5KKCA

L-lactate dehydrogenase from rabbit muscle with the inhibitor 6dhnad
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
331
structure length
328
Chain Sequence
b'AALKDQLIHNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Ligand binding phenomena that pertain to the metabolic function of renalase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 112
structure length 328
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5kkcA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5kkcA02
5F5LA 4MVJA 2W98A 2OFPA 2HUNA 4OXNA 1FJHA 3KYCA 3RUEA 2JFHA 1V3TA 3DZBA 4GWKA 1F8GA 3DONA 2VRCD 4K28A 3JQ9A 4YRDA 1YE3A 1T1SA 1ZW1A 4GQAA 3ONEA 2BI8A 1LU9A 4Q3EA 3IUPA 4WLEA 4F45A 5JO0A 1X7DA 1XLTA 1U28A 1N9GA 3WIEA 3PDUA 3F9IA 5DF1A 3UH1A 5JDIA 1AUPA 1YH3A 3GG9A 2V6BA 4P8RA 1IPEA 1JWBB 2CF5A 4TRMA 5TJHA 4K1LA 3UAGA 1DC3A 4EZBA 5CDTA 2TMDA 3D3EA 4FIZA 1HETA 4YVFA 2RIRA 1ZMOA 4PZEA 3T7EA 2BGMA 4WK6A 2NVUA 1GV1A 1EVIA 1PJQA 1XQ1A 2HK7A 2F00A 2J6IA 4ND1A 4CM4B 2I3AA 2GN9A 2PR2A 3OHSX 1QYXA 3GFBA 1I3LA 3Q3CA 5T6BA 3RKRA 4HWKA 4QX6A 4A5OA 1E7WA 3LC7O 3TN7A 4BNZA 3IKVA 4TROA 4KQXA 1Z82A 1P74A 4YACA 2NQ8A 4RPGA 1FXSA 2EKLA 1HDGO 3IDSA 2B69A 4JN6B 4M8SA 1YONA 5CDUA 1H9AA 3OH8A 3BZUA 4I8XA 3U3XA 2GPTA 3IIEA 4J1NA 3DOJA 2DPHA 3DMTA 3ZWNA 3ZU5A 2W8ZA 5BSGA 4FB5A 4PZDA 1S6YA 4CMJA 3GQVA 2FPGA 4J0FA 1SMKA 1MG5A 4FC6A 4J4TA 2HU2A 3ZWPA 2C2YA 3NYWA 1LRLA 1N1GA 3GA0A 3L4BC 1Y9AA 5C7OO 3QV1A 2C5AA 2UDPA 2YHIB 3W8FA 1Z7BA 2RH8A 1VE9A 3HFGA 2GN8A 1PIWA 4AJPA 3QWFA 2HMUA 3TF5A 2PD4A 5HS6A 3RJ9A 3W4KA 1E92A 4QTZA 4URFA 3BTUA 3QW2A 3K92A 3S2IA 1JVBA 2AQIA 2Y1FA 1NWCA 3PHLA 3I6QA 3H3FA 1I33A 4DQXA 5DNAA 4CMKA 1NVTA 3VPGA 1X1EA 2X0RA 2FPPA 5THQA 3A1NA 3WGQA 1LLQA 3K2BA 1HDOA 1M2WA 1QR6A 4J49A 2R00A 4PVDA 3CTMA 2BKAA 1WZEA 4BO5A 3AUSA 5CHEA 1PL8A 3GRPA 2C54A 4WNIA 3CPSA 1K2WA 3U62A 2P2SA 2CNBA 3QY9A 5AOVA 3I23A 2CDAA 1J49A 4U8GA 1HEUA 1NPTO 1P3DA 2E4AA 3DBVO 4XB1A 2CDBA 1DFGA 4CQLB 1ZKMA 4M49A 4AJKA 2NTNA 2HKIA 4ZICA 3HHPA 1QXSA 4QFCA 3VKUA 4A0SA 2FSSA 4IS3A 4M89A 4XDYA 1NAHA 3EW7A 1YDWA 4CM8B 4A10A 3AK4A 2O3SA 7ADHA 4J7XA 2D4AA 3JCZA 3OIFA 1ENZA 4QXMA 3U5TA 4DVJA 4MIOA 1C14A 2X86A 3RUCA 2X5OA 1IHYA 3CMCO 3S1LA 1ZIDA 1DC6A 2G76A 3LZ6A 1Q2XA 3INRA 1D3AA 4MJLA 1JDJA 2CMDA 3B6ZA 3L07A 3MJSA 4CMEC 5JNLA 3ITDA 3UGKA 4DWVA 4KTVE 1BGVA 4FSHA 4E2XA 3U09A 4BQPA 4BKUA 2E6UX 2WYWA 1CERA 5B1YA 3TFOA 2ILTA 5JAQA 4CMAA 5ENDA 2HQ1A 2OORA 4OJNA 4NK5A 1PJBA 4YJGA 1DLJA 3NTOA 3LT1A 2C7VA 1A7KA 2ZYAA 3MOGA 3WBBA 5KOIA 4KWIA 5JBIA 1QMGA 5L3ZA 1EVJA 4Q3DA 2NNLD 1A5ZA 3U4HA 2PZKA 1E6EA 1MG0A 1XKQA 4W4TA 1DC4A 4BKQA 1YXMA 2C29D 1HE2A 3JQAA 1LUAA 4K26A 5TS3A 2WJPA 4NBTA 2FR1A 3V2HA 3V1YA 5EINA 1T2DA 4PRKA 3BMCB 3SEFA 2TMGA 4PFJA 5EMHA 1E1NA 4AJ4A 2A94A 2ZTLA 3FR8A 4R3WA 1P0CA 5T5QA 3NDIA 2Y0EA 1HLPA 3ONFA 4JROA 3VH3A 4R1NA 2VOJA 1ZXLA 3GEMA 4MVJM 1JU9A 2PKQP 2X0NA 4RPLA 4Q3CA 1LBEA 3AFMA 5JMPA 4CM8A 1PR3A 3T4EA 4BNFA 2DUUA 2PLAA 2WD7B 2YFQA 4CQMD 1P1FA 2O3RA 2VZ9A 3AUTA 3ADPA 4PG5A 4YQYA 3TSCA 5FWNA 1GYRA 4PLZA 3PQEA 1PJSA 1A4UA 3QSGA 4CM7A 4E2ZA 4BKOA 4E13A 1W0CA 4RPHA 4HXYA 4N5NA 1O8CA 2RAFA 1YDEA 3PWZA 5DBFA 4QUKA 5GMOA 4J1QA 2Q99A 2GCGA 3AW9A 3GY0A 9LDTA 2Y1DA 5A02A 3G1TA 1DRVA 4K9DA 1YB4A 1VPDA 5I8ZA 4F46A 3BXXA 4YJHB 1P0FA 2J3KA 2ZK7A 3GPIA 1YOVA 3EK2A 4IBOA 3KVOA 1QLHA 2V65A 5F21A 1ADFA 1VI2A 2O4CA 2DAPA 5G4KA 1EQ2A 2GZ1A 4UVHA 1OOEA 4CM6A 3ZHYA 3ST7A 4C7JA 1QYCA 3V1UA 4IDGA 4HFRA 3NAQA 4R54A 1P9LA 1GEGA 3CH6A 4MIYA 2PZMA 4Z9XA 4CM3A 1YJQA 3HE3A 4WEOA 1PSDA 4WEQA 2G1UA 3IMFA 3LVFO 1EBUA 4HADA 3B1KA 4UUNA 1A71A 1CRWG 1H6DA 1LX6A 1LNQA 4NBWA 4DMLA 3FWZA 2VWQA 5CPFA 3RU7A 1Z74A 3JYPA 1O0SA 1NAIA 3RWBA 1NX6A 3E6AA 5CEJA 1I2ZA 4TSKA 1RM4A 4AFNA 3IL2A 5EIOA 1UP6A 1SEPA 1B8PA 1KEUA 3QWAA 3RIHA 3ZDFA 1PEDA 1F12A 5G2OA 4XDZA 1IY8A 1R4NB 1DBVO 1EFKA 1DXYA 1R0LA 1T4BA 3U9LA 1E3WB 1FDUA 1LLUA 5DOZA 4GX2A 4YJDA 1ORRA 3WLFA 1IUKA 3H4VA 3OFSA 4MP6A 2YHUA 4P38A 3SXPA 2NTJA 4MOWA 3JQFA 2CZCA 4OQYA 3DAPA 2IDZA 2NWQA 1NFQA 1OFGA 3AY6A 1TXGA 4BNUA 4M87A 4UAGA 3NTQA 3PPIA 3INGA 3W8DA 3EGOA 4JXKA 3H5RA 1YL5A 1UXGA 2O2SA 2Y0CA 2WYUA 3I9JA 5JE8A 2DFVA 3FN4A 2VNSA 3DMYA 3GNQA 1RM3A 1ZSVA 3E18A 1YJ8A 4RLHA 4CUZA 1V8BA 1TI7A 4WLFA 4BGUA 1O6ZA 3ZNOA 4GVLA 3BHMA 5GZ3A 1YS4A 1GPJA 2YDXA 3EYWA 3OBBA 3IS3A 3MEQA 2BFMA 5KVQA 1R12A 4TZKA 3WGGA 3SLGA 4AJLA 2A4KA 3I4FA 4MIEA 3UHAA 4AJEA 4BO1A 5JXWA 1G6KA 2ZCUA 1RM0A 3PFFA 3NJ4A 3E82A 4KUHA 1PZHA 4IQ0A 1ULSA 2XXBA 2VHXA 1ISJA 1ZCJA 1C1XB 3H7AA 3PQDA 4GMFA 4II2A 3KO8A 5AVOA 1WWKA 4R3NA 4TQGA 4Z0TA 3RAJA 3O38A 4BNKA 4A73A 4EEXA 3HFSA 3SBOA 4DYDA 3H5AA 3I6IA 3WBFA 4HP8A 4QFDA 1A72A 4TVOA 5HBRA 1BSVA 2DBQA 1KVRA 4NFSA 4BO8A 3K73O 4FFNA 1T2FA 1HWYA 4W7IA 3VZRA 3Q9NA 3JTMA 4JIGA 3RFVA 4ALJA 2AE1A 1LDNA 3EAGA 2E82A 3M6IA 3M1AA 3MWEB 4BMVA 1XSEA 1ISFA 1SB9A 1LDMA 1UR5A 4P22A 3EVNA 3DZJA 4Z9YA 3RROA 2ZTVA 1TB4A 4TWRA 1BVUA 1TLTA 3COSA 6ADHA 3FWNA 1Q0LA 5K9ZA 7MDHA 5JCXA 1HDRA 1PGQA 5IN5A 2GN6A 4BNNA 3UF0A 5AYVA 3NEPX 1NYTA 3P19A 2B37A 4RPKA 2EEZA 1PGOA 2EJWA 