5KKCA

L-lactate dehydrogenase from rabbit muscle with the inhibitor 6dhnad
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
331
structure length
328
Chain Sequence
AALKDQLIHNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Ligand binding phenomena that pertain to the metabolic function of renalase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 112
structure length 328
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5kkcA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5kkcA02
4W99A 2WYVA 2HDHA 4DIOA 3MTJA 1NFFA 3AK4A 5EQDA 1PQWA 4DC0A 4GWKA 1YQDA 1HSOA 1AXEA 2BELA 3COSA 1BGVA 1JA9A 1SO8A 1T2CA 1DRUA 4TKMA 3OJEA 4FFLA 2UVDA 2PH5A 3ASUA 3MZ0A 4UVDA 3W8FA 1DFGA 1CIVA 3QLJA 2O7SA 4NNJA 1QLHA 4DBVO 2F00A 5IXYA 4XQCA 4MKRA 1SZJG 4FB5A 3LC1O 1S7CA 1E3EA 1PQUA 1P0CA 2DM6A 3HJAA 1T4BA 3AI3A 4GKVA 2YDYA 4AJEA 2X0JA 5EL0A 5BT9A 3ZNQA 1IB6A 3BMOB 4BQRA 1CJCA 5A9SA 4J6FA 1P3DA 5B37A 3W4JA 3ZW9A 4I5EA 1ZFNA 4LN1A 5TF4A 5A9RA 2R00A 2YFQA 3KEQA 3WQQA 1V3TA 5I9NA 5L40A 1OZAA 4ZN6A 3DTTA 3TDKA 4CM8B 3NTOA 3C3XA 3PPIA 1SOVA 4YT4A 2VWHA 1ZEJA 2Q2WA 3D4PA 2HSDA 3B1JA 3L9WA 3QA9A 1C1XA 3EYWA 3I9LA 3ZZNA 4E33A 2UDPA 3O4RA 2Q1UA 4R9SA 4UUMA 1HE4A 4HUJA 2GR9A 2HMSA 4YTEA 5EESA 1ONPA 2CDCA 4U6QA 4YJGB 2DTEA 1EUCA 3AFNA 4XQ9A 1IL0A 2Z1NA 4Z0PA 3WLFA 1GD1O 1LJ8A 4J43A 4CLHA 1DLIA 5IF3A 1WW8A 1QYWA 4EGFA 3GEGA 2V7PA 2PZMA 3H5RA 2VZ9A 3NUGA 2BH9A 1PQPA 4AL4A 4L9RA 4DYDA 2OFPA 3C85A 3GT0A 1UXKA 3GGGA 4IXWA 3CMMA 3KB6A 3DWFA 2UAGA 3GEMA 3G49A 4W7IA 4CMIB 4BNXA 4DGSA 5KTKA 1ZMOA 4PN3A 3PJFA 1KY4A 3CZRA 1HDYA 4NH4A 4ND2A 4WKGA 3HN2A 3TZQA 3U4CA 5JCJD 1B7GO 3BTVA 4RF5A 4WLUA 2R2GA 1V3UA 1HF3A 4QFCA 2PWZA 3AM3A 3GPIA 1HT0A 2F1KA 3BMOA 1A4UA 2Q1SA 4TKLA 4BNUA 7MDHA 3N7UA 3KOUA 4CODB 4TZTA 4LW8A 1I24A 1B15A 5EQFA 4K1LA 5AXAA 3JQFC 2JD0A 2HLPA 4CM8A 2P91A 3ONEA 1YE3A 5ES3A 4YAEA 1NAHA 2FSVA 2Y67A 1NASA 3ITDA 3OQ6A 4NK5A 2HU2A 1WNTA 2Q1WA 1A7KA 4RZHA 5JPIA 4CUJA 4D79A 2B5VA 2JHGA 2RH8A 4IDGA 4ZHSA 5CG1A 1MX3A 5DCUA 3TZCA 1F8FA 1TT5A 3H8VA 4YJGA 3EK2A 5DOVA 3GN1A 2IXBA 1AN9A 1B8PA 1NR1A 1R0LA 3H3JA 4R1UA 2OORA 4IS2A 3Q3CA 4TRRA 1M6HA 1QYDA 4PVDA 2G82A 4IMRA 4AFNA 3GRKA 4OO3A 1TXGA 1K3TA 4R41A 5ITVA 2PLAA 2QRJA 2WJPA 1YL7A 3U9LA 4FGSA 4CMIA 1ZSNA 1A7AA 5G4LA 4D42A 2GN6A 1NX6A 5JSFA 1GQYA 1TT7A 1T2FA 2IZ0A 2ZTMA 1BXGB 4C7JA 1HE2A 2Q46A 1M6WA 1PX0A 1RPNA 1ZMTA 3HNPA 4BNIA 1I30A 1JN0A 4J2HA 3EHEA 1OAAA 2ZCUA 4BHTA 2X4GA 3PRJA 1YOVB 3UCXA 2GERA 3ANNA 2VOEA 3AU8A 4RDIA 3WGGA 4II3A 1U1IA 1PZEA 3FCOA 4YQZA 4MJLA 4CMHA 1FXSA 4LVCA 3ZWVA 3E18A 3R3SA 1LSOA 5A5EA 4MO2A 2WD8A 5ADHA 3L4BA 3TFQA 3M2PA 4MKXA 2AG8A 1HE5A 1MLDA 4EEZA 1LI4A 2B4TO 3QVTA 2JD1A 3FF4A 5K6AC 2PD3A 1Z7EA 3LLSA 4BNJA 1DFIA 3I9KA 3OSUA 2XAAA 1E5QA 3UF0A 2ZJ0A 4NU5A 5JNLA 3CE6A 2O3TA 2X23A 4NDNE 3WBFA 1M67A 1P74A 4YXFA 2FSSA 4K9DA 3DTYA 4BO4A 3ROKA 4YB8A 1Q0LA 4J1NA 5KKAA 1NHWA 4LRTB 3NDJA 2NNLD 4R1TA 1B26A 3HZZA 1SBYA 3GY0A 3VPHA 2BMAA 4TROA 1A72A 5ENVA 1DO8A 4UUOA 2HO5A 3FRJA 4OSPA 3TJRA 3DO5A 1VJ0A 2IEBA 1VI2A 7ADHA 2FR8A 1UXGA 4FFOA 3IDSA 1NWCA 1BXGA 4OM8A 4BO9A 2E49A 2W4QA 4NK4A 4OIMA 5B4UA 1WWKA 4FFPA 2YUTA 1E1LA 3VH2A 1HE3A 4JBGA 3RCBA 1AGNA 1YOVA 2WD7B 2DT5A 1NFQA 4GKBA 4ZQBA 2UUOA 1ZXBA 3ZNOA 4JBIA 4F3YA 1UP6A 1O8CA 4NBRA 4OXYA 3D4OA 1XCBA 1ZJZA 5B4VA 3PZBA 1JAYA 3JYLA 1XQ6A 1P1KA 2CSUA 4J1SA 4PLWA 5CHEA 3ZDFA 2ZK7A 4ND5A 1H6DA 1L7DA 3KM0A 4U6SA 4WLVA 3RUEA 4E0BA 4J7XA 5JAIA 1PGPA 2RH4A 3GGOA 2I5PO 4PLTA 1U7HA 1GZ3A 1LDEA 3PI7A 1R16A 3JD0A 1E7QA 4BOYA 2OP0A 2Y1EA 3IP1A 2YV2A 3TPCA 4KUEA 4G81A 3IJRA 5A4DA 2JD2A 4PLHA 1G0OA 3GQVA 3KRTA 3R0IA 3QWBA 5HTOA 3EZYA 4FFMA 1VRWA 1LNQA 4JROA 2HQ1A 2WTBA 3QWAA 4RF2A 4CR7A 4Z6KA 4E5KA 3IP3A 4MP3A 1R6DA 4AJ4A 2R6JA 4P38A 5C5IA 3JYQA 5GZ3A 1C0LA 1S6YA 2VUUA 2X7HA 1IHXA 2EIHA 1R12A 3PJEA 4NR0A 3WMWA 1N9GB 5KOIA 4ALKA 3U0BA 3AUSA 3ITKA 5CDUA 4E2WA 3FD8A 4CR8A 3BTUA 3Q9NA 3NGXA 4IJKA 3LF1A 2NU6A 4D46A 3FWZA 1JTVA 4L4XA 2VT3A 1PU2A 3GNQA 1W73A 2WD7A 2VYNA 3QIVA 5KJEA 3BMCB 3V2UA 3NT2A 3OECA 1BHSA 1QKIA 2GASA 4JK3A 4PG7A 4IS3A 4PZCA 1X7HA 1V6AA 2IYPA 2TMDA 3U3XA 1ID1A 1NQAO 3MJEA 5A05A 1Q0QA 1L1FA 5DULA 1GY8A 1A71A 3AOEA 3IOYA 3QP9A 2PZJA 2VUSA 3TL3A 1Q1NA 3HE3A 1WMAA 4RPKA 1E6UA 1ZUD1 4KTVE 4JN6B 1PZFA 3C1AA 3F5QA 2O3UA 1D7OA 2J3KA 2BHLA 4HFNA 1P77A 4YVFA 4AVYA 3AU9A 4D0SA 1DSSG 4HBGA 2CDAA 4YRBA 1EBFA 5FEUA 3U62A 1R37A 1LEHA 1Q7CA 1ENYA 2Q4EA 1E3IA 3U5TA 4XGNA 1EK6A 1E0DA 2VYVA 5TX7A 4JBHA 2X1HA 1UDCA 3WGQA 4BNVA 2E82A 2B37A 2EGHA 3JQCA 5JS6A 4YJDA 1QMGA 3Q1LA 3QQPA 1HL3A 1JU9A 1CQIA 1Z73A 5U1PA 2Y05A 3VKUA 5DP1A 4J90A 2Q2QA 1N9GA 1Z75A 3F4BA 5KIAA 1QORA 1M66A 1DRWA 4I9HA 3ANMA 3PWKA 4CV0A 2C5AA 1C0PA 4GWGA 3RUHA 4BMNA 1LLDA 2X86A 3D3WA 4BGEA 1U3UA 2AQKA 5ILOA 4DIFA 3N74A 4NJOA 3BMCA 4UUPA 4CL8A 3LK7A 2DQ4A 3GVCA 5TC4A 1NPDA 3O03A 2FHSA 3UICA 4TVBA 3RUDA 2X6TA 2Y1DA 1BTOA 4JIGA 3ANLA 4EEXA 2J5QA 5KKCA 3BHJA 3U4HA 1HZJA 5A3JA 2X0IA 1M76A 2C59A 1ISMA 3JQ9A 1DOHA 1NM5A 1KVUA 3SJUA 3QSGA 4RF4A 1TI7A 1T4DA 1DC6A 3WNQA 4YJFB 2Q4BA 5K0ZA 5G0WA 