5KKCA

L-lactate dehydrogenase from rabbit muscle with the inhibitor 6dhnad
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
331
structure length
328
Chain Sequence
AALKDQLIHNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase A chain
publication title Ligand binding phenomena that pertain to the metabolic function of renalase.
pubmed doi rcsb
total genus 112
structure length 328
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5kkcA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5kkcA02
4ZD6A 1E6UA 4NI5A 3NKLA 4INAA 4YCAA 3N58A 3GRPA 1PJBA 4IDCA 4RLSA 1XELA 2FMUA 1U7HA 2JFHA 3G17A 3CUKA 1ARZA 4J7CA 3QA9A 1U28A 3C1AA 1IHYA 4JNKA 2QG4A 3KYDA 5CP8A 2D8AA 3VH1A 1ZIDA 2GNAA 3PYLA 3BTOA 4RLHA 2NU8A 4QO7A 4ALJA 1MG5A 2RHCA 3VPSA 1HZZA 4BO0A 2CF6A 5DCWA 1N8KA 2X86A 3JD3A 3PWSA 4MKZA 2BELA 4TZTA 1NQAO 1T1RA 2LDXA 1NFQA 3HZZA 3PIDA 5A1TA 1LA2A 4NJOA 3ZWBA 3BMCB 1AN9A 1XHLA 3JQ9C 1GTMA 4IQ8A 4XYMA 4HFRA 2IZ0A 1W8DA 2XPCA 1BTOA 1E3JA 5MDHA 1HZJA 3GHHA 3K8ZA 4GVLA 5I9NA 5T5QA 4DBZA 1C0PA 1GD1O 2YDXA 2DM6A 3TPCA 1PGNA 4BS9A 4EUEA 5ICSA 4WE3A 2BI8A 3RBXA 2HMWA 3FTPA 3AI2A 3ETDA 3Q1LA 3JQGB 4KTTE 5GY7A 4M54A 2B5VA 1SMKA 3H9GA 4YQZA 1ISHA 4E5NA 3VKVA 5G2OA 4O6VA 1E6EA 2IXAA 4MVJG 3DOJA 4EEZA 4GX2A 1N9GB 4YJHB 4AJ1A 3ZV4A 1D1TA 2DTEA 3L4BC 3ZHZA 1BSVA 5I9MA 4D44A 5L7TA 2B5WA 3JQAB 3SBOA 2VHWA 5F1OA 3N74A 3RFTA 3ZW9A 3I83A 1NBOA 4HWKA 4I5GA 4JGBA 4BNTA 1QYDA 3MJEA 3D64A 1M2WA 4FC6A 3RUHA 1E7MA 3I9LA 1BW9B 2OZPA 3OETA 3U4HA 3V1YA 5BQFA 1LJ8A 3QWAA 1T26A 3QVOA 2PK3A 3RBVA 1J0XO 1I8TA 3RJ9A 1KVQA 1E7QA 5IG2A 1YL5A 2Q1SA 5T8KC 1YL6A 1SNYA 3I9MA 3VPGA 3WIDA 4HUJA 1I36A 3TNLA 4YQYA 4CV0A 4IIVA 1ZEJA 3HNPA 3LT4A 3QJ5A 3ZN2A 1XR3A 1EBFA 4GL4A 3U9LA 4IJKA 1Y9AA 2AQKA 1VL0A 4ZJUA 2UYYA 2V65A 1PEDA 2J6IA 4E2XA 1AHIA 5MGBA 3QVTA 1QR6A 2RH4A 2JAPA 2UUPA 5DBGA 1GQQA 2CSUA 3S8MA 3TRIA 3DEYX 3VOSA 3JD4A 5U4QA 1RYDA 1GUZA 2GDZA 1JKJA 4OSOA 3IQDB 1YQDA 1VPDA 3GQVA 1DAPA 3OM9A 1M67A 4CLXA 5IZ4A 4B8WA 1KBZA 4L4RA 1X7HA 1PTJA 2O4CA 5BNTA 2HUNA 4R5HA 4RJTA 4Z0TA 3MZ0A 5JNLA 4B7CA 3JD1A 5IZCA 2X8LA 3L4SO 4WLVA 3D3WA 1AE1A 3MCVA 4KDFA 3SLGA 1UZLA 5CEJA 3WQSB 4WLEA 5JSFA 5G4KA 5COQA 1JQBA 1NYTA 5EIOA 3H2ZA 3OJLA 4BKUA 1HXHA 5BSFA 1VKOA 5TGDA 4FJ2A 1NX6A 2AEFA 2NVBA 1U8XX 2PLAA 3L6DA 1AXGA 5FI3A 1E1NA 2X1HA 2TMDA 2VT2A 3FPCA 4LMPA 1YS4A 3DL2A 4UUNA 2WYVA 1R0LA 4IDDA 4AJHA 3O4RA 1P1IA 4EUHA 1GV0A 5B37A 1ONOA 2R6JA 1XDWA 3KBOA 4YT4A 4PRLA 4IZIA 4CM1A 1GDHA 2JFGA 3WGGA 4ZQFA 4DLAA 2V6BA 3KRTA 4EITA 5CDYA 4B4OA 2PZLA 4B7XA 3D3EA 5EINA 3QHAA 1P1FA 3I1JA 5DNAA 3LLSA 1RM0A 4E6PA 2HK8A 3MJTA 1PU2A 3A06A 3ADOA 1JDJA 1R4MA 3QLJA 1O94A 3K92A 3AOEC 4MIOA 3VZRA 3DZBA 4GGOA 2O2SA 2QZ9A 4TZKA 1QP8A 1NAIA 1IPEA 3PHGA 3O03A 2VRBA 1FK8A 3H9QA 4TSKA 2BLLA 1UXHA 3C7CB 1MUUA 1YJ8A 4B7UA 4R9SA 3W6UA 1U2GA 3T7CA 4ZICA 4X54A 1T4BA 4HY3A 3ROKA 2VNSA 3AFNA 4HFNA 4PLHA 4P4LA 5CPBA 2X0NA 4CQLA 3UAGA 3MTJA 1MP0A 3VTZA 3PDUA 5C7OO 3MJCA 4XQGA 3S2EA 3ANNA 1LTHR 1E7RA 3R3JA 2OHXA 4ZN6A 1L7EA 2YV3A 3DAGA 4KZPA 4K28A 4OMUA 4TQGA 4CM8A 2DLDA 3GGGA 1ZK1A 1YDWA 3FTNA 1R0SA 2Q2WA 3M2PA 4P38A 1CEQA 4CLOA 1YJQA 4BGEA 3GH3A 4JBIA 4WLOA 3WGZA 3RKRA 3I4FA 3TFQA 3ZWXA 5JMPA 4PLVA 1PR9A 1MX3A 2A4KA 5DP2A 1EMDA 3TOZA 3RC2A 1ENOA 5L45A 3UKOA 4RPGA 3WSVA 2HMTA 2IODA 4OKIA 1T25A 3ZV5A 4ALMA 2YYYA 4E3ZA 4J1QA 1A4UA 2X6TA 2ZTVA 4Y9DA 5JBIA 3QVXA 5JYEA 1VE9A 4BNNA 5IF3A 2JFFA 1PR3A 1KC3A 4NDNE 3HDQA 3ZWYA 3ULKA 3KYDB 4BO7A 1YH3A 2IYPA 2UDPA 4AJ2A 3RU7A 1VM6A 3GPDG 3G1TA 4J6FA 5DOZA 2VYVA 1L7DA 3FBTA 4GSKA 1SPXA 4E0BA 4RORA 4CV2A 4PG8A 1GPJA 3VZQA 2ZIZA 3VVCA 2DVMA 4BV9A 1HWYA 3DXFA 4Z0PA 3FSRA 3OIGA 4BQPA 3ZI0A 4KMSA 1HE4A 2ILTA 3I9NA 1O6ZA 3BMQA 4D0SA 5TT1A 2PGDA 4D46A 4J0FA 3U09A 3I9JA 4Q3BA 1HYEA 4Z0HO 1CJCA 1Y8RB 4WGGA 2B37A 3C7AA 3EK2A 5T57A 5G0UA 1I01A 1U8FO 3KSUA 3WGHA 2JD0A 2P4HX 1XU7A 2QX7A 5JLAA 2X9GA 4R9RA 4IDBA 2PH5A 1NQ5A 4U8GA 2DT5A 6ADHA 1YDEA 5ILGA 2QQ5A 4RL6A 2HMUA 2GZ2A 5I8WA 3MTGA 1UAYA 3JQFA 3CTMA 3BAZA 1JU9A 3FN4A 1HSZA 2IYOA 4KUGA 5B4TA 3BIOA 1GYRA 4TRRA 4YYZA 1WNTA 4BO3A 3ROMA 5TRTA 4DVJA 4FFNA 1FF9A 4JROA 2YHIB 3FNEA 4XJTA 4CMJA 4EDFA 5A5EA 4U6SA 1Z73A 1AHHA 3WJ7A 1NTOA 2WM3A 1OC4A 3JQFC 3SVTA 1I10A 1V6AA 1WMAA 2BFMA 1NM5A 3CXRA 2B36A 3H65A 3LQFA 3I9OA 3CZRA 1UUFA 4HNHA 5DULA 1DAOA 1LC0A 3R3SA 4PFJA 1EQUA 1UH5A 4XKJA 5I7SA 3GNSA 4OXYA 3E9NA 4IIUA 3RAJA 4FGWA 3FRJA 4PIVA 4ZQEA 2AA3A 2EF1A 4GKVA 1T2EA 4A73A 1NNUA 4IJVA 4J7XA 2I3AA 3GG2A 2OOSA 5G0WA 1PX0A 2YDYA 2O2YA 1C0KA 3PHHA 4PRKA 1T2DA 1B0AA 2R2GA 1X14A 5IN5A 1AXEA 4RO0A 2ZK7A 2NNLD 2PD4A 4CM4B 1LSOA 5F5NA 3UH1A 3VAZA 4GSLA 3GOHA 1NFRA 2AXQA 3GPIA 1B8UA 1V9LA 4NMHA 4E21A 5DF1A 3ASUA 3KYCA 3F46A 4BO9A 1P44A 4PVCA 5GZ6A 3OEWA 4YEDA 1H6DA 2ZJ0A 3GVXA 2AW5A 3F5SA 1GQ2A 5I7FA 2UUOA 3G49A 5BSEA 1E77A 1KVSA 2Q50A 3UVEA 4MVJP 2FP4A 4CM9A 3AI1A 3E9QA 1ENYA 3W8DA 3D3WB 4CQMD 4KWHA 2V6FA 1Y5MA 2NTJA 2GZ1A 1LQUA 5G4KB 5JDIC 1DIGA 1G1AA 4WOJA 1C1DB 5KKCA 4B4VA 1B7GO 2DTDA 4AJOA 5BNFA 5FWNA 4Z9XA 2YQ4A 4BL5A 3ITKA 1LRKA 3OJOA 3S2GA 