3DHNA 3DR3A 3BMQA 5L51A 2AG8A 3TPCA 2IZZA 2PGDA 4L4XA 1T1RA 4OYRA 2BFAA 4RORA 3PJEA 4MPDA 2W2LA 3L9XA 3C7DB 1QV6A 5T67A 3TQHA 4U0JA 4CLRA 1MV8A 1T2CA 4B7CA 1BMDA 1LJ8A 2Y1GA 5C3MA 3GZ4A 5DBGA 5TJ9A 1X1TA 1PX0A 4Y6RA 1I2CA 4NNJA 1HSOA 1O5IA 1WW8A 1X7HA 3ORFA 5JPIA 5KIAA 3F6YA 2Q1SA 3D5TA 1O94A 1WVGA 4GGOA 2EKQA 3S2EA 4ILKA 1E6UA 1KC3A 2FR0A 2Z1MA 3ROQA 4J7CA 4WLOA 5C7LO 1U7TA 2OO5A 4EDFA 3QA9A 1GUFA 4NR0A 3ENNA 1CIVA 2ZJ0A 3JQEA 1IB6A 1LLCA 1NP3A 2ZTMA 4CJXA 4Q3BA 3T7CA 4BO7A 3WJ7A 1Q7CA 4I5GA 1UXJA 2J3HA 2PGJA 2VYND 4TKMA 5TLSA 3D5QA 2B5VA 4RL6A 4N54A 1T25A 5KJCA 4OO3A 1KOLA 2OZPA 1BXGB 4A03A 2HSDA 2DTXA 2VHZA 2X23A 3L9WA 4II3A 3FNEA 1ISHA 2OMEA 2QRLA 4P4GA 4CL8A 4WOJA 4R1UA 4J0EA 2NU7A 3TL3A 5A5EA 3LSYA 3ZHBA 3CUKA 3PJFA 1I36A 1V3UA 2NV6A 4E2WA 4LW8A 4MVJI 3OQ1A 5BT9A 1ZSYA 2VT3A 4PGFA 3WGOA 1YB1A 2IODA 5F5NA 8ADHA 5TNXA 3DZIA 2RBEA 4DC0A 3U4IA 3KXDA 5EESA 3NT4A 3W8EA 2VUSA 3Q1LA 1GUYA 3ADOA 2AQHA 4CMEA 3FRJA 4HNHA 1GDHA 3SJUA 3B1JA 4N7RA 4FJ0A 1NQOA 2QYTA 2AG5A 1FDVA 2OL4A 3F4BA 3R0IA 2VRCA 3RSHA 3PTZA 3DZHA 1WXDA 1WZIA 4QEDA 2Y1EA 5KVSA 1GCUA 2VT2A 4OQZA 5JCJD 1T4DA 1ZZEA 3F47A 5BR7A 5HWSA 3KB6A 3O03A 5I9NA 4Y9DA 1W4ZA 3AI2A 5F1OA 4RVSA 3WX0A 5L9AA 2FHSA 4IDDA 2A92A 4BNMA 4F6CA 4ZGWA 3OICA 2DKNA 1N8KA 1UP7A 2PKRA 2B4QA 5A1TA 4CMBA 3CINA 3BMNA 4NH4A 3FHLA 1ARZA 3ASVA 1VC2A 3B70A 4XYBA 5IJZA 2Y66A 1ZK3A 3LF1A 1J6UA 4E2YA 1YGYA 1UDBA 3CE6A 4Q9NA 1SC6A 2PH3A 5ENVA 2CF6A 4ALIA 5JC8A 1PTJA 4W9NA 4OMUA 4DIOA 1VKNA 4LMRA 3IP1A 3DFUA 3KLMX 3PZRA 3U4CA 1BHSA 2X1HA 2NVUB 3W1VA 5G0SA 4DXHA 3I9KA 3KSDO 4EEZA 2EF1A 1DC5A 2C07A 1MX3A 4B7UA 4JBGA 4ND3A 4L0QA 1TVEA 4PG4A 2G5CA 4UUOA 1I24A 4OXKA 4R4JA 4DL9A 3G3EA 4ALNA 5L4LA 1BDMA 1A9YA 3O8QA 3FPLA 3AOEA 4ESOA 1PS0A 4FC7A 4D0SA 5TT1A 3IP3A 4CMIB 2NADA 5BSEA 2JCXA 3NUGA 2I66A 4UUMA 1WP4A 4S3MA 2GGSA 3WNQA 3GG2A 3OJLA 5B12A 1G1AA 1AHHA 1ZUD1 1SOWA 4CUJA 4J9UE 5JY1A 4ZQFA 1JA9A 3CKYA 5FEUA 1KERA 3V2UA 4NG5A 2H9IA 2X4GA 3LQFA 3F1KA 3PJGA 3VDRA 2JD1A 4FR5A 1CDOA 2ZQZA 1JKJA 2FP4A 3GN2A 1DIHA 3JQBC 3LK7A 5AXBA 3X2FA 4Y6SA 3QIVA 3TL2A 1IPFA 1LRKA 1LXCA 1YKFA 3GAZA 4ROSA 5A05A 2O3JA 4NBRA 2EKPA 3NGLA 3ZH2A 3RC7A 1GEEA 2WD8A 3AJRA 1KS9A 4D0RA 1OBFO 5CFZA 3A9WA 4B3HA 1E7YA 3C85A 4NFYA 2FMUA 3QVXA 5U4QA 4B3IA 4GSKA 1X0XA 3WWZA 2GN4A 4W7HA 4YRBA 4MVJF 5EPOA 3ZHZA 5KWEA 3BTSA 5A9TA 4EW6A 5L4SA 1QLJA 1E0DA 5DCYA 3TOZA 4YAEA 2HAEA 3RUIA 5K6AA 1YRLA 2EGGA 3WYBA 4CM1A 1VSVA 2E37A 3K2EA 3QVSA 1UXIA 1JLLA 3ICPA 4CV3A 3PHHA 1Z75A 4AICA 3G49A 3S2GA 1C3VA 2SCUA 4UVDA 4E33A 1DIGA 1E3LA 4IY1A 1J5PA 1PQUA 2NVBA 2GRAA 3H3JA 4AG3A 2QW8A 2HDHA 5ITVA 2PZJA 4NBVA 2YV3A 1GL3A 3ENKA 2AHRA 3JD1A 4B4OA 2HMSA 3PHGA 4KDFA 3JQGA 4GX5A 3JYNA 1XR3A 4CMIA 1YQXA 4W82A 2OP1A 4JLWA 3F1LA 4KP7A 2IZ0A 3TDKA 1LEHA 4Y67A 4OOFA 5KJEA 3RBZA 1OC4A 1A27A 3QP9A 1UAGA 1F14A 1DOHA 5ICMA 2AE2A 4JJIA 3E9QA 4RDHA 2B4TO 4WCFC 3WQQA 1NBOA 1CWUA 1M67A 5IZCC 4BNIA 1GYPA 3I5MA 1YBAA 2FRDA 3KBOA 3WFJA 5J23A 4IQGA 1H94A 4P4NA 1QSGA 1JAYA 1HDZA 3ZWYA 3D4PA 1C0IA 5ITWA 1BDBA 2DBZA 4LRTB 4MKRA 1OZAA 4LRSB 1E77A 3WGIA 1O95A 3GN1A 4YJGB 3QHAA 1MB4A 1P1HA 1C1DA 3UW3A 3UICA 5KVCA 3RVDA 1K89A 2NU9A 4PLHA 4XQ9A 4Q39A 1MA0A 2HJRA 5KVVA 1HRDA 5HS4A 1V35A 2EW8A 4XIJA 3ITKA 1S7CA 3AM3A 3GOHA 2V6GA 2QRJA 1MXFA 2ZIZA 3FI9A 3AU9A 3JQAB 4XRRA 4OM8A 2UVDA 3FBTA 1F17A 3MJ4A 4HNGA 3VPFA 1GZ6A 2VUUA 3VVCA 5IFLA 2ZB4A 3ZU2A 4FFOA 3Q0EA 4GPD1 4IDAA 4NBUA 5KJFA 3JQ7B 4CQMA 4EUHA 4E12A 5I7VA 1LDYA 1F0YA 3CMMA 4UUPA 2X5KO 4B8WA 3C24A 3WQRA 3OJ0A 2W2KA 1FK8A 1DDOA 2YW9A 2PA3A 3DO5A 4MVJD 5BNIA 1ZNQO 3DB2A 4BNXA 1SBYA 4Y6PA 1YBMA 3QVTA 1A7AA 9LDBA 1U2DA 2CSUA 6LDHA 4BNHA 2X0JA 2GDZA 1SAYA 1Q0QA 1AN9A 3L6DA 4BL5A 1XEAA 3GT0A 2B35A 2X8LA 3HDYA 4XJTA 2PZLA 2ZB7A 4IM7A 3VZSA 1EE9A 2QYSA 1HE5A 1MFZA 4GGPA 4I1IA 3EZYA 1E7MA 1P1KA 2VRBA 4BGVA 5L45A 5L4NA 3GNTA 3WYEA 4D7AA 4ZVVA 3DTYA 3AY3A 4OIMA 4E30A 4A27A 2X9VA 2BHLA 4OOEA 1HDCA 5JAZA 4CL3A 1YOVB 4YB8A 5BSHA 1D8AA 4B8ZA 1AXEA 5G4KB 1BG6A 4GLOA 1AXGA 2DTEA 1W8DA 4RJTA 2IYOA 4WGGA 1V0JA 3AM4A 3FR7A 2Q1UA 4KZPA 3WTBA 3AM5A 4H3VA 2DBRA 2DUWA 4EJ6A 3S2FA 2HLPA 1K0UA 4DPMA 1XDWA 3L6EA 4ND4A 5DP2A 1Y1PA 2UUPA 2Y93A 4FD3A 1ONPA 3W4JA 2CY0A 1GU7A 1P33A 3GVHA 1MXHA 3I3OA 3WICA 2E49A 2VOEA 1BXKA 1TEHA 3A06A 1YQGA 1KY4A 3CEAA 3MJCA 4DQVA 1U5AA 5FI3A 3VHRA 2D3TA 4B4UA 2AA3A 1BW9B 1IE3A 1DFHA 3JQ7A 3LU1A 5FI5A 1SPXA 1ONOA 2O48X 4I5FA 4WOKA 5IDYA 3UOGA 3VPSA 1DIBA 1QV7A 1U3UA 1Y8RA 1KIFA 2I99A 4YPOA 4E5KA 2HK8A 5F3RA 3EHEA 5F1PA 5G0TA 3D4NA 1EDZA 1PJ2A 5GZ1A 4BB5A 1HE4A 4R51A 4AJIA 4NJOA 1I3MA 1ZK2A 4JGBA 3F5QA 4NK4A 3EZLA 3GRKA 3MOIA 4L76A 5TF4A 3GVPA 4IQ8A 1NVGA 5L53A 2P5YA 3KYBA 4WCDA 4LSMA 1EE2A 1WPQA 3DXFA 3PWSA 1PU2A 1B26A 3VVBA 3Q6IA 3D4OA 3QE3A 1F06A 3LYLA 4J2HA 1H6CA 4DTIA 4LVCA 3H9QA 2P9CA 1LDGA 2X6TA 3BMOB 3U0BA 1KVSA 4AL4A 1R66A 4YJFA 1PGJA 2AXQA 3ONDA 1I10A 1SB8A 5LDGA 5KNLA 3TNLA 2HK9A 3WDSA 3PHJA 4PVCA 2DC1A 4E21A 4QT0A 1LDBA 1M66A 1Z7EA 3N74A 3K96A 3H8VA 2WM3A 1V9LA 1K6JA 5IDWA 4E32A 3ASUA 1EK6A 2GUGA 1TT5A 5G0UA 2H5LA 3JD4A 