1SOWA 2CFCA 3GVIA 4RVSA 4L73A 8LDHA 4LCEA 3HDHA 3DZHA 3ZU3A 4E2YA 2O3JA 3HQ4O 3PFWO 2FPPA 5BNTA 2YJZA 1ENPA 3A1NA 3DMTA 2WE8A 4R3NA 4QSMA 1A4IA 4QO8A 1MG0A 2AW5A 1HYGA 1ZSYA 1GDHA 5TIIA 3V8BA 1PL6A 5JDCA 1NHGA 1DHRA 1KC3A 3HDQA 3NAQA 4FW8A 4QTZA 4XQEA 1PGQA 3M6IA 2IODA 1EBUA 3NT4A 3KTDA 1L7EA 1QYVA 3IQDB 2LDBA 3DOCA 4E13A 1J5PA 3GPDG 4WCFC 1U5CA 4XGIA 2CF5A 3C7AA 4E2ZA 5BR7A 3M2TA 3ABIA 5AYVA 4BO0A 2D1YA 2VHZA 3QV1A 1T24A 2NSDA 4MVJE 5JAMA 5JAQA 4XRRA 2PTGA 4XB2A 5G0VA 1ENZA 1YBVA 2CNBA 4D3FA 4U7WA 4J16A 1E3JA 2EKLA 4LGVA 2BFOA 3LYLA 4XQGA 4EI2A 4XYLA 4FIZA 1TA4A 4RPGA 3WWYA 4ZA2A 5B1YA 1ZH8A 1U4OA 1QSGA 4R54A 2PH3A 1P1RA 4Y8VA 3K9QO 4ALIA 4CLXA 5C7OO 1LDBA 1U8FO 1O0SA 3R6DA 2D5AA 4TRJA 5IN5A 3NJ4A 4GMFA 8ADHA 1SCUA 2V6BA 4BL5A 3CZMA 3SX2A 4WLEA 1KY5A 1P1JA 4YJFA 3ZHYA 2X0NA 1WZEA 3D0OA 1EUZA 1GUFA 1UJMA 2B83A 3ZHXA 1H0KA 3MJTA 5FF9A 4DMMA 1A27A 1PIWA 1Q7BA 1PWZA 4GVLA 3PGJA 4NIMA 4J1QA 2VYND 4UEJA 3ENKA 1KVSA 3P2OA 3FNEA 4J9UE 4PRKA 3DDNA 3ONFA 3Q2IA 5TJ9A 4B79A 2Z1MA 4MKZA 4A2CA 1NVMB 5TNXA 2OBNA 2OP1A 3NRCA 2VWQA 4FSHA 2FPIA 4D3SA 4EDFA 5A1TA 4CLOA 4Y67A 1YGYA 2J8ZA 9LDBA 1BW9B 1Z45A 3PJGA 4NBUA 2HAEA 3I1JA 5GMOA 2C7VA 4KWIA 4B3HA 3RI3A 3I52A 4BO1A 3DBLB 4I1IA 3A9WA 4PG4A 5LCXA 3IUSA 4E31A 3CKYA 3OQBA 3WTCA 1IZ9A 3LT4A 1EDZA 1R4NB 1FDWA 1PL8A 3UVEA 1DIRA 3DAPA 2GN8A 2VYVD 3K5PA 3MJ4A 4ZU3A 3RIHA 3UGKA 1J6UA 1DJNA 3G17A 4G65A 4N7RA 4NFSA 3WLEA 3JQEA 1ZKMA 4GX0A 5DF1A 3FTNA 4IJUA 5G2OA 4ID9A 5JY6A 4BNGA 2EF1A 3Q11A 5H82A 1UH5A 4CM7A 3TSCA 2DFVA 5DBIA 4TMFA 2NU7A 1GZ6A 1VC2A 2EGGA 3E5MA 3WFIA 1EE2A 1F14A 3GC6A 4I5DA 5I8WA 2G76A 3M1AA 5HWSA 1N5DA 4BV8A 3W4KA 1JWBB 1P1IA 1E5LA 3OQ1A 3CXRA 2VRBA 2DKNA 5JDCC 3WG9A 2O7QA 1Z6ZA 3PLRA 3PZRA 5F5NA 4DRYA 4Y98A 4HX5A 2O3RA 1HLPA 4Q3EA 3ASVA 1DEHA 1BVRA 5DCYA 5L51A 2ZTUA 3WGTA 3RUFA 3GK3A 3LC7O 4Q3NA 3HDJA 4BKPA 1GV0A 1BW9A 4MP8A 1TEHA 4XR4A 1SAYA 2O2YA 1SMKA 4QQRA 1X15A 3T4XA 4LK3A 4R9RA 3DBLA 5I7FA 3AWDA 4Z9XA 4AJKA 1D8AA 5JBIA 3GFGA 2FR0A 3L4SO 4A10A 2HK8A 5HBRA 3ENNA 5TLSA 3VH4A 3U09A 5GZ1A 4RVDA 4R5MA 5T5QA 1CEQA 4DYVA 1G1AA 3K6JA 2X9GA 1JVSA 1NR7A 3KSZO 4EUEA 4E5MA 1EVYA 2CUKA 3WJAA 2ZB8A 3DBHB 1ADGA 4PZDA 2BI7A 2D5CA 3GMSA 3DHYA 3ON5A 2AXQA 3PYMA 4J4HA 4R1NA 2GZ3A 4GQAA 1RM4A 1YB4A 4ND3A 3SXPA 4B7UA 5C7IO 5TSDA 1VSUA 5T57A 2CDBA 1P1FA 2VRCA 2P4HX 4M1QA 4YCAA 5IZCC 4A7PA 4RF3A 1OOEA 2YHIA 1NQ5A 2OO5A 4QO7A 2I99A 4Q3CA 3PWSA 1EQUA 4IINA 2HK7A 4YDRA 3PXXA 1EUDA 3ONDA 3VZQA 4NBTA 3GRPA 5KVVA 2O2SA 3V5NA 3ZWAA 4J9VA 5IDYA 1DC4A 4B3JA 3S2EA 5HA5A 1EEHA 1N1EA 5EINA 1ISIA 1PS0A 3MJCA 2H9IA 4YA6A 1X13A 3PHGA 4OSOA 5CFZA 2GLXA 3JD3A 4NPCA 5IG2A 1GPDG 2B36A 4RLSA 3EUWA 3FHLA 1Y81A 4RVHA 4URFA 3U4IA 3JQBA 2OUIA 1EFLA 1LDMA 1ISFA 2YV3A 3PGXA 1I32A 4DREA 1LDYA 2X5KO 4CMGA 2D3TA 5L3ZA 4WEQA 3WGOA 1JQBA 3RBVA 2EW2A 1T2DA 3BXXA 4XRGA 3I6IA 3S2IA 3ZWXA 4BGIA 4FBGA 2C20A 2IYOA 1E92A 1PS9A 2FPGA 1GU7A 1R4MB 4UULA 2NTNA 4QEDA 1N2SA 4DQVA 1NQOA 3DBHA 3BYZA 3DZJA 3GR6A 4LRSB 4PG5A 2OXIA 1U3TA 2GF2A 3O9ZA 1IY8A 1TVEA 4P4NA 4YACA 1U2GA 3OFSA 1QR6A 4GI2A 2UUPA 4J4TA 3TQHA 2TMGA 3N58A 2VN8A 1PZGA 3CEAA 4PGFA 4OQYA 1JWAB 4Z9YA 3LC2O 3K73O 2WYWA 4CMEA 5JO0A 2BRUA 2OZPA 2PD6A 1QLJA 4ONEA 4Q39A 4Z0HO 4AJHA 1UUFA 4R16A 1CRWG 4TZKA 4K26A 1I3MA 3IUPA 4LSWA 2AG5A 3WYEA 4ZJUA 1FJHA 4WK6A 5IJZA 2ZCVA 5L45A 1N7GA 2W98A 1PR9A 1N8KA 5AQ1A 3A14A 4HY3A 3HDYA 3OJFA 5JLAA 1NWHA 2VZ8A 4YPOA 3TOZA 5COBA 4KOAA 2NU9A 5I8ZA 4IXTA 3VPFA 3W6UA 4XYEA 1D1TA 2H1SA 3HN7A 3IKTA 4KP7A 3LDHA 1HDCA 4XJSA 1ZZEA 2HUNA 4WGGA 3DAFA 4YAGA 2W2KB 1R4MA 1YJQA 4RPJA 3RKRA 4HP8A 4YJHB 5HRUA 4HNHA 5BQFA 2YHUA 2QRLA 2J5KA 4IIUA 4NQZA 3KYCB 2E6UX 4XYGA 2Z5LA 1OC2A 4IZHA 4NG5A 3H5AA 1BDMA 3AW9A 4LVUA 3HHPA 2QX7A 5KVCA 3QY9A 1MG5A 1DPGA 1LRJA 4E4YA 4O63O 1V35A 4RJTA 2O4UX 4XJTA 4K28A 2BF7A 2I9PA 3AM4A 4O1MA 1NQTA 3OM9A 5EPOA 4INAA 1NVGA 1Y9EA 1ZK0A 4IDCA 4UVEA 1EFKA 1LBEA 1VE9A 1HEUA 4YAIA 1XU7A 4W82A 5EJ2A 3WGYA 4WLNA 1HDXA 1GPJA 3GDGA 4NHEA 3I9NA 4OOFA 3ZV6A 3PK0A 3WX0A 4CR6A 2P68A 1KS9A 4FOOA 1UDBA 1EVIA 3H9UA 1Y5RA 3ZWOA 3FWNA 1BMDA 2W90A 3NV9A 1SEPA 5JYEA 3JQ8B 3TZKA 3QWHA 1XDWA 2R00C 4WE3A 4NBWA 1ISJA 1DIAA 2JAHA 3IS3A 3ICPA 2Y1FA 4RPLA 3VDRA 2VRCD 5ER6A 1PS8A 3K96A 4XWYA 5A02A 5TJHA 4XYBA 1LDNA 3FTPA 5TS3A 2NVUB 4KWHA 1KOLA 3ZWCA 3CH6A 5CEJA 5I7EA 1WP4A 3LLVA 3PHIA 3ZWPA 3GLQA 1WDLA 5DNAA 1FDSA 2PZKA 5KJ1A 1KYQA 4TRMA 4E5PA 2JKVA 1WDMA 2W2KA 2XPCA 1E7SA 1TB4A 1VJ1A 1GR0A 2Q45A 2RHCA 1HRDA 2XXBA 3GAZA 2WDZA 4YJHA 2BGKA 3LQFA 1DJQA 1NTOA 1RM5A 1JKFA 2C5EA 4JP2A 3KYCA 4Z9FA 2P9GA 1B3RA 3GUCA 1ZIDA 4IIVA 4GPD1 1ZK2A 1E7MA 4MIOA 4CV2A 2IZ1A 3DOOA 1SNYA 2BGMA 4A73A 1V8BA 2YW9A 1MP0A 3AY7A 3BMQB 5CAEA 3AI2A 4TQGA 1J4AA 5EIOA 3PLNA 2SCUA 4AJNA 3KO8A 3PQFA 5KWEA 4HFMA 1BRMA 2DFDA 2A4KA 4FGWA 4M55A 4AJ1A 2VZ0A 4XIYA 5IDWA 3PQDA 3INTA 2POQX 4I08A 5MGBA 5AVOA 3KEOA 4BNNA 2QIOA 3E8XA 2P9CA 2X8LA 1KVRA 4BS9A 1NXQA 3DHNA 1I8TA 4IJWA 5T8KA 4BNMA 3ICCA 3JQ8A 4N5MA 2AQHA 2VNSA 2DTXA 2VT2A 2CD9A 5COQA 2H63A 1VSVA 5DZSA 4CMKA 1I3KA 3RD5A 5KCZA 4RQUA 3MEQA 