1DBVO 3GVHA 4MP8A 2RIRA 3EY4A 2H9IA 2FR8A 3DAPA 3OJ0A 1YO6A 4IINA 4F6LA 3SC4A 4LCJA 2W2LA 2Q3EA 4ZA2A 5T64A 3NAQA 4XYBA 1VJTA 1MG0A 3P7MA 3D0OA 2C07A 4J2OA 4R54A 3BXXA 3E03A 2HJRA 2JD2A 5JDCC 3BMOB 2VTEA 2VHXA 4YA6A 4RVGA 3LLVA 7ADHA 5KCZA 4IS3A 4MIYA 3JYOA 4CR8A 3KZVA 2NVWA 1CWUA 4A10A 1G0OA 2O50A 5CEFA 5DT9A 1R4MB 3QIVA 4XRRA 5IN4A 3KSZO 3UUWA 5JS6A 1I2CA 3D4NA 1W73A 2HMVA 4GGPA 2PGJA 3PYMA 4II2A 2EWMA 3CH6A 3PHJA 1OOEA 2CF5A 5EQFA 3RCBA 1ORRA 2J5QA 1SOWA 5C7LO 3UCFA 1B16A 4EBFA 3FNGA 1DIBA 1ZK0A 3MOGA 3ZNPA 3IMFA 4ALKA 2J3HA 3OSUA 4Q39A 4Y67A 3NTQA 1GR0A 1I0ZA 3TZCA 3GLQA 4WCDA 4UAGA 1F8FA 1HDYA 1JVBA 3GFBA 1DPGA 2EJVA 4WNCA 3Q9NA 3DOCA 1U9JA 4MDHA 3E5RA 1VJ1A 4MJLA 4JP3A 4CM8B 4MVJM 3PRJA 4CV1A 1YWGO 4JXKA 4CLOB 5ITWA 3UOGA 4HXYA 5JY6A 3VPHA 5JMWA 3F6YA 1D8AA 3D4PA 4O0LA 3NT2A 1DIHA 4QECA 3GMSA 4QO8A 3DO5A 4E5KA 4XIJA 4LW8A 3V1UA 4Y6PA 1N92A 1KS9A 3U4CA 4Y6SA 3ZWWA 3PTZA 1P1HA 3W8FA 2F00A 4AJJA 3GG9A 3GA0A 5HBRA 1CETA 5H83A 1Y8QA 1EVYA 3DHEA 4PLGA 1A7AA 5KJFA 5K6AC 5DZSA 4GLOA 3WMXA 1IUKA 4HP8A 1GYQA 4OIMA 4MO2A 1VSUA 4DXHA 1PGQA 3WQRA 2X9VA 1VC2A 5HS6A 1NFFA 2BHLA 3GDOA 4OSPA 4DIBA 2DUWA 3QQPA 1E5LA 1P0CA 1JN0A 1SC6A 3DAFA 4HBGA 5JC1A 1UDBA 3EYWA 1UDCA 5DDIP 3DWFA 2FPIA 4MPDA 2PZMA 3JCZA 2PY6A 3ONEA 4FR5A 4XJSA 4EEXA 4AVYA 3BMQB 5L9AA 3ASVA 3BHMA 2EKPA 1WVGA 1DJQA 3E8XA 3NJ4A 4GWGA 4M1QA 4PZCA 2D5AA 2O23A 3DQPA 1ADGA 1BHSA 1DB3A 1Y1PA 2GCGA 3NUGA 3DBLA 2I76A 4TKMA 2B4RO 2VHZA 1X7DA 4BGIA 5TSDA 4O1MA 3Q6IA 4D42A 1ONPA 2IDZA 1BVRA 4BKRA 4R69A 3DB2A 4E31A 2I99A 4YXFA 1GAEO 1GCOA 5ER9A 3NGXA 5AQ1A 3BTSA 1LNQA 1XQ6A 2Q1UA 2V7PA 3NRCA 1ZXBA 4PG4A 2AHRA 1H93A 1E6WA 1N1GA 3G3EA 4BOYA 4IXWA 4XYLA 5B1YA 5I7EA 4LVUA 5A05A 4YTEA 5CFZA 1PZGA 1PL7A 2EGGA 3GMDA 3M2TA 2NTNA 4B3HA 4PLZA 3MOIA 4R01A 2CUKA 1FJHA 2YZ7A 2WYUA 5EN4A 4DIOA 1T2FA 1PQPA 4R4JA 4BMVA 2BGMA 4TWRA 4FSHA 4R5MA 2DPGA 4EUFA 2VTDA 4K9DA 1MGOA 1RKXA 4XB1A 4OXKA 1HEUA 3JYLA 3X2EA 3ZU4A 3ROPA 2D0IA 3UHAA 1Y9EA 3V2GA 1WW8A 4ZQHA 1X13A 3ZWOA 3COSA 3LDHA 4YT8A 5EMHA 3GHYA 1Q0HA 5TJHA 1R16A 1NAHA 2P2SA 1H9AA 3NGLA 4RPJA 3TJRA 3TL2A 1BDBA 3B20A 3ST7A 4M49A 2NWQA 4FDAA 2DC1A 4PLWA 2DBQA 1ZBQA 4J9VA 5JCJA 4IJWA 2BFPA 1E5QA 1EVIA 3PJFA 4Q3DA 3RUAA 3O9ZA 3JYPA 2VOEA 3WXBA 2WWRA 4CMCA 2WSBA 2P5UA 1DHTA 1CERA 2J3JA 1R0KA 2PKQO 1PSDA 3QV1A 1PZHA 2EKQA 1ZH8A 3KYCB 4OQYA 3JQ9A 2X22A 3GEMA 1QV7A 4BVAA 3KB6A 2WTBA 3R0IA 1P9LA 3AWDA 4ONEA 4LRTB 1UJMA 3KV3O 4CL8A 1LUAA 4UEJA 2HJSA 5F5LA 3JQEA 2X5OA 3JQDA 1DFGA 3GT0A 4A03A 5FYDA 4JX8A 3V8BA 4R16A 1QORA 2JCVA 2POQX 2P9CA 4PG6A 1YL7A 3HADA 2EV9A 2E37A 2NTVA 4FCCA 2PD6A 4F46A 1NR1A 3C24A 3CKYA 1ENPA 2ZB8A 3GDFA 4Z9YA 4CL3A 1HETA 2BFAA 4FOSA 5HWSA 2EXXA 2P9EA 4B3IA 2VT3A 2NADA 4C4OA 5CDGA 5CEEA 1C1XA 2VZ8A 1Y8RA 3NTRA 5JY1A 2Z95A 3LU1A 2IEDA 2VWPA 3C1TA 3NV9A 4IUYA 3L4BA 5B4UA 5JO9A 1M6WA 3WSWA 2Y1CA 4R1SA 1X1EA 1ZMTA 2Q1WA 2OP0A 5TF4A 5JFOA 4A5OA 4PCVA 4YAEA 1JVSA 1O8CA 3JQ7A 3LSYA 4NBRA 4RVFA 2E4AA 4XGIA 4EI2A 3GAZA 2Q2QA 1BG6A 3JQBC 5HM8A 1LC3A 1T2CA 4QT0A 2OMEA 3ABIA 1GV1A 3JYQA 4TRNA 4NNJA 1ZMOA 4E30A 1ZUD1 4YAIA 2Z1MA 3HN7A 4W82A 2YHIA 4RVHA 5T8KA 2PWZA 2I65A 1PL6A 1WDKA 1T4DA 4QSMA 3PP8A 2UV8A 1SCUA 3KXDA 3WGQA 5KWEA 3HFGA 5CDSA 4CLDA 3HUDA 4RF5A 1U3UA 5AXAA 4ZHSA 4LK3A 5A9SA 1SZJG 1ZW1A 3NX4A 2P9GA 2I9PA 3OQBA 4KTVE 2B69A 4Z9FA 1YKFA 1TA4A 4WLNA 5U1PA 5L7WA 4CPDA 1GU7A 2I6TA 1V3TA 4LRSB 4JBGA 4K1LA 5FEUA 2BI7A 3AM4A 3GZ4A 3BMNA 2GF2A 1I2BA 2PR2A 4L9RA 1HL3A 2CVOA 4E5PA 1VI2A 3IKTA 1M76A 1YQXA 4YJDA 4DPMA 3WBFA 1Y81A 3CE6A 3UFXA 2OL4A 3PQDA 4OOEA 4JK3A 4JN6B 3GUYA 3ORFA 4OH1A 5B12A 4WUVA 1BVUA 1PJLA 2JHGA 2A92A 4N5NA 5IDQA 3F9IA 4CM4A 3IC5A 3SXPA 1EDZA 3IUPA 4F3YA 2BMAA 1EVZA 4N7RA 4WKGA 4NJMA 3Q2KA 1WPQA 3GC6A 3C1OA 4IDAA 4BO8A 4G2NA 3SEFA 4NU6A 5L40A 5FI5A 1ENZA 5KVQA 4YPOA 1E7YA 1Y8QB 1UXJA 2WMDA 4A27A 3LZ6A 3FCOA 3PFWO 1ISJA 2FR0A 3PPIA 5JE8A 1J4AA 3BYZA 1BWSA 1GZ4A 2H1SA 3PYXA 4XR9A 1WAMA 1I2ZA 1PJ3A 2GN6A 5ICMA 3PK0A 4XA8A 4HV4A 2YY7A 2CVQA 3HFSA 1YRLA 2PH3A 2NACA 4EZBA 4B3JA 1YOVB 5DP1A 2VHYA 2E6UX 1DEHA 4ZRNA 1XQ1A 2IZ1A 2H6EA 4QXMA 1C1DA 3V1TC 3WNVA 2HAEA 1P33A 3U5TA 2JKVA 2W98A 4YRDA 1D3AA 3F47A 4RDIA 2C20A 3A9WA 3H9EO 4UUMA 3WJAA 1PS0A 1G0NA 1Q7CA 3IDSA 1KYQA 1LXCA 1H2HA 5L95A 3HDHA 1E92A 2DQ4A 2EIHA 1EFLA 4CUJA 2CD9A 3AOEA 4DTIA 3AY3A 4BGUA 5JCJD 2HQ1A 3DZGA 4HADA 1OC2A 1EK6A 3VKUA 3WB9A 3U4DA 2CDAA 3BMOA 1HLDA 1S6YA 3DBLB 3JTMA 3OQ6A 4CR7A 4Q3CA 1GADO 2CDBA 3ONDA 3Q9UA 5TT0A 3M6IA 2NSDA 4YWJA 3DTYA 1RJWA 1SBYA 4OM8A 2QZZA 3UF0A 3DMTA 3IUSA 3TOXA 4ALLA 2FOIA 3HB4X 1ZK4A 3H2SA 3H9UA 4XIYA 1ZKMA 1VL8A 4OHUA 1GYPA 4YR9A 1PGJA 1SEVA 3MWDB 3EC7A 3HE3A 5CAEA 4MVJE 4D45A 2YHUA 3NJ8A 3TN7A 4MP3A 1N7GA 4NBUA 4OAQA 4AJEA 3DMTC 1JW9B 4FFMA 2WD7A 5A9RA 2Y1GA 3UXYA 4CQMA 1P77A 1QKIA 4E2YA 3ROQA 3DBHA 4DPKA 4MVJD 3JSAA 4RDHA 1ZSNA 5U9CA 1TT7A 2GSDA 1E3WA 4XX0A 4RF2A 1XKQA 4ND1A 2D2IA 3ANLA 2Y1OA 3FWNA 5KJCA 3KLMX 4MOWA 1DO8A 4D41A 2ZCVA 4GAEA 4DPLA 4NHEA 3GGOA 3EAGA 3ZWAA 1QYVA 4XWYA 2X0JA 2V6GA 3KOUA 4BNKA 4IBOA 1KOLA 2PD3A 3I5MA 3H3FA 