3C1AA 1IHXA 5GZ6A 4AJJA 4AJ1A 3K9QO 4ND5A 3TZKA 4IDEA 5L40A 3FCOA 2WSBA 3F3SA 3RUFA 4IXWA 5I9MA 4I9NA 2QZ9A 3UN1A 1PZFA 4TVBA 1B14A 5COAA 3TJRA 1EUZA 4XIYA 2C0CA 3W6ZA 4FFLA 4JQCA 4L74A 5JAIA 1JVSA 4U0KA 5TRTA 4PLVA 5CEEA 1GPDG 3RASA 2YFHA 5I9LA 1NXQA 1ISIA 1Q7BA 3MJVA 4LVUA 3GMSA 1BW9A 3OA2A 4J16A 2ZTUA 3PP8A 2B0JA 4M55A 4BO6A 2DPGA 4CPDA 5JC1A 1QORA 3JQ9C 4J90A 1NHGA 2ZYGA 4NQZA 4XWYA 5ER6A 4D3SA 4RZHA 4NJMA 2I65A 2HMTA 2YUTA 4XKJA 3H9GA 4GBJA 5JDIC 2O3UA 4M54A 3ZNNA 3ROMA 2LDXA 3UCFA 2NTVA 1GR0A 3PWKA 3R3JA 4B7XA 2VTDA 3KOUA 1H2HA 1XHLA 3BMQB 3LC2O 5L7WA 4DA9A 3HDHA 2ZCVA 4RDIA 3DZFA 1PJ3A 3HQ4O 4CLRB 3BMOA 4PLCA 5MDHA 4H7PA 3H9UA 2VTEA 2JHGA 2H1SA 3EC7A 3DL2A 3HB5X 4OSPA 4B4VA 1SZJG 1B15A 3C7CB 1EEHA 3PEFA 4NU6A 3OP4A 1R15A 2J5QA 2J5KA 4GL4A 1KVTA 1IZ0A 3STHA 3KSZO 1JAXA 1C0LA 3RJ5A 3VPXA 4W99A 3L6OO 2G82A 1D1SA 3QLJA 3JQ8A 4ZA2A 1ID1A 3GVXA 4YBZA 5G0VA 2VYNA 3WG9A 1FDTA 4F3YA 1M76A 4HFMA 4AVYA 3K6JA 1LSUA 3LLVA 5EJ2A 3ZWXA 3TZCA 4WJZA 4GVXA 4I08A 1EFLA 4PLPA 3TOXA 5TC4A 2J8ZA 3DMTC 4I9UA 4MVJP 4D46A 3SVTA 1ADBA 5CAEA 4ZD6A 4U6SA 4XYEA 3X2EA 4D41A 1GTMA 2JAPA 1IYZA 3WFIA 3T4XA 1V3VA 4FGSA 3PGJA 1GFSA 1Z73A 3E9NA 2X9GA 3I9MA 3WLEA 3DHYA 1HYGA 3ETEA 4UVIA 4DPLA 4WECA 5ILOA 1FMCA 5A5FA 5CPBA 2PV7A 2NLOA 3RCBA 2O3TA 1U7HA 4RQTA 3PZBA 4IJWA 1GQ2A 4LMPA 4XEHA 3E03A 1NR1A 2BMAA 4O63O 1L1FA 1U3WA 4HFJA 2LDBA 2ZKLA 1RKXA 3ZGYA 1EZ4A 1KC1A 3EDMA 4MP8A 5JO9A 2PWZA 1N92A 3TFQA 3HSKA 1WAMA 1K5HA 2PY6A 4U7WA 2R00C 1ENPA 2NU6A 3ZV4A 5JYDA 3E1KA 3LC1O 3WGZA 4CV0A 1HZZA 5JCJA 2YJZA 1NHWA 3JD0A 1X15A 4R9RA 4CR7A 3VDQA 1I3KA 4Z9FA 2YQ4A 4FDAA 4UEOA 3GF4A 2H63A 4WCFA 2VHYA 2EP5A 4BNJA 1SEVA 4JNKA 2EV9A 2C5EA 2ZJ1A 4O5OA 4DYVA 4CODB 5IZCA 5C37A 2AEFA 1EVZA 1Y8QA 4YAIA 1PL6A 3L4BA 4R69A 3R6DA 4XRGA 1B7GO 4KMSA 4AJNA 2PNFA 1JN0A 4ZRNA 1Y7TA 4H15A 4L4SA 4O6VA 1GZ4A 3RBXA 5K0ZA 4NZ9A 2XPCA 3ANNA 4JK3A 2EXXA 1EUDA 3PVZA 3RD5A 2AMFA 3B1FA 5KKCA 3JYLA 2IYPA 2VHVA 4PN3A 3RFTA 1MC4A 3OMLA 1WMBA 1VRWA 3GFGA 3VC7A 3SX2A 1ONNA 4L75A 1PJCA 4PLWA 2P4HX 3C1TA 3M2TA 5DN9A 1PJTA 3BMNB 2PD6A 5T8KC 4DGSA 3HDJA 4BMNA 4EGFA 2NSDA 3GEDA 4W6ZA 2YV1A 3U4DA 4DLAA 3H2ZA 1BXZA 3KRTA 1L7EA 1U8XX 2HRZA 1VJ0A 1HYHA 4K6CA 1DJQA 2D5CA 3PIIA 3K30A 3FF4A 2JD2A 2QHXA 4UVEA 5CDSA 2VWGA 1VL6A 2I6TA 3MJTA 2G17A 4Z0PA 4EUEA 3GDOA 3ICCA 1HE3A 1PQPA 2IRWA 4DQUA 2DT5A 3FNHA 4IGFA 2NM0A 4G2NA 3I52A 4J1TA 4OSOA 1H6BA 1BVRA 4Z6KA 1MC5A 4OXYA 1UH5A 3WWYA 3WGYA 4D3FA 3O8QB 1XGKA 4A7PA 4B79A 1B0AA 1DAOA 1W73A 5C5IA 3NDJA 1QYDA 4GSLA 5CDYA 1GCOA 2Y1OA 4UVGA 4RVUA 2CFCA 2P9EA 5EQDA 1C0KA 1HSZA 1OMOA 3MTGA 4PG6A 2JAHA 3DDNA 3PJDA 3NRCA 1H6AA 4D42A 5HRUA 3DBRB 3DEYX 4U6QA 3JV7A 1ZEJA 2ZQYA 3S8MA 3UKOA 3O9ZA 3GHHA 4HX5A 3UUWA 4R5HA 3VZQA 4PRLA 1GYQA 2YDYA 3JYOA 5FYDA 3AUUA 3V1TC 2P5UA 2EW2A 3AI1A 1PWXA 5DCUA 3D3WA 4CLEA 4QO8A 2YV2A 4IS2A 1JKFA 3I9LA 4NMHA 3UCXA 1V6AA 3VPHA 4GX1A 1LI4A 3IOYA 4OHUA 2VN8A 3LT0A 1MLDA 1EMDA 3DHEA 2C82A 4XGIA 2J5RA 4IZHA 2C7GA 1B8VA 2ZYDA 1ZK1A 4RPJA 3VH2A 4R68A 4A26A 1N1EA 2AEMA 1NNUA 4R9SA 3GEGA 2A9FA 4GKVA 1B16A 4PLGA 4UREA 4E6PA 2I3GA 4BS9A 2AW5A 4BOYA 4CLDA 1I01A 5KJ1A 2V7PA 2CVZA 3DTTA 4B4WA 2EIHA 4TZTA 3SLKA 3K31A 1UZMA 4BKRA 5IG2A 1VM6A 4LCJA 2DTDA 4Y8VA 3VH1A 3S55A 4BB6A 4J3FA 4LCEA 4FPXA 3VAZA 3PI7A 1M6WA 2BLLA 2BELA 4BO4A 1YBVA 3N58A 1SO8A 5JLAA 2VZ8A 1ZFNA 3ZV5A 2O3QA 2JJYA 5JDCC 1ZEMA 2X0IA 4YR9A 1U4OA 3SC6A 3PK0A 2VZ0A 3WMXA 1UDCA 4NI5A 1R0SA 1U3TA 3DBHA 3DBLB 5A9SB 2C20A 1IOLA 4IMPA 3TZHA 4J2OA 1VKOA 1DAPA 4BNGA 4EITA 3DAGA 4BHTA 3RC1A 4L9RA 5H81A 2EG9A 3JQGB 3AWDA 3OIDA 4INAA 3DAFA 5A03A 1ENOA 2E48A 1H0KA 5CDGA 4NIMA 4XX0A 1EBFA 1E1KA 4DPKA 5JSFA 2JFFA 2VYVD 2UAGA 5ER9A 1KVQA 3WS7A 3DBRA 4LISA 1NFRA 2JHFA 3I83A 3M1LA 4FN4A 5B37A 2UYYA 1P31A 4CR6A 2FN7A 1GADO 4L8VA 3NJ8A 2WYVA 2AEJA 4OH1A 4AJ2A 3BA1A 3NGXA 2OBNA 2WTBA 1HXHA 3HB4X 4GH5A 1I3NA 2PD3A 3BAZA 1RYDA 3UFXA 2JKVA 1YO6A 2B83A 4B3JA 1K3TA 3OQ6A 3RBVA 2JD0A 1N7GA 1R4MA 2Q4EA 2PK3A 3NDRA 3HG7A 1C1DB 1Z45A 1PR9A 4YA6A 3HJAA 3ZW8A 3FTPA 4E5PA 2NVWA 2GASA 3TWOA 3E5RA 4KUGA 2Q2VA 1I5RA 2XAAA 5F1KA 3WJAA 1SNYA 1VL8A 2BI7A 3KEOA 2BFOA 5A04A 2BH9A 4R5MA 3IKTA 2VWHA 2UUOA 4M86A 3KM0A 2XOXA 3OJFA 5JYEA 1WNTA 3CIFA 4YDRA 1NQTA 4KWHA 4KUEA 1GD1O 3MTJA 3WGHA 4CQMB 1HTBA 1HLDA 2B5WA 2NACA 3GK3A 4BVAA 2EP7A 1DRWA 3ZU4A 4Q3NA 4BNWA 4J6FA 2W2KB 3ETGA 3DBLA 4LN1A 5A9SA 4NPCA 3QWIA 4ID9A 3WNVA 4X54A 1Q0HA 4NHEA 3KHUA 3ZNPA 3OF2A 3SJ7A 2WE8A 3DC2A 5IAAA 2DLDA 1Y9EA 3H6KA 1KEVA 4FOSA 2VWPA 2CVOA 2W4QA 1T2AA 3PDJA 1OAAA 4FCCA 4GI2A 4O1MA 2RH4A 4C4OA 1I8TA 3FPCA 2CD9A 4BV8A 3VOSA 1Y81A 5DP1A 1E5QA 2O7QA 3KTDA 4BNYA 1CF2O 3HNPA 4XQCA 2HO5A 4YYZA 3GUYA 3AUAA 1XU9A 2IXBA 1U2GA 1E7QA 2FY8A 3JD2A 4ONEA 4IJUA 3EVTA 1J0XO 3KUXA 3KV3O 3L77A 3AFNA 4GAEA 4IZIA 4N5LA 1C0PA 3OETA 3KZVA 3UVEA 5KKAA 4YT4A 4CM9D 4UEKA 5IN4A 5LCXA 3MCVA 2Y99A 4YRAA 3ZWWA 2GLXA 4FGWA 3LT4A 3IAHA 1YL7A 2JCYA 3VZPA 3BIOA 1EUCA 1Y5RA 2GD1O 4OKNA 3L4SO 3TZQA 3GC6A 4ZQHA 3RUHA 4BIIA 1UXHA 4IIVA 3PYMA 5T57A 5A4DA 1M6HA 1B3RA 4N18A 3E8XA 4IUYA 2D8AA 