5CFQA

Crystal structure of anemone sting (nematostella vectensis) in complex with 2',3' cgamp, c[g(2',5')pa(3',5')p]
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
180
structure length
180
Chain Sequence
NVADGLAWSYYFGYLKFVLPELEKQIEKTSKFRSKEKFVKKMFILIPSNCFWDDKIPGSDYDPQNRITFEGNTEPLEKTRGGVFLRHYKHSVYEIKDGENEPWFCIMEYATPLLTLYDMSVAQPGELSREERDAQVVVFLRKLQDILEGDRACQGKYELVTFSPDRDLADVMLRKLKDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Immune system
molecule keywords Stimulator of Interferon Genes
total genus 48
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5cfqA02
4KBYA 5CFMA 4F9GA 4F5YA 5CFQA 4KSYA 4LOIA 4LOJA 5CFLA 4F5WA 4QXPA 4EMUA 5CFOA 4QXRA 4EF5A 4LOLA 4KC0A 5CFNA 5CFRA 5CFPA 4EMTA 4F9EA 4QXOA 4EF4A 4JC5A 4LOHA 4QXQA 4F5DA 4YP1A 4LOKA 4F5EA 5BQXA
chains in the Genus database with same CATH superfamily
5LXTF 2WIGA 1EVJA 1B7GO 4I1PA 4FIDA 2I7VA 3OMLA 4UBNA 2P77A 1NU6A 1V6CA 3E8MA 1L8XA 1O3YA 3Q8LA 5IFKA 4CMHA 3GOHA 4RA9B 4WFIA 2FE1A 3O84A 1LJ8A 1QFZA 3GL9A 1JA0A 4ZD6A 3RRXA 3AWIA 2B83A 3DBIA 2MMGA 4IKOA 5ERGB 3QUBA 4WCVA 3RVJA 2JIZD 1KI6B 1ZUD1 1QS0B 3BTVA 3CO5A 2GDZA 2FX2A 3KTFA 2D5BA 4OX9Y 3ETHA 3IDZA 3TUJC 2CK3A 4UZFA 5LP6B 4QJIA 4MGEA 3JQEA 1KZ9A 1Z22A 1CUFA 1AX9A 2J7PA 4BNWA 2J3QA 4DSNA 1LBIA 2OMKA 3VJKA 1AA6A 4G63A 2B8NA 3LXRA 4IO0A 4PAWA 3OA0A 1NAIA 1O6FA 3BFKA 1U8ZA 3C16C 5DDIP 3VA7A 1FSFA 3UOGA 3GIWA 3GLGA 3HA2A 4URXR 1JJFA 3T7KA 1AV6A 4QU9A 1PKXA 3BEOA 3P2YA 1S3GA 1A50B 4KZKA 4LWZA 4E14A 3ONNA 4RSRA 4V0NA 3WJ2A 3NANA 4FYJA 3DLIA 1E99A 3FPGA 1NUPA 3H9JA 3JD2A 1RPTA 1T8WA 5IP5A 2Y1KA 1DNPA 2OLJA 4PG5A 4LY3A 3F1LA 6NULA 1EX6A 1WPRA 3FDIA 3HJRA 2ZW9A 2PN1A 4KRXA 4MJ7A 3SJZA 3A1TA 3H2IA 4N5LA 1T2FA 4UD6A 4WIAA 4NCNA 2N9UA 2NZVG 2I6TA 4RHTA 4DN6A 4E2ZA 5IHXA 1H93A 2FFHA 4F4HA 3NMUF 5BWOA 4WA7A 3WTBA 3BK1A 1JFRA 4X63A 3VR4H 3FFWA 5ALXA 4D6YA 3P2JA 2ON6A 3W1WA 3KJEA 4HMQA 2QTHA 3AV3A 1IY2A 4Z7JA 1DKQA 3RJTA 4ZHQB 1YUMA 3ZYZA 2AK3A 1I01A 1V1RA 3LGAA 3QPBA 4DG5A 2PH3A 4KMOA 3V4RA 3V7NA 1VTKA 1N3IA 4EITA 1ZINA 1YZLA 4K9PA 4ZOLB 2QV7A 3OF5A 4AKSA 3B7GA 4N5IX 2FSGA 2XDYA 2J32A 2HBZA 5EJIA 5A3VA 5CA0A 2XGMA 3RGWS 5DXAA 3DE0X 2ZRQA 1G3MA 3WYGA 3LS2A 3ZX5A 1A8HA 5F76A 3NNNA 2CJWA 4QZVA 3CC8A 4EARA 1JHVA 1XXHA 2B7LA 3QOYA 3PLAE 2OKGA 1UQTA 3BGIA 1RXCA 4KDFA 3EXEA 1XU4A 2JK1A 1DAKA 4A5OA 1WZNA 1SVSA 4I1SA 2YIJA 4O29A 4BMVA 1XXHE 3LBYA 3LP8A 2Z1MA 1ESCA 3FVQA 4AF7A 4O4IA 1WCXA 3EDRA 3WQHA 2YCLA 1E62A 1A4UA 1HEYA 4B75A 1GL9B 1I2MA 3H86A 4UATA 3LLMA 4R2KA 5DHQA 5JJLA 4YRBA 5F3RA 2EGUA 3CZRA 3D7KA 2AOTB 3VNSA 5CA1A 4K6GA 4D9MA 5JISA 3HK2A 3FD8A 1EX1A 1GCGA 1TJ3A 5K8JB 1F7VA 1VYTA 1P7PA 4C43A 4CUKA 3O95A 2D1SA 4YAJA 4YACA 1QIMA 4MRVA 4LSGA 1L4YA 2LXNA 3WWYA 1ZS9A 2HQRA 3QUTA 3SJAA 3I6IA 2VUUA 3RFFA 3T3NA 5LKRA 4B3DA 1P2UA 1G21B 1PT6A 3A2MA 3D7LA 3EIHA 5DCYA 2E4ZA 4DLAA 3KXPA 3ZY2A 5LMUB 1TT5B 3V4SA 1PFGA 4LZJA 1PR3A 1TZMA 3RU2A 3UJ3X 4F7WA 3MJDA 4NARA 3RG2A 1PHPA 4DCTA 4XR9A 1NV8A 5L3RA 3WLPA 5LQDA 3ZTWA 3MAJA 2FFBA 4FGUA 2YV5A 3IP6A 1SQFA 3OI7A 1N8KA 3VPXA 1HLDA 1PGJA 3LL7A 4F2GA 3V8PA 5EJEA 2NUTB 4QTXA 1N9GA 2XT9A 4HVLA 4EYOA 3AUYA 5CG1A 1CEEA 4CG0A 1RXEA 3QHQA 4FDAA 4OXYA 2HIGA 4UZEA 5KU1A 4CR8A 4JJKA 1WRBA 1YA4A 3U9TA 4YH1A 4CDMA 5BN4A 2LPMA 3CKKA 4RK4A 5IKXA 2QLJA 4Q12A 3FNRA 4EJ6A 4MS4A 2WEKA 4DJFC 4WXPA 1ETHA 2IUUA 4CTOA 3LQ4A 1OZGA 1G8PA 2GN6A 4I4IA 2HNKA 1E2QA 4D3YA 1YZ3A 3VJLA 1R37A 5LZ5A 3ONDA 4RZSA 3BJZA 2Q21A 5BY2A 1Y89A 4I3FA 5F78A 3TM4A 5EEHA 3L04A 5K0EA 1H9CA 1F2TB 1KP2A 4Y2XA 3V4PB 1IQUA 1ZNYA 3AEKA 2Y0DA 4EKGA 5LWQA 5EVJA 3R3ZA 4JB0A 3ZK7A 5CT6A 3EEFA 1DKPA 1ZC3A 2C7VA 2ID9A 2P0YA 3FMOB 3R9IA 2HYDA 4L27A 5BQFA 1DLIA 2I1WA 3TM5A 2C31A 4AJOA 4BWVA 3GEDA 2QRMA 3RYFB 3W2EA 3JRXA 4DEYA 2UXCB 1A71A 4Q4JA 4FWBA 1XZBA 1DUVG 1UC5B 2NQ2C 3P2MA 3R7WA 1G21E 4EO9A 3LTEA 3QWFA 2PQ0A 3LCCA 2OCPA 3LHIA 2B4RO 4QL3A 4Y1GA 3SQOA 4DMCA 1RM5A 1YJ8A 3P1JA 4GR4A 4M49A 3NU1A 1GTMA 4HP8A 3KYCB 1YE8A 1W4LA 1ZC4A 4ZHQA 1KYZA 1Y4ZA 5AVJA 5AQ1A 1GVHA 3NRJA 5K05A 1Z4JA 3AP3A 4YPOA 1IN1A 1GCOA 