1QMGA 3GN2A 1KEUA 3KSDO 2SCUA 3S2IA 4ND4A 1IZ9A 5ADHA 2HU2A 3RC9A 3RQSA 1ML3A 5L4LA 5A06A 5H82A 2NVUB 1ISFA 4EJMA 1PGOA 4ITUA 2DBZA 4OKNA 3TSCA 3S2FA 3FBGA 3ZHYA 3GFGA 1HDGO 1UP4A 3LVFO 1SB8A 3OICA 1NVMB 4RVUA 1GY8A 3WDSA 4GWKA 4J4BA 5JO0A 1E3IA 1Z75A 4CMGA 4XDYA 4A7PA 2E48A 3VHRA 1MFZA 3OJFA 6LDHA 1UP6A 4I9NA 1LEHA 4LMRA 2ZTLA 5F1KA 3KTDA 4PLCA 1XYGA 1PJCA 1YBAA 2FPPA 4QEDA 1QSGA 4YT2A 1J6UA 1Q7BA 3D5TA 5C3MA 4HNGA 1PJSA 4U0JA 1C1XB 1ZSVA 2HRBA 5JC8A 1WDLA 3GVIA 4NIMA 3D5QA 3AUSA 2FZEA 2PZKA 4RQUA 4YBZA 3S55A 1BXGA 3L9XA 4XD2A 4BNMA 4IDGA 5I8ZA 1U4OA 5AXBA 1ISMA 1OFGA 2H63A 4L4XA 2FSVA 3WLFA 5COBA 2RHRA 3E5MA 4D43A 1GZ3A 2O7SA 3AI3A 3JQ7B 4MIEA 4CMEC 4J49A 2W2KB 3A28A 2GN9A 2Y1EA 3G79A 2C5EA 3RI3A 2X23A 2Y99A 1GQYA 4BNUA 1N2SA 2ZATA 3P2YA 2ZYAA 5DBIA 2OGUA 2YV2A 1R4NA 5JAIA 1E1KA 5BSGA 3K96A 4CV3A 2G1UA 2ZYDA 4RVDA 3ZU2A 5KIAA 4AFNA 4O59O 3NDRA 5HS4A 3HDYA 2GGSA 2PV7A 2YW9A 4G5HA 1GUFA 4BO4A 1Z74A 3T4XA 5A9SB 1E0DA 4I8XA 1YGYA 3PHLA 2GN8A 3DHNA 4CMKA 2BRUA 5LDGA 2ZQYA 3ON5A 4KDEA 4RGBA 4WJZA 4DYDA 4N5MA 3ZU3A 5EERA 2RBEA 4FFPA 3NT4A 3BMNB 3WS7A 2UAGA 1TI7A 3AU8A 4YJFA 3RC1A 3VZPA 5JAMA 1LU9A 3H5RA 4IGEA 2XXBA 3WTBA 5KVSA 5ILOA 3RROA 4WECA 4JJFA 3L6OO 3TL3A 1A27A 1Z82A 5GZ3A 3WGIA 4J4TA 3G0OA 2WE7A 2GO1A 2Q4EA 2Y67A 3ZWVA 2I5PO 3DZJA 4UVGA 5LC1A 8ADHA 2NQTA 3OMLA 4LGVA 4RVSA 4ZQGA 1X15A 4NJMB 4CMAA 3AY7A 5JDIA 4GX0A 1EEHA 5HA5A 3GF4A 5TC4A 1QG6A 1UAGA 4DWVA 2P91A 1TVEA 4OO3A 3VPXA 4Q3EA 3AU9A 2HO5A 1B26A 3I3OA 4RPLA 3U62A 4BNXA 1D7OA 2IRWA 3AJRA 3Q0EA 4Q9NA 1HDZA 4U5QA 1NVGA 1EZ4A 1B8VA 1P0FA 4CM6A 4GQAA 1A5ZA 1UXGA 4N54A 3E48A 5JDCA 1U3VA 2W90A 1RPNA 3OIDA 2OP1A 5L4NA 5K0ZA 3WYBA 1LSSA 3UCXA 1YE3A 1PIWA 3VPFA 4B8ZA 1XGKA 1IY8A 2Q1TA 2E82A 4H16A 2Q99A 2ZYGA 1Q7GA 3P2OA 2FSSA 2PA3A 2CMDA 3LF1A 1WMBA 1QYCA 4WASA 1PZEA 5EJ2A 2O7QA 3ETGA 4I5DA 5GMOA 1NWCA 2J8ZA 3AUAA 4OGWA 3WFIA 1CQIA 4PLPA 4DQVA 1P74A 3NTOA 3ZCXA 3GVCA 3PZRA 1ADCA 1HF3A 3BTVA 2XF8A 3PXXA 2I66A 3RC7A 1U2DA 3ICCA 2EP5A 3B70A 3ZHXA 4IDFA 1GEEA 2DKNA 1YVEI 1BDMA 3IP3A 3EVTA 4FD3A 3W6ZA 1LSJA 2XAAA 4AJNA 1ADBA 1NQOA 1K89A 4W9NC 3U3XA 2B4TO 1YQGA 2C82A 4FFOA 1L1FA 1B8PA 5AXCA 5AOVA 3O38A 1X0VA 5A9TA 4Y6RA 5G0VA 3RVDA 3PWKA 4YJGA 4H7PA 1PQUA 5AYVA 2EEZA 2OXIA 2IE0A 1OBFO 3K2BA 2YFQA 4FN4A 3KETA 5ES3A 1PZFA 3H8VA 2GR9A 1V0JA 1YONA 2FRDA 1ZZEA 2WD7B 4PLYA 4CQMB 1V3VA 3Q11A 3DBHB 1LI4A 4XR4A 4IXTA 3V2HA 3ZGYA 1PS8A 2AG8A 1B15A 4L74A 3LC2O 2JCYA 3SJUA 4CM7A 5CDUA 1KY4A 3IP1A 3FD8A 1E3WB 4XEHA 1JKIA 1I33A 4NG5A 1NR7A 1QYWA 3FNHA 4NFSA 5TIIA 9LDBA 5K6AA 4GKBA 4IPTA 3RFVA 1R12A 5L51A 1IE3A 5KJ1A 1BRMA 1OZAA 2Y1DA 2X5KO 3OFSA 1KVUA 1ULSA 4IQ0A 1LDEA 3GK3A 4U7WA 5DCUA 1ZXLA 1VRWA 2BF7A 4DQXA 4U6QA 3VZSA 4JBHA 4J3FA 1HE3A 2Y68A 1NWHA 5JAQA 4BNLA 4BV8A 2BH9A 4PG7A 3G1UA 5K9ZA 2D3TA 4P4GA 4RV9A 3NDJA 5AVOA 4XB2A 2ZB7A 5BT9A 4UVHA 3JQ8A 3UCEA 1TT5A 3KLPX 1M6HA 4WOKA 1UDAA 3UGKA 4HFJA 1BGVA 2GD1O 3U4IA 2NU7A 1NASA 1MA0A 5C37A 1YOVA 4M86A 1H0KA 1WXDA 1NPYA 4IM7A 4K6CA 1T24A 1KY5A 4N5LA 1A7KA 3AM3A 3ZW8A 2VWHA 4AJIA 4NPCA 3BA1A 1HKUA 4BKQA 5DBFA 4BNZA 3DHYA 3DZHA 3WGTA 3OJEA 3EW7A 1P3DA 2VYND 2ZQZA 3ZDFA 1O9BA 2FPGA 3ZU5A 1PS9A 1OI7A 1D1SA 3CINA 3DBVO 3FPLA 1GPDG 4JCOA 3S1LA 3V5NA 1WZEA 3QWFA 3WMWA 1A9ZA 1BXGB 1NXQA 3L6EA 4OL9A 2VZ0A 4EJ0A 2QRLA 4HKTA 2WEKA 3OP4A 2DU8A 3VH2A 3MJVA 4DC1A 1LDGA 1PGPA 1GFSA 1KEVA 3H5AA 4OQZA 1SB9A 1DOHA 4AJLA 1LRLA 4BUCA 1CIVA 1JKFA 1BMDA 1MC5A 1PJ4A 1P31A 2X0RA 3L0DA 4JJGA 5FF9A 3ZNNA 4BNHA 4BNGA 3QP9A 2EHDA 3H7AA 4DBVO 2DBRA 1E3LA 2TMGA 3O8QA 4CMIA 3JQCA 1H94A 2PNFA 4XRGA 1LDNA 3DC2A 2NUAA 4S1VA 4D3FA 1NVTA 1R4NB 2C5AA 1VJ0A 2VUSA 4I1IA 2BD0A 4Z6KA 4XDZA 5COAA 1P1JA 1QLHA 1H2BA 5FFFA 3TZKA 4DREA 2J3KA 1EFKA 1HSOA 2VZ9A 4K26A 3SC6A 3OBBA 1YXMA 3ITDA 1HDRA 4C7JA 4M8SA 3SX2A 1ZJYA 2WJPA 1RM3A 5JXWA 1XIVA 2C54A 1ADFA 2ET6A 3ANMA 4YJFB 4E2ZA 4FGSA 3QSGA 2GUGA 4RF3A 2C2YA 1Y5RA 4TKLA 4Y98A 2BKAA 4M89A 5TJ9A 4BB6A 4R3WA 2IEBA 2HK7A 4PN3A 1C0IA 1KETA 3HJAA 4E33A 4F45A 3DZIA 2LDBA 2A94A 5JAZA 4PVDA 2EP7A 4QQRA 3FR8A 5L3ZA 3EMKA 4OJNA 4UULA 1E3SA 1IB6A 1PL8A 1WP4A 3EGOA 2HMSA 8LDHA 3OEYA 1DLJA 3L07A 1Z7EA 3NYWA 4D79A 2VUUA 2QHXA 3PZBA 3FI9A 3WOHA 5T6BA 1F0YA 4QFCA 2NVUA 4L0QA 1JLLA 1ULUA 4MKXA 4UUOA 2HDHA 4UVDA 4AICA 1F8GA 4BNJA 3D1LA 2BGLA 3PI7A 2AMFA 4GI2A 4W7IA 1ISIA 4A2CA 4WEQA 3GAFA 2G82A 5TNXA 1P1KA 4CM5A 3PLNA 2FN7A 2O3UA 4NFHA 2AE1A 1ZCJA 3JQAD 5AXDA 1U3WA 1N7HA 1UP7A 5GZ1A 4CMBA 4RQTA 2O48X 1E7WA 4ZRMA 4ZVVA 2V6MA 3RD5A 4K6FA 4J0EA 1MXFA 4BKOA 4ALNA 3JQBA 3R1IA 1R66A 3VH3A 3WIEA 4J9UE 1LX6A 4ND3A 4CJXA 2I3GA 5JW6A 3BHJA 1FMCA 4MVJA 3HB5X 3PHIA 1I5RA 1EUDA 4YACA 3RUIA 1Z7BA 1H6AA 4YB8A 2DAPA 3ADPA 2HK9A 4FQ8A 3F1KA 4RCVA 3EUWA 3C85A 2HKIA 3OECA 3GEDA 1WZIA 4TRMA 2QYTA 3OF2A 5KVVA 2O3SA 2Y1FA 2W2KA 1FDWA 3F4BA 3GDGA 4BB5A 3E82A 2B83A 5C7IO 4NK5A 4UREA 1EUZA 3GY0A 4PG5A 1DRWA 4KOAA 3RSHA 1DC6A 4PGFA 4L73A 3JD0A 1QRRA 4F6CA 2RH8A 3TFOA 3D7LA 2JD1A 2ZTUA 2BFOA 4RZHA 3KVOA 1U1IA 4GX5A 3INGA 2G0TA 3PGXA 1EK5A 1B3BA 4CR6A 4BIIA 5EL0A 4IJUA 2AG5A 1PQWA 