4QE3A

Crystal structure of antigen 85c-h260q mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
277
structure length
267
Chain Sequence
b'LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTQSWPYWNEQLVAMKADIQHVLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
total genus 105
structure length 267
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qe3A00
2EEPA 1YS1X 3G0BA 4PQEA 2HDWA 3VKFA 1XZFA 1CUGA 1R4ZA 1HL7A 1YCDA 3WKDA 1F0NA 4IHAA 1CUBA 3BDVA 5ALWA 1XZKA 1BS9A 4QWWA 4MQLA 3W05A 1XQWA 4P08A 1JJIA 4K2AA 2GYWA 3DQZA 3BJMA 2BGRA 4TPKA 2W22A 3N2ZB 4NVRA 2XE4A 4OSEA 3Q8WA 1ZD4A 6YASA 2BUAA 5DJ5A 1CPYA 1KU0A 1DWOA 3WZLA 4IH9A 5AK6A 2WUDA 5H3HA 4QDTA 1UOPA 3O4IA 2HA4A 2YH2A 3CXUA 3WMRA 3D5EA 1ACJA 4MEAA 4QE3A 4X00A 4AMYA 4F60A 4X90A 4XWGA 3ICVA 3A2MA 2FX5A 5F4ZA 4X3CA 4W1SA 4UFPA 1XRMA 3QPDA 4UFOA 5K3EA 2JGJA 1MO2A 4G9GA 3ILSA 4U2DA 3K6KA 1W52X 4UBMA 1E8DA 4B9AA 4OB8A 3MUNA 2VQ6A 3C8HA 4CIBA 4YASA 4G4IA 3AZPA 2XMSA 4NZZA 4CG3A 1QONA 4G8DA 1EDBA 2Y1KA 2GZRA 2GYVA 3W9BA 1TIBA 1L7QA 3GROA 4P92A 4DYHA 3C6BA 1AMNA 1TAHA 4BYMA 2C7BA 4EA6A 4K5QA 4KE7A 2DFPA 5FXMA 2HA3A 4MEBA 2OGZA 2NW6A 3AZQA 1XQXA 1YR2A 5HF6A 5LZ2A 1MN6A 4LYDA 1G4HA 1GZ7A 1EK1A 2XUAA 5J3JA 3G9XA 4UBIA 2Z5GA 3R40A 5DNUA 1AC5A 1XRRA 1VJ5A 1Q0RA 1VE6A 4WFIA 5DTIA 4G9EA 1ODSA 2PX6A 1M33A 2WIKA 1EINA 1XRQA 1ZI8A 5DYWA 4UHDA 2WG0A 5EIEA 3OG9A 2WFLA 2B4KA 1EVEA 5JATA 3WWCA 3BL8A 3GZJA 1TQHA 4LKOA 1ZGBA 4QLOA 4DLNA 5A6VA 2DQZA 2LIPA 4BZZA 3D3NA 5IVIA 2DHCA 2PSHA 1XZCA 3NOXA 5A7HA 3VXKA 2HIHA 1EX9A 1YAJA 3I1YA 3O4GA 3QMVA 5ALJA 5FLKA 1Q0ZA 1Q84A 4AQDA 5T4FA 3QPCA 3KXPA 3FYUB 1BU8A 2X76A 3CCBA 4K6KA 1E89A 1DINA 1FFAA 3LP5A 4FHZA 3H2HA 3FCYA 1XQYA 1OXMA 1K6EA 2QS9A 4Y7DA 1F6WA 4WDRA 3DYIA 1JFRA 3QVMA 3V1NA 4ARBA 4J0KA 3PICA 4HRXA 4OYLA 5JADA 2GZSA 4BVKA 5IKXA 1XZDA 3H1AA 5ALVA 5HKAA 4H35A 3G7NA 4CCYA 3FLAA 2OLEA 2QTBA 4J7AA 3WWEA 1QTIA 1XLWA 2CEKA 3EF3A 4HXGA 1QIGA 2C5GA 1NX9A 1LBTA 2JBWA 4PV7A 2XLCA 4G8CA 3H1BA 4HZGA 3R41A 1CUVA 3ED1A 5AM2A 1UK7A 4Y9SA 1ZOIA 5BV7A 1A88A 4M0FA 4X97A 4A16A 4O08A 3G9TA 1DWPA 5ALOA 2C58A 2IX9A 1I6WA 3RLIA 3FVTA 5FV4A 2PUJA 5A7GA 5LZ5A 1Y37A 1JMKC 2ECFA 4PSDA 2HADA 3F9CA 4BP8A 1MAAA 4H0CA 4ETWA 3G0IA 4UUQA 1DQYA 2BAGA 1TCAA 4W63A 4J0DA 2QRUA 3GELA 5CT8A 4QZVA 1IUNA 2VJAA 4Y2JA 2XUQA 3VDXA 2HA5A 3WIBA 3R0VA 3DOHA 3PFCA 1BN7A 4H7HA 1DQZA 1QTRA 3EQ7A 4FBLA 4QA9A 3I2IA 1HLGA 3IIIA 2XLBA 2BCEA 1GKLA 3F8SA 1S8OA 5BWCA 1J1IA 2Z8XA 4U2GA 2D5LA 3AIMA 3SX4A 3O4HA 4TGLA 2WTMA 3HACA 1E3QA 5LYYA 2JGIA 1TK3A 3S8YA 4BBZA 1SC9A 3BF7A 3EIOA 4KRXA 4UPDA 3W06A 1H22A 1CFJA 4J0GA 4BE9A 5D7BA 3CN9A 1R9MA 1RWQA 2Y2UA 2BUCA 4UBJA 3FWHA 5CW2A 3TGLA 3EQ8A 1CUUA 5ALZA 3WK7A 4Y2QA 4KEAA 2VAVA 4B9EA 4H18A 4MJ3A 3IULA 2C0QA 2H1IA 3FNBA 5CXXA 3WWDA 2ZJ6A 5AP9A 3DKRA 2OQVA 2XDWA 1UK9A 1CR6A 1IUOA 4HVTA 5LIPA 4DNOA 5JZ9A 2ROQA 1FFCA 4BRZA 3RKSA 5AM4A 3WL8A 5DWDA 1WCYA 3WKAA 2GBFA 1CQZA 2WKWA 5AKKA 1CQWA 4AZ0A 1JKMA 1ZIXA 1EXWA 3QMMA 2ZSHA 4RPCA 3MUOA 5A2GA 2PU7A 4JEIA 1A8UA 4C89A 3H2IA 3WQHA 3A2LA 2VAXA 1UXOA 3IUQA 2PBLA 2XQFA 1XRPA 1MAHA 5JIBA 3ANTA 4A23A 5JAPA 2ONCA 2XUKA 3H17A 2XQIA 1WB4A 3WK5A 5EHXA 1ODTC 1GQSA 4N8EA 4FNMA 4C01A 5BWBA 4KAJA 4AB1A 3ZV7A 2RIPA 5HKBA 3DJYA 4QWMA 1E8NA 4B82A 1P0PA 1AX9A 4ZI5A 2PSFA 4D9JA 3FSGD 2OG1A 1IZ8A 3WL5A 4K6HA 1MTZA 5DNVA 5ALEA 2XQJA 4C87A 1YAHA 5AKIA 1XKTA 3ESAA 2OPHA 5AJHA 1QIIA 3I28A 4W1PA 1QIDA 3S2ZA 4P9NA 2CJPA 3WK8A 4E46A 1LZLA 5LZ4A 2JGEA 5AK5A 1ETHA 3LS2A 5K3DA 4M0EA 2XI4A 2H9YA 2J3QA 1XZHA 5JAUA 4KRYA 1ZGCA 4G5XA 1ISPA 3M82A 2PSDA 1UK6A 4G8BA 4AX4A 5LZ8A 1R9NA 5JD6A 1H23A 4X6XA 2H7CA 2CUTA 2BKLA 4DMFA 1DT5A 2CB9A 4BZWA 1MNQA 4CIAA 1SOMA 4QNNA 3L1JA 5AKJA 3LIPA 4EBBA 2OCLA 4HXFB 5A62A 4GW3A 4CG1A 2B9VA 1ZICA 4C6HA 4DNFA 3OC0A 1Y7HA 3D2AA 2WILA 4HTAA 4UBOA 3QPAA 2WIFA 4FLMA 1RP1A 4Q82A 4H7IA 1E8MA 4INZA 5AK4A 2WHQA 4C88A 5LKAA 4B6GA 2P8SA 4BATA 1R1DA 3SK0A 5FPQA 1FJ2A 4N8SA 2Z3WA 1W6RA 4BC0A 1ZIYA 4BP9A 3M3DA 3LLCA 5JANA 1QOZA 1DX6A 1THGA 2WJ4A 4GI1A 5E4JA 3G0DA 1TCBA 2EDAA 2OQIA 4L0CA 2ZYSA 3VISA 2WIDA 1UOOA 1LPBB 1TRHA 3C8DA 1KU6A 1VXRA 5D3ZA 3WK6A 4AO6A 4F5ZA 3STVA 4AO8A 1UT6A 2HU5A 5IVDA 2GBCA 1CUJA 4XJVA 3ESBA 4Q3KA 2I3ZA 2QT9A 2JGKA 2W6CX 1MX5A 3IUMA 1QIEA 5YASA 3DEAA 3U1TA 4OYYA 3HLKA 3H19A 4JYMA 1DU4A 3WWPA 2AJLI 1AQLA 3QMWA 4EHBA 4KACA 3VJKA 4X7BA 2ACEA 4OB7A 1WOMA 1EI9A 2ES4A 4G4JA 3ZLVA 5AOBA 3IVMA 3V9AA 4UHBA 1LGYA 3R3XA 1X2BA 1ZD5A 3T52A 3BWXA 4L72A 5AI0A 5AOAA 5A71A 3JYHA 2C4HA 4DMCA 3WA7A 1U2EA 3SWWA 3DOIA 2DHEA 3NWOA 3FSGA 3OOSA 2XT0A 2XUIA 5CH5A 3VVLA 4DSAA 5JARA 3JWEA 2JIDA 5HFNA 1EB8A 2BJHA 5FRDA 2FJPA 4BVLA 4QEKA 2J4CA 1EB9A 1UK8A 3G02A 4U2FA 4ZXFA 5CH3A 2JGMA 1X2EA 2HL6A 4FLFA 5LLSA 3G9ZA 3O9MA 1BROA 1HQDA 1DT3A 3I2JA 5AI5A 5LZ7A 3FYUA 5AKHA 5ALPA 3IUJA 3STTA 2XUGA 4KE9A 4EY5A 5AIAA 5ALKA 4G4GA 5ALMA 5T4BA 1LZKA 5AO9A 1U8EA 1J2EA 1C4XA 5ALRA 4IH4A 2RONA 4Q3OA 1FFEA 2WJ3A 5FUMA 3QYJA 3D0KA 1QLWA 3WJ2A 3R3ZA 4N5HX 2VTVA 5EHNA 3TEJA 5EIAA 5JAHA 1XZBA 2JGFA 1QFSA 3UUFA 3IURA 1AUOA 1VKHA 