4QE3A

Crystal structure of antigen 85c-h260q mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
277
structure length
267
Chain Sequence
LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTQSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
total genus 105
structure length 267
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qe3A00
4FBLA 4YASA 5A2GA 4BP9A 5CRIA 4TVKA 4XJVA 3I6YA 5AJHA 3ANSA 4M0EA 3R0VA 2XUFA 4GBGA 4LKOA 1B41A 3C43A 1AQLA 5AK5A 1QFSA 3JW8A 4WFKA 4BCDA 1GPNA 1ZD3A 4N5HX 2G63A 1P0MA 5DYWA 2BKLA 3G0CA 4G8CA 1HQDA 2H7CA 4Q82A 4ZV7A 1QIFA 4LXHA 3VJKA 5DLPA 4AZ0A 1DT3A 4ZXFA 4UHFA 1SFRA 4C87A 1SOMA 4P92A 2XLBA 5JAOA 3KDAA 5BWBA 3L1HA 4JYMA 4HZGA 1UT6A 1CUGA 4NMWA 1W6RA 1K5PA 1MU0A 3M3DA 1NU6A 1ZD2P 4B9EA 4U2EA 2X8BA 2OCIA 3AJAA 3UUFA 3PUIA 1GKKA 1ZJ5A 1XQWA 4BAZA 2XUPA 3WYNA 2JF0A 1GXSA 4ROTA 4QA9A 4EHBA 3VVLA 3D3NA 3VVMA 2YH2A 4X95A 3EQ8A 5HQ3B 4G4GA 2HRQA 4HVTA 2YXPX 3FYUB 4WDQA 6YASA 3QPCA 2DSNA 4XWGA 3DD5A 5D6OA 5A62A 4RPCA 2JEYA 2WHPA 3CN7A 5CTAA 4KE9A 5LIPA 2LIPA 4GEGA 2BGRA 4MYDA 5CBKA 3B12A 4PV7A 3VJMA 1AGYA 5CT4A 1XFDA 2OGSA 3X3HA 2WSLA 1XZIA 1QTRA 3FLBA 1ZOIA 4KAAA 1K8QA 2WUEA 1UK6A 1JFRA 3ED1A 2Y6UA 1AKNA 2RONA 4X7BA 4O08A 1RP1A 3DOHA 5AM2A 3A2MA 5DTIA 3BDVA 1J06A 7YASA 2CZQA 5ALUA 4UFPA 4BDTA 3OURA 1MJ5A 3V1MA 5AKGA 3AIKA 4CG3A 5I8PA 2HL6A 5AKHA 4BVLA 4H7HA 2WG0A 3H2JA 4BE4A 3KXPA 1Y37A 3U0VA 4Y2QA 4FFVA 1QLWA 5BV7A 3QYJA 5FUMA 5JIBA 4RE6A 1H2XA 5HK8A 5ALNA 5AH0A 3HXKA 1E89A 4BDSA 4QLAA 1HKHA 1XZEA 2VJBA 5K3FB 3O9MA 1ZICA 1XKLA 3R3VA 1MTZA 5CW2A 1A8SA 2Y6VA 1BE0A 1UOPA 3K9BA 1MO2A 4HRXA 1Q0RA 5AI6A 3HABA 5ALJA 2JGLA 2RIPA 4B81A 1EK2A 4ZWNA 4OPMA 4AB1A 5AKKA 2ROQA 2EEPA 2WG1A 4AXBA 4EY4A 1QIMA 2ZSHA 4MWTA 1E5TA 4LYEA 3DDUA 2QXTA 5AOBA 4OD0A 3AUKA 4HXGA 1DQYA 1QGED 1EDBA 3KSRA 1THGA 2DHDA 2WIGA 1DX6A 5EHXA 3H19A 5JD5A 4CCYB 5FXMA 3WK4A 1ZGCA 2RHTA 5HFAA 3T52A 4X94A 1R1DA 5LLSA 4P93A 5AI5A 4P9NA 1GQSA 5DWDA 1JU4A 4Q1VA 5FDFA 4GLBA 1GT6A 2G5PA 5FP0A 3C70A 2OPHA 2GBGA 3ZLVA 5CT6A 3FCXA 2X76A 4KEAA 2BFNA 2VQ6A 3ICVA 5AM0A 5ALHA 1CUWA 1G5FA 1Y7IA 2WTMA 1YASA 4J0DA 2PSHA 3KOOA 4U2FA 1F0PA 2HADA 4X92A 4E11A 4J0HA 3H18A 4NZZA 3R3UA 4HS9A 3LS2A 4DLNA 2ZSIA 5K3FA 2QTBA 2X5XA 4GXNA 1LPSA 5JANA 2DHCA 4BE9A 3HACA 2XI4A 1WHSA 1ZJ4A 3TRDA 4ETWA 1XROA 3AINA 4FNMA 1Q83A 4OU4A 3IUQA 3R3XA 5ALZA 5E2IA 1FJ2A 3FVRA 3G8YA 2H1IA 4IH9A 4DM7A 4HXFB 3N0TA 4J0JA 5JZSA 3D5EA 5T4EA 1WPRA 1GPKA 2VEOA 2CJPA 5FPQA 2Q0XA 2BUCA 1P0IA 2OLEA 3JWEA 3R3YA 4ZREA 3VKFA 3MUOA 3D4LA 1UZAA 3WL5A 2ZVDA 1XZBA 3DOIA 4AO8A 3C6YA 5K3EA 3HJUA 3S8YA 2BUBA 1C7IA 1W1IA 5AM4A 3H2KA 3WL6A 1TCCA 1OILA 2XE4A 4PO3X 1CUBA 4F21A 3WA7A 1Z68A 4P08A 4B9AA 2QVBA 1MX1A 4PF1A 2OAEA 4X90A 1VJ5A 1HDEA 1Q84A 1EHYA 3G9XA 4HTAA 5FPPA 5E4JA 5DNUA 4D9JA 4AMYA 3A70A 4FLFA 4MWSA 1I6WA 1VXRA 1LBSA 2PL5A 4W1QA 3FYUA 5EGNA 2QJRA 4LXIA 1O6FA 4AO6A 1LPMA 5CH3A 3F96A 3MVEA 4EY7A 2IIVA 1JMYA 2QMQA 3FBWA 2DQZA 2CUTA 2VT7A 3BE8A 4G1FA 4G4JA 5HF5A 2OQVA 4K2AA 3WMRA 1L7AA 3PF9A 3WKAA 5I7UA 4HAIA 1MAAA 3IUMA 3E0XA 1VA4A 4DMHA 2Z3WA 2J3QA 3OOSA 3FSGD 4QDXA 3I1IA 1CEXA 4FNGA 4OCZA 1WOMA 1BN7A 3M83A 4WDRA 4MEAA 4KRXA 2VAXA 1HBJA 3HC7A 5FLKA 1YSCA 1E8NA 2CEKA 4N8DA 1QZ3A 3BL8A 3W9BA 3BXPA 3DYVA 3PICA 4QDZA 2XUHA 3I1YA 4QDOA 4IHAA 1LLFA 3DEAA 3VDXA 3C87A 2Z8ZA 4UHCA 1H23A 5A7GA 1BEEA 5BOVA 3AIOA 3RK4A 2XB6A 4L9AA 1AURA 2Z3ZA 1TIBA 1MNAA 2WTNA 1XZFA 1R88A 3WKEA 3CXUA 2ZJFA 3W05A 5K3BA 1LZLA 3E4DA 1DX4A 1XQXA 3QPAA 3G9UA 1XZAA 1E8DA 1O6GA 5DYYA 5ALVA 4MQLA 5FRDA 2ACEA 3WA6A 1PJAA 4H77A 1XRPA 5BWCA 2HU8A 4BRSA 2PU5A 2QKYA 5EHNA 4DMFA 1JKMA 3V1LA 5A6VA 4LXGA 3W06A 4BB0A 3I6MA 1FFEA 3HYSA 1EX9A 5A71A 1WB5A 4WY8A 1C4XA 1JI3A 1WPXA 4PSUA 5AKLA 1BU8A 4B6GA 2XUAA 3IDAA 4E14A 1DU4A 1XZJA 3T4UA 5JYCA 4OU5A 3H1BA 4B80A 4H7IA 2O2GA 4N8SA 4BZZA 1JJIA 1R9MA 1QTIA 4B83A 3HRHA 1A88A 3DJYA 5JATA 1E3QA 2QXUA 5JALA 1XZCA 3SX4A 3K6KA 2XQIA 1XLUA 1CUEA 2H7YA 3I28A 1IZ7A 4UPDA 1GZ7A 5AKZA 1YA4A 5HCUA 2VAVA 2PX6A 4MQMA 1R9NA 4KAJA 3OM8A 3QMVA 4XVCA 2OCLA 2W6CX 3IVMA 3YASA 1N5RA 1N8SA 3DYIA 4F0JA 2XT0A 1LBTA 3I2KA 3M82A 2I3DA 2C0PA 5ALSA 5ALOA 4PQEA 5AICA 2Y1KA 4W1PA 5LZ8A 1P0PA 3DNMA 5EI5A 4J7AA 1CVLA 4G8DA 4QDUA 4LHEA 2OAGA 4EY8A 4UBLA 1EB8A 3TJMA 5ALWA 1EVEA 4J0KA 2VTVA 4L72A 3ILSA 2WHRA 5K3CA 3C8HA 4UHEA 2DHEA 4S0XA 1CUSA 3F8SA 2XMSA 5AKXA 2XUGA 5C8VA 2BCEA 2FUKA 4OB7A 2B20A 3D2BA 4LIPD 1CUXA 2JGFA 4U2DA 4C4YA 2WG2A 3O4JA 4WFJA 1VLQA 3I6ZA 3STYA 4UBOA 1DINA 4JH0A 3PDCA 2WFMA 3Q8WA 2I78A 2VATA 2CMFA 1EI9A 2OCKA 4MEBA 4DTCA 4CIAA 3M81A 2XUIA 4ZI5A 1MN6A 3F9CA 3BDIA 1BCSA 2BUAA 3AZOA 1LNSA 1XRRA 1A8UA 1QOZA 1EK1A 5KBYA 4X97A 2AJ8A 4RNCA 1ETHA 2XDWA 3STXA 4GWLA 1H2WA 3LCRA 4RE5A 2C7BA 5DNWA 4BCCA 2HU5A 3A2NA 2HFJA 1UOQA 2ZYRA 4W1RA 2AJCA 1R50A 4N5IX 2HA7A 1NU8A 3OG9A 2OGZA 1YS1X 3H04A 5JARA 1DT5A 4GDMA 5C7YA 2GBCA 4KRYA 4C4XA 3WIOA 2FJPA 4EY5A 2XMDA 3FNBA 2JIDA 3WK6A 2XMQA 4OYLA 3SWWA 3ESAA 1YA8A 4FBMA 2HDWA 3H1AA 4Y2PA 1E66A 2GYVA 4F60A 2Y2VA 1IVYA 2WILA 2OXEA 5EIHA 1QIDA 1LPOA 2HHAA 