4YJGB 1GEGA 2C2XA 3LYLA 3INTA 3WQQA 3ICPA 4BQRA 3LT2A 4B4UA 3CMCO 4J90A 4DLBA 1U4SA 3WYCA 4PLFA 3K2EA 3WNQA 5L53A 2EW8A 3TZHA 1TLTA 2C0CA 2YQ5A 4M55A 4CUKA 4L8VA 3W1VA 4ND5A 2AEMA 3QW2A 5IDXA 1UR5A 2X9NA 3ZWCA 4GMFA 1X7GA 5IFLA 3TWOA 4I5FA 1KIFA 4Z3KA 1Q1NA 1RM4A 4BO6A 1MFPA 3PJGA 3IL2A 1WLYA 1S7CA 4OYRA 3JQ6A 5ENDA 3WICA 1XEAA 3QWHA 3GRKA 1HDCA 9LDTA 1J49A 2XOXA 1HDXA 4DQUA 3O26A 5IXSA 4R68A 1TXGA 4BNFA 1T2AA 1I3NA 5H81A 3AOGA 4J7UA 2EW2A 3DDNA 3HDJA 2G17A 1DRVA 3Q2IA 4LVCA 4W4TA 1A9YA 5ER6A 3LT0A 7MDHA 3CEAA 3JQ8B 1TT5B 2VWGA 5THQA 1Z45A 1K5HA 1H5QA 1GCUA 4YAJA 5I9LA 1NPTO 4II3A 4KQXA 4J43A 2X0IA 1ZEMA 5A02A 1JWBB 1W0CA 1ZNQO 3U0BA 2O4UX 2A9FA 4ID9A 4ALIA 2PTGA 1FDSA 2VRCA 2VWQA 3GN1A 3M1AA 4AJPA 1A72A 2PZJA 1FDTA 5JPIA 2NLOA 4E5MA 2VOJA 2G5CA 2G76A 4MINA 1PWZA 4M87A 4IQGA 4XCVA 1SOVA 4GLLA 4I9UA 1RM5A 2HRZA 5EQDA 2Q4BA 3CPSA 3INRA 4J1NA 3FF4A 1LBEA 4NQZA 2CNBA 1Z6ZA 2J5KA 3I23A 4DMMA 1F14A 3QWIA 5J23A 4NFYA 5LDHA 2JL1A 1LLUA 3C8MA 4NBVA 3LC7O 5IZCC 1IOLA 2NV6A 5T67A 1CF2O 1LLDA 1VKNA 1MC4A 5C5IA 3RU9A 2DBVO 3AY6A 1K2WA 3O8QB 4R1TA 1H9BA 3RUDA 4CMIB 3IAHA 4NBWA 2O3RA 4CM3A 3KUXA 3I6IA 2HSDA 2W8ZA 4UEKA 4BO2A 4GBJA 1T1SA 3OA0A 3GZNA 4BNIA 2HLPA 4FFRA 4FFLA 1Y6JA 4DYVA 5CG1A 2Y66A 1KERA 4GPD1 4E13A 3IIEA 1DHRA 2VN8A 4ROSA 3QWBA 2D1YA 4PZDA 4ZU3A 3X2FA 2YFHA 3OHSX 1TB4A 3L77A 3PEFA 5KKAA 1I3KA 4E32A 1B3RA 1X0XA 4E4YA 1FDVA 1KEPA 4C7KA 4ESOA 1RWBA 5I7VA 1C14A 3EVNA 3ZWPA 4A26A 2DPHA 3WG9A 4ZGWA 1K0UA 2HCTA 3CSDA 3AM5A 2QIOA 4H3VA 4A0SA 3GVPA 3PWZA 1EQ2A 4B4WA 4D3SA 1XA0A 3WYEA 2QYSA 4J91A 1QV6A 1DDOA 4JLWA 4WCFA 1HDOA 3A4VA 2GZ3A 2C29D 4U0KA 4KUHA 2IXBA 3PJEA 1E3EA 3PLRA 4BNWA 3E18A 1I3MA 3DZFA 1F12A 3RJ5A 3B1KA 4GVXA 1CRWG 2CDCA 1LLCA 5G0TA 5CHEA 2W4QA 3KEOA 2C7GA 5EPOA 2NM0A 2WE8A 4CLEA 1IULA 1N1EA 4E2WA 2E49A 2P5YA 2O3QA 1DJNA 1LDYA 1XU9A 1U5AA 3DMYA 3DR3A 1ZVMA 4GX1A 1DIAA 4WCFC 3IJPA 5HRUA 3DONA 4RF4A 4LISA 2ZJ1A 3I52A 3T7EA 3F3SA 1U5CA 1P1RA 2D4AA 2QRJA 4HFMA 2B0JA 1YB1A 2AQ8A 2J3IA 2Z1NA 3BTUA 3SLKA 3W4IA 2DFDA 4CMEA 4WLFA 4YRBA 2ZB4A 3IKVA 4BNYA 3AUTA 4MVJH 5KJ6A 1I3LA 4NU5A 3IS3A 3W8EA 3ETEA 3F4LA 3SJ7A 3OH8A 5F21A 4J1TA 1SEPA 2RCYA 5IDWA 1ZK2A 3KO8A 1XWFA 4IMPA 1XG5A 2GLXA 4DMLA 4TROA 5F1PA 2YJZA 3MJSA 1W4ZA 5IAAA 1HE5A 4FS3A 1B14A 1NPDA 1Q0QA 2Y0EA 3HHPA 2PGLA 2ZTMA 2CVZA 1DFHA 1K3TA 2OFPA 4URFA 4EW6A 2ZB3A 3STHA 1I30A 4CUZA 3K30A 1A71A 4R51A 4CLRA 2Y93A 3VH4A 3NEPX 4WK6A 1XCBA 2VCYA 4LSMA 2I67A 1ZO8A 3VC7A 3NT5A 1IHXA 4IGFA 1PJTA 5DCYA 2FHSA 1M66A 2D5CA 4XQEA 1VL6A 1EDOA 4NBTA 4KP7A 3UW3A 3HN2A 2YUTA 3RUCA 4QFDA 2R00A 3H5NA 3A14A 4FPXA 2D59A 4HX5A 4IZHA 4BGVA 4CODB 3PQFA 3TZQA 3M1LA 3K73O 3DBRA 2VRCD 3K31A 5BSHA 1OMOA 1PWXA 5IJZA 5A03A 3T4EA 2NU6A 4GMGA 2C59A 3GUCA 1O5IA 1HYHA 3AFMA 1F06A 1V8BA 2PFGA 3WFJA 3B1JA 4DRYA 3ZNQA 4BHTA 3NDIA 3VTFA 2OBNA 5KNLA 3B6ZA 3LK7A 4RZIA 2R00C 3TZ6A 4W6ZA 4YVFA 2FZWA 3IOYA 3TF5A 2VYNA 2FY8A 3C7DB 3GR6A 3HQ4O 4W99A 5JCXA 1KVTA 2Q45A 4UVEA 4QX6A 3I6QA 3WGYA 2OBYA 4XGNA 4D3DA 3RBZA 4RPKA 2FWMX 3RFXA 1JA9A 2PKQP 1E1LA 4BNVA 4D0RA 2GPTA 1IL0A 3U49A 3ENNA 3FNFA 4L4SA 5L7YA 3MEQA 1GZ6A 4YDRA 3ZWMA 2RAFA 3W4KA 1CYDA 1WWKA 1DSSG 2VQ3A 3VDQA 3E9MA 4BKPA 3L9WA 4KWIA 3ZZNA 3H3JA 3WR5A 3E1KA 1HYGA 1O0SA 4LSWA 3QRWA 1K6XA 3DOOA 4JQCA 5CPFA 4DL9A 1AUPA 2Q2VA 4L75A 1ZK3A 5TLSA 3KYBA 3K6JA 4DUPA 2DFVA 2O3JA 1C0LA 1ZFNA 2QRKA 3PDJA 3JYNA 3IJRA 1JTVA 1KEWA 3GGPA 1UZNA 1LDBA 4MVJF 2P4QA 5F3RA 1NQTA 1QXSA 4H15A 4Q3NA 4B79A 3ZV3A 2GASA 4LN1A 5THKA 3ZHBA 4XQ9A 2AEJA 3JV7A 4J1SA 5DOVA 4E5YA 5LCXA 3W4JA 5KJEA 4WPGA 1QYXA 1CQJA 1R37A 2UVDA 1SO8A 5A3JA 4IY1A 1MXHA 1GUYA 2EKLA 3DFUA 1D4FA 4XGKA 1JAXA 1Y7TA 4W9NA 5JYDA 3F1LA 1BXKA 3H4VA 2X4GA 3BMCA 4DC0A 1U7TA 2PKRA 2ZKLA 1HLPA 3LF2A 4DA9A 5A04A 5L4SA 4FW8A 3K5PA 2B35A 1HRDA 4JP2A 1VSVA 1DC4A 1GL3A 4IDEA 2X58A 5BR7A 3UN1A 4JIGA 4YAGA 4I9HA 1LRJA 1A4IA 1P45A 4EJ6A 4ZQBA 3BZUA 2CY0A 1EVJA 1N5DA 3HG7A 5A4DA 1B2LA 3WGOA 4G65A 3ZWNA 4TMFA 3ENKA 3JQGA 4KUEA 5TS3A 5B4VA 4AJ4A 4QTZA 4ILKA 2Z5LA 3GZNB 4AJKA 3DTTA 4XZ3A 3R6DA 4UVIA 1NP3A 1N9GA 4YJHA 1Q2XA 4NK4A 3CMMA 1BXZA 1PJQA 1WDMA 1FXSA 3RWBA 5KOIA 1OAAA 3AK4A 3GNTA 3QE3A 2YV1A 3EDMA 1EE9A 3WTCA 2Q49A 3JQAA 2VYVD 3ZV6A 1QLJA 2GERA 3HSKA 4O63O 3EZLA 1RYEA 4PLTA 4Z3DA 3AUUA 1ZJZA 1LQTA 3KM0A 4FOOA 3EZYA 1UZMA 3H6KA 2EJWA 1PJ2A 3OIFA 4FBGA 1V3UA 3P5SA 1BW9A 3TDKA 4KQWA 2O3TA 3RIHA 4J2HA 4OXNA 1TEHA 1MV8A 2IZZA 4P8RA 1DRUA 2VHVA 4PZEA 3QVSA 1NHGA 4J16A 5EESA 3LT1A 3MWEB 4CQLB 1DFIA 2WYWA 2A35A 2OO5A 1YBVA 3B1FA 3EHEA 1AGNA 4WLUA 4UUPA 1XSEA 1E7SA 1O89A 4WCFB 1KC1A 3ZNOA 4DGSA 1CDOA 2NU9A 3KHUA 3PIIA 3RKUA 3K9QO 4XYGA 1EUCA 1LDMA 2B4QA 4YRAA 3WX0A 2WD8A 1YB4A 1R15A 2QW8A 1DC3A 2OUIA 3E6AA 4NZ9A 1U3TA 3PFFA 2X5JO 3CIFA 4DLLA 3UICA 2H5LA 3FWZA 4UEOA 2OORA 5DN9A 4YT5A 3FR7A 4MKRA 3TQHA 3ONFA 4R3NA 1F17A 1JAYA 4WNIA 3WBBA 5KVCA 2GN4A 3H9JA 4J4HA 5TX7A 2Y0DA 3GEGA 3FHLA 4YAKA 4AL4A 4IS2A 5G0SA 2JCXA 2GRAA 1IPFA 2WDZA 5CG2A 2Q46A 1E1MA 1KVRA 2EERA 3PGJA 4P22A 4EGFA 3WLEA 3MJ4A 2CZCA 5BNIA 2JAHA 3VDRA 5KTKA 4N18A 4IMRA 