2QTBA 4WVFA 3TZ6A 4QRHA 3TF5A 2HU7A 3PXGA 3EA5A 2IYEA 2NSLA 4UFNA 1Z16A 3PSHA 4IVRA 3MTBA 4PNZA 1ECJA 2F7SA 1E96A 3JRWA 3PUJA 5JLAA 3AHEA 5K0LA 1XZGA 4GC9A 1EDBA 4BX3A 5C8ZA 1UH5A 1WXIA 2H9YA 3C8UA 3GCZA 1AQ6A 2H4YA 4XDHA 3TIVA 1Y9ZA 4KX3A 1NG1A 2Q3FA 2QQ0A 3HB0A 2HB6A 2JGAA 1OASA 4FMPA 1OYOA 1YHYA 4KQ6A 5ALYA 5GZ1A 4EYGA 1F1BA 2R8EA 1FFDA 3NTOA 4M0LA 1YULA 4BFTA 5LQUA 2DX7A 3G49A 2UYHA 3GCGA 5KWSA 4W7IA 7REQA 4U7TB 3ETDA 4MP3A 3D6TB 5K8CA 3KQLA 3WWDA 3HB1A 4E6PA 1J56A 2CXUA 2FPKA 3CVOA 4R9SA 2J48A 4Q3KA 3RVQA 1NM5C 1RLUA 4FNGA 4I6GA 4V0QA 5AKJA 2PMFA 2N47A 4P35A 4YCMA 4ZAXA 1YMVA 3OEHD 1X1RA 5G41A 2CXNA 1H9BA 1OFGA 2Z5VA 1AHIA 3H83A 2YV2A 1TTQB 1GSHA 3QY9A 5ER6A 2B1GA 2I2WA 3LVFO 2XTAA 5TSDA 1FDIA 4P7BA 4YR9A 4FI3F 1Q7EA 2BVNA 3AF2A 2ORED 1OH7A 1YJBA 2CHGA 2TSYB 1TRKA 2ZOSA 1H85A 1VMKA 3EXHA 5GZ3A 2O4UX 1DBVO 2WSLA 4WK2B 4D0GA 2PX2A 3GN2A 4BO3A 5AUNB 2FXVA 4K26A 2WWWA 3CZCA 3LK7A 2B78A 4LPSA 5B3JA 5A71A 1XVAA 3MINB 1L5MA 2VJLA 1XPJA 3BMCA 4DDHA 3DVSX 4CQNA 4PQGA 1L4HA 2B1IA 4YNBA 2JS7A 1NT4A 1W6RA 4PFQA 2EU8A 4HWOA 3PG5A 1NY5A 1UFQA 1Z13A 5FULA 2AC2A 3TNDA 2OZKA 4LJ7A 5IYZB 4E12A 1N57A 4J1TA 5GVRA 1WOYA 2WHPB 3E81A 4FZVA 5A5EA 3BRSA 4ZOLA 3AI2A 3IQZA 1DRKA 1JKJA 3CW9A 4JYMA 1FFYA 1DRWA 4JA2A 2NTJA 4EABA 4F2WA 1QH1A 1WR8A 3MWDA 3W7BA 3A32A 3WGIA 3AW8A 4CNBA 1TD1A 4E88A 4JKYA 4AICA 1I51A 5JPDA 2I03A 4YHBA 3MOSA 5JDCA 3EAQA 3HB9A 5AT1A 2B6NA 5KKAA 2O8CA 3TCKA 4F93B 3R8XA 1MIOB 4AQYB 4KJZA 1NHWA 1E9FA 2PXXA 1CXZA 4U2CA 3MCZA 2VK8A 4EB0A 4ARSA 1QIIA 3DCNA 3MD0A 5FA8A 2ZETA 3KJNA 4G5FA 3JQAD 2GUGA 3U6KA 2GCPA 3FYUB 1X8XA 1NZFA 1TVKB 4HMOA 3WWOA 3R6GA 1XD9A 2CF5A 5JOQA 5C32A 3KZVA 4WZAB 4L51A 1Q77A 4RA6A 2JANA 5FLEX 4JAVC 2ZR8A 3G2PA 3ZCSA 4FYYA 1IQPA 5AVXA 2G9VA 5JDIC 2GEKA 4EG1A 1SU6A 2V7BA 5BYBA 1H1LB 2HMWA 2CHEA 4MWEA 4L28A 3LK6A 1LTKA 3OC0A 4R5MA 4FYWA 4KH1A 3ZU4A 5CFRA 2NM0A 1SXHA 1STOA 3PFBA 4JC5A 4ZO8A 1KU0A 1SVWA 2YQ4A 4M36A 1HDZA 3CU5A 3ZDQA 1BGXT 2G5PA 4A8HA 4EZIA 1EKXA 3A7EA 5BSFA 5JXJA 5DYYA 1DX4A 1NMQA 4NHEA 1R0BA 2IODA 4KBFA 3GUVA 5AM4A 5J63A 3ZOZA 1DL5A 1R50A 2Q07A 2GZ2A 3RNLA 2FW9A 2FSVC 4QA9A 3WGMA 4ED9A 4JJEA 3I5XA 3VR4A 4BQOA 3ZKWA 4EI7A 3W0LB 5EFZA 1AKWA 1R3DA 3DFZA 3FOBA 4V1CA 2OWDA 4GO1A 1IN6A 4M0CA 5CU7A 1CS0B 4OJKA 1T5BA 1K88A 2C5AA 3DBRB 3KYIB 2PZGA 3AFHA 4MKZA 2GH1A 4CJXA 2HYIC 1Z6GA 4P4GA 5IFLA 4RU1A 1G2PA 4YRJA 5BQPA 2DBVO 4PYQA 4HRVA 1SCQA 3B13B 1DI0A 3RSQA 2NLOA 2X0IA 2ZIXB 1E2FA 3PYXA 1YJ5A 2JGMA 3B85A 3LM8A 4PYRA 5H4HA 4KN8A 4B8YA 1GNQA 1R0RE 1X80B 2F3QA 4F96A 3F6YA 2X5NA 3GQVA 4URWR 4F5WA 1MN6A 4INPA 5KJ1A 4HQLA 5IM5A 4WACA 1RKBA 1N4DA 5BR4A 1URPA 3LAWA 3UJ7A 5C1DA 4EYSA 2JLUA 1OVGA 2EG5A 3RRJA 4NULA 3O93A 2AKYA 4QJ5A 2NYRA 3HJCA 5ELLA 1Y1LA 1LPSA 3GOQA 3UZUA 4P3NA 3V55A 4YCSA 2NGRA 3GRKA 3RT1A 4A0QA 2POCA 1ILEA 2JLRA 2Z8XA 3A58B 3FN4A 4M9QA 5E8RA 5MHTA 4TKVB 2WV9A 1RPJA 3K0FA 3VKVA 3WYNA 3HY3A 1N92A 4GEKA 4I5DA 1X1CA 1F06A 1TF2A 4COOA 3TKYA 2QM8A 3BVPA 3D8TA 3R6TA 2P30A 1BC5A 1KEEB 1GKKA 3H1PA 3L49A 9MHTA 1GSIA 3FTQA 4CU2A 4BTVA 4ZQIA 4FCCA 4K6FA 1BD4A 3BM5A 2H00A 1XD8A 2PBLA 3BWCA 4XM0A 4R71A 3OTOB 1U0BB 3VUEA 4H4EA 4RQAA 3WNBA 3F74A 5CB6A 3UHJA 5HF8A 4DNQA 3AHGA 1UAGA 2NW6A 4GRDA 4Q9LA 3ZQKA 3R40A 2HWUA 4Y8VA 4ZMBA 4AJ4A 2QT9A 1UWCA 2Q9AA 3IT1A 4QXQA 5FUBA 4B6RA 4BMOB 4DIMA 2Q46A 1UP7A 2X8BA 3RJZA 3QUAA 1EA7A 3N2YA 4KLZA 2PH7A 2G25A 2QG6A 4RVSA 4ZGGA 1WHTB 3UAZA 1OAOC 1UT8A 4OATA 4LUCA 3KKQA 4CCWA 4RWEA 1LDGA 4K0KB 5L51A 1JALA 3EA0A 4GNKA 4HY3A 4BDSA 5ES3A 1NAHA 3D5QA 3CVWA 4I8DA 3AB8A 3WMWA 1G63A 4FW8A 5FORA 1UBTS 2VA8A 1ULHA 3I37X 5GAJA 4BEBA 1WXEA 2V8BA 2O8FA 1RHUA 2R7LA 2VS1A 2VSYA 4DUGD 3T4PA 5D6OA 4NABA 3VZDA 2K87A 5JS1A 2GVDC 2YJ4A 2Z2YA 3RS2A 4FCWA 3VKFA 3CBQA 3NBXX 1V35A 2YIVX 3IQIX 1RYHA 4NZOA 5F9MA 3EZFA 5JHGB 2FHPA 2RGDA 3DLCA 1DKMA 5AVWA 4X62B 4B3SB 3RWBA 2Q6OA 3PXEA 4ZO7A 1S4MA 3SHTA 3U16A 3LQ2A 2OCKA 4GMGA 1VBNA 1SVLA 3BXGA 4CMBA 5LOVF 1USWA 4P0PB 1RTKA 2ZULA 1ISRA 4OGLA 2EL9A 5CBPA 2ZXUA 3NT4A 3PWSA 1O4VA 3GG9A 5B57C 1QH8B 5IJ9A 1F6DA 1DIAA 