1VL8A 2G1UA 1EZ4A 2NVUA 1OI7A 3WYCA 1EDOA 3OMLA 5ER9A 3BHMA 1Y7TA 1ZNQO 1JKJA 1LDGA 2O50A 4XD2A 2PY6A 4I8XA 1DFHA 1W8DA 3E9NA 2Z95A 3OHSX 4GLLA 1H9AA 1F06A 2JHFA 1GTMA 1Y1PA 3RQSA 1PJQA 2G17A 2YZ7A 1PTJA 2O23A 1YQXA 2OOSA 4P4LA 4WLFA 3H9GA 4I9UA 3GDOA 4QT0A 4WJZA 5A9TA 1YRLA 1IYZA 3L77A 3WDSA 3P2YA 2Y0CA 1N1GA 1J0XO 3BMQA 1A5ZA 3WR5A 2J3JA 5BSHA 3V1TC 3GZNB 3B6ZA 1GCUA 1ISGA 5HM8A 4MVJP 4AJOA 2PA3A 3G79A 4S1VA 4ILKA 4R4JA 1O9BA 1MGOA 1P0FA 4KDFA 4YAJA 1HWYA 3I4CA 4OMUA 4A03A 1MFPA 3RUCA 4AJPA 4FOSA 3TZ6A 2AQ8A 4WNIA 3TF5A 2BFPA 4PLPA 1HETA 3VC7A 3AUTA 1A9ZA 1DAOA 3O8QB 4YT5A 4F45A 3S1LA 3TN7A 3FR8A 1GL3A 1K6IA 3DB2A 1JW9B 1GQ2A 2E4AA 3L9XA 4UVHA 4A0SA 2FR1A 5G4KB 2O48X 1SC6A 3OEWA 4RLHA 2YDXA 3X2FA 1D3AA 3BZUA 3SJ7A 3WIDA 3L4BC 3GHYA 2BKAA 3JQAB 4H15A 4IUYA 2P9EA 4HNGA 2YV1A 3RJ5A 1Y6JA 4RGBA 3T7EA 5IAAA 4R5HA 4FC7A 3D4NA 4E30A 2AQIA 3QW2A 5I7VA 1VKNA 2ZYAA 4BO6A 1P44A 1SEVA 3I3OA 1ARZA 3QVOA 5A04A 5JC8A 3ORFA 3C7DB 2DVMA 2BFAA 4OXNA 2OMEA 5DDIP 4E6PA 3GUYA 5C3MA 3DBRB 3PYLA 2Y1CA 2P4QA 2OGUA 4ALLA 3LU1A 2ZYDA 1B2LA 4ZQGA 2HRZA 2YQ5A 3RUIA 3BMNB 4GVXA 3VPXA 1M2WA 4IZIA 4EW6A 3GZNA 3KZVA 4IMPA 2Y0EA 2HMWA 3JYNA 3EAGA 3EDMA 3TZHA 3OIFA 5F3RA 3L07A 1HYEA 3JQ6A 3KSDO 2C82A 3LVFO 2YFHA 3DC2A 3P5SA 4JX8A 5F21A 1VL0A 5T8KC 4NFHA 5JW6A 5KJFA 1BSVA 4PG6A 3ZNNA 2X5JO 1VM6A 3L6DA 1A9YA 5JE8A 4J3FA 1IULA 2DPHA 3O8QA 4CM6A 3DZFA 1X14A 4QXMA 3QWIA 3RFVA 4PLFA 3OIGA 4Y6RA 5G4KA 3H9JA 3VVBA 4Z0TA 1JDJA 3H4VA 4UVGA 3PP8A 3JQGB 9LDTA 3GG2A 4DUPA 1E7YA 3JQAA 3GVXA 4RORA 3H3FA 1MC5A 1MB4A 3NJ8A 1C0IA 3IJPA 1KEPA 1LU9A 1R0SA 2I66A 3HFGA 1LC3A 2Q1TA 4DWVA 4MVJI 1YQGA 1DC5A 1PJTA 5FYDA 2AHRA 3T7CA 4DVJA 3NEPX 3D3EA 4D41A 4J4BA 4EBFA 2Y68A 3GOHA 3VZSA 4CM1A 4L76A 1RYEA 3ROQA 2PKRA 2IRWA 4HV4A 3DBRA 1BXZA 1QYXA 1XU9A 1ZO8A 1UXIA 1GYQA 1NFRA 1XSEA 3VTZA 1CYDA 4GSKA 3BMNA 1H6CA 3IC5A 3DMYA 3F6YA 5GY7A 4HFJA 4XGKA 5G0SA 1K2WA 1QXSA 3EVTA 1DDOA 1UDAA 3RC1A 3AOGA 1LLUA 4W4TA 4W6ZA 2QG4A 5DOZA 5L9AA 1O95A 3FPCA 3IL2A 4L4RA 4O6VA 4CLEA 4CV1A 4E32A 2V65A 4MDHA 1QRRA 4ZICA 3DZIA 1R15A 3BAZA 5TT1A 4B4WA 3K2BA 4EUFA 5THKA 4E5YA 1I3LA 3GGPA 3WMXA 3UCFA 1YXMA 2GNAA 5CPBA 4FQ8A 4BKQA 5BSGA 3ETEA 4ZQEA 2J3HA 2VQ3A 1PL7A 4J49A 4RVFA 6LDHA 1YS4A 4O0LA 4CV3A 3WICA 2AE1A 1KIFA 5U4QA 2D59A 4LISA 2XOXA 1LRKA 4IGFA 1E3LA 3HWRA 3ROMA 3JQGA 4N18A 2ZQZA 1GV1A 3JD1A 2X0RA 3WTBA 1H5QA 1OC4A 1X0VA 1RJWA 3Q9UA 2WE7A 3SEFA 4BO5A 4W9NA 3ULKA 3AOEC 2Q3EA 3S55A 2Y0DA 2D8AA 3RVDA 3FNFA 1P1HA 2AE2A 5IZ4A 2PGDA 5IFLA 4GAEA 4E5NA 4C7KA 4L74A 3PIIA 4D7AA 1N92A 3D7LA 1SB9A 3OF2A 4NJMB 1Y8QB 4D44A 2VNAA 2GGSA 5DP2A 1XELA 5LDGA 2HCTA 1GYRA 5EMHA 3ROPA 3RU9A 3FSRA 2BI8A 4A27A 1WVGA 2PD4A 3TFOA 3KSUA 4WEOA 4XB1A 1NBOA 2VUTA 3VKVA 3WNVA 4BO7A 2NWQA 3AFMA 4GX5A 3UN1A 3ZU4A 1K0UA 1UP7A 3OBBA 1YO6A 5FWNA 2WWRA 1DAPA 3WSVA 3DZBA 4JQCA 2OL4A 2FMUA 3K30A 1ZK1A 4MPDA 1W6UA 2NQTA 5JAZA 2ZKLA 5CDTA 1YBMA 1IPFA 1YJ8A 2DBQA 3AJRA 2GN4A 2VWPA 3DQPA 5L95A 1O6ZA 1J49A 3SBOA 2A35A 4E2XA 3ZHBA 1V0JA 5F1OA 2NV6A 2PK3A 4A26A 3OA0A 5HS4A 1K89A 3ZU2A 1B16A 5JY1A 1NPYA 4PLYA 1H94A 2ZQYA 2JCXA 3IKVA 4CLRB 3OETA 1Z82A 2O4CA 2I76A 3Q0EA 2EJWA 1XG5A 3A06A 3GVHA 1PZHA 4PLCA 5CDYA 5A3VA 2FN7A 1XWFA 4L75A 3JQ9C 4CMCA 1NP3A 1UXJA 1LX6A 1ZEMA 2EV9A 3GEDA 4Q3DA 3ZW8A 5IDXA 2E48A 1E3WB 3WBBA 1Y5MA 1LUAA 1Y8QA 4NJMA 4B4VA 2C07A 4EJ6A 3DAGA 1GZ4A 4WLOA 3VDQA 3L0DA 1YKFA 2IE0A 1WPQA 2HKIA 4YWJA 1X7DA 4BVAA 3DMTC 3AY6A 4G5HA 4IY1A 3H6KA 2GD1O 1B14A 4HKTA 4YRDA 1ZXLA 3JQAD 4RZIA 4AICA 1ZBQA 3ZGYA 3PJDA 6ADHA 1HDZA 2Y93A 5AXDA 2EWMA 2GSDA 3C24A 4DBZA 1FK8A 3V2HA 1NYTA 1D1SA 3VVCA 3DBVO 1P45A 4DQUA 3GHHA 3PIDA 1AHIA 1CETA 2B69A 3FBTA 1U5AA 3JD2A 3CTMA 4GLOA 3LT2A 4IDBA 3L6OO 2G0TA 2JFFA 4B3IA 3BHIA 4JNKA 2HMUA 3QHAA 4R01A 1WDKA 5AXCA 1DLJA 1Q2XA 2JCYA 2JCVA 3DHEA 1PJ3A 4KUGA 4CLRA 1HSZA 1XLTA 2RAFA 3INGA 1MA0A 3HG7A 4OKIA 4R68A 1SPXA 4JGBA 4FFNA 3PHJA 4MVJF 1PWXA 4IGEA 1W4ZA 1XIVA 1R4NA 4JJIA 4KQXA 3RASA 1I2BA 2WYUA 2EKPA 1PGNA 2CF6A 1NVTA 4J0FA 4O5OA 3I9MA 1E3WA 4XDYA 4CPDA 2ZJ1A 5IDQA 3GNSA 3CIFA 4L0QA 4BGVA 4GX2A 3MOGA 3KXDA 3QE3A 4XCVA 5A5FA 2AA3A 1DBVO 1Y8RB 1GUYA 5A03A 5DN9A 4PCVA 1R66A 2CMDA 4HFRA 4WPGA 3ST7A 4MVJG 4BGUA 2WM3A 1U4SA 1DXYA 2NQ8A 2GCGA 1Y9AA 3EY4A 2X9NA 1GADO 3GNTA 4PLZA 2ZATA 3JQFA 5LDHA 4U0KA 4IQ0A 4KMSA 5A06A 3ZHZA 4ALNA 5ICMA 1I2CA 4TWRA 1GUZA 1UXHA 4N5NA 4XX0A 5COAA 2ET6A 4LSMA 5IXSA 3KLPX 3HADA 3TOXA 3ZN2A 2UYYA 2UV8A 1K6JA 3EMKA 4FPXA 4B4OA 4YR9A 2VHXA 3X2EA 3K92A 4BB6A 1TLTA 2AEMA 3UKOA 5BSFA 1XQ1A 1IUKA 2GDZA 2VCYA 4KDEA 5L7YA 1E1KA 3ADOA 4FCCA 2YQ4A 3I6QA 4U8GA 1GAEO 3E6AA 2QYTA 4L8VA 3E9QA 2Y1OA 4WOJA 4YYZA 1PJLA 1IE3A 4JJFA 3UFXA 2JFHA 1B3BA 1LLCA 4NBVA 4UEOA 1B8UA 5FI5A 1PGJA 4DXHA 4WUVA 2RHRA 4UREA 5CDSA 3WB9A 4KZPA 2HK9A 1K6XA 3K31A 1U28A 4O59O 1Y8RA 3Q2KA 4YBZA 4BUCA 3RJ9A 4ND4A 3OP4A 3VH3A 3JQ7B 4GH5A 4XZ3A 5DBGA 4L4SA 2PGJA 3I4FA 1ZJYA 1C0KA 4JCOA 3S2GA 1X1EA 4P4GA 1IZ0A 3UW3A 3LF2A 2RCYA 4AJLA 4MVJM 3KBOA 3HB4X 4BV9A 2EP5A 1XHLA 2I67A 3DZKA 3RKUA 3RWBA 2EHDA 2DBRA 1QV7A 4XA8A 1KERA 4P22A 