1DTEA 4F0JA 3G0GA 2HRRA 2J3DA 1BE0A 4FMPA 4JYPA 3F98A 1IUPA 3ZLUA 2O2HA 4DNPA 5ALUA 2DHDA 2YXPX 1JI3A 4ZWNA 4X91A 4J0IA 2BFNA 3E3AA 4KYVA 4PO3X 4FNGA 5C8XA 1BN6A 1A8SA 3STYA 1VLQA 4QLAA 3K2IA 1WB5A 2ACKA 3R3WA 4RNCA 1CEXA 2AJDA 3HSSA 3C45A 1G66A 4B0OA 2AXEA 4Q34A 3V1LA 3HEAA 5AM5A 2ZYHA 1G42A 1P0QA 2XUFA 1XZAA 4DNQA 2VJBA 1XROA 4B7ZA 5HK8A 1QJ4A 5D6OA 2Y2VA 4ZGBA 5AH0A 3YASA 5A7FA 1XZMA 3R3VA 3PFBA 4EY4A 1VZ2A 3QITA 1U65A 4F21A 2XMZA 4CI9A 1QIFA 5E4YA 3G8YA 5EHQA 1JJFA 1QFMA 4QDOA 4I19A 5LP1A 3LCRA 2IIVA 2WFMA 5HF5A 1L7RA 3IA2A 3DL4A 3E1GA 4ZRDA 1YB7A 1VA5A 1CIJA 3DKKA 1LPMA 2OCIA 4HS9A 1AURA 3STWA 2YYSA 1XRLA 4EB0A 2VF2A 1CVLA 2OCKA 5DTJA 2WUFA 2DR0A 1CV2A 3UMJA 2K2QB 4LXIA 2VT6A 3DD5A 4FLEA 1XZEA 5FPPA 1SCQA 4BB0A 1A7UA 5KREA 2HA7A 2WFLB 5AKLA 5E4TA 1XKLA 5HQ3B 2J4FA 3AZOA 1K63A 2EDCA 2WJ6A 4Y2PA 2WFZA 4NMWA 5AI9A 4I3FA 3HZOA 4X93A 1LPAB 4IQ4A 2H7XA 1UZAA 3N0TA 5CT4A 3FVRA 1B6GA 4DTCA 3F97A 3KOOA 1NU6A 4LXGA 1CUDA 4QDUA 5I9IA 3KSRA 3FLEA 3HXKA 2WSLA 3WKBA 1CUFA 4GXNA 2PSJA 3FLBA 5CT6A 5K3FB 3D59A 3KD2A 3V1MA 4M0MA 2WIGA 2Y6VA 4MWTA 3ZLTA 2HRQA 1MT3A 1W1IA 5C8ZA 3W9UA 1MU0A 3I1IA 3M83A 1W76A 3BIXA 1QO7A 2RI6A 2Z8ZA 4RE5A 2ZJ7A 5AICA 2XQGA 1WHSA 4BTLA 4J0CA 3V48A 1QIJA 5IH7A 3E4DA 4X95A 3ESCA 5CBKA 1ZI6A 1HPLA 2I3DA 5HF9A 2XQKA 2G5TA 2G5PA 4S0XA 1HKHA 3NGMA 4PF1A 4A5SA 4FFVA 1GQRA 1MPXA 3B3QA 2ZVDA 2VSQA 1L7AA 4N8DA 3D2BA 4C4ZA 4DIUA 2Z3ZA 3U0VA 2VJDA 4GWLA 2O2GA 4JNCA 3WIOA 1N8SA 1GT6A 4B85A 2QVBA 1YB6A 3I2GA 3BXPA 1K5PA 2QJWA 1CUIA 1LNSA 1BEZA 3OM8A 4Y2YA 4U2BA 4ITVA 1ZD2P 5K3AA 4ZV9A 1YA8A 1N5RA 3B12A 5HQ3A 2QM0A 4OUKX 4GECA 5E2IA 5T4EA 3O9VA 1E5TA 1CUAA 3WYDA 1JT2A 1XZLA 3DDUA 5FKJA 1C7JA 1CUSA 4XIIA 4BC1A 3C6YA 3C5WP 1F8UA 5DLPA 5CXUA 3AIOA 3W2TA 3PF9A 3MGAA 3PUIA 5CRIA 1Q83A 2Q0XA 5JD4A 4JUIA 1QE3A 5ALNA 5ALHA 4XVCA 3HI4A 5JZSA 2PSEA 1CUCA 1WHTA 5K3FA 3IDAA 1DWQA 1CUEA 1XZIA 4YK7A 3OPMA 3WA6A 4Y2RA 3I6YA 2ZJFA 2YASA 3H2JA 1EDEA 3I2FA 4MXDA 5AOCA 4BAZA 4DMHA 2PL5A 2X5XA 4AXBA 2E3JA 2CBGA 1MX1A 5IVKA 1UKBA 4MYSA 5I8PA 1THTA 3IUNA 1QIHA 4V2IA 3UUEA 4AMZA 4KAFA 2AJCA 1VXOA 4GHWA 4UHEA 1FFDA 3STUA 1WB6A 4BAGA 1Z68A 3ZWQA 2XMCA 5C7YA 1JMYA 4H7FA 1PFQA 3C6XA 4EZIA 2PUHA 4EY8A 4C4XA 5ISMA 5DNWA 4AN1A 4FOLA 5HZGA 1LPOA 1TKRA 3WK4A 4B0PA 4CCYB 3PF8A 4MWSA 3I6MA 5JD5A 3H0CA 1UWCA 1WPRA 4GLBA 4Y2XA 5JASA 4NS4A 5ALXA 2WLSA 3ZI7A 3H2GA 1CLEA 5FOQA 2XUOA 1XQVA 4MYDA 1P0MA 2WG2A 3VVMA 3HABA 3ICWA 4JH0A 4L9AA 4YPVA 3L1IA 3FYUC 1K4YA 1J06A 1TCCA 1T4MA 1U4NA 5AM0A 4K6GA 4DM7A 1QIMA 2B61A 1FSSA 4E11A 2I03A 1XZGA 4CG2A 1P0IA 5ALIA 2XUPA 1H2WA 3T4UA 2WUEA 3WZMA 4H7KA 3WL7A 1QGED 2HA6A 4ZV7A 4FBMA 1VA4A 2BGNA 1RYYA 4Q3LA 5JALA 1E66A 1LBSA 4Q05A 4WFKA 5ALDA 3AINA 2X8BA 1EVQA 5CT5A 3AIKA 3D2CA 5ALLA 3CN7A 5AIBA 3WI7A 2RHWA 5ESRA 1SCKA 3WYNA 2VA9A 2ZYRA 1XRNA 4Y2UA 2WQZA 3EBLA 4GBGA 3QBJA 3EQ9A 5LKRA 4UHHA 4B84A 1PJAA 3DCNA 4E14A 4G1FA 1BCRA 1GKKA 4AO7A 2RGUA 2FJ0A 4BVJA 4RE6A 4XX1A 5I7UA 2JEYA 1OCEA 1BRTA 2CKMA 1H2ZA 2JGLA 4P93A 2JF0A 2BUBA 3PI6A 1AGYA 2C5FA 3CCCA 4X85A 1WPXA 3P2MA 2VATA 2QUAA 2VJCA 2XUHA 2GYUA 2IITA 3C43A 3L1HA 2GBGA 4EY7A 4WDQA 4J0HA 2HU7A 4UBNA 2QJRA 5AK3A 4OU5A 3WWOA 2WU4A 1MJ5A 1WM1A 3B5EA 1O6GA 1YA4A 5K3BA 5EIHA 3WLAA 1W75A 1ZJ5A 4L3WA 4YX9A 3AFIA 3BJRA 3FCXA 1T2NA 4BCCA 1JU4A 3LIIA 2B20A 3AILA 3X3HA 2UZ0A 2WHRA 3BE8A 1AZWA 3SC2A 3TJMA 4DGQA 1ACLA 4OCZA 4Q1VA 1ODCA 1YASA 5KWIA 4FFWA 1W4LA 3KWFA 4H7JA 1IMJA 2R11A 2OGTA 1R50A 3HYSA 2O7VA 1GPKA 1GXSA 4U2EA 3C70A 4AN0A 3FBWA 2OXEA 3HC7A 4PW0A 4B81A 2XMBA 3RM3A 5LZ9A 5ALTA 4BCBA 2VEOA 3IBTA 3GBSA 1H2YA 3RARA 2JEZA 1LPSA 4QDZA 4TVKA 2WM2A 2OAEA 2XMQA 5ALSA 2ZYIA 5AM1A 1G5FA 4J3JA 3Q0TA 2R8BA 4FKBA 3WJ1A 2V9ZA 1YS2X 3QM1A 3VJLA 3OURA 1F0PA 2DCMA 4QDXA 1XLUA 3I2HA 3FOBA 1BCSA 3GFFA 1XLVA 2QUBA 2QKYA 4BRSA 4BDTA 1N5MA 2HHAA 2XMGA 3E0XA 3O0DA 7YASA 4EUSA 3JW8A 5AM3A 3F96A 3WKEA 3A2NA 2C0PA 3C5VA 4PSUA 4HXEB 1EHYA 5ALFA 4PNZA 5ALYA 1GPNA 4X94A 2HU8A 2CZQA 2D0DA 5CH8A 3M81A 4OB6A 1GPLA 5K5EA 4BDSA 3H18A 1VZ3A 5JAOA 3VJMA 2WHPA 4X71A 2WIJA 1C7IA 1CUZA 4Z49A 3HRHA 5BOVA 3KDAA 1MX9A 1ZJ4A 5AKZA 5JYCA 4RGYA 4N5IX 1QZ3A 4CFSA 2OAGA 4X6UA 3A70A 3ESDA 2PM8A 2V96A 3I6ZA 5CURA 2V97A 3V1KA 1VE7A 2PVSA 4H7EA 4WY8A 1PV1A 5CT9A 2HM7A 1EH5A 1CUHA 3A6ZA 3DNMA 4B80A 3AJAA 1LLFA 1ZD3A 5K3CA 1UKCA 1IZ7A 5HFAA 2WUGA 4KE8A 3RK4A 4IO0A 5SYMA 3BDIA 2AJBA 4KR0A 5SYNA 4UHCA 1ORVA 3DS8A 3MVEA 5KBYA 2HA2A 2AJ8A 3STXA 2DQYA 2O2IA 2QXTA 4LXHA 3ANSA 2HFKA 4OU4A 5D3KA 5JZBA 1O6FA 4LHEA 5DYTA 4BE4A 4WJLA 1ORWA 2QXUA 1KEZA 5DYYA 2ORYA 3O4JA 5FP0A 2XMDA 4C4YA 1HBJA 2CMFA 5C8VA 2RHTA 4HAIA 3C6ZA 4PSCA 4Y2VA 2QZPA 3FYTA 4DSZA 4FTWA 4DMKA 1SFRA 4CCWA 1HDEA 1MNAA 5EI5A 4I4CA 4HRYA 2VT7A 2G63A 4H7DA 2WU3A 3QH4A 3BF8A 4IH1A 3D7RA 3H2KA 4LIPD 1R3DA 4U2CA 3WL6A 3WK9A 2GBIA 3I2KA 1LPNA 2ZSIA 1EK2A 3DYVA 4BAUA 2XMRA 2XUDA 2WTNA 1X70A 3ZPXA 5HK9A 1DX4A 1JJBA 1USWA 5AKEA 4BCDA 4UFNA 4ZREA 2WG1A 5AI4A 4AZ3A 4WCVA 5CTAA 5ALGA 3PDCA 2DSNA 2O7RA 1LPPA 4EY6A 1N1MA 5CMLA 4ROTA 3D4LA 1R88A 4Y2TA 1CUXA 4WY5A 1CRLA 