3I0MA 2FCRA 4FFLA 1DEOA 2AFIE 3OKAA 3AF3A 4HH0A 3T3EA 4D4HA 1NRXA 1LX6A 1IBCA 1WUKS 3FFAA 3JRNA 3JQ7B 3QX9A 4IGFA 4YRCA 5ILQA 3R75A 3VU1A 4OLBA 2COKA 3JQ9A 4RKQA 5LA6F 3E4CA 4UQOA 4WLUA 2F67A 4WK4B 1GSOA 3SF0A 4KGXA 3V1TC 5IUJC 3FVWA 3LBFA 2BMAA 1SK8A 1T0IA 2KX7A 2WVJA 4MK4A 2BF4A 2Q1TA 4ZALA 2FSUA 1I4LD 3AFNA 3UKJA 4ENSA 4ZIRB 1MAWA 1TQDA 1MHPA 4YX9A 3GJ5A 2RONA 4INAA 2HZBA 4EMSA 4WY5A 4H3HB 1NYQA 3NWOA 3DGFC 5KTTA 1GYQA 1FQJA 3RVBA 2C4TA 4D9KA 3JASA 3O9MA 1JWAB 3JARA 3PX3A 2G08A 3VJMA 1W87A 1QG4A 2I4MA 5ALSA 1A95A 5JYBA 1VLLA 2DE0X 3ZU6A 1P7VA 4GI5A 4RZ2A 2H5JA 4YYZA 4KJXA 4LJRA 2V98A 4V2UA 1SH7A 2G71A 2J9ZB 1X92A 4GI1A 2Y05A 2YW2A 3P9YA 3CKMA 2ZIUB 2FN7A 4UEQA 2TMGA 3G0OA 1SXIA 2EFHB 4HQKA 4B4VA 2O4CA 4MVJH 4EJSB 1JMKC 1V6AA 3QU5A 4TMVA 3TKLA 4D9JA 3KZOA 1L7RA 2IYQA 2EC5A 2YZKA 2YYYA 3LX5A 1G7TA 3BRCA 4BB6A 4C3OB 2I91A 2DYKA 1PGNA 1J97A 1KYVA 5F33A 4OHWA 3J7TA 3SVZA 3PHCA 1CY8A 1EQUA 1OX6A 1RQPA 1OILA 4P93A 4YALA 1RBMA 5KX5A 3I2IA 2OOSA 4PX5A 1GM5A 4H7JA 1IC6A 3KCNA 4RKFA 1YBVA 1DRJA 2O5VA 5LC1A 1L5GB 1ZICA 1N2SA 4UE6A 4DIDA 4H0CA 1X38A 2LDBA 1JV2B 3DZGA 3EXAA 3A8TA 1SA0B 4DA6A 1K8ZB 2NU6A 4TL7A 1VKNA 4ZVSA 4Z8XA 4YUVA 1YGYA 4G2NA 5B4VA 4I55B 1Z8DA 3T3HA 1L8QA 1TCUA 3JS5A 1LPNA 2UXBB 2RKBA 1HYQA 1HH4A 2AA3A 1LI4A 2CJFA 3L4BA 1EP9A 2O8EA 3TOCA 2K4MA 4KFTA 2OENG 2FW1A 3WYEA 4EUFA 4TV9A 4ENQA 2QTTA 1NU8A 2BCJQ 4PXAA 5ADVA 5HZHA 4OI4A 1R8XA 4NE7A 5C4GB 3T3DA 1QE5A 2R96A 1XZJA 2XBUA 3ENVA 4IIXA 5KNBD 1HLPA 4D8XA 2XKJE 3AV0B 4BGVA 3GLFB 1AUVA 1DQRA 2C84A 4D2IA 2DP4E 1V1MA 3O1JC 1C8BA 3VH4A 2J3EA 1J8MF 4B4WA 4C08A 3ND7A 2J85A 1JI0A 5IT4A 2DHQA 1T6ZA 4OA5A 2M6LA 3P9CA 2X6TA 4KEAA 2VBFA 4QXPA 1Y1TA 2WSSD 2AI1A 1XLTA 3E22B 3VPCA 5BRAA 4JLMA 4DJJA 4PPNA 4JXJA 2PZKA 2A1TS 3LWBA 4PANA 1EIWA 2WU0A 3GRUA 5JJBA 3A0UA 1NBWB 2R7NA 4OKNA 3HDYA 4P08A 4PO3X 2DPMA 4IS3A 3V1KA 2CDCA 4HH3C 1YBFA 4EG7A 2I8AA 1N25A 4HRXA 4Z6KA 5AOVA 5HM8A 3QXGA 2WWGA 1UK7A 4FHFA 5H4GA 2VN8A 3D31A 4GQAA 4U9HS 5A4AA 3J80A 4XQ0A 3GA7A 3IR5A 3SJCA 2KI5A 5IT0A 1J2TA 3ORSA 2VRWA 5C52B 4QGFA 4XGQA 1RWNA 2IEYA 2X0RA 2DBZA 4ZZ0A 1C3XA 1QHYA 1KO8A 1VSQA 5JH7F 1F3LA 2HRBA 2WFZA 2QGZA 3G8DA 4GPAA 4QAQA 3IUSA 2HDNB 4IJ6A 5ALNA 4AB1A 4BNVA 1XN1A 4DCPA 1RYDA 3NEAA 4PZLA 4PNPA 1FVHA 1IBRA 1ELOA 4HMPA 3W9SA 4FI3C 5DN9A 3GLHE 1NBHA 1S02A 2ZEJA 3V1NA 2NVUB 1G55A 5D5QA 3D2CA 4X60A 1QCZA 1XK6A 1UZUA 1X15A 2GF0A 3LP6A 2GAIA 5KJ6A 1UIMA 5EPOA 1CEYA 5IT9A 4N47A 4ARIA 4BO5A 1VOTA 4OTZA 1JVSA 3A1CA 1N5OX 3TYXA 2VPYA 4TTIA 1SBTA 4LQLA 1DDIA 1PI3A 2OOKA 3HDQA 4EUSA 2WU8A 2N3ZA 1VCHA 2XMBA 1YZQA 4Z3DA 3UMVA 2WQ6A 2FK7A 3B36A 4HDRB 2FPXA 4WNCA 4BE4A 3EXFB 1RRMA 2N1MA 1IAQA 1E1CB 3FNBA 3EOAI 4XD7D 4C07A 4FEYA 4KITB 2GCOB 1WSBA 4GUDA 5I7HA 5LLSA 5JD5A 4ZJZA 2XW6A 3E5NA 1HETA 3AM4A 4YRRA 2IYWA 3E9CA 1XCGB 2JAWA 1S8FA 5H3CA 4XUGB 2O8NA 2C58A 3G0GA 4ABYA 3HA5A 2LIPA 3H11B 2E82A 3LRTA 5H81A 2WMDA 3NVKI 2XR1A 4QOJA 5IKOA 2I4TA 2FR8C 5CDSA 3I04M 2P9QA 2ADOA 3VC7A 3K94A 4A82A 4AY5A 5KOJB 4ABTA 5ESWA 2WRZA 3S29A 3AX6A 4NDAA 2HT6A 3BHNA 5T8KA 2CB9A 3FCOA 3ZX4A 1DJOA 3WL3A 4G5GA 3WA6A 4DVJA 5KBYA 3VMMA 4YRAA 3A2KA 1RJDA 4NXNB 1CZNA 1UUFA 1ODFA 2VH2A 2FKNA 4DCUA 5CFNA 5KTKA 3QELB 1LFAA 3OKFA 3DMPA 4U5XA 2ZIAA 4UTNA 2FFQA 2HR1A 3LFUA 1NMEA 3PE3A 3Q6IA 2PO5A 1GGJA 3P9KA 2Q7DA 1U2DA 2PMDA 3CLHA 3PDIB 4IJKA 1NNLA 2D13A 2W6PA 4ZTUB 1J24A 2QNIA 5K3BA 4PSUA 1KK2A 3TNJA 3RHTA 3UOAB 1A8SA 4BJ6A 4K6HA 2XCQA 5CB4A 2W2KB 2DXIA 2LD4A 1RZRD 4ZZ2A 1Z0KA 5JI3E 5IYZF 1A2BA 4DCCA 5JQGA 3AGQA 5TQ2B 2NYUA 1VYHA 1TJYA 1UBHS 4LTNA 4QOHA 5AI6A 3RU7A 2I66A 1SBHA 1SN7A 2FUKA 4X8HA 4GT1A 2W2VA 1KEKA 2XUDA 5JCPA 4FYPA 3C87A 1A04A 3F9RA 3C6MA 4IHJA 5ICEA 4WBSA 1JVBA 2J0UA 2LTAA 4BO8A 3ONFA 1Z82A 3CNOA 3PWTA 3NFRA 5LZ4A 3FZQA 1ZU4A 1MNQA 1H2WA 1YKSA 1ZGJA 2PRZA 1QK3A 4J49A 1K5HA 4M1ZA 5FOUA 5H68A 2WTBA 1WW2A 4MCAA 5DI9A 1VLQA 1HFJA 1YGPA 5CPBA 2EKQA 1DKUA 2XSZA 3RYHA 3G0IA 3DW1X 4J8PA 2ZRNA 4AUNA 3Q7EA 2QMYA 2YJTD 2JAUA 4TYPA 2CXSA 4EAQA 2BKEA 1EE2A 4LRQA 4OHCA 3AVOA 4MULA 5AOBA 4EPTA 1GR1A 1VA5A 