5KJCA 4UEKA 3WQSB 3AY3A 4IBOA 1TT5B 4PVCA 4H3VA 5GZ6A 4PLGA 1ZK3A 2I3AA 4ZQHA 3TL2A 4F6CA 2HMVA 1E7RA 5K6AA 3B1KA 1G6KA 2I6TA 2VHWA 5CP8A 1GQQA 1MUUA 3A4VA 3WWZA 2AEJA 3IAHA 4N5LA 4CMJA 2V6GA 4IDFA 3RAJA 3AUAA 3ZI0A 1RM0A 2ZB7A 2P2SA 3UCEA 1P9LA 1PEDA 4M8SA 3PWZA 1LXCA 1UP4A 2C29D 1H6AA 2X5OA 1DIGA 2G5CA 4MINA 1YL6A 2FP4A 3K8ZA 1O89A 1G0NA 2A92A 4BO3A 1AUPA 3DXFA 2Q99A 3JYOA 4KQWA 4XEHA 4BNZA 1UAGA 2OBYA 4PIVA 4E21A 1YDWA 1BWSA 2DBZA 4PZEA 3JV7A 4R69A 3F5SA 4D45A 1AHHA 3O26A 4BNYA 5TQVA 2C0CA 2NU8A 4FDAA 1WMBA 2H6EA 4Z3KA 1ADBA 3MCVA 3UAGA 4WECA 2Y1GA 3NTRA 2Q49A 5DT9A 1IPEA 4PRLA 3JQ7A 3GF4A 3RROA 4FD3A 4RL6A 4XYMA 4NMHA 3ETGA 5F5LA 3OA2A 1E7WA 4J7UA 1ONNA 3VTFA 2EKQA 4CQMB 1ADFA 4J1TA 2FZEA 4B8ZA 3SLKA 4Q3BA 3H2ZA 4Z3DA 4M49A 4QECA 3W8EA 4C4OA 4IQ8A 3PHHA 4QUKA 3VPSA 2PR2A 1XYGA 3OEYA 3CPSA 3ZNPA 3FNGA 1W0CA 2ZB3A 1PJ2A 3OIDA 3JQBC 4XDZA 1LLQA 2VWGA 3H9EO 4BKUA 4OJNA 5ILGA 4BNWA 1QP8A 5CPFA 2EERA 1ULUA 1F17A 4ZD6A 4ALJA 3G1UA 1QV6A 3UUWA 3ZV5A 4CL3A 3E48A 4EUHA 4DL9A 1FDVA 5L4NA 4BQPA 4XIJA 3NKLA 4BO8A 3I23A 1FDUA 4GBJA 3GN2A 3H5NA 2PZLA 3QWFA 3H9QA 4JP3A 1I01A 1EVJA 1WLYA 3EC7A 4MVJA 1WAMA 4CQLB 3HUDA 1VL6A 1N7HA 3NX4A 3ZU5A 3QVSA 1LQUA 1EK5A 4X54A 1EMDA 4ALMA 2RIRA 1CF2O 4EZBA 3KUXA 1BVUA 2WSBA 3E5RA 1NPTO 3PDJA 3V1YA 4CM4B 4I5FA 4W7HA 4DLAA 1ZVMA 2RBEA 4CMEC 1CDOA 5I9MA 4BB5A 4DIBA 1JVBA 2ILTA 5JYDA 4JJGA 4FJ2A 2D2IA 4OH1A 4BMVA 3I9OA 3L6EA 3G0OA 2XXJA 3AI1A 4AG3A 1V9LA 1UAYA 2CVOA 3LT1A 3LSYA 2QHXA 2JL1A 3LT0A 1HYHA 1I36A 1ULSA 4CQMA 4J91A 1X1TA 3WS7A 1DRVA 2DC1A 1HZZA 1VKOA 4IM7A 1UZNA 1YONA 3PFFA 4QX6A 1T1SA 2A9FA 4II2A 3FPLA 4DMLA 5JDIA 1MFZA 3P19A 3MJVA 3PHLA 3M1LA 3W4IA 1T25A 2EEZA 3O38A 1XKQA 4B7CA 4D0RA 3RC7A 1HTBA 4RQTA 5T67A 5ICSA 2I3GA 3NDRA 5AOVA 1I33A 4YT8A 1LQTA 1HXHA 4LMPA 5EERA 2DBVO 3W6ZA 5JO9A 2W2LA 2ZYGA 3D5QA 3H65A 1T2AA 5ENDA 4CQLA 1DC3A 4BKOA 4RO0A 4BNHA 4MIYA 3SLGA 4HXYA 1ZCJA 4WCFB 3RC9A 3RFXA 2PNFA 1F12A 3OH8A 4NI5A 2EXXA 1HDRA 4IDAA 4CM4A 2BFMA 2NVWA 1Q0HA 5B4TA 4DLLA 1MXFA 5TGDA 3OJ0A 1Z74A 5FFFA 1PJSA 5CG2A 2OHXA 4B7XA 4OXKA 4OHUA 1DIHA 3GVPA 4FFRA 4M54A 1EVZA 3MOIA 5KVQA 4DPMA 4EJ0A 4DA9A 2ZIZA 1YWGO 4UVIA 5ITWA 5T6BA 1ORRA 4OYRA 2DUWA 1PSDA 1LRLA 1JKIA 1PJCA 2VTEA 2PKQP 3F1LA 1O94A 4PG8A 3I83A 4BNFA 2GUGA 1MV8A 4IJVA 4XR9A 3BTOA 2GZ1A 1DB3A 3C1TA 4WNCA 2C7GA 3GMDA 3UHAA 2HRBA 1I2ZA 4G2NA 1SB8A 3B70A 1HLDA 3C1OA 5C37A 1FDTA 1OMOA 3QVXA 3F4LA 2V6MA 3GFBA 4H7PA 3WOHA 4NU6A 1E3SA 2CZCA 2X58A 4NFYA 4ZGWA 5L4LA 1XEAA 1H2HA 3UH1A 3V1UA 4CM9A 4UAGA 3E03A 5F1KA 4YRAA 2IXAA 4RVGA 3NT5A 3VHRA 2Y66A 5TRTA 4BNKA 3EZLA 4TRNA 3TRIA 3U49A 1E1MA 3W1VA 1JAXA 2IDZA 5T64A 3RSHA 2X9VA 1ML3A 2O3QA 3D3WB 3PEFA 2EG9A 1C1DB 4WCFA 1I0ZA 3IIEA 2FWMX 3SC6A 3E82A 2A94A 1XA0A 1IOLA 1RWBA 2FRDA 1GEEA 1U7TA 4WCDA 1PJ4A 1Z7BA 2B4RO 2O3SA 4Y6SA 4YT2A 1JLLA 4B4UA 3A28A 5CDGA 3ETDA 3JTMA 1NNUA 4OAQA 1LA2A 1C14A 4Y6PA 4OGWA 5JMWA 2QQ5A 1PR3A 3K2EA 5FI3A 4XKJA 1D4FA 3RBZA 4BKRA 1H2BA 2JAPA 5JDIC 5J23A 4MVJH 2B0JA 3GZ4A 4WASA 5L53A 3JCZA 4MVJD 4BMSA 2NM0A 3WYBA 2WMDA 4MIEA 2J6IA 4ROSA 1ONOA 1H9BA 4OL9A 4HWKA 4GL4A 4TSKA 1P33A 4ESOA 3VZRA 3GH3A 5TT0A 3S2FA 4F46A 4J7CA 1OFGA 5L7TA 3ADPA 1I3NA 4CUZA 5KVSA 1BG6A 3V2GA 4NZ9A 2Y99A 5AXBA 4CMBA 2PGLA 4R1SA 1EQ2A 2IEDA 3S8MA 4DC1A 1E77A 3I9JA 4RVUA 1UZMA 4MP6A 1H6BA 1VLLA 1M75A 4CQMD 2JJYA 1QYCA 2B4QA 1GCOA 3G3EA 2BD0A 2Q2VA 4IQGA 3T4EA 1P31A 3RFTA 2C2XA 2NVBA 3LZ6A 3D5TA 1RKXA 2AEFA 5JMPA 3ZWYA 4CM5A 2NACA 1C1DA 3NGLA 4YQYA 5KNLA 5JXWA 2NTVA 1B0AA 4GSLA 1T2EA 2QYSA 3KHUA 3KV3O 1WXDA 2PV7A 3BA1A 1ZW1A 1YDEA 2ZTLA 4RV9A 1O5IA 3PQEA 3QRWA 4S3MA 1R0KA 3EVNA 1B8VA 1RYDA 3KYDB 4M87A 4Q9NA 2VHYA 5DBFA 1GYPA 4F6LA 4AJ2A 1UZLA 3JSAA 1BDBA 2NUAA 3EW7A 2IZZA 2W2LD 4OKNA 4FN4A 1VPDA 1UR5A 4OOEA 3C7CB 1FF9A 4DPKA 3RC2A 2CY0A 5F1PA 1E6EA 2DLDA 3F3SA 1V3VA 3IMFA 2GPTA 3QJ5A 2XF8A 1ISHA 2ZB4A 3W8DA 5BSEA 2FOIA 3HFSA 3E9MA 5I7SA 3WQRA 3ZCXA 5BNIA 4ZRMA 5C7LO 1AE1A 1ZK4A 4ZQFA 4B8WA 1U8XX 5G0UA 3KETA 3TNLA 4M89A 3FN4A 3PVZA 4I5GA 3NYWA 1KVQA 1PGOA 4LCJA 1NAIA 5JCXA 2I65A 3Q6IA 2D4AA 4CLOB 3VH1A 3JD4A 2QZZA 1Q7GA 4ND1A 4JXKA 3WJ7A 4BIIA 3WGIA 5U9CA 1LSJA 3WXBA 4BNTA 3RBXA 5H81A 3NTQA 2DPGA 3BTSA 3STHA 5LC1A 4FJ1A 2QRKA 3B20A 4J2OA 1F0YA 1LSSA 1E1NA 1U2DA 2NADA 4P8RA 3VOSA 1MXHA 3CSDA 1YVEI 2QZ9A 1WZIA 3U4DA 4CM3A 2YY7A 4PLVA 3WSWA 3H7AA 4KTTE 4E3ZA 2D0IA 4DLBA 3F1KA 3KYDA 5KJ6A 3AUUA 3F46A 4A5OA 2WEKA 3OJOA 3WGHA 2FY8A 1KC1A 4DQXA 2X22A 4YEDA 3E1KA 1I10A 3MWEB 4CM9D 1ENOA 5MDHA 2GZ2A 4FC6A 4RCVA 3DEYX 2Q50A 1YB5A 5EN4A 3FNHA 1XGKA 1K5HA 4YAKA 2QW8A 1KEWA 2AMFA 1EE9A 4J0EA 3GA0A 1LSUA 4UUNA 3G1TA 1GFSA 3I5MA 4M86A 3BIOA 4DPLA 2JFGA 3HB5X 5BNFA 3FI9A 3WFJA 3DFUA 3JQDA 1KBZA 1U9JA 3UXYA 4BO2A 2NTJA 1X7GA 5IZCA 2DTDA 1XR3A 3GDFA 3PTZA 4AJIA 2VHVA 4FJ0A 4K6CA 2DAPA 3MJSA 4LMRA 1CQJA 4TVOA 2V6FA 4EJMA 1IHYA 4RDHA 3EGOA 1KEVA 5L7WA 2BGLA 3GG9A 4I9NA 3ZWMA 1DIBA 5THQA 3FR7A 2DUUA 3ZWWA 3ZV3A 5I9LA 4IPTA 1OBFO 5IN4A 3ZWNA 3KLMX 4ITUA 3UOGA 2W8ZA 2HJSA 2C54A 4GX1A 4D43A 2H5LA 4N54A 2B35A 2GRAA 3NDIA 3CMCO 