1VOTA 2QR5A 1SCIA 1XZJA 1Y7IA 1EA5A 2HFJA 1QO9A 4OD0A 3G0CA 4UBKA 1CUWA 5EHZA 1ZI9A 1J07A 3O95A 1K8QA 2QMQA 4J03A 5IVHA 2PU5A 3OTQA 4H77A 4KE6A 5AKXA 3TRDA 1QIKA 2OGSA 2RAUA 3FAKA 4GEGA 4Y2SA 4OPMA 5AHXA 1EDDA 5AKYA 4FWBA 4MQMA 3GUUA 1B41A 5AI6A 4X92A 5ALQA 3K9BA 2HA0A 4B83A 3BIWA 3KWJA 5KWJA 2FUKA 5T4HA 5EGNA 2PPLA 2G4LA 2XUJA 3IB3A 4FDMA 5EFZA 4E15A 4KAAA 4GDMA 4W9RA 3DL7A 3DLTA 1FFBA 1CUYA 1OILA 3R3YA 3R3UA 5HF8A 5C81A 1YSCA 1NU8A 3F67A 5HCUA 3H04A 5FDFA 1JU3A 2XB6A 3PE6A 3G9UA 5AI8A 4LYEA 4ARAA 5AKGA 3WKCA 4WFJA 2PKYX 2QOEA 1H2XA 1GGVA 3W04A 3PUHA 1D07A 2WHPB 1BEEA 2Y6UA 2I78A 4KJXA 1IVYA 3HJUA 1A8QA 4BTVA 4UHFA 1UFOA 3GA7A 1AKNA 4X6YA 2OCGA 1UOQA 4W1RA 3QZUA 3AUKA 1UKAA 4W1QA 3C87A 3NUZA 2V98A 4UBLA 1XFDA 2H7YA 4J0JA
chains in the Genus database with same CATH superfamily
4NCHA 3L06A 5C8YF 4ER7A 4RLSA 4GRIA 4PLZA 2DKNA 2AYZA 3FPCA 3MXOA 4KUEA 4FJ2A 3OSUA 4IGFA 5EL0A 3VKFA 4F56A 1UBKS 4NOLA 2Y77A 4F97A 5C5EA 1JEYA 4BWYA 1F4PA 2OV8A 4ZZ3A 4DQ0A 5A0FA 1V3QE 1HL7A 3AUJB 1U80A 4FGJA 1Y3BE 4G23A 1RJ9A 5JG7A 3NYQA 4IHAA 5GZ6A 3PXXA 4HDCA 3KVNA 1CUBA 3BDVA 3IHKA 2NSJA 3E48A 1XZKA 1EQAA 1VMKA 2BFAA 3NNNA 3WMWA 5BNZA 1SXJD 3EZXA 4J6EA 5KPDA 1CJUC 3EH2A 4K2AA 4A8HA 5CDFE 4BFCA 4LCBA 2BGRA 2PWBA 5HWSA 1M75A 2FF5A 3N2ZB 3RTBA 3SBXA 2QL7A 1IBKB 2QD2A 1OT3A 1ZD4A 4JA0A 4RV9A 4EKYA 4OJTA 1F1JA 3HWRA 2OM6A 3KYDA 2BUAA 5DJ5A 1CPYA 3FNFA 1NLUA 2BEWA 3M9LA 4HGZA 1ZK4A 2FCRA 2FMHA 2G40A 3IFSA 1Q7TA 2QG9A 1M10A 4I1UA 2I91A 4F96A 4AUKA 3BL5A 3H5LA 1NVUQ 2CDAA 3D3WB 1V1RA 3EISA 5DXJA 5F12A 2Z4SA 2WUDA 1T5TA 3NASA 4GOMD 3H4TA 1TU3A 1P19A 3S2YA 5EXTA 2BH9A 2DKOA 1PR1A 2CXPA 3ETGA 3B6EA 4JI3B 3CRW1 1Q1ZA 4CTNA 3CLRC 2F2TA 3BXXA 5DO9A 4K8OA 2H1WA 1XXHA 2P40A 3AVUA 2G67A 3EVBA 4UCWA 4FN5A 4BLPA 1GCAA 4MEAA 1E32A 4QE3A 2FG7C 3NETA 1DAEA 5JDIA 4Z4IA 4TXHA 2ARKA 4B74A 1DAGA 4F60A 3TYXA 3CS3A 1EYZA 2AN5A 1QYXA 4HQ6A 3WB0A 3NI2A 3VO9A 1GG2A 3LDGA 4JITA 3HWX1 3WLOA 2IYYA 4QIHA 1IZYA 6REQA 3AOEA 1EFDN 2NGRA 2OYCA 3UTDA 2E4YA 2VFAA 1PYGA 4D99A 5F23A 2Q4RA 1KI2A 4ZU6X 5G3YA 1JJVA 1N6OA 3DWFA 3WOHA 1NVBA 4ZEXA 3H2SA 3ZNQA 3N2KA 3D3WA 3MLBA 4TOIA 2ZJ3A 3OOEA 3QPDA 3CNNA 4MVCA 5DLQC 2W8ZA 4RZXA 1M2VA 1S9HA 2JGJA 5AT1A 3NAGA 1MO2A 3COPA 2X86A 5E4FA 3KE9A 1KZ4A 1PGOA 1NR5A 1TQ6A 2BMJA 1QZZA 2P9HA 3LT2A 4URUR 4U2DA 3EYWA 3G2HA 2RGBA 2XWSA 4OMCA 2OBNA 3CCFA 1A8HA 3BERA 3GCZA 3G5UA 4R3NA 4C0WA 1XAJA 4WWHA 4B7UA 1V7QA 2EHJA 2IBTA 4FGUA 3DKPA 3MUNA 3CLSD 3ZKWA 1FSFA 2VP5A 1J8FA 1I9GA 1FPMA 4Z54A 1UKVY 3KLBA 4I9GA 3AZPA 1P5RA 2B4YA 3N70A 1Y5LA 3K7EA 3BFXA 2H16A 2LBPA 4Z9BA 4BNIA 2H5JA 5TB5A 2C7VA 4CV1A 3TUJC 2WSIA 2OR3A 1R4AA 1KXZA 3CEHA 3WR5A 1ULUA 1HQYE 3IMKA 2NQ8A 1QRTA 5K1ZA 3D8NA 3LQYA 4A82A 4GZ6A 4ZOLB 2WWWA 4QYMA 3W9BA 4OL0A 1YDWA 2HNBA 2AI2A 4I6JA 2GM4A 3ZDDA 3FMIA 4FZJA 1ZUHA 2B8WA 2RI0A 4F7DA 4GSYA 5HMMA 1PKEA 3COVA 3J7TA 1YZKA 4X7PA 1PZGA 1RFLA 4E88A 5A4DA 1UDBA 2C4TA 4Q9HA 4BS9A 1YHZA 4MO2A 4DA0A 3HVIA 1L5QA 3C6BA 1TAHA 4LMPA 5JJKA 4X8LA 4F3KA 1X8LA 3QF7A 1K08A 4AJ2A 1GR0A 4CLRA 4ES6A 3VYSB 2C7BA 3BILA 1AXEA 2D5IA 2P5TB 2Q5CA 4ZAVA 4JUFA 2VAWA 3DULA 5KDOA 4KE7A 3GAFA 3HUFA 4GGPA 1Y82A 5ENZA 1XCOA 3LK6A 4RZIA 4MEBA 3DBLB 2OGZA 3BHIA 4AUMA 4L8LA 3BGWA 2C9BA 1XQXA 3ORRA 2EQAA 4Q66C 4E0BA 2PD6A 3TGPA 3RSFA 1RCTE 3KETA 4JUAA 1T5OA 1U1DA 1J0AA 2I2FA 4FVTA 1RJ9B 3NHUA 4H1UA 1BJRE 4J4HA 3PD7A 2J32A 1KC3A 3PEVA 4C08A 1U3DA 4YROA 1MRZA 2OHVA 3UFXB 5DW0A 1SBHA 1A5AB 1M8FA 3OZDA 2VJMB 1U1GA 1EAYA 3AV0B 5D5QA 1V3TA 2HLPA 2JDIA 3WNBA 5JCOA 3OQJA 1UJ6A 1Z17A 1AC5A 1XRRA 1VJ5A 2WMOB 3KZVA 3COYA 1VE6A 3AJEA 4RHTA 3UEOA 3GJXC 2XECA 1JZSA 2OG2A 4B79A 5L7WA 3TF5A 4HX9A 4JUDX 4HNUA 3FWNA 1N25A 2Q28A 2X77A 1EINA 1XRQA 1CETA 2MT9A 3N8DA 5DYWA 4AJNA 2NT3A 3KKQA 2FSGA 3KHKA 1G98A 4AX8A 4DKJA 4Z7JA 2WG0A 2YHSA 3X2SA 1IHOA 1XV5A 3BXOA 3OG9A 2WFLA 5C1PA 1G8MA 2O0JA 4GKVA 2DPYA 5LQCA 4ENUA 3EZYA 3ED5A 5HZMA 1XJ0A 3LE8A 4DV2B 1BWQA 2VPQA 4DR3B 1FYWA 3GZJA 3LHDA 4ZQEA 5LU8A 2YC2C 3KCQA 3E2PA 4YRCA 3UO8B 2RGRA 3G3EA 1TQHA 1EBBA 5HKOA 4HWTA 2IUYA 1UKEA 2B3TA 3D4IA 3EXG2 1HRKA 1Z88A 3FETA 4N5LA 3RYHB 1EP3B 1ES9A 4ZT7A 4OL9A 4EL5A 1YZHA 4PZPA 3MTJA 1L5VA 1U3TA 4Q7JB 4JJEA 3W9YA 1WXDA 1FBTA 4F3NA 5GZ1A 1YL6A 1GT91 1NT4A 1PUJA 1Z4JA 1B14A 3LL4A 4LY6A 4U00A 5C8YA 1EHCA 1L1EA 2DY1A 1T9GR 3B7PA 2NTJA 1G5HA 1NDUA 1VIVA 2NSDA 2FAXA 2HWYA 4JLMA 2JJ2A 1RCUA 5BR1A 3KOXA 5DGCA 2HPHA 3WGLA 3FSJX 3LUPA 3IJRA 4P34A 4XOUA 2E2WA 4Q4HA 4YMVA 3QW2A 2XTNA 3MN1A 1RRPA 2LGJA 2R5FA 2V8BA 1P31A 5ALJA 1I4TD 3TIXB 5IN4A 5K0JA 5T4FA 5KYXA 1QYRA 1RJFA 3QPCA 4WH0A 4B6RA 1M2FA 1CJVC 1N3LA 1WMEA 1BU8A 2VYVD 1YTLA 1NVTA 1GNPA 1Z6XA 3QI7A 3UCFA 1T91A 1EQUA 2XNHA 4B4VA 1FFAA 1OB2A 5IF3A 5FO0A 1Q3TA 4B87A 2JW5A 4IMIB 2JCVA 3QVXA 5D3MA 4XIFA 1V7ZA 2PZBA 4IKEA 4RL6A 3U4DA 3B5IA 2PSSA 2RGWA 1Z6AA 1K6EA 1N77A 4FZRA 4KBGA 1Y6GA 1RCFA 2Z58A 4DA7A 3L4EA 1PJTA 2PLRA 1PT6A 4BNTA 3DNPA 5GM1A 4HATA 4AJJA 3QVMA 3H5IA 1R5OA 3LO5A 2FSFA 3HBMA 2PZ8A 5KOJA 4NI5A 4ZVMA 4BMZA 2PUGA 3TE6A 1XTRA 1SZPA 1TA9A 1YZVA 1KOJA 4JDUA 