HYSA 4NMWA 3WLAA 1ZIXA 3WIBA 5JZBA 3AIOA 4RGYA 3FLBA 4FNGA 4XWGA 3WK7A 4DSZA 4N5HX 2WHPB 2JIDA 2WU4A 1ZGCA 1EVQA 1LZLA 1VE6A 1W6RA 3G0IA 1RWQA 3H1BA 2GYVA 3QBJA 4OD0A 2PKYX 3H18A 3QMMA 2B9VA 1QOZA 1YA8A 3N2ZB 2VJCA 2VSQA 4BRZA 4GXNA 1GPNA 4HS9A 5KWIA 4KE6A 3KSRA 1NU8A 5ISMA 5IVHA 3I2GA 2OG1A 5ALUA 3ANTA 5I7UA 3IA2A 3NWOA 2ZJ7A 3HZOA 3D3NA 4BP9A 4BRSA 1WB4A 2VA9A 4PF1A 4B82A 1MX1A 4QEKA 5JD4A 1XLVA 4BVJA 1CUCA 2VT6A 5DYTA 1E8DA 3WWDA 2W22A 5AICA 2PU5A 4J0IA 2QOEA 3PFBA 5JANA 4QWWA 1JU4A 1ZJ5A 3MUNA 4JNCA 4BAZA 1WHSA 3JW8A 3R3ZA 4E11A 2PVSA 3KXPA 5AI5A 5AKZA 2WIKA 3F97A 1XRRA 1A8UA 1DT5A 4CG1A 2VAVA 3FAKA 3FWHA 4G5XA 1DT3A 3A2NA 4U2EA 5A7HA 3WI7A 5LZ5A 1O6GA 1P0QA 4LXHA 3ICVA 4KAFA 3FYUB 2PSDA 5HKBA 5LKRA 2XUKA 5LIPA 5ALPA 2BGNA 1VA5A 1XRPA 1WOMA 5T4HA 2XT0A 3KWJA 1QFSA 3QYJA 7YASA 5AM0A 4DMKA 2XMBA 5DNVA 5FUMA 2H7CA 3FLEA 5ALHA 2XE4A 4WJLA 4FTWA 4FBMA 4X95A 3D2BA 2DR0A 2CKMA 4OB6A 3H19A 1CUXA 5C8XA 3FYTA 5CXUA 2WKWA 3BDVA 1BEEA 4BAUA 3S2ZA 2DCMA 2JBWA 3IUJA 2IIVA 5K3FB 4EY4A 2FUKA 3OPMA 1IMJA 4ZGBA 1GXSA 5ALLA 5JIBA 4UUQA 2WIJA 3G9UA 1VXRA 1XZMA 1W52X 3E0XA 4TGLA 5AHXA 4Q3LA 5FPQA 3BXPA 2PL5A 3V1KA 4PQEA 4HAIA 2QXUA 3IDAA 1HBJA 5CT8A 5HF8A 5C7YA 4AX4A 3AZOA 1ODCA 1EX9A 3FVRA 5EHQA 4BP8A 2RAUA 3DOHA 4F60A 2HHAA 1D07A 4J0JA 1EA5A 2JF0A 1EK2A 3WK5A 1BN7A 1R3DA 1O6FA 1HDEA 4HZGA 5FPPA 3W05A 5CT9A 1B6GA 4LIPD 5E2IA 3ICWA 4Y2XA 5CH8A 2QJRA 1TCAA 4TPKA 5LZ2A 1AGYA 1BCRA 3ESBA 4AN1A 5EHXA 1W4LA 2Z5GA 3WKAA 1IVYA 4S0XA 5HF5A 3ED1A 2X5XA 5AI6A 5ALKA 1A8QA 3WWCA 3BWXA 3PFCA 2HA4A 5FV4A 3RK4A 1IZ7A 4GW3A 1JU3A 5IVIA 1UKAA 4WFIA 3WA7A 1Q0RA 5ALMA 5EFZA 5AOBA 4Q3KA 1UKBA 1LPPA 4QE3A 3H2HA 1WB6A 3F96A 4Y7DA 2DHCA 2B4KA 2VTVA 1ZD4A 2CJPA 4L72A 4E14A 3PUHA 4DMCA 1JMYA 1GZ7A 2XDWA 1ZD2P 3EBLA 4U2FA 1ZD5A 2EDAA 1UOQA 3AZPA 1GPLA 5HZGA 3I2FA 3AZQA 5HQ3B 2WJ4A 3GA7A 2VEOA 4H7HA 5JASA 5AM1A 4G4IA 2CEKA 2DFPA 3R3XA 3STVA 4U2CA 2WIGA 5HKAA 4W1RA 1YASA 4MYSA 2WUEA 3H2JA 4BC1A 2WIFA 2C58A 1CVLA 4ARBA 4QZVA 1CUFA 2DHDA 5EI5A 4P9NA 5BWBA 4W1SA 4K6HA 1UK9A 3HJUA 2AJLI 4G1FA 4Y2VA 4HTAA 4UHHA 3FCYA 4HXEB 1SC9A 3D2AA 1FFCA 1IUPA 1CUHA 4IH1A 1W76A 5F4ZA 3TGLA 1QO7A 4C4YA 4YK7A 1YSCA 1UFOA 1XQYA 4ZV7A 2OCLA 3RARA 4BAGA 4AQDA 1H2YA 5D7BA 2OCKA 5JAUA 1ISPA 5LZ7A 4JH0A 3DOIA 1KU6A 3MUOA 3D2CA 1ETHA 3CN9A 3DL7A 3M82A 3PICA 5CH3A 4YPVA 3GBSA 4EUSA 2J3DA 3D5EA 3A2LA 5I9IA 4EY7A 1M33A 4AN0A 5AI0A 1XZFA 2HA7A 3EQ9A 3QPAA 2V98A 1T4MA 3GROA 4UHFA 2IX9A 3DL4A 1EXWA 2ROQA 5ALXA 3HEAA 1RYYA 2V96A 4DIUA 5FOQA 4CCWA 1DQZA 3PF8A 3HI4A 2GBFA 1UOPA 2LIPA 2PM8A 4DMFA 2BUCA 4B6GA 3O9MA 4BTVA 2PPLA 1JFRA 2FJPA 4G8BA 4FLEA 3TRDA 2JGKA 4J0KA 2QTBA 1Q84A 4FMPA 2ZYSA 4AXBA 5DNUA 4CCYB 1U8EA 2FX5A 5EIHA 5C8VA 4FLMA 3NGMA 5AKIA 3WL7A 3P2MA 4Y2TA 3OM8A 3C5VA 1CV2A 4Q34A 2W6CX 1CEXA 4JEIA 4FOLA 1TCCA 1DWOA 3PF9A 1QIHA 1WPRA 4ZV9A 4Y2JA 3AIMA 2VJDA 2YXPX 2VT7A 3ZLVA 5ALJA 5AI4A 4ZREA 3O4GA 1EDBA 4X93A 5AM2A 1JJBA 1CUAA 2VF2A 4BVLA 4MQLA 4M0FA 3ZWQA 3DQZA 3ESCA 3HACA 2VATA 4BE9A 1CUVA 3BE8A 5HCUA 1AMNA 2JGIA 3R0VA 3R3VA 2G5PA 3WYNA 1PJAA 3H2KA 1YB7A 4J7AA 5ALIA 2PBLA 3HABA 3DS8A 2XUDA 1EHYA 5J3JA 5CTAA 3C8HA 2P8SA 4GDMA 1QONA 1ZIYA 2RONA 3C6XA 4X91A 4HRYA 2XMQA 5ALYA 3M81A 3V9AA 4J3JA 5AM3A 2PU7A 1LBSA 3WWPA 4AZ0A 5C8ZA 4IH9A 2BKLA 3G9XA 3BJRA 3QVMA 4B0OA 4OB7A 1FFEA 5ALNA 2OQVA 1MX5A 5CRIA 5T4EA 1WHTA 4DNQA 1G66A 4Y9SA 5HK9A 3VVMA 2OAEA 2VJAA 3O9VA 1W75A 4LXGA 4EB0A 5AOCA 1GQSA 1TKRA 3V48A 2Y6VA 4MWTA 4PV7A 2J4FA 5FXMA 1F6WA 4KRYA 4FWBA 3ZPXA 3U1TA 5ESRA 2Y6UA 5IVKA 2WUGA 4HXGA 1NX9A 1QIDA 3R40A 5KWJA 3DDUA 3FBWA 2Y2VA 2XLCA 5CT6A 2JGFA 3DYVA 2XMDA 4FFWA 4QNNA 4B81A 2ZYHA 1SOMA 1XZKA 2XUOA 3LLCA 1J06A 1MNAA 2HA5A 5LP1A 1EK1A 2AJDA 3G9TA 4L0CA 3RLIA 1XZBA 1CUIA 1MNQA 3FNBA 4RE5A 4F5ZA 4MJ3A 3CN7A 2QUBA 4I3FA 5DYYA 2VQ6A 4AZ3A 3E1GA 3F8SA 2JEZA 1UXOA 3OG9A 2QXTA 4L3WA 2WHRA 4LYEA 4UFPA 2V97A 2WQZA 2YYSA 2WHPA 2DQYA 4H35A 2XUQA 4WDRA 2HDWA 4MEBA 4DMHA 3ZLUA 2OCIA 5IVDA 4X97A 1BRTA 3WIOA 4NS4A 3C5WP 3C70A 1EB8A 4QA9A 2BJHA 2AJCA 1QZ3A 2Q0XA 1UWCA 1TAHA 2BFNA 2WU3A 4PSCA 3O0DA 4Y2QA 1CR6A 1EH5A 5DLPA 5JAOA 1XQWA 3EF3A 3SC2A 1DWPA 4P93A 1H2WA 2NW6A 3L1IA 1G42A 4I19A 4WY5A 5EIAA 4A5SA 1VJ5A 4QDZA 3I6YA 1MN6A 1E8MA 4Y2UA 3I6ZA 5AKJA 4B9AA 4Y2SA 1EINA 1PV1A 1UK8A 2GYUA 1FFDA 4Z49A 2XUHA 4ITVA 4C01A 3H1AA 2PSEA 4W1QA 1K6EA 3BF8A 2XMGA 2CMFA 2JEYA 4FHZA 4U2BA 3FYUC 1R1DA 3C43A 4KR0A 2RGUA 1IUNA 4M0MA 2OGSA 2XUPA 1ACJA 1CUYA 1T2NA 2GBGA 1DX6A 3IIIA 3G0GA 5ALEA 1BU8A 5AI9A 1BEZA 3X3HA 3G0BA 1THTA 2I3DA 3ESDA 1QLWA 2WG2A 3AJAA 3STTA 2RIPA 2HL6A 5ALOA 5DWDA 4RNCA 3FYUA 4CI9A 5JD5A 1IUOA 1P0MA 1CFJA 4OUKX 1R9NA 4JYPA 3C6YA 1J2EA 5AK4A 3WJ2A 1Y37A 1EDEA 1LPNA 2AXEA 2H7XA 1ACLA 1AX9A 2H7YA 4U2GA 3LIPA 3L1HA 4ETWA 3YASA 1JJIA 2Z8ZA 3I2HA 2QZPA 2PUHA 3I1YA 3PUIA 4AB1A 4C88A 2HU5A 1HQDA 1U4NA 3VKFA 1LPBB 2HFJA 6YASA 1P0IA 2PSFA 3IBTA 2D0DA 2DHEA 1AZWA 5EGNA 2J4CA 5K3FA 