4QE3A

Crystal structure of antigen 85c-h260q mutant
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
277
structure length
267
Chain Sequence
LPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTQSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
publication title Inactivation of the Mycobacterium tuberculosis Antigen 85 Complex by Covalent, Allosteric Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 105
structure length 267
sequence length 277
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qe3A00
1QIFA 1XZDA 3HI4A 5K3FB 4HXGA 5AK6A 4N8DA 5HZGA 2ZSHA 5ALSA 2HA3A 1WPXA 2I78A 2ROQA 1P0QA 3A2NA 3IULA 3VJMA 1W6RA 2Z8XA 1XZJA 3DQZA 4UFOA 4J0GA 3I2GA 4X6YA 5HQ3B 4Y2RA 3STUA 1LPMA 1MU0A 1AZWA 2HRRA 2FX5A 1WM1A 2P8SA 1UFOA 2FJ0A 4S0XA 4U2CA 1MNQA 1LPOA 4RE5A 2B9VA 3O9VA 4H7IA 5LZ4A 4EY8A 1XLUA 4G8DA 1FFEA 1ZIXA 3C8DA 4Y2YA 4KE9A 1EX9A 1R9NA 2XUPA 2JGKA 3DNMA 3H2HA 3WWPA 3D0KA 3GROA 1N1MA 5ALTA 4QNNA 1NX9A 1XZEA 4PSDA 2CUTA 3F67A 3VDXA 4CG2A 4DMHA 3ANTA 4BCDA 4J0DA 4TGLA 5KREA 5CXUA 3QMWA 4U2FA 4FLMA 2W6CX 4AB1A 2QM0A 1NU6A 4Y2JA 4ZV7A 2I3DA 3HABA 2UZ0A 2WFZA 4Q82A 3AINA 4E14A 1Q83A 4INZA 5CTAA 1XKLA 4ZREA 3F97A 2QTBA 1JJFA 4L3WA 5AKXA 5ALVA 4M0FA 1GZ7A 3IB3A 2OG1A 4Q34A 1MX9A 5AI4A 3OM8A 2XQGA 1OXMA 4AO6A 2PSEA 1WB6A 1AX9A 1E8DA 2HRQA 3AUKA 5AM2A 3QBJA 5KWIA 1QZ3A 3CN9A 4Z49A 1ZI9A 2H7YA 2J3QA 2OQIA 5CT5A 2G63A 3AILA 1VXRA 4GHWA 1YR2A 2BUAA 2VJCA 2E3JA 3QZUA 4H7KA 5CH3A 3V1NA 5DLPA 5AJHA 5SYNA 2WG2A 3KWFA 3ZV7A 1VOTA 3HLKA 5EIHA 1G66A 1Y7HA 2ECFA 2Y6UA 4PQEA 1P0MA 3LIPA 4QDTA 5ALPA 1H2WA 4HZGA 4M0EA 2PX6A 5K3FA 2RAUA 5LZ8A 3H04A 3ESCA 5DNVA 1QIDA 5HF8A 4QLOA 4WY8A 2XUHA 2XB6A 4AO8A 4F21A 4LKOA 1ORWA 5FPQA 4BE4A 5ALQA 3WI7A 5HQ3A 5ALNA 3KSRA 4WY5A 2OGSA 3NGMA 2W22A 2G5PA 3LIIA 2PSDA 2QUBA 1EVQA 2QT9A 4WDRA 4AQDA 1N5MA 3O4JA 4EUSA 4UHFA 5AOBA 3UUFA 4QE3A 3I2IA 2XUDA 4MYSA 3VKFA 3W04A 2HIHA 2BAGA 3O9MA 2DHDA 3FAKA 1XLWA 1YSCA 4MXDA 4F5ZA 2QMQA 3D2BA 4LYDA 3WWCA 4WDQA 2V97A 4MEAA 1CUZA 1VJ5A 3QPCA 2OGZA 5ALIA 1EDEA 3LCRA 1VZ3A 1MNAA 1BROA 2ZSIA 1P0IA 4YX9A 3PF9A 5AKJA 1BRTA 1K4YA 2WU3A 3MGAA 5I8PA 5JIBA 2VTVA 2OLEA 2YH2A 3D2AA 2HA2A 2AJBA 4BC0A 2WUGA 2DCMA 4ITVA 4H7FA 2XE4A 3NWOA 3T4UA 3WJ1A 4H18A 4PV7A 3VJKA 2QKYA 1XKTA 2IITA 2Z3ZA 2WSLA 3I6YA 3FLBA 5D3KA 2AJ8A 4CCYB 1R3DA 5FKJA 4UBJA 5T4EA 3S8YA 3WL8A 4IO0A 1ZGBA 2C0PA 5CT6A 3OPMA 4DNQA 1JJBA 1XQYA 2PM8A 2WHRA 3I2FA 3FOBA 1AUOA 5AKEA 4UBLA 1Q84A 4DMCA 2XUOA 1ZI8A 4OUKX 3I6MA 3QMVA 4PF1A 2BJHA 3W06A 2RHTA 4AMYA 4X97A 2RONA 3YASA 4L9AA 1VE7A 4BB0A 4QDOA 1LPPA 2JIDA 1L7AA 3OTQA 3H2GA 2V98A 1QJ4A 5K3CA 2XDWA 3SC2A 2OGTA 3WWEA 1IUOA 3ILSA 3G0BA 3W9BA 3HRHA 5KBYA 1LGYA 4BAUA 3Q8WA 4XWGA 5ALFA 5E2IA 5FUMA 3GFFA 4BAZA 2LIPA 5ALDA 2XMBA 4K6GA 1XRNA 4QDZA 2O7VA 4I4CA 4MYDA 5JARA 1BN7A 1HL7A 5ALMA 1ACLA 5ALKA 2WHPB 4WFKA 3MUOA 4GEGA 5AKLA 2GYUA 3BJMA 2J4FA 1L7QA 2XUFA 3KXPA 1YAJA 1WHSA 5DTIA 2VT7A 5T4BA 4G4JA 4BCBA 4K5QA 5FOQA 2Y2VA 3H1BA 3EBLA 4DNPA 3CXUA 4FNGA 1H2YA 2VAXA 1XQVA 3DCNA 4X00A 5D7BA 3WQHA 4B7ZA 3JWEA 5JYCA 3HJUA 2OAEA 1ORVA 7YASA 5ALRA 1TAHA 1GPNA 1M33A 5LZ7A 2XLBA 4C4ZA 1Q0RA 5CW2A 4V2IA 4X7BA 4RNCA 4Y2VA 5A7GA 3I28A 3RARA 1BCRA 1C7IA 4OU5A 1Z68A 3DL4A 5AKIA 2GBFA 4H35A 2O2GA 5LKAA 2H1IA 3HEAA 4B82A 2OCKA 1XZCA 4KRXA 4OD0A 2Q0XA 1GPKA 3WIOA 2XUKA 3EQ8A 2XQIA 3K2IA 1WOMA 3R3ZA 3RKSA 3AIOA 2YXPX 1WPRA 3H2KA 1VA4A 4E11A 1QONA 2QJRA 4ZWNA 5AK3A 4X71A 2ZJFA 5DYYA 2WFLB 5C8XA 4A23A 4E15A 4CCYA 2OAGA 2RHWA 3ZWQA 1DINA 4IH9A 1A88A 1WHTA 5A6VA 4PSUA 4DIUA 5C7YA 4WFJA 4C89A 2GYVA 3C5WP 5SYMA 1CUYA 2XQFA 4ARBA 4Q3OA 4YASA 4H0CA 1CUCA 1ZJ4A 3DDUA 4PO3X 3WYDA 2FUKA 3B12A 3FLAA 4W1SA 3O4IA 3PUHA 1UKBA 4BYMA 2WKWA 3ICWA 4C88A 4C87A 1QO7A 5ESRA 5JASA 4Y2UA 1JI3A 3AZOA 4BCCA 1FJ2A 4FNMA 4MJ3A 5CT9A 1HPLA 4OU4A 3ICVA 4TPKA 3ZLVA 1CUFA 4DSZA 4HRYA 4QDUA 1XZMA 4DLNA 4HVTA 5JADA 1JMYA 5F4ZA 1XZGA 1VE6A 5AM4A 4FLFA 1JMKC 1YS1X 5AKZA 3OG9A 3BF7A 3D3NA 3AJAA 4P9NA 2VJBA 4HS9A 2Z3WA 1CUXA 3P2MA 3G9TA 1CUIA 4X6UA 4IQ4A 2V9ZA 5K5EA 4OYLA 4J0IA 2VA9A 2B20A 3BIXA 3E0XA 3EQ7A 1S8OA 1BE0A 4DNOA 2BGNA 4QLAA 5ALJA 1X2EA 1BU8A 5LZ5A 2WHPA 4NS4A 2H7CA 4N8EA 5AI5A 3D4LA 2C5FA 2DSNA 3WZMA 1OCEA 4DM7A 2OQVA 3ZLUA 4OB8A 4GI1A 1JU3A 1RWQA 3DYIA 1HLGA 1G4HA 3D5EA 3AZQA 4HXFB 2HA0A 2Y2UA 4B81A 5AKGA 2PU5A 5EHNA 5A71A 2XMDA 1XRMA 5JD4A 4FFWA 4EY5A 1CUAA 1FFAA 3D7RA 1CUVA 3WMRA 2CJPA 3QH4A 1N8SA 2X76A 4DMKA 4H7DA 1CUEA 4MWSA 4N5IX 2J3DA 1QIHA 2WILA 3N0TA 1DTEA 1CV2A 2XMRA 3WKAA 5AK4A 1LZKA 2GBIA 1WB4A 2AJLI 5JAHA 3I1YA 1EDBA 2OCLA 1CQZA 1XZBA 3QITA 5K3AA 1DX4A 2HU5A 4LIPD 3I1IA 1K63A 1F0PA 3AZPA 1LBTA 1IMJA 1R9MA 2DQZA 2VT6A 1K6EA 3U1TA 3VJLA 4CIBA 2WJ6A 1QE3A 3OOSA 5ALYA 2C0QA 5KWJA 4CIAA 5JATA 4G1FA 4B83A 1OILA 5FXMA 4EA6A 4KE8A 4Q3LA 2WFLA 1CUHA 5DYWA 1MAHA 5AO9A 2WUEA 4H7HA 1UXOA 5K3BA 3IUNA 4F60A 1ISPA 3IUMA 2BFNA 5AOCA 1B41A 4GDMA 2YASA 1QTIA 4BDSA 2R11A 5D3ZA 2VQ6A 2JEZA 5IKXA 1CUUA 3PF8A 5HKAA 5C8ZA 1IZ8A 3CN7A 3BL8A 5AHXA 5HF6A 1L7RA 2JGJA 1UOQA 1EI9A 4ARAA 5AP9A 1GXSA 4A16A 3FCXA 2QR5A 5AI8A 