5B2FA 5BOSA 4MVJP 3ENKA 5K0NA 1C9DB 5D51S 1ECBA 3GRYA 4HPJB 3RC3A 1JAXA 3RK0A 5BXYA 3JX9A 4V0ME 1U90A 4QAJA 2GPNA 5DTMA 5K1ZA 3K6KA 4JEIA 3KKNA 4G0XA 4R2LA 3WL4A 4CL0A 2AC7A 2JJ2D 1RHRA 3D2BA 2BBSA 1G4AE 3QV2A 4OOFA 1HUQA 3IMKA 4RDCA 1DC5A 2WYVA 5B4TA 2XE4A 3OOHA 4BRZA 2ZI7A 1XWWA 1XNRB 1E2BA 4EY8A 1O6ZA 2FDXA 4MAMA 4YROA 4BXOB 3ZJ4A 5DBEX 4EZEA 1OREA 1ZK2A 4JX9A 1QHEA 1IXKA 4R16A 4PZYA 4BRUA 5ALIA 3SBDA 3DV0B 1DKLA 1OI7A 3ZBUA 4ZVQA 4ZVUA 2EHDA 2I9PA 1KAHA 4CQMB 1PJSA 1GL6A 4UHHA 3FNIA 3AHCA 2FKAA 3H1BA 3SHOA 2VYQA 1CT9A 1W52X 2AZTA 3OT5A 4NAHA 1DELA 4DLLA 4CEIB 2JASA 4YRFA 2VHCA 3KELA 3T1HB 1WUTA 1GG9A 1XP8A 1KJQA 2HJ9A 5CHYA 4WXYB 4RTOA 1P77A 2AMFA 4TL6A 2I2CA 2YZ2A 5DRYA 5H1YA 5E7JA 3EPPA 1U7TA 4MS1A 3GLIB 3ZE2B 4X3CA 1T3ZA 3CJQA 4I1VA 3BMXA 4QNRA 2ZB3A 4BPBA 4LNAA 1YACA 2JI8A 4XPIA 2C9CA 3F3KA 1PV2A 3RSHA 3CG4A 3SSMA 3LVBA 2IF0A 1DO0A 3BWXA 2QMQA 2IELA 5TQVA 4KMSA 2WUGA 3GNSA 2QTWB 5AW0A 3HSKA 4PYOA 4CKWA 1DC6A 4OK6A 4H6PA 3DL4A 3M6IA 5KWIA 1BMDA 1KQFA 3PQ3A 3P7MA 2VJDA 4YBRA 4QXOA 3G2OA 4KR7A 1LDEA 1D7AA 5EKUA 4L9RA 4EB6A 4PZDA 3M6LA 4LTDA 2C4KA 3ZCRA 4MRMA 2XHZA 3FWPA 2R6JA 2F00A 4ND1A 2HCRA 2BGRA 2YXEA 4U7FA 5CD1A 3WQQA 2VBGA 2F43B 2GK7A 1Z6QA 3V2HA 1TE2A 3A2NA 3AM3A 2E49A 3QEJA 4MUNA 4N3BA 4X97A 1NRIA 1CR4A 3CONA 3PENA 3GW8A 5DEIA 1JEAA 1II8A 4YMSA 5AM1A 4G5YA 2CDNA 5AI9A 1K89A 2EJTA 3U2QA 3KSAC 1XP5A 4YY3B 1H8HA 1C1DB 2JD0A 2XOKD 2R2GA 1FNNA 3OQJA 4LRSB 2JD2A 4HXYA 4PAMA 4UBLA 4B6FA 4ZGBA 3EBOA 3G2JA 3NHLA 1L9KA 1OGYA 2XV1A 1GAQA 3E82A 2C3MA 2IP1A 2Q2NA 2L19A 3GF4A 1NYRA 4WECA 1ULSA 2R86A 4BV8A 1ZX1A 2VZEA 5A5FA 4A73A 2X6QA 3LPCA 3KG2A 3H6GA 3PC7A 4ZIRA 1LK7A 3R4CA 4TXLA 1QVRA 1E69A 1UXGA 3G5MA 1CZRA 4HWPA 1Y1KE 1YKGA 1ZRNA 4EA6A 1P9LA 1RRPA 1YF3A 1M1NB 1V3QE 4XYEA 2HA4A 2R7MA 4JASB 2UXDB 4A6DA 4CV3A 2IGTA 1JA1A 3LDGA 2QZ4A 4B3XA 4LF6B 1YVPA 4RYDA 3LP5A 3R3JA 1NWCA 4L72A 3NYWA 1QCYA 1KL7A 2YHAA 2ZSFA 2REQA 4FJ2A 4PHCA 5HG0A 5KIAA 2DHDA 2CUTA 1NI3A 2P6UA 4KXXA 4HB0A 4L8GA 4FYIA 5TR9A 1X14A 3T61A 4J0HA 1WP9A 4CM4B 3RO7A 2HIAA 4ND2A 4CEJA 3LPDA 2CVZA 1L9XA 5CM2Z 4ARZB 1CUZA 1P3DA 1WY7A 1MOZA 2EBFX 1ODJA 1DOZA 1N3YA 2V65A 2I4NA 2V7VA 3L92A 3N86A 3WSVA 1ZBDA 1D2HA 4ZFNA 4HVTA 5I9BA 4RGVA 2ERYA 5I7AA 2AUMA 3NV9A 1G4UR 4DY6A 3DAYA 5J47A 2OGSA 4BB5A 5BWCA 5FNVF 5I7WA 2D74A 3HFRA 3PXDA 1VQ1A 9GPBA 1XCBA 3BMNA 3TL3A 3NS7A 3I6ZA 1TCAA 3UHFA 3GJXC 3UMCA 3TD2A 3M3PA 5K51A 5MFPA 3KSBC 4IIJF 1JU4A 2G76A 2GN2A 3GPDG 4IWXA 4QQKA 5DOZA 1GQ2A 1DZIA 1XVUA 4Z9BA 3UK6A 3JY6A 4P4SB 3NRCA 3QLJA 3V8QA 1AKTA 2C2WA 4UUPA 2WUDA 2DFDA 1AHPA 3HUUA 2WWFA 1TGYA 1E2DA 5KTNA 3QFCA 3CY6A 4O2BA 2F55A 4Z0HO 4CI9A 1BH6A 4Y7DA 1L3IA 5FNVB 2X42A 2Q3HA 2ZVPX 2VWQA 3KLMX 1YTLA 3ANXA 1ZNWA 3ODGA 2E55A 1L1QA 4QASA 4CEHA 2VQ3A 2C9OA 4UHBA 3N87A 2X0KA 3A36A 2LW7A 4LJ9A 4FFWA 3LI2A 1R0YA 4UHDA 5BT8A 2NTNA 3RHSA 1TYZA 5E1BA 4Z8YA 1AF4A 4Z9XA 1ZJWA 4WLEA 1BVYF 1E3WA 5DYIA 2PRYA 1NX6A 3ZHTA 5JNLA 5JMPA 4DB2A 2O54A 2NYVA 1ZFNA 2WMNB 4DAEA 4OFXA 4LECA 2O2SA 4P80A 3PV0A 5CVUA 5IDWA 3BORA 2QVGA 4HLNA 3SGLA 4MGYR 4KUEA 6CHYA 4IUCS 4A5SA 4RZIA 5TPZA 3FSRA 4EKIA 3KQKA 4RGQA 1IHOA 2ZB7A 5IC4A 2AG1A 4IDQA 4X9XA 1NIPA 1RP1A 2AJCA 2G06A 3GT7A 3OESA 4TRRA 5E9JA 2QX8A 2JCXA 3QVGB 5EUQB 3PL5A 1W49A 4CQMD 2DEUA 1AT1A 3ZGXA 1M2WA 3BDIA 4HSGA 1MH9A 4K9RA 4NQZA 4NE2A 4RACA 1KWKA 1RW4A 4E1BA 1JR3D 3K6JA 3E1KA 5CYOA 1UODA 3F6PA 3VR1A 1X80A 2O2ZA 3RU3A 2NO9A 4MPPA 4RFVA 1F17A 2A9JA 2OUKA 2R48A 2LVBA 2WA2A 2MCFA 1T4DA 4P6VF 4FXPA 1RI5A 3ETJA 4FC6A 3RS5A 2LZ0A 4BAGA 3EAFA 2FLVA 2W90A 1LLCA 2XVYA 4OI1A 4PCLA 1JDBC 1QVVA 4BFVA 4Y1FA 3T9DA 4CQJA 2PPVA 3OFND 4YB8A 3S27A 3JAMA 3ER6A 3W4KA 4JLUA 3K9BA 3D8NA 2R84A 1UXIA 3RRFA 3SSNA 2JJ8A 3PE6A 4HXFB 3WWEA 2FN9A 4TV9B 1VMDA 1E4YA 4ND5A 2QTNA 4PLPA 4RVDA 1P0IA 5EMNA 3TOZA 2NNWB 2OHXA 3MT0A 3Q11A 4Q3AA 1GFWA 3AZOA 3QKSB 4O4JF 4Q4LA 2B30A 3HZZA 2R5FA 5CT5A 3UK2A 1C7FA 3EASA 3HM2A 1TCCA 3OQ1A 3O2QB 1DINA 1JQAA 1Z7YA 2H07A 3DDZX 3PHBE 4RTPA 4TXJA 1R4NB 4EJ0A 3Q9NA 4CXMA 3IEUA 3SZOA 4O2BB 3RCBA 2O2GA 2JFHA 