2NLOA 1HDGO 2C2YA 2FZWA 3B1FA 5CEFA 3KYBA 2EJVA 1ZSVA 4CUKA 3PYXA 4RPHA 2PFGA 1KEUA 3DFZA 4Y9DA 2CVQA 3JYPA 2GYYA 1E6WA 3RUAA 4CLDA 1AXGA 2DU8A 3MTGA 3VPGA 1T26A 1RM3A 4H16A 4PFJA 1C3VA 4U5QA 4CJXA 1X0XA 2VTDA 1FMCA 1HDOA 3OICA 5JCJA 4BNLA 4JLWA 1KETA 1H93A 2P5YA 5G0TA 4WOKA 3HSKA 3P7MA 2YYYA 3R1IA 3GAFA 4R51A 2BLLA 2YHIB 3R3JA 3ZWBA 4W9NC 1LTHR 3DR3A 5JC1A 4CMAA 5HS6A 5B12A 3SVTA 5L4SA 2LDXA 2GO1A 4GGOA 4D3DA 1YB1A 3DL2A 4IDDA 3DZGA 4ZRNA 3QVWA 1T1RA 2CVZA 3CUKA 2HJRA 3WGZA 4IDEA 1QG6A 3F9IA 1BXKA 1PJBA 3OJLA 4ZVVA 3H2SA 3ZV4A 1YL5A 1KVTA 1I5RA 2EP7A 4GGPA 3ZH2A 3FBGA 2J5RA 2ZTVA 1VJTA 3C8MA 3TWOA 3VZPA 3D1LA 1CWUA 1U3WA 5A9SB 2B5WA 2VOJA 2E37A 3WIEA 4U0JA 4OQZA 5DCWA 5H83A 3VAZA 5K9ZA 1HKUA 4Q3AA 4E12A 4MOWA 3SC4A 1YH3A 1F8GA 2GN9A 4HADA 1LC0A 2P5UA 4K6FA 2PKQO 1GEGA 3AM5A 3F47A 2HMTA 4FR5A 1YBAA 3D64A 1C1XB 1CERA 4EYEA 5CEEA 3KVOA 4DTIA 4AJJA 3MWDB 1MC4A 4GMGA 4KUHA 4QFDA 1U3VA 3INRA 1DHTA 3DOJA 4FS3A 3DONA 3RU7A 2J3IA 3CINA 1ADCA 2EW8A 5JFOA 4EITA 4R3WA 3PDUA
chains in the Genus database with same CATH superfamily
1UFVA 2QMZA 5DEOA 2ZQ5A 3LFTA 2VK8A 1AS3A 4L27A 1NVKA 2GTIA 4LXIA 3MTJA 2B1JA 3CUTA 3REFA 2PUJA 4DC0A 1YI8A 2AH5A 2B1RA 2XQKA 3Q15C 1P0MA 4AY4A 1N2CB 3D7MA 1DEAA 2FQ1A 3E9RA 3EG9B 5K3CA 3EIUA 5D5HA 4QLBA 5C8YB 1BDJA 1EK1A 1RABA 2BDEA 2DX7A 2RGAA 2UVDA 1VRCA 2PH5A 3D3KA 4FFLA 4NV1A 1DFGA 3QUTA 5JROA 3ICOA 1MGPA 2O7SA 2WIDA 4JHXA 3K2IA 1SFRA 3ODGA 4IF6A 1T8TA 1RAGA 4PN7A 2KB0A 2OC4A 1FFCA 2C5SA 3LC1O 4IIJB 2V9ZA 1PQUA 2YWGA 3FTDA 3OPYB 4QTUB 1WEHA 3HBAA 3TEJA 2EBUA 1QZXA 4HH3C 2WTMA 3OJXA 5DYGA 5MGNA 5BT9A 1KMQA 4QGHA 2GEJA 4W9MC 3NQ41 5M3BA 4PNHA 3RS5A 3THWB 2ZBPA 1CJCA 2XTAA 5AJWA 4J6FA 2G06A 1M5RA 4LN1A 3QKUA 2QUBA 2R00A 4K9NA 5A9RA 3HCFA 1V3TA 2MWMA 4G63A 2P9ZA 3IKJA 2ISSD 3OEEA 1DWQA 4QXQA 2OFFA 3TKLA 4UASA 2QGNA 3R9IA 4CM8B 3L1KA 1JLSA 1YC5A 3C3XA 3T15A 1SOVA 4YT4A 3GJ3A 4JITA 1VLQA 1IN7A 4E1VA 3I76A 3B1JA 3L9WA 3AJEA 3QBTA 1C1XA 1IZ7A 1N6LA 2KX7A 2R96A 5IU6A 1ZM9A 1E6LA 1NBAA 4DCMA 3UAWA 3G0HA 4E33A 5KTNA 1JYEA 5JVDB 4R9SA 4QTTB 4UUMA 4JYMA 1AZWA 2QXUA 2GR9A 2HMSA 3B9QA 4RD3A 1ONPA 5EESA 5ESDA 1IM5A 5A2GA 1UEXC 3KT0A 3D2LA 4F6RB 3LV8A 4BP3A 1FW6A 4XQ9A 4AMBA 5D1NA 2Z1NA 1BC5A 2DWPA 4TWBA 1SOMA 1V1MA 2IOYA 3D8NA 3N05A 5FBKA 5IF3A 2IP4A 3BSYA 1E2GA 3D0QA 3EBPA 4A8JC 1QYWA 1U1CA 4OJMX 4CCYB 4DMGA 3E15A 4EGFA 1JWLA 1SBNE 3G6WA 3T5PA 2EFDB 1U3GA 2PZMA 3G82C 4HWTA 2DT8A 1CS4C 5J4HA 5AHOA 1AH2A 3WNZA 1UPFA 2OFPA 1JQDA 3NAGA 1Z8HA 3GGGA 4IXWA 4I50F 4W7IA 5DGIA 2WWIA 5FR2A 1N32B 2JC3A 4R2HA 4BNXA 1AKMA 1UC8A 4PN3A 2AJ8A 1SHLA 1IJFA 1KY4A 3U48A 3CX3A 1T6YA 1KQ3A 5IK2A 1ODKA 2IIQA 3CU5A 4WTOA 1T6XA 1XBTA 3RWOA 5FI0B 4ND2A 1M73E 1Y3AA 3CLSD 3HN2A 2FQWA 2WSLA 4OATA 1VMKA 4R1OA 4WLUA 4WXHA 2RKOA 3LP5A 5ELLA 3RO7A 1FSZA 2PWZA 3AM3A 5FNVA 5K0GA 3BMOA 1XJCA 1U3FA 3S1AB 4A03A 4BNUA 1DXOA 1LF0A 1ZD3A 3FUWA 5E9JA 3KOUA 5I01A 5T4BA 1W47A 1Q83A 3HO8A 4FN5A 2X4DA 3RQIA 1NP7A 1W59A 5GGYA 1GWNA 1B15A 2BM0A 4MLPA 5AXAA 3SSMA 2ID7A 3QX9A 5FTWA 3S5JA 1VJCA 1XWIA 4ZZ3A 3T12A 4KIFA 5JADA 4MS4A 3LLMA 3V33A 4KN8A 3CFYA 1L1QA 2EZ8A 3ONEA 2I6XA 4MW4A 3DUFA 3GZTB 3NBXX 2Y67A 3ITDA 2BDTA 3OQ6A 4PSKA 4L7QA 2QTNA 3LKVA 3TLCA 3GRZA 3ZK8A 3RB8A 4RZHA 1TVKB 1AQ6A 3ES9A 5CU7A 5ARBA 4FX2A 2R87A 3M6LA 1QP4A 4LTNA 4HYQA 3RAPR 1WULS 5LSAA 1TT5A 3AFIA 4QDKA 3TX2A 1P3Y1 5H4GA 3ESBA 3HDVA 1Z56C 1CZUA 1NN3A 3JALB 3MTEA 4RFLA 1R0LA 1IIBA 3RVBA 3UK1A 4II7A 3Q3CA 4PX3A 2Y0BA 1A2QA 3CLTC 3HEAA 4I66A 3TAHA 4F2HA 1K66A 1NJ8A 3DWEX 1A8SA 3H2BA 4JI1B 3TD6A 2C84A 5K03A 5CJ2A 4L5JA 4OO3A 5I47A 3PX2A 1TXGA 1K3TA 1W9MA 1Y5NA 4D4MA 4DOMA 2NUPA 1EK2A 1VIDA 2PLAA 3EBLA 1JXAA 4FGSA 4CMIA 1ZSNA 5G4LA 5JSFA 1NX6A 2B8JA 3IDAA 4KC0A 4DDHA 1ZNXA 4NYJR 3WWPA 2IZ0A 4FIDA 2ZTMA 3P0HA 1BXGB 4IEIA 3EQ7A 4G1VA 4TL8A 3HNPA 5EJ9A 5LXTA 2PANA 1TLLA 3DDWA 4J2HA 4X1KB 1I1OA 2W2VA 3SJBA 1OAAA 2ZCUA 2JA1A 1KJZA 5K8CA 2Q6VA 5LQKA 4KR7A 4B82A 4Q9DA 4RE5A 3WGGA 5K99A 2VOEA 3L04A 3QBEA 4RDIA 4TYMA 5FBZA 2CLKB 5KEIA 2WWYA 3HA5A 4WVFA 3RRNA 3U4QA 1E2IA 1KR2A 1FUIA 1NDUA 4LVCA 3L8GA 2Z09A 3NBKA 4J0CA 1ULZA 3E18A 1L5HB 3PQCA 5AHKA 5LQRA 1OI4A 2MYNA 2WD8A 3M2PA 2QE7D 3TXXA 4CF4A 1MLDA 5EHGA 3NHJA 1SXIA 1KAQA 2ZPTX 3D8SA 3O3OB 3OZSA 3EXG1 4JUAA 3THRA 3TLEA 3WY9A 3ZD8A 5HCNA 5HR5A 2BFDB 3UA4A 4CG2A 5FPPA 3FOEC 4HDRA 4BFVA 2AFIE 2JD1A 2C95A 3FF4A 2V03A 3FPFA 1SBTA 2NXNA 4K0RA 4B6SA 2OTCA 5IT9A 3OSUA 1OYYA 2W2NA 1WV0A 2XAAA 3N0XA 3Q10A 4I4CA 4NU5A 2VSFA 4FS8A 3O7WA 3CE6A 3WBFA 1K27A 2QP3A 3F7MA 1M67A 2HX1A 5CB4B 2FSSA 5KOJB 4HGRA 4RZ3A 2E4YA 3KZKA 5BYJA 3M6UA 3ROKA 1IVSA 3UV6A 1Q0LA 3C6BA 4J1NA 5KKAA 1JVNA 1SC4A 4IMIB 5AM4A 1W87A 1ZMBA 3GRYA 4NULA 3WMRA 5A6SA 3VO9A 2IP1A 2E5WA 1Z6AA 2XWJI 2NNLD 4G4SP 4UDYX 4ZWNA 4F11A 3PUJA 3HZZA 2PWBA 1I0IA 1T4CA 3VPHA 2HTFA 2Z9DA 3SX4A 1CEYA 3AUYA 4MQLA 1DO8A 1G3QA 4FBLA 4BQOA 2HO5A 3FRJA 2NO5A 3TJRA 4B31A 5HF5A 4GRAA 3Q7PA 1QIGA 3H1BA 2IEBA 3JZDA 1CFZA 2QVCA 1CUSA 1RKQA 3B3QA 2JH9A 5BR8B 1UXGA 3C14C 4UE2A 3EE6A 5DYWA 1U1GA 1RZRA 2R6ZA 3RFFA 5BWBA 1BVYF 4PC6A 