1MORA 2ZXUA 4UW9A 1M6YA 2YQ4A 2P4UA 1SUWA 4CPDA 3PQ4A 3R5TA 4YEDA 2OD2A 4CQMD 2ZIEA 1LUAA 4GP7A 1AN9A 4QTUB 1C8LA 3LUDA 1I0ZA 4G5FA 1N5KA 1SG6A 5K0LA 1K7EB 2OV3A 1L5NA 3P9ZA 1X7DA 4DUYB 2VHVA 1MLDA 1SOVA 3ENKA 1VJRA 1QS0A 1F4VA 1SU8A 4MS1A 5E7MA 1QTIA 1WLSA 1XKXA 2FZ4A 4G65A 1N2XA 2J3KA 3EPKA 1QIGA 3C1AA 2F8SA 1E4VA 2WM3A 4IRXA 3VFDA 1P4HA 3ML1A 3PQCA 3ZCSA 4DLLA 3AH8A 1NBWB 4PV7A 1SVLA 2V45A 1CUVA 2FSHA 4QC2A 5A4KA 1D3AA 1UK7A 1B6RA 4C2BA 1CNEA 3KKNA 4Z1OA 2XYHA 4IJVA 4L50A 1N2CB 4MJLA 3W6UA 5KTOA 1OZFA 2ZAIA 4NK5A 4DIKA 3U4QB 1A1VA 3OCXA 3LQ1A 3ADBA 4OHCA 2UVQA 1T4DA 4GZ5A 1XTTA 3K0EA 1ZJ6A 4LFBB 3VU9A 4PQYA 5ALOA 1KFCB 1Z8HA 3TSAA 3H6KA 2R79A 4YJGA 3S70A 5EIOA 5JNWA 3BXGA 4L5BA 5EQDA 4CKCB 1OFVA 3U1VA 3DLBA 3RS5A 1PJ4A 3TINA 2ZCVA 3RLIA 3NYIA 3ZGNA 1OROA 1T9GS 5HFJA 2JFGA 2AG6A 5LQDA 1NTRA 3D4PA 5LZ5A 1Q77A 1Z4QA 3BICA 3KR9A 1JSXA 3WYBA 1Y37A 2UYYA 3FBGA 4QBKA 4LC9A 4PSDA 3VOBA 2IQIA 4IXDA 4ALKA 5GJBA 2QV7A 1FX0B 3PYXA 4Q18A 2IXAA 2AMYA 5DNCA 3HDJA 3HMQA 5HR5A 4RTOA 3OQPA 1XJ5A 5CYFA 1TCAA 3GEMA 4O2RA 3ZE9A 1XD2A 2ZWPA 2Z1NA 2BMEA 2VNAA 4NMHA 1N8NA 3PGVA 5F35A 3UCXA 1YULA 4LXXA 4IIEA 4ZICA 4KLRA 1KAEA 1L7NA 3MC1A 5ED4A 1KF0A 1IUNA 1ZUWA 2D0PB 3RHSA 1CQPA 2W6JD 4Y2JA 5BSFA 2D8MA 4QJ5A 4IJMA 4JQOA 2Q9AA 3THXA 1XQ9A 2J5RA 3JD3A 3KALA 4KVZA 1I5OA 1X8KA 1XZ8A 1BIFA 4IRUB 1FL9A 1OFIA 4YC7A 1I3LA 2VYFA 4QFBA 1W88B 2O8DB 1FVFA 3S81A 4MQUA 1SCUB 4HQKA 1A9PA 1LRJA 1PJ3A 4MB6A 3SX0A 4CLEA 3KCNA 4H7HA 4B3RB 1KNQA 2O3TA 3AEUB 3NC0C 3CUKA 1ADBA 4II3A 1KFEB 4FBLA 3AB3A 1WF3A 3F6YA 2WHEA 1EUDB 3WGMA 3WBKA 2DAPA 3ZQJA 4O33A 4RVGA 4ZO6A 1WCWA 2LE0A 3IIIA 4HGPA 4FMDF 2OFWA 4TUYA 1TUBB 3ZI0A 1K6IA 3EZ7A 2BCEA 2FSVA 1BNCA 3M6UA 3HXQA 1ZMTA 5DTQA 1WZEA 2YZKA 2W58A 1S8OA 1RYBA 4L9SA 1M2HA 1ZBDA 3OP4A 1IN6A 2Z8XA 1II9A 3EGEA 4MUBA 4Q16A 5KVSA 4YCNA 5HJ5A 1W5BA 2JC3A 1A8PA 1CCWA 2VH2A 4GF5A 5IBCA 2CZCA 5IG2A 3DT9A 3ACDA 1HNNA 1PWXA 3ADKA 2Q2NA 3AHGA 5BQ3A 4AP9A 3K4PA 5LYYA 1FSZA 5A2QA 1E4EB 5EIBD 3H9QA 2JJMA 3DFKA 4B32A 1TK3A 3A0RB 3A6HA 1ESZA 4GPEA 1KERA 2CLEB 4JENA 3LGAA 5BVGA 3L9WA 3HN6A 2VBGA 3C5HA 3NKLA 3RSSA 4BBZA 1M8JA 5CA0F 2PMEA 4TLAA 3T5MA 4PNPA 1C2YA 5SY4A 3BOSA 3L2OB 4FSXA 4YGYA 1TECE 4FOOA 4AG5A 4F6CA 3U1BA 4US0R 1GSIA 1ZN2A 3RAEC 3BGIA 2OHIA 5HIMA 2ODEA 1L5YA 1KO7A 3QHAA 3W06A 4BNWA 4DCJA 3C41J 1NPDA 3ZVMA 4PRZA 4HH0A 4H31A 1Z0DA 1Y5NA 4IILA 1H0RA 3ZX5A 2N47A 4JL6A 4JSYA 3A6FA 1SR8A 5D7BA 3DTYA 1VL6A 3RAPR 1RWQA 3GJ7A 2BUCA 3GLGA 3ZJUA 3RBAA 2Q5HA 3RC9A 1ZNYA 4I1YA 3ZV5A 2O07A 3AFGA 4Z86A 3ZW7A 3QLJA 4U9UA 3TGLA 3JQFC 1CUUA 5ALZA 2LV8A 3VPCA 3FJYA 3U09A 3CZMA 1L7DA 5A1JA 4B9EA 2QMUA 4M1TA 2WZQA 2J0UA 3CG0A 5DVZA 2LTAA 4ZKDA 2YMPA 4H18A 4NHEA 3OX4A 4MJ3A 4G4SO 4RDHA 3GLIA 3IOBA 3NTVA 1RAHA 2YWHA 1KEUA 3NDBB 3LQ2A 4HGRA 4IKPA 4OXNA 1W2GA 3RNOA 3DKRA 4JK3A 1N2OA 1YHYA 2OILA 2OQVA 1OFUA 2OTCA 2VJLA 2VHQA 1IHUA 1ORRA 2JVKA 3OZXA 3UCEA 2DPHA 1BHJA 4C5BA 1JR4A 4MV6A 2QNRA 3QG1A 5IYZB 2AK2A 1E2GA 4KXLA 4K6CA 1USIA 5LIPA 3F5MA 4XW2A 3TLGB 4MW7A 5I4BA 5JZ9A 1DG3A 1FFCA 2C3PA 3PA6A 4MH0R 4KIJA 4N40A 3RKSA 2WICA 3WL8A 3V2IA 2R25B 3CLUD 3LGSA 4KV7A 3WKAA 1NMSA 3TLYA 1M34A 2HRBA 4CMEA 1FB5A 2IPOA 1CQWA 2BKVA 5A9SB 3TQHA 1BAPA 3L0ZA 1X7YA 2C84A 1MG5A 1F38A 3VNBA 3W5SA 3WDKA 4TKLA 3GH3A 3LGXA 3ZU6A 1EXWA 3DH0A 4EH1A 3BPSA 3DLCA 1PHRA 4TT3A 3ZZ0A 1U6KA 5DU2A 1OF1A 4O0MA 3B52X 1UXKA 4RTRA 2ZSHA 3QFCA 1LLUA 2BD0A 1A9TA 1AZTA 8OHMA 1DC8A 2FSUA 1E2NA 3MWEB 4C89A 2QLBA 2FRVA 1AHHA 2EBFX 2O6LA 4NG5A 3WQHA 4N65A 2NVUA 3FB1A 3L8YA 3N2GB 1YNSA 2H1VA 3H0KA 1NJFA 1NXPA 1YZLA 3CZ4A 4A26A 4CYMA 5BUSA 4X66B 4URZR 4WA7A 4YHHB 2PBRA 2PBLA 5DWQA 3TTXA 4C6TB 4ZPJA 5TV2A 2YQZA 4GP6A 4BXOB 2W00A 3TZ6A 4E5MA 3GLFB 1MAHA 2J9ZB 3GLHB 3RYCA 1NURA 1X7XA 1QYIA 2MDTA 2W43A 3FTPA 1BH2A 3CZPA 3IBSA 2C3UA 3HCBA 4MW0A 3FVQA 3C8ZA 5DNAA 3T3IA 3VOSA 5JAPA 1CR1A 2XUKA 3VZRA 1QJCA 3FUUA 1G7CA 2MINB 2ZXEA 3PRHA 4QUEA 1WB4A 1X1DA 2WSYB 2ZR9A 5LXTF 1GQSA 3MINB 2PKWA 3IV7A 2IY9A 3HY6A 2P6OA 4N8EA 1R0LA 5HA5A 3UG7A 4CM8A 2ZWMA 5BWBA 4FGKA 5IT0A 1KAHA 1O5IA 1B43A 1T4CB 1HT0A 1Z5NA 1GA4A 1A27A 2QMEA 2QN7A 1AY0A 2HLDA 2VF5X 3HA3A 3OE7D 5CG2A 2BMDA 3WTCA 1QGDA 5K3OA 4QWMA 1WXQA 2Q5FA 5JJ5A 5G4LA 1PJSA 4GRDA 1KYZA 1FW6A 1C9NA 1DO2A 2ZULA 1T3SA 3LCCA 1AX9A 4D9FA 1M72A 1N8KA 2CW5A 4P6VF 3SQOA 2QMZA 3DT6A 4QM7A 1VIDA 1HFJA 2FMFA 2G07A 4K6HA 4UU8A 1ZY2A 3S55A 3K20A 3E82A 1L5KA 3DL0A 3WMXA 1KEEB 5DNVA 3TNFA 3B20A 4HN9A 5ALEA 4WKCA 4E22A 5GGYA 2L18A 5T6MA 3EFHA 1C0KA 2OPHA 3EDCA 4NABA 1G3RA 3EZNA 3GAZA 1B7GO 3R24A 3RIYA 3AVVA 2BZ1A 3IALA 4W1PA 3BSWA 1QIDA 4GPTA 3S2ZA 4WEOA 1VTKA 4A73A 4B4WA 5KJFA 5KQGA 1Z26A 3EUWA 2RE8A 4TYYA 1QR2A 4C7KA 4MQFB 1E2BA 5EXSA 3TN7A 1RQNA 4QM6A 2YJGA 1NVKA 1IL0A 3ZV6A 1OXTA 3IPXA 1LFDB 3GPLA 3UM9A 3BQ9A 5K3DA 2IFTA 3ILXA 4L2IA 4HDRB 5CW1A 5HTOA 4FD2A 3L49A 2P1ZA 3QU4A 4DM4A 2FX3A 2ZI9A 3KVVA 1HQKA 1YJXA 1YOBA 1TQ4A 3BH7A 3Q2IA 4P3OA 5BN3A 5JAUA 3INYA 5KDDA 3QVLA 1ZGCA 1YK1A 3NHLA 3PQ2A 5E7IA 2BRUA 1N4DA 3N28A 3PFFA 2E5LB 1DG1G 4UD2A 5CVCA 1TAUA 2PYIA 