5A5FA 3DZKA 4MP6A 3OA2A 5A3VA 4I08A 4G81A 1Q0LA 3P19A 1ID1A 3I4CA 4R41A 1EE2A 3PVZA 1UXKA 2JJYA 3LC1O 4Y8VA 2FR1A 1IZ0A 4BO1A 2AE2A 4NR0A 4AG3A 1HTBA 1SAYA 3JD2A 4CLRB 5ITVA 5IXYA 3RASA 4ND2A 1JWAB 1ISGA 3VVBA 2Y0CA 1I32A 1C3VA 1IYZA 1H6CA 3N7UA 2AQHA 4R1NA 2AQIA 3PJDA 4EYEA 1MLDA 2P68A 1NHWA 1MB4A 4XYEA 2VNAA 4CLHA 1UXIA 1ONNA 3Q3CA 2X7HA 4GH5A 3I9KA 2Y05A 4TRJA 1FDUA 3DBRB 3DFZA 4FJ0A 4E12A 1YBMA 3RUFA 4CMHA 1I24A 1V35A 3BHIA 3KEQA 4W7HA 1VLLA 2NQ8A 2XXJA 1O95A 4CM9D 4BMSA 3V2UA 4QUKA 1K6JA 4I5EA 3C3XA 4P4NA 4TVBA 1HE2A 3F5QA 4R1UA 5ENVA 4OOFA 4BMNA 3D4OA 2J5RA 4Q3AA 1YB5A 3AW9A 4S3MA 5CDTA 1DLIA 5TQVA 4XQCA 5IDYA 2DTXA 4FIZA 3RUEA 5G4LA 2BGKA 1G6KA 3GNQA 4NH4A 1DXYA 4FJ1A 1HT0A 2JHFA 1EBUA 2ZCUA 3OQ1A 4JJIA 4L76A 1LLQA 3QY9A 4RPHA 2DUUA 3ZH2A 1XLTA 2W2LD 4FC7A 4O5OA 4TVOA 3A1NA 2EGHA 4FB5A 2VUTA 4D7AA 2GYYA 1H6BA 3PQEA 1ZSYA 2C7VA 3CZMA 3HWRA 4BO5A 1R6DA 2F1KA 3WWYA 3WWZA 2CFCA 1M75A 1K6IA 5HTOA 1DC5A 1LSUA 4WEOA 2EG9A 3QVWA 4MVJI 1X1TA 4DIFA 1W6UA 4LCEA 1J5PA 1DIRA
chains in the Genus database with same CATH superfamily
2NUTA 1ZAYA 1FFWA 4PAOA 1E9VA 3GQBA 3N39C 2P0EA 4INAA 4UJ3A 4QQ8A 3CJRA 4YCAA 3VUEA 4ETNA 4Q1EA 1QKJA 1E2GA 1IATA 1U7HA 4JZYA 3G17A 3ZDRA 3ZCPA 1ARZA 4LNHA 2HH9A 4I3GA 2LKDA 1XRLA 2GKSA 2QG4A 3KYDA 1Z0SA 2D8AA 3VH1A 1WDWB 3PYLA 4HSEA 4RLHA 5HJ5A 1VB3A 3PUIA 5BN3A 3ICEA 4ALJA 4MWGA 2PL9A 2WUWE 2ZUTA 2GS9A 3HKBB 3VPSA 1HZZA 3CG4A 5KOHB 2RHGB 4HDOB 1ESNA 1CQJB 3VR2A 4BAGA 1RAHA 4JLDA 2B3TA 4QM7A 1GGFA 1HPLA 1UBRS 2BELA 3PWSA 4MKZA 3DQQA 1T1RA 1JSXA 4TZTA 3WLLA 1D2HA 3HZZA 3PIDA 3TDMA 3C3YA 1F2UA 1PZXA 1ZHFA 2BFDB 4M0CA 2D5BA 3IEKA 1AZLA 4KODA 1G20E 1XHLA 1GTMA 3OM1A 3ONVA 1ODKA 4IQ8A 3RRBA 5EJ6A 5B3KA 1H2XA 4HFRA 4UZFA 3UUEA 1MF7A 2IZ0A 1IONA 1NP7A 3E27A 2VJPA 4I5IA 1HZJA 1USIA 2ZJBA 2HSJA 3GHHA 3T06B 5T5QA 3WWPA 2J41A 2YDXA 3RDPA 4RZUA 4HAVA 4KFUA 2FZ4A 2DPMA 1G21E 4BS9A 3G13A 4OI2A 4BMOB 4FB4A 5ICSA 3D1JA 4FNOA 4U7FA 1V6CA 4PO1A 2I2WA 5JY6A 3RBXA 3FUWA 2HMWA 3F7NA 3GAAA 3NWOA 2VA9A 4ZU1X 1NBMD 2ZE8A 3Q1LA 1OXVA 1A04A 1Z26A 4D8UA 2QUZA 3HWX1 3DBIA 2PQ2A 4M54A 2B5VA 1QVVA 2FUG6 1SMKA 2VUHB 4MYRA 2QVLA 1M0SA 2XITA 1AJEA 1YKSA 2AFIE 5G2OA 4ZVSA 3VKVA 1GZDA 5INTA 2F3UA 4ZJZA 4G89A 3ZZMA 2BL4A 3HUEA 2DTEA 2NSYA 3TSWA 3I53A 3GT4A 5ALGA 4ZAZA 2BEWB 1QQ6A 1VI6A 3CW9A 1VL5A 3M34A 1L7PA 1BSVA 3TG2A 2QR3A 2QN8A 2W2PA 2RKWA 3E22B 2H4FA 5F1OA 3HRIA 3K1AA 4WACA 4PONA 3O1IC 3IERA 4HWKA 4P33A 4CIAA 1PBTA 4FC6A 2XAUA 1H0RA 2B3DA 4BJ1A 3G7NA 2RHOA 3CRVA 4PHHA 1YIDA 4B4KA 5IH3A 5BQFA 3QWAA 3LPNA 2PEYA 1T26A 3RRJA 3WP0A 3W5BA 2GXQA 4QICA 1RVV1 3RBVA 1RMQA 3IA7A 4OLFA 2OGTA 2Y76A 4Q3KA 3VI3B 3VPGA 3WIDA 3ZJ4A 4Y2VA 4AF6A 1M9NA 5CVUA 1HH4A 4D4MA 3DW1X 4IIVA 5CK4A 4DRXA 2GWRA 1FVFA 1LW7A 3QJ5A 5EKTA 3ZN2A 1SXIA 2OSBA 4XARA 2XB2A 1DKUA 4MYSA 2XEXA 3B1VA 4DABA 2MSCB 4CNBA 2AQKA 1FFBA 3NTLA 4AN1A 1WY5A 2YV5A 4PX5A 1QHEA 2V65A 5E9JA 4ZJUA 2IDJA 4OHFA 3DTVD 4AO8A 4E2XA 5MGBA 4ZMBA 4HB0A 5EKSA 3R9XA 1K98A 1QR6A 3IHTA 2IXDA 2JAPA 4IEFB 2P2NA 1TJ3A 5DBGA 1Z8DA 2QRHA 1Z2CA 1Z2OX 3L7OA 5LA6F 1TVCA 1RYDA 3TRIA 4A0HA 3ERCA 2DQKA 1JKJA 4EG0A 1E59A 5JNTA 5H16A 2O0HA 3KYIB 3OZAA 2UYQA 4Q4AA 4L0MA 3LXMA 3W5VA 2IXTA 1KDPA 2IF2A 3QE9Y 1EFHA 3D6AA 3HVJA 3KG2A 3TW6A 4LHWA 4LG1A 3MGGA 3OM9A 4KN5A 4M7OA 5AOCA 2O59A 5IJWA 3A4LA 1NUQA 1KBZA 4QGGA 2V1XA 5KI6A 5B53A 4LUCA 4ARUA 4D5GA 1NONA 2HFKA 2Z3ZA 5JNLA 3EVAA 3LQQA 5F23A 2FRXA 3CR7A 3JD1A 1SCDA 1LY1A 1XYYA 3MQFA 4KIWA 3R77A 3L4SO 4RGQA 1YR8A 5E1MA 3L6UA 3T5BA 3IA2A 4B3FX 4G5RA 5CEJA 4WLEA 5TR9A 3O31A 5IHPA 1LKZA 2E7ZA 4EPXA 2DB3A 3HJFA 2HYIC 2QSYA 5COQA 2IYUA 3EARA 1NYTA 3QLTA 2ZBRA 4J2TA 4R2HA 1CUDA 3B78A 2IK8A 2B1IA 3OJLA 4AO7A 5C8XA 3B3FA 2WWTA 2FLKA 1EWQA 1SOAA 2NVBA 4LXUA 1FUUA 2RGCA 1LV7A 2FPIB 4NE7A 4AZ3A 1E1NA 4XASA 4X1YA 2A58A 1QPGA 4LMPA 1OWPA 2XVXA 3DL2A 3SSNA 4HATA 5HQ3A 1DG9A 4A0QA 4UUNA 5D01A 1RADA 4QUDA 1T3ZA 3W2EA 2XKJE 2XUGA 3D7KA 3O4RA 2WHYA 1FFHA 1DKRA 4WFJA 3PL1A 1GV0A 4G0QA 2NVOA 2BHTA 4YT4A 3I2GA 1C4KA 1F7UA 1E4YA 2JFGA 3EXIA 4MKFA 4Q47A 4EELA 3WGGA 1SU8A 4ZQFA 2IWHA 3UMVA 3GLGE 2QRNA 5FWDA 3PQ3A 3C3KA 3L6RA 4EITA 3AW8A 3S4YA 2RARA 4Q19A 4XOUA 2I29A 5EJ8A 3K09A 3LLSA 1RM0A 4GM0A 3E4CA 3RQIA 1H69A 2EARA 3ADOA 3FB1A 1FQWA 1SU4A 1QQ5A 2J9FB 5C4MA 1RAEA 1XMXA 1G7RA 5GM2A 3RWMB 4CKBA 5KYUB 2QTAA 4MIOA 4ZT5A 1J8QA 1II0A 4HTFB 3SX0A 3VZRA 4AQ7A 5T41A 2O2SA 2QZ9A 2JLYA 1QP8A 2QRVB 1NAIA 4L5YA 1U2RA 3BWDD 1IPEA 3FBWA 1Y1KE 1YB7A 1FK8A 2DULA 1Q22A 3II6X 3W6UA 4DAEA 5FQNA 1U2GA 5C0OE 1JDTA 2H85A 2OTCA 2ZVJA 3GLHE 3L46A 4X54A 4INJA 3HH8A 2I2DA 3EGEA 1Y3AA 3AFNA 1JXQA 4HFNA 4LYJA 2I8AA 3DP7A 2VF8A 1OAOC 2X0NA 5G1OA 4ETIA 3UAGA 1MT3A 1E9SA 1JQAA 1MP0A 3KKMA 2X13A 5CVJA 1NKVA 5F2OA 3PDUA 4P80A 3MJCA 1ECJA 3DUWA 4XQGA 3KC2A 2ZTSA 3FTCA 1PR2A 3G2IA 5CB6A 1E7RA 3H2YA 3R3JA 1FZQA 1US8A 2PSEA 2OHXA 3EA4A 3MPOA 5AJXA 4C88A 1PWYE 3K0CC 2A1TR 2IYVA 1KI8A 2JGLA 4YFYA 4OMUA 4TQGA 5FCDA 4CM8A 2PWBA 2O8EB 2QXYA 5BVGA 2CHUA 4YCDA 3N2EA 1YDWA 4AIRA 4CT5A 4Y1RA 1CUJA 5CFMA 1XA3A 4CLOA 3LUAA 2OAP1 2A3NA 3GH3A 