4C03A 1WWKA 4MI3A 4ZVNA 5HZMA 1GZ7A 3ML1A 2YC4C 2OV6A 1G8JA 1XTUA 5AQEA 2G9NA 3OCWA 2C9YA 1BDHA 1E1RA 3STUA 4K6KA 1KHHA 4MDYA 1C29B 3V6LA 1P7VA 3IQWA 3MILA 2W22A 4RHXA 4BZQA 1E60A 3QEMA 4ZCRA 1NFQA 1U9IA 1QBKC 4ZQBA 1DPFA 1RXWA 3ZNOA 4EMUA 2WVAA 1ZAKA 4PQFA 5JAHA 1O8CA 2ESRA 4QDXA 4OXYA 4CW7A 1J56A 2GNPA 1VIVA 4EY3A 4H7EA 1ZJZA 3F90A 2MT9A 3MS7A 4IV8A 3Q7TA 2OB2A 3JYLA 5MFZA 5CHEA 2YXBA 3OTHA 4HLDA 4UU1A 1VG0B 1QOQB 5HCIA 3WNDA 4C3VA 1ILEA 5D51S 3VR5A 4X84A 4O4IA 1SUEA 2H9AA 1C7ZA 1F4PA 3FX2A 3PVCA 3RUEA 2ERCA 2PVPA 3GGOA 1QPBA 2D2EA 2P9QA 2CHGA 4MQEB 3CT6A 4PLTA 3V8PA 3VZBA 3PI7A 3QPUA 1LDEA 3HMKA 4TXMA 1J8VA 2GBPA 4XTCS 4BJ6A 1E7QA 4BOYA 1QDEA 1PEAA 4HYYA 2OP0A 3AONB 3NR2A 3GLIE 2XOKD 2IUUA 1S89A 3IP1A 4HH1A 3QE4A 4YDQA 5JWRA 3DFIA 2JD2A 2J7KA 3DTNA 3HFRA 5TB5A 1JYFA 3KRTA 3TTSA 3OVMA 3QWBA 5ILQA 1VFPA 3MGBA 4HN2A 2D7CA 3EODA 5C8VA 1HTTA 1PR4A 1LNQA 4AQDA 4ZODA 1J42A 1ZR4A 5JAOA 4ZVMA 1G8SA 3IT3A 1M10A 3M34A 4P38A 5DLPA 3A70A 3ISVA 3TB4A 4C2BA 1C0LA 1FEZA 3DXYA 4HPJB 2XQFA 2ZRCA 3B1YA 1NUUA 1XB2A 1GILA 2B1QA 4MR7B 4EAQA 4PHCA 2IS1A 5CDUA 1UODA 4PYJA 3FD8A 3FCXA 3U1TA 1X7WA 4D9MA 1ZOPA 4GVPA 4CWAA 4L5BA 4JL5A 1UM9B 3RFCA 4IF4A 2NU6A 4NENB 2HDWA 2FPLA 4GDMA 4HEA6 3KOWA 2WD7A 1PVOA 8AT1A 2MSCB 2IEYA 3L0ZA 2GD2A 3NT2A 3OECA 3JPYA 2EYUA 2GASA 4MGKR 3EIHA 1ZD1A 3TIVA 5KINB 1E2JA 1KSHA 2DHCA 2WFMA 4PZCA 4AKSA 1FQWA 2R44A 1C7IA 4ZJZA 1Y6GA 1ZOLA 1EH5A 1T9DA 2XGSA 5A05A 2WNSA 4BVKA 4RTLA 1GY8A 3LH5A 1TGVA 2INGX 4ZEOA 1QMPA 3WMGA 2GBFA 5JCPA 3MTIA 3PHCA 2C7OA 3U1VA 2CV2A 3R7DA 1E6UA 1ZHOA 2UYGA 1P7YA 2IYYA 1PZFA 2PXCA 4HLNA 4JN6B 4LX8A 2EF0A 2N42A 2O3UA 3E5NA 3SSNA 1WB6A 1RJDA 3ETNA 3L79A 1P0IA 2VJDA 4BWGA 4ENTA 4UFPA 2W6QA 1P77A 4M53A 1OWNA 1XTBA 1JDUA 1K4MA 4U7DA 5IC4A 1DSSG 1CLEA 4HBGA 3PC8A 4KGVA 3SP1A 1ZESA 1EAMA 2BLNA 4WI1A 2VQDA 4YRKA 1R37A 1SK9A 2Q4EA 1GDTA 3CX7A 1E0DA 4MUAA 2RHOA 4ZOAA 4ZPXA 3D3NA 1I2DA 3WZMA 3FZYA 4KR0A 4TV8A 1SBZA 2E89A 2V45A 3OX4A 2A7XA 2E82A 2B37A 2EGHA 3OLZA 3JQCA 4M99A 2UYCA 5EEGA 5C1OA 5IM4A 1CUCA 4GDFA 4DUZB 5FUBA 1CQIA 2WJ6A 3AF0A 2AK3A 1TAGA 2JAQA 3ESCA 3GNLA 5DP1A 3R7SA 1N9GA 4J0GA 5KIAA 3R7LA 4C7MA 1UJ5A 1DRWA 2YH2A 1HUQA 4O29A 3PWKA 3WC4A 3BDIA 2C2GA 1G7SA 1OZ0A 3QXGA 1DAHA 1F5SA 4LXQA 3ITEA 1EM8A 4GWGA 5TS2A 3PA6A 2X86A 3ELDA 4BGEA 1JPNA 2O57A 2FMXA 1UBFA 1YRQA 2AB0A 3I61A 5KTSA 3FYUC 2I4OA 3NC4A 1XJ5A 4RLQA 5BMVB 2ZSBA 5DM70 4CL8A 1J25A 1CPYA 3LK7A 4PYLA 2Z08A 2O0JA 4WADA 3QFCA 5IKEA 3A6KA 5TC4A 1NPDA 2E1PA 1GRQA 4LVNA 1UMCA 1R8JA 2CDRA 3FVQA 3O03A 2FHSA 2O8BA 1LK5A 4X20B 1JQ3A 3VUEA 3ZY5A 2Y1DA 1W30A 4ZIRA 1VGVA 5A62A 5KKCA 2YWFA 2QLTA 1X94A 2LP4Y 1RYYA 1UF9A 2VBIA 2I4NA 5CLLA 1P4SA 1UIMA 4DNPA 1JDSA 1KEZA 4PSDA 2QG9A 4L02A 4S2EA 5JCOA 1I0LA 4OJQA 3W90A 5EVCA 4KRFA 1Z37A 1O08A 3UMFA 3LFHA 3SJUA 3TXAA 4HHEA 2P67A 3M89A 4K7JA 4RF4A 5E4FA 3E7WA 3T0FA 4CEJA 1SCUB 1V8PA 3WNQA 3PX7A 5B3KA 3BBLA 4EY8A 2JGAA 4YRIA 1SKAA 5C4MA 5K0ZA 4WW0A 1SOWA 2CFCA 2JGLA 4RVSA 1L4HA 4U02A 5KOHA 8LDHA 2XB6A 1OLSB 1R8XA 1QS0B 3ZU3A 4E2YA 5ABPA 3GUZA 4Z4HA 2AOUA 2ZRGA 3PFWO 2X5XA 1HFWA 2FPPA 2IFTA 2J6HA 1ENPA 4P32A 3DMTA 5SY6A 2FFRA 1VHDA 1E9DA 1K3FA 2VHQA 3AFHA 3EDQA 4GRDA 3QLEA 4QSMA 4R3NA 5J5AA 5TQ0B 4YMUA 3V8BA 5TIIA 3NVKI 2CE2X 1DHRA 2PE5A 4FW8A 4XQEA 4I8IA 4QTZA 3SYRA 3EIQA 4ICIA 2IODA 1RC0A 5CT5A 5DM0A 1EBUA 1JR3E 5JSUA 3CNNA 3KKMA 1B76A 1QYVA 1SPBS 2FPIB 3IQDB 1HYQA 1IAQA 4M37A 3PRYA 4YP0A 3GPDG 4E13A 4TYQA 1WBJB 5G02A 1SXHA 3O83A 3UOAB 3PJRA 3ZGXA 3AP1A 1P91A 4X6YA 4V39A 4BO0A 2ZUFA 1TF2A 3QV1A 5SY9A 3HNRA 3JAWA 4R7GA 4QBIA 5ALEA 3TLGA 1T24A 4FDVA 2DZDA 1FMFA 2HV9A 1MDFA 3JWGA 4EMSA 4XUEA 2OCGA 2QAGB 1Y8CA 2X14A 3PXGA 3T1VA 2FPSA 1NVFA 3HBLA 3DYBA 4KBGA 4M8IA 5G0VA 3G5LA 1ENZA 1WMSA 4D3FA 5GONB 4YMLA 2ZRIA 2P3SA 4LQDA 4LYGA 1N1MA 1SG9A 3PNLA 4NYIQ 4LGVA 3H18A 2ZUWA 3LYLA 3ETJA 5FYQA 4XYLA 4FIZA 1TA4A 4N6NA 1VPWA 3VR2D 5DVZA 5B55A 2P8SA 4ZA2A 3HS3A 5TPWB 1Z4QA 2FSUA 4KE9A 1U4OA 3WHPA 2AR7A 3X1MA 1P1RA 1PFUA 3K9QO 4CLXA 4F91B 1LDBA 1UZUA 4YMSA 3P2JA 5CITA 4H7JA 1UJ2A 5IN5A 1Y4ZA 1Y1KE 2OV1A 3NJ4A 3FDZB 2QAJA 2OYSA 4BY9E 1PDVA 4IYRA 1UBGA 2G9UA 4PSCA 4QBHA 1NVXQ 1CEEA 1QBGA 3HL4A 2PBRA 1C8KA 2CYCA 3OEHA 3D0OA 1FXWA 1N3BA 5D7BA 1GUFA 1UJMA 2X0FA 3WYFA 3ZHXA 2HSWA 2C3UA 1A27A 4DMMA 1F8YA 2D1TA 4GVLA 5F7ZA 4M1SA 1LGYA 2Q6KA 2WM9B 1MTZA 1JT2A 1KVSA 1VP9A 3G88A 3JRXA 3M3PA 3P2OA 4PBRA 2ZM6B 3VZDA 10MHA 1GTRA 4FSXA 3KKLA 2KW5A 1X2EA 3U3RA 3ONFA 1QRSA 2YS7A 2Z1MA 4MQUA 3O8OA 4MHTA 1Z2NX 3OU6A 4KW7A 2MHCA 2P77A 3PNQA 1TRHA 2OUKA 4FX5A 2OP1A 2VDKB 2XUIA 3NRCA 4INOA 4KN6A 4Q16A 4ZAVA 4D3SA 5BPFA 4QYMA 1Z25A 5A3RA 1RAAA 5L3QB 2O8CB 4MMYB 3QPBA 4ZOLF 3KT8A 3CX6A 2HHJA 3I1JA 5GMOA 2C7VA 2IDJA 3K9BA 4B3HA 5KTRA 1FVOA 3RI3A 3UJ9A 5KX5B 1N6PA 3PNKA 3BXGA 4KIWA 2XCIA 2YFKA 4TMKA 5D84A 4NEQA 4RMNA 5FWXA 4B2IA 4R05A 1UC5B 4DS3A 1U81A 3A9WA 2NO6A 3JR7A 4PG4A 3UK2A 3CR8A 2ZYHA 5ENZA 2XT9A 4ZHQF 4HZUA 4JX9A 3O8CA 2PJRA 3M1IA 4HQLA 4H1TA 3EMDA 1FLNA 1T6BY 3ZBPA 3PHBE 4ARCA 3GRRA 1EDZA 4WDRA 1FDWA 4NEHB 2AG6A 5A4MS 2EJBA 3BHNA 