1BRMA 1E3JA 1UXKA 3KLPX 4TKLA 3G17A 1PWZA 2Y68A 2AQ8A 5COQA 1NTOA 3P5SA 4J9VA 1B3BA 2Z1NA 1QKIA 2X7HA 2IXAA 3LLSA 3WXBA 2BFPA 2Q1WA 1DLIA 4YT8A 3Q11A 2YYYA 2F1KA 5I8WA 4MINA 2WMDA 4MP3A 4FS3A 2R6JA 4TRRA 3ZI0A 4JCOA 4ZJUA 4TRNA 1T24A 4PIVA 1SOVA 4RF4A 3F5SA 2D5AA 3A4VA 1VJTA 4G5HA 1Y8RB 1A4IA 1ZSNA 3PIDA 4FOOA 2CUKA 3KSUA 4RV9A 4DRYA 1JWAB 5COBA 4CLXA 4OGWA 1ML3A 1ZH8A 3PRJA 4ZQBA 1E3EA 1FF9A 4PZCA 2G0TA 4G81A 1XYGA 3OSUA 3ZV3A 5EN4A 2CDCA 4QSMA 3UXYA 2DVMA 3H9EO 2ZB8A 1Q1NA 1DFIA 4J91A 4XGNA 5BNFA 4D79A 5ILGA 1EVYA 1PGNA 1U3VA 2PGLA 2Q3EA 3ETDA 4G65A 4WUVA 4DMMA 5CG2A 1AE1A 3MWDB 3EUWA 5MGBA 4J4BA 1CQJA 3D0OA 3R3SA 4CM4A 3L0DA 1NQAO 1NWHA 4UULA 5AXDA 5LDHA 3OJEA 1YQDA 3GAFA 3NKLA 1AHIA 4CLHA 1DHRA 4P4LA 1ZO8A 1CJCA 4YJFB 3W4IA 2PH5A 2DBVO 4FJ2A 4PLTA 3C1OA 4FJ1A 3AU8A 4FFMA 1VSUA 2RHCA 2Z95A 2GF2A 1L7DA 4WLUA 3JD3A 4OAQA 3HUDA 3QVOA 4K6FA 4I5DA 4HV4A 5TX7A 1G0NA 1X0VA 4CM5A 1TT5B 4DC1A 4RVGA 2BGLA 5IXYA 1UZLA 3G1UA 4D3DA 2OOSA 4PCVA 2NUAA 5T8KA 5HTOA 2HRBA 1U1IA 1FDSA 4NU5A 1HYEA 3ANMA 4BKPA 1HF3A 3E9MA 4YWJA 4HFNA 4D45A 1E7RA 2YHIA 2GZ3A 3K5PA 1R6DA 3SC4A 4BO2A 2EERA 4QECA 4EUFA 2QX7A 4PG8A 1BWSA 5EQFA 3M2PA 1WDLA 1GZ3A 2B36A 3IQDB 3GDGA 3C7AA 5DCWA 4BNVA 2I67A 1RM5A 1KBZA 3E5MA 3JQ6A 5LC1A 3GHYA 3RFXA 2Q2WA 4ZQEA 3Q2IA 2PKQO 4JBIA 5DOVA 1DJNA 4NFHA 3CXRA 1D7OA 4NJMB 1UDAA 5L7YA 3ZWCA 3H65A 2DQ4A 3D7LA 3QVWA 3IJPA 4DBZA 1UAYA 1KYQA 1LQUA 2V6MA 1GQQA 4XD2A 3BTOA 3GR6A 2D0IA 4W9NC 3C8MA 1UZNA 3CZMA 4E5MA 1TA4A 3I9OA 3KEQA 3G0OA 2EJVA 4IGEA 1UP4A 1OC2A 1D1TA 3FNGA 4XZ3A 4A2CA 1N2SA 4CQLA 2NQTA 2B4RO 4YQZA 3VTFA 3B20A 3NT2A 4MO2A 1Y6JA 4E31A 1RJWA 3P7MA 4WPGA 3HN7A 1PS8A 1XQ6A 3IUSA 1F8FA 3JYQA 4KOAA 2DU8A 2V6FA 4ALKA 1NVMB 2J3IA 4EJ0A 3AOEC 3TZ6A 1VLLA 1HDYA 1GV0A 4KTTE 3JQ8B 3ROKA 3ZV6A 4TRJA 3GUCA 2D59A 3KYDB 1LC3A 5CEFA 3PHIA 3O4RA 4XQGA 3PGXA 1AGNA 4CMGA 4E5YA 1QG6A 1HZJA 4WKGA 2Q46A 2RCYA 1P1JA 1ZBQA 2FPIA 2ET6A 2OP0A 3I1JA 1LA2A 3CZRA 4WNCA 1H5QA 1X7GA 3AY7A 5H83A 3WQSB 1XG5A 1KY5A 3A14A 4GWGA 1J4AA 1XA0A 2BGKA 4CUKA 3FBGA 3R1IA 4IMRA 1MUUA 3WSVA 3IJRA 1LDEA 1ISMA 4ITUA 1RPNA 4Z3KA 3QWHA 1WDMA 3WR5A 2FR8A 4DBVO 4JBHA 4DLBA 2AQKA 5ICSA 1NPDA 5AXAA 3ZHXA 8LDHA 2QQ5A 3ANLA 5IDXA 5JDCA 5KCZA 3AI3A 1LLDA 3WTCA 4BQRA 1P77A 1CETA 1CEQA 2FOIA 3BHJA 4PLYA 5U1PA 4MVJH 3CSDA 5FF9A 1BTOA 1E1LA 2XF8A 3WGTA 4YTEA 5BQFA 5ES3A 5I7FA 1JKIA 3HZZA 2EGHA 1JW9B 4ALMA 1VJ1A 5JFOA 3TRIA 2IEBA 1ZXBA 5TGDA 3BMCA 4IDCA 3VH4A 5K6AC 1PZGA 2O50A 4J43A 4DREA 4Q3AA 3ABIA 3FNFA 3OEWA 2C2XA 1N5DA 3GVCA 2EWMA 4J1SA 1EQUA 3JQAD 4WCFB 1E3SA 4R1TA 5B4TA 4FBGA 4FFRA 1I30A 3FSRA 4DIBA 1ZJYA 4YAGA 1Y8QB 2I5PO 4ND2A 4S1VA 4EI2A 1R16A 2Q1TA 4CV1A 4L73A 2BF7A 2GERA 2JCVA 2OGUA 5HA5A 2I76A 3BHIA 3ZWAA 4AJHA 3JQBA 5IZ4A 2WD7A 5L7TA 4WE3A 4O0LA 4BNLA 2Q2QA 3GVIA 2I9PA 3LT2A 4IDFA 3RC9A 3UCEA 4HBGA 1YL6A 4FQ8A 4GLLA 5DZSA 1SCUA 3H2SA 5TT0A 4RO0A 1E5LA 4MKXA 1XWFA 3DOOA 3JSAA 3KYDA 4CLOB 4DLLA 4R41A 1WLYA 3GH3A 1ADCA 5FFFA 1I0ZA 1IZ9A 3E48A 2ZATA 5EL0A 1O89A 1Q7GA 1G0OA 1KETA 3C3XA 3HN2A 4HUJA 5IF3A 4R1SA 3FD8A 1EK5A 2J3JA 2ZB3A 3GZNB 4BO9A 2W90A 4YJHA 3ZZNA 1E1MA 4BO3A 1W6UA 2VUTA 4EBFA 1NQ5A 2GR9A 1ZJZA 4YXFA 1ULUA 1ADGA 1XU7A 2HCTA 5B4VA 2Y0DA 4JJGA 5TSDA 1XELA 1N7HA 5I7EA 4JX8A 4YCAA 3MZ0A 2DM6A 5G0WA 1NASA 3U49A 4EYEA 3NX4A 5TIIA 2Q50A 3RU9A 3KETA 4IINA 3HWRA 4RF3A 3ZWOA 4NDNE 3JQCA 1YWGO 5DT9A 3VKVA 2YZ7A 1B2LA 4RGBA 2R2GA 1JQBA 1PQWA 1LSJA 3D1LA 4GX0A 3JQDA 2GZ2A 4XGKA 3ZNQA 4XB2A 2O4UX 3D64A 5JY6A 4E5NA 4CV2A 2FWMX 1X13A 4IIUA 3ROPA 3K8ZA 5JS6A 3V8BA 2YY7A 4E3ZA 1OI7A 3QRWA 1VL0A 4RF5A 4BMSA 1U4SA 3RC2A 5CP8A 3WSWA 2CVQA 1LC0A 1LSSA 3QQPA 5EERA 4BO0A 3PXXA 4RQUA 1R4NA 4YAKA 2Y05A 4XYLA 2GNAA 1DRUA 2IEDA 1E3WA 3P2OA 4AJOA 4J7UA 3ZW9A 5HM8A 2IE0A 1I32A 1PJLA 5DDIP 3HADA 1DIRA 2YQ5A 4IJKA 3AOGA 2JL1A 1WDKA 4IJVA 3D3WB 5A06A 2RHRA 2WEKA 4RF2A 3OM9A 1E3IA 2DFDA 5A9RA 2D2IA 4O59O 3MJEA 4XR4A 4CLOA 1HDXA 1E7SA 1U8FO 5TQVA 4LSWA 3F46A 1NM5A 1DB3A 2Q45A 2D1YA 1LRJA 4H16A 3EY4A 3I9NA 1NPYA 4ZHSA 1PJ4A 1GQYA 1LTHR 4RVDA 4EJMA 4YT2A 3GZNA 1KEPA 1ZK0A 3NTRA 2P91A 1JTVA 3BTVA 1WMAA 1ZVMA 3O26A 3PLRA 4BUCA 1MP0A 1T26A 3DWFA 4L4RA 1P44A 4ZN6A 5L95A 1EDOA 3GDFA 3OA0A 1HT0A 4XR9A 5H82A 4CR8A 3LDHA 3DFZA 1MGOA 4XYMA 2VHWA 1HL3A 2Y1CA 2QG4A 4I5EA 4Y98A 3RUAA 1XCBA 1YVEI 3G79A 2GO1A 2Q49A 3GPDG 1H9BA 3ZU3A 3V5NA 3WOHA 4R16A 2PTGA 3GGOA 3FTNA 3N7UA 3VTZA 1U5CA 2VYVA 1C1XA 1UJMA 4OL9A 4RVFA 3GMDA 4FW8A 3DBHB 3GGPA 2Q4BA 1R0KA 4WLVA 4U5QA 4ALLA 2Y67A 2H6EA 1HKUA 4C7KA 2UV8A 2FZWA 4OKIA 4BGIA 1H2BA 1T2EA 2P4QA 2Z5LA 1ISGA 3GGGA 4BNTA 2EHDA 5JMWA 4I9HA 4YT5A 2OHXA 3DOCA 4CMCA 5AQ1A 1O9BA 1ZK4A 3ZWMA 1A9ZA 4KQWA 3OEYA 1DHTA 1CYDA 3OJOA 3INTA 1Z6ZA 4IPTA 3HDQA 3DZKA 3DQPA 4BGEA 2POQX 2OUIA 1R37A 1UUFA 4KDEA 3RI3A 1TT7A 3I4CA 1DO8A 5BNTA 1LQTA 1PS9A 2X9NA 4XQEA 1RWBA 1B8UA 1IL0A 4JJFA 4D44A 4D43A 2NU8A 1P1RA 2VQ3A 3WYCA 4WASA 3BYZA 2X22A 4MVJG 4E0BA 4E4YA 4FFPA 1QYWA 4IDBA 4CMHA 2QRKA 5IXSA 2P9GA 1R4MB 3GNSA 1GY8A 1MFPA 4RLSA 3RKUA 4ZU3A 3PYXA 4QQRA 3PQFA 1QYVA 2BD0A 1H93A 2HMVA 5DBIA 