4HXEB 4UHHA 5AOAA 3QVMA 2BCEA 1E8MA 2OXEA 4OYYA 5JD6A 2ZJ7A 5HFNA 4BATA 4X92A 1ETHA 3R0VA 5IVDA 2IX9A 5I9IA 3HSSA 1IVYA 3X3HA 4C4YA 1BN6A 1SCKA 1BEZA 4Q3KA 4ZGBA 1UOPA 3L1JA 4CI9A 2VJDA 1JU4A 4BTLA 4UBKA 2HU8A 5E4TA 2DHCA 1YS2X 3HZOA 3H2IA 3PFCA 4X3CA 3QPDA 4KR0A 3W05A 4CCWA 4H7JA 4HRXA 3C43A 4DNFA 1F6WA 4UHCA 4X6XA 3G0GA 4AXBA 1UKCA 4LXIA 4G8CA 3DYVA 5ALHA 2X5XA 4QWMA 3G02A 5CT8A 1MJ5A 4KEAA 5LZ2A 3WK9A 2XUQA 2Y1KA 5AI6A 4OSEA 2GZSA 2ZYHA 4J03A 5CH8A 1AKNA 3FLEA 3GA7A 1AGYA 5DTJA 3QMMA 2WIJA 3H2JA 4C6HA 4W1QA 3F8SA 5FDFA 3BDIA 3RK4A 2EEPA 1XZKA 1IUNA 4U2BA 5K3DA 1EK2A 2C4HA 3C5VA 1ZD3A 2EDAA 2PL5A 5C8VA 5EIEA 3WK7A 5IVKA 2G4LA 2CBGA 1EB8A 1UWCA 2XLCA 2JGFA 2WLSA 1FFDA 5EGNA 1SOMA 2WIFA 1F0NA 2V96A 5LLSA 4U2EA 1F8UA 1XROA 2ZYIA 5AI0A 2ACKA 3TJMA 4BC1A 4BP8A 4ROTA 2B4KA 1LLFA 1TRHA 2PU7A 4MEBA 3PDCA 3V1MA 2WJ4A 4FMPA 5AM0A 1A8SA 2Z8ZA 5T4HA 2DR0A 1DWPA 1XQXA 4QZVA 5JZ9A 4H7EA 3DL7A 5EFZA 5BWCA 4AX4A 4WCVA 3FYUB 4QA9A 4JYPA 2QJWA 4A5SA 1JJIA 2XUJA 1U8EA 5FPPA 3C70A 3C6ZA 1XLVA 5E4YA 3G9UA 3FSGD 3STTA 1Y37A 1YB7A 4FLEA 4JYMA 4QDXA 2JGMA 4X85A 2VSQA 1QIMA 5IH7A 4LHEA 2HDWA 1E89A 1MX5A 5FP0A 4AZ0A 5HFAA 3C6YA 4FBMA 4FHZA 1AMNA 2WHQA 5ALGA 3G7NA 4UUQA 1YCDA 4X90A 1LPBB 1GT6A 4EY6A 3HXKA 4JNCA 3BDVA 4UHBA 1U4NA 5LP1A 4EBBA 5IVHA 1E3QA 3IUJA 4B84A 3G0DA 1VKHA 2VF2A 4CG1A 1ZD2P 4J0JA 4E46A 1XZLA 4W1RA 3R41A 3E3AA 4JUIA 5HCUA 4Y7DA 2DQYA 2PSJA 4JEIA 5T4FA 1RP1A 4AN1A 2H7XA 3VVMA 2CB9A 1LPSA 4NZZA 2XMQA 4RPCA 3C8HA 3GELA 5K3EA 3FBWA 4L0CA 3JYHA 1YASA 1K8QA 2HA5A 1J06A 3A2LA 3ED1A 3PUIA 4MWTA 4K2AA 3QPAA 3EF3A 3KOOA 4U2DA 3KDAA 1XZFA 4G4GA 5LYYA 2XQJA 1EHYA 3IIIA 1PJAA 3G0IA 3DOIA 4GXNA 2Y6VA 5AKHA 1FFBA 1ODSA 3CCBA 4O08A 1GQSA 1CUDA 4FKBA 1SCQA 1NU8A 4I19A 1A7UA 1QFSA 2WTMA 3FVRA 5IVIA 2PBLA 3E1GA 3W2TA 2Z5GA 3V1LA 4FFVA 4KAAA 4KAFA 1WCYA 2AJCA 4ZXFA 1EB9A 4BVJA 3STXA 1DT3A 1JKMA 1CUSA 4BTVA 2PVSA 5EHXA 3LP5A 2GBCA 1K5PA 2HA4A 4EZIA 4RGYA 1UK6A 3BE8A 2JEYA 5I7UA 3WKBA 4B9AA 3ANSA 4P08A 2XMGA 1EDDA 5CH5A 1TCBA 3FYUC 3L1HA 4U2GA 1R1DA 3SX4A 4UBMA 3Q0TA 4GW3A 2NW6A 3FYUA 2O7RA 5ALZA 4GWLA 1ZI6A 3PE6A 3CCCA 5AK5A 5ALEA 2XMZA 5DNUA 5LIPA 3RLIA 1E5TA 2HM7A 4EHBA 3I2KA 1VLQA 4B85A 5FV4A 4XJVA 1DU4A 3WIBA 1GGVA 3LS2A 1VA5A 3O95A 2WTNA 1CQWA 3PFBA 3PICA 1UK8A 5DJ5A 2WUFA 3I6ZA 2EDCA 4IH1A 1ZD4A 2BUBA 1QTRA 1ZJ5A 1TKRA 5AKYA 1GKLA 2OPHA 2PUJA 4AO7A 1XRPA 1XRLA 5J3JA 1AC5A 1XZHA 1H22A 1C4XA 1USWA 5JAUA 1B6GA 3H1AA 5JD5A 4N5HX 5DWDA 3SWWA 4F0JA 3M81A 5H3HA 2DHEA 4G5XA 3HC7A 4LYEA 4DTCA 2X8BA 4J7AA 1DWQA 1IUPA 2WUDA 5JAOA 4FOLA 2WIKA 2OCGA 5HK9A 4G4IA 4XIIA 5C81A 3ZPXA 3OC0A 2YYSA 4Y2TA 2WIGA 5AM1A 1QLWA 3FYTA 4BRSA 2CKMA 3STYA 3H19A 1ZIYA 1QIKA 3WWOA 4BZWA 3DEAA 3C87A 1D07A 1MPXA 1X2BA 2ES4A 4DGQA 1IZ7A 2PSHA 3V1KA 3HACA 1KEZA 3D2CA 1J2EA 1GPLA 1W1IA 5AM5A 4BBZA 4KYVA 4BAGA 4G9GA 1UKAA 1THTA 2OCIA 4DYHA 1CFJA 1XFDA 2AXEA 1FSSA 1H23A 4BP9A 3E4DA 2RGUA 2GZRA 2GBGA 5JALA 4X93A 4X95A 3PI6A 3U0VA 4FTWA 1MX1A 2PSFA 1Q0ZA 3F96A 3STWA 2XUGA 2BUCA 3A70A 4EB0A 5EI5A 2HL6A 1T4MA 4Y2PA 2WQZA 2QZPA 2D0DA 2ZYRA 2WG1A 4KACA 4C4XA 2C58A 2XUIA 2QRUA 5AM3A 1O6GA 1QIGA 1E66A 1BEEA 4BE9A 5AIAA 1CUBA 3QYJA 2DFPA 2HFKA 4LXHA 4L72A 2HA7A 5HK8A 4QWWA 2QXUA 3WYNA 3MUNA 1CUGA 2CMFA 1XRRA 1A8UA 4K6KA 1O6FA 4QEKA 3KWJA 2BKLA 4FWBA 1CVLA 3I2JA 5CXXA 1THGA 5BWBA 2ZJ6A 1ZD5A 3N2ZB 5JZSA 3NOXA 4P92A 3DOHA 4TVKA 3V9AA 2C7BA 1QO9A 3WL6A 1TCCA 3LLCA 1SFRA 1R50A 1VXOA 1DQZA 5HF5A 1CUJA 1ZICA 3R3WA 5AI9A 1ZGCA 5EHZA 3IBTA 5AKKA 2JBWA 1ODTC 1UK9A 1KU0A 1AQLA 2JGEA 1XRQA 4B80A 3F9CA 3H0CA 5ISMA 2PKYX 3OURA 4P93A 4RE6A 1A8QA 4EY4A 1QGED 4UBOA 3VISA 1ACJA 3ESDA 3UUEA 4K6HA 2JGIA 4YPVA 4HAIA 3M83A 2PPLA 3G0CA 2XT0A 3WK4A 4PNZA 3R3XA 1DWOA 2QS9A 2J4CA 3SK0A 3G8YA 2XMCA 5HF9A 3G9ZA 3R3VA 4WJLA 4AMZA 1JFRA 4GLBA 6YASA 4MQLA 5CURA 3FSGA 4IH4A 4JH0A 4UFNA 3VVLA 1W4LA 5YASA 4KE6A 3R3YA 1QOZA 3WK8A 1EH5A 3A6ZA 3DLTA 1XZAA 4IHAA 5DYTA 1X70A 1H2XA 1QFMA 2K2QB 1TCAA 3M3DA 3DKRA 3GUUA 5HKBA 3W9UA 3AFIA 3S2ZA 1GQRA 2G5TA 5A7FA 5EIAA 3T52A 3V48A 2HU7A 4KAJA 1R4ZA 1BS9A 3STVA 5A7HA 4J0HA 5CBKA 4BVLA 3WK6A 3WWDA 4Y9SA 1W76A 3F98A 5BOVA 4UBIA 5ALOA 3EQ9A 1CR6A 3BJRA 3KD2A 4PW0A 3O0DA 4KRYA 2O2HA 2WFMA 3B5EA 3FWHA 1PFQA 2C5GA 3GBSA 4AZ3A 4AN0A 1EK1A 4D9JA 4MQMA 1HQDA 4W9RA 3AIMA 4H77A 3K9BA 1CIJA 4FDMA 3A2MA 3DKKA 3IA2A 5DNWA 3H18A 4PSCA 4KJXA 2VATA 2ONCA 3C45A 3IDAA 1CEXA 3B3QA 3BXPA 3IVMA 4HTAA 1HKHA 3R3UA 1EXWA 2JGLA 4UHDA 5AIBA 3FCYA 1W52X 2QUAA 1J1IA 4NVRA 2QXTA 4W1PA 4M0MA 2XQKA 2RIPA 3MVEA 5ALUA 3WKEA 1LBSA 2HA6A 5BV7A 4I3FA 4CFSA 4J3JA 3C6BA 4ZV9A 5LZ9A 2ACEA 1CRLA 3IUQA 3WLAA 2JF0A 2HHAA 1TK3A 3WZLA 1MT3A 1FFCA 4B6GA 1EINA 1PV1A 1R88A 1QIEA 1YAHA 1UOOA 2PUHA 3DS8A 4EY7A 5A2GA 3EIOA 2WIDA 3JW8A 2H9YA 1ODCA 2WJ3A 1DX6A 4NMWA 2WU4A 1N5RA 2O2IA 4BZZA 1UT6A 1T2NA 1EVEA 1QIIA 1DT5A 4Q05A 4WFIA 4XVCA 4G8BA 1J07A 3ESBA 4C01A 5CT4A 2B61A 1LPAB 5EHQA 2AJDA 4W63A 4UBNA 1LZLA 5A62A 4UPDA 3WL5A 4Q1VA 4J0KA 4UHEA 3IURA 3TGLA 4Y2XA 3R40A 3TEJA 3BWXA 4GBGA 1MTZA 4XX1A 4BDTA 2HADA 4OCZA 4J0CA 1H2ZA 1I6WA 1HDEA 3WK5A 