1U8EA 1HPLA 1AMNA 3K2IA 2HFKA 1ORWA 5CURA 1EXWA 4DGQA 2G5TA 2QS9A 2ZYHA 5LP1A 1R3DA 5LZ2A 5C81A 1CQWA 2PSFA 5LZ7A 2V96A 1MPXA 5ALRA 4KE7A 4E46A 4BC0A 1TQHA 5IVKA 2VJAA 1UOOA 2B9VA 3A6ZA 1K6EA 3QITA 4H7FA 3EBLA 1CUHA 4X00A 3BIWA 2PSEA 4AMZA 3DL4A 4KR0A 4L3WA 1ZGBA 1CUYA 2WIDA 3BIXA 1M33A 1B6GA 4QLOA 5AI8A 3NUZA 4QNNA 1W4LA 3HI4A 4V2IA 1IUOA 2XUDA 1TKRA 5AKYA 3W9UA 5JAHA 4PNZA 1PV1A 4QWWA 1G66A 3G7NA 2GBIA 2VF2A 2QUBA 1LPPA 3ZPXA 3FAKA 1XQYA 3FOBA 3I2IA 1EINA 3IIIA 2AXEA 3SC2A 1YAHA 3H2HA 4BAGA 4DMKA 3WKBA 4RGYA 5AO9A 1J07A 3PFBA 2HA5A 4QE3A 2NW6A 5ALQA 3O9VA 4FHZA 3ESDA 4FTWA 2ZJ6A 4UBKA 1UXOA 5JASA 5AHXA 4G9GA 4F5ZA 1YR2A 2ECFA 2RHWA 3V1NA 1CQZA 5ALIA 2WKWA 5LZ9A 2ZYSA 5C8XA 2GBFA 1IMJA 3P2MA 2JEZA 4KE8A 5LZ4A 2PPLA 3WWOA 1VZ2A 3TEJA 1LGYA 3WZMA 4DYHA 3DLTA 1CLEA 1D07A 3PUHA 3LP5A 4J3JA 4NVRA 4GI1A 5AM5A 4HRYA 2WHQA 3I2HA 2JGMA 1BROA 3RKSA 4XX1A 1LPBB 3UUEA 3BJMA 3C45A 3WWCA 3DKKA 4X91A 5CH5A 4BBZA 2Y2UA 1FFCA 2PUHA 4JEIA 2WUFA 1GKLA 4H0CA 4QZVA 3QPDA 3PE6A 3G9TA 1L7RA 4EUSA 4GW3A 5SYNA 1EA5A 4INZA 4KAFA 3ANTA 5SYMA 1GGVA 4H35A 1XZGA 4A5SA 3WKDA 4FMPA 5FV4A 1ZI6A 3D59A 2XUQA 5HF9A 2WJ4A 3O4HA 3MGAA 4PW0A 3VXKA 1J1IA 1G42A 5CT8A 4AQDA 1RWQA 4MYSA 2XQJA 2UZ0A 4TGLA 3GELA 5AIBA 1S8OA 5ALEA 3IURA 4OYYA 3KWJA 3KD2A 5ALLA 3LIIA 3PF8A 4UFNA 5JD6A 3H17A 4GHWA 2ZYIA 4I3FA 3MUNA 1IUNA 5AIAA 1UKBA 3DQZA 2DR0A 1ZD4A 3EQ9A 2PKYX 1AC5A 2C5GA 4W9RA 2GZRA 1WCYA 5T4BA 3UMJA 1GPLA 5C8ZA 4Z49A 1MNQA 3IUNA 1BCRA 1LPAB 2FX5A 5FOQA 1VA5A 5EFZA 5JAUA 3B5EA 4FWBA 4EB0A 3VJLA 5AI9A 2CBGA 5DNVA 3AZPA 3R41A 5JZ9A 5HF8A 3VISA 4M0FA 1XRMA 4LYDA 3WWEA 4BAUA 4CCWA 1U65A 2PBLA 1UK9A 1XRLA 3V1KA 1LZKA 3ZWQA 4K6HA 5AKIA 5AKJA 2WIFA 2DQYA 3FCYA 3H0CA 2GZSA 1EH5A 1XZDA 3GROA 3WZLA 1TK3A 4E15A 1MX5A 4G5XA 4QEKA 4UBMA 1DWQA 2HU7A 3AILA 5HFNA 4UFOA 5A7HA 4CI9A 3L1JA 3JYHA 4UHHA 3H2GA 2WFZA 4XIIA 1QIHA 2HRRA 4OB6A 2YYSA 5IVIA 3WL8A 5JADA 4KYVA 5CH8A 3EF3A 1H2ZA 2V98A 3WK8A 4FLMA 1VKHA 4OSEA 1X2EA 4DIUA 3I2GA 1F0NA 2XMCA 5KREA 4H7KA 1CR6A 4X6YA 2VA9A 2PSJA 4JUIA 3STUA 5HKBA 1CUFA 5F4ZA 5ALTA 1U2EA 1ACJA 4UUQA 4Y2RA 3V48A 3GA7A 3O4GA 4A16A 3F98A 1QIJA 4Q05A 4DNQA 4JYPA 3C8DA 4C89A 2XUKA 4DMCA 3PI6A 1KU6A 3CN9A 1WB6A 1U4NA 5AI0A 1ORVA 1XRNA 3FLEA 3STWA 1CUZA 4EZIA 1X70A 1UK8A 5ALXA 5AOAA 2C5FA 3E1GA 4KE6A 4Y2YA 1L7QA 3F97A 4PSDA 4I19A 4B84A 1CPYA 3RM3A 2WIJA 3FYUC 5IVDA 2WU4A 5IKXA 4BP8A 4ZRDA 2Z5GA 4BATA 4CIBA 4EY6A 2AJDA 4ZV9A 3STVA 2PVSA 3OPMA 4DNPA 5HQ3A 3HEAA 2WLSA 4CG1A 4Y2VA 2QUAA 1ODTC 1CIJA 1YAJA 4H7EA 1ZIYA 4WCVA 3D2AA 2EDCA 4KJXA 1EB9A 1TCAA 2XMBA 5AKEA 1RYYA 3QM1A 3C5VA 5E4YA 1N5MA 1XZKA 4AN0A 2ZJ7A 2DFPA 4X71A 4I4CA 2XQGA 4U2GA 2V97A 1VOTA 2ONCA 1SCIA 3CCBA 3OTQA 3CCCA 2ORYA 3NGMA 2XMGA 1ZIXA 2H7XA 1CUUA 5T4HA 5CT9A 3ESCA 1CUIA 3FVTA 4BTVA 5DYTA 1CV2A 4WY5A 4FFWA 4B0OA 4W1SA 1W52X 1JMKC 3BF8A 4AO7A 4X6XA 1JJFA 2GYUA 5CT5A 2AJLI 1HL7A 3N2ZB 5HK9A 5AI4A 2R8BA 1DWPA 3AZQA 5ALPA 1CUJA 4B82A 4MXDA 1DTEA 2HA4A 5HF6A 3U1TA 1XZLA 4Y2SA 1WB4A 3BWXA 1QE3A 1T2NA 3GUUA 4YX9A 2XLCA 2XQKA 4DSZA 2QRUA 4N8EA 4K6GA 1R4ZA 1KU0A 4C6HA 3LIPA 2BAGA 1YCDA 2C0QA 1QIKA 3O95A 5AM3A 3QBJA 1EDDA 4U2BA 1TAHA 2W22A 5DTJA 3DCNA 2J4FA 1Q0ZA 4C01A 1E8MA 5IH7A 5JAPA 1SC9A 1BRTA 5K3AA 4OUKX 2QR5A 5EHZA 2JBWA 2XQFA 3C6ZA 2JGKA 2C4HA 3IULA 3QZUA 1ZI9A 5ALFA 4YK7A 2QOEA 1XQVA 2VSQA 1MX9A 4BCBA 1ODSA 4J0IA 1VE6A 2FJ0A 3ICWA 1Y7HA 1EDEA 2ES4A 4Q3OA 1J2EA 3AFIA 3GBSA 1IUPA 3R40A 1QO9A 5YASA 3FSGA 5JZBA 3O0DA 4L0CA 2H9YA 2D0DA 3W2TA 1C7JA 1TRHA 2PUJA 4B7ZA 2WUDA 3RARA 2WQZA 4OB8A 2XUOA 1XLWA 5CMLA 2QZPA 1ACLA 3WJ1A 1TCBA 3G9ZA 4ARAA 4IH4A 5IVHA 2E3JA 5J3JA 3ESBA 4BVJA 4X85A 4YPVA 3C6XA 1QJ4A 2J4CA 3EQ7A 4Q34A 2WU3A 3D7RA 1H2YA 1QONA 4FOLA 1VE7A 4WJLA 1UFOA 5EIEA 2VT6A 3WLAA 5JD4A 1FFDA 5ALKA 2QM0A 4UBNA 3D2CA 2WFLA 4IO0A 3E3AA 4Y2UA 5H3HA 2P8SA 2OCGA 5D3ZA 5KWIA 1AUOA 2IX9A 1EVQA 3BF7A 3NWOA 1FFAA 4K6KA 4M0MA 3R3ZA 1VXOA 1ODCA 1W75A 5KWJA 2GYWA 1LPNA 1AZWA 5ESRA 1CUAA 4BYMA 4CFSA 4K5QA 4C4ZA 5LZ5A 1QIIA 1XKTA 5DJ5A 2IITA 2O2IA 2C58A 5AOCA 3S2ZA 2WFLB 3WWDA 1MAHA 4BC1A 4KACA 5ALDA 1QO7A 4QWMA 3QMWA 4PSCA 3C6BA 2J3DA 2K2QB 4CG2A 2B61A 1THTA 1W76A 4MJ3A 1QIEA 3H2IA 3ZLTA 2OGTA 3G0DA 2RI6A 2O7VA 3AIMA 3I2JA 1SCQA 2B4KA 5ALYA 2EDAA 1BEZA 4AZ3A 5D7BA 5AK4A 3G0GA 4FDMA 2CKMA 4A23A 3EIOA 2D5LA 4J03A 2RGUA 2WM2A 1MT3A 4CCYA 3ZLUA 1CUDA 3WK9A 3QVMA 2JGIA 1ZD5A 4B0PA 5CXUA 2HA2A 4AX4A 1DWOA 4ITVA 3HSSA 2I03A 4EA6A 5EHQA 3A2LA 4Y2XA 2QT9A 3L1IA 5AK3A 1XZHA 3IB3A 1T4MA 3ZV7A 3WI7A 2ACKA 1N1MA 1YS2X 4UBIA 2VJCA 2OG1A 2RAUA 4BRZA 3G02A 1BS9A 3W04A 5LKAA 1VZ3A 4Q3KA 3DL7A 3FYTA 1UWCA 2WUGA 3RLIA 1P0QA 1H22A 3QH4A 4NS4A 5D3KA 3STTA 2QJWA 3C5WP 2OQIA 5T4FA 1ZI8A 1JU3A 1NX9A 4WFIA 4UBJA 1OCEA 4JNCA 2XMRA 3GZJA 3ZI7A 5EIAA 5HZGA 2WIKA 3OC0A 2BJHA 3GFFA 4DNFA 3KWFA 3PFCA 5LYYA 2WJ3A 3BJRA 1WM1A 3WJ2A 1YB7A 1QFMA 4X6UA 4ARBA 5AM1A 4U2CA 3WL7A 2I3ZA 4BTLA 1SCKA 4DNOA 1CFJA 4QDTA 2HM7A 4H7JA 3WK7A 3FLAA 3WYDA 3WK5A 2HIHA 4EBBA 1KEZA 4W63A 1A7UA 3V9AA 1ISPA 3G0BA 5I9IA 3IA2A 1F6WA 2VJDA 3IUJA 4X3CA 4X93A 5LKRA 2G4LA 2R11A 3O4IA 1DQZA 2DCMA 3D0KA 5ALMA 4Q3LA 1XZMA 5ISMA 1UK7A 3HLKA 4BZWA 3DS8A 2HA0A 2Z8XA 2PU7A 2BGNA 1A8QA 3WWPA 3LLCA 5HKAA 4FKBA 4UHBA 2V9ZA 3WIBA 3B3QA 3QMMA 1WHTA 1QIGA 5ALGA 3SK0A 1XLVA 4TPKA 4H18A 2O2HA 1FFBA 1USWA 4Y9SA 5AK6A 1GQRA 2WHPB 5K5EA 4G9EA 4GECA 4IH1A 4B85A 3IBTA 5A7FA 4J0CA 3DKRA 2JGEA 1YB6A 3F67A 2PM8A 3TGLA 1AX9A 1BN6A 2WJ6A 5E4TA 2XUJA 3WQHA 4AN1A 1HLGA 3HZOA 3G0IA 4FLEA 2O7RA 4H7DA 1JJBA 3R3WA 2AJBA 1OXMA 4J0GA 3NOXA 2HA3A 1K4YA 1K63A 4G8BA 3I2FA 4UHDA 1CUCA 4HXEB 4DSAA 5FKJA 1XRQA 2JGJA 1UKAA 1G4HA 4BVKA 1IZ8A 2YASA 4G4IA 4C88A 1CRLA 5K3DA 1PFQA 3WKCA 3Q0TA 1X2BA 1CUVA 3FWHA 4Y2TA 1FSSA 4ZGBA 1UKCA 4IQ4A 2HA6A 5AP9A 1F8UA 2PSDA 2XMZA 4Y2JA 1JT2A 2CB9A 4Y7DA 5CXXA