3AONB 2ZRKA 3HLYA 5FUXA 1PBTA 2Q8QA 5KHAA 5NLLA 4AZTA 1EDDA 3LDFA 1VLZA 2AN5A 5BQ5A 3UKDA 2AHRA 3DZBA 4JBWA 3FCUB 4EPWA 3CNHA 3PNYA 1J5XA 3OAAD 5I9NA 4W9RA 1M83A 4HN9A 2IV3A 3AM1A 2R6HA 3HXPA 5JCZA 4JITA 3DBHB 2DBQA 2OCIA 1F6BA 4X3PA 2DETA 1X9GA 2FQYA 1YQDA 1YRHA 3FUTA 2VA9A 5F2EA 2P1DA 1MC8A 4UUBA 1U99A 4ZVKA 3C1UA 1VHLA 1JNYA 3FBGA 3NASA 5FI0B 2FW8A 2EKZA 1Y9JA 3CRZA 2AG0A 3GUYA 3QF4B 3NKFA 4TZKA 4KFCA 4JB2A 3F8WA 1CVIA 2QVZX 3G5TA 5CXUA 2B99A 3GVXA 2QD3A 3ENZA 4MRNA 2OYRA 2XNSA 4HDMA 1EFDN 2BKVA 1PNOA 5D00A 2RSLA 2OP0A 1MJNA 3D1JA 2ZUWA 2YVAA 4LRWA 3HB5X 4WADA 1EDZA 4IIUA 4WERA 3FF4A 4U8GA 3DJFA 2NACA 4DG8A 3GNLA 3TG8A 4L2IB 2H11A 2JLXA 1CB0A 3R41A 5JADA 3I9V6 4EG5A 1COZA 3DXYA 4BLTA 2PL9A 3BCRA 3KFLA 2C9MA 3P0FA 4G2TA 5HXAA 2P2ZA 1P19A 2H1WA 1Y33E 2HIHA 2O2DA 2HSEA 3ABOB 4QPPA 2DY1A 4ZT4A 5BMOA 2A1UA 4IWNA 5KYYB 2P9HA 4IAOA 5CVDA 1NVMB 3NXSA 4EJSA 3P20A 1YIDA 4FEGA 2JI7A 4QU8A 1YA8A 2WIJA 1E3LA 1IDN1 1N4AA 3QI2A 2DPHA 1T3HA 3FSGA 4W9MC 2RGUA 2W6IA 4TT3A 4CLRA 4KYTA 3AYXB 1XPUA 2GCOA 2WF5A 4IF4A 5JSFA 2A5FA 4BUZA 1HNWB 3PR2B 4H7KA 2FW0A 4Z4IA 1RAGA 2GXAA 1G2OA 3LSTA 4UHFA 2WAYA 1G5QA 3RYHB 1DAEA 3TMYA 3CUEF 4I66A 5D01A 3OOEA 3HSYA 1TM7E 3RS7A 2IPMA 4E5PA 3FMVA 1I6MA 5FKJA 4RZQA 2DERA 4QFDA 3HMKA 2QE7A 1E64A 1H4SA 3AL2A 3IDFA 1CK4A 5ITVA 5FTJA 4II7A 4CFSA 1GU0A 2VT2A 1U9ZA 1G8MA 2G0AA 5HKOA 4GOOD 2AN4A 1BSVA 1ANKA 1UMDA 2PRKA 5GOTA 5BV0A 3IUBA 4DA8A 3FUVA 5CW1A 2YY5A 3OIGA 3PUZA 2CT8A 1H1TA 3RWOA 2MR5A 1Z0JA 2IYFA 3I9JA 4OP1A 4XJTA 3TRHA 3HC7A 3SS7X 1Y3HA 4RYLA 3KBBA 1G21A 2B94A 2JPDA 2AXEA 3DOCA 2AYYA 4KQIA 4LHWA 5DMXA 2DH5A 2D2XA 4LF8B 3D0RA 4FINA 3LNCA 4C0WA 3MCVA 2EBUA 3G2LA 4KWTA 2X22A 3PQ6A 2HCBA 5A5DA 4CDRA 5EJFA 1N6PA 4M9UA 1L1EA 2RAFA 3HMQA 3N2ZB 1ZPDA 3HJHA 1WY5A 1PL7A 3L6EA 4P22A 4CQLB 3FPAA 5AVTA 1E5XA 1PT7A 2ZKIA 1GYRA 1PJLA 4PR3A 4R31A 3AU8A 3EQ2A 1FDTA 1K7XB 3ELDA 2OBXA 5FWDA 1I1OA 2HQOA 2ZUFA 1MVLA 1CYEA 1KRXA 4JMPA 5CM9C 3TTTA 1M2EA 1ES9A 4AP9A 3ZD8A 2QYHA 3K0FB 4OYYA 2ARKA 3DZIA 3PXXA 4DJEC 4RY9A 4BZXA 3NT2A 3FWHA 1HORA 4AS2A 4ZWNA 3ECCA 1ECCA 1Q84A 2J31A 3I9LA 4O1IA 2RK3A 4H7EA 3W5HA 2PT9A 3L0DA 1G8YA 1GPDG 1W5AA 4AMVA 2BIFA 5DBHX 1QYXA 5TQ0A 3TBKA 4IDEA 1CDZA 4BB9A 1GZ6A 3CZ5A 3K70D 5B3LA 3IEXA 1MFZA 2WK1A 2XMRA 3K0BA 2AUTA 1KDTA 2P75A 4TPKA 1T2NA 5JWHA 1HM5A 5HW0A 2FP3A 5M04A 4Z4QA 2ZWOA 3N58A 4PN7A 1Q83A 4I36A 5BVHB 2H7VA 1UBRS 2W9XA 3G8CA 1N5MA 1Y34E 4N9QA 2HRDA 4XKJA 5KAPA 3V2UA 3SE7A 4YMLA 2ZSUA 1ENYA 2VBCA 1WHSA 2QSYA 2ZM5A 2H4HA 2ZRPA 3LYUA 4LJYA 3RC1A 5FEMA 1JHMA 2GZAA 2P8SA 3O4VA 4AO6A 3JD4A 1BWPA 4GYWA 4GOND 2VR1A 2JFOA 1J0DA 2AOWA 1IPHA 3IOBA 3BZUA 1JDZA 4K8RB 3C5CA 4RTNA 2O2HA 2JL1A 4FDLA 1SHLA 3OZUA 5TF4A 3ZWKA 3ZVNA 1ZA2A 2WP8J 3PX2A 3GI1A 3WGQA 5BUQA 1VE9A 4CL3A 3ZJ5A 5C2JB 2C07A 1RKVA 3AIIA 4A2WA 1YC5A 1H2XA 3I30X 1H6CA 2VCYA 3SBOA 2YWDA 4KRGA 4EI8A 2VPQA 4B73A 2FWAA 1VE6A 4L6CA 4D9FA 1T5TA 1H0RA 4C06A 2K7FA 3QBJA 1OQAA 4JL5A 5AJYA 3CZAA 3JD1A 2OO5A 3O1HB 2PUFA 3A4YA 3RC2A 3PDIA 3A1UA 3E84A 2DFVA 4QUHA 2A94A 2E6KA 3NBQA 4JODA 5E6UB 3RFCA 1QIHA 1UDRA 3DFFA 5ADUS 2ISQA 1Z4NA 4A6EA 1ZESA 2CVOA 8ADHA 1P4RA 3F71A 2FLKA 4LWPA 1W6UA 1BS9A 2ENWA 2Y66A 3UB3A 2Q5CA 3RKUA 3RSGA 3LXUX 5T7BA 2WJVA 2IK8A 1GU1A 1JLSA 1Z45A 2G82A 4HQNA 4Q01A 2IY9A 4YT8A 3UBTA 2XZDA 3H9EO 2NZJA 1Y1PA 6LDHA 4U4AA 4BNNA 1RJ9A 3GWGA 1EUQA 1H2FA 2B34A 3E70C 5HIMA 3VI4B 3T5CA 1XNQB 3QEOA 5AKKA 4FPXA 3QU4A 3WDSA 3RAPR 1VA4A 1XXLA 1OA1A 2WTXA 1GGHA 3E9MA 1D07A 1S2OA 2G1JA 4LZLA 5KPJA 4U6QA 1M8FA 1TKRA 1IOVA 2YXDA 1DFIA 2QD5A 2XKAA 3X3HA 3HPQA 3TDNA 5T41A 1HLGA 3E53A 4JBNA 4GPD1 3ZI7A 4KVGA 3W6UA 3E7DA 1IOZA 2A0KA 4N49A 2CNKA 3DMTC 1D3AA 3KVOA 2PUGA 1W46A 2YYAA 1GU7A 3AUXA 3S2ZA 2F1RA 1LVHA 2G40A 3FY4A 4XJSA 3CWZA 4MLPA 5K6AC 3MB8A 1ZW1A 4DANA 1HYGA 1OYWA 3F3MA 3PUWA 2CV2A 3T3GA 3D4BA 4GP6A 4JB8A 4JIGA 2JHFA 5KJEA 1FFSA 1N6KA 2YDYA 3I76A 1Q5PA 4B35A 5AXBA 4IXWA 2IWHA 4YV0A 3U4QB 2IBMA 2EJCA 4KWHA 4MI3A 5G02A 4YJ3B 2G5CA 1WW3A 2QTLA 1PS0A 2ZI6A 2J3HA 2H63A 4NMWA 4OMUA 4L4XA 3G3EA 2Y76A 3OUZA 