3T52A 1XZLA 1UOOA 2VJBA 2XUAA 4C87A 4TVKA 4H0CA 2BUAA 4KEAA 5CW2A 1SCQA 4BC0A 3C87A 3G0DA 5AH0A 5K3CA 4Y2YA 4X3CA 3H04A 1H2XA 3LCRA 2Z8XA 4B85A 4EA6A 4X6UA 5AIAA 4G4JA 1BN6A 3VISA 4H18A 4GECA 1NU6A 1CQZA 1F0PA 1LPAB 2XUFA 3MVEA 2HA2A 2I78A 3F67A 2O7RA 5AKEA 4B80A 2GBCA 2JGEA 3ZI7A 3E3AA 5ALTA 2Y2UA 2B61A 3VJLA 1QE3A 2CBGA 5AIBA 1HKHA 1L7QA 3DNMA 4EBBA 3WK8A 4N8EA 5LYYA 1XKLA 1ZJ4A 3BIXA 1XRNA 5HFAA 1MT3A 3DYIA 2C4HA 1BE0A 3PI6A 4X6YA 3WWEA 1E66A 4E46A 4DGQA 3UUFA 4EY5A 2ZJ6A 5AKLA 4K5QA 1JMKC 4H77A 4UBJA 4GWLA 3C8DA 4OU5A 4C6HA 1XLWA 2QS9A 5ALGA 4JYMA 1KEZA 3AUKA 5E4JA 1CUJA 5BWCA 4MQMA 4X85A 4GEGA 5D6OA 5AP9A 4H7FA 1XROA 2J3QA 3AIKA 5A62A 5AK3A 2ZVDA 1BROA 3VVLA 3FLAA 2CB9A 3IB3A 2AJBA 4JUIA 5AO9A 1QIJA 3I2IA 2XQJA 2R11A 3R3WA 5HQ3A 4IQ4A 2WM2A 5K3EA 1YR2A 2B20A 1XRMA 1F8UA 2QMQA 4BE4A 3H0CA 3DKKA 4V2IA 5AKGA 1CUWA 5JADA 3KWFA 2XUIA 2YASA 3AILA 5CH5A 3WZMA 2GYWA 4KACA 1XFDA 4XVCA 2QR5A 5EHZA 1UK7A 4Q82A 5AKHA 1E89A 2XLBA 2BUBA 3WL6A 1AKNA 2OPHA 1UZAA 3W9UA 2BGRA 4OYLA 3QMWA 3LP5A 1WCYA 5A6VA 2EDCA 1CUSA 1ORVA 1CUGA 4WFKA 1J1IA 1XRLA 5CT4A 1L7AA 1LGYA 1Y7IA 2O2IA 4INZA 1Q0ZA 2D5LA 3JYHA 4DTCA 5DTIA 3A70A 1QFMA 3EIOA 5EHNA 2WFMA 5AJHA 4FLFA 2ACKA 1USWA 3A2MA 4Q3OA 2HADA 2WG1A 1TQHA 4PSDA 3CCBA 1ZI9A 1VZ3A 1IZ8A 1VKHA 5HK8A 1TRHA 4XIIA 1ODTC 1J07A 3WWOA 4WCVA 4Q05A 2RHWA 4Y2RA 5JYCA 4QDXA 1LPMA 2XQIA 2ZSHA 4BB0A 4CG2A 3R41A 4FNMA 4GHWA 1CUEA 1C7IA 1CLEA 2ES4A 3WKCA 3I6MA 3HXKA 5HF9A 4RPCA 4G8CA 3VXKA 1GQRA 2CZQA 3UMJA 1QTIA 1YA4A 3G7NA 1Q83A 4DNFA 3JWEA 3V1LA 4W9RA 5K3BA 1HLGA 2YH2A 1N1MA 1CRLA 4UHCA 2QVBA 3HLKA 4KAJA 4K6KA 2XMCA 1VXOA 1G5FA 2K2QB 4H7KA 1BCSA 5ALQA 2ZSIA 2WUFA 1XQXA 2E3JA 4CCYA 2WIDA 4FKBA 1H22A 1R50A 3KD2A 2WFLB 4PO3X 1UT6A 2I03A 4B7ZA 3AFIA 2Z3ZA 4A16A 3WKDA 4WY8A 4DLNA 1ZD3A 1ZGBA 1EDDA 2V9ZA 3UUEA 5JAPA 3SWWA 4OCZA 1N8SA 3ZLTA 4KE8A 3WK4A 4K6GA 1QIIA 1X70A 3G9ZA 5ALFA 2HFKA 4X71A 1OCEA 3D59A 4CG3A 4BDSA 4N5IX 3QITA 1CPYA 5BV7A 3W04A 4N8DA 4DNPA 3H2IA 3D7RA 3WK6A 3G8YA 4A23A 1BS9A 5AM5A 4BCCA 3LS2A 4PW0A 4KAAA 2I3ZA 4J0DA 3TJMA 3U0VA 1MJ5A 2XMZA 1MX9A 4BZZA 5IH7A 3AINA 3DCNA 4I4CA 3WK9A 3MGAA 3C6ZA 1G4HA 5JALA 4IHAA 2EEPA 1TCBA 4DNOA 2WFLA 3I2KA 1WM1A 4C89A 4MEAA 1LLFA 5SYNA 4YASA 3ILSA 4ARAA 2C5FA 1B41A 2O2GA 4J03A 2OGTA 5AOAA 2HA3A 5CXXA 5LZ9A 3NUZA 3WA6A 4BCDA 5T4BA 3R3UA 1CIJA 2G4LA 4QDTA 5FKJA 1LPOA 2ZYRA 3SK0A 3DEAA 2CUTA 5JARA 1YCDA 1YS2X 2R8BA 4GLBA 3FVTA 1X2BA 3D0KA 2G5TA 1C4XA 1MPXA 2G63A 1XZCA 2PSHA 2WJ3A 1XZDA 3G02A 1X2EA 5DTJA 3C45A 5JAHA 1LNSA 4OSEA 1DTEA 5A7FA 1SCIA 4FFVA 2HRQA 4MXDA 2XUGA 2OQIA 2DQZA 3R3YA 2XQKA 2C5GA 4QDUA 4UHDA 5D3ZA 1MAAA 2QM0A 3H2GA 1GGVA 1EB9A 1CUBA 3L1JA 3PE6A 5A7GA 4LXIA 4GBGA 3B5EA 2WSLA 4CIAA 4DM7A 1CUDA 5SYMA 1XZAA 4N8SA 4WFJA 4IH4A 4O08A 3HRHA 2ECFA 4F21A 1W1IA 1GPKA 1GKLA 3PDCA 1ORWA 1DU4A 3CCCA 2OXEA 3QPCA 4UHEA 1DX4A 5YASA 5ALWA 4WDQA 4H7IA 1YS1X 4H7DA 4J0GA 4AO8A 1QIGA 3O4JA 1QJ4A 1AQLA 3M83A 5ALZA 2RHTA 1VOTA 1P0PA 1XLUA 1K5PA 2VAXA 3Q0TA 4LKOA 3Q8WA 5ALVA 5D3KA 2BCEA 1MTZA 4ZRDA 4EY6A 3O4HA 3H17A 1XZEA 2QT9A 4L9AA 1DWQA 2C0QA 1YAJA 5IKXA 3WJ1A 1CQWA 4KE7A 2RI6A 2WTNA 5AK5A 1GT6A 4QLOA 2WUDA 2ZYIA 4BZWA 2PX6A 1VLQA 1DQYA 1U2EA 3W9BA 2AJ8A 3T4UA 2WG0A 3DLTA 2WHQA 2HIHA 2O2HA 3OTQA 3GUUA 4FDMA 4HVTA 2QKYA 4X7BA 4KRXA 1LPSA 3N0TA 5KREA 4UBMA 1TIBA 3WZLA 3GZJA 5AI8A 2XI4A 2GZSA 3BDIA 3LIIA 3STUA 4EZIA 2HU8A 2JGMA 4J0CA 5A2GA 5CURA 4M0EA 5DNWA 3WL5A 2XMSA 4UPDA 3W2TA 3QZUA 5KBYA 1CUZA 3BF7A 5I8PA 1ZI6A 4G9GA 3CXUA 5AK6A 5ALRA 1HPLA 1XKTA 2BAGA 1I6WA 2C7BA 4ROTA 3IURA 1EI9A 1A8SA 5FLKA 2UZ0A 4X6XA 1K63A 1AURA 3VJMA 3VJKA 2QUAA 1QGED 4BTLA 4RE6A 4B9EA 4B83A 3RM3A 3K6KA 3DKRA 1FFAA 1H2ZA 1JI3A 4Q1VA 4B84A 4X92A 4XJVA 4UBNA 1XRQA 2ZJFA 1WB5A 1FJ2A 3TEJA 2XUJA 4F0JA 4BDTA 5JZSA 1ZI8A 2QJWA 1JKMA 2IITA 1K8QA 2XQGA 2WFZA 2O7VA 3BIWA 2GZRA 4UBIA 2WILA 4W1PA 5JZ9A 1XQVA 3W06A 3EQ8A 4UHBA 3GELA 4BYMA 1XZHA 4X00A 1ODSA 5AM4A 4UBKA 4QDOA 2PUJA 3K9BA 5LZ8A 1F0NA 1E3QA 1UKCA 5BOVA 2HRRA 4HRXA 4G4GA 4AO6A 4KYVA 4EY8A 3B3QA 3QH4A 5LLSA 1VA4A 4BATA 1JJFA 1Z68A 5T4FA 4UBLA 1KU0A 5AKYA 1QTRA 4K2AA 3ESAA 3DD5A 2WLSA 1R9MA 5FDFA 1Y7HA 3M3DA 3S8YA 4PSUA 4GI1A 1AUOA 1XZJA 1A88A 2HA6A 1MO2A 4C4ZA 1HL7A 1EVEA 3HSSA 1QO9A 3OC0A 4ZI5A 2Y1KA 4HXFB 3I2JA 2HM7A 1R4ZA 3IUQA 2ACEA 3I1IA 3QM1A 2FJ0A 5K3DA 4YX9A 5EIEA 4CIBA 3BL8A 2JGLA 2XMRA 4QLAA 1OXMA 5LZ4A 5DJ5A 4X90A 5FRDA 2OCGA 3KDAA 3FOBA 3F98A 3DJYA 3IUMA 2Z3WA 1TK3A 3I28A 3A6ZA 4G8DA 1C7JA 2H1IA 3C6BA 4XX1A 2JGJA 3E4DA 4NZZA 3FSGA 1RP1A 5AKXA 1U65A 3IVMA 1E8NA 2PSJA 4IO0A 1XZGA 2H9YA 4LHEA 2WTMA 3K2IA 3O95A 1YB6A 1N5MA 1MU0A 2C0PA 4OU4A 4AO7A 3HC7A 2XQFA 3KOOA 2XB6A 3WMRA 1CUUA 5ALSA 2HA0A 1GKKA 5JATA 3RKSA 5CMLA 3F9CA 1H23A 4C4XA 1E5TA 1FSSA 4E15A 2ORYA 4CFSA 3G0CA 4H7EA 1L7RA 4J0HA 3V1NA 3STYA 4P08A 5HFNA 1XZIA 5C81A 1MAHA 3EQ7A 3STWA 4AMZA 2HU7A 1QIMA 1SCKA 1S8OA 5E4TA