4RZIA 5DULA 3ZCXA 2HJSA 4HY3A 2WDZA 4UEJA 2IZ1A 1XIVA 2XXJA 3EMKA 5C7IO 1CQIA 1PGPA 3PLNA 1K6XA 5T64A 4XJSA 1U9JA 4WLNA 4YAJA 2PFGA 2GSDA 3F4LA 1I2BA 1KVUA 2WE7A 4ZRMA 2A35A 2W2LD 1FDWA 1PL7A 1ZMTA 4M1QA 3KYCB 1GAEO 5GY7A 5JAMA 1D4FA 3H5NA 3WMWA 3ZN2A 3NV9A 4MDHA 4TMFA 3PFWO 1LSOA 3RQSA 5KTKA 3DZGA 4MVJE 1RYEA 1M75A 1N9GB 4GMGA 4PG7A 4XA8A 2X58A 3QJ5A 2QIOA 3W6UA 2FZEA 3WB9A 3GLQA 1DSSG 4RCVA 4ZQGA 4DIFA 1DEHA 5U9CA 4Z3DA 1P45A 1BXGA 4Z0HO 4LK3A 2O23A 4CM9A 1DIAA 1ENYA 3A28A 3H9JA 1QRRA 5KJ6A 4MKZA 4IXTA 4J4HA 1PZEA 4BV9A 5CG1A 2VCYA 4QO7A 3RUDA 5I7SA 5IDQA 3PYLA 1KEWA 2VNAA 5THKA 3OQBA 2X5JO 4YEDA 3OIGA 2C59A 3IC5A 5G4LA 1P1IA 2WWRA 4DUPA 1K6IA 3P2YA 3QWBA 5A3JA 2QZZA 2O7SA 4PLFA 3ZWVA 4HKTA 4JP3A 1DPGA 2OBYA 5JW6A 4GKBA 1QP8A 3Q9UA 4JP2A 3JQFC 3NT5A 3ON5A 1IULA 5A3VA 4RVHA 5BSFA 1NFFA 1X14A 4LGVA 1Y5MA 4XCVA 1GUZA 2FSVA 3WIDA 3V2GA 4F6LA 1NR7A 3OECA 5AXCA 3ULKA 2GYYA 4XYGA 3LF2A 1E6WA 3Q2KA 4R01A 2HMWA 1YB5A 3ZWBA 5ADHA 5B4UA 2BRUA 2OXIA 2P68A 2O2YA 4N5MA 2JFGA
chains in the Genus database with same CATH superfamily
5YASA 1RADA 4MVJA 4RPCA 5DLEA 2FDCA 1YZYA 1JR3A 4M1ZA 1N6KA 1O9HA 4OXNA 1FJHA 3KYCA 5IH7A 1LVGA 4WFJA 1F8GA 4N47A 4K28A 3TTVA 5JZMA 4YRDA 3FAZA 5LL6P 1K1EA 3D6NB 5EXPA 1SXJC 3HCBA 1EUQA 1E9RA 3TTWA 5MN6A 4QUHA 4F45A 4PX9A 1HMPA 1QDEA 1OGYA 1N9GA 1U28A 5I7OA 2QGZA 3UH1A 1YH3A 2QXUA 4RD0A 1TJ4A 2V6BA 2FWJA 4Q21A 1HORA 1PJ8A 4I4TB 1Z16A 3JWGA 1FSGA 1GAJA 1XTQA 4TS4A 3NVDA 3ELUA 4OXQA 5EKSA 3QMVA 4JBYA 4YVFA 3BZBA 1T5BA 4G67A 3T7EA 1I6MA 1RYZA 1H2ZA 1Z8FA 2GPNA 2X6QA 1NC1A 3ER8A 4ZPXA 4OQFA 1EVIA 1KOGA 4CM4B 1TZKA 4ND7A 1KOJA 4OB7A 2B34A 4L8YA 3OHSX 1FFGA 1QYXA 1VFNA 1I3LA 2A0FA 2JRLA 2QUKA 4G9EA 4HWKA 1KQNA 1RYFA 4DQLA 4E5UA 1Q21A 3ROTA 1ZD9A 4DLRA 1ECJA 4FB4A 4LYYA 4TV8B 1OX4B 1UWLA 3T94A 3DXYA 4L28A 3IAS6 3V6MA 2V03A 4QQNA 1FNBA 1G20A 1M8FA 2EJUA 4JN6B 3CNNA 4TWAA 5KCMA 4IKEA 5CDUA 4V0QA 4ESHA 1H9AA 3C3EA 2P27A 3BZUA 5LQJA 4I8XA 1NQUA 4WXEA 2GPTA 3SGLA 1TZCA 2C9YA 1YJXA 3DMTA 5EA2A 3ZU5A 3S0JA 2WBLC 3LCCA 4CMJA 1Q92A 4J0FA 3L1JA 4EB3A 1M1YE 3GJ7A 1SMKA 4J4TA 2NXCA 3OOHA 4L7VA 4QEZA 5LB4A 1BU8A 2XE7A 1GA4A 4TKUB 4GQBA 1K7CA 5DN6A 1DAEA 3GA0A 1R5BA 4F3RA 5C7OO 5BW8A 5FL7D 5GADl 2YHIB 1C2TA 4EZIA 1MKYA 3FGOA 1OFUA 3JS5A 4RWEA 2NZYA 2IDKA 2A5YB 2HMUA 4ZT6A 3X1YA 4I4CA 5DYWA 3TF5A 3H2HA 1JFFA 1RXYA 2X40A 3CZ5A 5TV2A 3L8ZA 3DLTA 4EFMA 3A1TA 4ZODA 5TEWA 4WAUA 2XOKA 1PE0A 3BTUA 3QW2A 3K92A 4NBNA 1JVBA 2XDAA 1NWCA 2Y1FA 1QGAA 2WWIA 4HXEB 3ZDRA 4U2KA 5ES4B 5MGNA 2Q0XA 3CSSA 3H3FA 3VR6H 4EKEA 3GLKA 3OD5A 4Y6GB 3VPGA 1YI1A 1RC0A 2O1XA 3DWEX 3QEJA 3UMSA 1XV5A 2BBOA 3MGAA 5EYPB 1CUXA 2RDMA 3A1NA 4ZU1X 4EG5A 3HNRA 5IJ9A 1BN6A 1OFVA 1LX7A 1LLQA 1QR6A 1QS0B 2R00A 4PVDA 1QGZA 4QBTA 4Q9JA 4PN7A 3FW1A 3U44B 2HM7A 3WAJA 1KGSA 3AUSA 3LUPA 5CHEA 5IABA 2R85A 2PVSA 2C54A 3NOXA 2XW6A 3RSOA 3OG9A 4JEHA 3RIYA 4JVOA 2VHTA 4GMXA 3I23A 4HNAB 5AOVA 1IJFA 3VHLB 2QTLA 4KGXA 4U8GA 2E4AA 5I5EA 2IYEA 4XB1A 1F4PA 2YWXA 3R5JA 1RWNA 2CDBA 4I4TF 5A1JA 1YK1A 5AHWA 1FBNA 4M49A 1O08A 1PWYE 4NZOA 3FOCA 2HKIA 4OGLA 4EQ6B 3DP9A 3K32A 3QXGA 1K5DA 3SJBA 1C9MA 1OB2A 1N3IA 3ETHA 2FSSA 4XDYA 4Z3OA 3ILHA 4NZYA 3EJWA 4CM8B 4YUZA 3Q87B 2QJOA 4G1FA 2B2CA 2O3SA 4TX1A 3GJ0A 5KI6A 2HGZA 2JLYA 4NULA 4RE5A 4XW2A 4M0PA 5EAIA 1CNFA 4OLHA 2MDTA 4P4SB 1DINA 4IR7A 3B6JA 4UJ3A 2YW2A 1P62B 2B94A 4TV8F 3RUCA 2ACWA 1LPMA 1T6XA 1CLUA 1XALA 3VPBA 3S1LA 2G76A 4K9KA 1JHUA 2H4HA 4RDCA 1PFGA 3LUDA 1Z4PX 3L07A 3MJSA 5IAJA 4MI9A 4LRQA 1U8ZA 3ITDA 3WWEA 4YYEA 1T5SA 1MB0A 2I2BA 2O52A 3W3AD 2JVKA 4DADA 1GTG1 1BGVA 1N6NA 4KTVE 5DBOA 5ECDA 4FSHA 1P9WA 3Q7RA 4OBXA 1PJAA 1FS6A 4HMPA 4E2XA 3CRNA 3FVTA 1WL8A 2E6UX 2L69A 4BQPA 5B1YA 2UYOA 3FOAA 3U09A 3TFOA 2WR8A 3ITEA 1DU4A 3MB8A 3HCNA 3MERA 3P0JA 5ENDA 3STUA 4PFSA 1UKZA 5BWBA 3UC5A 4KO8A 2K4MA 1GSIA 2PWBA 2VEOA 3EWSA 4NK5A 1M9NA 2C88A 1PJBA 1W5SA 3BWCA 4IMIB 5FKJA 1KKMA 2CXPA 3UJDA 3LT1A 5IAGA 2ZYAA 1A7KA 4LZAA 3VYUB 1VCMA 2YYSA 2J0QA 1PJZA 4KQ6A 1QMGA 1CUWA 3MGBA 3O0DA 1DKLA 2NNLD 1A5ZA 1OXSC 4J0DA 1BMFA 1XKQA 2WUFA 2HQBA 4W4TA 3AQ4A 1EA7A 4I99A 4IDNA 4DR2B 2OG2A 4XGQA 1NW8A 1W8IA 4QWWA 4JJZA 1DQYA 4YASA 3JQAA 1EINA 2HHJA 2ZRLA 4GOMD 4W5WA 4CGZA 3V2HA 3IPCA 1HPLA 3V1YA 3O8BA 1T2DA 2H4XA 5E4TA 1K9VF 3R9WA 3FPAA 3KOOA 1JKXA 3KE9A 1UODA 1P2UA 2B8TA 3AHHA 3GDWA 1C8VB 1X9HA 2VJAA 4PFJA 5M3BA 1E1NA 4KRYA 4LS3A 3UJAA 3FR8A 2CBGA 3F98A 3EXAA 4BMXA 2DWCA 5GONF 2PMFA 2Y0EA 1JZSA 3A6ZA 3ONFA 3OO1A 4JROA 1SA0A 2VOJA 3WRYA 1E2FA 1U2PA 3SDSA 1CEEA 1UPXA 1RBQA 3K6SB 3THWB 1P91A 2CCJA 2OLKA 4OHOA 4F84A 5JSUA 4F06A 3A2KA 1SCQA 4RPLA 4Q3CA 3GELA 1V7QA 5EE9A 4BJ1A 4KFUA 5JMPA 4CM8A 2PE5A 4CIWA 2DP4E 3SZUA 2YFQA 2O54A 2WD7B 3CLRD 1H66A 3RAEC 1YZKA 5C4MA 2UUAB 4KQIA 3TSCA 2C94A 4OYHA 1XDSA 3RS4A 5FWNA 4P4SA 3SYRA 1AK2A 2ZJ7A 3QUTA 1PJSA 2CFTA 4CM7A 1A9PA 3P9ZA 3NG1A 4E2ZA 4YRGA 3RC8A 4U2BA 4LYGA 3TYXA 4RPHA 1RE1A 3U81A 1H85A 1YDEA 1IMJA 3QMPA 3GGCA 5DBFA 1IXYA 4TV9F 3C43A 4X9XA 2ZOSA 3G88A 4QPPA 1RWVA 4ARSA 5FADA 5EJ9A 2CDNA 3GY0A 1I1HA 2Y1DA 5FPQA 3S81A 5A02A 