chains in the Genus database with same CATH superfamily
4G5RA 5KMGA 4DWVA 3GLTA 4EVRA 3ZQ4A 3O21A 1II9A 2BM0A 1ZA1A 3VA7A 2AQKA 1WBBA 1M5UA 1HOTA 4JCCA 3WICA 2XOXA 2PIAA 2XNDD 3K73O 4FYWA 4X63A 2GEKA 2NUTB 1BD4A 1G5IA 2Z9DA 2YWGA 2VHZA 4LSMA 3HXOA 4X44A 3IJPA 2PT5A 5BMVB 2O3RA 2PX2A 1QFSA 3R7AA 3PI7A 3NASA 4CLEA 4ZI3A 1GNVA 2C8VA 3FNRA 4OXNA 1VHDA 2D1RA 4A73A 1S7CA 1GPNA 1NVFA 4PPQA 4JJFA 4KBFA 1UJ6A 3UB2A 3WOHA 3N59A 4TZKA 3D4PA 3FZNA 5DBFA 4ZOBA 4N5HX 2G63A 2WTBA 4GC9A 4OHRA 3H5AA 2LRHA 2BKLA 3G0CA 4G8CA 4PRZA 4W5WA 1HQDA 2OQ2A 1I9GA 3IMKA 2YV1A 4J1QA 4F06A 1NMEA 4I0WB 4QSMA 2GS9A 4DT1A 3VQTA 3ZGYA 2AVDA 4G65A 3L7JA 3H5WA 4S05A 3GJ0A 4QM6A 4YXWD 1QIFA 4R4JA 1JQLB 4IVRA 3RBZA 4TXJA 3ICCA 3T9EA 2MR5A 2YJ6A 4JIGA 5DVZA 4G86A 2HIGA 1ZPDA 3OM0A 4ZQHA 3FGOA 1PUIA 2I6TA 4RPGA 2ZDQA 3PHLA 2QX7A 2D1QA 4R2IA 3VH1A 3LQ1A 4ZCIA 4IWNA 2UDPA 4MHOA 1QUFA 2WWRA 1PNVA 5BN3A 2YC4C 3HO6A 1O87A 4KWCA 1W30A 4N6NA 4P92A 2XLBA 1N0HA 1P73A 2Q1UA 2ID9A 1BTOA 3FSRA 1ORTA 3L0CA 2C88A 4G0NA 3L1HA 4B87A 4D3ZA 5CA1A 1SQGA 5KEIA 1CQXA 2C7GA 4JBLA 4I3HA 3QJ5A 4QNMA 3QXXA 1IOLA 4OJNA 3JQBC 4RV4A 2JANA 2FW6A 4URXR 3W78A 2L0XA 2X8BA 3Q7QA 4U2EA 3ZNQA 1H3NA 5A4AA 2GX6A 4BKMA 1EFHA 1V25A 1VMEA 4RL6A 3MCWA 1XZNA 4JP1A 5CNJA 3AJAA 3BMQB 3EZNA 3UUFA 3Q9SA 1WV0A 3EOAI 1GKKA 4O4JA 2RHBA 1P3Y1 3DMTA 1JEQA 3QU7A 2Z57A 2AEJA 1NDQA 4JI4B 4YJGA 4KQEA 3N75A 3OZDA 1RYFA 1DXQA 1RRVA 3R0XA 1YCFA 4BU1A 5FTWA 1E5XA 2QB5A 4IOKA 4TLLB 4RKRA 4J2HA 3TUZC 3OFVA 1NJ8A 4XEHA 3FI9A 3TTTA 4MGIR 5AUQA 4C29A 1E64A 4E5PA 4IMRA 3F6RA 3CE9A 1I2DA 5JYBA 1J39A 3MQ4A 1AKTA 1QM5A 2ODQA 3IT3A 1MW9X 4RLSA 4XR9A 4G4GA 4IIEA 1DDOA 4JZYA 4Q3BA 5ELLA 3I01M 1SBIA 4OH1A 2QTZA 4RM3A 4EG6A 2GD1O 3QVOA 1PV4A 2V3WA 3FYUB 4WDQA 5TQ0B 3U40A 3KT0A 4X7RA 1KL7A 3DXYA 4US1R 1CP3A 2GNAA 3DEIA 3BREA 3NUGA 4PSVA 3DD5A 1I4DD 1PJBA 1X15A 4JASB 4RPCA 3K09A 2JEYA 3CN7A 3FHCB 3QXCA 5IJ0A 3V3KA 3BXHA 4GXTA 5JSQA 4OLHA 4R2JA 3HNRA 4RVSA 3PEVA 1CJKC 2QK4A 3IR7A 3E5MA 4BP1A 4TTJA 4UAGA 5JCJD 1QYVA 3FE2A 2P4EA 4AROA 4H16A 4I50B 3LL7A 3R9XA 4IXMA 2BGRA 2BJWA 3GRKA 3JSXA 2FRDA 4MYDA 4GZLA 5CYGA 1IJFA 1RKVA 2QT1A 3B12A 4YH1A 3L04A 3LFUA 3MSXA 4RQBA 3ZS9A 1FPMA 2IYTA 4QOSA 4M38A 3HXQA 2P9FA 2ZRBA 4OHOA 5CEJA 3IX7A 4G5YA 1PG0A 4NS1A 3COYA 1GGEA 2OGSA 4ZTBA 1OQAA 4QYIB 1OD6A 3WGZA 1YMQA 5DCWA 1ECLA 4XUEA 1QTRA 3TOZA 4P53A 4NNJA 1F14A 1BKYA 4IQ8A 3W6OA 1S8AA 4FR2A 1K8QA 2WUEA 4R98A 2G9QA 1UK6A 5ICSA 2I6XA 4UMDA 2FMHA 4PG5A 3RV3A 2UXDB 2RONA 5IANA 2FUNB 3H9JA 3HHEA 4UEWA 1OIXA 3DZDA 1UC4B 4O08A 5G1NA 4EG3A 1Z0KA 1KOFA 1RP1A 3KCNA 2HHJA 2QF7A 5EZYA 2ZJZA 3W34A 2M1ZA 1Q2UA 3H7IA 3UGKA 3FG9A 4G0WA 1SZPA 1TVCA 1RQPA 1ZUNB 3NHJA 1FU4A 4N76A 1QG2A 2YNMC 3OPYB 4HWRA 1J5PA 3KX2A 1TM2A 2JCYA 3QW2A 4XIFA 4KPYA 2HRCA 5HSGA 2GJAA 2XRMA 1HGXA 3P9KA 2F1JA 4Z1OA 3AY7A 2CZQA 4DYDA 1CX9B 2C4KA 2J3MA 2G6BA 1B8PA 3PFIA 1M1NB 2PWZA 3LPLA 3L5OA 3FPSA 2IVZA 3O9ZA 2YNMA 2PKXA 1M7GA 3MWGA 4BDTA 4KIWA 4IQGA 3M0EA 4UUBA 3KKQA 5FTLA 1U3TA 4D02A 4CL3A 1WXWA 4M1TA 4I1UA 4I4LA 5BQXA 1G4UR 3EEYA 4IDCA 4RANA 3CF4A 1EEHA 1NUUA 3E7WA 3MK31 3NYWA 3AIKA 4TTQA 2B1RA 3GBPA 4GWGA 4HZUA 2IF0A 1M6HA 3EXFB 5EIBD 2WG0A 3N58A 2WWWA 3ZDAA 4HSGA 5B7QA 1OLSB 5G2OA 5T8KC 1O1YA 5EQFA 1ZEMA 5C5DA 1DAFA 1VI2A 2VPQA 5LXTF 1XTBA 1U9ZA 2G1KA 2ZXEA 4M0PA 3SQNA 3LWNA 2JD2A 3U0VA 1JIQA 1MBZA 5J5VA 3G1UA 3SHFA 1W9MA 2I4RA 1F20A 3KDSE 3ETCA 4OY3A 3LDGA 3L1VA 3AF6A 1WMSA 1T8YA 1UL1X 1DLIA 3P32A 1F48A 3NG1A 5HK8A 3VR4D 4K1LA 3SYMA 2DZDA 2R6DA 3UK7A 2AUMA 4E5SA 5JC1A 3DBLB 5KINB 4QM7A 1U2ZA 3HWWA 1GT91 2VK1A 4I5EA 3B6ZA 4CQJA 4OKIA 4HMOA 4Q9AA 1QHFA 3ULKA 4XPIA 4C0AC 3TL6A 1BH6A 3N70A 4EQ6B 4POOA 2YUTA 3RGGA 5L6LB 4IVQA 4WBSA 1J0AA 4CWAA 2PMBA 2QMEA 3GLUA 5JZVA 1A3CA 1UIMA 5K01A 1V3QE 1WXEA 2JLAA 4JT4A 2E5LB 2YICA 4X1IB 5C8DA 2CNLA 2CVFA 2ZDGA 4Q7EA 4E5MA 4RQAA 2G4CA 3BT7A 3AWIA 3AEKA 3RU9A 1YCGA 1MO2A 1NXOA 4HRXA 2GOYA 3BH7A 5CCXA 2I99A 1E2NA 2XEXA 1SWVA 4PBRA 1Q19A 3OJLA 3LF1A 5BNTA 3NTOA 4MITA 1WUKS 5EMHA 4DKJA 5HPYB 3S70A 3S81A 4Y2HA 4M7OA 2JLCA 1LX6A 3L82B 5TS2A 1TO6A 5BWOA 4CLOA 2R4UA 4LSZA 3LE8A 4OH7A 2EEPA 4ZTUB 2OVBA 1U0NA 2YZ2A 4NENA 2CN1A 2GNOA 4QTUB 1GPH1 1NMXA 4HAVA 1V8ZA 3MS2A 1N7JA 4J1NA 4UJ3A 3WSTA 1YOVB 4QPJC 1EGVB 1JR3E 2CSUA 1SHJA 3CONA 1DTSA 1XCLA 1FFXB 