1OH5A 2GN8A 2VYVD 2IXGA 3TI9A 2F9MA 3RIHA 1J6UA 1OBHA 4G5SA 4G65A 4YJ2B 1WKBA 4HXEB 3RYFB 1D0IA 1ZKMA 4RTJA 4GX0A 5DF1A 3UPTA 4UU0A 3CRW1 1W4LA 4U7TB 4PYMA 3B1ZA 5H82A 1MX9A 1YF3A 4HDKA 3BGIA 1RWOA 2D2VA 3NEJA 1YRAA 4CM7A 2R1TA 5DBIA 3CVYA 1ESNA 5FOUA 4HX9A 3IR6A 4RELA 3E5MA 1GPKA 2EGGA 3DM5A 1VYUA 1TYEB 2GBLC 5E6UA 3R8FA 3OQHA 3L41A 5K3EA 1EE2A 1QQ5A 1TTPB 2K5UA 3DPIA 1MN6A 3V42A 5HWSA 5I8WA 3OO1A 5K4HA 3N3BC 1E5LA 3S2UA 3CXRA 4KRGA 2O7QA 4XE5A 3Q2OA 5B36A 1Z6ZA 3PLRA 1MT3A 4MYRA 4F4FA 1THTA 2QRGA 2WTXA 3JRNA 1D9ZA 2XCUA 4FWTA 5MN4A 1VJDA 5IM5A 3D7KA 2D3WA 1CUDA 2XB9A 3HKCB 1DUVG 1TKCA 3USCS 4ECAA 2FN9A 3ASVA 1DG1G 1JSXA 2WQZA 3RVLA 1JHYA 1QTRA 3VHLB 3VNRA 5FP0A 2A3NA 3RUFA 2WF7A 1N34B 2YXPX 3SXUB 1PO7A 2YNMC 4B73A 1FRFS 3MGKA 4Z7NB 1GV0A 2IELA 5KHAA 2FF5A 3HK2A 5FPTA 1TEHA 3MPUA 1SIBE 5ESWA 1N0HA 1XVUA 3O9VA 4LYJA 3T4XA 3W5CA 2GS9A 5KSWB 1XAIA 2IKQA 4H1VA 3RVQA 2NTYC 2QMUA 2V7QA 1FRZA 1NI5A 1BAPA 2VXOA 3KYIB 3KZOA 2PCJA 1V1RA 2QS9A 3DE1X 4X1OA 1TM3E 2VVTA 5B7QA 4XFDA 4TKZA 3IIIA 3U7JA 3URKA 1TO1E 1GR1A 2GESA 4R5MA 4RVDA 4L5IA 121PA 1HEYA 1TCBA 5TEWA 3WWCA 2IYAA 3EJ6A 1GZVA 3K6JA 3PXAA 2NUTA 1NR7A 5KYWB 3C6ZA 2AMYA 3CR7A 4KLNA 3L2OB 2NZXA 1WHTA 4C88A 3NB0A 3WJAA 3I8XA 1GKKA 1ADGA 4PZDA 3VR6H 2D5CA 2IYNA 4L0CA 2DQSA 2QRMA 3FYHA 3ON5A 5FA8A 4DQUA 1WF6A 3O5AA 4FT2A 4GQAA 2FV8A 3HVKA 1RM4A 2OYCA 2RB5A 3NORA 4KO3S 5BUSA 2NPIA 1S4QA 2NSLA 1ZISA 4URWR 3S70A 1VSUA 2QW1A 1W36B 1XTRA 1E4EB 4M1QA 1DDGA 2G0NA 1ZRMA 4A7PA 1K6EA 1XCJA 3LL7A 3NHSA 1X1CA 2YHIA 4JASB 1VPLA 3HSSA 4RF3A 2I99A 3J7AC 4IICA 2HHAA 1NIPA 3H8JA 2I4LA 4KLRA 2A57A 3G7UA 2ZE7A 1IDN1 4NBTA 3FM9A 5BW8A 1HLFA 4N65A 4GZ3A 2FN3A 3BD9A 4RH1A 3NLLA 2HA0A 1BS9A 1Z38A 4J9VA 5IDYA 3IB6A 3F78A 3IBSA 3S2EA 1HI9A 3OJCA 4BASA 1C9KA 5CB6A 4YMHA 1EEHA 3KOXA 5IWAB 3PXBA 2ZUEA 1PS0A 3OIVA 5KBYA 1I1NA 3AIOA 4Q47A 1KYWA 4RLSA 1E1CA 2BEKA 1Y81A 5CFRA 1RQXA 2IDKA 3BD6A 4URFA 1WZNA 3U4IA 3JQBA 4OYYA 1EFLA 1X9GA 2D62A 2FETA 2AMJA 1RP7A 2P35A 2YV3A 1X77A 2I55A 2ZI5A 3LXMA 4H0FA 1CZLA 1JDBB 2IYVA 4CMGA 4FLEA 4Q93A 1GKIA 4WEQA 1T5HX 3L7YA 1EFVA 2F1JA 3NANA 5D85A 4AY2A 2WKRA 3BXXA 3TCXB 1S9HA 1GNLA 2PKWA 2AGVA 4OJKA 2I7DA 2NPOA 4GIBA 2RGDA 2EFHB 4WA7A 2FZ5A 2ZWAA 3A1SA 1MRNA 1ND5A 4KWEA 4OQXA 3S7ZA 1X19A 1J2UA 4ZO4A 3RLIA 1C1YA 1XXHE 1V71A 1JKXA 3DBHA 2RGUA 3GR6A 3EWSA 3OD5A 4JDUA 1U3TA 2GF2A 5DSTA 4CKXA 3HCAA 1OZGA 3HJHA 2NO4A 1ZYUA 5KSYA 2BGWA 5HKBA 4P4NA 4YACA 3K8YA 3OFSA 4EM6A 2Q28A 2GAIA 3MWYW 4EFNA 5CH3A 4ATNA 4B7AA 1G5FA 2TMGA 1PZGA 3AYZB 2NO7A 1VPVA 1X7YA 2B92A 3FJOA 1VLVA 3R20A 2QPOA 3LC2O 2WYWA 2ZRMA 3FZQA 2BRUA 3GAMA 5F64A 5FWDA 2HRCA 3RF7A 1MJNA 2IPLA 2PD6A 3P52A 3PICA 4P80A 4DRXB 3LY5A 2QSZA 4OMFG 2JVIA 2Y3IA 4AJHA 2PLWA 1UUFA 2D0OB 3CZPA 3GMIA 4LDNA 2E4VA 2XB4A 4KAXA 1CRWG 4TTJA 4WXYB 3FMFA 1CR6A 4Y1EA 5DBEX 4ZARA 3ADBA 4ABTA 1W25A 2FSPA 3QU9A 4LSWA 2AG5A 3Q6NA 4G23A 5BUZA 2A0FA 4EFMA 5AVYA 5JSQA 1NBHA 1Y1SA 1WKCA 3I2GA 5L45A 1PVVA 1N7GA 3A05A 2CHQA 5BV8A 1RAIA 3GZJA 2QZSA 2YCLA 5H80A 4V2UA 5C80A 1EWTA 3TOZA 5DJ5A 5EP2A 4KBYA 1AGYA 1I3CA 1P7PA 1YS6A 1Z18A 4M7OA 2A1TS 1GKUB 3OM8A 3HCBA 4IIDA 3B6JA 1ZM3A 4XJSA 1HDCA 2HUNA 1ZD5A 4A15A 3KJQA 4KNYA 4D9HA 4G41A 4LWZA 3DAFA 2V96A 3QF7A 3OO0A 2CLDX 3R3YA 4JI6B 1U0FA 2E4WA 2WAAA 1NNLA 1KBQA 1L5NA 4YJHB 5G1NA 5AM0A 1MNQA 2H52A 4UTPA 2YHUA 1FA9A 5DXFA 4RQAA 3OPVA 1AQNA 4AY5A 1Z0ZA 3LUGA 5LZ9A 4B4KA 2LKDA 1OC2A 3V8VA 1Q17A 3AW9A 4RDXA 2ILVA 1SVMA 1N6HA 3ECAA 1G66A 5AVXA 1DPGA 2BKXA 2OC9A 4QGFA 5CAEB 3UT5A 4E4YA 3PNPA 3FOBA 4IIYA 3UAXA 1XZDA 4CVNA 1DJMA 4F06A 4P0TA 1J23A 2PAFA 1TZCA 5B64A 2RGEA 3AM4A 1LBTA 3P26A 2Z2YA 4G86A 4MQFA 4W9RA 5BV7A 4R31A 4CFSA 5AW5A 3RYIB 1NVGA 5DLDA 1D4OA 4OMDA 3LGSA 1G5RA 1XDUA 3T7IA 4RCZA 4O1IA 1QZZA 1P4RA 3EQ2A 4QU5A 4DCUA 4W82A 5TQ0A 5EJ2A 3T4PA 4POOA 2V1XA 5DW0A 5B2ZA 1HDXA 2GEBA 2QD1A 1SJ9A 4I3FA 4OOFA 5FTJA 3ROMA 3PK0A 4GM0A 4M8KA 1G18A 3W5HA 4OQNA 3H9UA 1Y5RA 2KM1A 3I2IA 4UCQA 1SEPA 4DLZA 2WWVD 3QWHA 2R00C 3LBHA 1P75A 1AT1A 1T10A 5AVJA 3WBKA 3EASA 3FKJA 2F59A 1EWKA 3HC7A 3CB2A 3ICPA 4BTVA 1T5DX 4TMVA 3ZDXB 2VRCD 2ZI4A 3K96A 3FTCA 1P3JA 4Q4HA 4ED9A 3UXMA 1K8YB 1KXZA 1S2MA 4W5HA 1KOLA 3CH6A 2G9ZA 5I7EA 2ZE6A 1WP4A 4TLMB 3GLQA 1JKJB 3CXUA 1VKJA 1CQZA 2PZKA 5DNAA 1N57A 2Q2OA 4YAFA 1WDMA 4KOEC 4B6OA 2WNIA 1AVTA 1C9EA 1E8MA 3OZTA 4S1OA 4N12A 2BZSA 4RGYA 2WDZA 1Z5GA 3LQFA 2VNHA 3F3YA 3LQQA 3CV3A 1RDFA 2C92A 1H0HA 1NTOA 2HA3A 2IVFA 2WT4A 3BQ9A 5J2UB 4HATA 3KYCA 1G6OA 5D1HA 4Z9FA 1RE1A 1RFGE 2FYTA 5FPHA 1RWQA 4IIVA 1ZIDA 1MBZA 1J0EA 1KJWA 4MIOA 1HX7A 1NUSA 3DOOA 1RADA 2BGMA 2CLIB 3DL7A 1BD4A 5BN5B 3TZBA 2OO3A 4B6PA 2GCPA 3HRIA 1I7QB 3BMQB 4WKBA 2CHVA 2I71A 3TQFA 2V9PA 3ER9A 3C8HA 1NN0A 2VZLA 4P86A 3PLNA 4MQ6A 2AKAB 4MULA 4L8FA 1DVRA 5KWEA 2DFDA 4M55A 5E3HA 1SD2A 4X6UA 5H16A 1DX9A 3FPBA 1UT6A 1XCLA 5IDWA 5KQPA 1NBIA 3INTA 3K9FC 5JARA 2P1ZA 1ICEA 1NXVA 2POQX 4XIFA 2AFHB 4QHTA 5LUAA 4F56A 2NMVA 2QIOA 1P0QA 5SICE 4YMWA 5DK4A 4XB6B 2X8LA 1V6SA 1NXQA 3B6KA 4KH1A 4YRMA 3LYAA 1KMIY 3ZE6A 1II8A 2J33A 5T8KA 5TPZA 3ICCA 1V11B 