2FW8A 3ASZA 1C8BA 4JVSB 4TMXA 1E62A 2BWJA 5EIBC 3GLHB 4F46A 5LOVF 4YJHB 2BEJA 3T5GA 1PUXA 2ZK7A 1U1CA 2ESRA 5KOJB 3KVOA 2V65A 5JAHA 5DLYA 1CJSA 3UK6A 3TNFA 2O4CA 3A6DA 1M74A 4G5XA 4Q4AB 2APJA 2GZ1A 2OZLB 1GAWA 2YWGA 3OVMA 3A6FA 4JQSA 4M1SA 4C0QC 4EGAA 5BSKA 4C7JA 1QYCA 3OPYA 3OLYA 4D8WA 3EVEA 2H4FA 3UV7A 4EO4A 4MUEA 1GEGA 3CH6A 4Z7OB 3FI0A 1J2TA 1RI2A 4MIYA 2FW9A 4HSEA 4X1OA 1YJQA 2WQZA 2X4DA 4CM3A 5BWLA 4LF9B 3FLAA 3HE3A 2HDNB 4WEQA 1YASA 3MTEA 4FCTA 3LVFO 3L4KA 2WWYA 1EBUA 3CT4A 1F8XA 1CULC 4U7JA 2JIQA 1CRWG 5F9MA 3MELA 1EGAA 5SY4A 1BD3A 3RRJA 1MC8A 2A5LA 2J33A 1ZHOA 1GNLA 5ITZA 4GS5A 3FFTA 4DMLA 4C2UA 1OY1A 2YV4A 5CPFA 1RWOA 3DB1A 3I64A 1NAIA 3N0VA 1T0IA 1G5HA 1NX6A 2H7VA 2N3ZA 1MPXA 1DEAA 2O8NA 3AY0A 1RM4A 3LT5A 2DPLA 2PZBA 1RI5A 3RS2A 2VF5X 2HF8A 1B8PA 3ZDFA 4HHEA 1GSOA 5A6VA 5G2OA 3M4JA 1ZVJA 2IEAA 4FDUA 1DXYA 3K6SA 4EJSB 5EMKA 3Q9SA 4DV2B 4FX2A 2O0MA 3WDKA 2P9BA 1FDUA 1XCJA 2EX4A 3DVAA 5DOZA 4ZAYA 4TKVA 1EVEA 4KKXB 3O93A 4HNQA 4BMOB 2P3SA 2QZSA 1UPFA 1G5IA 1E1YA 3GH1A 5AJXA 2YHUA 1FSPA 3MB5A 3SXPA 2NTJA 1XQ9A 2ROQA 16PKA 2FN4A 1CUUA 4JR1A 4AUKA 2PBZA 4NYJQ 1VIDA 3FWPA 4OQYA 3NIGB 5B64A 1G17A 1AMUA 4Y2UA 5MFPA 4UFPA 5AVKA 3EISA 2HU5A 1XPOA 4KNWA 2FDXA 1ISRA 1SVWA 2V4MA 1TXGA 2VKTA 4BNUA 2HA4A 3BWXA 3NTQA 4M87A 3ZY6A 1JWLA 3N0RA 1TC2A 2JAXA 2PMWB 2YIVX 3INGA 4LVOA 1BE0A 3EGOA 3QENA 3AGPA 4MA0A 5CURA 5C5CA 3H5RA 1ZN2A 2A5JA 2HTEA 4NTZA 2HHHB 3I9JA 4L5YA 5JE8A 2CL0X 3TR5A 4AMZA 1QRTA 1CJVC 2V7VA 4DXDA 2FUG6 4M37A 1A4RA 1PR1A 5ECWA 2ZUWA 5HDBB 1M5UA 1TI7A 4WLFA 2E4WA 1O6ZA 3BXZA 3BHMA 1XU4A 1SHZA 2RKOA 3PE3A 5KOJA 4KR7A 3BJMA 5SICE 5HVNA 4NDAA 4FS8A 1A97A 2QY9A 1GCIA 2BFMA 4U7DA 2RI6A 4U1RA 3K4PA 3LLMA 5I9BA 4EKNB 3ET4A 2A4KA 1Z2NX 4AJEA 4BO1A 2EG5A 2ZCUA 2TECE 3UKJA 1F2VA 1RM0A 3PFFA 3E82A 4LAFA 3BGIA 3Q5GA 4HLQB 2XXBA 2JIPA 1ISJA 3I09A 1G66A 1CQWA 2FP3A 1C1XB 1LJUA 2CD7A 2VSNA 3KKMA 3PQDA 4IIGA 3ND5A 4WKCA 2WQ7A 4RL4A 1WWKA 3IAUA 1QK5A 4BVHA 2FWPA 3L0CA 3AFHA 4LXTA 1J24A 3O38A 2R87A 4FI3F 4A73A 3SBOA 4BNKA 3H5AA 5BQPA 3FWYA 5HKBA 3MAJA 5K4AA 1ZQ9A 1FFXA 2DSNA 2DQYA 3IRVA 4FFNA 3Q7TA 1A96A 4HQOA 3PI6A 4ALJA 3RFVA 1I6WA 2OAQ1 2ZSEA 5HRCA 2E82A 4BMVA 1GNPA 2QMHA 3P0EA 1W9MA 2YVUA 3NH9A 1ISFA 1ICIA 1SB9A 1S0UA 2C8JA 2QP9X 2XCUA 1T3SA 2NO6A 2WHQA 1JSLA 4P22A 4EWLA 2I22A 2VA8A 3E9RA 5J63A 3RROA 5B7QA 2ZTVA 3T12A 4TWRA 3KJEA 1BX3A 5C1DA 3B6IA 2CLSA 1NR5A 2XVAA 2Q29A 5GOZA 1PGQA 4KO4S 1W2WB 3QXJA 4RD6A 4P3NA 1NYTA 2ZM5A 2H59A 1CQPA 1QGYA 1T5LA 2VO1A 2GZDA 3QHQA 2EEZA 3RC3A 4WBNB 5JOQA 3DHNA 2QL5A 3BMQA 3H9BA 3R5XA 3TPCA 3QXXA 5CVVA 4L4XA 2OV1A 2R1TA 4KO1S 4OYRA 3TS1A 4F8JA 3SS9X 1W35A 2W2LA 3C7DB 3EVCA 1S9DA 1J8DA 2OD9A 1KO8A 3OM8A 4COOA 1OUMA 1QGOA 5LZ4A 4N12A 3GA7A 4N3CA 4F9TA 5FWAA 2JZNA 3KQKA 5IJAA 4KDRA 5LU9A 3ZLJA 3D2AA 4MMYB 5TJ9A 1X1TA 3V4PB 1IXRC 3DYVA 1GG8A 4Y6RA 4UNPA 9GPBA 4B5KA 1O5IA 1ZOPA 1WW8A 3NHMA 3OZ7A 1X7HA 1VYVA 3NCTA 3ORFA 2WRZA 5JPIA 4CTOA 3F6YA 5KIAA 2ZT5A 1O94A 1WVGA 3PSHA 5EXDA 3S2EA 1TYAE 1C9YA 1E6UA 3VHXA 2A67A 2P4UA 4UE6A 2EBUA 3U3DA 2Q5QA 2W93A 2X1LA 5ALYA 3JPWA 3IE1A 4WKOA 4Y0AA 3PHCA 1D9XA 3R6WA 1CIVA 5AT1A 4PAQA 2REBA 3DAHA 4JT9A 3D8TA 2WF7A 4LQ4A 1OXVA 4CJXA 2BW0A 4YLEA 3T7CA 1UQTA 4UZFA 3RJMA 1CQXA 4MS1B 5B55A 5DSXA 1FP7A 2PRYA 2F9FA 3Q88A 3G8YA 4P7FA 3N6XA 4MW9A 4OFBA 3L0YA 3O94A 5FA6A 7ABPA 5FPTA 5FO0A 1BXGB 1T1GA 4FYHA 8ATCA 4A03A 3ECAA 2HSDA 1BQEA 3L9WA 4V0NA 1NATA 1ISHA 1MVLA 1J56A 2QRLA 3BE6A 2HA2A 2A3NA 3OD1A 4EATA 2F7SA 3O5AA 4H3HB 3FLMA 4R1UA 3M3DA 1WQ1R 4LTMA 3TL3A 2D2EA 4TN1A 3KQYA 3QVVA 3MINB 3HV2A 4OMCA 5A5EA 3MYRA 3KPWA 1Z7GA 2Y9MB 4YP1A 4A2QA 4US2R 5I01A 1WW3A 1L3BA 4MWGA 3PJFA 1I36A 4QNNA 5CX4A 2ZI3A 2W70A 3WK9A 4Q1FA 2B8EA 1Z8DA 4O4JB 4QU9A 2OT3B 3A58B 2AOTB 4MUMA 2PSDA 1FYXA 4H1HA 2FZVA 4YAFA 4EELA 1M8GA 4AY4A 2VT3A 3WGOA 3RS5A 3G9UA 4PV7A 2IODA 2OHIA 1WF6A 5F5NA 2D4HA 1L4KA 3L6RA 5A2GA 2HT1A 2G0AA 3HU5A 1DKOA 3KXDA 3NBKA 3NT4A 1R4AA 2GKSA 2HHCA 3AJ9A 3DWGA 3EJ6A 3Q1LA 2NUTA 1P4GA 4HNHA 5KYXB 1TAGA 5EIFA 1GDHA 3PD0A 1H42A 1J2UA 3UK2A 1XTUA 4BBAA 5E8RA 3H5LA 1VPTA 1KARA 1E9VA 2H1CA 1ZBDA 3N2LA 4N7RA 3SHTA 4U3JB 3VJMA 4PPGA 5HUQA 2C2GA 4HXFB 3O8NA 4KB5A 4WBNF 3RSHA 3PTZA 1WXDA 2GZRA 3AINA 4QEDA 2VTBB 2GRJA 3IVAA 4DEXA 3CRW1 2J7PD 1HT1E 2R2AA 1Z4OA 2HO4A 2ZANA 4LJYA 3NNNA 4RD3A 5K3AA 5TE9A 4HDSA 3KPYA 4HQ6A 5BR7A 4KRXA 4PO9A 1DT3A 3ECCA 1YAJA 2G77B 3AI2A 3PNKA 4RVSA 3N0WA 5AJUA 1W5FA 2CLOB 2WZCA 3B78A 3SOPA 1TNDA 1TPYA 3GV0A 3LE8A 1GHTA 4K6MA 4QFBA 3U6KA 1CY1A 1A9QA 3W9UA 2Q7XA 3QKWA 1N25A 1MTOA 4F6CA 1W76A 2OECA 1OLSA 1NRXA 1KK0A 2DKNA 1N8KA 2ZI7A 3KG2A 3N28A 1K86A 4LFBB 2IYVA 4Z2YA 4ZOBA 5NLLA 4HB3A 4AZ3A 2B4QA 4NCAA 4URHA 4MK4A 2Z57A 1JQ3A 3CINA 4H4EA 4WKNA 4JZYA 1RXUA 4XYBA 5LP6C 3RU3A 4CYMA 5HKOA 2BYTA 4MS1A 4CEJB 3PGVA 5FA8A 4L57A 3GUVA 1AGYA 2YZGA 1KWKA 5AVZA 4E2YA 1A9XB 2DJ5A 1UDBA 1M10A 1UBEA 1V5EA 1SC6A 2FUKA 2PH3A 1Y9JA 5JC8A 5T4EA 3NHUA 3S7TA 5SZJA 2WTXA 5FUWA 2YRXA 4ED9A 3H1AA 1WV1A 3CS3A 4IIHA 4AXXA 1VKNA 4QUDA 4B48A 4FZVA 3ZXYA 2X3UA 3U4CA 2GCPA 2QF7A 4M0DA 