3S1SA 3OU7A 1N2SA 5CB8A 2AYYA 1OFIA 3KYDB 4P2GA 5AOBA 4I4TA 3TRJA 4WCFA 3UK6A 4BP3A 2D7JA 4C0BA 5KQRA 2PRYA 3FRHA 4OL9A 1M6EX 2HZBA 3S8YA 4GKKB 3KQLA 5LXTB 4OBWA 1EDBA 1MAWA 3UJ8A 3DPSA 2RH4A 5BPHA 3C39A 4KDCA 3CSUA 4P4SA 2LXNA 4ID3A 4PWZA 4DEVA 4LFCB 1RLIA 3GLGE 4GQIA 1QR6A 5JD5A 4E1VA 3EOZA 3Q5DA 1OX5A 3E61A 3OEHD 1KH2A 3EVNA 4CCYB 4CL0A 5HJ5A 1OH6A 3L7NA 4X8MA 4IDEA 4OQ4A 4PNEA 2RHTA 1JDUA 2PIDA 3BGIA 3O8LA 3OQBA 5DTRA 2H9IA 3U4GA 2WEKA 2HSEA 4KIFA 3FF4A 1TZCA 3T7RA 4KI7A 3RVKA 2E37A 1XA0A 4LE1A 4UU8A 4D4LA 4DM3A 3A9WA 2ZRQA 2EAUA 3KXIA 3NBAA 4YJ2F 2CXOA 1ARZA 2ODWA 3G1TA 4X1KA 2Z5LA 1QRRA 4FYYA 3BB1A 3N3BC 3SQDA 1TL7C 4ZT6A 1J23A 2CUNA 3A4LA 4QBTA 4TSKA 3VO1A 4L85A 3SHWA 4MO2A 1WSBA 5JTUA 1XLTC 3LBYA 3MEQA 2X19A 5CP8A 4D8TA 2Q3DA 4JSRA 1WPQA 2GBGA 1IBCA 2Q0QA 3WSWA 4K05A 1KS2A 5F76A 1FQJA 1B16A 4QBKA 3TAXA 1A2OA 3W2IA 3MQFA 2GTHA 4B3XA 2E7ZA 2P6NA 1VIDA 3D0RA 1UINA 2VQ6A 3JPWA 2NIPA 1KSJA 3M6MD 5GMOA 4ERXA 5ALHA 2I4OA 4NHEA 1R10A 1TI7A 3N8GA 2RH8A 4V38A 2WTMA 5KVSA 1GL6A 3UW3A 4OFXA 3KOOA 4OGWA 3NT2A 2GN8A 4U0KA 1N92A 3AEKB 5CYFA 4MA4A 4ZJPA 4E11A 2ZRKA 1U1FA 2VJMA 3GJ3A 4JLJA 2I1QA 1RZRD 3R3UA 4NZNA 3H7AA 4KV9A 3NCHA 1VE5A 4NATA 1ADYA 4QXRA 5HKLA 3FSEA 2HF9A 4JR1A 1VLJA 3MUFA 1QFJA 1H8HA 2C4VA 1DIBA 3EFOA 4TL9A 1DKOA 4WUTA 1L5QA 1KQNA 1X7YA 1LPSA 4KO4S 2IIBA 3GW8A 4Z1MA 4CF4A 1UPUA 3FNIA 3HBJA 4OYHA 3IAUA 5IXSA 1UPCA 5CUQA 4I9UA 3ZWBA 2ON6A 5CFPA 1EQAA 1LFAA 1NVVR 1ZJ4A 2R8PA 3ETLA 1ONPA 5FBKA 4ETWA 3QJYA 1UAAA 2HH9A 4CN9A 1T6XA 4ZHQA 1Q83A 5U4QA 4HB3A 1C9EA 3IJ5A 3LX8A 2JIZD 3A6KA 4CE6A 4CDNA 1NKSA 5KYVA 1PDVA 2OC9A 4UVGA 1R8QA 3PL1A 3TXYA 3F6PA 4WMLA 1L8QA 2FI1A 4FFBB 3FOEC 3WRXC 1VDZA 3FVRA 4QUHA 1W8IA 3G8YA 3ZZMA 3HZHA 4CEHB 1AGRA 3AR2A 3CE6A 4KXXA 4JEMA 4LG1A 4F5WA 1SUWA 4OLAA 1YDWA 3PDIB 2X5NA 3NAGA 2IL1A 1ZHFA 1SB9A 4YVFA 2Q5OA 4FM9A 2IS4A 3UPUA 1KVQA 1LBQA 4NL4H 2WSBA 4QAQA 3W8FA 2JHAA 1H65A 2WU0A 1E2UA 4PZ0A 2G40A 4TXHA 2LCQA 4Z2AA 3D5EA 4FVTA 5CX1B 5LIRA 5T4EA 4MEJA 1XBTA 2O05A 2CHEA 3NV9A 5ILGA 1GPKA 2IEAA 2CJPA 3VR6A 4JI8B 2MSCB 2C3MA 7GPBA 2Q0XA 4ALJA 1OGYA 2RHOA 1YBVA 5J2TF 2O3UA 3VFDA 3AVYA 4QJ4A 2EQBA 5FO0A 2P9EA 2W2MA 2QAGC 2Q4TA 3H75A 1S2NA 1SA0A 2P4HX 3TM4A 3LKVA 4G5FA 4MPRA 5IN5A 1V41E 1GEGA 3W1VA 2XNHA 2XNDA 2EBFX 1WQ1R 2RGYA 4TMXA 5IVPA 2BF7A 3ZWKA 2ZVPX 1IXRC 1Q1GA 4YCDA 1JSZA 4D0SA 1AD2A 1W34A 5DX0A 3U37A 1TA0A 2BGMA 3UWOA 5DI3B 2BUBA 2BEVB 4FOSA 4EFDA 5B4VA 1W1IA 4Z6KA 1N25A 2P7HA 1HDZA 1KEPA 1JLLA 3IAEA 3IO3A 3L02A 1Y3DE 3R9WA 4Y8VA 4D8VA 4KPEC 3PLAE 1IXSB 2EFHB 1HT3A 3USES 1BMDA 3WL6A 2F8MA 4PGAA 4ER5A 5JBQA 3MIZA 2CDNA 3CF6R 3AKCA 4P36A 5FPYA 2BSQA 4FCTA 5GWXA 5ES4B 4LQ4A 4Y9RA 4N03A 3TH5A 1E1KA 3KSDO 4J91A 1Y5NA 2II6A 4OJYA 3HR4A 1IAVA 1KYZA 1O57A 1R2QA 1IULA 4F21A 1OX6A 1P5ZB 2ZB7A 2P91A 3BHNA 3WA7A 3K72B 4ERNA 1ZK4A 2FKNA 4CT4B 5KYUA 4B9AA 3O74A 1N5DA 3A1TA 2C4TA 4G24A 2GN6A 2OAEA 5IXYA 3SSAA 2YJ3A 3G2HA 2A33A 3H1GA 3M1IA 4L0DA 4QYTA 1NI3A 1Q84A 1T5BA 4PX5A 3MINA 2VIIA 3JVVA 3VU0A 3HYRA 2EJUA 4B5KA 3JWIA 4OQNA 4XQCA 3VDNB 4E21A 2HWYA 3BWYA 2JJ8A 4I50A 1GPDG 3GNLA 3I0MA 1TEXA 2FEWB 5FPPA 1G2PA 1SOUA 5E4JA 4LXYA 2L82A 4URVR 5DNUA 3EK2A 5BXYA 1DIRA 3GVPA 1EWQA 1UWVA 1V4NA 2YYAA 1L1FA 4CIWA 1TU0A 1QE0A 4RZ2A 2OM2A 1B00A 2I1WA 3D8HA 1VXRA 5DHQA 1CE8B 1HG1A 4TLDA 4WVFA 1LBSA 5CDUA 2PL5A 3W5UA 4MRPA 1U2PA 3FYUA 5JNSA 4LXIA 1C3OB 5IAEA 2QTCA 3EVZA 4DE5A 1R5JA 3AHHA 5CH3A 3O94A 3B5JA 4A0QA 3MVEA 1O8CA 2P77A 5ICMA 3Q6IA 2FVYA 2IIVA 3FF1A 3JYOA 1OF1A 2RAVA 1JZQA 3A6DA 3NBYC 2J5RA 4TKZA 4TL8A 3VC1A 4E5NA 3RVSA 1Q77A 1R5NA 4B34A 4L8YA 3V80A 4QFMA 2IW3A 1NYRA 3THYB 1NT4A 1LNQA 4N54A 3TEMA 4G1FA 4Q6BA 4FZRA 4OHPA 2FSFA 5EP2A 2H1SA 3T35A 3W1WA 2JHCA 4MW2A 1O5IA 1PDOA 1NLYA 2PE5A 1N77A 3QF4A 5AVJA 5I7UA 2BL4A 5DT9A 2J9ZB 1NN1A 4YRCA 5ETJA 4EMSA 3HU1A 3OIUA 2IXBA 4IGFA 4PHTA 1IY1A 4U0JA 1DAKA 1F1BA 1ECGA 1UZNA 1FSPA 1O5OA 2RC5A 3C16C 4X65B 4DG5A 1P5RA 5I4BA 2WYIA 4BQQA 2V1XA 3DKPA 3OOSA 3JASA 1T6YA 4EO7A 3OFNA 1FCJA 1X1RA 4QDXA 2FETA 4UD2A 4HNTA 2J3LA 4FNGA 2CL7X 5BN3B 2G9RA 2OQRA 1MFPA 3WLJA 1O4VA 2D7DA 3I6IA 4PZAA 2AR7A 2X6TA 2C5AA 3CJRA 2IPOA 1RTTA 1G7SA 1GIAA 4QBHA 4MEAA 3HJRA 4FCWA 4KRXA 5KHAA 3T9BA 5FLKA 4J4TA 1YSCA 2OILA 2ZS7A 2H92A 3E2PA 3O47A 3DNPA 1OYYA 5T67A 1O7JA 3RHFA 4E5YA 2Q1TA 5DM0A 1WP9A 2DHRA 3BL8A 3HBLA 4GBMA 5BYKA 1PJCA 4FYVA 4BO3A 5GVSA 4ZT5A 1EUQA 2VOEA 4Z86A 4J0QA 3K53A 3TL2A 4Q3EA 1E1RD 2Z4TA 2CCKA 3PIIA 5K8IA 3OMWA 1EG2A 3WRYA 5B55A 3DYVA 4CKCB 5DN6D 1LKZA 2C9YA 2VH1A 1JFSA 3I1YA 2VJLA 5DM2A 5DRYA 2GPBA 1T1EA 4G81A 4U63A 4GWKA 3LWZA 1H2BA 1ADGA 4HQKA 3DEAA 4AIRA 4BLUA 2AK3A 2D1FA 5CXQA 3V32A 3NPAA 4NZPA 3JD0A 4UHCA 1H23A 3BK1A 5TY0A 5BOVA 1KK3A 3V7WA 3PT9A 2FQQA 4I4NA 1KVRA 1MKYA 1RR6A 2XB6A 3D9QX 3KKMA 2OYCA 3AFHA 4PVDA 2Z3ZA 1NXWA 2Y99A 1UOEA 3ZU4A 1PTJA 1ZU5A 1MNAA 3DAHA 3MM4A 1R88A 3UMRA 1ND6A 4GZMA 3FX2A 3EIQA 2J48A 1LZLA 3IT0A 2E4ZA 4IHQA 1DX4A 1FY2A 2OD9A 1XQXA 3DV0A 3I12A 4DDVA 3LVQE 4ZZ1A 5JDCA 2MTBA 4FZJA 3OT1B 1XHEA 2YQ4A 3JU3A 4O8CA 4ZJZA 3DMGA 2JFFA 