3H9BA 4BFYA 2FZWA 1L0BA 2ZRGA 1MAUA 4DDWA 4EVIA 1NE2A 1YDEA 4ZANA 3FCCA 3SZ3A 4E2YA 1RACA 5FL7A 1AKVA 2XR1A 1HFEL 2GFQA 1GPWB 4G0XA 3CRVA 4KFSA 2VQFB 4R5HA 3IKVA 4PYIA 2B2XA 5EEHA 2Q7DA 2YN0A 1V39A 4GYWA 4EKNB 4U63A 2QRLA 1Z3IX 4FKMA 2EJUA 3L8CA 3K0FA 5HQTA 5LOVF 1QAOA 4X7MA 4NBUA 4Q9NA 4AZSA 5GONF 4L5YA 3L1JA 4BHTA 4X54A 4F0JA 4ZXPA 3CH4B 3C1UA 2JATA 1QVAA 3CLTD 4ILKA 4KVAA 4EA9A 5A62A 3CWCA 4I2NA 3WLIA 5KNBD 3H3JA 2RSLA 3HO8A 2B9VA 4ZMRA 3KQOA 4C6HA 5JJBA 4TXLA 1VHDA 1YC5A 1R2QA 1Y7HA 2JLCA 4GX1A 3A6LA 1U2DA 1B26A 5JSZB 3IIKA 4D56A 3QQ5A 3ETCA 3K6SB 2UZ4A 1G5TA 4J2TA 1H05A 4P84A 4HTAA 4ZOBA 4BP1A 1ZL0A 2HR1A 2OMEA 4OHYA 2CNWD 3I01M 3MA0A 5ED0A 4ABTA 1OZGA 1G5IA 5CA0A 4A03A 3AT1A 3WXMA 4KLZA 4TM7A 4R1PA 1G20A 1SU7A 3K35A 1BDJA 4W7HA 1JXOA 1NXTA 2WTAA 3OFNA 1W0CA 2YJ4A 3G0OA 1YCFA 2QRHA 5LKAA 4DG9A 3BMOB 4Y9DA 5EXEA 4B6GA 1BOOA 2YWJA 4LK3A 5E9AA 4FI3C 2O8BA 3SK0A 2ORED 5L4LA 4P5DA 1BVUA 4F86A 4LF8B 3EG5A 3LRPA 4F06A 3PPXA 4N8SA 4DILA 2GBLA 3RAFC 1WQ3A 2RBGA 4OXXA 4BLTA 4UOEA 1OIWA 1ZIYA 2Z57A 3CNLA 5HPYB 2V7UA 3VPSA 4DN6A 1KOGA 1T10A 1K27A 2XYRA 4C04A 4GC9A 4IBOA 2XYVA 2WLTA 4IXMA 4PGHA 4PZEA 4OSPA 3M3DA 3WLEA 4XUGB 4DHWA 1V8ZA 2V6JA 1V2GA 2VP6A 4PN3A 1TYEB 3MINA 2B35A 1IPFA 3OWOA 5E0OA 3GJQA 3TIFA 3WNCA 1P75A 1THGA 3AF2A 4JP8A 1AA9A 2IXTA 2WJ4A 4YACA 4ZTBA 3CW2A 4S1PA 3TLJA 5FH9A 3UQYS 5KVQA 5BYAA 3NH6A 1V47A 3BRCA 3GUZA 2EDAA 2HMTA 2YHIB 4O2AB 1G8AA 3GWZA 1ACMA 3A1EA 2SECE 4OO3A 4QUDA 3HN2A 1YJAA 1H2RS 1NWCA 4FKZA 5BO5A 4PZYA 3OT1A 4LXTA 4RIHA 5FUXA 3E5MA 3ETHA 1F2DA 1QZUA 1X92A 1I30A 2ECOA 2C9CA 3EA4A 3KT6A 5A6SA 4REQB 3WK6A 1QU2A 1ZMOA 4RQUA 3JY6A 4XA8A 1JKJA 3VVBA 4L08A 1XTZA 4UJ3A 3STVA 1R0RE 3CUEF 3DQPA 1O97C 3FHCB 5F51A 2HU5A 4CE6A 2R4TA 4R51A 3RWOA 1Y3AA 1M6WA 2ZRHA 2C4KA 1EM8A 4E13A 3GLKA 4Q3KA 2X41A 4G24A 4OLHA 1IBMB 5IAJA 2QT9A 1U0LA 2JGKA 2TMYA 2W6CX 3QYAA 3VV3A 1T1GA 1MX5A 2VT2A 1ADYA 1HYQA 2UYQA 1K06A 4CMIB 2ZANA 1C0PA 3DEAA 3GLRA 4WNAA 5DRYA 3ZBPA 1K9SA 4EI9A 5F3DA 5CP8A 1XJCA 4QYIA 2EFEB 4JYMA 4OQEA 4ZGGA 3JAWB 1UC5B 1VI2A 2F64A 4WK6A 2VAMA 4YIKA 2W6ZA 4LX8A 3WWPA 1VPDA 2N9UA 5CDGA 4IDBA 1ODKA 2BV3A 4I4TA 9LDTA 2X0FA 4R98A 1HSZA 4FR5A 5F9MA 5I7VA 3E05A 2VP2A 3TVYA 3PL5A 5FAXA 4EHBA 4YMUA 1JYEA 2PQ2A 4MIOA 4OB7A 1DKQA 2Z2ZA 3T7DA 4P0PB 2ZVJA 1P1CA 2ES4A 2Y0BA 1H8HD 3ZLVA 1DB3A 1KZGB 2DECA 2G04A 2A1TS 4IPTA 5AOBA 4N7BA 5IC6A 3SM9A 1WETA 4WECA 1FDTA 1FQWA 2DLDA 2IYUA 1IDN1 3GLVA 3PX2A 4RDCA 4CEIB 2F62A 3P9KA 2W5UA 4H6XA 3NXSA 1XZNA 2GTHA 3QFFA 4JS0A 5EZSA 4ZI2A 3L7JA 3BWXA 4BNYA 4JBGA 1KVQA 4L72A 1K68A 3BHJA 1VL1A 1CX9B 1ZP6A 2ZBRA 2AS0A 3KKEA 5AVKA 2CL6X 3KOZA 5E7QA 3QE3A 3WGNA 5BUQA 1ADFA 5J2UB 4BASA 3LX5A 4LWOA 4MRRA 2PH1A 2H0AA 3QELB 5JROA 2B0JA 1OLUB 1XDBA 1KAGA 2A0XA 1FYVA 3AM3A 5T41A 3A1NA 1JE1A 2PAAA 2J07A 1G3MA 1H0HA 3MWKA 3OOSA 3JQ8A 2XUIA 1Y1RA 5U4QA 2AG1A 5M5BA 2QA5A 1ESCA 1EWVA 2GB4A 5CH5A 3UHPA 3ZIAA 3GRRA 2I66A 1CR0A 3V7WA 1GM5A 3F6BX 5TS3A 1O58A 5FRDA 5KNCD 1VMAA 2EHDA 5CM2Z 3OF5A 2PUVA 5JWHA 4BO6A 4RVCA 5IT5A 1GPMA 1YBVA 3G02A 3ABRB 1HNWB 4JYBA 4ND4A 3VOTA 3IQIX 3KXDA 4O4JF 5DHRA 2QAGC 4DFDA 2X1VA 4EM6A 5HRAA 4JU9A 1XF9A 2V03A 2Q1TA 2JGMA 2XAAA 5KYWB 3TNJA 3LHSA 4JIMA 2X0NA 4RMIA 3TLBA 3VYRB 2YS7A 3O9MA 3PJDA 1XP8A 2PLNA 4K9OA 2B1RA 3RSGA 2FDXA 1M7HA 3VKGA 3TSZA 3D6UA 3QVTA 1HC7A 5JCJD 3E15A 1ZD9A 2CWDA 3GZNA 3I2JA 3A6JA 3KR2A 2O8DA 3CGGA 4L57A 4K9MA 4S1NA 5AKHA 5ALPA 4UE2A 5B57C 3BD9A 4KSYA 2HTEA 5DN6A 4PEVA 1MAVA 2XUGA 4CG0A 4IUYA 1Q0PA 1YR6A 3QLVC 2JB9A 4DDUA 4C7OA 5LOVA 4WEQA 3W2HA 1KQFA 2FN7A 1GEEA 2DFTA 3O4FA 2Q27A 3THOA 4CM1A 2DXIA 5DHPA 2QVCA 3EW7A 4HYTA 3GAMA 2WVAA 4TMTA 4ERXA 1E2EA 5AO9A 2DWOA 1PIWA 1R37A 4G41A 4FSDA 2IWHA 2I87A 3CBQA 3KFXA 1KH2A 4ZO7A 4KSBA 1MQAA 2GEVA 1VE1A 2C03A 2D2EA 2P3LA 3Q10A 1ZD1A 2UZ3A 4NARA 2W4QA 5DWVA 3SFZA 4S1OA 3ZHOA 3LNTA 4CM9D 2WJ3A 4BV2A 1D6JA 3N5CA 4GIBA 5FUMA 1QLWA 1E63A 4FFSA 3A26A 1T2EA 1H1DA 1NMXA 4JNKA 1DMRA 5EEGA 4WZBA 1R10A 3JQ9A 4E4YA 3O8QA 2AHOA 4F4JA 3ZU3A 1CQIB 1T4BA 2V7XA 1NW5A 2WEKA 3PRYA 4QBHA 2WWVD 3AY7A 3OQVA 3GLFA 2D74A 4EBFA 3EVAA 1AUOA 2ZS7A 3OIDA 2GAIA 2GTIA 2O3QA 4LYGA 4HUQB 1WL8A 1X7HA 2EP8A 5I8WA 3INTA 4XX0B 2UKDA 2R4QA 5B6IA 4FZVA 4MMXB 4JYPA 4ZYUA 3F98A 4QT0A 4ZDJA 3PLAE 3GFPA 3ZX4A 4W8OA 1KDZA 4B3HA 2RB5A 2HI0A 1TL7C 4GLLA 5HRUA 2Z5VA 3R0ZA 1IN5A 3CMCO 3LQKA 3KJHA 5ECGC 3WLLA 5FWAA 4HMPA 1QLHA 4RWEA 1SN7A 1SD5A 1I33A 3UC9A 1XCGB 2O8EA 1RIFA 2YXPX 5L4SA 1NBOA 1NGSA 2LKCA 2SBTA 3L5OA 4MMYB 5TJHA 1TM4E 2VSFA 3F2VA 4BB6A 3NS7A 3MJEA 4TWJA 4G81A 3WVNA 4L02A 3P52A 4RD4A 4BLSA 1Z8DA 2W2TA 3F7MA 3ODGA 1ESNA 4X91A 3T41A 3RS4A 1YV9A 3TPZA 1DUSA 4PO3X 2Z43A 1UKYA 2C1ZA 1F51E 3G1TA 3SE7A 5C8XA 1HLDA 2UVPB 4FHGA 4BMPB 3W05A 1FDOA 2ZI6A 4BY9E 4QLAA 4MI9A 4DHEA 3COSA 3AKDA 5AUPB 4LJ6A 2IUSA 4LQCA 3MG9A 4I3GA 3TAUA 2QPOA 4XJXA 5G0SA 5LNK1 2E49A 4NOJA 3T0IA 4G0WA 1HG0A 2YN4A 3J81k 2RG7A 1X87A 3QHQA 1J42A 5EQTA 4EHIA 1G2IA 4Z6KA 3R5FA 3LC1O 3P9PA 3O8CA 2AJDA 3ZWWA 3MS4A 4JBXA 2H1OA 3I30X 4HWKA 3UMCA 1M1NA 4KPFC 4BE7B 1U2GC 5ERGB 