3RVPA 3QKSA 2NVUB 4PAMA 2BMDA 4HLUA 4TXMA 3ESCA 4J7AA 5TGTA 3WL8A 3ABSB 5IKXA 2EF1A 3MINA 2WDPA 3D1VA 4G1BA 5HQ3B 3PCTA 4L0QA 3HO1A 3P9IA 1S2GA 4GLFA 4PG4A 1ZRNA 2K5UA 4O4JA 4WJKB 2OFFA 1A9YA 3O8QA 3FPLA 2IHJA 1HM5A 2QX9A 5BSEA 5LQCA 2JCXA 5KTSA 3WHKA 1SBCA 1Y3BE 1ESZA 1GKKA 2FZCA 1S96A 2QD3A 3U26A 5D8DA 5FL7A 2JI4A 4LX0A 3UYLA 5KWJA 1G1AA 4M6WB 4NCJA 1GNVA 2OV6A 1NMQA 4MVCA 4AY5A 1ULHA 2RGXA 2XBMA 4GM0A 2QN7A 4AULA 2BMWA 2ZWOA 4BVJA 1NBMD 3MHTA 4XE5A 5KSOA 1JA9A 1TVKB 3CBGA 3KIPA 2YHAA 1DAFA 3CB2A 1YS9A 4NG5A 3K1TA 5G3YA 4ZT2A 2VTBA 3PJGA 2Y1XA 3F1KA 1JLMA 1N9ZA 3FZGA 4RJKA 4YI3A 1QB7A 4V1CB 2ZQZA 2VCHA 1NRJB 2E55A 1V8FA 3EXEB 3W2FA 4AN0A 3LPNA 4I4NA 1OA0A 2BFWA 3SBDA 3X2FA 4K40A 1QO0D 2JK1A 4GG1A 4QELA 1S3IA 2XGMA 5CVCA 1AHNA 1VYHA 4ZC8A 1QQ6A 1YKFA 3GAZA 4NPAA 2PT7A 1YR7A 4H27A 2EKPA 2V5AA 3LQQA 3RC7A 1NVAA 4A0FA 2A9JA 1FQOA 1KS9A 4RQBA 5FLXA 2LP4Y 3BICA 1QTIA 4NFYA 5U4QA 1L7RA 2BZ1A 4KYVA 5KNDD 2CYCA 3GLRA 3WWZA 1EI9A 3HCPA 4UOEA 5A3QA 2XD4A 1G60A 1PUIA 4YRBA 4X0EA 3UMVA 1Z5NA 1QDUA 5EPOA 5FUYA 3ZHZA 4D9GA 2N0SA 5KWEA 5KTRA 3KFVA 3T6KA 5A3RA 5L4SA 3IURA 5T6MA 2FPPB 3FXAA 1F0NA 1T8SA 1FYDA 4JGGA 3TOZA 4IRMA 1GGMA 4Q05A 3QNMA 1KEKA 3CCBA 2HAEA 4YAOA 1MB2A 1DCFA 1YRLA 2EGGA 3DUFB 2ZYUX 1T5DX 3VSEA 1MF7A 4IIXA 3QOXA 1WKCA 1JDZA 4JLPA 1QP0A 3K2EA 2C4HA 5AK0A 1KJJA 1RXSA 3CZCA 2R4UA 1TEVA 4H3SA 3SU8A 5AVWA 3BD9A 3PHHA 3MW8A 4BV2A 3UJPA 2FV8A 4A2PA 4AICA 1C3VA 4FI3C 3L7YA 4UVDA 1YNSA 1J5PA 1PQUA 3HZHA 3OTQA 1R5OA 2W2PA 4LNHA 4NS4A 3KJHA 5EJMA 5TS2A 1KQGA 5K3CA 4B2IA 3LGAA 3H3JA 3NP7A 3VR5D 2QW8A 3WP1B 2WIJA 3DXZA 3FGZA 5ITVA 3AEUB 1CRQA 3ENKA 2AHRA 4LNAA 1HFWA 4B4OA 4M9ZA 2Q5IA 1P7WA 4ZVLA 3L43A 3W3AA 3BOSA 1KYTA 3IBGA 1YQXA 3B89A 3VU1A 4A8HA 1XKXA 2R6CA 2A78A 4BEWA 3PEEA 1V95A 3L8HA 2CLEB 1JR6A 1XLVA 4JLWA 3F1LA 5AKLA 1M1YB 1NF3A 4DDKA 3BIWA 1LEHA 3PEWA 2RG7A 2I7CA 5KJEA 5GINE 1OC4A 2IYZA 1VJ5A 3QPDA 1NRWA 3SC2A 1VHWA 1UAGA 3T5MA 4AP5A 5IWAB 1KR5A 5ICMA 4FYKA 4JJIA 5KO2A 3AKDA 3E9QA 1P0QA 3IX7A 2JBWA 4P7GA 3TQOA 4A0GA 3O9VA 1TVKA 1V43A 1QQAA 4EJSC 5JAPA 1GYPA 3I5MA 1N6HA 4GSYA 4D80A 4GIBA 2G9NA 4KFCA 3LK6A 4H7IA 3FZYA 3KL2A 3Q6MA 4FP9A 1P9RA 4J0IA 3ZWYA 4F7DA 821PA 1PP4A 3AVUA 3I39X 5F7XA 5DI3B 1P2SA 4CTNA 1O58A 1OZAA 3IEIA 2ZRIA 1PDWA 4LRSB 1CVIA 1DI0A 4PSAA 1VMAA 3GN1A 4BTVA 3YASA 3QHAA 3KFLA 4B3TB 4CTMA 3LY8A 5KVCA 1I4OA 4BUJA 5KPDA 1X42A 3IQGX 5AI8A 3LCJA 3K09A 3RUPA 1V1MA 3LPMA 3O9MA 5CB0A 1WQ4A 1H2RS 5D3MB 1C80A 1CY0A 1K7XB 1AOXA 3G23A 1SCBA 1XB2A 1H05A 1MA0A 1Z5OA 1NM5C 4MRNA 4N0PA 1HRDA 4URZR 2EW8A 1VHQA 4NCKA 3AM3A 5I9IA 3MJHA 1CUZA 4U2EA 3A9RA 4O3MA 1PW5A 2ZIZA 3KJNA 3AU9A 1DJLA 3G59A 1G64A 3QVJA 1N0HA 1ZYUA 4HGQA 4RELA 2WAXA 3G2HA 2Y9PB 4X92A 4XRRA 2AXNA 3FBTA 4BKUA 1XPUA 4IF4A 2V6IA 4QOSA 4C29A 1ESEA 1FYEA 2C5HA 3IIIA 2PZGA 1GZ6A 1FYFA 2VUUA 4RWZA 1ZI9A 4MWEA 2ZB4A 2XKAA 4I1YA 4P35A 4UBLA 5K8IA 5JJIA 1YS1X 5C8YA 3AB7A 1TJNA 1EVKA 1VLMA 2VHQA 1F9EA 3L8FA 5AW2A 3MD0A 4KXQA 4B5LA 3W5AA 5M34A 1Z0ZA 3STWA 3CMMA 2HMYB 2X5KO 3KLOA 1CUAA 2P11A 3N05A 2VYCA 4FE3A 1F1JA 5AOAA 1QH9A 2B7BA 3OC6A 2QDKA 1GFZA 1M2JA 1E4YA 3HXTA 3OCVA 1FK8A 2XZPA 3EEYA 4NLLA 1L5RA 2PA3A 4RJJA 2OGWA 2VXCA 3C5CA 5BWMA 1JJBA 1SBYA 1V25A 3PX2A 4Y6PA 5H3LA 1CP3A 1A7AA 1G8JA 1N2IA 2EKZA 2GK7A 3H13A 3KHTA 3HDVA 4BNHA 3A9CA 1NW3A 3N0XA 4MUYA 3IR5A 1Q0QA 1YC2A 1AN9A 2KHZA 3EUEA 3PL1A 4MEBA 5LQKA 1K06A 2B35A 3V33A 2GPBA 4QJIA 3V46A 4AIRA 1GZHB 1YULA 4UU1A 1X7YA 2OAGA 1CE8B 1MFZA 2VNIA 1NT2A 4DLVA 2WSYB 2FWBA 3E0XA 3TEFA 2NZ8A 3GLTA 4FSDA 1QYRA 1E7MA 1XJQA 2P1ZA 2QAGA 2VRBA 4LJ8A 4UE2A 5DRYA 4JHLA 4RA9A 2QQEA 3GCZA 1Q2UA 4D7AA 5HQJA 5IULC 3REFA 4S0XA 4XTCS 3DTYA 5J2UB 1GKUB 1Y7PA 3K5IA 4A27A 5CUQA 1VHLA 4OOEA 5ALMA 3H1BA 1YZQA 1S1MA 4TL7A 3UUGA 4IICA 1H4SA 5BSHA 2ZI5A 4F8YA 1JHDA 5K0SA 5G4KB 1KU0A 4GLOA 5SYMA 5AKEA 4M7WA 2KYRA 4RJTA 1R0CA 4MQUA 1WKVA 1KS2A 2QQGA 2RHTA 3D6TB 4FOPA 1GKLA 1UKBA 3QFRA 1KAHA 1VKHA 2Q1UA 2I03A 4R8LA 5ICCA 2CHVA 2ZE7A 4H3VA 1E0AA 3ZCQA 2YOFA 3DGEC 2O8BB 1TFUA 2DBRA 3BE4A 1GG5A 5FWXA 3S2FA 4EJ6A 4F60A 5FNZA 3L6EA 1XFDA 5LP6B 4BP1A 4HEHA 3NFRA 4DJEC 5AM1A 3U9TA 3ZBQA 3M49A 4FD3A 4W7SA 4DCVA 5JS1A 1OAOA 1P33A 3ZS8A 1E2LA 1PG2A 2G5TA 1SUBA 4XSHA 5ALOA 1IVSA 4I0WB 2E49A 1RQXA 5J59A 2BEVB 2V97A 2XBLA 2E18A 2IGBA 1DNPA 3CEAA 2ZIFA 3EVFA 3MTQA 3GIWA 5IVKA 2ZWAA 4YO8A 2PUCA 2D3TA 3SMQA 2OLEA 4QM6A 3O6VA 1UBRS 2RCNA 3CW2A 2VP0A 1JDVA 1BW9B 4DDMA 2WSIA 3EGXB 4TQUS 4JV5B 1XZHA 1R2QA 3QUCA 4C4SA 4IRUB 1VB3A 4PSCA 2O48X 2EC5A 1G6OA 4WOKA 2GI4A 3HC7A 1DIBA 1XOIA 1IIBA 2FEXA 1XMJA 2LKDA 4WZAA 4ZQCB 1LPSA 3WV4A 3KQMA 1T34A 5F3RA 5G0TA 1P72A 4NC9A 1CQZA 5HCUA 3ZIDA 4C4TA 5DNYB 3UATA 4KO3S 3RIMA 1PJ2A 4ZPJA 3THSA 1W52X 1Z29A 3BMXA 4R51A 2ZG6A 4AJIA 4KODA 4RVCA 3L4JA 1MPTA 5JAUA 1XTJA 2G9ZA 2O2CA 4L76A 5TF4A 1WTCA 2AJTA 1XVIA 1E2PA 1NVGA 6Q21A 2ADOA 1RABA 2LCIA 4NATA 1A1SA 3HGTA 1B43A 1GXSA 4RKWA 4TXHA 3PWSA 4ENTA 1K3UB 2O8FB 4ESEA 1E58A 5JT1A 3DLCA 1GL6A 2ODEA 3D4OA 3Q6IA 1F06A 3LYLA 2NUPA 3QE3A 2RD2A 3PFBA 1KYZA 1Y37A 3B36A 3L8EA 3DEKA 4UCWA 