chains in the Genus database with same CATH superfamily
1E9VA 2GFQA 4QUHA 2VQ3A 2FEKA 2UVDA 2E5LB 2G76A 4AWXA 4TZ6A 3AR3A 1RW4A 2A2ZA 2GBIA 2HSZA 3GBVA 4KJXA 3KVVA 4B7CA 2XR1A 4DIOA 5I7SA 5I6DA 4PRKA 4DR7B 1KMNA 2JJ1A 1TYDE 2GCPA 4QICA 4FYWA 5BSWA 3SC3A 5ICEA 4OHOA 4BFXA 4LRWA 5CT5A 2ODTX 2D0PB 4X24A 5DYWA 3QWAA 5F7OA 4GPBA 1YZFA 1KMIY 3ELWA 3MRTA 2ZSDA 4CG0A 2AI2A 4DRXB 4GYWA 3GZNB 1TPZA 3LLSA 3QFHA 3AUTA 3QXJA 3W5SA 4UNRA 1XTZA 3VAZA 1VG0B 3KTAB 3KT0A 3QY9A 2Q28A 3WQHA 5CHEA 4C43A 2O2EA 3PITA 2J0VA 3FKQA 4JP5A 4RFSB 5TJHA 1NQXA 3ABRB 4MX8A 4MV9A 1QV9A 1ZOIA 5ALDA 1ORHA 5G1PA 1LXCA 3QJGA 1ZNWA 2FPIA 3ZWVA 1A7KA 2BTOA 2BVNA 2H06A 3OCZA 1ZMBA 4RLFA 4NXMB 3CSUA 3ISTA 2OV4A 3COZA 1DBQA 2OBFA 2W6PA 4MWSA 2YY5A 4YNBA 1I10A 2DPMA 3KP1A 4QGAA 4B75A 4O5AA 5TMPA 1YCHA 1CDDA 1OFUX 3TECE 4UUNA 1TFUA 1FYWA 4H3HB 5E4YA 5ABPA 4DUZB 1PJLA 2EKDA 2ZR7A 3IAS6 3U7QB 1NVUQ 1LDBA 3DVRX 3M6AA 4J07A 4PNZA 1PTJC 1YE8A 4Z2YA 3KXIA 4OHBA 1GJRA 4V1CA 2R48A 3K16A 1FVXA 1UFKA 1JFFA 1QWSA 2SKEA 4DPMA 4UBOA 3M4YA 5BQ3A 2BLLA 2QV7A 3CNBA 2VDOB 1GYRA 1PVVA 2DM6A 2WJ6A 3A1CA 1P81A 3D43A 3H2YA 1J33A 2RJOA 4PLFA 1FZQA 3S0JA 2JVIA 1UM8A 2DT8A 5IKPA 1XYVA 4LGMA 4Q9KA 4X94A 3HSYA 4L5JA 5LOVF 1OYYA 4QGFA 4BNNA 4EM6A 4IIXA 4QUBA 1PI3A 4R68A 4RLSA 4F5WA 4ZQCB 3MB8A 4BNZA 3JU3A 1GCIA 3F5MA 5KU7A 1IN1A 2NO5A 2EQAA 5HF6A 1JX6A 4X65B 4RGVA 3RVDA 1JQ3A 1FFBA 1O94C 3DWIA 4H60A 1QIEA 4N18A 4OOFA 5T6MA 2QM3A 2ODWA 1YC5A 3T0GA 2GFIA 1N4DA 1V41E 4AQYB 4O2BB 4BGIA 3AR6A 4MVJM 5K3AA 1I2BA 1EBFA 2GS9A 2QBYA 1M8GA 5A5EA 2DRIA 3F46A 4P92A 3N8NA 4FCWA 5TPZA 2X41A 4ND7A 4RY0A 3W8FA 5A3JA 4BCBA 5FH9A 3G8DA 3WKBA 4DCOA 2OO7A 2LD4A 2WEKA 3P4YA 4H7JA 3PPIA 5LKAA 2A1UB 1QSGA 2QP4A 4FINA 4UVIA 1HT0A 1N2CB 1XFAA 4V0LA 1XL1A 2FKNA 1THGA 4YJ2A 3C24A 2Q3FA 3C5CA 4NMWA 2NYAA 4ZCSA 3WLAA 1P2BA 1RSZA 3T61A 1M6EX 2G6TA 4WSOA 4G86A 3UMVA 4NZYA 4XEHA 4XXHA 5DM0A 4F4IA 3AIOA 4U7WA 3FLBA 4XR9A 1X8XA 3ICEA 1P80A 4XWGA 1QOPB 3R8XA 2QX9A 3LY7A 4KPUB 1M83A 1RLIA 1VJ1A 3FM9A 2ZULA 4Y0VA 5IYZA 3GZTB 1EFRD 1RXWA 5CB4A 2PFKA 3NWBA 1X7GA 2XNDD 5IC5A 5IHPA 4D44A 2QMYA 3WLOA 2P62A 3QX8A 1R8SA 3N5CA 3P71T 4IS3A 3IV7A 4LYGA 2OGUA 4MW5A 4QDJA 4UNPA 4OD0A 5EKTA 4M9SA 3TG2A 4F84A 3QMMA 2B9VA 2VP5A 4ZPJA 2POQX 1SBTA 3W5BA 5CIWA 3FTPA 4C4PA 3AWIA 5DGTA 1YA8A 3R2JA 3QVWA 4H6VA 3N2ZB 3SY8A 3UG7A 1X1CA 2P0AA 2QW0X 5ICSA 1FFYA 3NYWA 1V7ZA 4OHRA 5GP1A 4ESOA 4KNVA 3DMYA 2AC7A 5KWIA 4KE6A 4JKOA 4G63A 4JQOA 2QLLA 3HWX1 3VPBA 2RSLA 1ZD9A 3E2IA 3IESA 4MQ5A 1YT5A 5IUNC 2PA0A 3R7AA 5CFMA 1Y8RA 3VNBA 4WZBB 1J21A 1SCAA 5ALUA 2VTDA 2J31A 4YRCA 2FSSA 3U9LA 1P1IA 2WYUA 4WX2B 1YB5A 3IAHA 3LUAA 3JWJA 4MA4A 3SYNA 2ZJ7A 4D3XA 3DT9A 5K99A 2GPAA 2IYUA 3WGZA 5C8YF 3DC7A 1KZ4A 4BRSA 1SU6A 3I53A 1MJGM 1WB4A 4MKIA 1M75A 1OYOA 3C74A 4ZJUA 2EBUA 4B82A 2JBAB 4YXFA 1JMVA 2DUNA 4ZOBA 1P9NA 1UBHS 1WZ2A 3FA2A 2W2XA 2COEA 3I76A 4YRLA 4RZSA 4IICA 3INNA 1N2EA 1F1BA 5JD4A 3THXB 1U2DA 3CGWA 1YXMA 5K0LA 2WB4A 4CKWB 1CUCA 3B1YA 2WZCA 4WN3A 2WWGA 4EQ6B 3P7MA 4GM1A 1T9CA 3HG7A 3MAJA 3UMBA 2A9OA 4IHJB 3C3EA 2A78A 1G8SA 2Q9UA 4J0IA 4LOKA 1PJBA 1ZN8A 3RBAA 2SKCA 3KVNA 3GHHA 3TKYA 4CT0A 3IAXA 2EL7A 1GNPA 4K9QA 3UJ3X 3W1WA 3W5UA 3ZZNA 5KQGA 1NLUA 1OREA 2YIVX 3SM3A 4CQNA 5LA6F 1PQPA 1ZJ5A 2HXGA 2CMKA 3JSXA 1QBGA 1WHSA 3JW8A 3PB3A 3QA3E 4JX8A 4UU1A 4K40A 4CIDA 4BNGA 1HLDA 2OZVA 4WI1A 2G9RA 3NEPX 3UCEA 6ABPA 1BXGB 2XSZA 2IY8A 5B2FA 4YJ2F 5F23A 5GVSA 4AKHA 3VZCA 2UZ1B 4H1VA 3ZIAA 5LVAA 4EO7A 1XRRA 2ZXFA 1U0HC 3V8RA 3S8MA 5HRCA 5IZ4A 3CLHA 2O8VA 3ZHOA 1IBSA 4EL5A 3HA3A 5JVDA 1E3MA 1GYQA 2X58A 5BSEA 2ST1A 4G5XA 4GQBA 4EMTA 1GNLA 4EYSA 4U2EA 1CIVA 2ISCA 3B6KA 3OQHA 3NDRA 5LMNB 3B1FA 3CRRA 3S2FA 1RXCA 4D0GA 5AUNB 1V11B 3ORHA 5CB4F 1YFZA 2BFAA 4Q5IA 5A7HA 3FR7A 1DOAA 1UMBB 2ZUUA 2YWFA 3ROFA 4ENPA 4PS0A 2CNDA 3DZDA 1DC8A 5ENZA 1Y81A 3KKPA 1O6GA 4RK0A 4LXHA 4RUKA 4AIRA 3ICVA 3VGJA 2IYTA 1DRVA 3R5HA 3ZY5A 4K9LA 1SD1A 3FYUB 3L46A 3ENWA 3KWMA 4KN6A 1OI3A 3ZS9A 5A4MS 2ASVA 5FLXA 4ESVA 4B47A 1MG5A 3KSMA 3WTCA 3EGIA 1MRNA 5TLSA 2NADA 5DMHA 1VIYA 1YK0A 3G5TA 3W9SA 1QG6A 2EFHB 3VKGA 3W7AA 3TKAA 3AG5A 1NW5A 1E0DA 2PZLA 1JLRA 1X3LA 1E7YA 1NF2A 4HEA6 5T4HA 1Y4AE 3QYJA 2VK2A 1WUYA 3VPHA 3I0MA 4R84A 7YASA 4DMKA 1LK7A 3MC1A 2X86A 4KPGA 5DNVA 1RC1A 4WUVA 3AF5A 4D7AA 2FOIA 1E2DA 3S1LA 4LTMA 3OX2A 3WQSB 4FU0A 3I37X 3RU7A 4CCAA 3IO3A 3CIFA 2Q6OA 2XJ4A 4WZ6A 5BN4A 2FU5C 5ALHA 1UPCA 1G2PA 1BKSB 3HM2A 2WA2A 2XE4A 3OHSX 2CJWB 4GSLA 3SM9A 4WJLA 5JR3A 1B4DA 2JHCA 3N2KB 4KIGA 5DCLA 5GPBA 4X95A 2FQQA 2YVKA 5HOQA 4IUCS 4BLUA 1O96B 4RESA 1HOTA 4HNQA 1RWOA 1XMJA 3L7NA 3CLUD 1R6UA 5KYUB 5AMXA 3OA2A 3QVLA 2FWIA 4FW9A 3FYTA 4HUQA 4URYR 1FFWA 3CLTD 5G4LA 4EPWA 3SXUA 2TMGA 1KY4A 3EFHA 4P3KA 3L6RA 1F8YA 1BEEA 4WKOA 2H0AA 2JFQA 5LWQA 1Y1RA 3SP1A 3SJBA 2ZVPX 3WAKA 4BNHA 2JBWA 1JEAA 2VJMB 3H9EO 3KKQA 4GQIA 2WVGA 3IUJA 4ZCIA 4FOSA 2JJ8A 3C41J 4RTQA 1BMDA 4ARIA 4O1HA 2J6HA 3MJHA 2P3LA 5AW2A 2QM8A 