4DT1B 4JEUA 3ZZTA 3FYHA 2I65A 3NHFA 1OGJA 2NYVA 2X2PA 4COOA 2GEJA 4LF4B 1Z4PX 1UDAA 1Q3KA 3SDBA 4KKVA 2BFBA 2X3UA 3V1LA 3HEAA 3V8NA 2JLXA 4AKIA 4IG9A 1SBNE 4OBWA 4AW9A 3NDPA 3K9LA 4I4TF 3IYLW 3FOAA 4BFVA 1GP2A 5EMMA 3SQLA 3SJAA 1ZITA 2R00A 2H1RA 3F6RA 3NBKA 4K0RA 1GVNB 3LY5A 3OTIA 5L7YA 5JCXA 2ZYWX 3RBVA 1UDCA 1XCLA 2BM1A 1I7QB 2I6TA 4IX9A 1JZQA 3CA8A 3EYAA 4JT9A 1KYQA 1QJ4A 2Y2VA 4CV0A 4FFBB 2YZGA 1CNMA 3DLIA 1CDOA 1K7CA 5AH0A 4K1XA 3V8VA 5A7FA 1H9CA 3ENVA 4MDEA 3KYJB 2JIMA 5I9TA 5CB4B 5DGDA 4WNIA 1ZM9A 1B8UA 1GYRA 3DEIA 1GU0A 3Q1KA 5BSVA 1XVAA 2XMZA 5IK2D 1QIFA 4QBFA 4RTPA 3LOPA 4Q47A 3MMNA 2GCGA 1AUQA 3ABIA 4WNCA 5EHQA 3VI4B 1LF5A 2OXCA 2EVWX 1JJFA 4RLFA 1QFMA 4NJEB 1CS4C 4EJMA 1NVMB 1WNTA 1ESEA 5HF5A 5BQXA 4M1SA 1Z34A 2AOXA 3KHSA 3BMQA 5DNEA 3PX7A 1YIAA 3CW8X 3PD0A 2CD7A 3LJKA 4J6FA 4M3NA 1LB1B 3EWSA 3U13A 3TIGA 2PX0A 1YZGA 2BL4A 2QUJA 1F12A 2DJIA 3E1GA 1G8FA 3OMXA 5E1BA 1UMCB 2R97A 3KDSE 3RU3A 4XM0A 2W71A 1YUMA 4CT4B 3V4RA 3NJRA 2AB0A 2OCIA 2ZRNA 3HFSA 2REQA 4RK7A 4OMUA 4TWBA 4A2QA 3JQ9C 1ISJA 1W4CA 2QL9A 2AUTA 1Z4IA 2OCKA 5DTJA 4J29A 2W2KA 2GEDA 2BI4A 3TOCA 1U2RA 2J0UB 1UPXA 2Z2IA 2ZB2A 4NCJA 3H16A 1Z7WA 3A9UA 4YXWA 2GT1A 4C0JA 4BEBA 4MTLA 3PNVA 4BNXA 2SHKA 4GXQA 5EHGA 3NDJA 1RWPA 3OEYA 3JQBC 3LU1A 3AP1A 4D9NA 4MWEA 1J7KA 2QN8A 3A3OA 4IMRA 4O4JA 5A9TA 3ZCPA 1MV5A 2ZE6A 4F2DA 3LYHA 2FVXA 5AKLA 2VXBA 3RS2A 5GTDA 2VQEB 4H3VA 4KI0A 3TK1A 1XKLA 5F1PA 2DTDA 3GDOA 3JD2A 4WZBE 1V8BA 2PGAA 2J4FA 4D7AA 5HM6A 1FDVA 1N2SA 3CNEA 3HCNA 2OKGA 2XWBF 3QF4A 4A6XA 3D54D 1P9RA 1QPZA 1VPLA 3RVPA 1FFHA 4JELA 5I6DA 2FSIA 3R6DA 4QREA 2NACA 3OZCA 4X3PA 4EHAA 2P9EA 3NFYA 4UEOA 3U4AA 3USZA 3LSTA 4HEHA 2WNIA 2OV4A 3IE2A 1HE5A 3MCZA 2FHPA 3VKUA 5CT4A 2X6QA 3FVRA 4KN6A 4IJ6A 5I5GA 1PYDA 4EFKA 1JLLA 3ZQ6A 1Y6QA 2NXWA 3F97A 1B74A 3KOOA 4DTCA 2DR3A 2GVZC 1NKVA 5DX1A 1V8PA 2OXFA 3CH7A 3PFWO 1I7DA 2GERA 1AQ6A 3BE4A 3ANLA 1EVJA 3C98A 4UQLA 5I9IA 1W36B 4XQ0A 3AM5A 2W6JA 4CXMA 2JJ1A 4MKXA 3GG9A 2WSLA 3PCXA 4Z3OA 1S2NA 4GXNA 3TOSA 5HYVA 1YQDA 3B3AA 5C3MA 1VFPA 5K0NA 1PDVA 2JS7A 1F8YA 1P0CA 5AVOA 3BMNB 3BULA 3SYMA 4B3DA 1KZ6A 5EJ7A 4I9NA 3RYFA 3IR6A 5DBOA 3NGXA 3D59A 3FNHA 3KWLA 2VDOB 4RK5A 5T3YA 1R0BA 4MPDA 2HK7A 3L43A 3Q7IA 4NZNA 3P0HA 5DOVA 3CLHA 5EPOA 1XYYA 4JHLA 2O48X 3ZLTA 3RYCB 1U0FA 4HDSA 4RVUA 3LDUA 4P2BA 3U49A 1W1IA 3UWSA 3E9CA 4EJFA 4IHJF 2BRUC 4E6PA 3FTDA 1FNBA 1W76A 1S8AA 5F64A 4F3CA 4BLUA 1I51A 2R8YA 3H11B 4RE5A 3THXB 1YONA 1GTVA 3PU6A 1E58A 3KJXA 4O02B 3ZGVA 3OM1A 1N36B 1FYXA 3AMVA 4IDNA 4JGIA 1QOQB 5FL7D 3L0DA 2BSAA 4PX9A 3C24A 4ZYLA 1ZNQO 2ZZNA 3R9IA 4AF8A 1N7GA 4EW6A 1DBRA 1L8QA 1BW9B 1PF7E 4IIGA 3SXUA 2VN8A 4NOMA 2JAXA 4DE5A 1VM6A 5F9FA 3L7CA 3N59A 2CV1A 1XU7A 3PBKA 3H4MA 4BBAA 3AKYA 3UMGA 5JYDA 1WHSB 1J2UA 1MX3A 2YJZA 3F2IA 5IDVA 3ZWOA 3IGFA 4IF4A 4DDHA 3Q3HA 4ZJUA 3IQXA 5BWMA 1EGQA 3OSZA 4LJYA 2M6KA 2YWBA 1D9XA 5JFGA 2G72A 3DBHA 2G5TA 5TEVA 4NU6A 5JQGF 3PHJA 4E70A 3RI3A 3H2YA 2HBRA 1OIVA 2GAJA 1WW2A 2OQRA 2XNDA 1QC5B 2OWEA 2VSQA 2ZB8A 3IHTA 5AJYA 3NHAA 4PFKA 1HE2A 2OO5C 3OC6A 1L7AA 4BNKA 5EJIA 2EP7A 1XXHE 3IPCA 3I37X 4IZHA 4P83A 4GWLA 4OJKA 4JNCA 5HMLA 5BN4B 1SVNA 3UENA 1E99A 1XL0A 2C2HA 4JX9A 4OKSA 1GT6A 2JDID 3M7IA 2XB4A 4FMBB 4FZ5A 4K86A 3T34A 4BX8A 4B85A 3GO4A 4NFYA 4V3BA 1QORA 2ICAA 3EMDA 4QOJA 2BDUA 3EGCA 3FRIA 4W5HA 2OCBA 4AYWA 3I2GA 4E2FA 5A5VA 1HETA 1J0XO 1K5PA 2JFOA 1ZGHA 3BORA 2Q9CA 1CUIA 1JLHA 2G80A 3C14C 5LMNB 4CQNA 5IF9A 1SVWA 1ZUNB 5G4KB 1BEZA 5C0OE 4G97A 4B5LA 1SZJG 2ZUFA 3BSSA 4ITVA 4YRNA 4OFXA 1RJGA 1AKMA 1WMAA 3NTLA 4IMPA 1SNYA 4U6SA 2XNKA 4WNAB 3TDKA 2GF2A 1WR8A 1YA8A 2JIQA 1GR1A 1K2WA 2AE2A 2QXYA 1F0YA 5BVGB 5HQ3A 1I13A 1XE3A 4CIXA 1GQFA 2I71A 1ORIA 5E2IA 1NNUA 4QUAA 3O9VA 5KTKA 3H3XA 2OZLB 2ZB7A 4YP7A 3E3MA 5K8JB 4IS2A 3WYDA 5KMGA 2B7BA 2WK1A 4IDAA 5CU7A 2X0IA 3KT3A 3WGTA 4BZPA 4YCMA 4FZ3A 4XUCA 5FKJA 1LI7A 1C7JA 4EUEA 5DBFA 3ZLBA 2GO1A 1C8KA 3WE7A 4BC1A 4PSKA 3VR2A 3GEDA 3INNA 4EG1A 2P6RA 4PLHA 3ADDA 3C6YA 1JL3A 1OXVA 3I4FA 3AIOA 3LPNA 3DGEC 1K6JA 4TUYB 2JGNA 3PUIA 1RR6A 1RP7A 3HA2A 5IYZF 3WGHA 4PG8A 4WCDA 5IANA 3GLHA 1DIOB 2Q0XA 2G36A 2SCUA 2W9XA 4KAXA 5JD4A 2JFVA 1EX7A 5K4GA 4BTEA 2C57A 4QGGA 4QOGA 1Q11A 2IZ5A 2JIBA 2Z1MA 3OPQA 4IDDA 5ALHA 3N2GA 1R9GA 2YMMA 3BCSA 3MOIA 5HE8A 5JZSA 2X6RA 4QVKA 4RA9A 3QKTA 3BGOS 1O0SA 1X86B 5EUCA 1N4AA 2IHJA 2FFRA 2H5LA 5KYXB 1BX1A 4KXMA 4D82A 3P5BA 2A67A 1W59A 5BURA 1V6CA 3GVHA 3AO0B 2WJVA 1H4QA 3GDHA 3BZBA 4DJTA 3S44A 2HQBA 3I6YA 5EERA 5TGZA 3EQ6A 2CCKA 1Y98A 2FJUA 2VG8A 2E21A 3W3AH 2L82A 1TIPA 2YIMA 2IXEA 4OMFG 3IOCA 4LQ4A 3FJ1A 1EM8B 1SVKA 1XUOA 1YB5A 1O2DA 1ZK1A 1E5XA 2OSBA 2WSMA 3AUAA 3FDXA 4Q24A 4WXEA 3OI7A 4MDHA 2NU7A 1E0AA 1KRXA 3OIWA 3PC8C 4QJBA 3ENWA 4Q0MA 2PL5A 4U4AA 1ENOA 2RKOA 1W29A 4Z0HO 3CUSA 2AFHA 3GT3A 2CLDX 1TM1E 1T35A 2A9OA 2CBGA 4LK2A 5DYNA 3T5AA 1P7ZA 4D0NA 3OT1B 2HYDA 2HSZA 4LVUA 1EJ6A 4QXMA 3H2BA 3A28A 4WACA 2WW8A 4LTNA 5I8PA 1HNZB 3ET4A 1AH2A 1FX1A 2XZDA 3NONA 1BCSB 1C3XA 1MVNA 1QIHA 5AJZA 3EUAA 3TD2A 4BQRA 1Y1QA 1NI3A 2WVHA 2NO1A 1Y33E 