2GKGA 2W48A 1O89A 4YV1A 2VSOA 1OHHD 2G6BA 1MQ8B 1N5DA 1XR3A 1XX6A 3OQIA 4MR9A 3WRWA 4XIJA 1W85A 4EATA 1JLRA 1W0KA 4WQMA 3FPFA 2O2XA 2PY6A 1RU3A 3F7NA 4G4SO 3WRYC 4M99A 3A3OA 1W34A 4TLMB 4EHAA 4HT3B 2GPAA 5KCMA 5LD2B 1BCSB 1KYXA 3GJYA 3KKMA 2DFLA 2P78A 4HYTA 4UM9B 1COWA 3MMXA 5JY1A 4OHYA 4LRTB 3BK2A 5DGIA 1EGVB 1I13A 1DWUA 1NV9A 1KOLA 5H9VA 2XUZA 1HO3A 1BXKA 4FD3A 3T99A 4D3SA 3P4UA 4KCGA 4LRYA 1FS5A 1POWA 1GKIA 4LNUB 5EXPA 5G3YA 4BLUA 5AW7A 2OTCA 2ABWA 4G1CA 4B3CA 2EL7A 2J0VA 2APJA 1GTL1 2GUWA 3IBTA 2BTEA 3I73A 3UG6A 2EJUA 4FLFA 1NBME 1H2YA 2VAWA 3TBHA 1FVXA 1OFVA 1TK3A 1PL6A 5AD1A 1B3BA 4R1UA 1AXRA 4I4TB 2BGNA 3FPSA 1UFRA 1P8JA 3HDHA 3RC7A 3WJ1A 3ZQ6A 4QGSA 4KPUA 4B7AA 3LKZA 2WPNA 1H0KA 4JIMA 3PK0A 3ODPA 1SMKA 5JU6A 3GZ4A 2D2FA 5EHQA 4KN9S 3SEZA 5TS3A 3EC7A 5JAPA 4BNGA 3VR6H 4P81A 1BO6A 1L5SA 9ATCA 2ZB8A 2Q9UA 3AP1A 4O59O 2HOQA 1V3TA 5FUVA 2J7PD 3HVUA 1N2ZA 2OHIA 1UFKA 3LPNA 2BYTA 1C3EA 2HK8A 4HJXA 3C8HA 1QX3A 1GARA 1H4VB 3M83A 1KMNA 1YS4A 4IX9A 5L4LA 4ZYVA 3RS3A 1KBZA 1K6JA 1BGVA 2BFCA 3L9WA 1TVMA 2OHFA 3VHQA 5BV1A 1GO2A 3T9AA 1VE7A 3B1JA 1DAPA 3IPCA 1P44A 4B7CA 5KQMA 4RK5A 4B79A 1QZZA 4MR8A 1I3OA 4L8WB 2FPGA 4BNMA 4C3UA 4OH1A 3G2QA 5CK4A 5E9QA 1M1YB 2WDZA 5H3HA 3ECSA 2NU6B 2OL4A 4H16A 3VSDA 4RLSA 3COSA 1OFHA 1YNSA 1WZUA 2AVNA 2YMQA 4XLTA 3KD2A 4M2LA 4CT5A 5DTEA 3WNCA 1XRRA 5JAQA 3G2IA 1DFHA 3DO8A 3GAFA 4M6WB 4XFKA 4W5JA 1J21A 4DY4A 3FGZA 2QEQA 2W5UA 3EISA 1H2ZA 1CUWA 5J58A 1GGMA 3DEYX 1Q14A 3E7XA 3DLTA 4TTSA 3UENA 2OFOA 3CIFA 1J9EA 3SDBA 1RYZA 4KR0A 2GM5A 4OSEA 1T2DA 1C9MA 3MTEA 2PLWA 3A6FA 4OAPA 5E8JA 2PVPA 5H5JA 3TX2A 4NU5A 3WGOA 4BO0A 1DS6A 1WB6A 1COWD 2XMCA 3WLKX 2DQKA 4N9WA 3WZMA 1ORIA 2CE2X 4RAQA 1Y4AE 5DEOA 1RWOA 4WN3A 4ZU3A 3ET4A 3UA3A 1Y7HA 1V95A 3OM0A 1NOKA 3AZPA 1LSJA 4EKDA 4F5ZA 5HRCA 3ICEA 5FPPA 4CLDA 2PKEA 1WXQA 3DEKA 3UMJA 4E5KA 1GUAA 1TZJA 2I0FA 3U49A 3GT0A 5AO9A 2PSFA 2C5EA 3HU5A 1CJTC 3R1IA 4IJQA 5BN1A 3M2TA 5IK2A 5JASA 2XB2A 4D25A 3ILSA 4E4YA 4KXFB 3VSCA 1AKYA 3IDQA 4EFKA 4Z3KA 2H18A 3EGVA 1UPAA 2PGLA 5CAEB 2OG2A 1I4TD 2R1TA 4YAUA 3PI7A 3U19A 3RF7A 3ZXSA 2MYPA 1D2RA 2FAXA 3PE4A 1YO6A 5AXDA 2PZ8A 2W98A 3C45A 1RWBA 5DHFA 1Y7LA 2OO3A 4G8DA 3SC2A 3OCYA 1PZGA 2WWIA 2HPAA 2ZBGA 3B1KA 4LZNA 4R51A 5GWXA 4BZZA 5LIPA 2J59A 5BUZA 2BV3A 4AKGA 1DBSA 1KO5A 3OZAA 3TQIA 3T5MA 1QGED 1YKFA 3MERA 1L4FA 4JHLA 4W6ZA 4OXKA 4BBAA 5KTMA 1Q0LA 1IB6A 2B20A 5KOJA 3MUEA 3Q6NA 3EFOB 4FE3A 2FUG1 4EG4A 1ZWLA 1SKUA 2JGNA 2Q0QA 3N8KA 4Q7KA 1CF9A 2GBPA 4RKWA 2H9AA 4Z4EA 4FFVA 1ISGA 1UM8A 3QPAA 1O54A 4TYYA 5LFAA 3KV1A 5DM0A 3U7QA 2M6SA 4OQMA 2HD4A 1A72A 2CW5A 4PPFA 1RRVA 3ZWCA 4ZVMA 4O2AB 4HVAA 1C30B 5AWFC 2MYNA 2Y68A 1VB3A 1KMIY 4WRRA 3M6UA 3CZMA 3EC2A 1QIGA 2WKPA 1Z0AA 1JIXA 2H7YA 2NZ8A 2FPLA 1R4MB 2E7ZA 2ODEA 3FF1A 3KOOA 4NSNA 3URMA 4CTKA 5LMZA 1ZRSA 3D2LA 4BFYA 1L6RA 1U2RA 4R5HA 4J03A 4XEUA 4D44A 2YFQA 3HDTA 1E0KA 4GPIB 4DLTA 2BKUA 2YJNA 3DOOA 3I9FA 3L02A 5FOXA 3T7AA 2GS9A 3VNAA 3WB0A 5L40A 3NDPA 3R9WA 5FAXA 4C6TA 4RXTA 2C2KA 1ADYA 3G2HA 2X0FA 2PZFA 2VLIA 1P1RA 4JR0A 4TV9F 1FPMA 2I8LA 3SX2A 1ZIOA 4G1UC 4PRKA 4HAIA 4JI0B 1TADA 1QHGA 3EIUA 3HXOA 1KJYA 3H8SA 1JDUA 2ZIZA 4NK4A 3WIVA 1QPBA 4IVPA 4NX2A 3A9WA 4WZ6A 3EFBA 2H2IA 2ZUBA 4GX2A 1G6HA 4F72A 1FXWA 5LZ9A 3NDBB 2FG7C 1NVEA 3H5RA 3O8CA 2OV1A 4GD3Q 3I32A 4OQYA 3WZLA 4ZMSA 1AQYA 1VCIA 4XIFA 3ZE6A 5CEFA 1Q1BA 3IRUA 2V45A 1CE8A 3UV3A 4YUYA 3OT1B 2D5LA 2FMXA 4YGYA 3ORQA 3U4IA 4KV7A 3A1DA 3K35A 1G38A 2XUHA 2QI9F 5JD3A 4BAUA 4KQFA 4Q15A 1T15A 4RZUA 2ZRDA 4I14A 4W1QA 2RHLA 4J7UA 1UWVA 4L50A 5DM70 1IN5A 4D4LA 3CW2A 3B8EA 1PEAA 1ZISA 4MGIR 3FYSA 1AK1A 1J1ZA 3D7NA 1JDJA 4KMMA 4P4LA 3VR0A 3V4VB 4KFRA 1GZ4A 3C3AA 2A9PA 2AFRA 3X44A 2W2LA 4YJHB 3V80A 4DMMA 5BN5A 1MB0A 3KVNA 3MG9A 4NCJA 2RIRA 3L82B 5DYNA 4KNYA 3LH5A 4FDVA 5EQDA 3FPEA 4W7HA 4BATA 4B5LA 4DIOA 2YBEA 2VHQA 1OLUB 2UUAB 5TEVA 2GDJA 4NONA 2H2DA 4DQDA 4PC3A 4JZKA 1EWVA 4X65B 2QL6A 1Q1GA 2JBHA 3B1YA 5A2GA 3AF1A 3C98A 1RZUA 2Z4TA 4GYYA 4UFOA 3WB2A 4K6MA 2CV1A 1E2UA 4O0MA 2A0YA 1Z75A 1JHAA 1SUPA 3ZE1B 1ACMA 