4Q6WA 1KNQA 4LE0A 4HVCA 3GK3A 1Z6PA 3S40A 3OEHD 2QZJA 3FDZB 1B8NA 4JJ7A 4Q7MB 2FUKA 2FZ4A 1MIOB 3OLWA 3OPMA 3O8QB 3CUEF 4OXQA 3CVVA 2I6QA 1ZGHA 4P4GA 4MMXB 5K4HA 3QVTA 4V38A 2IUYA 1Q7TA 1FP6A 3KB8A 3LMKA 4QQKA 5KOHB 1BXKA 2BSAA 1OWOA 4TXJA 2RHRA 3CVUA 3OPQA 4K88A 3ENVA 5CA0A 5JVDF 1MC4A 3I32A 5D51S 1W85B 4BJHB 5DX1A 4YRFA 4B4OA 1ZCJA 2QZ4A 4DIFA 1ML3A 2HPHA 2O8DB 4JZYA 3H5RA 5CFNA 1EWTA 1SURA 2VAMA 4HH4A 1W36D 1JR2A 1QZUA 2OAP1 1OFTA 1G63A 4I4TA 3SJ7A 4TGLA 2Z0MA 4WKCA 2FWJA 5BP7A 4Q3LA 4MZDA 5FPQA 4LOJA 1SZPA 2IS1A 2A0YA 2JIQA 3BXPA 1ZQ9A 5FFMA 4QUKA 2PL5A 1WTAA 1I13A 1HBJA 2AFHB 3VR1A 2XODA 3KRTA 3EC1A 5JYBA 3NCHA 2C7VA 4AP6A 3UAZA 2OZPA 4AX4A 4D81A 4FFNA 5FDFA 1U8XX 4ZK2A 4H08A 2DLCX 4WCFA 3E5NA 2QHXA 3PHIA 4WXYB 3TUIC 4MVJP 2ONYA 2ALJA 4GU5A 2YN0A 5DTQA 5E9JA 1P44A 3WBJA 3FVWA 3PNKA 1FDIA 3CH6A 2J3IA 3AB7A 2AFIB 1VG9B 1D07A 1C7EA 1EGQA 2ERCA 2HHAA 2CDAA 3G0OA 4J0JA 1QE0A 4AMVA 4ZAYA 2ZBPA 1IXKA 1AGRA 2WWTA 3CZCA 3HBFA 1AY0A 3HVKA 1EQ2A 5FULA 3WK5A 2Z2JA 1BN7A 1R3DA 2E4ZA 3CLRC 2Q1TA 4BVGA 2WYVA 1UMDA 3MMPA 4LOHA 1O6FA 1ZK0A 5E2AA 3VV2A 4E4YA 4OQNA 5BPFA 1HDEA 5JQGB 2IGBA 2Z4TA 4YB8A 3W05A 4BX0A 1UBUS 3P97A 3REGA 4JSTA 5DRYA 5BVGA 2UYHA 1UEJA 3MSXA 1JQJC 2I2CA 4PZ9A 5D3MB 2O1XA 1XMVA 3ICWA 3LVBA 4N76A 5K6TA 1XA3A 3U4IA 4UTOA 2EARA 1RIFA 2QJRA 4YWHA 1K7EB 3V8VA 2WA1A 1PZGA 5BURA 2WUVA 1NAHA 4ZD6A 3ZTWA 2ZUDA 1X9IA 2AUTA 3ESBA 3HVUA 2OV8A 4QAQA 1H2AS 1XD2A 2O2JA 2OB2A 2ODPA 1Z22A 3DCYA 3NHZA 1W4LA 1QMGA 2PQMA 2Q5OA 3QKUA 3H2BA 3RF7A 2REQB 1IVYA 1OX5A 2IYOA 1FTQA 5IM5A 4A8PA 3ED1A 1YB2A 3GDWA 5DLEA 2X5XA 1F20A 3TJRA 2QE7D 1E1NA 4DUGA 2Z2KA 3A1UA 2HNKA 5ALKA 3J81k 3CZPA 4C0AC 4TKUB 5TGTA 3H86A 2WAYA 1JSZA 1YBVA 3D02A 4DPKA 3A4NA 3HB4X 5I9BA 3A6JA 2BFWA 2Y0DA 1GGJA 4CMJA 1Q22A 1U7HA 1WXXA 2NXEA 4ZQIA 1W87A 3KXDA 2XRFA 4B6JA 4COKA 3PIDA 5CA0F 4JLUA 4KZKA 5JH7F 1IRXA 4AM8A 3GNSA 3EXFB 3JAMA 3ASVA 1SWVA 1OA0A 1QRDA 1P33A 4FD3A 3KAJA 3OX1A 3C97A 1ZD4A 1KJQA 1REQB 2X0NA 3IQWA 4I4TF 4L72A 2BFDB 4FD2A 3THSA 4BQNA 2GESA 3TQQA 3OCJA 3LUKA 4DMCA 4QVGA 3TQOA 3OUZA 2Z2YA 3I04M 3EBLA 2BZSA 3SEFA 1ZSVA 2EDAA 4KIJA 3AZPA 3RUAA 1GPLA 3WGYA 2JASA 4TLLB 2WKQA 3I2FA 2VOJA 4RC9A 3F6BX 3AZQA 4XWAA 5FA6A 1VQ1A 1RHUA 5EKUA 4KTVE 3TZCA 4PXAA 3GUCA 3OQVA 2C2BA 5GJWC 1K3UB 1S1MA 1Q57A 3KAKA 5AVJA 1Y3CE 3VC1A 1QZZA 2JA1A 2ZRHA 4HLUC 2PL3A 1P4GA 3N28A 2PMFA 2YXDA 3C6KA 3SX0A 4INJA 3J81A 1GTG1 3MTAA 4AKGA 3R3XA 5G1OA 4EKDA 4V0ME 1R5NA 1IQ0A 1LK0A 2P5SA 5CGZA 4YJFA 3O8CA 1EK0A 3EPLA 2ZTSA 5HKAA 1R8QA 2R6JA 1YASA 1WSDA 2WUEA 4RXUA 1U9ZA 5JDIC 3UOWA 3PXGA 2EIXA 3ILVA 2FWPA 1N7IA 4KN9S 2YWGA 4B74A 2IIBA 1ZNZA 5TV2A 1Q0QA 3DQQA 3OOHA 4TSFA 1ZN7A 3L7YA 2C58A 1GG8A 2VDJA 3ID6C 3P9KA 4ARBA 4W8OA 5AUPB 1IVSA 3DE5X 1M2VB 1NVMB 2DHDA 5EI5A 3C1TA 2WY2D 4WNAB 1KPGA 3U7HB 4Y2VA 1G2OA 1N92A 3E70C 3UJBA 4GX0A 4UHHA 4S0ZA 4K81B 4HXEB 3WNZA 4POOA 1DTSA 4B40A 2UZIR 5IDWA 1SC9A 4B6SA 1Q0HA 3SNHA 1VHDA 3WX0A 3A1SA 3D2AA 3MZ0A 2QN6A 1E7SA 1AA9A 2R2AA 1CUHA 3LDGA 4C03A 5AVZA 2NU6B 1M76A 2PGIA 2B94A 3N0VA 4BKOA 3LI2A 1QO7A 5JS6A 3LKBA 2NVBA 1E2KA 3EVDA 4E32A 4E5UA 1U2SA 2H4WA 3QLUC 1RM4A 3L7BA 1Z7YA 3LFHA 3JQ8A 4KN8A 5D1HA 2P27A 1K4KA 3ZDBA 1UFOA 1YULA 3DO5A 3V7FA 1KI9A 4J1QA 2VCEA 3ZNPA 1E79D 4U9UA 1NMZA 3ZCSA 1E2MA 2QGFA 3OT1A 3D54D 2HBYA 1AS0A 3FB4A 3GQBA 4LHWA 4L07A 2I6FA 3HRKA 1VJCA 5JBQA 5MN6A 1W19A 1LTHR 4BJ1A 2OCKA 1ZXXA 1SMKA 1TO2E 2O14A 2R5WA 3UK0A 1IOWA 1E2BA 4AKIA 2WTBA 4HR7A 3SJUA 3D2CA 4TLMB 1O87A 3O47A 4HVAA 3FPFA 3CN9A 1CQIA 4KO3S 1YS9A 3PICA 1ZN2A 2BEVA 2PR7A 5K3SA 4CKCB 3B48A 4YPVA 3EEOA 1GCOA 3E23A 4EUSA 5C32A 1EYZA 3D5EA 1LNZA 1JE1A 1M1YE 3A2LA 4L6AA 4ND3A 1WVGA 2ZB2A 4KQHA 3VUFA 4R01A 1ZMXA 1MO4A 4X54A 1UBLS 3KHTA 1E1CA 1M33A 1I4DD 2PZGA 1HDXA 4U4AA 1ZJ6A 2R6AA 2IYWA 3MLBA 5F2KA 4AN0A 4CMIB 3AEZA 1KZ6A 3CA8A 3KYIB 3UGKA 2IU4A 2FZEA 1D8AA 1WMEA 3VTKA 3PJRA 5JW6A 4DV0B 3OLVA 1SUAA 2H3HA 4AIIA 5CHYA 3V8NA 4B7UA 2NUTA 3W4KA 5KMGB 1U0EA 1DDOA 1BQEA 4GMDA 4KTTE 4XB6B 2AC2A 2ZM6B 3GCXA 4UZFA 4NAUA 1UPXA 2QQFA 4BQPA 2V98A 3A58B 3V4VB 3FDFA 4Q4AA 4YUXA 4BNMA 5IT4A 2WW8A 4DC1A 2RGGA 4UHFA 2IX9A 3TZHA 3DL4A 3IXLA 1EXWA 2IQIA 3PQ5A 3WHPA 4F93B 1GNVA 2R5FA 2LPMA 4BBJA 3SI7A 1RXEA 4ENTA 4L78A 1OX4B 4GPIB 2WE8A 4INAA 5FOQA 2Q2VA 3FGOA 1IPHA 3OSZA 4NPCA 3RSSA 1Z7EA 2HWYA 1IAVA 3PF8A 5FEMA 3SJAA 3COJA 3HI4A 2NTYC 1TZJA 1RR6A 2GBFA 1BW9B 1NPYA 1LU9A 4IS2A 4PGHA 4AMUA 3OBBA 3FROA 1RRGA 4IDBA 3AI1A 3P0FA 3U48A 2QDKA 3LPNA 3PYLA 2MWMA 2PM8A 5BSFA 2FP3A 4OFXA 2FP4A 2I29A 3EMBA 1JZQA 3IDOA 4LCJA 1DG1G 1V6AA 3OJXA 3ORYA 2CXQA 3W1EA 3TB4A 4BTVA 4FVTA 5KYKA 1C9DB 1DFGA 4E5KA 4ON9A 1HE4A 2I99A 1GA4A 3HNOA 3WGTA 2WLTA 5IJ9B 5LQKA 1JQDA 4ZI7B 1GQYA 4G8BA 4OA8A 5C53B 1DPFA 3CURA 4JEMA 2ADOA 3OCYA 5LL6P 3TO5A 3GEIA 1N2IA 4DV4B 4LFAB 1X14A 3W8NA 3GAMA 1TKBA 2C29D 2WWXA 5COBA 4AW9A 4TL9A 5ESDA 3KQLA 4FMPA 2RGWA 4L0DA 2JKYA 2ZYSA 1S3GA 2IXFA 3E7WA 