3X2SA 4ECAA 1FZTA 2R79A 3CLSC 1E8DA 1KDRA 4CPDA 3BXFA 1XTVA 5IF9A 5K03A 4RDHA 4F84A 5ALVA 4KLCA 4O63O 3B70A 1X92A 3S99A 1VE9A 3WA6A 2DH6A 4BIIA 5IX8A 3UC9A 3F90A 3KELA 4E13A 3L6CA 1HNZB 1HK7A 1VYUA 2G07A 2SECE 1XRPA 1W48A 1K8RA 4PZZA 5BWCA 4YHHB 4N5DA 2HU8A 2JNWA 3TZLA 2PZLA 5GADl 2QGZA 6REQB 1BDMA 3F7TA 4K1XA 4BRUA 4EG7A 4MKFA 3F0TA 1GUZA 3S40A 4FSDA 5CIQA 2QZJA 2QBYB 4L3VA 5EG5A 3SKVA 4Q47A 4BO5A 1P74A 3BTVA 4N3GA 4ND5A 2ZAOA 4PBSA 4QNRA 3DWFA 4LXGA 3P0JA 4AZSA 2QI9C 4M83A 2DU8A 3W06A 2RI0A 3HYSA 3QBVA 3P0IA 4QUBA 4TTPA 2X2OA 4EW6A 2C59A 1PIWA 5A71A 4CM4A 1E98A 1WB5A 2BPOA 2PL1A 3LKZA 4RL4A 2WBLC 1T5OA 3EZ2A 5DN9A 1BA3A 2WF6A 1JI3A 2H29A 1BGVA 2EVWX 1L4FA 2Y77A 1Z5GA 3PQEA 3S2GA 1EM8A 2CD9A 4DF3A 1AHPA 1MENA 5GY7A 1RM4A 1NHGA 3M4XA 5KMGB 3LNCA 4RX1A 1W87A 1TLFA 3E1KA 1E94E 1DU4A 5IKMA 1XZJA 3TI7A 1NVKA 3FVWA 3PDJA 4OU5A 4AUEA 3H1BA 2IXGA 4EB6A 3GDFA 4ENTA 2O2GA 4LV6A 1CHNA 1AKEA 3NBXX 2VDRB 1E9SA 4MCAA 1SCJA 1BFUA 2HDHA 3O1IC 4HADA 4HUTA 2CMKA 1R9JA 2ZW9A 1NN0A 1A88A 5H02A 4AWXA 2Q5IA 1E3QA 3HCAA 1ZVJA 4M8LA 4PGGA 3E9RA 4YCBA 5E3IA 4BO2A 1GOTA 1ZH2A 1OYWA 1XLUA 1CUEA 1JQEA 2DC1A 4HLUC 1PLKA 2H7YA 3FGZA 1TO1E 3I28A 2FP4B 3E81A 3CRRA 4G4SP 3R7LA 2GNPA 5LMUB 2I6GA 3X1ZA 1NVAA 3K0FA 1S7GA 2IOHA 2R85A 3G2PA 4BNIA 2REQA 4QHTA 1E99A 2NYAA 2PX6A 4YHBA 3VPDA 3GZ4A 4BB9A 4C0HA 5ENZA 4KAJA 3DHWC 3QMVA 3CUSA 4XVCA 2QSUA 4TWBA 4Q4JB 2JC3A 2FN8A 3LOQA 2Q6OA 1AZTA 2HPVA 2PA3A 3BOSA 2ZPAA 4ZA2A 3KB6A 4E5VA 1T5IA 4TSFA 4L5IA 4BFSA 3O31A 4ER7A 2ZAGA 3EBPA 7AT1A 1TM1E 3JAWB 4UAUA 2YIMA 1ZGGA 1NHWA 4M2LA 3JQGB 2ZAYA 3M82A 2GKGA 4AYXA 2J9YB 4GPZA 3ZJVA 3TE7A 1PO7A 4YLGA 4Q48A 3OTWA 8LDHA 1J0DA 1KP3A 1T3HA 2FPIA 3PSHA 1SELA 3KETA 1VSQA 4PQEA 1P2BA 2QP4A 3CRVA 4LJYA 2ZULA 1P0PA 3DNMA 3QFHA 1NR7A 5EI5A 4TKUB 2P9TA 5AXBA 2MSKA 1CVLA 2Q8PA 1QDLB 2PGJA 2J7PD 3VNBA 3Q3IA 3RFTA 3ZZ0A 4DIKA 2XTAA 1Q0LA 2XHEA 4LK2A 5DF1A 4UJ5A 3ID6C 2X3FA 1T9KA 3SR0A 4CGYA 3C3KA 2HHLA 1JPNA 5JNTA 3QE2A 1M66A 4Y6LA 5E3HA 4LF4B 4LVNA 1I0IA 2QTLA 1OAOA 2A9FA 1NSFA 2OD7A 4LXXA 2XYRA 4CKBA 4EENA 1XMJA 1Z4KA 2IHBA 3T5PA 1SCAA 3ZU5A 2ADMA 2VNJA 1RSZA 3R9IA 2Q7XA 2VRNA 3OE1A 2BFAA 1OXBB 4UHEA 3FMVA 3QFRA 3SC4A 1BDIA 2YXBA 1E69A 2B25A 3GDWA 4EUNA 1CJMA 1ST2A 3VU1A 1K6XA 5JAZA 3GFQA 3BM5A 2QUJA 1M0TA 3ABIA 4XASA 5IZ4A 1D04A 2DFVA 3LX4A 3T0IA 5KQLA 2B20A 3CH7A 4DQ0A 2C5EA 1JJ7A 4TVBA 1HE8B 1TYEB 2QP3A 4LIPD 5EE1A 4LWZA 2G17A 2ZT6A 1YI1A 4FYMA 2GDJA 3IUEA 2JGFA 3MMXA 4U2DA 3SQLA 4FSXA 3O4JA 4WFJA 2CFTA 3WGOA 2FPPB 3I6ZA 5KYUB 4WXYB 5KAMA 4X20A 8ADHA 2UVPB 3GY0A 1DINA 1I2BA 4FOOA 2UXBB 3IMCA 3OUZA 4HG2A 2E48A 3PDCA 2BMFA 4PNHA 4R05A 3W1EA 6Q21A 1NKTA 2DPLA 3MD9A 1G8JA 1SCUB 1EI9A 2CMFA 2H8KA 1TYCA 2ZIUB 3T7IA 3RABA 4MEBA 1Q92A 1EK5A 3R0IA 4DTCA 2Q6LA 4BX3A 2A0KA 3INRA 1I32A 1GLVA 3ORHA 4NRDA 4ZI5A 3RQIA 3SS9X 3PEYA 2ECPA 4QPNA 2R7AA 2REOA 1IVNA 3M6FA 1VGRA 3VR1A 3RSQA 3LCCA 4WY2A 1W6UA 2O8EB 1LNSA 3OIGA 4HN2A 4AIIA 3ONNA 1JJAA 1LRLA 3C0KA 4K9OA 1JHUA 1GFSA 1ABEA 3U4AA 4OX9B 1R4NA 2F9LA 2WYVA 4BLQA 2IXAA 4A5OA 3GLHA 3H3FA 1GUAA 4MUKA 5F3WB 4OA5A 4RK7A 1M2OB 2HC9A 4ND3A 4WKOA 1DBVO 3G0OA 3BXGA 1V8PA 3VGPA 1V1RA 1F60A 1H6BA 1E92A 3G85A 3IXQA 4M8KA 2Q5QA 4PYMA 4WXPA 4F5YA 5K0TA 4GVPA 4XE5A 1PT7A 3K4QA 4BCCA 5K6RA 2HU5A 3T3OA 2HGSA 1PD1A 4DQKA 1WG8A 3E58A 2HFJA 2LWIA 1A9QA 2O50A 3ODGA 4DHWA 4WADA 2XYQA 2ZYRA 3QQPA 2AJCA 4MWCA 3L8MA 1HKUA 3UMBA 5AW2A 5DKFA 3FUWA 1A96A 3U49A 1Z12A 4Y30A 4C6TA 4EM6A 4IP0A 3KZKA 4EO4A 4IFTA 1DTWA 3RS0A 4C0QC 4UZEA 3NB0A 4ZVOA 2ZGVA 4ZEOA 4EGFA 3TK1A 2A84A 4BV9A 1DP4A 1NU8A 3LPDA 1QO0D 1DT5A 4MDHA 3BRWD 4ZVNA 4G0MA 4OJMX 3GXOA 5IC4A 1HT0A 2ATIA 1SJ9A 3D8SA 3MXOA 1WCIB 3PNVA 4KRYA 4R1PA 4C4XA 2UYCA 4JYZA 1NWCA 2I2FA 1SUFA 1DSSG 1WVGA 2NO1A 3WIOA 2P4QA 2FSSA 2P27A 1DO8A 1KRWA 4GM4A 3FNBA 4MA0A 3TKYA 4W8GA 3H87A 3AYXB 3KCQA 2IP4A 1QVVA 5MGBA 3GRYA 1EWRA 3BWDD 1E6WA 2J5XA 4YA6A 4EYKA 4ZYYA 3H1AA 3LO8A 4RPHA 3A1EA 2B30A 2RGEA 1EXDA 5J1TB 2GYVA 2CUKA 2Z5FA 4XGNA 1D6JA 1J99A 1T9AA 1RVV1 4D4KA 5LLTA 4L2IA 4PLCA 5DSTA 3IR6A 1IVYA 1I4TD 2NVWA 5CLLA 5IKPA 4QTTB 1AS3A 1PFGA 2WMDA 4A7PA 5DTEA 3DOUA 1TTTA 1JLKA 2QRZA 3RJTA 3AM1A 2I4NA 3KXKA 2P5UA 3RC8A 5JT1A 4RMNA 2WKSA 4LF5B 2ATVA 1IIRA 1LPOA 3C41J 1TJYA 1I80A 1YGYA 1YKSA 3G23A 4FUTA 2HHAA 4M22A 4OQYA 1Z2AA 3AEQA 2IW1A 1CZRA 1R0XA 4JX8A 3B3FA 1U94A 5IYZB 3CWQA 2I6FA 2NQ2C 2Y1OA 2WB4A 3RANA 2JGDB 4QPPA 2PBFA 3MWFA 5CDFE 3V2UA 2Z4SA 3WFZA 4FDTA 1QQBA 5CLGA 1TPYA 2AN3A 3WNBA 4EUEA 1EXWA 1D2GA 3AQIA 4JJZA 5CCDA 4DGQA 3ZJ4A 2V7QD 3GUYA 3CLKA 1M8FA 1O03A 5LZ2A 1D2CA 3ZEIA 4YCJA 4U02A 1M7BA 3OFSA 2ZK7A 3P5SA 1LSOA 3N05A 2AA3A 1EQ2A 1T2EA 1Z2NX 2TSYB 3ZQJA 1U7TA 2A1UB 3EGEA 3VNUA 5J4HA 1CJTC 2Z30A 3D6AA 2FXVA 3HYCA 3N6XA 2XADA 1MPXA 4KQMA 4TYMA 1UFVA 5ALRA 3NIDB 5LZ7A 4HWTA 5EWMA 5A05A 4RK0A 1DAGA 1RI1A 3A25A 1BFKA 3CPEA 3PYXA 1KZ1A 1KI1A 3O8NA 3QSGA 4YLEA 3GO4A 3NBMA 4BC0A 2H2HA 1ZIDA 3ZOZA 4F4CA 1NLMA 2H2AA 4W6ZA 4HAOA 4J7XA 1SM4A 1SKQA 2BTOA 5F3DA 1BGXT 3ZJTA 1A4IA 1MQ8B 2Y05A 2P65A 3DUFA 3QI2A 4B45A 1RIFA 