3OAAA 4ECAA 3PGLA 3MCTA 5G2OA 2XCTB 1SC4A 3UUEA 3Q4GA 1U8UA 1I24A 5B1EA 5K09A 4ZCRA 2EGGA 3ZDRA 2ZB4A 1PJZA 1VXOA 3H1FA 3CRZA 4KQ1A 4OHOA 3OQ6A 4GL4A 3TNYA 3WHPA 4ZQIA 2JZNA 1Y1KE 5EJ9A 1VBKA 3RRMA 3TRKA 3CZ5A 1JPJA 2B34A 2GCEA 1XB2A 3T99A 4BAGA 2QGFA 4QGBA 3VDRA 2OBLA 3UAVA 4JKIA 3ZVLA 4CHGA 1VYTA 1T2VA 2AX4A 1RHRA 1PFQA 4BNJA 1WCIA 3NO4A 2XDAA 1K6MA 4CKWA 1Z6PA 2PX2A 4EZIA 2MYPA 3IL2A 2PUHA 2VBIA 1CY0A 1MABB 2YVAA 3GU3A 3I1JA 3LVQE 4YALA 5HIAA 4BLQA 5LQNA 1R0WA 2UUCB 2JJ1D 1TZJA 4ZCQA 4ZN6A 2K2WA 3PT5A 4RXMA 5BRNA 2RGGA 3KQPA 3ZJTA 1M76A 4GUDA 2AXNA 2XCQA 2V65A 4KQKA 3D4OA 1VYVA 3I6MA 3LH5A 4MQ4A 4MWSA 5D01A 5E0KB 1AXGA 1KK1A 2RHOA 4FSHA 1PZHA 3BXHA 3QEOA 2VYVA 3W3AD 1ILEA 1U94A 5JPCA 1YMUA 1Z5OA 4BO8A 4JBYA 4R2WA 3E0QA 1YMQA 5TR9A 3HKCB 1PT8A 4H3HB 4NS4A 2FFJA 2O3JA 2H4JA 3O2SB 1HDCA 1TYZA 3CZQA 3HFRA 3JSAA 2QM8A 4M0CA 4TLDA 1U31A 2YVQA 1HT3A 4YCJA 1L5HB 1CLEA 4C14A 1QV6A 5CDUA 1XEFA 1NPTO 3C85A 3IDZA 4QPCA 2ZUEA 1A04A 2QLJA 5LD2B 2WNSA 1UP7A 2Y1FA 5ENDA 4CQMB 4CT5A 1Q50A 3R20A 4LY9A 1KMCA 3CX4A 2FFAA 1P0MA 1B8PA 1VRWA 3SHTA 3AKZA 4D44A 4GU5A 4NU8X 3X1DA 2UXDB 2ETXA 1W85B 1UODA 1MHPA 1J06A 1TCCA 2FZ5A 4UVDA 3PVCA 1RABA 1SOAA 4GLJA 4K6GA 1QZXA 1H42A 4E94A 1KDTA 1P0IA 2A4KA 2QVXX 4F45A 5AD1A 2A35A 1EZZA 3HE3A 1W0JA 4GX5A 3RT9A 5IAEA 2F9MA 1ULZA 5H9VA 1G2OA 4FIDA 4KWTA 3PIRA 4IFTA 4MNTA 3T4UA 5A5EA 2Q3BA 2YV5A 2VJMA 1ISGA 1TMOA 3NHKA 3PDJA 1UPCA 4FE7A 1F1BA 1OHHD 3QLUA 1XNGA 3WL7A 3MT9A 4H08A 4XOIA 5FAKA 1QGED 3RTCA 2HA6A 3B36A 1I4LD 4IGIA 1K3UB 1UPBA 3DOFA 3RPEA 2NXNA 1EBFA 4CQLA 4DKXA 1B1AA 4OQMA 5IKMA 3MPUA 1FS4A 3F4LA 4HEA6 4Q3LA 2Y4OA 1HZZC 2YFHA 4P80A 1P4JA 1MGPA 4WFKA 2DBVO 1KVUA 3F7OA 5HOEA 4GNKA 3S40A 4C0SA 2Z30A 3X1KA 3OKAA 2P4HX 2P9QA 2NQ2C 4IWYA 4LJSA 2QVYX 4FX2A 5E7JA 1EVQA 2IP1A 3I6QA 2PS0A 3IODA 5DI3A 1YZTA 2WSSA 5ALLA 2LCQA 2VIIA 5IRCD 4MUEA 4MS4B 3WI7A 3GMIA 1B0AA 2RHWA 3DZFA 2GKOA 1RPAA 2YIDA 3DB1A 3GX1A 5EZYA 5CVDA 2GMWA 1XRNA 4JLAA 1YC2A 1S2IA 3CURA 3EEIA 3QBJA 2O8FA 1PR6A 2EL7A 1W19A 3V55A 2QD4A 1SXJC 2Y1DA 3JVEA 4R05A 4HLQB 2YOFA 3A3NA 1LS1A 1SGWA 4S3MA 4PX5A 2IYFA 1UMBB 2PH7A 3F49S 4IWXA 4O8CA 4XX0A 4TS1A 4AO7A 2RGUA 3NOOA 4MSUA 3TGWA 4JX8A 3SG0A 1G291 2XYQA 5CJJA 1GUBA 2IU6A 2ASEA 4D81A 1PUXA 4HWSA 3WAKA 4R1LA 3A6GA 1LBEA 2OP0A 1YDMA 3M9XA 2XGGA 3JRWA 1M73E 1W35A 3K0AA 1P2UA 1UMKA 3FYDA 4QELA 1OCEA 4RV5A 1T9BA 2MHCA 1VQ1A 2Q2WA 4ZVPA 3WYGA 5IYZA 2H4XA 2GJ4A 2JAOA 1JDZA 2IBMA 2ILVA 2PZLA 3COZA 3DMPA 3N2NA 1M6HA 1VBMA 2Q2OA 3DEHA 4AMGA 1NZFA 3AUYA 3TCXB 1AGYA 2C5FA 4G86A 1YR3A 4J8PA 2HF7A 3CCCA 4A0FA 3IAXA 4Y8VA 5JW6A 4G0ZA 4MPRA 3QV2A 1N7IA 1V9CA 1KOLA 2VPYA 1JHXA 1XU9A 1TO2E 2KBEA 2VATA 3NHSA 4MVJM 3V1TC 1HORA 1WSBA 3HBJA 7MHTA 1V1JA 5L9AA 5J63A 4IHQA 1AUPA 3E3LA 1T1RA 2O0KA 1J2TA 3Q3IA 4IVRA 3O84A 4YRRA 2V6GA 3PQFA 1QWSA 3UUWA 3L92A 1QX3A 1FMJA 1C4KA 1VJCA 3IOEA 3Q9UA 2BGGA 4YDHB 1WMFA 3GJ6A 1KVRA 3L1HA 1KS9A 3MT8A 4RY8A 5IZCC 3K9GA 4YFYA 2LCFA 5IM5A 1QKKA 2OAP1 2QUIA 3I9KA 2PQ6A 1QV9A 3M6XA 3R7LA 4QVIA 1UJ2A 1Y81A 4JZKA 1TTPB 4PSVA 4YHBA 4X6LA 5GY7A 3WWOA 5HJ7A 1N2ZA 2BF4A 2WU4A 4D4HA 3K72B 1D7OA 4FMCB 3O83A 2PX4A 1O6GA 2F4NA 5IJAA 1COZA 2GDZA 4YRKA 4LYYA 3GD5A 1TZBA 4GYYA 4OXQA 5AOVA 4YQEA 5IPFA 3IBYA 3UKDA 4MUMA 3EZ6A 3D7MA 5I4IA 3HZHA 4LGCA 1G7RA 5I9BA 4U1RA 3BA1A 2Y1EA 1QPGA 3WLAA 3FCOA 1I1HA 1W75A 2P2YA 3ICCA 3KTDA 4J07A 4L3WA 3G5MA 4GYJA 3BJRA 2QTNA 4F91B 3DGFC 2WT8A 2UAGA 4KV9A 4KPEC 3T5CA 4BCCA 1XQ1A 5AJTA 2XEDA 1EG7A 1JU4A 1EAMA 5CPFA 5K51A 1XK7A 5KIAA 4AROA 5IHXA 1INLA 5DASA 5LP6C 2B20A 2J0QA 4ZEVA 4AKGA 3AILA 3F78A 5FB3A 3BE8A 4OGWA 1AZWA 3RQSA 2BIFA 4DGQA 1Y0BA 4G5HA 3UPUA 5BW4A 3U7EB 3A3PA 2GQ0A 4GPBA 4FS3A 4FFWA 4CDNA 3DE0X 4NCNA 1HYBA 2O20A 3SYTA 5JXHA 2GPWA 1NOKA 4H7JA 1C1DA 1BU5A 5M2QA 4UATA 4RQAA 1F5NA 1EUDA 2CV2A 2R11A 1SCJA 3NPMA 4LJRA 2HTFA 2A5FA 3LQ4A 4LPKA 1JXAA 3HZZA 1A76A 2PKRA 3HYSA 3EUEA 4Q03A 4JJFA 4ZQBA 4U2EA 2RFLA 3FXAA 3HDHA 4DA6A 1PX2A 3A7DA 5K20A 1OWNA 1WMSA 3ZDAA 1UP4A 2V3VA 3UW3A 1Z08A 1OU0A 3R7DA 3G82C 4PQGA 3ROQA 4AN0A 5L7TA 1Z5GA 2NAPA 3FBWA 4NNOA 4UM7A 5TPZA 1G60A 3G2QA 3HC7A 4PW0A 4HNAB 4XEHA 3WYEA 4CIVA 2YX1A 2A86A 2FZLA 4RKQA 2XMBA 2G8LA 3RM3A 2DTEA 4DA4A 4XJSA 2H3HA 3I5MA 3L04A 3TS1A 4F4DA 4RZHA 5ALTA 4EG3A 5KQRA 4BX9A 2YV2A 2VEOA 1NFFA 2C8KA 3C3WA 3GBSA 2XHZA 1X42A 1JIXA 3SQDA 1J0EA 2EGUA 5EWJB 3ZV3A 5FUQA 1EUZA 3ZDYB 1LPSA 2GN8A 4QDZA 4TVKA 4BMYA 3T3NA 2OAEA 1RQGA 1C4OA 2A0YA 4QQ8A 2BHRA 2GLTA 2HIGA 3RJTA 1GFSA 3ZOKA 4IDOA 2OB1A 1C7QA 4O59O 4OLAA 2BP7A 1BW9A 5DP2A 1UWLA 3P32A 1A2KC 1GVHA 2PKQO 3QLVA 1OKKA 5AVJA 2C5AA 4J3JA 2F43A 4YJHB 2ZRBA 1KP2A 2H0QA 4NKRA 1U8ZA 2FWBA 1KL7A 1NIJA 3Q0TA 2DGDA 4FKBA 5CAEA 1U8YA 2QQGA 2VSYA 4GL2A 3WJ1A 2VJYA 2FPKA 3NBYC 4B4KA 1E3TA 2C2YA 3JWPA 1X9IA 2FWNA 2OBXA 4R31A 8ATCA 2XE7A 4MUGA 3R3SA 3BTOA 2G9NA 3RFUA 3QM1A 4RACA 3VJLA 2CWWA 1F0PA 4MKFA 1CJSA 4L8VA 4QDXA 1XLUA 4F84A 3LA8A 3ZD7A 3I2HA 4ZCLA 5DMXA 2RK6A 1N2CA 3I04A 3GVIA 2ZSDA 2NZXA 3DOUA 4FUQA 2FMKA 4WBXC 2Z4TA 3GFFA 1KS2A 1XLVA 5A3RA 4TWAA 4BRSA 