4UFPA 2ZYSA 1LPNA 1UK7A 1TQHA 2XI4A 3WKCA 2WG0A 1UZAA 3RM3A 1VZ2A 1MO2A 2QVBA 1TIBA 4ETWA 1WB5A 2ORYA 2QOEA 5AICA 4CG3A 1KU6A 3GZJA 1DQYA 3BIWA 4KE7A 3QM1A 1U2EA 1G42A 1CLEA 3BF8A 1HBJA 5JZBA 1QIJA 4OPMA 3DD5A 2XUAA 1AURA 2XMSA 3WJ2A 3O4GA 3O4HA 2HFJA 3FNBA 1G5FA 3ESAA 4FBLA 5ALXA 4YK7A 4X91A 3M82A 5ALWA 4BRZA 4DSAA 3HYSA 3L1IA 3WA7A 4OB6A 2FJPA 5AH0A 2ZVDA 1BCSA 5CRIA 2WM2A 2I03A 5E4JA 4ZRDA 1SCIA 3H17A 1JT2A 4X94A 3I2HA 4N8SA 3TRDA 3G9XA 4GECA 4DMFA 1YA4A 4Y2QA 4B0OA 4B9EA 1LNSA 3ZI7A 3K6KA 3WA6A 5CMLA 3VXKA 5D6OA 3C6XA 1EA5A 1XZIA 3FVTA 1P0PA 4Y2SA 3NUZA 3AIKA 5FRDA 3DJYA 5JAPA 1MN6A 2VEOA 2VJAA 2BGRA 1U65A 2IIVA 4LXGA 1E8NA 1W75A 1CPYA 1Y7IA 4G9EA 3D59A 1YB6A 1YA8A 1RYYA 2VAVA 3WKDA 1MAAA 5ALLA 1SC9A 5FLKA 2R8BA 2I3ZA 1XQWA 3WL7A 3UMJA 2D5LA 1ZOIA 4B0PA 2CEKA 2GYWA 5JANA 1GKKA 4ZI5A 4BVKA 4OB7A 1C7JA 5LKRA 3ZLTA 1CUWA 2RI6A 2CZQA
chains in the Genus database with same CATH superfamily
3OPXA 1QIFA 1XZDA 3QI2A 3AV0B 1QS0B 1QZXA 1ETUA 2BEJA 2ZB8A 1G3UA 1VJCA 3N0XA 4TQUS 4QELA 3E9RA 4OF4A 4ARZA 3Q5DA 3L8YA 4HXGA 1BHJA 2R6JA 3HGQA 3NHRA 3E22B 1NLFA 3KFVA 2VUIB 4R1OA 5AK6A 1KR5A 1M1UA 3RFUA 5KYYB 4Y1FA 2IPNA 2DXIA 1C7ZA 1EM6A 5KPDA 3PYLA 1HMYA 2ZSHA 3BBPA 3RSQA 3UOAB 2HYDA 4TKZA 1QC5A 3L6RA 5JW6A 1N34B 1ZUIA 1B15A 1K06A 2JAHA 4XIFA 3O4RA 2EJWA 1GPBA 1J42A 3HEBA 3HN7A 1VYVA 4F84A 1OC4A 2WD8A 4FGZA 1VLZA 2ZIZA 3KKLA 3T95A 4DA7A 3IT2A 4IJKA 5AJZA 1N32B 1H0RA 4C7OB 1PP4A 3DUFA 1BVRA 3PR3A 3WGOA 3TEMA 4OX9Y 2P62A 3JD4A 1K2VN 3OCUA 5AVTA 1KEVA 1YZYA 3D64A 3GOHA 4Y2RA 1SOAA 1C80A 3STUA 5FA5A 1BNCA 2IDJA 5BWMA 5IDWA 4GL4A 1F0KA 1Z4IA 3U4DA 1GL3A 3L0ZA 4TWBA 1JSRA 4G5FA 1PI3A 3DV0A 3E3LA 3HCAA 4ZMRA 5HXAA 2PH1A 1GGNA 3RS8A 4HBZA 1OY1A 4NMMA 1WM1A 3D5TA 4NZMA 4BIIA 1U1CA 3PKZA 1NJ8A 4B4OA 4NC9A 4UASA 4XW2A 4XGQA 3UFXA 1H0KA 4PFJA 4J94A 2ZT6A 5TR9A 1WBBA 4S0XA 3LK7A 1E3IA 2QVYX 2ZSFA 2AL7A 2ZZKA 4FQ5A 3FCEA 4D4HA 3E18A 2VYND 1Y98A 3KZNA 1JLMA 1Q0SA 2H59A 3O9VA 3M9XA 4H7IA 4MB0A 5LZ4A 1B8PA 1KARA 1QFJA 5DT2A 5EZQA 2W90A 5CVVA 3ADKA 5BY2A 4N0PA 4G8DA 3C8DA 4KE9A 3OTIA 1UXKA 1Z5GA 2C2GA 3K96A 3OP1A 4ZT6A 1SRRA 3ORHA 2Q41A 2I7VA 1ZINA 1WVIA 2W8ZA 1IZZA 3MM4A 4C7VA 5C2JB 3BERA 4BPRA 3P4XA 2OO3A 2IYLD 1ULTA 3AUYA 1D2HA 1G5PA 3L82B 3P2JA 3ICQB 4KGXA 2FWIA 3DBLA 5IKEA 4Q3BA 3DT9A 3M2TA 1NXVA 2GZHA 3CVYA 4CQLA 4ZJZA 3DNMA 1UR5A 3IQGX 1OOEA 1QHXA 2IPLA 3KDPA 2GMWA 3QWFA 4M88A 1QDEA 2EGHA 2PR7A 4MYHA 4HUQB 4EO9A 4XYLA 3ZDDA 4YT4A 2BVNA 1C7RA 3RFCA 2I4MA 3PNPA 3MT0A 2UV8A 5EXPA 5AW5A 4DAEA 2OHGA 1NX9A 5I7RA 3JU3A 4IGEA 2PX4A 5AW7A 1VL2A 4PSDA 2CUTA 1GGEA 3FG9A 3C1AA 2XKKA 1EK5A 1B7GO 1UBEA 1BW9B 3WLMA 4J0DA 1IOVA 5LLTA 4JQSA 3I83A 1F14A 1NLYA 3HUFA 3M4ZA 3PUKA 4MMZB 4XKJA 3S55A 4N41A 4U2FA 4FLMA 4O2BA 3Q98A 4XM1A 1XTQA 4JBGA 3L18A 2Z6QA 4Y2JA 1XEXB 2PHZA 1EHCA 2YMLA 3QPWA 5L3RA 3ESQA 5TQ0B 2WFZA 1WPGA 2OFPA 4GXRA 4HX2A 1FJXA 4BZXA 3PA6A 1L4MA 1OV6A 4LZLA 2Q7OE 1YU9A 1VHTA 1UMKA 4INZA 2A14A 4PCUA 4IIEA 4UUPA 3TLAA 2NYVA 4QIHA 1K2WA 1K7CA 3NW9A 8ABPA 2DLDA 4J75A 4XAQA 3QFTA 2GEVA 3AOGA 4OL9A 1GPYA 2IHKA 1GNTA 4FW9A 4JC0A 1B8UA 1GCAA 3CF0A 4M1KA 5ERYA 1H4SA 1VB5A 2IH2A 1G16A 3HCDA 4M0FA 1KO1A 4HZIA 1JEYA 1FW6A 3BIOA 3ZR4B 1JE0A 3IB3A 1SUFA 1Z29A 1ZZEA 1LLDA 3ABSB 2NNLD 1KMHB 3OM8A 2XT9A 3UKDA 1NVFA 2PO7A 1BMFA 4ARVA 4LJRA 2AMJA 2JH9A 2PZAA 4AO6A 5DTRA 2CMKA 3V8RA 2P3QA 1J20A 4DIOA 2FNAA 3OQHA 1JQ5A 4S05A 2X23A 2IU0A 4CHGA 5CDHA 5EMKA 2B7LA 3QBJA 2F8MA 2HRBA 4RPHA 3TQQA 4Z49A 4A82A 4KITB 3N2GB 4XB6B 4OTZA 3FVWA 2V3WA 1PR2A 2QBYB 1DAEA 3VV2A 2I6XA 2VJMA 3BRCA 3F9RA 4QO8A 2GO1A 1ZVJA 4KPUB 2IYPA 4NJMB 3F6YA 3C74A 2YXBA 1FMTA 2VJLA 3KT6A 4G1UC 1YR2A 4TWZA 2BUAA 2VJCA 4C7KA 5C3MA 4LQDA 4MDHA 1YZVA 1XJQA 3LD9A 3V1NA 5DLPA 2SHKA 3QF4B 4XQCA 3RRMA 4JL8A 3WO1A 1ZW6A 2WZBA 2WG2A 4PYKA 3MB8A 1YRHA 2ILVA 2DWQA 4R9VA 2X0IA 3HLKA 1PJCA 3C7AA 3TZ6A 5BNIA 3GEBA 1ZWKA 2NSYA 1NC3A 3JPYA 3AESA 3KE9A 4PINA 3O1IC 5CEFA 1T8UA 3BXOA 3AEKB 5KC8A 3VC2A 4B6PA 2OY0A 1HYQA 3OQPA 2HJWA 2GQ0A 1GTJ1 4KLNA 4F4UA 3PC8C 1U2TA 2EF1A 1WD5A 1M74A 2ECFA 2ZBRA 2V5UA 1YOVB 1ZN9A 2H2FA 3EUFA 2ZWOA 2W7TA 3MMNA 5GJWC 4B71A 4BMSA 4EQ6A 2YWBA 3OQMA 4PQEA 1LB1B 3T3MB 2XGSA 1XVIA 2BHLA 2PH7A 1VRCA 1NX6A 1WP9A 3PC8A 1M67A 3O3CA 3PNBA 5DI9A 4A0SA 4ZAFA 1MEJA 3LIPA 4MUKA 4QDTA 1DKRA 1QXSA 3WHIA 3QEOA 2XECA 4KB5A 2REXB 4Q3AA 3VM6A 4DREA 3EPKA 1QS0A 5CLFA 2V7XA 3S0JA 3T7AA 3GLHA 3NNSA 1ZK3A 4TVBA 1E9VA 1UH5A 2NO9A 2P6PA 3NFYA 4GYKA 4AZSA 4M0EA 2CLOB 4NYIQ 2JA2A 3PYXA 4RENA 5G0SA 4Z9BA 3E22A 1MOPA 5KYYA 2I7DA 5E3IA 2OXFA 1H94A 2V0NA 1MJFA 1EHIA 5T7BA 3PTLA 5FEMA 1KYWA 3N6XA 1QRAA 3QUAA 1SXJE 3JD1A 3CF6R 4QLOA 4UEJA 2G06A 1Z0ZA 4KR2A 4JD5A 2XUHA 4QUGA 3DKVA 1E0SA 1E79D 1MXHA 1WF3A 1WMSA 2JFOA 3C6MA 5GONF 1RFGE 3TTVA 1R9JA 1NMSA 4LKOA 4X8HA 3HBAA 2J5BA 4MW4A 4DA8A 5TJ9A 4CDMA 3H87A 1ZO8A 4KDCA 4X5OA 1COZA 4IKOA 2B8NA 3WP1B 5FPQA 4C7OA 3CBQA 5KDOA 2O5CA 2D13A 2O48X 5AW2A 4F12A 3WI7A 3DQQA 3WYAA 1IXYA 5ALNA 3KSRA 2X41A 3BT7A 4R9NA 2Y77A 3UB3A 4JR2A 3NGMA 4GE3A 1QHYA 3BSFA 3UC5A 3E15A 4X8LA 4AG5A 2PL3A 2YMQA 