1H05A 1NZFA 3E9QA 1CUHA 2JASA 3NNDA 4R0NA 1PZHA 3DDNA 3HJTA 4YAFA 4HLQB 2CC2A 3ZIUA 1AZSC 5DGCA 2PL3A 3L92A 1AGNA 4J9VA 4OVKA 3WXBA 4QELA 1O94D 1VIMA 1SG0A 2PLNA 4HDSB 4KG7A 1FYVA 5JFTA 4OUDB 1TD9A 3GLSA 4FX2A 1JDJA 2ZVJA 4MI3A 4ZQGA 3V5NA 4B7CA 4UCWA 3GLFB 4MQUA 3DL4A 2X2EA 4P4SB 4L3WA 1ZK3A 3S29A 3CLTC 1XALA 1WCWA 4O2BA 2E85A 1W59A 5T57A 5IAGA 3EVDA 4HYYA 4NNPA 4JN6B 3V46A 1FXWF 2XCQA 2COEA 1CU1A 2YDYA 2OWEA 1CZNA 3NAZA 3ZWNA 1EP3B 1S4MA 3K3PA 5JSFA 3NUZA 2CNOA 3HI4A 4V2IA 4HNQA 5AJZA 3WBJA 4A0FA 1HTTA 2EJWA 2DTDA 1KI6A 5IHXA 2Q3LA 2IGBA 3QP9A 1MOSA 4MQ6A 5ERXA 5FD8A 3UG7A 4JCOA 4PNZA 3M4ZA 4S35A 1KZHA 3F5SA 4TMWA 5A04A 5IU6A 3HPQA 1U98A 2KI5A 2DT8A 4CMHA 3PGJA 3ILYA 2IXTA 2FYTA 4HHEA 2PSSA 4RHYA 4TV9A 3SYTA 4JMLA 5LBUA 3SJZA 3L0BA 1HWYA 2BDEA 1KY5A 1WLSA 1YZFA 1RAEA 2C9BA 4GOLD 1NYLA 3EG9A 3O1HB 4RF2A 5JNLA 3PPXA 1FYXA 4DXAA 5DHRA 4XYEA 3E3LA 3ZPXA 4E51A 4C7XA 3HI6A 2J5BA 1XQYA 1VLVA 2DY0A 2KM1A 2QWXA 2VH2A 3OIVA 4WZAA 2HXYA 1IK4A 1SKYE 3BMNB 4MRVA 4BNUA 1N36B 4LVUA 4NDAA 3OICA 1EINA 2ZI7A 1KMHB 1DKNA 4US2R 3IBYA 4PIPA 1Z2DA 2A57A 4KX3A 4ZEVA 3FOZA 3MYYA 3LY5A 2VHJA 1J20A 2R5FA 1RQNA 1Z4PX 2NAFA 3H2HA 4MVJD 4WNAA 4TVOA 1TFUA 2PKWA 3EUAA 4O2BB 4OI1A 3DBLA 4FE3A 4U6NA 4DLKA 4FFNA 2ISQA 5C32A 1P6QA 3A58B 4F12A 2XE6A 5K0CA 2WMOB 2YXEA 4HF7A 4KFSA 2RGDA 2NW6A 4JMPA 2AZDA 2R3SA 3B6JA 3TQIA 3X43A 4AMBA 1C3JA 1Z2OX 1RU3A 2CZGA 3REOA 4YRBA 1YKGA 3I8SA 2ZKIA 3M5DA 1JDTA 4LRWA 4DZTA 4QT0A 5HJEA 3MF4A 3E8XA 3ESDA 4WKCA 4FTWA 2ZJ6A 3FXAA 4UBKA 3EF1A 1E58A 2I6UA 3GN1A 1W96A 1R66A 3VZQA 5BN4B 1Y5MA 2RBEA 2Y27A 1CQZA 4G5HA 4EQZA 3WL4A 3ACDA 2VPTA 1YACA 3NHWA 3NORA 1LCIA 4K0RA 3FMOB 4WD3A 3KAJA 5EWMB 4NAUA 5BQ5A 4EW1A 1EVZA 2ZYSA 2ERXA 3ZIDA 2R48A 4EPTA 3UV6A 4P4TA 1V1MB 1SKMA 2CF6A 4EGAA 5LDGA 5LZ4A 2PHZA 2K7ZA 5BW6B 5E6SA 3BK7A 1SUDA 2XCTB 1VZ2A 2QMOA 1LGYA 3WZMA 3VYVA 4ZOEA 3TLZA 2OXRA 3O1JC 4RS3A 1P6UA 1XTJA 3EIUA 1Y1RA 1IQ0A 2QVGA 3HCDA 4BFVA 1QOPB 5IDYA 4FB5A 3Q88A 3E5RA 5BWLA 5ILOA 3GLIE 4GI1A 1DEXA 1L5KA 2Z04A 2E5WA 5EC8A 3TO5A 3HXMA 5I47A 3DD1A 1GRVA 4XX1A 2NPIA 3LMKA 4G25A 3J81k 2HQSA 3C45A 5FNVA 1M1XB 2H9AA 2NX2A 1IFXA 2ZSUA 1ZOSA 3ROKA 4BO4A 4X91A 1CIPA 1RJDA 1ZRMA 2VDWA 3OA0A 1NZDA 3LP8A 1Z7BA 4FFPA 3ICPA 2KSQA 2ZIZA 2QRHA 4JEIA 1G38A 1GZVA 4Z54A 4ZJUA 4EZBA 1N0IA 1ZJJA 3QKRA 4MSUA 1ZWKA 4MB2A 4J16C 4HDNB 4KXYA 3GDHA 3ZZ1A 3E7FA 1M8KA 2VYVD 3D43A 1NQUA 2X1HA 3A6HA 1SU7A 4KAFA 4L8WB 2DBRA 4NBSA 2Z56A 1JE1A 5KPDA 2I22A 2BEUB 3I52A 5SYMA 4AJJA 2HJ9A 4L02A 3KV3O 4UU1A 1AQIA 1VM6A 1LC0A 1K5DA 1MV5A 5CDFA 3BA1A 3CA8A 4ZQFA 4CV1A 1TGYA 2TMGA 3KE9A 4BB5A 5LMNB 5JMOA 2QZSA 3G1WA 3WP0A 2YWBA 3Q3VA 1JBEA 2RHCA 3CF0A 1SR8A 4J1SA 2ZB3A 3MGAA 3TXAA 4KIUA 2W2XA 4AJOA 2PK3A 4F2WA 2O59A 4KPUA 1A82A 4JI6B 2XQJA 1IG3A 4TGLA 1ISFA 2W4IA 1S8OA 5TQ0A 1Q2XA 4TXMA 4ZT3A 5KQMA 3IURA 2ZIAA 3AOEA 4OYYA 1EVJA 4TTIA 5DSXA 1I94B 5BSRA 5ALLA 1K66A 1RIIA 3GOHA 5CEEA 3K1YA 3IQHX 4L51A 4DR5B 1I5RA 1U5CA 1DKUA 2BF4A 4EVQA 2CXSA 4C07A 2XXAA 5K6AA 2FPMA 4H6VA 1ZRNA 1QHXA 1F38A 4A03A 1WZ2A 1QHIA 1XD2A 4UULA 1FXUA 1D5CA 1QG4A 1TJNA 4NBVA 3E84A 5AIAA 1UKBA 4AJ9A 2O7NA 4NQRA 2ZTHA 4QULA 3M34A 4RY0A 4DUGA 4YJGB 5DGHA 2CXXA 1MP0A 1D8TA 1ZD4A 4L74A 2PKYX 2GTPA 5F77A 1RQXA 2C5GA 5JS1A 4LSGA 5DIFA 3TKAA 4DR6B 1THMA 3UMJA 1ZGHA 5C8ZA 3W7VA 2X4IA 1LQUA 1MNQA 4RD1A 1ZN9A 2PT9A 5KX5A 3DE1X 3ETHA 1N4AA 3PSAA 4GMKA 4YJFB 2MSLA 3V42A 2YINC 5FOQA 2QE6A 1VA5A 5EFZA 2F1KA 4H6XA 4RU1A 2WQ7A 3B5EA 4DA8A 4MW1A 4EB0A 3RIXA 2Z2JA 5LVAA 2OXCA 4TLAA 1RADA 3E5HA 3EARA 4MQBA 5KOYA 1Z8HA 3F2VA 5AI9A 4NCBA 1SUEA 1EBUA 4H3VA 2F1IA 4YR9A 3K1JA 3WE7A 5LUBA 5CD9A 1ZVMA 4RPJA 4C2BA 5L3QA 4ZVLA 1KIMA 3PFGA 5C1IA 2QRNA 1XRMA 4B46A 5AJUA 3CZ5A 4LQCA 4JR2A 4I55A 3NC1C 1XF1A 3NFYA 3P4XA 4OIMA 3WWEA 2DOKA 1PLJA 3SYKA 1L7EA 3V1KA 3U4QA 1G20E 1LZKA 1NR5A 2J9FA 3IC5A 3ZWQA 5I9TA 1PR9A 2OZLB 2X0DA 2R6JA 6GPBA 4ND7A 3U3KA 5A4KA 3IKMB 1PTJC 3R0QA 1EWTA 3ZVRA 1CERA 1MX5A 1VECA 1YE8A 2P6UA 1YK1A 2C2OA 4QEKA 4UBMA 3T9AA 4UREA 5CIWA 3VYSB 4JI7B 2P5TB 3VU3A 1G1AA 1SNYA 1ZN8A 2ORVA 3MJVA 1H1DA 4GVLA 4LTDA 1RNLA 1IJBA 1R4AA 3KKPA 3AILA 5LQMA 5HFNA 1P1IA 1ZWLA 3DE6X 5A7HA 4TSRA 1YRLA 4OXYA 2BDUA 1AIPA 4KQ2A 3ICEA 1V2HE 2PS1A 1GCAA 3RVRA 4UHHA 2JIMA 3H2GA 1WUTA 3GLIB 4J07A 4KQ1A 1EUYA 4OB6A 3EPRA 4GE3A 2IPXA 3CR3C 5CGQB 2UYHA 4AECA 1ZVVA 4FGKA 3WYEA 1YF3A 2N47A 3WL8A 3H9BA 3CSDA 5JD3A 3OKFA 3HE3A 4LY3A 3WR5A 3A6LA 1MT0A 2B2CA 2NUTA 2ZROA 4R16A 3VMFA 1CTQA 3LWDA 1H9BA 1VC2A 1DARA 2FN9A 1VKHA 2GBLC 3PWZA 1D9XA 5KTSA 3PPIA 1QBKC 1T0UA 2H48A 3DJFA 3IAFA 3I72A 5LWHA 1M2JA 3I2GA 3DUWA 1KKMA 4IIDA 5J43A 3OE7A 2FPIB 2A5LA 2A67A 3D7SA 3FWYA 3HA5A 3C6QA 1JALA 1SXHA 4EGJA 4H7KA 1CR6A 2VA9A 3MJSA 4X6YA 2C99A 4XOUA 3BBPA 2XAAA 4QTYA 5ALTA 5FV7A 3VBCA 1NMZA 2JBAB 1U2EA 3QYAA 1W4BA 2HCTA 1RQ2A 4XM2A 3FYCA 1TZKA 1BDBA 1WUJS 1GGFA 2QVCA 2ZRFA 1HLDA 1IN8A 2PCLA 3CM0A 3I04M 4A16A 4EKDA 5AVQA 4ZT2A 3R7WB 1X86B 1OVMA 3OU6A 3JQAD 3QKRB 4GOXA 3B9BA 3QX9A 1NSTA 3NWBA 2V5VA 4EJSA 5L3SA 4ZO4A 3RYFA 1MW8X 3WDSA 2OV6A 2BC9A 