3CLKA 3L7MA 3EIHA 5HF9A 3G2JA 3PQ4A 3RKRA 4TV9F 2GHIA 1QWSA 4C76A 1WLSA 4PLVA 2CDRA 2PMKA 4D9HA 1QKKA 2A4KA 1CS0A 1H2EA 3UJDA 4MGKR 3RC2A 3G2PA 4GBED 1ZVJA 5L45A 4KQCA 1GNTA 2FPRA 2NUTB 1QGZA 4ON9A 2N1MA 3JXEA 2I33A 1RQRA 3EXG2 1IWOA 4R40A 3GQBB 2IP4A 3LPCA 1ODJA 1T25A 5CVDA 5BSUA 2ID4A 1M73E 4ZV7A 4J1QA 4OK3A 5JYEA 2GTHA 4IJ5A 1VE9A 3OOEA 3TAHA 1P0IA 1VIVA 1JHZA 4NDNE 5G53C 2WWVD 3WYAA 3WNCA 5GP1A 4EW3A 3ZWYA 1DDGA 3KYDB 1XN1A 3BXPA 2OZVA 4BO7A 2W42A 3MTEA 4DB2A 4AJ2A 3BCRA 1PJZA 2ZAMA 4EFKA 3V8EA 2G5GX 4UHEA 1R10A 1DQPA 1N78A 3UMJA 4KKVA 2WG2A 1UZUA 3DWGA 1HURA 1JR2A 4RORA 5HIMA 4DS3A 2F1RA 5EA2A 3ILVA 2ZJ2A 2ZIZA 4L5CA 3ZY2A 4I19A 1EUQA 4IHKA 1CY2A 1SPBS 4Z0PA 1HNWB 1UK9A 4K6GA 4BQPA 4KHZA 2CT8A 5AI0A 5EJAA 3I9NA 3V42A 4BNDB 5BW8A 5IAGA 3G88A 3GJ4A 5TT1A 2XUHA 3B9RA 3R41A 2VNHA 3ENZA 4G41A 4CF3A 1W87A 1P81A 4QQNA 4QYTA 4DNXA 1LD3A 3E1GA 1Y8RB 2OHGA 2B37A 4MULA 3C7AA 3HYRA 2GUWA 3GFRA 4QU5A 3RS5A 4F5WA 3NORA 1EPUA 4GR9A 4QL3A 2NYUA 4R8LA 3KSUA 2RH5A 4YK7A 2JD0A 2P4HX 1XU7A 3EQ8A 4ZO9A 4ZEOA 1IJBA 1QVWA 1UOOA 4DM7A 3A6LA 4Z1MA 1M5UA 3O8BA 4RTQA 4ZPXA 2QQ5A 3TRKA 1RWWA 4FXPA 2J4CA 2J3QA 3UOAB 4OBWA 3MTGA 2ESRA 1UAYA 1FYWA 3R2JA 3A1CA 3B52X 2TYSB 1HSZA 4OQMA 4M83A 3P4XA 5KREA 5DBHX 1EUYA 4OYHA 4KUGA 5B4TA 1GYRA 2C04A 2X14A 4TRRA 1FNSA 3F6CA 4MAFA 3WMEA 3ZOKA 3QOFA 4EDFA 2YHIB 2Z2ZA 2RH9B 4XJTA 2JFVA 2XTJA 1CUBA 3Q3HA 4BMYA 5H9VA 1GU0A 4RD2A 3V3KA 2FEMA 1NT2A 2PQ6A 3BDAA 1P8AA 1ODTC 3FFBA 3NC1C 2OO3A 1LTQA 5JZOA 1OC4A 3EVDA 3K1AB 1TAHA 5EIEA 3JQFC 2YZMA 1B1CA 1V6AA 4L8LA 4TWJA 3N2YA 5AK3A 4TKVA 5DNCA 4XEUA 4AN4A 2BM8A 2AOTB 3CXRA 1SVIA 4JJKA 4N12A 3FKQA 5AM3A 4F84A 2NGRA 5CJ2A 3SDSA 2KLBA 3F74A 3WLJA 4PFJA 3D6VA 1A50B 1EQUA 1UH5A 2PS3A 5I7SA 2P75A 1IN7A 3EBLA 3L1UA 4NE2A 4OXYA 5M5BA 4IIUA 1TZJA 5J2UF 3D43A 3CISA 4DDVA 4DRXB 1JS1X 2HRRA 4TUYF 2P9QA 3UFXB 2F9LA 2I3AA 3TIFA 4Q7QA 2OOSA 3BJMA 2YDYA 5GOTA 1C0KA 2BRUC 3UWSA 3PI6A 1B0AA 1L5SA 2R2GA 5IN5A 3W9YA 1SBIA 3H19A 2ZK7A 3CFYA 4IQ4A 3RPEA 1X1AA 4DEYA 3R9XB 1GPH1 2NYVA 3P2KA 2RHJA 3BXEA 5DT2A 1CT9A 1L7RA 3K9LA 5JQGA 1TYCA 4GSLA 3DEAA 3GOHA 1Q1QA 1JKJB 4ZARA 1YUNA 3IV7A 3K8OE 3V7UA 3UB2A 2XQFA 1B8UA 3GPIA 2HC9A 4KFCA 4NMHA 4Q4AB 3EPHA 1OU4A 1U2EA 3F46A 3KYCA 4BO9A 4HPJB 1KI2A 5HKLA 2B4AA 4JI6B 4JR0A 3HVHA 4YEDA 3A3YA 5K2OA 7AT1A 2ZJ0A 4ZEVA 4PICA 5J59A 1GQ2A 2RGXA 4LQCA 1Q12A 3KHKA 4KC0A 5EMLA 1XP5A 1ZQ9A 3OZEA 1NNLA 2VC2B 1E77A 2GN0A 1SG9A 2LD4A 2Q50A 1AZTA 4MVJP 3E9QA 3W8DA 1DEAA 3HCPA 3EXAA 4CQMD 5C1DA 3RVJA 4NOMA 2XSZD 4KWHA 1SBZA 1T3HA 2PLFA 1HT1E 2RGAA 1GL6A 2DPLA 2V6FA 4XD7A 2GZ1A 2J7PA 3S40A 1MW8X 2BMWA 3MLBA 2PUGA 1DIGA 2IIBA 3E84A 4HXFB 3ZDQA 3H16A 4ZDJA 4B4VA 3OJCA 2QXUA 3G8CA 2PX8A 1N6LA 2QD2A 3E5NA 4P5PA 4LGYA 4HLQB 3K70B 2G9UA 2ZJFA 1UOEA 4BL5A 3ZS9A 4X1YB 4X5OA 3HJTA 5NULA 1W93A 4IHAA 4KV7A 5HQ3B 4B2LA 4IINA 2M1ZA 3SXJA 2X6QA 4HC4A 2YWRA 5E2IA 1MIOA 4ZA2A 4NP6A 2PBFA 3T7IA 1MG0A 2IEZA 1THGA 3HJCA 2XCUA 3TRDA 5A5DA 4GC5A 4KV9A 2JD2A 5BQXA 4L9AA 2VTEA 4PYJA 1MU0A 4KYUA 1LS1A 1USWA 1GUDA 1PDOA 1KI1A 3LLVA 4RIHA 2CMGA 1JXMA 4UUBA 1HFWA 1GRQA 1LNSA 2FW9A 2R7KA 4IS3A 4MIYA 3RM3A 3KZVA 3U31A 1CWUA 2QM7A 5TPZA 1G0OA 4L08A 1P6QA 2R9VA 3SIWA 4D99A 4EECA 4D2IA 1RP7A 1P6XA 1I2CA 1VHTA 1AQIA 4OHPA 3C5EA 4CKBB 1W73A 5HILA 5HVNA 3UJCA 4Z99A 4EPTA 4KQ1A 4X91A 3QPWA 3S81A 2OQRA 4NAHA 2A1IA 2Z3VA 3EHDA 2EWMA 1WCIB 5AM2A 5K0GA 5LYJA 3PHJA 4E70A 3UAVA 2XWBF 4LQLA 2GN1A 3Q41A 3CRQA 3EW9A 4PSUA 5I9SA 5K8JB 2ZU6A 3QKWA 4UPVA 4KFRA 5LKAA 3O2QB 4RH3A 5DWQA 3CZPA 1J97A 2V0NA 4EBFA 4HNQA 4CWAA 3L8FA 1CJTC 4ALKA 5FD8A 1YE8A 2J3HA 5CU7A 3E3LA 2NN3C 3LX5A 4Y67A 3UWOA 1ULAA 2G67A 3NTQA 5BQOA 3HFJA 5CYGA 3V8MA 2IOFA 3CHYA 3KL2A 2MSKA 1XQWA 2B1QA 1DPGA 4DIKA 3SDZA 2FGKA 3Q9NA 3RV3A 1US8B 4DDMA 2JJ2A 1U9JA 2D3WA 2ZWPA 3LIIA 3E5RA 4FR2A 3EA0A 4EMBA 2F8TA 4BPRA 4CM8B 1JJAA 1AKTA 1WV0A 3WMRA 1EFTA 3I6ZA 2V58A 1ECFA 4KBFA 5IAEA 5BVGB 2XBMA 4MVJM 4Z51A 2LPMA 2GBPA 4Y1RB 1JT2A 4LDRA 1YWGO 4JXKA 4FT4A 4CLOB 1W75A 5ITWA 2JH9A 1X7YA 3TSYA 4ZT7A 5JVDA 4HXYA 1K8QA 5ALHA 4C6TA 4CQNA 4O0LA 2EIXA 1IK6A 1DIHA 1G4HA 2FRDC 3NT2A 3BL6A 4OHXA 2WFMA 3UWMA 4CHGA 3DO5A 4E5KA 1UWKA 1J25A 1CS0B 2IV3A 4PZUA 2K7FA 2WP0A 3BKWA 3EXHB 4P54A 5K0BA 1T0IA 1LGYA 3GA0A 3IAM1 5HBRA 2V5AA 3CX8A 2IY7A 3UMMA 4HEHA 5BUQA 1RT9A 1T9GS 3P8ZA 3QX9A 2WIFA 4P7JA 1RYBA 2Z2JA 5CLQA 1O54A 2C78A 2J09A 3D31A 1L5GB 3VOBA 1QB7A 3DE2X 2H18A 4O2BA 4US2R 4IJQA 4URXR 4BAZA 3BEOA 1DGQA 3IV6A 2JA1A 3VKHA 2BZ1A 1E2UA 1IOZA 2G06A 1NFFA 5F52A 5EHGA 4IX1A 3KR9A 3B6IA 3QQPA 1TUBA 4B8YA 4I2VA 3GD5A 4RKQA 4X85A 2VJCA 1JN0A 1SC6A 2GOYA 3KZXA 3EYWA 1TF7A 5IAOA 3IB6A 4AKIA 3ONEA 3R9IA 3THRA 3ROZA 1GDTA 2FK8A 1J1ZA 1Z33A 4KDCA 1Z2AA 5DX8A 1HQYE 1NW3A 2Z98A 4B75A 3RTAA 5L9AA 2AG6A 3R3WA 4ZYWA 2BFWA 4XW2A 1BC5A 1U5BA 1S01A 1N9ZA 1DZ3A 1NBEA 2EKPA 1DJQA 3E8XA 3NJ4A 3ODPA 4M1QA 5DTQA 3OZSA 5EMNA 3WHKA 4Q4CA 2D5AA 2O23A 1C30B 4C3UA 1YU6A 4DLVA 3LI2A 4ZAYA 1NJ5A 3OQOA 4AI6A 2GCGA 4YS6A 4Y2YA 2RKOA 2B4RO 2VHZA 3WKEA 3RYHA 1XTIA 1IN5A 1WCXA 1ONPA 1XLUA 2TRSB 5J5VA 