4AXBA 4QUEA 4DUYB 3PX2A 5DNUA 4B1FA 1P5ZB 1QK5A 3QNUA 1SRRA 4PSKA 4Q9HA 1U2GA 1GEGA 4RQAA 1IY9A 2VSNA 4PO8A 1X1RA 3HZZA 4E33A 4F6LA 3O1IC 4HNUA 1Y4DE 4JSRA 5KOYA 2WSYB 1LY1A 5E7IA 3V4OA 5GGXA 2WV7A 3WL7A 4ZCRA 3I3SR 5IJ0A 2ZB8A 3C5VA 3O82A 4GR9A 3AERA 4C5CA 2RKBA 1JBKA 2GXSA 1N0UA 4RTNA 2WMNB 3T41A 1DC6A 2AC4A 2Q6IA 3ZBTA 1E0SA 2XEXA 1XYYA 4UE3S 4FOLA 2VRNA 3DP7A 3R5TA 4UEQA 1CR0A 2P2LA 2YVLA 4QYSA 3EDRA 1QIHA 5H16A 1PRYA 2ZE8A 5DMXA 4F5YA 1RTTA 2FR1A 4Y2JA 1UJCA 3AIMA 4HH3C 5JXHA 4M1WA 3GRAA 3WYFA 1QYVA 2OSBA 2VT7A 1MVLA 1AF7A 1SHTX 3T7IA 4B3GA 2WJIA 1J70A 2QAGC 3VZPA 3BD6A 4PZZA 1T8RA 4WEQA 3UJPA 5AM2A 2PL1A 1FW8A 3PT5A 1Z36A 4QYMA 1NC1A 1JJBA 1CUAA 1XTKA 1R0WA 4YCNA 4BVLA 4RXMA 3L7DA 3GWGA 3OCCA 1YJ8A 2M6KA 3TTSA 4D0RA 1L3BA 3DVLA 4BIIA 4C7KA 1BS2A 2R00C 2ZSKA 2NVOA 1LRJA 3X2SA 1BKYA 1VSQA 1OI7A 3DQZA 1E9FA 2C78A 3ESCA 3G2NA 3KELA 2VATA 3A32A 5BYKA 3I2YX 4AROA 1DRKA 1P1CA 4OAOA 1AS2A 3IIEA 2X6RA 3Q7IA 1HQCA 1HV8A 1K6MA 5JMOA 4PICA 4GKJB 3RG8A 1KMHB 3T5BA 4F8YA 3NVAA 1EGVB 1GLNA 2C9YA 2J45A 2Y0CA 3N9IA 3R0VA 4QYWA 4BPRA 1SK9A 3RS9A 3WYNA 1V43A 3H2KA 1NI4B 4LV5B 3JVIA 1Z38A 1YB7A 2IZ6A 6ADHA 2ZIFA 4KO1S 4DA6A 3FLMA 3T3NA 2GF9A 1NMSA 2AEEA 5GADl 4QTTB 1SBQA 1DDIA 1V95A 2VUIB 1IN7A 3WRYA 1QHHA 3BUSA 4RKFA 3JRWA 4I50A 1G9TA 1HWYA 4OFZA 1EHYA 4XDHA 3ZE6A 4CV3A 1DCTA 4JLOA 5J3JA 4NFSA 2PJRA 1HRDA 3Q6NA 2P8SA 2H16A 1QONA 1KP2A 5DZSA 1YJ5A 2DPXA 4HRYA 1AB6A 1GAJA 3KQMA 3AGPA 4JSYA 1Z39A 2KHZA 4BNWA 4CTJA 1W0CA 2ZS8A 5CAEA 4C7OA 5JRDS 3F9IA 5I51A 1OH5A 2CC2A 2DFKB 4RA9B 4BHTA 2JFXA 2VJYA 2ZZKA 1WCIB 2ZTUA 2QUIA 1R0LA 2D1YA 2XCOA 4HUJA 4G5QA 3UAOA 4EW2A 4F2HA 4RTJA 1LWOA 1UOEA 3COYA 3GYBA 2GK3A 3B3GA 4NHOA 1GNTA 4LOLA 3VKVA 1PV4A 4UREA 3I9KA 3BL6A 2IE0A 5F52A 3Q11A 1PZMA 3DEIA 5HMLA 1QLJA 1JPVA 1EFPB 2Q2QA 2I7CA 2H1SA 5ALNA 4AJ9A 4I1YA 3RKRA 4DL9A 2GAIA 1JQKA 2P75A 5CRIA 1PFKA 5T4EA 4C3UA 5L7WA 1IZZA 3O94A 2PWPA 2D2EA 1FRVA 1NNSA 3UJHA 2AI1A 3M6WA 5I9LA 1M6VA 2LVBA 4YRBA 1V6CA 3OBIA 4CM3A 5HK9A 4FN5A 2ON6A 5IAOA 3CO5A 2C8JA 3V2IA 1LX6A 3JZIA 3K9GA 4ZMRA 1W75A 2AG0A 1J2JA 2A5DA 3I9FA 1OV6A 1KC1A 2IC5A 1FTYA 2NSYA 3EZ7A 3O38A 3JZAA 4CF6A 4KXVA 1CIPA 2BKUA 2XYVA 3BSYA 4A15A 1S96A 1E1MA 2D5IA 4R2IA 1TKRA 4YRGA 1QH9A 4J9VA 1MJNA 3CRW1 3V48A 2NV2B 2OEPA 3DDNA 4J16A 3WGQA 1HT2E 2DH6A 3KPWA 3HU3A 4F56A 4KUEA 2J4FA 1KR2A 1XU7A 4YRJA 3UMGA 4Z7QB 3EFOB 1ISIA 5JS7A 3F9RA 1U5BB 2CVHA 1APBA 4FWBA 3UQYS 1U28C 4XPZA 2UYYA 5EJ4A 3SZMA 3SR0A 3PWTA 4BQRA 3KUCA 5IVKA 3URKA 2PS3A 3K0HA 3E8SA 4CODB 2FSIA 3DOCA 1S01A 4HK4A 2XF8A 2O5EA 1Z7WA 4HDOB 1Z33A 2P2NA 2UYQA 1NX9A 1JDBB 2NZVG 5IDXA 2GZHA 1H6BA 2O2CA 2BTQA 3L7CA 4EHFA 1PT5A 1EFDN 3MOGA 2IHBA 1NOKA 3U4HA 1L7EA 4NCNA 2W4QA 3UMRA 3JRXA 3A36A 3D3WB 5FLYA 1V1JA 2YMPA 4FGZA 5TVKA 2CCGA 3V2HA 2HWKA 1AXEA 4Y6SA 3HB7A 2PXXA 4ZOLB 2JGFA 3D6AA 3DYVA 4P58A 5KAPA 2PMWB 1NNLA 2E4VA 1GCUA 3W4IA 4ZAGA 2ZYHA 2IZ1A 4N5DA 4WK0B 3GLFE 2JCSA 4IVPA 3GLKA 1KIAA 3MMNA 3OQJA 4PZPA 1II0A 5CD9A 1KS9A 2IOFA 1JIIA 1XZKA 3LGAA 1L1QA 2B30A 2FW7A 4GPTA 4I50F 5FYQA 3SC2B 1MNAA 1XTRA 4NMHA 4D1YA 1CS4C 4I2VA 1EK1A 3C3BA 4I8XA 4LVOA 4L0CA 4AJIA 3WLKX 1H1TA 1PJQA 1FTSA 2HC9A 4UMEA 1XK7A 4HWRA 2V6IA 2YJ3A 3ICCA 4YJGA 4Y9UA 3ZGNA 1PJTA 2QN8A 3QLVC 3CRVA 2PT6A 4AU1A 2Q8PA 3OE1A 4HAVA 4N12A 4XM2A 3NDJA 4JXKA 1CUIA 2PLNA 3NP9A 5CNJA 4RE5A 5B4TA 3PQ8A 1KDYA 5TPZD 3FRJA 2BHTA 4IP0A 4OQXA 3FFBA 1L4EA 4DADA 1GAQA 3PL1A 1C8LA 5B58C 2O8BB 3TSWA 1NY6A 3PFHA 4I3FA 1M2OA 5BMVA 4NYIQ 1DAKA 4QT0A 4CHGA 2VQ6A 1VB3A 2QK4A 5FADA 2GHRA 2FUCA 2PLAA 4RORA 4CF7A 4M1KA 3F8SA 5KX5A 4RK5A 2RHLA 5LUAA 1A9SA 2KBFA 3BEOA 4PHHA 4S1OA 3HGQA 4LCEA 4XCVA 5AR1A 4B3DA 2HT1A 4TX1A 2V97A 4UFPA 2YWBA 4QC2A 4IIGA 3ZV6A 2QA5A 4P32A 1XEXB 3I45A 3H83A 4B7XA 5ADHA 4G0YA 5MFZA 1IHYA 4H35A 2DC1A 2L18A 1SOVA 1V39A 3GJYA 1X1EA 3BK2A 3T7JA 4EW6A 1FNDA 2WVAA 1KKLA 3MBOA 3RJZA 5IMSA 1DMSA 4MEBA 4PIMA 2X0JA 1KYIA 4XGKA 3ZLUA 2OCIA 4XE5A 1BKDR 5IVDA 4B8WA 3C48A 4KIUA 5K20A 1VYUA 3OF5A 1VDMA 4U7PB 1AKUA 3IOYA 4UVGA 2L17A 3RYIB 2VYCA 3UNXA 1FFGA 1KR5A 3HB0A 5B3JA 2Q62A 3C70A 1EX6A 3RROA 1EB8A 1YBAA 4IPTA 4XB1A 1D0VA 2CE7A 4PPQA 2CYCA 1KYWA 3IS3A 2UZ4A 1SUFA 2NU7A 1O6ZA 3A05A 1OASA 3N74A 1UWCA 1TAHA 4NARA 4H2DA 2BFNA 1UBMS 4NPHA 3BFXA 3PC8C 2ZPAA 3B7WA 3L7AA 1HK7A 5AW9A 3HKEA 1FYVA 1KQ3A 1OTXA 2RG1A 4LXUA 5COQA 2W2OA 1V1RB 4AKSA 4Q19A 8AT1A 4RM3A 3H4IA 4NQZA 5L7TA 1KVSA 2VNAA 2A9PA 2Y9PB 3EDYA 3I6QA 1Z6XA 2AR0A 4GNKA 4HWPA 4P93A 1EEHA 4DR4B 3KPVA 3ESYA 1K66A 2GO7A 2VDMB 1E9AA 3L1UA 3SOZA 3TRJA 2W11A 3E7PA 3M89A 4I19A 3PGA1 5EIAA 3U09A 1KPHA 3C15C 1RWVA 3NLLA 1HX7A 4L4SA 1JT9A 4J76A 4Y2UA 1H42A 2PJZA 4ZJZA 1M1XB 2XBLA 5AKJA 5JH7B 1UK8A 4ACAA 4I55B 1VP9A 1RZVA 1BJKA 3A04A 4ITVA 4A8TA 2NO4A 1GSHA 3WGMA 1M2EA 4GRIA 1B6TA 3IDSA 3ZQ6A 1K8ZB 4D9NA 3U44B 1LQUA 1QQ5A 4DDWA 4QTZA 4F71A 2XMGA 3PHHA 1V47A 1J6UA 2W2KB 4R7TA 4WNIA 3TIVA 3SFVA 2V5AA 5HUJA 3VNQA 2B9EA 