2FZ4A 2O07A 4YFVA 4AAYA 1KU6A 3CN9A 3EHDA 3QOWA 4DSTA 5BYAA 3BRWA 2R1VB 2BEKA 1JPUA 4N5LA 5HE9A 2E9SA 1FUKA 1UBEA 2M1XA 2PRKA 3OIYA 3STWA 4BFZA 5HR5A 4CTKA 2AFIA 2GAIA 4BNFA 3SZMA 1SPXA 2NSYA 4LMRA 1ZCFA 3AUFA 1SH7A 4B5LA 4RTRA 4M21A 1Q1BA 2QT0A 4OO3A 5AOAA 3E9EA 3N8IA 5B2ZA 3G2IA 3OCWA 4HMPA 4KKXB 2ZIXA 4ZOLB 2Y76A 2V65A 3C8MA 2O5VA 1VHLA 3NVMB 2QQ0A 4R2XA 3PGLA 1VQ1A 3F97A 1MEOA 2EQAA 1UXIA 4PSDA 5D00A 1ZL2A 1SXJC 4UD6A 3S68A 4F04A 1CS0A 1M8GA 3COSA 1DC7A 4N18A 4WE3A 1U4OA 4DBZA 4TYQA 3FYUC 3GCDA 5HFJA 2SCUA 2OFWA 1UWLA 2GAJA 4BP8A 4XRRA 2Z5GA 4FZVA 4BATA 1HT2E 4FDVA 1ZH4A 2JVIA 4CF7A 4CIBA 2B37A 1FFGA 1SU6A 1ADCA 1LJUA 1XMVA 2DTEA 1NVVQ 3DV2A 1IL0A 1JDZA 1KE1A 1J24A 1LDBA 3PX2A 3HEAA 3BC1A 4MJ7A 5AWFC 4DNPA 5HQ3A 4CG1A 4R1MA 2IOFK 2QUAA 4JSTA 2V5AA 4JDUA 4FXOA 2A7QA 1G8HA 1YAJA 2BFPA 2LBPA 3ABSB 1TRKA 1U3WA 1TX4B 1ZIYA 4MYUA 1YJ8A 3QPWA 3S2EA 4C4SA 4W5OA 4Z4FA 1C2TA 2JFZA 2R7MA 1NSYA 1ITZA 3FIJA 2EDCA 4FW9A 1A98A 2RB5A 3W3AH 1HZZA 1EB9A 3LCJA 1IN4A 5E1OA 2CV1A 3NOQA 3INYA 3RJ9A 5D3MB 1N2ZA 2IP2A 4PPNA 3IIJA 1F3OA 2C9MA 5AKEA 1E5QA 4D0NA 2VP2A 5C7OO 2I67A 1BIFA 5AVRA 3AX6A 4ESOA 1XZKA 1AUQA 2BKUA 1QGDA 4FT4A 3VNAA 2YVLA 4M9ZA 1FRZA 2WAAA 4AN0A 4E5DA 4HFNA 4HL6A 3EVAA 4DZRA 5EPUA 1QRSA 4RMIA 2B94A 2IYSA 2XQGA 3RS3A 2A5DA 4EI2A 1V43A 3W4KA 3GRFA 4FMDF 1GU7A 4V0QA 2JCXA 4JD5A 1LBIA 5EWLB 5JE8A 4JFRA 3OTQA 3BCHA 1ZSVA 5F98A 1LV8A 4P98A 1RABA 2ORYA 3UATA 1MABA 1OIVA 2QI9F 2OO5C 1M2NA 3B51X 4QAJA 4QYSA 3NGMA 3TTUA 4J94A 4AW9A 5IKEA 2MYNA 2XMGA 4WSOA 3V4RA 1JV2B 1PFVA 1OC4A 5GM2A 4NCKA 4LXQA 4UAVA 3WJ7A 3BL6A 4F9GA 1Q17A 3DDSA 2RD2A 1DOAA 3L3BA 3KPWA 3DKVA 3PUJA 1XUOA 4OA8A 4MGKR 5CDTA 2BP7B 4KUEA 3V7UA 2BFCA 1FX0B 2VHVA 2IELA 1FUUA 3EGCA 2PGOA 1DEHA 1E4YA 1SZJG 4IPTA 4RJIA 2OUIA 3GFGA 4XPZA 2PV7A 3DC7A 4L22A 3OAAA 1NVMB 3HKDB 4QRIA 4W1SA 2W6JD 2RC6A 3AUSA 3BJEA 3ZVMA 2QV0A 1RXVA 4C7JA 4JI3B 4POAA 1JJFA 2O5CA 2GYUA 3GQBB 1G5PA 3BFPA 3PQ8A 4HNHA 2AJLI 4DEYA 1JHQA 1VLZA 4IVNA 1ZOOA 1G64A 3IQFA 1WOYA 3DBHA 4XH9B 5LA6F 3U5ZB 5EGSA 4B2PA 4O33A 4A0GA 4PIVA 4LJ4A 3GGJA 5E9QA 5HMLA 3U3XA 1W29A 2HY7A 4QOGA 5HBGA 2FG6C 3TGPA 1G8AA 5HK9A 3GJYA 1IQPA 4XX0B 4YRAA 5HHTA 5IWCA 2R8BA 2R7LA 4JK3A 4RORA 1IM5A 3I5UA 3LQQA 2CFOA 5TQVA 2PJZA 2JLQA 3GCWA 4MGEA 3ITNA 1L5LA 3AZQA 1B15A 1WBJB 4W99A 3NGLA 4RXMA 4FPXA 4NONA 4H4EA 1ZR4A 1T3ZA 1L6RA 3A6JA 3UA4A 4MXDA 5JG7A 1UMCA 5CLIA 4ATNA 2ZBUA 4IXNA 3D2LA 3UTCA 5KHOC 2ZQYA 3BG5A 2I76A 4QFCA 5HF6A 4DCPA 1GVHA 4Y2SA 3L8FA 4HVCA 4UARA 4ZMRA 2Q3HA 4K40A 2EJCA 1EX6A 1QE3A 3KJGA 3D4IA 3JASB 4NK4A 4EI9A 3U16A 4Q3DA 1RAIA 2D0OB 3A6FA 5C4MA 1WB9A 3OZTA 3V8VA 1G41A 1B3RA 2PRZA 2R60A 3ESQA 3JWHA 5KNCA 2E4VA 4YX9A 1JA9A 3VDMA 1XNRB 4NJEB 4JYBA 4JBIA 4QRHA 2XQKA 3BFVA 1YR8A 2HQBA 2MIIA 3I83A 4ZPXA 1TPZA 4J0FA 1V96A 2GD2A 5K0LA 4JKOA 1XVAA 1NW6A 3G82C 4JLUA 1KU0A 4C05A 3BMXA 2GQ0A 3LIPA 5H83A 1YCDA 5KCZA 4WXEA 1OXTA 1L6IA 1JA0A 2YBDA 1FNNA 2QA5A 2FMFA 3R5FA 5EN4A 3WMGA 2BE9A 3M5WA 1GSAA 3QBJA 2V6JA 3H9GA 2HUNA 3OCCA 1UJ5A 2O0HA 2QTVB 1W94A 4DA9A 3THWA 4DLWA 5HVNA 1H2RS 3A26A 4WOBA 5A3SA 3AY0A 4QHSA 1C0EA 2W22A 3OJ0A 3A27A 3NBUA 1U4SA 4TRMA 3K9LA 2ZAIA 4FQ7A 4JIMA 3DHNA 4YJ3A 3U7QA 4B6RA 5K8UA 1R8XA 1EDOA 4ARVA 4C01A 2GM4A 4QOEA 3DF7A 3WLNA 1J9ZA 1L7DA 4L0QA 1SHKA 5FI3A 1G21E 1ZSNA 3ZCVA 1A8IA 1HDXA 3AF5A 2NV6A 1BRTA 4KNVA 5AVTA 2GHQA 4HWSA 4ESEA 5LYJB 2WY2D 5EHZA 2NSJA 2JBWA 2AOUB 2XQFA 4LAFA 1NOKA 3L8YA 4HS4A 1OXKB 1Q7GA 3C6ZA 1A9TA 1P39A 2JGKA 3O8OA 4KIJA 3WNZA 3BWMA 3K0CC 2QEQA 1WKVA 5F5LA 1GHTA 4D3FA 3E9NA 4MVJH 2MINA 3P2IA 3WAKA 1M6VB 3E15A 4HK4A 5NULA 5AVUA 4EFLA 2BTQB 3AR3A 4WFQA 4UOQA 1ODSA 5GGYA 1C0LA 2E89A 4TYWA 9MHTA 1XT6A 2FWNA 4JWKA 2FJ0A 1P9NA 2FSVA 1IU9A 3ICWA 2KBEA 1KJQA 5CLQA 5ES3A 5GIOE 2DH5A 2A35A 1J90A 1JG3A 2M2IA 4ZVPA 5J63A 5KWEA 2NUAB 2UYOA 1CQJA 3EOBI 1J2EA 1NC1A 3AFIA 3AYZB 3K30A 3DZKA 1TK9A 3GBSA 2XRFA 2LW7A 3WMEA 5KKNB 3PX7A 1DC8A 1OMOA 1DJPA 1V7CA 3R40A 2C5HA 3CZ9A 1XJWA 2B8WA 4LNAA 4XCQA 3TB4A 3FSGA 2C04A 1KO7A 1DTWB 5JZBA 1E0KA 4R9SA 3NDJA 2VJYA 4L0CA 1EVYA 4S12A 3ZDRA 4NPAA 3F49S 1WMBA 2H9YA 5EMLA 4BEBA 1N1DA 3VZSA 2RK6A 1UBFA 5LMZA 3BWCA 1C7JA 1FTSA 2PUJA 3I6BA 1X7XA 3D64A 4KRGA 3ZDZB 5FAKA 1SULA 2WUDA 3LGXA 1GZ5A 3HDJA 4TTTS 1Z63A 2ZYGA 3GXBA 4D4GA 1UWKA 2GK3A 2IRWA 2YWXA 2DFKB 2IPNA 2IPAB 3O83A 4YPOA 4JBWA 3ZTTA 4B3CA 2IEIA 5CMLA 3KSMA 3TJZA 2HWXA 1D1TA 1PJQA 1RKQA 2I7CA 2N0SA 2PTGA 2Y92A 1F2UB 3HKEB 3KTFA 5H70A 3RR2A 4CV3A 4AWAA 4D9BA 5ITVA 3NBZC 3WX0A 1U9YA 1OC2A 3JQAA 3ICOA 4L9SA 2PGIA 4EABA 1JPVA 4JI0B 3LV8A 5J3JA 3ESBA 3EY9A 1I7SB 1E1LA 3FJYA 1OT3A 2DKNA 4UVIA 1DJLA 5IEJA 1U2DC 2FMUA 1O0SA 3FR8A 3K05A 4HTFA 1X19A 4M1WA 4TMVA 1I0LA 2CMHA 4IIBA 4DWWA 3OE5A 1D03A 1PWHA 1V3TA 2G70A 4MUMA 3TGWA 2XZOA 3AL0C 2Q3JA 4PSAA 3DVQX 4E5UA 2I71A 3ZGLA 3EAFA 1ID8A 4Q34A 4KL8S 1QONA 3NANA 1RPNA 5FL3A 1N0VC 4L8LA 4F4IA 2V6GA 4QYXA 3RAJA 3CB4A 4U39A 5CX1A 1VE7A 3OJCA 1YCHA 1FQWA 2JKVA 3LUDA 4GOND 1VKRA 3RJZA 5EIEA 1JIVA 5MN5A 3K6SB 2UYQA 4GOJA 1FFDA 1FDVA 5FYQA 5ALKA 5KNBH 3FGPA 