3SG0A 3V48A 2I99A 2H00A 4YXFA 1H0SA 1GCOA 5JAHA 1A8PA 1EE1A 1ZI9A 3QHQA 5KOJA 5JSYA 3NGXA 5AQ1A 5B64A 1DINA 3IYLW 1SKYE 1XEWY 3ZWQA 1J7JA 3ETLA 2YXEA 1M7BA 1XQ6A 4YC7A 3UG7A 5BMVF 2V7PA 5T4EA 3UPTA 4EB3A 3VR5A 1NX9A 1GN8A 1H93A 1E6WA 1N1GA 2C4HA 2O9JA 3MWDA 1BKDR 1PKEA 3DZ8A 1HKHA 3IFSA 1D2EA 3ETHA 4LDQA 4YBRA 4BFSA 2P69A 4C22A 1FMLA 5FLYA 5BWBA 5I7EA 3Q8LA 3PNLA 3CLSC 2JJ1A 5CFZA 3SQLA 1GDDA 2NTNA 4MTCA 3E1SA 3U81A 1PKXA 4P2BA 3TZLA 1TD1A 5CFQA 3T5CA 4JBXA 3COZA 2A9KA 1COWD 4TKVB 1QGAA 5B3AA 4EWLA 1PBNA 2QE7D 4X7BA 2WYUA 1UXOA 5EXEA 5TMBA 2JCBA 4BE7B 1E5XA 2P6UA 1M0TA 3C6ZA 2DHQA 3NLLA 3ZJYA 1BHO1 5BT8A 4FSHA 4TQUS 4R5MA 4K9DA 1MGOA 2IF0A 2MSWA 4FU0A 5DMHA 2XDAA 5BWLA 4YP5A 1DQSA 5HIIA 3V2GA 2ZULA 1OH5A 2E4VA 1AB6A 3RVSA 4Z3OA 2ZRFA 1JL3A 1OI4A 3M6FA 3ZWOA 2Y2VA 3FUTA 2GWHA 3PT5A 5EMHA 1T9CA 4AZ0A 2X6RA 1Q0HA 4GC9A 4O4JB 3SHWA 2ONCA 3MC1A 3NGLA 2ZSKA 3QPVA 5H3HA 1J33A 3TL2A 1SBCA 1XK6A 2E87A 4IEIA 4CXMA 5AW8A 5KQGA 1RRFA 3B1WA 2WPDD 4PLWA 5DYIA 1ZBQA 4U4AA 8OHMA 5AW4A 3NBMA 2QM8A 2BFPA 3PJFA 4UHHA 4C7VA 4EA7A 2CYAA 4Q3DA 5AT1A 4H18A 3R7FA 5LMUB 1POWA 1AG9A 3JYPA 4GT1A 4Q21A 3W2IA 5JQGB 2XYRA 2J3JA 1Y1TA 1R0KA 4KVFA 3TB6A 2QN9A 5KX5A 1HBJA 2W4MA 1PZHA 4US0R 1ZH8A 3KYCB 2F3PA 1O57A 3C6KA 3KWMA 4HLNA 3GEHA 4LBYA 4BVAA 1V6SA 2B1RA 3CO5A 3KB6A 1NU6A 2HM7A 2WTBA 3EUFA 3K16A 3R0IA 4M7RA 4OIFA 2IP1A 3QENA 4Y0VA 4LRTB 2NNWB 2WIBA 3KV3O 4RAQA 1EM8A 2HJSA 3ELBA 3DFIA 3JQEA 4JLVA 3GEIA 3JQDA 4NEGA 3SBEA 1XV5A 3QTLA 4B6GA 2BMFA 3BG5A 1MJGA 3KWFA 1P7ZA 5IASA 3QM1A 1G8FA 3AHCA 4R16A 1QO7A 5LP6F 2ZSIA 2HEIA 2POQX 1SFRA 2P9CA 3JWEA 4N4AA 3IEMA 3RHFA 2C9DA 2B4KA 4FYWA 2E37A 2QV0A 2IPNA 2NTVA 1C29B 3EQ9A 4KNWA 4KSCA 1QX4A 3RU2A 5LR6A 1TYDE 3N87A 1SR8A 1TA0A 3GDFA 4Q4LA 3GXOA 2R8BA 3IIIA 3N8GA 2EXXA 1NXVA 1Z6TA 3GMTA 5JTTA 2PL5A 4JI2B 5KBYA 1SHZA 2VHJA 4S2EA 5CLIA 3VMFA 2REQA 1SA0A 3C4QA 4WA8A 4I0WB 5BRJA 1FNMA 4UM9D 5EMKA 1EVKA 1UC9A 1S02A 3HYCA 3IMEA 3IE1A 2IEDA 4OAOA 5E3HA 5IM5A 1VBMA 1V9SA 4KI7A 4DLXA 5B36A 4FP9A 4E1BA 3AEQA 2ZS8A 3ZKWA 2O5EA 2BBOA 3T5TA 2PUJA 4YAEA 1YJAA 2Z2IA 4NBRA 1INLA 4RVFA 2WKRA 1SU7A 4ZV9A 4RDXA 2Q2QA 4RS4A 4QT0A 4EZIA 5C4IA 3FLBA 2ECKA 4TRNA 1ZMOA 3WK9A 3NIWA 4EB6B 4EHNA 2B9EA 3NOVA 1L9XA 4D9KA 3AR4A 4DVGA 1PX2A 4TYWA 4V2IA 1PL6A 1TCAA 5K4AA 3MK31 3PFNA 5DM70 4K8OA 4EMTA 1LF5A 3KXDA 1LBQA 4CKEB 1TZKA 3D8HA 5CDSA 4C4YA 3C6YA 1UFOA 1DELA 4U2CA 1U3UA 1OFUA 2IU3A 4GXQA 3GLIE 1ZW1A 1BMTA 4UARA 5LYJB 1TMGE 4GDFA 1QDUA 4UHDA 2QR2A 2D6FA 4WIAA 1CC1S 3DKPA 3IEXA 2XWSA 1M8GA 4CPDA 1OIWA 2I6TA 1V3TA 4J6EA 5DTEA 4F8JA 3DPIA 3T3GA 3OQMA 3Q4GA 4DG8A 5J3JA 1PFYA 1I2BA 1R8YA 2BKUA 2IXEA 4JLAA 5KHAA 1ODCA 1VI2A 2PTHA 4QGAA 1RI5A 1M76A 2QX9A 5K0SA 4FE3A 4YJDA 1U1CA 1WQ3A 1ZL0A 2ZAOA 4IIJF 3AEXA 5ESXA 4EK9A 2BMJA 5ALUA 3WWOA 3W2TA 2FG6C 2DG2A 3M9XA 9GPBA 3IAS1 2Z8YM 1ZOOA 4KK3A 1U7PA 4YP6A 3ORFA 4OH1A 4AMGA 3SBDA 1BVUA 3WK7A 2JHGA 2WD9A 1U3DA 1WUYA 3F9IA 5DWVA 2ETVA 4CM4A 3IC5A 4G63A 1WB9A 2PSSA 1X7YB 2R62A 5JVDB 4C6TB 3CRRA 4R2LA 2P67A 3N05A 4GWLA 4REOA 1Z0ZA 3MELA 5TMPA 2BMAA 1F8UA 2CHEA 2VBFA 4RA9A 3GC6A 3C1OA 4B2YA 4YMTA 4G2NA 3KLBA 4HVCA 2APJA 2F9FA 3SEFA 3G59A 4NU6A 3OUZA 4PPNA 3FW1A 3ZVLA 1YFZA 5CA0A 4NOKA 1W0KD 3HR7A 1JUDA 4A6DA 1BOOA 4M0PA 5MN5A 3F71A 4JLNA 1UXJA 1W1WA 3LZ6A 3PFWO 4RLFA 4MRMB 4MV6A 2QMHA 2VP4A 1KTIA 3C8UA 4MR7B 1I2ZA 5CIYA 1OBCA 2PPLA 2ZS7A 3VTAA 4O2BB 4YX9A 7GPBA 5LD2C 2E4UA 1YRLA 1TCCA 1KA9H 2NACA 1XPJA 1CQZA 4EZBA 4UC0A 1ZRHA 2FG5A 2PXHA 1ZRMA 2VDOB 3GJ8A 3MCWA 4YP7A 4KRFA 1GP2A 3V6LA 3RIGA 1C1DA 1TUBB 2HAEA 3WY9A 4CTNA 1LZKA 3U5TA 1PFUA 3DEHA 2FN9A 4RDIA 4ZIRA 3H9EO 5LQJA 3J7TA 5CA1A 1G0NA 3FUVA 3FRHA 2UYGA 1MEEA 1H1DA 2A1TS 4BXOA 2QXTA 2Y0BA 4TT3A 1LXCA 4QBKA 2ORED 2A8YA 2WJZB 3L8DA 3HDHA 1E92A 2ZRJA 4UU8A 2XMCA 3COYA 3W5AA 2G77B 2XDWA 4DTIA 1U5BB 1OXUA 1YQEA 2C4KA 3AY3A 3H4MA 4Q4DA 3FKJA 1QZXA 4YRQA 1K7FB 5AM0A 3VKUA 1GA4A 1HLDA 4D3XA 2H8GA 3OQ6A 4WZ6A 3R23A 1DP4A 1GADO 2CDBA 3A32A 3Q9UA 1V8PA 4FI3C 4Q6WA 5TT0A 3RYHB 2HIHA 5JRZA 3FPEA 4YWJA 5DW0A 5E9QA 3LDUA 2QUHA 3GZJA 2NYAA 4LKRA 3MXOA 3W9SA 2MYPA 5E8RA 4HWPA 4TWAA 1G19A 5E95A 1C9JA 3ZGVA 5BSVA 1OAOA 2C9MA 5KOJB 4QXRA 1Y34E 3HB4X 2ODBA 1VPEA 5FBRB 1G5IA 3QBDA 4XIYA 4WVLA 3MG9A 4OHUA 3K05A 4UMEA 4HT3B 2JC3A 3MWDB 4R7ZA 2B4YA 5ESRA 2IYYA 4ILEA 4QHYA 1HDEA 1J70A 1TGVA 1WXFA 3Q0TA 1MVLA 2OHOA 3K0CA 4K9RA 4DIDA 3G7UA 4NAVA 4RK1A 1MV5A 4WJKB 3ICQB 4A15A 2QPOA 1KOFA 1Y3HA 3LBHA 4PY2A 5SY6A 4AMYA 2BPOA 3MBOA 5F98A 5CNIA 1BCSA 2QLJA 5SY4A 2NXWA 3G5TA 2Q41A 4JWTA 2QPAA 4O4IA 2WD7A 1V47A 4EKDA 5A9RA 4LE2A 5L6LB 3AVWA 1GITA 1O4VA 1J20A 2Q3MA 1P77A 1G6HA 4C4AA 2PT9A 3BRCA 3R6GA 1YVUA 2J9RA 2FG7C 3AL0C 1IY2A 3COWA 2PIAA 5DTMA 3VC1A 4AO6A 1I5EA 4MUHA 5U9CA 4OGLA 1C4XA 3FSGA 3RTDA 2GSDA 3VO1A 3VO9A 4UCXA 2QGZA 3PDWA 4QXOA 3JVDA 4RF2A 1BJTA 1XKQA 2XMQA 2D2IA 3PUYA 3RKSA 2I1WA 2WG1A 3FWNA 5KJCA 3WRWA 3SQMA 1FLVA 1LBSA 1SJ9A 4MOWA 5J4VA 5BOSB 4AZ0B 5KNCA 3TNJA 3I0NA 4PE5B 1NLYA 5DM1A 2Q5OA 2GM9A 5B6PA 1EFVA 4Z9BA 5D86A 2AJ8A 4DY4A 4ZCRA 4X9XA 2LW7A 3T54A 3R9WA 