2PZBA 1L7NA 1QRSA 2OLKA 3QX7A 5L3RA 1HXHA 2CN1A 1Z35A 1NKVA 2GRJA 3FYUC 1R1DA 4RAQA 2CMGA 3RLFA 3SR4A 4N7BA 3TI7A 5BMVF 3GRFA 2FYTA 4OBWA 4KFTA 1I94B 3Q5GA 4ZEOA 1NBME 2QGNA 3HBJA 3KR1A 4EKGA 4RPGA 5KX5F 2RHBA 2XSZD 5BSGA 4DCUA 2GN6A 4RY2A 3ZIAD 3NDPA 4U0KA 4UU8A 4A8JA 1J8MF 4Q03A 1AG9A 4D4GA 1PGJA 4EA8A 1KK3A 2EWMA 1HO3A 2P3SA 2E4UA 5MGBA 5JCOC 2HQSA 3R09A 4LV6A 4RV4A 1KY2A 3KXKA 5HTOA 2XVMA 3LY9A 3NI2A 4HWOA 3LDFA 1Z26A 4QQRA 5BQPA 3T8YA 2P9YA 3NCTA 1XMSA 2WG2A 5SY6A 4HGOA 2DMRA 3AJAA 3M33A 1ZD8A 2G9UA 4RD1A 2CLIB 1XTSA 3O73A 1TYZA 1T91A 4PCLA 1I80A 3A9RA 4IF6A 4CI9A 3RSFA 5JD5A 1NRJB 5L4LA 3I58A 4TWZA 4IRMA 2Z1DA 1P0MA 2N46A 3EZ6A 3JR7A 4FSDA 4FHGA 1X1AA 2L82A 5FOWA 2AOUB 3TINA 1ZNQO 1QH8A 2EAUA 4XSGA 3F1LA 2COUA 2BI8A 3R7DA 5EMMA 5UKDA 1TMYA 1QRTA 3R23A 4MV1A 4JLBA 3VVBA 1UMKA 2AXEA 1CF2O 4NV1A 3JD4A 5K4GA 2ZUVA 1AX9A 2FHSA 2H7YA 2RD2A 2Y68A 3BRQA 4HQ6A 3AU9A 2BM9A 3UAVA 2BFBB 5AW6A 4OREX 4FR5A 3KUKA 3FJOA 4WKBA 4YREA 1JJIA 3GX1A 1MB9A 1PJZA 3BT7A 1JGTA 2W6OA 2I4IA 3KYCA 1FXUA 2QZPA 4EQZA 4WASA 4E6EA 1FY2A 1Q1EA 3U4CA 2VJLA 3NOOA 4WLNA 3AKEA 3HL0A 2NSLA 3DA8A 1L3CA 1NXSA 4DFDA 1S4MA 3BHJA 1GPJA 1RKUA 2H4ZA 3AH8A 3LCVB 2UZ3A 4LJ4A 3P19A 1X86B 3W5DA 1LF5A 1XKQA 4LWQA 5EE0A 5EJGA 1NOJA 4WK2B 4X6LA 5G4KB 3VU9A 2H54A 3D8BA 3ZHQA 2Q4TA 1LPBB 2C2ZA 2JB9A 3VKFA 3PUZA 1RQLA 3BRCA 4ZANA 3ZDEA 1LRLA 1RTKA 2GJ8A 4NOKA 4C7XA 4RWEA 4JGIA 2IXEA 2X8JA 4U7DA 4WBSA 3IBTA 1JWLA 1LLQA 2N75A 1DAMA 3V4LA 4KGVA 1AZWA 3AM3A 3RNLA 4LRYA 1RAHA 2C9OA 2FFJA 4OTZA 4CEIB 3F6EX 1K3TA 2FGKA 1AQUA 3ESXA 1UT5A 2UUOA 3FNQA 2XUAA 4C87A 5C46F 1LVGA 5D01A 3TE6A 4DV5B 4ZAFA 1EVZA 3BH7A 3S5JA 1XZ8A 4DAOA 1HDGO 3C87A 1WXFA 1DXQA 3W2GA 4JYCA 2GM5A 4HLDA 1MXFA 1MXHA 3PUKA 2CLEB 1TUBB 4GIBA 1WZUA 1Y7PA 2IZ0A 1CJTC 4JZKA 4HNVA 4PRYA 3AB8A 3GL9A 5F9FA 1D2NA 2H07A 3B70A 1P77A 3GGGA 5FWYB 4X3CA 1FFXB 3NO4A 1O4VA 1LSUA 1Q7GA 3LCRA 4I1IA 1NI5A 1PYGA 3AP3A 1XXHE 2O2XA 4A82A 1WF6A 4F3NA 4M6WB 4B85A 1BVYF 1UBCA 5CX1A 4X6UA 5AIAA 3M3HA 1ESEA 1BN6A 1J5XA 4J0FA 4RJTA 1SCJA 2AYXA 1KH1A 2XWPA 3GMTA 2V7XA 3NIDB 4H18A 4LDRA 5HDBB 5TMBA 4GECA 1MUUA 3Q6MA 1OZ0A 2G4CA 2J3EA 4XYEA 4M0UA 3NOVA 3KYBA 4C9BA 5DBEX 1GYPA 3UKDA 5A9RA 3UBMA 3D8RA 1O95C 3HLYA 2XUFA 3MVEA 5ER6A 5I7AA 3PDIB 2WP0A 1ESCA 3GD7A 3U5TA 4W5RA 2VYNA 4R0MA 3BM5A 5FTMA 4O0LA 4JQYA 5JXJA 2GEFA 3KOYA 4L3OA 5ALTA 1DXOA 4KAXA 3OF2A 3DUFA 4RIHA 4X1KB 3RUFA 2HSEA 5JC8A 2BYTA 1DTWA 1JVNA 3QV1A 3I4LA 3VJLA 5EJ5A 1C41A 2FSGA 1HKHA 2FQYA 3GCGA 4LNAA 3VR0A 4BBPA 4DA7A 5AIBA 1H6AA 4PNEA 4EBBA 1E4EA 4P0QB 1GQFA 5D00A 4KBFA 2NN3C 3PS9A 3GH3A 5EE1A 1ZJ4A 1VMEA 4TL8A 3TTWA 4PLWA 4BWGA 4CRWB 1KK1A 1JP7A 1G3UA 1UR5A 4A5OA 2QLJA 3MGGA 1KE1A 3D0OA 2C4HA 2F1IA 2XNJA 2J9YB 3QEMB 1BE0A 3NT2A 3GJ0A 4X6YA 3VNRA 2GUWA 5LPNA 2V8OA 1GZ5A 3AQIA 5F3RA 5FBKA 5AW4A 3UUFA 4EY5A 2VA8A 1DV2A 2YWXA 1F4LA 3MERA 3AUJB 4K9NA 4MO2A 1D5CA 2QR2A 1XCJA 3UW3A 2XWSA 1ZVQA 1NMQA 2EZ8A 1E92A 3LBIA 4XCXA 1VDZA 3U0BA 5I47A 1Z5PA 2ZUTA 1ECGA 3FDXA 3OF3A 4EEKA 4CMKA 4XTCS 1SVKA 3C8DA 4DUGD 4BO5A 1LI4A 4NK5A 4KXYA 3TZQA 4RQUA 2WRZA 1XLWA 4RGQA 3B38A 4ZU3A 2BISA 3E9NA 2WAAA 4I1UA 2R0QC 3H5NA 1VE5A 5E4JA 1D5WA 1UJ6A 1OR8A 1UWVA 2ZIXA 4NBNA 2QLBA 1KETA 1HLPA 4MQMA 1QU3A 1OLXB 1KFCB 4MI9A 1NR1A 1R4NB 1SUBA 3KPUA 3TQFA 3EBOA 5ITZB 2KPOA 5D6OA 3T9FA 4DQUA 2VDWB 3IMEA 1IU9A 3GRZA 1XROA 1L5RA 2MOKA 1AN9A 3O31A 4GE3A 4YP5A 2J3QA 3ZE2B 5F1YA 5FWXB 2ZBVA 4YAFA 4RNDB 3CW8X 5A62A 2PUVA 1OFHA 2ZVDA 2XMPA 2FEXA 2PXCA 5IBQA 1EWVA 1SG6A 2I2DA 2X1MA 2I4OA 3K73O 1YUMA 3L4SO 3O75A 4QGGA 2AOWA 5FF9A 4A2QA 2CB9A 2G70A 2CCJA 3OZWA 3VYUB 1P0CA 1FP1D 1QVZA 3VVCA 1QCDA 4DA4A 1PR3A 2IPMA 1YDEA 2OORA 4L8WB 3ZQ4A 2X9NA 2XA2A 1SVUA 2NSHA 2OXFA 2R11A 1BXZA 1QFJA 4DRYA 5KNDD 4Q1AA 1PZFA 4MUBA 5HQ3A 2CHGA 1JLMA 4IQ4A 1P5HA 2DOKA 3GF4A 3K32A 4PYRA 3SN6A 2NPIA 1YR2A 3LQQA 3O8DA 2B20A 1XRMA 3UGTA 4M1OA 4NCKA 1RLJA 3UB2A 4AZSA 1EFTA 1I4WA 2WWIA 4HFJA 4XCQA 3DKKA 5FUYA 2G5GX 1VLLA 4DB2A 3ZGOA 5AKGA 2IEDA 5HIJA 4BZZA 1P1HA 4LY9A 4N49A 2C5SA 4FQ7A 1XQ6A 4IY1A 1CUWA 1F17A 2QTMA 2ZUWA 3M0EA 4IOJA 4LHYA 5JADA 3G68A 2WC1A 1M6HA 1NFFA 2HXSA 3T3HA 3UFBA 3RFTA 3D4IA 1SXJB 4Q15A 3THYA 2LV8A 1I24A 2PCJA 3C2QA 4DSOA 5KYVA 2G1KA 2XXJA 3WZMA 1QWOA 3QFFA 4GI3A 5B1EA 1XI2A 2XJ9A 2O48X 3AB3A 2GEUA 3S2SA 2BGKA 3OWOA 5LM3A 4TSFD 4NU0A 5JUWA 3G59A 1AUVA 3KHUA 5EHZA 1JHZA 3BIJA 4HAXA 3H8WA 1WB9A 4L4UA 3WL6A 1RZ3A 1VRWA 2F9MA 2GKOA 2XB9A 4HX9A 4YS6A 1O97C 1ONOA 2CJFA 2FZ5A 3F5FA 2PO5A 2YIJA 3O1HB 3GI1A 4O4LB 4WD3A 4Q7EA 4YDHB 4MUMA 3RBVA 1NA5A 3A6LA 3P9CA 1J99A 2RH4A 1FPQA 4HGQA 4DV6B 4U9HS 4QYIB 1PNQA 4MR8A 5DHTA 5F78A 2H31A 3VV3A 4Q1EA 4A03A 1KO1A 3ZZMA 5A6VA 4PG4A 4MRNA 1ORVA 2P4HX 3SYTA 5JAIA 4GX1A 2GVZC 2B5VA 5BSHA 2X4IA 4KZPA 2XE8A 3Q87B 3OA0A 4J2OA 3WNDA 1XNRB 4LVUA 1FA9A 1QFZA 3ZV5A 2IXGA 3NRCA 1SVMA 2KWIA 4HGZA 4IILA 1PSDA 3BBLA 4I46A 1U1DA 4NCXA 4U6NA 4CPDA 3NVMB 4QM7A 1IM2A 