3KZKA 3C1TA 3TJRA 1FSPA 2RGBA 1HLFA 2P91A 1K5PA 3H5NA 5AK4A 2W70A 4DC1A 5B12A 3WGKA 2X9LA 3CVJA 3OEYA 1GKLA 1GSAA 3NZEA 5HEKA 3G7SA 2C5GA 4EY3A 1XLVA 4M1EA 1H94A 1E5TA 3A6ZA 3EMVA 4DPKA 1QF7A 4TKUA 2E5LB 1BU8A 3V1UA 4K9MA 3H3XA 3ACBA 4PWYA 4XARA 5EIBC 1GDHA 3TLYA 4C01A 1FRZA 3ISTA 3H19A 2AB0A 2A6PA 2VJBA 3RSOA 5HZGA 3ADPA 1E9EA 4PC6A 2Z4RA 1GFZA 4J4BA 3RE1A 3OC6A 3SNKA 1LTQA 1MX5A 1R0CA 4L3WA 4BLVA 4YXWA 5I3CA 4OGGA 4JOBA 4G36A 5C35A 3GJ8A 4HX9A 5B5SA 2O8FB 4KQGA 1EMDA 4ITRC 4GM4A 4IZOA 2VFAA 4Q1AA 2JGDB 4LF9B 3GYBA 4FMDF 4OU5A 5F12A 1D6NA 1KFKB 3GBVA 3N0TA 2BHLA 1I6LA 5DOVA 4LDAA 3RNOA 3EFHA 4F97A 4XTRA 3VHLB 2A86A 3AI1A 3R3UA 3QXJA 1U4OA 1NPYA 2AIRA 3SYMA 1BMFD 3PXUA 2H06A 4WFKA 2VEDA 5ANRB 3D8UA 3L9XA 3VVBA 3GR6A 1ZUWA 1N1EA 3QX7A 4M7WA 1XLUA 3MHTA 3WLNA 3C2QA 2AOTA 2B69A 3BA6A 4NXMB 3IKVA 3SD7A 4N01A 4O3FA 2I62A 2CFIA 4XQ9A 1NJFA 2D4HA 2POQX 2W00A 2XIJA 3PGMA 2IDMA 1P1KA 2XYQA 2JGKA 5E4TA 2P5YA 1AKQA 3ZCQA 1A0OA 1IQ0A 1PG2A 4FHEA 2AF4C 4LE2A 1SJ9A 1H8HD 2XOKA 1XPRA 3UWMA 4E5NA 5FEUA 5IRCD 1ZH0A 3T1YB 5B37A 2CLOB 2ZSDA 4ON9A 1KY5A 2D1QA 2RGYA 1M6EX 2O20A 1W8IA 1Q0UA 2GESA 3DP7A 3L0CA 4JH0A 3S7ZA 3FHCB 5AUPB 4F86A 4UARA 2RGAA 3CJRA 4ZEXA 5D87A 1NA5A 2CJWB 3BJMA 3GH3A 4RJ2A 1L7XA 1F4PA 1QQ7A 2V96A 1P1IA 1AH2A 1F12A 1JIJA 4JC8A 1L4BA 3DDUA 2JIQA 3OETA 4LNHA 4Y6GB 3PEVA 1D09A 2A0FA 5CDGA 1N6IA 1JHRA 4KXUA 1PS9A 1AQNA 1Z25A 3QV1A 1U28A 3U09A 3DKRA 1JLLB 2CK3D 5E2AA 3EXFA 1MBZA 3Q72A 3I2JA 1U0JA 3QEKA 4UU7A 3GPLA 1LLFA 4G81A 3CUWA 1A4IA 1N9ZA 4LX0A 1L1FA 3OP1A 3DPUA 4LOKA 4J0DA 1USVA 1RSZA 2IXBA 4F5EA 2H0RA 2JKZA 4A0FA 1TYBE 1PQYA 2Y67A 3I5AA 4G4JA 1Z2EA 2V7UA 4RVUA 4NP6A 1ADCA 1BG6A 4RY8A 5DSXA 3NETA 5IARA 3STWA 1EXMA 1J20A 2JEZA 2XOXA 4XLZA 5G1OA 1VIYA 5TX7A 4A2CA 3ADCA 2WKQA 3S1AB 3ZHCA 3ESCA 4X24A 1L5HB 2XWBF 3D8HA 1R0KA 1VPVA 2UZ4A 3ERCA 3A4LA 4L4SA 3AVUA 3BT7A 3KZNA 3R5FA 4IEEA 5FI3A 1FB5A 16PKA 2FRXA 3C6XA 4QTYA 4LBWA 1WCV1 4RESA 3YASA 3ETGA 2AEJA 1YBAA 2JRLA 2KS6A 3CH7A 3UC5A 2HRCA 2NQ8A 3PEUA 1KARA 5KPDA 5F3WB 4C0QC 4BKPA 1E1RA 4BN5A 2BE7A 2FTKE 3AUJB 3D6HA 3GUCA 4LV8B 3R6DA 1RXUA 2IPNA 1XYYA 3I12A 4DE5A 4CFZA 1YRAA 2QHXA 5JH7A 3OSZA 2TMDA 1Y8QA 3O26A 2HBRA 4BX9A 1SFRA 2RDMA 3TLCA 2GPJA 3PNLA 3Q40A 3CB2A 2OFXA 3ICVA 3I39X 2F1OA 5DW3A 1FS4A 2CFRA 2H17A 1ODCA 3H2JA 3H42B 1XHEA 3IUPA 4WGGA 4Y2TA 4A2QA 5B1SA 4Q3CA 1BQ3A 1V5EA 4OLHA 4BASA 1W9HA 2UZ3A 2X1HA 3P71T 5AUQA 2YZ7A 3BMOB 3DLBA 1D7OA 1MHTA 4U63A 3SP1A 1XDZA 2P5TB 5CX4A 1KQGA 3BX1A 5EIEA 1BW9B 1TMYA 3OLCX 5ECDA 2VQEB 1U65A 3LQKA 1LLQA 3LQRA 4H3KB 2FMHA 1M8PA 4TQGA 3E9DA 1XTSA 2XNHA 3LPLA 4TYQA 3L4BC 4XYLA 4MMXB 2IY7A 3AI7A 4XWGA 3V8MA 3OQPA 4B3FX 1T29A 3G23A 4MVJM 4F8YA 4AROA 1ISFA 1CHDA 1ISPA 1UZAA 1IWPB 2GN0A 4FDMA 4W4TA 3V00A 3JZFA 2TS1A 4FGJA 1G291 1G8GA 5HDBB 2VJOA 1CKEA 3GFVA 3KLBA 1XDDA 5B2ZA 4M8NE 2O0LA 3U80A 4R7ZA 4LISA 3VO2A 1V8BA 1F1JA 1JLHA 2FQ1A 2ZIFA 4HADA 4KVFA 5IJXA 3ZNOA 3BXOA 4B33A 4D92A 5JJ5A 5EUBA 5LKAA 1P5FA 2IXDA 4URZR 3TGWA 3O8BA 5LBTA 3C14C 1PX2A 3M34A 4LS3A 5IU6A 3BDVA 3NGMA 3GJTA 5KVQA 2XYPA 4C9BA 2B5VA 1M2FA 2G72A 1RYMA 2ATXA 1FP2A 4IXDA 1Z5WA 3CBGA 4B0OA 4CG3A 5I51A 3KPUA 4YP7A 1R0WA 4BNDB 4FUTA 1SA0A 3QA3E 2PIAA 2FVXA 3QOFA 3S1LA 1D2GA 4PICA 1OH5A 3RU9A 4ZZ3A 5J2UA 4EA9A 1HDYA 3K5IA 2D5AA 2WAAA 3N0RA 3TK1A 2DSNA 4AZ0B 4H7HA 3WHKA 4WLNA 2JKYA 2OC4A 3GMTA 4WAUA 4IHJB 1Q0ZA 2VUSA 3DLPX 3VZSA 3S2EA 3DAFA 5SZHB 5B6IA 5K0SA 2A67A 3ZDBA 3AUTA 2FPSA 3O8DA 1M5TA 5FV4A 3HL0A 1WZ2A 1WB4A 1QVAA 1AGRA 1QO7A 3R24A 1RS0A 3MTJA 2WVGA 2ZVQX 3V9PA 4D1YA 1QPGA 4KHZA 4MQMA 2WWXA 2EJVA 2HA0A 2VEOA 2WZBA 4UD2A 2RBGA 3LO8A 4F9GA 5FOQA 2XTNA 3PC4A 3HCEA 1PWZA 2DJIA 2R62A 3H5WA 3HBNA 3SBEA 1K2VN 1SXJA 5D3KA 1QS0A 1GQSA 1KR5A 1L3BA 5ER9A 2Z8ZA 5HIIA 1SVMA 3QE3A 5LUAA 1L4UA 2FK8A 1XJCA 2V9CA 4DFDA 1D0VA 2PLFA 4JUCA 2PWYA 5LQRA 1IVSA 1MIHA 1OXUA 2XDAA 3I42A 1RXSA 5B30A 1LRJA 1DBIA 2NUPA 1KVSA 2VL7A 4LG1A 1GXSA 4MYSA 3ASZA 4BQIA 3NTLA 2P68A 1QUEA 3KQWA 3KYDA 4TYWA 2XQFA 4R7TA 4B85A 3E9RA 3P19A 5JS2A 4QBIA 4B43A 2C77A 3ZGVA 4JUIA 