3K9CA 2PMEA 4L5BA 5F7XA 2JS7A 4DQXA 3NBFA 4ZI7B 4M0LA 3VC2A 1QHSA 2XY4A 4RIIA 4ZCPA 1T9BA 1R0LA 4J76A 1GSIA 4LJRA 1MOPA 3EPLA 4ZHQB 5SYNA 1AUOA 1MD9A 2Q6IA 3E6AA 2Y4OA 7MHTA 2GGSA 5IM4A 2NV2B 1W36C 3R3ZA 4NAVA 1ODCA 3N2LA 4C3ZA 4BKQA 3I58A 2R6CA 1UC5B 4RH3A 4D43A 4C7OB 1NUTA 3O0TA 2GYWA 1Y8QA 4XD2A 3WC4A 3RG2A 1AZWA 2MINB 2AG1A 1V5EA 2FSUA 4CFSA 4P6VF 2GZAA 4PBTA 4C4ZA 1E0AA 5EHIA 2R87A 1MX3A 2P9CA 2DPHA 4LTMA 3UWKA 3O84A 2FFRA 4EKNB 1VI6A 1UMBA 3ZN2A 3BE6A 3MUEA 2O2IA 4DV0B 3U4CA 1P1RA 3PFNA 4A8TA 1ZM9A 4M9QA 3C8UA 1GUBA 5AOCA 1G7CA 3QVLA 1OI4A 2OHGA 1PGJA 2WFLB 3OJEA 3WWDA 3S3TA 4B3TB 1GG8A 4RFSA 1VKNA 1RBQA 2WU1A 2ZUTA 2C7VA 1GYRA 2FPRA 2FV8A 2ZS9A 3A7DA 3EDOA 3QVJA 4FCVA 4QWMA 1KWGA 2YQZA 1V6SA 4AICA 4EPYA 4JLWA 3T0GA 4ZYUA 4QSHA 2IDKA 3QTTA 1N2BA 1ONBA 1EFCA 1RHMA 2RARA 2V8BA 2X15A 1W5TA 3HXLA 2ZBRA 3P9RA 4FIZA 4RXTA 5I7AA 4FFLA 2O48X 2J3DA 1XZQA 3KZMA 4IG9A 4LGVA 4QC2A 4CG2A 1JB1A 3UBTA 2B61A 1Q7RA 1QHEA 3MSCA 1THTA 1ZINA 1K92A 1Y1KE 3CT6A 4LOLA 4OQFA 3ZNOA 1N6HA 1YZHA 1Y6ZA 2YZ7A 1W5EA 4JQOA 1TEZA 3ZDBA 4M53A 4QGHA 1Q22A 3NOVA 1GDHA 3QWHA 4P4LA 1V7ZA 4GLLA 4RC9A 3B6KA 4IIFA 5IBRA 5LR6A 1U8AA 3FFBA 4O59O 4CMJA 4PO8A 4S24A 1KGSA 3QGMA 1O96A 2GEDA 1NLFA 2GN1A 2MJLA 3OTIA 5CLHA 3QFFA 3L01A 2JJQA 2F1HA 3IUYA 1R0KA 2B99A 4L4YA 4CRWB 4HMQA 5CA0B 1SCQA 2YWRA 4DM4A 2B4KA 3FOWA 2BFEA 2VCEA 4PLPA 4R1QA 3V8PA 1SK9A 1BSVA 1TYAE 2VXCA 3L0DA 1XQ9A 1IZ9A 1PZNA 3GIDA 1BEZA 3B1KA 3QUTA 1MB2A 4FW8A 4OFWA 4CF3A 5I5EA 5AK4A 2EYQA 3D4BA 3PITA 4N40A 3PDHA 4G01B 1OWPA 3EULA 4NDNE 4US0R 4ZARA 1Z74A 4FDMA 3S6JA 3JZFA 4U7GA 4Z7NB 5B3JA 2JI9A 3ZE9A 4QOJA 1C1DA 4Q9NA 4V2UA 2QJOA 3ESYA 1V8DA 2NO9A 3RVJA 4ZQEA 4IQFA 1FMCA 2CVQA 1ZC3A 1MT3A 4YT5A 1Z16A 4R01A 4C5BA 1N6KA 2O2EA 1E3SA 4ZQIA 1CUDA 3ROEA 3FNEA 2FFBA 2IFTA 5FUVA 1OREA 1A77A 3L1UA 5CXUA 4DQLA 1DS6A 1HH4A 2I80A 2Q9CA 1Q0UA 4NZOA 3CXRA 3GUCA 1SEPA 2O2XA 3VSDA 1IZYA 1KAHA 1ODJA 2LPMA 3FVQA 3A2LA 3R6LA 1NAIA 5EHQA 4XARA 4CTOA 4MTLA 4Y2XA 1NXSA 3H2BA 4LOKA 2QT9A 2R4QA 4K9RA 4EG0A 2PR2A 3ASZA 3T1TA 1LWOA 5DTQA 5H9WA 1YOVA 4YV7A 1KOLA 1NBIA 1Y63A 5DP2A 3NTLA 1OTXA 3WI7A 1GAQA 5B3KA 5MDHA 3H05A 3FFAA 1O6ZA 1U04A 1UADA 2WD8A 4LZPA 1I7QB 4BRZA 1G6HA 3G02A 3V1UA 4WWHA 3I39X 2JDIA 2WA1A 1ODFA 1BS9A 4YCNA 3CG0A 2O7QA 1J0XO 1GJRA 2BKVA 4Y6GB 4LZNA 2PYIA 3DL7A 4B6QA 4YAUA 1B8VA 4E2WA 3EHEA 3EIHA 4YMVA 4L5AA 1SBCA 1CP2A 3EA5A 3FHLA 2FZEA 3IODA 1G2QA 4FOTA 2O5RA 2BH9A 2GXAA 1XCGB 3M1AA 3LOUA 4IINA 4MQEA 3X0DA 3LDHA 4NS4A 4CHTA 5E7MA 1HRDA 1LDNA 3GJ4A 3C5WP 1J09A 1MMFB 4JVLA 3UJCA 4YUXA 2JJ2D 1XDBA 3MGGA 2BDTA 1XAHA 2EWMA 4WFIA 5KOJA 1LY1A 3KSBC 3HJFA 1PGNA 3C4JA 4NZ9A 4IW3B 3W6ZA 3CKMA 1G5QA 3P9CA 3WLSA 1N6NA 1J8FA 3ZQUA 1XQ1A 5AT1A 1K7CA 5B2FA 5CB4F 4JNCA 3MRTA 5BVHB 3M6VA 4UEQA 3QXJA 3ZDXB 4MA5A 2XMRA 1NBMA 2QYHA 2XTZA 1G3UA 2YW9A 2VYQA 2UZIR 3A31A 3L6DA 4R7TA 4WZ6A 3D3JA 3TLKA 2VF5X 2BJHA 4PAQA 1XDUA 1R0SA 3TQFA 1IBMB 1Z0JA 3AJRA 3B48A 2FDXA 4MHSA 4N3CA 1J56A 1PR6A 3NI2A 1WM1A 1YZUA 1QFMA 4TRNA 4D79A 1Z5PA 2OTCA 3IBFA 3L8DA 3IHTA 1BYIA 4LMBA 4Y9UA 5DOVA 5IUNC 5JECA 1GFIA 4B75A 2B5OA 5CJ2A 5TF0A 5AVZA 2VTKA 1NNI1 2P69A 1B7GO 4C7OA 4QATA 4TWIA 1UBSB 1CFJA 4W9NC 1MB9A 4HYEA 2GN9A 4M54A 4PCAA 4MUNA 2QDKA 4M1ZA 4ARIA 3EGDA 4M1YA 1TM4E 2E0IA 1JHRA 4EBBA 4Q66C 5GZ1A 4BMPB 4DPLA 3P94A 1JLRA 1V11B 4WKPA 3KFLA 2ODEA 2ATEA 4QHYA 2W6PA 1E3JA 4UE2A 5BWMA 3A1CA 5I9IA 1KYYA 3IA2A 2CHQA 3JAKA 3ZWXA 5HUJA 2D74A 3PHIA 3V8BA 1ZA2A 1YQEA 4X5OA 1Q11A 1FJXA 4CMIB 3NAMA 2AG8A 2GD6A 1X1DA 4DJTA 1T13A 4UM9B 4RIGA 2FZWA 5EMKA 1VSTA 4FFRA 4TUYA 5LKRA 4D5EA 1UKZA 4NU0A 5EZYB 3WL3A 3BFKA 2PMWB 2QD2A 1GNQA 3A4NA 2KLBA 3K0BA 3F1LA 1PK9A 2QLNA 1K5HA 1Z6PA 4Q3LA 3UQYS 3VZBA 5K9ZA 1U0BB 4DLXA 4C78A 2X3UA 1GPAA 1P2TA 4LMPA 1BNCA 4BZWA 1EMDA 2X8JA 1GV1A 2CY0A 2WWHA 1AKVA 1R74A 3L0PA 3LPMA 5IDVA 3S4YA 5KX5F 2AOTA 4P7KA 3KQKA 2YVKA 2PU7A 4AKSA 2BGNA 3NH9A 4BV3A 1M5RA 3HKBB 3WWPA 3S44A 5HKAA 4FKBA 1M75A 2A86A 3WIBA 1MUUA 3B3QA 4AJEA 3HVIA 2GCEA 3ZK9A 2R8ZA 1F3LA 3NU1A 2PFSA 3Q85A 1N3IA 4M87A 1F2UA 2GCOB 1M9NA 2OOKA 2PGXA 4XWTA 5PNTA 4JDPA 1QVAA 2DUNA 4O0MA 5ARBA 5FBZA 1KEEA 4XD7D 4FZ5A 2MR6A 3K20A 2HF7A 2QD3A 3PS9A 1XNHA 4KO8A 4NCAA 2ZB2A 3DZIA 3NBQA 1L5HB 2BVNA 4N7BA 4DMLA 3TOVA 3RAPR 1V37A 2RIRA 4TPKA 4DVGA 2NZ2A 5AW5A 5CFZA 3W4IA 1BS1A 3OQIA 3UKOA 2DWOA 2JI7A 3IVAA 1NXQA 4I9FA 4F85A 1E7RA 4X64B 1U1DA 3TLGB 4WLUA 3MELA 2QLLA 3PUKA 2N46A 5AQ1A 5IF3A 4Q19A 5AK6A 3GPDG 4Q15A 3FCCA 2OESA 2Q6KA 3KUUA 4IDDA 5CM2Z 2EGUA 2UUCB 1XPUA 3F5FA 2I87A 4CN8A 4GECA 3TW6A 3DFMA 4JQCA 4IZIA 4EI8A 4LWQA 3IBTA 1T6NA 2XB9A 5T6MA 2X23A 3EZFA 2QRKA 1KFCB 3NJ4A 4MK4A 1C1YA 4Q7QA 3CVXA 2J30A 3TLMA 3E82A 3CNQS 1OLXA 2PWPA 2VDKB 3DKRA 2GZDA 3NAQA 2RK3A 3GLIA 2O1EA 3RK0A 4UVDA 2G25A 3VX4A 4A2PA 5DWVA 1AX9A 2B92A 3BEOA 3COZA 4I7EA 1GL7A 3ZE8A 2DPYA 1LTQA 1ZAKA 1NNLA 4CDRA 2XUJA 1NQAO 1N6OA 3CTMA 4RHFA 4AN1A 2CE7A 5DM60 3IMFA 1WSAA 3IGFA 5LYJF 1Y5RA 1CFZA 3OZIA 2J6CA 4IQ0A 4ARSA 3G0IA 4R1LA 5LMCA 1SHZA 4B79A 4HQ0A 4DA0A 5AW6A 2W83A 3ORYA 4Q3CA 3E7DA