2EKBA 4U5XA 4BWYA 3HVJA 4GOMD 5L4NA 3P26A 2PSDA 3KV1A 2A0KA 5I01A 1VP9A 2BCGY 2V9CA 1EVQA 3F5QA 3KT8A 1LFAA 3Q72A 5IXJA 1PZFA 2QT9A 4QGSA 4GRAA 3TL6A 1Z5PA 4AD8A 2NXNA 2UUOA 3AUSA 5BSUA 4AQDA 4R51A 4YXWD 1NN1A 2FI1A 4CM1A 3I4FA 1NONA 3OZCA 2JDIA 4WZAB 1TF5A 3FGPA 3FCAA 3GMDA 3HN6A 4ZAWA 1RFLA 4EUSA 4CTJA 4N6OA 1PTJA 3N9IA 4CDNA 3PJRA 3C14C 4BVAA 2QEQA 5J2TF 1KNQA 4Z4IA 4WHMA 1BJTA 3WDKA 2GR9A 2R44A 4MYSA 1NAHA 5D7NA 3VKFA 4H0FA 3W04A 2HIHA 2P9BA 2OYRA 4F4JA 3CUSA 4G23A 4JVMA 2PBFA 3QLEA 3RD5A 2E9SA 5FO1A 1I13A 2RFLA 2WWTA 1WCXA 5EKTA 1YSCA 1DEXA 5ESWA 4TQGA 5KSOA 4H4DA 2ZUFA 4JXJA 2ZSAA 4WDQA 1QR6A 2XWBF 3K0FA 1W6UA 1DB3A 1K3FA 2AEJA 1MDFA 2CYCA 4HUQA 1CUZA 5FI1B 2VCYA 1FYWA 3C5HA 2H4JA 3W2IA 2OB1A 5JNTA 3U3XA 2ZQ5A 1Q0UA 1EDEA 2VUHB 4TYWA 1MA0A 2ZJBA 3CEPB 3CMMA 1MC4A 3TGWA 3MJFA 3FWNA 4CMEC 5I4CA 2PRYA 4O1HA 1OB2A 3TRFA 2CHUA 1LQUA 2DY0A 2OXRA 2Q1UA 1BW9A 1BROA 2OBLA 2IYTA 2ZSIA 3A1WA 3AR9A 4BX0A 3PF9A 4G07A 4FN5A 3B9BA 4II2A 1Z2CA 1JSXA 3UZUA 1EKXA 2QN3A 1MP0A 5B7PA 2VJYA 5AKJA 5JSKA 3USZA 1BRTA 2WU3A 1SWVA 4UM9B 1XEXA 5I8PA 4XGRA 1QOPB 4YFYA 2VTVA 5TQ0A 1QRUA 4HDAA 3RTGA 1ZQ1A 3AQIA 1H93A 4MGZR 4OKSA 1RWOA 3D2AA 5A4AA 1VLHA 1VSUA 3ET5A 4JLAA 4JVOA 3IAM6 2HA2A 1WKBA 4UXJA 3AP2A 2WUGA 2OHIA 1NSFA 1MTOA 4ZTUB 2F1RA 3VKUA 5KSZA 1O08A 1XCOA 4H7FA 4QO7A 1BGWA 3NTRA 4U8HA 1EDOA 3WJ1A 1OXTA 3T4UA 5LMCA 4RMIA 4QNMA 3O1JC 2E6UX 2DAPA 1N2HA 3I9NA 4HX9A 3TLKA 1KMHA 1PTKA 2KWIA 4L08A 1RHMA 4P22A 4EKIA 1EVZA 2BP7B 2ORWA 4KXFB 4QXQA 3TZQA 3MWLA 1SUBA 2OSBA 1E5LA 2NP6A 1C4OA 4TTIA 4B4WA 2ZYAA 1PZMA 1RNLA 4GOXA 4KN6A 1R3DA 3N2GA 4D8YA 5FBVB 5I45A 5FKJA 2X0DA 3S8YA 1J33A 2QBYA 4HGRA 1WHTB 1DBSA 4A5OA 2IP4A 4OAQA 5FA8A 2XYGA 4KPUA 4NJMA 2PUVA 4I3GA 4YLYA 3NYQA 3IUSA 4OKNA 2YICA 4B5LA 3KU1A 1O89A 1JJBA 2WKRA 4OGKA 1XQYA 4S2EA 1HDGO 1PJ3A 3I2FA 5KKAA 3BJIC 3RC1A 4KR7A 1NNUA 2PQ2A 3QQPA 4QARA 3GCXA 3FOBA 1EXDA 1T4CB 3NWBA 3PIRA 4MI9A 4A0HA 1EESA 3QF4A 4QREA 4ZEMA 4KPYA 3I9MA 4FP9A 2B3TA 1RXCA 5NLLA 2XUOA 4LCJA 2OZEA 4K0RA 4RD0A 4DWOA 2QR2A 2KSQA 1RLUA 2ID7A 2P30A 3OZBA 3A3KA 4FFLA 4X7RA 4A8JB 1T1EA 1P4HA 2GTPA 3AEKA 4KREA 2DPYA 1XCMA 4F7DA 4M7OA 1VE7A 3TAXA 5AW4A 4MW2A 5JYBA 1QQAA 2VXBA 2AK2A 3A4YA 1LPPA 5E1MA 3RSZA 2CJFA 1XMVA 1VRWA 1SKBA 2JIDA 1RKVA 3D02A 4KXYA 4CJXA 3NASA 2FE1A 1YOVA 2OV8A 4DBLE 1CD5A 2NP7A 1OI7A 3ZGLA 2JIOA 2OAP1 4I14A 1SCNE 3H2GA 1ZNQO 3GFOA 3E9CA 2NNWB 2EJVA 1NQWA 3RK1A 3WWEA 1L4GA 3PNMA 4XYGA 1K88A 3C48A 4P5PA 4GVPA 5E7QA 3WQQA 2AYYA 2ERXA 3HY4A 3VOBA 1YB4A 5J2UF 4NDZA 2W6ID 4JXXA 2PGDA 4E2YA 3BSWA 1YMVA 4UOQA 5G40A 4RV5A 3T7EA 1XTJA 3ADOA 4AJOA 1YJ8A 2YJ6A 3GEEA 3USCS 1F9AA 1YBMA 3ASVA 3RBVA 1TUGA 3FYCA 2GAFA 3SHQA 3N74A 5E2IA 3RRZA 5FUMA 3HCCA 1H3EA 3LHSA 1HUQA 3HE3A 3JYNA 4DV4B 4LGYA 4RACA 5ALDA 4B3GA 3DKPA 3NTXA 2RK3A 1QF9A 4O1MA 5LOVB 3E05A 1DC6A 3FJOA 1XRNA 1RHUA 2G3YA 3WIUA 1C9NA 4EECA 2V3CC 1K6JA 1SOWA 3U60B 4BNZA 2NUTB 1Q0LA 2O7VA 4QDZA 4MYDA 4UULA 3S2SA 3ROXA 3U37A 2CE2X 3K8QA 4LZAA 4F5WA 1YBAA 1KKLA 3CFYA 2RHJA 1O3YA 1DFGA 4X3OA 4YCDA 4WLEA 1TYAE 1QVVA 1HL7A 1KZ6A 2FX2A 4XJSA 3TW4A 2CNLA 2YZ2A 4R1NA 3GEMA 1Q22A 1NV9A 1WBJB 2UVPB 1ACLA 4YPFA 1EWQA 5UKDA 4L3VA 4MS4B 4ER5A 1CJMA 1NVAA 2CMDA 3ABRB 4A6XA 2C2XA 2WHPB 1UAYA 3ZLJA 2EFJA 1HT0A 3TXAA 3HR4A 3TIVA 3AF5A 2W43A 3RWMB 4WKPA 1KJQA 5TVKA 2QN2A 1T9BA 1TW3A 2GVNA 1S9DA 4K9QA 2IHJA 2J4FA 4FSXA 1TC2A 4QSMA 4PXYA 5ED4A 3KXPA 4ZZ0A 2OG2A 5BNFA 3KCNA 2XCSB 3S7ZA 3I92A 2QP4A 4YRCA 3FBTA 2Z2KA 1Z6GA 1E9BA 4WZAA 4G4JA 2IHZA 2QPOA 3R3SA 6REQB 2CLLB 3DL2A 5IDYA 3RCBA 1T24A 2QV0A 3PGA1 5DCLA 4A73A 4KXNA 4BLRA 2X13A 2Z2IA 4JSTA 4UNSA 3EVCA 4BLWA 4EF6A 4A6DA 4COKA 3EUWA 5JJLA 3B5JA 1SELA 2QK4A 2XD9A 2ZUWA 2Y2VA 5C4IA 2A9JA 1PK9A 5KTTA 2VNKA 3PEVA 1PQUA 1YCFA 1NDQA 2GWHA 4LEIA 3MUFA 2OZPA 1KVRA 5BO5A 4CF4A 4FNGA 4YV2A 4X00A 3GAZA 5D7BA 4MYTA 4B7ZA 2YR0A 1Z4OA 5BWLA 2F4NA 1O5TA 4TV9F 5BW8A 7YASA 2VWGA 4ND5A 3TRJA 2LD4A 2ONYA 3FUXA 3ESZA 2C7RA 2IYYA 3CZ5A 4NFLA 3VTAA 1E3DA 3DPUA 4MUJA 4MRPA 3NI2A 1XCGB 4C4ZA 3G9QA 1MXFA 3IDFA 1CJUC 3O73A 4OL0A 3K05A 5CW2A 4C3ZA 4EPXA 4EYSA 3DAPA 4V2IA 4HFRA 3FHCB 4Y2VA 5K8LA 1WQ4A 1P2DA 2HO5A 3C7KA 1LLCA 3G2PA 1AKEA 3I28A 1JYFA 3DFKA 4P86A 2OPBA 3GXOA 1KNXA 3LCCA 1XCPA 1KKMA 3KLMX 1XVLA 5A3JA 1USKA 4B3CA 1NYQA 3PEEA 4TSFA 3HNOA 3QVJA 1U1GA 2GHIA 1RJ9B 4LW8A 3ZDYB 5LKAA 1ORRA 5IYZF 2H1IA 4B82A 2EW8A 1U94A 1OYOA 1XZCA 4NAHA 1LLQA 4Q3DA 3ZHYA 2Q0XA 3WIOA 4RZIA 4AF7A 1N7JA 1O4VA 4QFBA 1GRRA 1SZPA 2Q4RA 3MWEB 3R3ZA 5ICFA 3DFMA 2SICE 4HN4B 3PX7A 3ETJA 4KDEA 3V6MA 3WIDA 3IJ5A 4R54A 1JE1A 4F6CA 5ABPA 4EFMA 1DE0A 2HIAA 3WNBA 1NP7A 3DSRA 2I6UA 5EJ5A 1QONA 3ACDA 1H65A 5AHOA 2JLXA 2BP7A 2FW8A 1M9NA 4CKBB 2AFVA 1V39A 4FGWA 3OTOB 3AJEA 1B00A 2FSFA 3RSGA 1ISJA 5C8XA 1OI2A 2VCEA 2YWGA 5IBRA 1KVQA 4E15A 1P75A 2OAGA 4YAKA 1HLDA 2FJUA 2VT3A 1YC2A 3Q7QA 3NIFB 5JWOA 1VCMA 4FS3A 1H4TA 3N76A 1YB2A 1A88A 1WHTA 2FPSA 3HYRA 2EAUA 5A6VA 1T2AA 3W8DA 3B3FA 1NNSA 4OSOA 1PV2A 4QU5A 1IG3A 5SYMA 2PZFA 3FPFA 3MCVA 2EG9A 2RGXA 4QPDA 4ARBA 2A0XA 1TIPA 1MV8A 2D54A 3IVXA 2PKXA 4S2UA 