1WQ1R 1NSFA 2XUQA 3EAGA 3ZWAA 1JAZA 1KO8A 5GWXA 4L8FA 5GINE 1AUOA 1KOLA 2QTRA 3BBLA 4OG2A 1YMQA 3HXTA 2CB0A 1QMGA 5AW6A 5KX5B 1RHMA 3EMVA 1IY9A 2FV8A 4OJTA 3VH4A 4U2FA 3OESA 4BYMA 3RC9A 4ESHA 1LPSA 5LB4A 1U0BB 2X9QA 1X8JA 4R8MA 2NVUB 4EHIA 1EM8B 3DWEX 2PCLA 5TMDA 1K8XB 4QEZA 5EVJA 4A2QA 2XUDA 2PFKA 2ZBQA 2GYUA 2H92A 1VJ5A 2V8BA 3NATA 3QXCA 4Z9AA 3SNKA 4ZCTA 3OICA 4D56A 1IAVA 1DWQA 1BWRA 1QIDA 2EBHX 1JQ5A 4GWKA 5H68A 5JO0A 1XVUA 1Z75A 5AH0A 4CMGA 4EUKA 3BH0A 3OJFA 3AXSA 1UP6A 2I2FA 4LMRA 4AKGA 4ZANA 2IUFA 5KUTA 4LHZA 3U7FB 3IR5A 4TYQA 4DKXA 1SQSA 4QJ5A 4YT2A 3D5TA 2XYHA 1YZTA 2REQB 1SA0B 3NPAA 1ZSVA 1OXBB 5JC8A 1KHHA 2QTCA 2C4MA 2J67A 4NIMA 4RPCA 1JTEA 4UXIA 4HX9A 5FB3A 4RQUA 2J5XA 3UUGA 4CN8A 1UEJA 1DADA 7ABPA 1X1RA 3OQHA 5I8ZA 2DHRA 2E5FA 1ISMA 2NXEA 3E9YA 1HG0A 3A04A 1AKRA 5COBA 3AEQB 5D1HA 4CEJA 5L3SA 1Y3BE 3ZKWB 3ME5A 3VR1A 4EA8A 1YJ5A 4NJEB 2QQEA 4AZTA 4ZOLA 1C1HA 5B1HA 2ZBGA 1UMDA 1Y42X 821PA 2Y1EA 5FWXA 1W44A 3KQLA 3ZBTA 4RETA 1GQYA 2ZI4A 3CG0A 1U7XA 4M7WA 4HPXB 4PQEA 1ZWKA 4HGOA 4OHRA 2ZYAA 2Y27A 4PX9A 4G0OA 1R4NA 1SVUA 3NETA 1E1KA 1PUJA 3QFCA 3GPBA 2G1UA 2NIPA 3RW9A 3ZU2A 4BUZA 1JKXA 3I12A 4JASB 4AFNA 3NDRA 4ENVA 1HQDA 5H4HA 1ZA1A 2PV7A 1BN7A 1V5EA 4OI1A 4A8HA 5JS1A 1GUFA 4X64B 1Z74A 4L85A 4ECAA 1XCOA 1E0DA 5BQ5A 3E9CA 3FUCA 5BWOA 2PU5A 4CMKA 2Y9PB 2BRUA 1UBTS 3ON5A 4LY0A 4PYRA 2OQ2A 2OBXA 4RGBA 4N5MA 4X00A 3WI7A 3PUVA 2W0MA 1A76A 1NQVA 5C8DA 2M6KA 2Q3FA 4RLQA 1TQ4A 3LFUA 1RXIA 1G16A 1U80A 2I8LA 2RBEA 3WHPA 5EIFA 3FMFA 1OXSC 3AU8A 3EGIA 3EVZA 3FLEA 4L50A 4QTXA 3CVYA 1DUIA 1U0JA 2OV2A 2WM8A 3LM8A 4PAQA 1L3IA 1PFWA 3GL9A 3H5RA 5F3WB 3IR6A 3M6UA 3B13B 1DBQA 1CUEA 4CTJA 1FXWF 4ZZIA 1SCAA 2PZEA 1J90A 2VDQB 3TW4A 3ZTWA 3HVRA 3T35A 3VYRB 5ILOA 3RROA 4G5GA 2QSUA 3CUEF 4WECA 1XCLA 2AVNA 4OREX 5F33A 5A3SA 1L7AA 3UGTA 2Z30A 5DHTA 5GZ3A 4J4TA 4PYIA 4M1SA 3G85A 4L5BA 4CW7A 2A7XA 4CN9A 3EPKA 2GO1A 2Q4EA 2GLUA 4OV6B 3ZCRA 3DZJA 1Y9DA 5LC1A 8ADHA 2P62A 3OMLA 4RVSA 4RA9B 1FFAA 2JHPA 3Q6NA 4ZQGA 2BF4A 3V55A 4RH1A 4H7JA 4LWQA 5E3JA 2XGOA 4H2DA 5JD5A 5HA5A 3UATA 4X97A 1EVLA 2HPHA 4YRPA 4YV0A 5CA0B 2DX7A 3WLSA 1P2UA 3EISA 3EAQA 3OKAA 3VPXA 1QCDA 1R1DA 1OY1A 1VCIA 2VXOA 4JBWA 4N01A 3TTWA 3AU9A 2HO5A 3FLAA 4OHVA 3WO1A 3FTDA 4RPLA 4BNXA 2BEVA 1RE0A 2AR0A 2Y71A 1IPHA 2VP0A 3AJRA 3BOSA 3I2FA 1HDZA 4D8TA 5CB4F 1EZ4A 2P1DA 2PUEA 3N2GA 3T9FA 3WP1B 4MXDA 1JB9A 1R3DA 1KARA 3G9QA 4FD2A 1BO6A 2W90A 5KQLA 1RPNA 3ZQJA 4XVHA 4DCVA 3IPAA 1YJBA 3TLJA 3ZY3A 5K0ZA 1LSSA 3OTQA 4MEBA 4EFNA 1L4LA 3UCXA 2IVZA 4BJ3A 2QMEA 1BMFD 5CA1B 3NALA 1Q21A 1ZMRA 2QRPA 1GNLA 3RHTA 4AZVA 5JLJA 4JVSB 2G6BA 4UXJA 2A9PA 1W0JD 3P9SA 3ROGA 1WMBA 2A7QA 5AUQA 5LOVF 3ROFA 5EJ2A 3EPJA 1Z7GA 3AUAA 4OGWA 1QF9A 1CQIA 1TIPA 4KQ2A 3TIVA 1P74A 2VJNA 1QO9A 3NTOA 3GVCA 3PZRA 1LH0A 4PPYA 3IE2A 1SUWA 2PYIA 4HQ6A 4M1OA 1R64A 3N3AC 4LY3A 1GRRA 1U4NA 5BURA 2ODEA 1N2GA 4MQMA 3NXKA 5K03A 1CEYA 3Q0IA 4LV8B 3ICCA 4R84A 1IZZA 4QLOA 4BWGA 3ZHXA 2WUFA 1OV4A 1E1RA 4IDFA 1KQNA 1GEEA 3KVVA 4KXNA 1GTG1 3RK0A 1OLUA 1Q7TA 3U3OA 1RWQA 4FD3A 5A0VA 1LSJA 3MAJA 1FUYB 2A0YA 1PFQA 4L9SA 4B09A 2UYHA 1LZLA 4YAOA 4O4LF 1PYOA 1W5EA 3ESDA 2QX8A 3I37X 5FTWA 2O7VA 4X7RA 3ESRA 5IJ0A 2NTYC 4QFMA 3O38A 2R6CA 5CAEB 4EA9A 4A16A 2H0RA 4Y6RA 2ECQA 3RFFA 3RJZA 2OHJA 3PWKA 4ZYXA 4OI0A 3CX6A 3HCRA 4H7PA 2QQFA 3W1EA 1PQUA 2A5DA 4ENTA 5ALNA 2JLZA 4BPBA 3GRYA 2G1KA 3I04M 1RQXA 3KJEA 4Q7JB 3C3PA 2Z3WA 1BCSB 2QN2A 4N41A 2B98A 5DI3A 1KMQA 4G86A 2NV2B 2YJ3A 3DQZA 4O4IB 5BSWA 1YONA 2FRDA 2WD7B 2D62A 1FW6A 2F62A 1V3VA 3TE6A 3WK8A 4KX5A 2IWRA 2VPYA 2GHTA 3AY0A 1ZWLA 2A0UA 2QJFA 3E15A 3D6MA 3L7LA 4XR4A 3KJFA 3MJDA 2YXPX 1NXSA 4FIDA 4H77A 4M6WA 5K4GA 2VLBA 4NXNB 4JUBA 3CZAA 1A95A 4QT4A 5LKRA 1JKIA 1GCIA 1Z2DA 4ETMA 1CQXA 2DHDA 2QUJA 4NG5A 4WMLA 2VJDA 1QYWA 1NG1A 2COUA 3OCJA 3S44A 2WIKA 5C46F 2ZJ4A 3MUNA 9LDBA 4IPTA 1AUQA 1Z56C 5DTIA 1R12A 1J0DA 1T13A 3F67A 3JY6A 5KJ1A 2WBLC 4PXSA 5SICE 1EFVB 2CLHB 3EGWA 4KX3A 3LP8A 4IAOA 5CXUA 3AIIA 2IW1A 3F8SA 4U7WA 1EJ2A 3N0TA 3GK3A 4OXIA 2WA1A 1IVYA 1TZBA 2PXAA 2BF7A 2PZAA 3I73A 2F43A 4M8LA 2C88A 1NBIA 4WK6A 5JNSA 4S0XA 1QFJA 2NZYA 3PXEA 1UKEA 4QOEA 1T5HX 2O1WA 5FBQB 4C01A 1NWHA 4QQKA 5A4FS 1L1EA 3G1UA 2HZ7A 3NDJA 4GEKA 4UVHA 4NYIR 3FGOA 4UTOA 1OR8A 4PANA 3EPLA 1KDOA 3ORRA 3UGKA 4HFJA 4J16C 4JXJA 3TLZA 2VI5A 4EG4A 1NASA 5SZJA 2O8CA 1A9QA 1MA0A 2IH2A 4EHKA 3Q3EA 1YOVA 1PN3A 5DN6D 1DAMA 1ODIA 4PBTA 4TM7A 1J0CA 5JIBA 4KPYA 1ZUHA 4K6CA 4MKIA 1T24A 2O8FA 2YWFA 1THZA 4Q1FA 1A7KA 3CF4G 4TMYA 4OFZA 1QGUA 4YO8A 3WV5A 4NPCA 2JRLA 1N3BA 1RWPA 2Q29A 3AVQA 1VHDA 4XVRA 1ADJA 1M5TA 3P71T 4UAVA 1Y0BA 3OJWA 4RC9A 2XLCA 5E4JA 1P3DA 1KI4A 2VYND 3CZ5A 3KK0A 3ZDDA 3C5HA 2J0VA 2ZQZA 4PTZA 5KHOC 1YA6A 1N8SA 1NW7A 5BP7A 3AMVA 3AVXA 2H51A 3W1WA 2HQBA 5C9ZA 5D7NA 4B5LA 3DBVO 2IGTA 1KH3A 1DXQA 1OA1A 2CFTA 3U3JA 1GPDG 2QV7A 1G5FA 3DE5X 3S1LA 1H3EA 3WMWA 3QWFA 4MJ7A 5J9FA 4RCZA 1NXQA 2XXAA 3CTPA 3U3MA 4YIHA 3CUTA 3UUFA 4EJ0A 1CQWA 4HNAA 1LPPA 4C2AA 2DU8A 2J4FA 2JIZD 4OCZA 2RE8A 1ZH2A 4BUCA 1QIEA 4LOJA 5EZYF 4DCMA 2OCKA 4ZVPA 1BMDA