4HDAA 1J39A 1KMQA 2AQHA 4CRWB 3O0DA 1YFZA 3FCEA 2JCSA 3GVPA 3H8JA 4KTVE 5IASA 4GQBA 4TTAA 5IN5A 1PGQA 3EA5A 4GM0A 3F96A 4C7BA 2IZ1A 3PGMA 1OYWA 4COKA 2P3OA 3A4TA 3WL3A 3RVDA 4B6SA 1VDMA 3L3BA 1B2RA 4TSFA 2GPJA 1EGMB 3FZEA 3Q9SA 4RGBA 4G01B 2GFHA 2QJOA 2CDRA 3EGWA 4F5EA 4PSUA 3KQLA 1RJWA 5LWHA 1CZUA 1EHYA 5ALFA 1EGVB 3OFND 2B3DA 1XA0A 3K31A 2ZETA 3OY2A 5HCNA 5JNUA 2CEAA 5JDIC 3RS3A 3FYSA 1Q21A 3CC8A 2CZQA 2GCOB 4H3SA 2CLSA 1CQXA 2OXRA 3BK2A 5AM1A 5FV7A 3PR1A 2H2GA 1AGNA 4XASA 1AF7A 3I5AA 1ZX1A 1GPLA 3EIXA 4N1AA 2GBPA 3SZGA 5K5EA 2QQEA 4OJQA 1IN4A 2DFDA 3T9CA 1E2LA 3ANNA 1Z6YA 3AM1A 2QLLA 3C97A 2MMCA 4PAMA 3TZKA 2DQ4A 2WNHA 3DC2A 1E1CA 4TZ0A 5JI2E 4I1VA 3RTDA 3FOEC 2XJ4A 2ZTVA 2FQYA 1L4GA 1JIJA 1ORTA 3SM3A 2O8BB 1C7IA 4JR2A 3PDWA 5CFLA 4P0TA 1C1YA 3NCTA 4Q6WA 3HRHA 5BOVA 2CNKA 4PXAA 2H11A 1AQIA 2JFQA 3D2LA 4NHOA 4IO1A 1KPHA 5U1PA 3HYTA 1WKCA 4U9HS 2WJAA 3S1LA 2JVIA 1ZJ4A 1UJBA 2PIDA 3ZOZA 4HQOA 3DO8A 1JDTA 1XG5A 4IRMA 4P5EA 4DM3A 1Z7BA 3SY8A 2ZROA 3PNPA 5G02A 5TVKA 5FUYA 4DSOA 4F12A 3MSXA 3ELWA 4K9LA 5H0IA 3SHQA 3SKYA 3AERA 4JC4A 2DWQA 3H1PA 5ILOA 3RROA 1PQUA 2IYTA 1Q74A 4B44A 2BDTA 2VZEA 4ALJA 2I4NA 3V4ZA 4EW2A 4GX0A 4P38A 3QEKA 5JJLA 3P0IA 4V0OA 3KL2A 4MGZR 2WABA 2CVHA 3UWMA 3VPGA 3RR2A 5FWYB 4DJJA 2Q9BA 4X45A 2LVBA 4PC7A 2IK8A 1V1RB 3KAPA 2MSWA 2EKQA 3AWDA 3I3SR 3JQAA 2JI4A 4QUJA 4WY8A 1PV1A 1DC7A 2VUHB 5CT9A 2HM7A 2WU8A 4BFXA 4JSTA 3NHPA 1CUHA 3A6ZA 3BXZA 1M1ZA 3AYZB 1K5GA 1RZVA 2ZYVX 4EJSC 3FPGA 5K3CA 1W0JD 4LJKA 1P9WA 5JCOC 5FFFA 5KOYA 5HFAA 3WQBA 1ZLYA 1SEVA 4KE8A 2G25A 3U9TA 4XB1A 4IO0A 5EKXA 4ESVA 1D9ZA 2HWWA 1GFZA 3HKBB 5A4MS 4KVFA 4K28A 3QPVA 4Q3CA 4ZEMA 5F2KA 4Q4AA 2EGHA 3OJLA 1QRDA 1EFPA 1JFSA 4EQ6B 2PJUA 2JIRA 3JVUA 5CEEA 3FFTA 5EE1A 3ROZA 3I76A 2PZJA 4PR0A 1PJLA 5KBYA 3CV3A 4RTMA 3STXA 4JP3A 4AS1A 3W5DA 3GJ0A 5JR3A 2QXTA 4LXHA 1T13A 5JZBA 7AT1A 1A2OA 1QNFA 3C3CA 4LHEA 4PAOA 1V9LA 2GHTA 1BH6A 2R6ZA 1R4MA 3HVUA 4M38A 5HW0A 5ARCA 3UAYA 1C41A 4RTJA 5HJ2A 1D5WA 3IPYA 2QLTA 4FR0A 4V0KA 1BGVA 1WXFA 1WDWB 1RLTA 4P98A 5DYYA 721PA 1O9HA 2JHFA 3ND5A 3UFXA 1IEQA 1Z2PX 2JAQA 3DYBA 1KDOA 1EFPB 4OK5A 2XMDA 5FP0A 4C4YA 1FS6A 1JQBA 2CVFA 4CQLB 1CP2A 4R8VA 1E2PA 2IEIA 1HBJA 4A1OA 4EITA 4MWGA 1FP2A 1VG8A 1XZPA 2X5JO 5C8VA 3DDCA 4L1KA 2RHTA 3TZQA 1PQPA 3T7JA 1HTWA 1Z5WA 4PSCA 2XH8A 3UHFA 5LLDA 2HZ7A 1GAXA 4F11A 2OC9A 3WAJA 1DKNA 4J1TA 4DZZA 3FYTA 4LA4A 1P7YA 4P8RA 1WZUA 3P5SA 2OVFA 4D9BA 1EJBA 3LWNA 1QQ6A 2C92A 2ALJA 1CF9A 4LN1A 3WO1A 1ZO8A 3ZJYA 4KXUA 2PZAA 3OQNA 2O7QA 2P90A 4W6ZA 2A92A 3DBVO 2P6NA 2VT7A 1EK6A 2G63A 1NUAA 3WWYA 5HIIA 2R1UA 5T67A 4G63A 3ZQKA 2IKQA 2XWJI 3LTNC 5L3SA 3TJZA 3L6BA 4CUJA 4B3GA 3BF8A 1LC3A 2A59A 3GAAA 4R2LA 3RGWS 3B6KA 1OXKB 5L4NA 1XAIA 1U7UA 1Y8CA 3H2KA 3RFCA 1IB6A 3SYRA 2YWEA 3WK9A 2D7DA 2GBIA 5M04A 4EJSA 2ZSIA 2YYZA 4TT3D 4L07A 4YR9A 4BMVA 1YI1A 4RH1A 4II2A 4OIMA 3DDHA 1ND6A 2WTNA 1G8PA 1I36A 1K86A 1X70A 4KYUA 5F73A 2O6HA 3SZMA 3ZPXA 1XEXA 3CZRA 4EDFA 1U4SA 1F3OA 1TU0A 3BMNA 1AGRA 4YRIA 4MRAA 2I76A 2QP9X 2Q5EA 4BCDA 4FCVA 1ZGAA 2C7QA 2DB3A 4Q1FA 3UATA 5CCBA 4JGGA 1E61A 4TV9A 1RYMA 3ICOA 4MULA 4XWYA 3Q8XB 1ONNA 1E1CB 5AI4A 4YMSA 4RY0A 1RYFA 3OFSA 3CO0S 4BNUA 1CZLA 4IG4A 2BGTA 3I0NA 3PWSA 5COBA 5CTAA 3U4GA 2AQ8A 3V2GA 1QDUA 2X0RA 3QRWA 3GLFE 3GP5A 3W7VA 1P5HA 1X77A 1VSUA 2DSNA 2O7RA 2VJPA 3C4JA 2VPZA 3DM5A 3RVMA 5AVYA 2P0YA 3GNSA 2HIMA 1JQ5A 1N3IA 2GXUA 1ZM3A 1N1MA 2H63A 2PUBA 5TDHA 1XNQB 3ZE0B 1HA3A 3LLUA 1LJ8A 2QTMA 1NVDA 2V55B 2JVJA 3JQ7A 1BHO1 4JP1A 1VOTA 4CLRB 2QR5A 4FDLA 1SCIA 1XZJA 2R6JA 1Y3IA 1H8HA 1TADA 1HH4A 2P2DA 2NADA 2R7MA 2VA8A 5T6BA 2HFJA 5H02A 4B71A 2WC1A 4L4XA 1K5HA 1V16A 2IEBA 2JKYA 3GDGA 3JAMA 1CS0B 1NBMA 3G0CA 3I53A 3IAS1 1UM9B 2BTQA 1QF9A 1ODLA 1Z73A 4HAXA 3BWVA 2MYTA 5EHZA 2G71A 4KK3A 3QVOA 2SKEA 2CUNA 1Z13A 1QB7A 2D1YA 1VSQA 1L5LA 1KE2A 4ND7A 4OHVA 3UK1A 2C9OA 3AHFA 5ESDA 2Q6IA 1VCNA 1L7BA 2PU5A 3OTQA 4OGLA 3ZKAA 4S04A 1QGOA 4QTTB 1EG2A 1R8YA 4B7XA 4Z51A 5JCZA 5K2OA 1P18A 1SZDA 3QBEA 4RCZA 3RASA 1D0SA 1QP7A 1X7ZB 4CW7A 3BJZA 4N7JA 1NFQA 4QULA 4OPMA 3EJ6A 1H1LA 1M8PA 4URFA 1PK9A 1XAGA 4JC0A 1J9ZA 1HEYA 1PE0A 4PAQA 1M5RA 3HU3A 2G5GX 5LQAA 1N3YA 2J5QA 3AQIA 4LDNA 3RIEA 4HLCA 3BZWA 1QWOA 5F9HA 4H1TA 1DL5A 1PS0A 5TVGA 1NVWQ 4IV0A 5ALQA 1T6YA 3L05A 2G76A 3LYLA 3S68A 4MUIA 1S01A 2CVQA 2HA0A 3UK6A 2RJNA 1JB1A 5EG5A 1DXYA 2WB4A 5E3IA 4ITRC 5DCYA 3EF0A 3HN7A 3SJCA 3LOUA 1SB9A 2DKFA 2YY5A 1XTVA 2NNWB 1P7WA 2FTKE 2G7ZA 5TF0A 3RWMB 4PO1A 2N1BA 3E7DA 3TI7A 2G4LA 3AEYA 5CNJA 4DR2B 4CMHA 4EHFA 5HEKA 1R3UA 4KQGA 3OCYA 3IHWA 5EFZA 1V95A 4KAAA 4E15A 2L2QA 4QQNA 1A7JA 4R16A 3V32A 4GWKA 4JT4A 2I7XA 3JRXA 2EIXA 3LT1A 5F7JA 4BOYA 1G2QA 1AJEA 5FLEX 3DLTA 1OILA 1FNSA 4RIFA 4EI8A 2VP9A 3CH5A 5AHOA 3K6SA 3ZHSA 1SXJE 3RC3A 4ZHQA 1QH9A 4CVNA 1T5DX 1YRYE 4N9WA 4XYMA 3H04A 1WQ4A 1P62B 3OX1A 3PE6A 3LZ6A 3G9UA 4RF5A 5AI8A 3FA2A 2QP4A 3OOHA 4FN4A 4C0LA 2E4XA 3GRPA 3KPVA 3GYGA 3L7DA 4RVDA 2NZYA 4DSUA 1FJHA 4Q3DA 5DW3A 2PKYX 4AT1A 3ICQB 3BZUA 2GF9A 1MH1A 1GNVA 3LDAA 3RO7A 3HLTA 4GOLD 4ME6A 4NK4A 3S2SA