3OY7A 1DCMA 4IWYA 1Z28A 5FBHA 2BDTA 3WYDA 1RZRD 3GXBA 2JRLA 3EVZA 4RH3A 1E6WA 5KNDH 4A8JC 3K1JA 5FL7A 5H3CA 4CIVA 3ICWA 5IWAB 1VJGA 4C88A 3N2NA 1U3DA 1F4PA 2Z95A 1GPAA 2XYVA 1YRBA 2E4AA 5LYJB 2VDPB 3EIEA 3AZOA 4RVFA 1YL5A 4A8JA 4FNMA 1EAMA 2HIGA 2R7MA 1PG0A 4MJ3A 5U9CA 1GD1O 1XAHA 3VX4A 4C05A 2FEXA 4JL5A 5B58C 1FDOA 1XTSA 1CUFA 2J0VA 1RC8A 3N28A 5EJ6A 2EFDB 1UBRS 4DSZA 4DMUB 3ZD9A 4KOAA 1QPZA 5HFJA 1XZMA 3T9EA 5AVZA 3KLPX 1N8KA 3O1HB 5JCZA 4MVJI 4PYOA 3QFCA 3UO8B 3MWGA 4HVTA 3EQ2A 3WRVA 3EGOA 2IZOA 1TVKB 2EEZA 5F4ZA 5CAEB 1ORHA 2C7GA 1XZGA 2IHBA 3NX4A 4HQ0A 4RKYA 2CLKB 2H1SA 2ZBDA 3LOQA 1U6IA 1OREA 3ZN2A 4RD2A 1BXKA 1THMA 2F2TA 2IYVA 5JMOA 3LZDA 3EY9A 2XY4A 1XJ5A 3D3NA 4LWPA 3D6VA 4LY9A 5TPZA 3LX4A 2VJBA 2QLBA 5LOVA 3W78A 4HS9A 3GFPA 5FCDA 1CUXA 4PO8A 4EGJA 3P2MA 4MCIA 5F12A 3DM5A 3IEPA 4XOUA 4C3OB 4JT8A 3K0KA 3GJ8A 1ESNA 2EC5A 3GV0A 3HHPA 4G4SP 1SJ9A 4IQ4A 4X6UA 5TARA 4DDWA 3PDJA 5CFRA 1MAWA 1YQUA 4PN7A 3GRZA 1EWTA 3ZZNA 4NATA 5DHSA 5BNWA 4MWCA 3TL2A 5FTWA 4CKEB 2YRFA 4LE1A 2IU3A 4BFZA 1UJBA 5FLYA 2UVPA 2FPUA 1ONNA 3BIFA 5F64A 1ESDA 1X2EA 1V8OA 2J7PD 1RPTA 5HQTA 2WHPA 4FB5A 3CEAA 2RIRA 4XE5A 3TUIC 4YRBA 1TEZA 1OBCA 4M9QA 2N1BA 2RK4A 1SXIA 1Z62A 3NS7A 4ALKA 1GVNB 3ZCPA 1B93A 2C5FA 5LA6B 3KRTA 2OE2A 3IO5A 2LXNA 1G64A 4KQKA 4M99A 4NV3A 1BD3A 1FDWA 1DJNA 1RRVA 2H4ZA 3W8NA 2G1KA 2YTZA 2GVZC 1B23P 1OCEA 2H4HA 4MRAA 3S1AB 3KUCA 1V37A 4YRNA 3GLGB 1BJRE 2PNJA 1PZEA 1T1IA 4YWHA 1XPRA 1NRIA 2UUCB 1HG1A 1L9KA 6REQA 1I0ZA 2XVMA 4HXFB 4BMVA 3ENQA 3F3MA 2G0NA 1QV9A 1NFRA 2E7ZA 2HA0A 1AK9A 2Y2UA 3AY6A 3HV2A 1MPTA 2PUBA 1PFKA 4PYMA 5AKGA 1U81A 3TNLA 1N7HA 1J56A 3IE2A 2HSEA 3AETB 8AT1A 5FR2A 1RRMA 5HIMA 1TAQA 1DC7A 3CZPA 5M3BA 1SKQA 2NXCA 1WABA 2BGJA 3OHSX 2HV8A 3FYSA 1KIFA 4MDFA 4FFWA 1KI7A 4KXWA 5A3RA 1Y8QB 3JZMA 4YDHB 1CUAA 2YDXA 4OGWA 3UK6A 3KQNA 3DOEA 4JB8A 4ZO4A 1PR6A 2BKVA 3ZWYA 1R6TA 1Z4LA 3OE5A 3OZSA 4EKNB 5A5GA 4Y6QA 4F5EA 5B12A 1VPLA 4AYWA 4DMKA 4UCWA 2ODBA 3E81A 5FBQB 5JCJD 4IYRA 4H1TA 2BEKA 4ID3A 1X7GA 2LZ0A 3E7WA 1Q0QA 2ADFA 4N5IX 5EP1A 1QIHA 3BE4A 5FT9A 1BG6A 3SSMA 4IKEA 4ZDJA 4Y30A 421PA 5J43A 4D8VA 2YHIB 5MDHA 3MJRA 1RADA 3DH0A 5CNIA 5H9VA 4O4LF 2Q07A 2LPMA 1ULSA 3C3BA 1E6CA 4D9IA 4PX9A 4RVHA 2IJGX 4MUEA 4BFXA 3KJNA 1X7ZB 2BEVB 621PA 1WB4A 2DQ4A 2AJLI 1WQ1R 3K6JA 1QKIA 1F3LA 1JG1A 1UKEA 5KQGA 4CPDA 5B57C 1RJ9A 4YRTA 2H9IA 2NXWA 2OZVA 2FB9A 3OIVA 4RETA 3B2EA 3GCDA 3QKWA 3AQ4A 2HU5A 4MMYB 4P53A 5K3AA 4NZYA 3MWEA 4OQNA 4IOKA 3R0XA 1FYDA 3ZE0B 5K05A 1K6EA 3D5QA 3DDNA 3U1TA 5AJWA 2JKVA 3RTDA 2BKXA 5JH7F 2N75A 3Q6MA 4N48A 1QE3A 1W4CA 2LGJA 3UW1A 3B9RA 2TECE 4FMBB 3DR3A 1FMLA 2HX1A 1N7GA 1FQWA 3V80A 3B1KA 4CIAA 2ZJ1A 5IT4A 2PCJA 3ES9A 1SVLA 1SKUA 3A1UA 3DMTC 1UC9A 4CKBA 4GNKA 5HYVA 4D80A 4EA6A 4N5DA 1H5NA 4RSGA 1KO8A 4ZCLA 4A8PA 1QYVA 1X8LA 2PIAA 3H2BA 2DBVO 4WZBB 1KFCB 3ICOA 2WUWE 1WDWB 4OHPA 1SBZA 3IEKA 2WZDA 3NC0C 2D2IA 4TTVA 2VDWB 3NDRA 3ZUPA 3WG9A 2AG5A 4F60A 4LMRA 4N0MA 2F48A 1TGYA 3AKDA 3SLGA 4A9AA 2R6CA 3A6PC 4FCVA 1YKFA 4CV0A 1HMPA 3M6MD 4YRLA 4L1KA 4YAJA 1PVVA 4URUR 1UKYA 2QTTA 3D7KA 3NEYA 4BVGA 2BGTA 2IX3A 2R11A 3H84A 2PGXA 1NP6A 3A9TA 2YJ3A 5K2OA 2JCVA 4PBTA 1CUUA 1GU7A 1NVUQ 1P1HA 2C1XA 3PF8A 4FYVA 3TLMA 1O87A 2HPZA 1OZ0A 5C8ZA 4G0QA 4J8PA 5LYJA 4PGHA 3LC2O 4DDHA 1TEHA 1VKJA 3BL8A 4IDAA 1GAEO 1NNI1 1ZPDA 2ATXA 2JIZA 3HI6A 4M76B 4XRRA 3J81A 2YZNA 3CRW1 1UFKA 2WB2A 2RGDA 4RLFA 5GOTA 4J1QA 2G17A 1DXQA 2B92A 3RSLA 4G09A 1VE3A 3N39C 3RVPA 2CDRA 5DF1A 3NHAA 3MGCA 2JAXA 4L15A 2WOOA 5H8WA 1FFSA 4GSYA 3KC2A 3S8EA 3REFA 4NYJR 3SJZA 2VZ9A 2QR5A 4QBTA 2NQTA 3E9NA 4HXEB 5DCUA 4UHHA 1Q0PA 3WLRA 3QVMA 4K9RA 2V7GA 1TVKA 1LVHA 1V0JA 3LY9A 1OGJA 1P5ZB 2ECQA 3Q5GA 1E8MA 2YV5A 3FUWA 2HJ9A 3QKRA 2H06A 2NQ8A 2OXEA 1FQKA 3JTEA 4IILA 4E94A 5JD6A 2PUFA 4AZ0B 5HFNA 5GV8A 2Q3LA 4BATA 4GQBA 3AVVA 5GQSA 4YUAA 1J5XA 2Q5LA 3S70A 1QH0A 4GUAA 3V7FA 3GLTA 3KKOA 3LKBA 3RC3A 3HSSA 3VPAA 1P19A 1T8PA 2H2WA 3V8VA 5JECA 3RS2A 2HH9A 3B70A 3OZTA 1E2KA 1P91A 3EXHB 5EUCA 3V3TA 4YNBA 4C4YA 4H1WA 4EW1A 1AN9A 2QZ9A 3RVLA 3L0IB 1UOPA 3CUKA 4IQ8A 3H2SA 1XBTA 5LD2B 1J23A 1ELOA 2RGNC 5C8YF 5KCZA 2YW9A 2ZCUA 1JU4A 2CT8A 2Q45A 1UJ2A 4KLRA 1P4GA 1VJ0A 3CSSA 3S5JA 4CKEA 5BSHA 2VH2A 3GJRA 4GUDA 5E4TA 2JFVA 3MGKA 1YS2X 1H05A 2RGNA 4BS9A 3WNZA 4EOGA 3E7PA 1QG2A 4P2GA 4PPYA 3X1XA 2J5RA 4B3SB 3CPSA 3D7NA 4WEOA 3IPCA 3FFAA 1OFIA 2E48A 3GUHA 3P9NA 4CCWA 4HRXA 3OLYA 3HU2A 3BJEA 4DNFA 1WWKA 5LA6A 5JNRA 2Y71A 1T9HA 3AY7A 3JZDA 1DBWA 4UHCA 1I8TA 1NNEA 3EGVA 3U3MA 3FTQA 4YRJA 4AXBA 1IC6A 3B6JA 2ZCVA 5ICMA 2EU8A 4XM0A 5KOJB 1AY0A 1GTSA 3N7UA 5KQMA 3S1AA 3GLGA 3L43A 2ZSJA 2DKFA 1F9EA 3MOSA 4G8CA 4L73A 5ENZA 5ALHA 2O8FB 5IXSA 3EZ6A 1JHZA 2XZOA 1T91A 4DTIA 2ZE8A 2PFSA 1U63A 2Z08A 1KYXA 3OJWA 1C1YA 5CCDA 1WBDA 3EXFB 4LVCA 3G02A 1X7YB 2Q6OA 2A6PA 1M8JA 1TM7E 1CRZA 1MJ5A 1XRJA 1YS6A 2R4QA 1Z5OA 2CUZA 2I65A 2QTCA 2W2KB 1R6XA 2HGZA 3AETA 3HP7A 4QVKA 5LZ2A 3RT9A 4B2PA 2XUQA 4JENA 1SUCA 1ZUWA 1NP3A 4C14A 2Y1KA 3RUCA 5AI6A 3DYBA 1X74A 1YIAA 5GGYA 1YFJA 1OF1A 4DCCA 1Y8QA 3IYLW 5FBWB 4Z54A 1K5DA 2ZQYA 