3A3YA 4TQAA 5HP4A 5JZMA 3ZWKA 1Z9BA 1L8OA 1XEAA 3GLHA 5CX4A 1Q0ZA 2D5LA 3AOGA 1SKAA 3ECSA 2Y4NA 2FPMA 4RJ2A 1SXQA 5CD1A 4CUKA 4NCJA 4TQUS 3OZ7A 4M55A 1NVBA 1IYZA 1N2CE 1GO2A 3AL2A 1QFMA 3HCNA 2K5UA 3R3HA 1RBYA 2C4KA 4Z54A 2HRCA 3MWDB 1K6XA 4R6WA 4ZZ2A 3VHQA 3OH8A 3JYPA 1VYVA 2R47A 4Q3OA 3A1EA 2EP7A 2IEZA 4CBVA 1KH3A 2DFVA 1QVVA 5DI9A 3GJXC 3LQ1A 2OBXA 1TMGE 1KFEB 1ZISA 1YI1A 3HY4A 4BFVA 3K4HA 4AJ2A 5BO5A 2ZJ8A 2ZJ1A 1S6YA 1WZIA 1JN0A 1VKHA 2BEWB 2I2FA 2X40A 2P4EA 2YHIA 4MW1A 4Q9AA 5EINA 3ZQUA 3WADA 3BA1A 3PVZA 1JDJA 2H1RA 5JSUA 4XFJA 3TW8B 1G5TA 2ZB3A 5IM4A 2BV3A 4EB3A 1YBMA 3CPJB 3BDAA 4FFOA 5REQB 5FPHA 3P0IA 4AJEA 2J41A 3FE2A 5CG2A 5TB5A 2OTCA 2CF6A 4WCVA 3UTDA 4A1OA 4BV2A 4DBZA 5JJKA 2Q41A 1LJLA 1LPMA 1YBHA 3IMCA 1UJ5A 1USVA 4UM5A 2H2GA 2I4LA 4CG2A 1WXDA 3IMFA 1QCZA 2Q3MA 3QELA 4FNMA 4H4CA 4IG9A 4XD7A 4AY5A 4D9FA 3K6SB 4I9NA 2C9CA 1U9IC 5B1DA 1E3SA 1C7IA 2FPOA 2HT6A 2Q6LA 4K0RA 3HDGA 5A1TA 4MS3A 3C7CB 3QUQA 2LW7A 3I6MA 3HXKA 3TLCA 3I0NA 4R31A 3ZN2A 5CU7A 1OLSA 4AK9A 3BJZA 5HF9A 3RGWS 4WZBE 2BRUC 1ESMA 4A1FA 5I4KA 2ATCA 1GQRA 1C8VB 3U3MA 3L8FA 3ESRA 1HDZA 1QTIA 4DNFA 5LP6B 1Q83A 3CVWA 3BXXA 3HDVA 4RD0A 2O5RA 2HOQA 5E3IA 2XD9A 4U2KA 1WKBA 1NRWA 4MVWA 5K3BA 1IMOA 1R66A 4TZKA 2JI8A 1TRKA 1N1MA 4OKSA 3FWYA 1Q7RA 1YZUA 2OV2A 3GOHA 2QMEA 1LRKA 3ZKAA 2ADMA 1Q95A 2IJGX 1SXHA 1IFXA 3QXSA 5DI3A 3UW1A 3X2FA 1QPBA 4BFWA 2CJYA 3FR8A 1HEUA 2K2QB 1J8YF 1U1IA 3HO8A 5KVQA 1BCSA 3X44A 1RT9A 2VUUA 3WYAA 2IX3A 1FBTA 2MYNA 1IN5A 5IEBA 2A0XA 4CCYA 5GIPE 2GEBA 1ZN9A 3HCDA 3DFIA 3NGXA 3VDQA 2O5CA 4BNXA 4EDFA 5JO0A 3QU2A 3RTDA 2V65A 2QU8A 2AH5A 1R50A 2ZRLA 1W0KA 3KD2A 3PTZA 4KMSA 4NDNE 4AURA 1ZH0A 4BRUA 3P4XA 3FY4A 1IXSB 1UT6A 4D26A 2D59A 4B7ZA 4C0BA 5JZOA 1C1HA 1D2EA 2EX0A 4PPNA 4IIBA 5BYAA 2W2PA 4WXRA 4JVSB 1ABEA 4DLNA 3D3EA 2PRJA 2NXWA 2YXBA 2B1GA 1JEYA 1F9AA 3QK7A 2LXNA 1ZGBA 3R6DA 4HPXB 4YQYA 4B5LA 2XTZA 1TGYA 3W6UA 3NQ41 1VMDA 1ZVMA 5J2UB 3UUEA 1POWA 1P29A 4IWXA 3LW8A 3TRHA 1RFGE 3DFZA 3SXJA 4ZCTA 3FIJA 2EW2A 1C0PA 1BX0A 2Y1XA 5FT9A 1N8SA 2V7QA 3ZLTA 4NFYA 5HX7A 5BQ5A 5A06A 5AVQA 1GU7A 1D1QA 1EVJA 1XTPA 4K6GA 1Y4SA 1Z8HA 2AMFA 4G25A 2UVPB 4EMUA 4E2WA 2B8EA 1M73E 1Y6GA 3PWZA 4YDRA 4QBGB 5KHLB 2HWWA 4TKVA 1CFZA 2HMTA 1DBSA 1RKBA 1N7GA 3G9ZA 4JUAA 5IM4F 1V8DA 4I1OA 1N5LA 3HS3A 3UKOA 4N5LA 1MENA 4GKBA 3DULA 5EKDA 4C0QC 4F9EA 4OSPA 4EFNA 1FQWA 5L3SA 4TLCA 3QHQA 1PQ4A 1PBNA 1CPYA 4P4SA 5BV7A 3UC9A 3ROZA 4R9NA 5KPDA 1TQ8A 4YACA 1NBEA 4D8YA 4DNPA 3TIGA 5AVTA 3WK6A 1NKSA 1F5NA 2D4HA 2R1VB 3K1JA 5SZKB 3EIUA 3NAGA 2WV9A 4KJZA 1N7HA 2ZIEA 4A23A 1A3CA 4OY3A 4S12A 4LF4B 4NJEB 1WQ4A 4PW0A 3WY9A 3ELDA 1JNYA 1G5PA 2N3ZA 4G1MB 4GYYA 4MULA 4QSMA 4D5EA 2PUEA 3ON5A 4L7VA 3ZDZB 4DYVA 4G1VA 4YRPA 3DCNA 3FTNA 5IH7A 3TTYA 2EKZA 2B3TA 4J29A 3ZD8A 3N2GA 3WV5A 2JAXA 4S1PA 2EC5A 2BDUA 4D9IA 2ZR8A 4IHAA 5FL3A 4B2LA 4H3VA 5H8WA 3FYCA 1TCBA 4R8LA 4X1YA 1BJTA 4NLLA 4ZKEA 1WM1A 2ZSEA 1A1VA 1K9SA 1PJ2A 2E21A 4ERNA 1YZNA 3UH1A 1Q50A 1SIWA 3G2JA 2EWVA 2XH8A 1UJ2A 1RU3A 2G36A 2X0FA 5JFOA 1S5PA 4PBRA 2AFRA 1MOSA 5JMWA 3FCCA 2EVWX 3U19A 1B41A 3V3TA 2OYCA 4HVLA 1SEPA 1T2DA 5D87A 4GFDA 2W00A 4MWCA 2O2GA 5AOAA 3TW6A 2RGEA 3IMGA 4QBHA 5TS2A 2HA3A 3FPHA 5KVAA 2HJVA 3ZXYA 5LR6A 3NUZA 1CWUA 1LLCA 3WGJA 4BCDA 3LC1O 1RVDA 4IGFA 3G5MA 1CIJA 2QF7A 4LS3A 4QDTA 1DBIA 2NUPB 1BX3A 3ZZTA 1JDBC 1SUEA 2BGIA 3SZLA 1E5VA 3PP8A 1U0BB 1VLHA 2ZYRA 3SK0A 4YA6A 4ANFA 2H00A 5A4KA 5IT9A 1U6KA 2DPGA 5JARA 3B3AA 3WBBA 2YCLA 3VC3A 5BN3A 1P4RA 2Y1CA 1W36B 3L6DA 3O21A 3FVTA 1Q74A 4GVXA 1UZMA 3QKRA 4WT7A 4BO7A 1OYVA 4MV6A 3D0KA 3VPDA 4J43A 3RV3A 1JEDA 1JQEA 1XZCA 2G63A 3OAAA 4LA4A 3KEMA 3OOYA 4CQMB 1OB5A 1DHRA 2F43A 2XQVA 4XB2A 4JVOA 4F38A 3TIFA 1DIRA 1X39A 1E20A 3NB0A 1SB9A 4MVCA 1XZDA 1G8JA 2HBZA 2ZJOA 3I9JA 3NUGA 4RYDA 3LNTA 4BUZA 4WOCA 3ZJVA 4IQ0A 2VWQA 4INOA 4BX3A 1YK1A 3MJDA 2DTXA 3HI6A 5FJIA 3RBXA 1KVTA 3KOUA 5IZCC 2AFHE 2PGJA 5JAHA 2NQ2C 4OSEA 1H8HD 1SCIA 4FFVA 2HRQA 5IAEA 1USKA 1V25A 4CQLB 5BSRA 5FTJA 2ZIVB 3OZIA 1TJPB 5K7SA 4A9AA 3K53A 3QE2A 1CKEA 2XQKA 5A05A 1A5TA 4C0HA 1GZ3A 4KW7A 4YAJA 5FYDA 3H5AA 4QKQA 3VZSA 1QYIA 1T1GA 5IHXA 1JVBA 3E2PA 1EVYA 2IYRA 2N47A 1OXVA 1IY0A 1R00A 3EGWA 4QU5A 2AFIE 4D3ZA 5HOEA 2GN1A 1SIUA 3U60B 1Y9ZA 2VK4A 2UYOA 3H8VA 3NHBA 1ZGGA 3QKWA 4ETNA 2MT9A 4GI5A 4OXNA 5DCUA 1CUBA 3ND6A 3KCNA 3AEXA 5KSPA 2I4NA 1SUWA 2RHHA 5K8JB 3GP3A 2PK3A 2Z58A 4LZLA 3RWMB 1Y5RA 1OFVA 1U04A 4YAWA 4ZP1A 3WOVA 4MGZR 1T0UA 1GPBA 2VHYA 3EN0A 3OQMA 3MJEA 1RXUA 4CIAA 2SKDA 3LC0A 1FX0A 4KO2S 4NONA 5EWLB 3ZX4A 3EHEA 1QTQA 1NQOA 4B3RB 1MA0A 1GXSB 5JHHB 2ZXEA 3RT1A 2IP1A 2ZWVA 4PO1A 4EOGA 5AVYA 1B0UA 1M2GA 1YR7A 3IAM1 4LGCA 2F8MA 1XC7A 3LRXA 2YN4A 3RYTC 3DMDA 4BZPA 1Z7GA 2O52A 3SQXA 1QH1A 1XCBA 1U1FA 4XPIB 2I65A 4FCVA 1WSAA 1GPWB 1W1IA 5BPHA 1GPKA 3UEOA 1ORWA 3CCCA 3ZGVA 1UJBA 1N1DA 1UBJS 5ALWA 2O7NA 2QLNA 1D2HA 4HS4A 4J1TC 3IRUA 1C4WA 4G0MA 1HOXA 4FCCA 4ZFNA 2ZM5A 