2A9PA 2W6CX 2XRFA 4N5MA 3DMDA 3TNYA 5KZMB 2CD9A 2DH6A 4EI7A 4NBSA 4TTIA 4U7JA 2H63A 2FZVA 2PX5A 1YMUA 2VAVA 1TMYA 3TIIA 3CVUA 3GFPA 1W36D 1WO8A 3KJXA 2NVUA 3KL2A 4LNUB 1CUIA 1OI7A 1CNMA 2IP2A 4M0EA 4B3FX 3BHMA 1ECLA 1ZNQO 3LK6A 3TH5A 2BE9A 2DLCX 4MV5A 2O50A 2YMPA 3WP1B 3LWBA 5LA6A 4JGIA 4GLLA 3SZOA 2KPOA 1UINA 1QHFA 1H9AA 3L7NA 4GC5A 4KGXA 3ZWNA 3KVRA 3R4CA 1I94B 2BBSA 3QKIA 4CCWA 3OZUA 4YP6A 3QXXA 4N76A 1RHQA 4L4UA 2QXYA 4F38A 2BFEA 5CLFA 4HN9A 1RJ9B 1O96B 3AIKA 1EE1A 5AW9A 1TYZA 4HX2A 1JJAA 4I9UA 1NQWA 1O1YA 4S1TA 4OK3A 4GBED 3B60A 4WJZA 5A9TA 4KWCA 1E69A 1YVPA 3JSXA 2Y0CA 3DW1X 3O4GA 1A5ZA 5TEVA 4CU5A 5E6RB 1PG2A 5BSHA 4KYTA 3U2QA 2I6SA 2MU1A 1GCUA 2YVKA 2VSQA 3M6WA 3U4AA 4AJOA 5DN6A 3HXKA 3TKYA 1G16A 5GJBA 3W8RA 1O9BA 3FPSA 1P0FA 1C3JA 1A0OA 2ODAA 3I4CA 4KDFA 3LBNA 1ZPDA 1MFPA 2JCGA 2E6KA 2REXB 3N70A 4O4JF 5ALZA 5F33A 3RVNA 2XNDA 4AJPA 4WNIA 3VPAA 3OY2A 4CKEB 3IO3A 2BFPA 1HETA 4ZTBA 4Y3UA 2Q3FA 4DREA 4I50A 3J81A 4TWAA 3VPCA 3EUEA 2V0CA 3AO0B 4NCXA 1L7QA 4EKDA 1F2UB 3D2CA 3G9ZA 1JW9B 3L9XA 3DAOA 4A0SA 3AB7A 3OOSA 2ADFA 5IKOA 3IAEA 4LF6B 5HHTA 2OZEA 2O48X 4RLHA 3BE5A 4O3MA 3X2FA 4KQ1A 1FFAA 2PUWA 4CT5A 1FFBA 1JAIA 2Z58A 2ZR9A 3BZUA 5H9WA 4UMFA 4NJEB 3SJ7A 3WIDA 4U2EA 4A2QA 3ORSA 2XDQB 3GP8A 2P9EA 2YV1A 4UC0A 4Q7QA 4QSHA 3T7EA 2RJOA 5DXJA 4IP0A 2OZKA 1Z33A 3TMYA 1UBOS 3ZR4B 1FYXA 4BJ5A 1P44A 3I3OA 4RQBA 3F2IA 1YCHA 1PV4A 1DAGA 1ARZA 1R2QA 3MMPA 1E2EA 3EVAA 4F4CA 1CFJA 2B34A 2R60A 1SKUA 1V45E 2X3YA 1Y1RA 2YHBA 2DVMA 3C7DB 5ALTA 3ZE2B 5BSKA 2UZ1B 4OXNA 1YGPA 3GUYA 5C3MA 4RSGA 2GXQA 4N3GA 2AR9A 1P7ZA 4ZO6A 4H17A 5DISB 4ALLA 5KNBA 2AN3A 1I7PA 2ZYDA 3GXOA 1QJCA 1VLZA 2HRZA 1U8UA 4R6WA 1TZ2A 1XF1A 1Z16A 3BMNB 3I0NA 1E2LA 3JRWA 2GPBA 3N2GA 3C5HA 3NWPA 3VPXA 1DQRA 3WLSA 2QX6A 2YZ2A 1LNZA 4Q01A 3BXZA 5JZBA 3KZVA 3HCWA 1W9HA 2YJNA 3GBPA 3M7IA 4Q3BA 3HV0A 3TZHA 3WLAA 4D2IA 2FWNA 3KSDO 2BY4A 4IVPA 1RBYA 2C82A 4CKWB 2YFHA 4JX8A 1EIWA 1G21B 1I5OA 1KP9A 3WDLA 4TL7A 5F21A 3LY8A 3H5WA 4NFHA 3AVXA 1K4KA 4JC4A 5KJFA 4Y7DA 2P6PA 3L6DA 3O1IC 1OXTA 1A9YA 4HYEA 1N2CE 1DBWA 3ILHA 2PEZA 3M4YA 4J3FA 1P5HA 5A4KA 5HK9A 4MUHA 1U9IC 4X97A 1TZBA 3RVKA 1K6MA 3QPVA 3MMSA 4L1KA 3R77A 3BL6A 2YJ5A 3H9JA 1XTPA 4PV7A 1Z5PA 3H4VA 4UVGA 4Z0TA 5IAKA 1O03A 2VJOA 3HR8A 3PF9A 5ALYA 1EBBA 4REOA 5AOBA 3B9RA 3G7SA 4H6PA 3H0EA 4AZVA 5JXGA 4RORA 2VLBA 1QQ7A 1ISSA 2QNBA 1MC5A 1MB4A 3GVXA 3VR3A 1GPYA 4BPRA 1M2OB 1KZYC 1R0SA 4H4CA 1C8LA 2I66A 1FXUA 3HFGA 1GPUA 3E35A 4HNAA 2P78A 4MVJI 3U40A 1SU4A 1YQQA 4DDTA 3RVSA 1QANA 1CW2B 1AUOA 4CEHA 1RC1A 3PPWA 4FYHA 4Q1CA 3J81k 1R5OA 3SIPA 1F6BA 3T5TA 4Z9AA 4Z4QA 4EBFA 5EUCA 1H05A 4ND8A 2QR5A 3WNCA 2UVPB 4CM1A 2B6NA 3PXCX 3H2GA 4DA0A 3PGA1 3B7PA 3F96A 2BHSA 2PKRA 4PICA 4HV4A 3DBRA 3OC0A 3ZCSA 3H5VA 1ZO8A 2I22A 3AERA 5I7RA 5IUNC 1GYQA 1R6BX 1XSEA 4MCAA 3D7SA 4BFWA 4CTMA 1CYDA 4GSKA 3IC5A 4IDPA 2XUDA 5REQB 1K2WA 1Z68A 4Y2TA 3QVLA 3G2NA 1AURA 2DHQA 3LQ4A 1M2VA 1XO1A 4TTRA 4W4TA 5DOZA 3IL2A 4RVNA 5ITZB 1Q1BA 4CLEA 4HG2A 4CV1A 4MQBA 5G3YA 2NPFA 3S5UA 2LRHA 3VYUB 7REQA 4NHOA 3TW6A 3R5TA 1R15A 5TT1A 3AVWA 4EK9A 1WKVA 5L8VA 1TPZA 2G07A 2O8DA 2WJJA 2WF5A 3VR6A 4CZ2A 1DWUA 2RHLA 4RA9B 1SZDA 3TM5A 1Z35A 4FQ8A 3EDOA 2VQ3A 2ZETA 4J49A 3OT5A 4GOMD 6LDHA 4CV3A 2AE1A 4QFBA 4EW3A 1Z12A 4QEKA 1XQVA 2D59A 4BBAA 3G02A 3U3OA 1E3LA 3HWRA 4QKQA 1GV1A 3ILVA 4HZGA 3DE3X 3WTBA 1X0VA 3QMPA 4ARAA 2OXFA 5AFSA 4MO9A 5KHOC 3CJQA 3QYFA 4W9NA 5IAJA 2Q3EA 1TIPA 3S55A 2OCLA 2Y0DA 4BCCA 3J80A 1P1HA 3CEHA 3CZ9A 5EWMB 4TQAA 1TTTA 4JLOA 4EG8A 2PGDA 2XH8A 2VNIA 1VCMA 3TLYA 3VR4D 4EARA 5I48A 5J1SB 2VHTA 2JAUA 3I5UA 2EQBA 4ESHA 2X7XA 3OF2A 1A8PA 3GFTA 3LD9A 4NJMB 2JPDA 3TBKA 4D44A 2OG2A 3BKXA 4Q19A 1ULBA 2V0NA 4KXNA 5LDGA 3KFLA 5T4HA 4CCSA 2HCTA 1CUJA 4Q4CA 5GVSA 3DE4X 3UKDA 2PSEA 1NYLA 1I4DD 3DTVA 3FSRA 3PC8C 4MTCA 2FXIA 4MRRA 2MSWA 1YQEA 4UBJA 1WCV1 4RY2A 1TQDA 2CLHB 2VUTA 3HEMA 4YFVA 4C4XA 2OMKA 3C4VA 3COPA 3AFMA 3SMVA 1K0UA 3QKRB 1RYMA 1U63A 1WXFA 4IDHA 4HEJA 3LHSA 3TNDA 4HQFA 4TM7A 4LXGA 2OHGA 2EVWX 3DOUA 3WSVA 4AMYA 3U56A 3EF0A 5FT9A 1JEYA 5AWFC 3WHKA 2WZCA 4G5FA 2VPXA 2H2DA 1B23P 3HXMA 1L6RA 3BWVA 3I1FA 5JG7A 1M5TA 1ABBA 3AVYA 2NQTA 2ZJ3A 3GD5A 1KZ1A 1YBMA 1YJ8A 5JAZA 1G3MA 3ZZMA 3GPLA 2JZOA 2QP9X 2R751 3AJRA 3K15A 2VWPA 5DFAA 5D3MA 4GM1A 4ZAZA 1O6ZA 1QCCA 1RXCA 3EWNA 5JS2A 3SBOA 1Q22A 4RDCA 1WW2A 1FFXB 5B5SA 3IQGX 3I01M 4HQKA 3V7NA 2XZPA 3CWCA 3EIEA 3ZU2A 1B16A 4V0QA 4PYOA 1UKZA 2E7ZA 2JLSA 2ZUSA 3C98A 3A58B 3DQZA 4PLYA 1R9MA 1H94A 4PE5B 1JXMA 3IKVA 2CVFA 5AKKA 1OFVA 5F9FA 1KJ9A 2O0HA 2O4CA 3HR4A 4EELA 2I76A 4LGMA 5C7YA 4Z1OA 2WIBA 3FFXA 1XJ0A 4A8JB 5JD3A 4TT3D 3ZIDA 4F60A 3A06A 1EFPB 4P36A 5FH9A 5JCOC 2FN7A 1S2GA 2P5SA 3M5CA 5SYAA 3OZ7A 4B6GA 1LX6A 5HUJA 1ZOIA 1E3TA 1MPXA 4ZMRA 5JYBA 4M2LA 2QTWB 2QM3A 1M2GA 1Y5MA 1UPUA 1LUAA 1UXOA 1Y8QA 2WAOA 5H5JA 5B7NA 2DFPA 4MGEA 5AUQA 5HTKA 1EPUA 3IULA 1FP7A 4UOZA 1K3UB 4AECA 3ZDAA 3WGKA 1GZ4A 1TD1A 4WLOA 4ZU6X 1OX5A 4HGYA 4LJ9A 3KWLA 3A1TA 3GT4A 4HQRA 2HF9A 4G2TA 3RYCB 3H86A 4ZANA 5HQJA 4O4LB 3DMTC 4W8GA 4Z0NA 4DM3A 4ENPA