5BQXA 1V4NA 2DX7A 3G5MA 4RA9B 1AKNA 1K9VF 5DHRA 1J0CA 3COSA 1IUKA 4ZVTA 3SQOA 4ISBA 2WWHA 3JCZA 1MOZA 2AN5A 3T5CA 4A26A 4KNYA 2PN1A 1U7WA 1W8DA 3GH1A 3F8SA 4ZALA 3GDHA 2JG3A 3AEUB 3CURA 4TMWA 3ZZ0A 2DSTA 2VQ3A 4UE2A 2YHIA 3RK4A 1CP3A 4DY6A 1PQYA 5HOQA 3WLIA 3QTBA 3ZD6A 5K3DA 2XYRA 2DLNA 4LJLA 1X7ZA 2BEVA 4OFXA 1ZD3A 3HJBA 4M89A 3IMCA 2WA1A 3E35A 2EDAA 2FK8A 1K4MA 1ZOSA 3OIDA 4J0EA 1QAOA 3INTA 1I2MA 3WK7A 4A2CA 1PQ4A 1NC1A 3A36A 3TNDA 3UWOA 1RXYA 1Y7PA 2DFDA 2PUAA 2O8EB 3H0KA 1TVEA 4GGOA 1MJNA 1M5RA 1UWCA 3O8DA 3CGGA 4TTJA 1LV7A 3L8DA 2JGFA 3PNLA 3K3PA 8ADHA 4LTDA 5EGNA 3L8HA 5JATA 4OI2A 3N87A 4R8SA 2QTMA 3WJ7A 1NVVR 1VL1A 2V96A 1B26A 4PC3A 1F8UA 1JH8A 1J8FA 1XROA 4D56A 4DR4B 1DBQA 1L1RA 4RXUA 1E1RA 1GQYA 3GT3A 1D2EA 5FV7A 4D9HA 1FS6A 2EW1A 4U9UA 4UREA 3TQIA 3LU1A 1KZ7B 1VMIA 1OWMA 3P8ZA 3PGVA 4BC1A 5I5EA 1P4JA 2E21A 2X4GA 1U9YA 2HRCA 3DMPA 4TT3A 1KA9H 1R5OA 1OW3B 2BC9A 5KIAA 3WE7A 1EFTA 5FI3A 3UG6A 2ZJ8A 1OAKA 4HLNA 3FCCA 4ZQBA 2D4AA 4WZBA 3GB9A 4OJMX 3VR5D 2O2JA 3E4CA 2B8WA 4DADA 4BN5A 1YZQA 1KSJA 3MJVA 1TM2A 1E6EA 4B3BA 3OWOA 3TEFA 3BHJA 4H7EA 4O1IA 3EC7A 2VDWA 4EG4A 3UAXA 4DSOA 1FLVA 2OQ2A 3LDFA 4Q39A 4RTOA 1R6VA 3BCUA 8LDHA 1SH7A 3GLVA 4U0JA 2IVFA 4WCVA 5KX5B 5BMOA 4Q24A 2JJ8A 5I6DA 4UE3S 2H17A 2O2XA 3IP9A 5LBTA 1Q3HA 1O5OA 1TCUA 3L7LA 1GTRA 1YR3A 2AKAB 3GIDA 3CEMA 1BMTA 4JOQA 1PG5A 1QVRA 4A5SA 4Q9HA 1J97A 2YWFA 2JLAA 1JJIA 1OZGA 3LL4A 1K6IA 3VU1A 1XWIA 2W4IA 4LUCA 3QGMA 3ZU4A 4EW3A 3W2EA 4PC2A 4RHTA 2XUJA 1S8NA 1ZOPA 2ZI7A 1ZIOA 3P9KA 5DGCA 2EQ5A 4BVHA 4K9NA 4ARSA 5ANRB 3A2KA 1X0VA 3G9UA 4PTLA 3U44B 2FWJA 3WBFA 2R1VB 1QU3A 4EI9A 4EHLA 3ILHA 2QW8A 2C77A 4I81A 4FLEA 1Z33A 1Z7YA 2BR4A 1Q44A 3HYLA 4JYMA 4E3WA 2EERA 4POOA 3AG6A 4PAGA 1POWA 4PLGA 3ZV6A 1V7ZA 5ADUS 5A4FS 2A58A 2Y1OA 1TADA 1R6UA 2PEZA 3MTQA 5A4MS 3U4CA 4A0QA 2H4FA 2HSJA 2Q4TA 4DDUA 5BPHA 4NFYA 3PT5A 2HF9A 2I99A 4L27A 4J0QA 1DV2A 2CSUA 4LHZA 5AD1A 1E89A 1HORA 1C0EA 2CVHA 1HE1C 1ODJA 2AZTA 5CLLA 4AZ0A 4DT1B 1CY6A 4WOCA 1TAGA 4RNDB 1BQ4A 1JSZA 3EXHC 4ETIA 3HNRA 1MVNA 2VNIA 1RJEA 4FZVA 4NJOA 2DH5A 1QRSA 3WRXC 1ECGA 4XSGA 3E70C 3WSTA 3PRKE 3CNOA 3HZZA 3MCTA 3NDJA 2PZBA 3DEIA 4JOBA 3T3GA 2YXDA 1WXWA 3EXHA 3OFSA 3QBVA 4M1EA 2I7TA 2CK3A 3A7DA 3UAGA 2Z98A 3WRXA 2I2DA 2XKJE 2C5BA 3R8FA 4NBNA 1NUUA 5IAGA 1MHPA 1E3QA 3PS9A 5KCMA 3TNFA 1SWWA 4M1QA 2DRIA 2ORVA 2QX8A 2FMXA 4MJXA 4RYDA 4V1CB 1V16A 2W37A 4QKQA 5IS2A 1KMQA 4C29A 4Z53A 1OJ7A 3G89A 1ILWA 1XK7A 2VK4A 3EGXB 3GRUA 4LXTA 3WYFA 4O4HF 2UU9B 1N2IA 1U7PA 2WU1A 5HG0A 3JVIA 5JAZA 3DE3X 3F90A 1ZD2P 2A59A 2FPKA 2QTHA 4E46A 2PKQP 1O77A 2VZEA 3E3AA 4IR7A 1EG7A 4HQRA 2ETVA 2R5WA 4K3UA 4ZARA 1FFHA 2QGZA 3X1YA 2A9FA 4NU0A 3G5AA 3BWMA 4TXMA 2ANCA 5F52A 4ESOA 5LP6F 2WD9A 2ASVA 4PHFA 2CB9A 1LXCA 4IZ6A 4KVZA 4NZZA 4OX9B 2ZT8A 1LY1A 4PGGA 4FYPA 1FDRA 4RPCA 4B75A 5KJCA 5K3EA 3SEFA 3TH5A 3K0EA 3BXGA 5KOJA 2Y68A 4QT0A 3JYHA 2O8FA 1K8QA 3LBFA 4KMOA 5AYVA 5B7GA 5CFNA 2NU8A 2NAFA 4ALMA 4OA8A 1J06A 3ED1A 3PUIA 3EW7A 3HB5X 4K2AA 4MWTA 4DHEA 4FVTA 3QPAA 1Q7BA 2FP4A 1JIVA 4I1IA 3EXFA 1KERA 1X7YA 4MIEA 2W2KA 4A2WA 1WOYA 1YCHA 5LYYA 2XF8A 3IIIA 1JZTA 1XE3A 4JBXA 3WBBA 3NGXA 5AXAA 1H9AA 1SK9A 2J7KA 3PHGA 4HB0A 2GN2A 2Y6VA 2Q3MA 2RSLA 3B7PA 5AKHA 1ODSA 3A4MA 4IWXA 1RVDA 3CCBA 3UCFA 4J6FA 4M7RA 4RA9A 5KNBH 4NBSA 5JCXA 1KIMA 3H1TA 5CDUA 1DRKA 1VPVA 5GZ1A 4ICIA 2COEA 2HK8A 4Q1AA 1OT5A 4XCQA 3OCVA 5J5CA 4AY6A 1J2TA 3NO4A 5AUQA 4GI2A 4I19A 4TLEA 4KO8A 3AEUA 2WTMA 3FVRA 3RPEA 2H2AA 3OUZA 3REOA 4DLPA 5ARBA 4LDZA 3NBYC 3E1GA 3IHTA 2IDZA 4QULA 1AF7A 1H8EA 2RC5A 3FWYA 2GM5A 3I4CA 1WMFA 4KAFA 3K94A 1MABB 1DRJA 1FZQA 4HAVA 2MYNA 3FZYA 3KKEA 2FXVA 3ECAA 2ZATA 1Q2XA 2AJCA 4L75A 2O0MA 4KXVA 3U17A 1BH6A 1EB9A 3GY0A 1Y3CE 1DT3A 1YMQA 1Y5IA 2F3QA 3HXLA 3STXA 4QNRA 3BTUA 5KNBA 1ZMBA 1UPFA 2NLOA 3BD8A 4HH1A 5T6BA 3ZGZA 3CNQS 3MT9A 1SA0B 3GFGA 4GFDA 2ZBUA 4NPHA 1CUSA 2NUAB 3CINA 2R3SA 3ZCSA 3AW9A 1CU1A 2M32A 4CKZA 3PPXA 1FBTA 4KQWA 1EXNA 1OMOA 1YZNA 3AERB 1HXHA 1AQ6A 3L1KA 2PVPA 1K5PA 2WF8A 4KQFA 4WNCA 2IHNA 1CJBA 1K4KA 1KI3A 2HA4A 1JKIA 1G5HA 1IBRA 1Q21A 1VG1A 3FZQA 1UK6A 3RTAA 2X0EA 2R25B 3ZWDA 3QOXA 2D0OB 2P9QA 5I7UA 1VPWA 3ABQB 2IZZA 2IPXA 2NO1A 2RAVA 4FINA 5D00A 3P94A 1XSEA 3SE7A 4UU8A 1WL8A 3HUUA 4I0WB 1S2LA 5JXHA 5JJKA 1AKTA 2I2CA 2I3BA 3ABIA 3AVQA 1WZCA 4Q4HB 1WTCA 5H0IA 4AULA 4EMTA 1D6MA 1E2FA 1TCBA 3BFJA 5I51A 1V5WA 1OGYA 3OY2A 2P35A 2ZAYA 4P4NA 1T8YA 2B99A 3ASYA 3KFXA 2C78A 3SX4A 3UMFA 2X2EA 1PFYA 2HQRA 3QU9A 4ZVVA 1P17A 1B2RA 1ZNWA 2G72A 1R37A 3KPUA 3LUCA 1A27A 2C4NA 4KO2S 4EVQA 1HA3A 3QY9A 3R2JA 4WK0B 4BMXA 4FDUA 2G8NA 2NTVA 1Y1RA 3ENNA 3V4OA 5GPBA 1G0NA 3K1YA 4D9FA 5MF6A 4B3XA 4BNDB 3I9V1 3LDHA 5F7OA 1KF0A 3M33A 3P9QA 1FNNA 3OJLA 5AK5A 2MHCA 4O2RA 1ND6A 4AFNA 3JATB 1NL3A 2GA8A 1CLUA 1U7DA 4E6EA 2ZUSA 5LIPA 2A35A 5F1PA 5U1PA 1E5TA 4F2DA 4JA0A 1J9GA 1ZMRA 2HBYA 2HM7A 4LV5B 3I2KA 4BKOA 1LJUA 3L05A 3TB6A 3JQAD 4PCLA 3P4YA 4BKQA 4RL4A 3P45A 2C9CA 1T1GA 4K9MA 3U44A 5FBLB 2R1VA 3LS2A 2QM8A 1XMSA 2YZ7A 3O84A 1SHLA 3GJXC 3TCKA 2KHZA 1THZA 3PQEA 3RSCA 3PFBA 5EKUA 