1ZRHA 3T3MB 3U0BA 1I10A 4TXLA 2HK9A 3HACA 4H6WA 4R31A 4EFKA 3SSOA 3SX0A 2FMKA 4CETA 2ZUUA 1VG0B 4Q4DA 2DC1A 1L4HA 1I0IA 4BWVA 4IILA 4Z9AA 2FZGA 2BEUA 2QXYA 3FB4A 1Z7EA 4NXNB 3CGGA 3K96A 1F9AA 1OIVA 1X7WB 1ZUHA 2IX9A 4B6SA 2JARA 2IITA 5JNWA 2XB4A 1V9LA 1KYWA 2AUMA 5B6IA 3NJRA 4QDOA 4H60A 3ETLA 3PUJA 1UT6A 2GUGA 5CA1F 1TT5A 5AKJA 4NONA 2ERCA 1E4EB 2FLVA 4RHYA 1UKVY 5G0UA 3T5CA 1M2FA 1W88A 1Z6PA 1UJCA 2Q4OA 5JD3A 7GPBA 3EQZA 2JGIA 4GXQA 5IC6A 4TT3D 4C0XA 3EPHA 3DV2A 3N6VA 1PZFA 3TJRA 5CB6A 4CZ2A 1GZ5A 1ZM3A 2PMDA 3DBOB 1GRCA 5HYVA 4MCHA 5JPDA 4L6IA 2FSVC 3QYPA 1UBKS 4NYJR 4ZVQA 4L74A 3W6ZA 2WP0A 4HMQA 2V9PA 2DFTA 4IZOA 3HUEA 5C35A 5AOBA 1GPDG 3HCCA 3JQQA 5DISB 2C1XA 4R0MA 3O1LA 1VL2A 2BEVA 5WRFA 2LZ0A 1A5AB 2P9QA 3ZUGA 2BRUC 3CWZA 3D4LA 5KPJA 4LVUA 3TTSA 1OQAA 3AIKA 4R40A 1BW9A 1LKZA 3EGXA 1E8NA 1II9A 1ZUWA 2IY8A 2JW5A 3O95A 2ZRJA 1AQLA 3I5AA 3VRHA 4HVLA 4RIHA 5K99A 1CUIA 3SIRA 1IRXA 4RADA 3ODGA 2PEYA 2J48A 3UJ9A 2IZ6A 2XVYA 4QREA 1G2PA 2ZYGA 1W1WA 4NQZA 5ER6A 4CEHB 3GDHA 4D3SA 2HY7A 4NJMA 4RZHA 3I92A 4TWJA 3ZYZA 2R97A 4MUJA 5EWMA 2HMTA 3CNLA 1FXUA 4XKJA 3DEJA 3HB0A 4JEUA 2P2YA 2CFOA 1FFAA 3SM3A 2C92A 2GN2A 2JIZD 1Q83A 1AY0A 1GCAA 3GT7A 4JB2A 2ISCA 2VAPA 5DMXA 2AJCA 3CX3A 3L41A 1SUEA 3VPAA 2VTDA 5LLSA 3KOUA 1GSHA 2J45A 4YJ3B 5HG0A 3ZDQA 2X8JA 1SVOA 3CJRA 1M2OB 5L7WA 4ACBA 1FOEB 2VJCA 3H8JA 4LJ5A 5F2OA 3DZFA 4ASUD 3KE8A 1PJ3A 2CE7A 3ZHOA 2I54A 1JF8A 4DM3A 2B5OA 3A3NA 4CLRB 3UBMA 1L4MA 2BTQA 3HXLA 1QQBA 5B3JA 2JHGA 3D3KA 1Z0FA 1Q1QA 1SZJG 2GBIA 2WICA 2XNSA 1XXLA 2CK3D 2I3DA 4E51A 1PT6A 4FHDA 1TYDE 1UM9A 2D7JA 2XDYA 1S8NA 4I50A 4ZVRA 1KVTA 2BGUA 3ESYA 3O7WA 4UMEA 1UWCA 4DR6B 1VA5A 1SM4A 3ROKA 3C2QA 3QLJA 3IGFA 4ZA2A 1Y4AE 5G0VA 3GVXA 1CS0A 3OKCA 4MB0A 1KQFA 2QVGA 1SG0A 3A2LA 1BFUA 2QM7A 4O25A 4QGSA 1QUEA 1UM8A 4FE7A 1AO0A 4GVXA 4I08A 1EFLA 1H5NA 2OBXA 4B3RB 4POOA 2D8MA 1CRLA 3AP2A 4EGQA 4ARIA 1NSFA 1ADBA 1NP6A 4IVPA 4D41A 1IN7A 1C9KA 4WZBE 2Z8YA 2LBPA 3E3MA 3CX6A 4WSOA 2JAPA 3TIVA 4ZYWA 1N4DA 1JPNA 1T8YA 3PGJA 4HDKB 3LKVA 1A7JA 3LPDA 3M5DA 4QTYA 1OXXK 2C04A 3GLGE 3FJ1A 5BT8A 3IAEA 3SQXA 4UVIA 2R44A 5ILOA 3Q12A 5KTYA 1GFWA 4BLWA 4HQKA 4G0NA 4IAOA 2P6RA 2JZCA 1SRQA 2PV7A 3ELBA 3IV7A 4Q6WA 3I28A 3WB1A 2R5FA 4EECA 4ROTA 1C3LA 3D54D 3R75A 1UMDA 3DT8A 1L0BA 3FYUB 3IFSA 3CF0A 3PZBA 1OFIA 1AIPA 1RMTA 3OZBA 1U0GA 1RWMA 2WKWA 3E03A 2BMAA 5FBVB 1U3WA 3PRYA 4HFJA 2H8KA 4NE2A 1BE6A 1RKXA 2ZKLA 2ZWMA 3EEFA 4B84A 1UPCA 3ZGYA 1XA3A 1PBTA 4QOJA 5TQ0B 3CZQA 2KX7A 4HB4A 1JEJA 4Q9AA 5HCIA 3HSKA 1MZPA 5BV8A 2F8TA 1NI4A 1SK8A 5A4FS 5K20A 2ZXEA 3EZ2A 4LJSA 2PY6A 3CO5A 4MW1A 4AMYA 1ENPA 2JBAA 5I4KA 3RQIA 4AKGA 3GRAA 4UPDA 4XARA 2J7PA 5JNVA 3LC1O 4CV0A 1BZYA 3TXAA 2WHYA 5FP0A 4Z9FA 4KOEC 2B1GA 2GCNA 2WJZB 2YQ4A 4FDAA 2ZJ8A 4MO9A 4XQ9A 2GFIA 2MHCA 2VHYA 4A0QA 1RWXA 1SEVA 4O5OA 4C05A 2C5EA 2ZJ1A 4DYVA 2UZ3A 2D2VA 2ZBDA 4KK3A 4CODB 4EAQA 1WXXA 2RJOA 4ENQA 5C37A 5ICFA 4RFSB 4YP0A 1Y8QA 2I80A 3Q72A 3EEBA 1E2DA 4RMHA 3R6DA 2J46A 3FNRA 4YJ3F 4DCTA 4V39A 4V3BA 4R71A 3UIEA 2C00A 4L7QA 3VTKA 4ZRNA 1CZOA 1Y7TA 2A57A 2RARA 4RK6A 4O6VA 2AJBA 3PE4A 4HAOA 5HM6A 2VC2B 3HMKA 3Q5DA 4C89A 2EXXA 3IE0A 2V98A 4H0FA 5FUVA 3RD5A 1AO3A 1KK1A 1ZCFA 1F6BA 2AMFA 2QD2A 3B1FA 1RTKA 2IYPA 5JZSA 2VJNA 4PBSA 3ZKWB 1CRPA 2GILA 5AKYA 3GFGA 4BVFA 4G0WA 1MC1A 3ZD9A 4R9UC 1XNQB 2KSQA 1ONNA 2HIGA 5GVSA 4GOND 5C8XA 3M2TA 1L6RA 5HMLA 1TD9A 4JWTA 5D86A 4BTEA 2J6HA 2PD6A 5FUXA 4DGSA 3F71A 1IH8A 4EGFA 5KYNA 2CUZA 4N5HX 2Z2IA 3GEDA 4W6ZA 4IZ6A 3SQWA 3ZQKA 1L1EA 3H8SA 1N3LA 4HDKA 4DVGA 4WINA 3OESA 3H75A 5CM2Z 1WD7A 1U7WA 1NVWQ 2RGYA 4B4DA 1DXQA 1WUKS 5E7MA 4EX6A 3GLIE 1L7EA 2FH5B 1Z4KA 1EWVA 1VJ0A 5I7AA 1HY3A 2E4XA 1KE1A 3WE7A 2QQ0A 3R6GA 4KGDA 5IM4F 3QUBA 4HAWA 3LXUX 1ES9A 5KEIA 4QTXA 4YMSA 1VL6A 2F64A 4QTTB 2G17A 1RQLA 4UD6A 1Y1KE 3GDOA 3FYUA 1HE3A 4RD4A 3V1KA 1LPBB 4EL5A 1NXPA 1J70A 3QELA 4OMFG 4QD3A 5EPUA 1Q22A 3DW3X 4HNUA 3Q3IA 4FMCF 2G7MC 2PWAA 3WRWA 1AS0A 4HDMA 2B1IA 1VXOA 1DE0A 3AVYA 3LECA 2I7VA 1RLOA 1UH5A 3C5EA 3NPAA 1EM6A 2NZ2A 5AH0A 4BP9A 1NBMA 1AKQA 4COKA 3B6MA 4A7PA 4B79A 4JI8B 1W73A 3H86A 3G2NA 3M3HA 1QYDA 4PE5B 1XZIA 3IBYA 1GGFA 1UDWA 1O0CA 3HZOA 1JAIA 2P9EA 1BVHA 5EQDA 3H1TA 1NOJA 2GXUA 1BQ4A 2FKAA 4OD0A 4YRNA 4H4DA 3VR4D 4C20A 4RGQA 2VDJA 1XDUA 4YUWA 1YCHA 3JASB 4LRWA 3UAYA 4U6QA 3URMA 5IU6A 2Q6KA 2NNWB 3C14C 1DX4A 2XCOA 3PR1A 4QARA 4MWZA 1ESDA 4JJ7A 4LDRA 4PXSA 4R5HA 3JAKA 4RFSA 4TTSA 1X3LA 4BU1A 4J0HA 4QE3A 4H6VA 5FYDA 3AUUA 4JC4A 2P5UA 4U2GA 1P9NA 3K15A 2JLXA 1XBTA 2ZUSA 3DMFA 3JATA 4ZAXA 4P31A 3W2TA 2IW1A 1IJBA 3VPHA 1V6AA 2QJTA 2ZBRA 3G2OA 3HI6A 3IOYA 3L2OB 5BMOA 3IHLA 4OM7A 3CN9A 1EA5A 3PXDA 4KV7A 1C29B 3OOSA 1Z38A 1GOTA 3IOBA 1B8VA 2ZYDA 5EVCA 4ZCRA 1SN7A 3G2PA 4MTLA 4R68A 3ZQUA 4PX2A 4YCMA 3WADA 4CKWA 3ZKWA 3SK0A 1OYWA 2FRXA 3AJ8A 4UMDA 5DM70 3GEGA 4GKVA 1B8OA 3ERCA 2OWEA 4EGJA 4E6PA 2I3GA 2W0SA 2Y6VA 3TCNA 4CLDA 1KH2A 3OUZA 2R8XA 3KUDA 4Q03A 5AW0A 4KSBA 3AEQA 2CVZA 3DTTA 5FBLB 5J43A 3DHWC 3EARA 1UZMA 1L3CA 2OCXA 5K05A 2JLUA 4CWAA 2DTDA 1IXZA 2CXXA 3CX8A 3BILA 4Y8VA 3S55A