2NZYA 1KI1A 4DF3A 5BOSB 2V58A 1GITA 2YZNA 4DLXA 4YT8A 3ZCVA 1Z15A 2C8VA 4F12A 5K8UA 2AZTA 4GP6A 4Q21A 4DZZA 5J2TB 9LDTA 4PAOA 1P17A 2CCKA 3H3FA 3GXOA 4PG5A 4PZ0A 4V0QA 5AW7A 2ZU0C 1T5OA 2ZBQA 2VAXA 3S2EA 2WWHA 4MKFA 5P8WA 4XASA 3TMYA 2EF1A 4FNOA 3RSCA 3O8OB 3RSOA 3A4VA 3VC2A 1GZDA 3SYMA 2BCEA 1E69A 4G5FA 4L15A 3RS2A 1MTZA 1W4CA 3KQTA 3JAWA 4ESHA 1I2MA 3V42A 3ROTA 1H3EA 1HTWA 4LSWA 2NVWA 4JCOA 3BBPA 2QT9A 4QATA 3RC7A 3RYFB 4LJRA 1CY6A 1DMRA 2QVZX 1C0IA 5LYJA 1PWEA 3GJ7A 2GPTA 2R9VA 3K6JA 5DBIA 5KVVA 4DR3B 4LDJA 3ZK9A 1FVFA 4QLBA 4CKBB 2D5CA 4QSHA 3A11A 3NJRA 5SV2A 3B9RA 1W5TA 3RC3A 1OAOA 5BRAA 1XA0A 4UNSA 4CIYA 3R20A 2FPXA 1JAHA 2D2FA 4HDNB 1HDOA 1AZLA 1G3RA 1RBQA 3ODGA 4ZYYA 2WUDA 1C3XA 1H66A 2E48A 1P9RA 2ZYIA 4OHFA 5TMEA 2PX6A 1BCRB 2BSQA 1N2GA 2IV2X 1M2FA 1LDMA 5F5NA 4ZC8A 1TMOA 4RVHA 4KI7A 3RCBA 2YC2C 1UMCB 4U8GA 1IWPB 1TD9A 2RBEA 5DTMA 1RLOA 4CU2A 1JTEA 3W2EA 5LWHA 3U4QB 4BO2A 1LFAA 1N8KA 3OIVA 5AXBA 1M6WA 1LDGA 3VYSB 1XR3A 3BTSA 3W3ZB 5CFLA 3TSAA 1AHPA 3DLTA 5IF9A 4ZXPA 2QVGA 2ATXA 2HIHA 4IBOA 1HETA 2O2HA 4FYMA 2UUBB 1JG1A 2PKRA 3GUUA 3MG9A 3O3NB 5CNMA 1L4BA 4FDMA 5EGSA 6GPBA 3LUGA 4X61A 1PL7A 5FFFA 3GFVA 3LCUA 4HVTA 5L3QB 4JC0A 5MF6A 4II3A 3PUJA 3BC1A 3JQ9A 3DONA 3G1WA 1VG1A 3VI3B 4EJFA 4N6OA 2J5KA 1AS3A 1N6IA 1JDNA 3GVPA 4PQGA 4FUTA 2BTEA 3OZDA 4Z4CA 2BF4A 5DP2A 3VMMA 4HGRA 1A9TA 2YJTD 3N0TA 5KREA 2ZK7A 1TIBA 3HUTA 3UV3A 5TX7A 4EO9A 1GL9B 1KTIA 1ZP6A 4JOQA 3OU7A 2NZ8A 1NYRA 1NUUA 2DTEA 2GZSA 3U7IA 1FUEA 4NC9A 4TV9B 4G8JA 5IABA 3LIIA 3VZBA 3C3MA 3IEKA 3IVAA 2NGRA 3KQPA 3STUA 4DTIA 1YDGA 4FXPA 3ZGYA 2JGMA 4J0CA 1UZLA 5I9SA 3Q3HA 2CHFA 1NVEA 1Z2EA 1V1MA 4M38A 4F45A 1IXYA 3A26A 4KKXB 2I54A 4M0EA 1SQGA 1GLVA 1C2YA 1ZUHA 3EA4A 4MJXA 5K0TA 3GAFA 2ZITA 3IAFA 5GY7A 2BKEA 1ZONA 3ND7A 5TT0A 3ZJ4A 5ADUS 3G13A 2ZZMA 4ZVSA 2G80A 2XT6A 3Q8LA 4NYMQ 5DPMA 1D04A 5T5QA 1Y1QA 4Y2HA 2J0SA 1GFWA 3HTXA 3S1AB 4BGUA 3DLHA 2ZRBA 2EFEB 5ALRA 1RJ9A 4EDHA 2DP4E 1CNEA 1L8AA 3RSGA 5L95A 3PLAE 2BAGA 1XJ5A 1P5FA 3EASA 4PC2A 2V7EA 3DXXA 4AJKA 2C7BA 5GOTA 2C2WA 5LYJF 5GQSA 1DOHA 1LW7A 4OFBA 4GOXA 2PH1A 1I1HA 3N7UA 5FOVA 3FZQA 1M9NA 1XJ0A 5FLKA 5JNTA 3FPCA 4JI5B 4X6XA 3SCZA 1JKFA 3HWWA 2HW8A 3DXYA 3LDHA 1AURA 4JHLA 2YV1A 4F2GA 1I6MA 4O3MA 1YQXA 2QUAA 4BMZA 4RL4A 2J67A 4JT4A 1QGED 1NXOA 4PBSA 3KZ1E 2OPBA 1QYWA 4EX7A 2AIRA 2CXOA 1DAOA 3BMCA 2IY9A 1OVGA 1QHGA 4ISBA 1PQUA 4BBAA 5DSTA 3CRZA 1ADCA 3DKRA 3OM9A 1FFAA 5H9VA 4WBXC 2A35A 5BY2A 3B6IA 3HXLA 2EWWA 1CP2A 2XKKA 4ZJYA 1PG2A 4MP3A 4IIUA 3CSSA 1LVUA 4MB2A 4UBNA 1CETA 1XRQA 4DUPA 2C61A 2A0WA 4BV3A 1T2CA 1NC3A 3G9QA 4AF7A 4S1NA 3C6QA 3MTJA 2H9IA 3T3EA 3KZXA 2WD7A 4MR9B 3HKDB 2P6RA 4V02A 2QRNA 3MJRA 3R5KA 1VLVA 4GI7A 5K0GA 4NNOA 1ZI8A 1YIOA 1EJ2A 2J9FA 4C7VA 3DDCA 1NDHA 5TJ9A 2FFRA 4QEZA 4UXIA 4MPDA 3ZCTA 3PFGA 2XQGA 4K28A 3OFSA 3AESA 1CZOA 1P7CA 2XV1A 3F7MA 4MHOA 4C7BA 4URXR 1IJEA 1DDGA 3ITEA 1E3WA 4UBIA 3FPGA 1KQFA 1CYDA 1S3FA 3B5IA 1MZVA 3KKZA 3Q4GA 3UJ7A 5TPWB 1F3LA 5IANA 4UHBA 4BYMA 1F0YA 4BO8A 1TA0A 3LOUA 1GZ4A 4JV5B 1F8FA 4X00A 4A2PA 3ZBUA 4MTCA 2IKSA 4M83A 5LZ8A 2VUSA 5GZ1A 2PZJA 5IAJA 4KHPB 3CZRA 2P3OA 4YFVA 4AJPA 4GLJA 4JJKA 5A0VA 2UVQA 2B0CA 2XEDA 3VR6H 4C08A 5LB2A 4FOPA 4AO6A 4I08A 1MB4A 5HS6A 4OHCA 3V2UA 1WBDA 4K3UA 1XO1A 1QQTA 2D0OB 1YR6A 3BQMB 1KEWA 2ZWMA 4ENVA 1SU8A 3B3QA 3IE2A 3SLGA 1BSVA 2P2DA 1CVRA 1YTLA 1VA4A 5LLSA 1KOLA 4BATA 2OAQ1 1FOEB 3DEHA 5CPBA 3ADOA 3WFZA 4TVBA 3RAJA 3DW1X 5E1DA 3EQ6A 4PE5B 1UJMA 3OZFA 4RHYA 3NWPA 4UBLA 4BKMA 4DY4A 4O4IA 3L0PA 5DO9A 2OHJA 4K8OA 4XWWA 1EFLA 2IYYA 2CT8A 1F8XA 2AMVA 1UC8A 1NNUA 1ABBA 5DLDA 2VYND 2ZRJA 1GPAA 5FQNA 3L4JA 3N70A 2I87A 1OAKA 5H4GA 3GLIB 2QGZA 2ZBGA 4PSUA 5E9AA 3TBKA 1XZJA 1W47A 1NJFA 1A88A 1SAYA 5KSZA 2CXSA 1C1DA 1TNDA 3BWEA 4YVFA 1I8TA 4R7ZA 5IUJC 3NBXX 4WXHA 4QUIA 4PX5A 1EVEA 2CNBA 3UGJA 1C1XA 4JEHA 2DPYA 4LMAA 3NGLA 2XBMA 2Y1KA 4N1AA 3EW7A 1QRRA 2FZWA 2W5UA 2VBCA 3HUUA 3I2JA 3NKVA 4I5EA 4HXFB 5DV9A 3RQSA 2HM7A 2IGTA 3DBRA 4M98A 4TYNA 1JEJA 3I1IA 1T5IA 2I2BA 3R0XA 5K3DA 1L6IA 3Q7EA 2P69A 1NJ6A 1DGQA 3LL7A 1VKJA 3DTTA 3K5PA 4NQRA 3NV9A 2B4YA 3NBKA 4WNCA 5LZ4A 1N7JA 4NEHB 4B6RA 1AA6A 1JSLA 3DC2A 4C7OB 1HE2A 2ZYVX 4L8GA 3KVOA 3C7DB 3AFNA 3K0SA 1JBEA 1TYAE 4P7KA 2OM2A 3ABIA 2J6CA 1FP2A 5FRDA 4LE2A 3I62A 5BWOA 2JFHA 1N25A 3MJTA 4OXKA 1IQPA 1N6HA 3M5WA 3F98A 4MYRA 1VPTA 3SS7X 4BWVA 3IUMA 5LXTA 4AQ7A 1Y7LA 2HREA 3ODPA 1FDVA 2BHSA 2Z3WA 4G0NA 4JLDA 3U6KA 1I6LA 2RGRA 2PWBA 4EGFA 2UUCB 2FMUA 1C7JA 2H1IA 4MCHA 4Q4HB 5BW6B 1BFKA 4HATA 3LV8A 3UF0A 2GB4A 4XX1A 3WYBA 2XY4A 4NZZA 2PCLA 3U80A 4LJ8A 3ERCA 1HE3A 1YWGO 2ZTHA 3AEQB 3BFPA 3IDZA 1E8NA 4HN9A 2QI9C 4FFLA 3WNVA 4KRFA 2D7JA 4CV0A 1F0KA 2LCQA 3V4RA 3GGCA 4HQOA 2GZ3A 4AY2A 4LHEA 4ZDWA 1SUPA 3JV7A 4OGFA 1QAOA 2IPAB 3K9WA 1SZJG 2XVAA 3L06A 1T0PA 3OM0A 3SAJA 2XZTA 1J97A 4JQCA 4JJ6A 1RBZA 4HJRA 3O95A 2Z09A 1N5MA 4HKTA 2YWRA 1NZJA 3SMQA 3RAEC 1UQUA 3ZC3A 2B8JA 4GYKA