1KMCA 2VOEA 3EDMA 1DAPA 1XF1A 4OY3A 5TGZA 3P2YA 1UK8A 3PD0A 3OAAA 4Q9IA 1KYZA 5HDBB 4DUZB 1QGZA 4Z9XA 3UANA 2HOQA 3ZVNA 2QX7A 2O54A 1OZFA 2WUFA 3I6ZA 4C0HA 4DT1A 3SVLA 1MGPA 3DZBA 3ZGOA 1BFUA 2C82A 2AOTB 2F3PA 2BUBA 2XIQA 1QTRA 5AVQA 1DOHA 4MRMB 4PICA 3GBVA 1GPUA 1MQSA 5JS2A 3EIFA 4IV8A 5PGMA 1T0JB 2R4TA 3C97A 3CVJA 5AVJA 2FZ5A 3AI3A 3FMIA 4BNJA 1XRPA 1XRLA 4M54A 3VYVA 1JW9B 1OX4A 4DCPA 1FFYA 1XZHA 2VDNB 3B6MA 1U11A 3E2IA 2J07A 1Y6RA 5JAUA 1J9EA 4CMKA 3QBTA 3H1AA 2RKOA 3ROZA 3E27A 5AVSA 3FPBA 1C8LA 2A1UA 2M98A 3M81A 3T7IA 1OTHA 4V1CA 2DHEA 3IEMA 2E18A 1SKMA 4OLAA 1J49A 1DEAA 1H2BA 1I80A 2B8TA 2CLFB 2XCRB 2C94A 1TOAA 4ZHQA 3EGXA 1DP4A 1DWQA 3ZNPA 4LWZA 1AS2A 4GBJA 5B1IA 5JAOA 3PRHA 3PQ2A 1J1UA 4FOLA 2WIKA 4H17A 4RTSA 4GMGA 1FYFA 3PUJA 1HRDA 4Y2GA 1L5ZA 5F7JA 3GJ0A 2HCFA 1CULC 2PR2A 1VE1A 1SIWA 1GUFA 1OPXA 5C35A 3KALA 1W2HA 3LQ4A 1BOOA 2OBXA 4BQOA 4M7WA 2E37A 3KXLA 1SY7A 2VTKA 1ECBA 3OC0A 2VCHA 4H2DA 4XRGA 3K35A 1X8XA 5LUBA 1RWWA 2HDHA 3IRVA 3QXSA 4MUIA 4GZLA 3P27A 1EP3B 2FZGA 1QLWA 3BUSA 2GXAA 2DWOA 2O6HA 4GBED 1IN7A 4BX2A 3TD2A 4JJ7A 2VJPA 1C8KA 2R7KA 3KBOA 3CB2A 3LUKA 3LBNA 3PVSA 2O5RA 2EHJA 1RXWA 3TQRA 1QU2A 5A2QA 3B9PA 1DKUA 1R27A 4XPZA 4RJIA 1EAYA 1BA2A 3OQOA 4PLPA 1BFKA 2IC5A 2FMTA 3D4OA 4K1LA 4RDIA 2ES4A 2R8YA 3OFND 2GEFA 3O92A 4PNPA 5JPIA 3M89A 1NW8A 1IZ7A 2ZIVB 2R84A 4BPBA 3GF4A 2PSHA 5CLHA 4BNVA 4JLUA 1KEZA 3D1LA 4YT5A 4AJEA 4O33A 1M1XB 1PQWA 2WVHA 3A05A 4KX3A 4QBKA 2YWDA 4RZQA 1NAIA 1NGSA 3P5SA 1EFRD 1D8AA 3P96A 4KYVA 3QEKA 4ZHSA 1THTA 3PJDA 3PGMA 1KY4A 1QE0A 2B94A 1NLMA 2OCIA 3DAYA 4DYHA 1G8YA 4PGAA 4F7WA 3EH2A 4D41A 2FSSA 5C53B 4NENB 1IBMB 1WR8A 1LRLA 4QECA 5J4LA 3E4DA 3AEXA 4NBTA 2J9ZB 2RGUA 3WADA 4Q4CA 2IHTA 4YTEA 2IIPA 1KVSA 4TTPA 4X93A 1C3JA 4DY4A 3DWGA 5JQGB 4LXYA 2LP4Y 3T61A 2IOYA 1IONA 1MABA 4L8VA 3ZDEA 4EIWA 1GA4A 4DOMA 3U0VA 3DM9B 3EZLA 4IIYA 1TI7A 4TV9A 2OO5C 3THRA 3F96A 3JSAA 3GG9A 2DECA 2FPWA 4RKWA 5ESDA 1B6SA 1OASA 5AR1A 4TVOA 2IE0A 4JLPA 4YCSA 4TWJA 3HGTA 2TMDA 1SA0A 2ZJ4A 1T4MA 3JQPA 4Y2PA 1Y6GA 4IX9A 1ZUHA 2AT1A 2NUAA 2OO5A 5DWVA 5A5DA 2WQZA 3RC8A 4D96A 4IDEA 5H5JA 3W34A 5D1HA 4HQ6A 2IOFA 2CD7A 2ZYRA 3AERA 2P2LA 1P6XA 3GN2A 4LPSA 4KI0A 1FMCA 4K2HA 1QYRA 3PQCA 2R68A 4MR8A 2XUIA 4O29A 3K0AB 4Q4LA 2B83A 1DGQA 1QIGA 2ZGVA 5EL0A 1E66A 1Q6ZA 4D4KA 1GRVA 4RHYA 5AIAA 1CUBA 5EA2A 4AZ3B 3TUZC 4Y6OA 3LTNC 5IYZA 1HDXA 3X2FA 1XCJA 4F6LA 3CTMA 3OTGA 4TUYB 1NJ6A 1RWXA 1UDBA 2W2XA 1EVLA 1LDGA 5HK8A 3REQB 2QXUA 4YP7A 5CB4F 4JX9A 4Q4HA 2GVDC 3MUNA 4QXAA 2CWDA 1RYZA 1O57A 5LN1A 3GPIA 1TL7C 1VYUA 2CMFA 4CT5A 4DC0A 4QUIA 4OKIA 2B0JA 2C3OA 5FYQA 5JV5A 5FTJA 1MA3A 1O6FA 2FPPB 1MB0A 4O2AF 4TOIA 3K9LA 4CMGA 5C32A 4JIGA 4IYJA 3RTEA 1ID1A 3COYA 1CNEA 4I9UA 4LYFA 4DV1B 1M0EA 4HHEA 3MPOA 1E61A 4MUAA 1B3RA 1GNQA 2ISSD 2V5VA 4I9GA 4PLHA 3D31A 3DDZX 3KEQA 3V97A 1THGA 4D4MA 1W1WA 4QEDA 1NRWA 4HSEA 4BNDA 2ESRA 1HDIA 5TDHA 5JZSA 1ZD5A 1BTOA 3MJ4A 4UUAA 3F2IA 3I5XA 5DX1A 4PLZA 3PE3A 1IRIA 2WR8A 3PFNA 2K7ZA 3JATA 2VNHA 4ZVPA 3VC7A 2GFQA 1HNNA 1ZN7A 2QY9A 3O2QB 1KPGA 1M0SA 2C7BA 4TSRA 3WL6A 3M7IA 4OJQA 2BW0A 2ZRGA 2VDMB 1VXOA 4TM8A 4P4SB 5FFNA 3IP8A 2PAAA 3ML1A 3DHNA 1GUBA 3ET4A 2BGMA 4RQBA 5HF5A 4FFBA 1R0XA 2K87A 3CF2A 3DMRA 1UBJS 2FRVA 3UWMA 3UXEA 4ANFA 5HZHA 2QNBA 3KJXA 4HYEA 3FPGA 3VKVA 4CQJA 2C3UA 3W6PA 2IYAA 4E5YA 5LL6P 5AKKA 1FBNA 1M34B 5IU6A 1U0NA 4JSYA 4JUBA 1U7TA 1ODTC 2O3JA 1IBSA 3GRRA 2WKPA 1UK9A 3ROGA 4GPD1 3Q7IA 1E2HA 4QYSA 3GGPA 2I33A 3UJAA 2JA1A 1XRQA 2OBMA 2AQIA 3IPAA 3LTEA 3UM9A 1ODFA 4MRMA 1W9MA 5ISMA 1T29A 2BMDA 4CEHB 1N2EA 3OURA 1QO0D 2R7LA 4PZ9A 3RFFA 3EARA 5EHGA 3E5MA 3ZS8A 3LPNA 4LDQA 2CNWA 3ZVLA 1A8QA 4GM4A 3ZBTA 1GN9A 1F2VA 3OQ6A 1QGED 4HEA6 1CR2A 3EOBI 4C43A 3WTCA 1A2OA 1SCUB 3K5WA 2ZUUA 1WU8A 4P1ZA 1D03A 3GDWA 4KVAA 1SHKA 1PX2A 3DNPA 3DTVD 2ZUEA 4RCZA 5FB3A 1W88B 1FF9A 4QOJA 1FVHA 2QVZX 4PLVA 4WNAB 2EBUA 2CWWA 4OEHA 2OV3A 3TDMA 1B16A 1JJAA 1VJ1A 2W58A 3UQZA 5AFSA 3V7NA 4HAIA 4BO4A 3RDPA 2YHSA 4A7PA 5GTDA 2IYZA 5ILQA 2PPLA 1A9YA 2NT3A 2Q4DA 2X9NA 3D4NA 4KNVA 2SNIE 2XT0A 2WJVA 2WJGA 1IE3A 1XCBA 1L7EA 2R6GA 3QU7A 1HNXB 1NVKA 5HP4A 3RVNA 4YT8A 4C1BA 5C7OO 5K8VA 4GX1A 1L5MA 3LAWA 3LYUA 2JFHA 4CLDA 2ZU6A 2E6KA 4KQJA 1SB9A 4DEVA 1EFDN 3EEOA 3UGJA 2JJ1A 1MOSA 1ECFA 2A57A 4C5CA 1PCXA 4DRYA 1VGRA 3IAHA 4EB3A 2F67A 3G0HA 5F35A 1T6ZA 1DUSA 3D0OA 3K6SB 4EVRA 4PONA 1W44A 3FSGA 1SXJA 4IH4A 5DM0A 1JWAB 1K5GA 4RTRA 3IMGA 1G6HA 3BD9A 1NKSA 4YPOA 2VQEB 1GJRA 1HTWA 4L3OA 1MW9X 4S1NA 2B36A 4JJGA 2Z9DA 1BWPA 1MMFB 1R2QA 1CE8B 1TZ2A 4NE7A 3ZYZA 2GAIA 2ZRCA 1G9TA 1KTVA 2EFCB 2OZLB 1EH5A 4XYBA 3GEHA 2AJTA 1ZSNA 3ANMA 5BSFA 2BE7A 4B43A 1JEDA 2XA2A 3CNHA 3PUZA 3FKJA 3K70B 1YNOA 3WGMA 2J6IA 4NDNE 4WT7A 2QN1A 2R8RA 1GGHA 2G04A 3AGPA 5FULA 4NP6A 1E3WB 3G2KA 2HEGA 2V6FA 1CTQA 2G77B 3WQSB 4ALJA 5WRFA 5I7VA 2BF7A 4RZ3A 3DKRA 4NSNA 1JKXA 2BZ0A 3UHOA 3UNXA 2WI8A 1OTXA 4XDHA 5CFOA 4QOHA 1OFTA 5F2NA 1BMFD 3W1VA 1C7QA 4HPJB 1FUUA 3LSTA 4JY7A 4NENA 2YC4C 4P5DA 1G2IA 1GQRA 3CR3C 4HLDA 5ECGC 2J8ZA 1KDPA 2UYCA 1W36B 2WVJA 4WXMA 4MB6A 3RU9A 2H2IA 3EZ7A 2ZAIA 2FF7A 2DEUA 5JQGA 4KC0A 3WRYC 2X3YA 5EIAA 4MAAA 3T52A 1Q1GA 4R1SA 2RGGA 3NWPA 2HU7A 4M1WA 3ZIAA 1JXAA 1MVOA 3STVA 3I32A 1ZL2A 2Y92A 3PJFA 4IHKA 2CCJA 2VPPA 5CBKA 2YFQA 3PQFA 4M0UA 4QJIA 4BVLA 2VDVE 2JGDB 3MD9A 1YJCA 4DBLC 1GITA 1T3ZA 1IJEA 1U98A 1W76A 2QQEA 3FDJA 1UANA 4TZKA 4UBIA 4Y98A 5ALOA 3V2UA 2FG5A 5LIRA 3IVCA 2X0NA 1EE1A 3NAQA 4NWIA 1N5LA 2C5HA 3DMHA 2HLNA 4QRDA 4I08A 3TTTA 4HPWA 3D3EA 2C1EA 1Y8AA 1JMVA 3CXRA 5IPFA 3RU2A 1V7QA 1QHEA 2O2HA 1WEKA 2NVOA 3GJ3A 4OQDA 2V7VA 1KDRA 1B14A 1F8GA 3AVOA 3MQ4A 1G8MA 3CVXA 3VU8A 4WZ6A 1EIZA 3HYTA 2KI5A 3DQPA 1KHTA 5IN5A 2IZ1A 1E2LA 3KJFA 3ADPA 1PFQA 3K0AA 4BGVA 4YRSA 5BURA 4UVDA 2VJQA 3SEZA 3ZHSA 5KVSA 1KZYC 4AZ3A 3TR5A 2FSVC 2HY7A 4L9WA 3UKJA 1EK1A 1ZZGA 2FOXA 2JD0A 4TUYA 2HBZA 4X20B 3REQA 3RNOA 4FHDA 1HQDA 4D98A 1M6NA 1EK0A 4YAOA 4DDTA 5IEBA 3AIMA 3NM5A 4H77A 1GDDA 1IZ0A 1JQ3A 3SY8A 3K0BA 1XDUA 2FSVA 1BE8A 1E3LA 1PJ2A 1T5SA 2F1KA 2YRWA 3DKKA 1W7AA 2X40A 2FPPA 1D04A 5DXFA 5A0TA 1FPQA 4G0NA 3D3KA 3QBEA 3KPVA 2XNSA 1CS4C 4AP5A 3ZGYA 4F06A 4V39A 3R7LA 1FX1A 3E53A 2VATA 1N2XA 4W4TA 1SBQA 4ZT3A 1SU6A 5CLQA 4BVFA 1GQFA 2VPZA 3B3QA 3BXPA 3C1UA 5K8UA 1HKHA 1XTIA 1XZQA 2FPRA 2K2WA 1DJPA 1G8JA 1LX7A 1EWRA 1CXZA 2QORA 1O96B 3AO0B 4UHDA 3S4YA 1U5AA 3WMRA 3AHFA 3ZGVA 4PPFA 2NSJA 1C8BA 3DBHB 3FCYA 3FROA 4G41A 3KZMA 3E8XA 2RGYA 3GMTA 1W25A 1I1QB 3ELBA 2GEDA 1CW2B 4QU9A 4RK1A 4P4SA 3ROTA 3TFWA 3AFGA 3EPRA 4XOIA 3TE7A 2UZIR 4UNQA 4I9FA 4KYTA 2AMFA 3DOUA 3P9PA 3GRYA 3NVAA 1I3KA 3UWDA 1W73A 1W8IA 2KS6A 5BQOA 1QBKC 4Z0NA 3QP9A 1OD6A 4C22A 1JFSA 2EATA 2WHYA 1LBSA 1KMNA 4HXYA 2P77A 1C0LA 1ZJ6A 1K8ZB 4CFSA 1M1NB 2C5EA 2P67A 2G7ZA 3EBOA 4FGSA 1M34A 5IK2D 1ODIA 2DB3A 5SICE 4OP3A 2ZR9A 2P65A 1N0HA 3QMPA 3FDZB 1S2IA 3RUEA 1CRLA 1JEEA 1E0JA 1MFPA 3DOJA 3R6GA 2B82A 1O6BA 4Y1RB 1DKOA 2AZDA 1E5DA 4BO2A 3P7MA 2BFDA 1FDIA 2GWRA 2ZRFA 4K6CA 1TK3A 2DQSA 3QVTA 3WZLA 1MT3A 4CEHA 2R00A 2JDID 2LKCA 3WLPA 4EYQA 2NXEA 2H5JA 1RS0A 2WWXA 4CKYA 3I64A 4ML3A 4YO8A 1R15A 3LUJA 1NW3A 1EINA 3OFVA 4PX3A 3KTDA 1R88A 3UMVA 2VH1A 4ZOAA 4B7UA 4BLTA 2QTRA 3LPCA 4Y2HA 1R4AA 1A0OA 1SCUA 2B1QA 1KE2A 1G59A 1YAHA 2PUHA 2IOFK 4D9GA 4EY7A 3KL4A 1L3BA 1X38A 3OT1A 5EJ8A 2WIDA 4UU0A 2IPMA 1W88A 3KAQA 4KWTA 3PWSA 1F12A 1Q14A 2H9YA 4R16A 1DOZA 1JJ7A 3A6JA 4WNAA 3E5HA 4BZZA 2C9DA 5CXQA 4PRKA 4CGZA 2ZI5A 3NNDA 3QFSA 2OUIA 2Y3IA 3I09A 1QIIA 3DVQX 1PEYA 3UT0A 3WLOA 4C2AA 1D5WA 4DDKA 4B3MB 1Y7TA 2G70A 4G8BA 1J07A 3LNCA 1J8VA 1VL8A 4V38A 5CU7A 1XQ9A 4C01A 4ZO6A 3EASA 1L7BA 4CIYA 3F5SA 2X58A 3EVEA 2BFMA 5FNVF 1ZXXA 2C4UA 2GFHA 4MKGA 2D5AA 5DYGA 2P9FA 1IPEA 5FORA 1RQGA 2AJDA 8ATCA 5IHPA 2VHJA 4DCGA 5FWXB 3BGOS 4DPLA 3WL5A 4Q1VA 1GAWA 1W85B 5L4LA 3IURA 4I1RA 2ZIXB 2GK4A 1AB6A 1N57A 3UKOA 3EYWA 4IFBA 2BF4A 3AR3A 4DV2B 3QFFA 2X8LA 1DQNA 2C4WA 4X66B 1GDTA 2YWJA 4UEQA 1W581 4GOOD 4Y2XA 4XQ9A 1AH2A 2J3KA 1CE8A 2BBTA 3K70C 1MGOA 1VDMA 4MVJG 3ZZMA 3VNSA 1YQ9A 2OMKA 2KMLA 2OZLA 4WZZA 4II7A 4HV4A 1KSFX 3KPWA 5JTUA 1RI1A 1VECA 4WWHA 1LJLA 2Z83A 4X44A 1ZNZA 2I80A 1TZBA 3FNIA 4YAEA 3CVUA 4XCVA 4FJ1A 3E7XA 2QHXA 4YYEA 2BM1A 1HDOA 1VFPA 1E3WA 3KYJB 3QXCA 5EE0A 4K7JA 2PUCA 1NUPA 5JO0A 1YVPA 2HZBA 4JEUA 1W36C 3R75A 3TX2A 1KH2A 1L8LA 3MJDA 4L8FA 2WG0A 1WP4A 1UL1X 1VZ2A 2QVBA 1TIBA 4ETWA 2GBLC 5ECWA 3QVVA 3UK0A 3V4ZA 4NABA 1GQQA 1RAEA 1PBTA 2QOEA 3QU5A 5AICA 1WDKA 3KX2A 3GZJA 4Q6WA 3I76A 1DQYA 3JQDA 2XDYA 4CTOA 2GBLA 2G6TA 4X45A 3RF6A 1Q16A 3HBMA 3JRXA 2VUUA 3QK7A 2OD2A 1VP3A 3JQBC 3SF8B 4JCCA 4M1YA 5JZBA 2ZKLA 4MWBA 4BFVA 2V54A 4CF7A 1NG9A 5EEGA 4JLOA 5E9JA 1XYGA 4IHJF 4OPMA 3D81A 3VNAA 3ZXUB 3PXUA 4L4XA 4HBGA 1AURA 1UXHA 1GEEA 3JQBA 4QGHA 4RADA 3B5IA 1NJGA 1P9WA 3G7UA 2G1UA 3TIGA 3WJ2A 4AKHA 2JK1A 4S1OA 3SJUA 4UDYX 3MRVA 3I01A 1K7SN 2PLFA 4RY0A 2HFJA 2FLWA 3PEFA 1BAPA 1NWCA 2J6BA 2CD9A 5ALXA 1G55A 2HJRA 4M9ZA 1ST2A 2C04A 1PDWA 1YDEA 4TV8B 5CA1B 1G63A 3ZHRA 2D3TA 5K45A 4X91A 1DRVA 4N12A 1PJ8A 4RU1A 5KPJA 5P21A 3NRCA 1RYNA 3U2QA 3U48A 3ZJ5A 5AXDA 3DDWA 1JHYA 3BDAA 1NOIA 2ZYGA 1RWNA 3FUVA 5AW3A 4E09A 4RF4A 3IDOA 5DXAA 5E6SB 4L5IA 5B55A 3DULA 4JKIA 1L5KA 2NG1A 3GP8A 4FR0A 1U8YA 2GD2A 1XTRA 1MZVA 1JQKA 2GKOA 2VYNA 4KIFA 4EHDA 3G3EA 5GZ3A 1SCIA 2DBYA 3ID6C 4KMRA 2J3EA 4RQAA 2QRMA 3V8PA 3N8IA 3CIFA 5JSUA 2OC4A 2P4SA 2FN9A 2W2NA 3I2HA 3OIFA 3R8CA 1KAOA 3DOCA 4B0OA 1YGPA 4NS1A 4QYIB 3D4BA 3HWX1 1U5CA 2HMSA 2DFLA 3JWJA 4OP1A 1IJFA 4B9EA 1HG0A 1CZNA 5CIWA 5EWJA 3T3EA 4XASA 4HUTA 3E9DA 3ZI7A 3TWOA 3DW1X 5AUOB 4C7XA 1P81A 4LYJA 2YJ5A 1O96A 3VXKA 1QGAA 3D6JA 1Q5PA 2JRCA 5D6OA 3PE4A 1ZXLA 2L82A 3H5TA 4U0KA 2H3HA 3DBHA 4ZQEA 5KU7A 1N33B 3SMQA 4Q47A 1P0PA 4Y2SA 3NUZA 3UFBA 1U0RA 1U3WA 5FRDA 3TBHA 2HQ1A 1PZHA 2CHVA 5JAPA 1IEWA 5TMPA 3CBGA 3R7NA 1E7QA 3SC3A 2XW6A 1OYYA 2PBZA 4YMSA 4IAOA 1WSDA 4J4HA 5B1EA 6NULA 1WIWA 4RULA 3SVZA 1KWGA 2P1DA 1GKIA 2IIVA 3W5CA 1E8NA 2ATEA 4WMLA 1L5RA 4M98A 2WV9A 3Q0IA 1M1NA 1Y7IA 1XKXA 2H9AA 3ER8A 1IATA 3D59A 4TYPA 1RAGA 1PD0A 2F90A 2ZRQA 1T0HB 3CSUA 3HRIA 4DSNA 2QYHA 3TOVA 4F4DA 3WX0A 3RHTA 3FDZA 2IA5A 4R9RA 4DLZA 5FLKA 5EERA 1V6CA 2R8BA 4Y1RA 4URFA 5K0S