2I80A 1JVNA 1U7DA 3G1UA 2QRZA 3PDHA 4NYJR 2NWQA 2XCTB 1MABB 3BSWA 4F5YA 2XPCA 5JTUA 2ZE6A 5I5EA 3B1WA 1ORVA 4ZC1A 5BW5A 2I4RA 1M1XB 3B1XA 3IXMA 3LT2A 2R6AA 1ZK4A 3UT0A 4DIFA 1TJ5A 4D56A 3GY0A 1Z3CA 2PZMA 5A4JA 1SRQA 2VDLB 3EIFA 1X7XA 1XTVA 4WL0A 5BMVA 1T34A 4HX5A 2ZR0A 4MI9A 4PTLA 4QPNA 5A5GA 1FK8A 2HXGA 3ZWXA 5EJMA 4BTEA 1U1DA 1X77A 2FR0A 2ZBRA 2O3TA 3WFZA 1RMQA 3S1SA 2G9QA 5ARDA 3S99A 4L6IA 3LUFA 4ZHQF 2FYTA 1SXPA 3HO1A 1VE3A 2RBEA 3I1JA 5DU2A 1R1DA 3BKWA 3K32A 3T95A 4XD7A 4R3UC 4US2R 1KSFX 4PHFA 1U9IC 1UXKA 1E32A 3EYAA 3MWLA 5KYWB 4ENRA 1J9GA 1IZYA 5GIOE 3R7SA 1W9MA 1QO0D 2GCIA 4QRDA 4F3TA 1PFYA 3UAYA 1KC1A 3L8CA 2DPXA 5DB4A 4BS9A 4B4OA 2QQFA 4KYUA 1S4QA 3R20A 3KP1A 4HOYA 4JJGA 3JQQA 2ONJA 3FUCA 2XA2A 4BCDA 4AI6A 1THZA 3ANMA 3WOHA 4IGAA 4CF3A 3DMRA 1S2LA 3OOWA 4IV0A 1E2EA 4JCOA 3MWEA 1N0UA 4Q3LA 1G2IA 3U5ZB 2RGNC 1KXJA 5CLLA 1MG0A 3KJIA 3WK8A 4C2TA 3MLAA 3HV0A 4PLGA 2I7TA 1Q7GA 2I3ZA 3ABIA 1IVYA 4HEHA 4OKSA 4P53A 4QPCA 3WRYA 1YQXA 1L5LA 1GQOA 3OCWA 2NUTA 2DFNA 1KNQA 5AM0A 3COZA 3H1TA 5KQSA 2D3WA 4QUKA 2VHTA 4NV0A 1DFGA 1G1MA 4AJ1A 1DX6A 2VK4A 4KI7A 3K0AB 6ABPA 4QBGB 2SNIE 4GW3A 5DF1A 1K3TA 1JB1A 1ZITA 3F8SA 3PITA 1XDUA 3CR3C 1MCZA 2CMKA 1CQPA 1ZG3A 1B8UA 4BY9E 2Q1UA 4CE6A 4B0PA 3KTAA 5EZQA 2Y0EA 3L43A 1R15A 3QJYA 4QDOA 2EJBA 2QA5A 3NHBA 1QZUA 1WBBA 2C3OA 1OGIA 3A04A 2PH1A 3NM5A 3OFKA 1CRPA 4KSCA 3O5AA 3PUVA 2PPLA 2NXEA 5K0CA 2G5GX 2HLDD 4ALIA 4Q48A 1CLUA 1G9TA 4J1NA 4NJOA 1Q1EA 4HAZA 1L6IA 3N0WA 2Y93A 3I28A 4CZ2A 1SZCA 5P8WA 1J0BA 5FF9A 1NVGA 3IVGA 3MAAC 3NW9A 3OHMA 2Y1DA 4WUVA 1BWQA 3DE6X 3P5BA 4OHOA 4AZ3B 1U7ZA 4RV5A 2WSIA 3IELA 5G1PA 4PAOA 5T4BA 3B89A 3R76A 5FBRB 3VYVA 2Q9CA 4ARCA 2Q3CA 3B3GA 2B8TA 3OQVA 3ROTA 4ML3A 3TCNA 4MVJG 3ZTYA 5JATA 1QAOA 2VDOB 4URHA 3C7CB 1U9YA 3ROZA 4G0UA 1XTBA 1AHNA 3VTFA 5LP6F 1PJRA 1YQWA 2H9IA 1O95D 3K2BA 1IN7A 1SELA 3EUWA 1Q1AA 5L8VA 2RJOA 5EPEA 3V2IA 4BEVA 3QGMA 4IXMA 1LK0A 2BBTA 4QPDA 4K28A 3W9YA 3ZS8A 2BT4A 5K2MA 1F8GA 2HMUA 4MV5A 4R1LA 3UOWA 3W2HA 3WIBA 5EIXA 2EXXA 2FZVA 3IKLA 1IHDA 2SCUB 4AAYA 1BROA 4J9VA 1KSJA 2H8KA 5I7VA 1DO2A 2BWJA 2DQSA 3IPRA 3LW7A 4HGNA 4S3MA 2FU5C 4IFBA 3HFJA 1GA4A 4L08A 4QHTA 3L7DA 5T4EA 4AZVA 1ZSNA 3WKEA 2VDNB 5EQFA 1Q11A 4P2GA 3QE0A 1YCFA 3ZV3A 5HR5A 1FTNA 2VHJA 3LJKA 3QMVA 5K8LA 3NIWA 2BEUB 4R8LA 3AXSA 4XZ3A 1K9VF 3GPBA 3WMXA 4MGHA 5TVGA 3PQ5A 5JARA 3W9UA 4D8UA 4MRMB 3MAGA 4XB1A 2PD4A 4LZWA 1H65A 4DMUB 1Y7PA 3BWMA 4G1EB 1U81A 1UC9A 1B0AA 1NE7A 2OXRA 3FG9A 3KQVA 3OY7A 4K9OA 1X9HA 2ZT8A 3SXUA 5L9AA 3OD5A 2I7XA 3JQ8A 2XZTA 1KKUA 2WHRA 5TARA 1LBHA 4UNRA 7GPBA 4QDXA 1JEDA 1PFKA 1EK5A 2UU9B 5LCXA 1QU3A 2CUZA 2Z09A 2D0OB 5ALWA 5AVSA 4ARBA 5DKFA 3O31A 3G6WA 4K46A 1YK0A 3ANSA 3FLAA 5AOCA 5BSUA 3IXQA 4DNXA 4KLAA 3ZNPA 3O7WA 4FBLA 2JAQA 4O2AA 3LT1A 4OL0A 1ZRHA 3A6PC 1B93A 1WPGA 4GIBA 4MQ6A 4WA8A 2D54A 4Q02A 4RW0A 2V8OA 4O3MA 1ML3A 1YTUA 2J1LA 2V54A 3VDRA 2YRWA 2OBMA 4U3JA 5GJCA 2D1RA 2XKKA 3A25A 1FTWA 1SURA 3FETA 3I52A 1WABA 3UT5B 5BVHA 5AVZA 1TU3A 3QIVA 3GRVA 4KLRA 3T3OA 2HZ7A 1XQWA 2WY2D 4UPDA 2VJMB 2PL3A 1PFVA 1E79D 2V7QD 1MIOA 1EFAA 1R27A 2NO6A 1GZ7A 2NVBA 1I8TA 1T1SA 4UDOA 5B3JC 3DNMA 1HEIA 1K68A 3E3NA 4H7DA 4C14A 3QSYA 3MT7A 2BUCA 2GNAA 1HL7A 1G8FA 4KLNA 5BSEA 1FA9A 2C1ZA 5HKKA 1O95A 1SR8A 1PD1A 2FNAA 3NCTA 1XIVA 3OFSA 3PP8A 3MMNA 4R84A 1U11A 4XCQA 3O83A 1E7QA 3R3WA 4OKIA 1NXWA 1U04A 1CZUA 3BB4A 4FYKA 5EZYF 2AE1A 2WTMA 1O9HA 3R7LA 4D42A 3KCQA 3EZNA 1VGRA 4Y30A 3OIDA 2RHTA 2JFFA 3OLWA 2Z08A 1C50A 3A10A 5ES4B 3F4KA 1AIPA 3OMXA 4G8BA 2O57A 1S3FA 1VL2A 1FLNA 2ZIEA 3BMCB 3GDOA 1YQEA 2AKAB 2HQBA 4ZV7A 3WMFA 2BSXA 2HJWA 2BM1A 4GKVA 1G59A 2IV2X 3LX4A 2P6OA 5CJJA 4C4PA 2DWOA 3L84A 4N5DA 2CDAA 3IUYA 3O82A 2E21A 1R3UA 2WQ7A 3QLUC 1WDKA 1BDHA 1Y63A 4YGXB 2P79A 4E6EA 3TECE 3OWOA 4FJ1A 4E30A 4C1BA 1LGYA 4ZQHA 1FE8A 4ETMA 3IBFA 3C3JA 1TLLA 3ISVA 1PZXA 4JI5B 3RUEA 3STVA 1QM5A 5EHZA 4PWZA 1QBKC 3MCAA 4I50B 1WP4A 1V2HE 4LI0A 4LFAB 1NP6A 3EMDA 3SQLA 3QTTA 4WZBA 3KL2A 2H6EA 4L7QA 4R1TA 5IT5A 1Q20A 3VR2A 5DX8A 4MQBA 2OBFA 2XH8A 3WYBA 4DTCA 3NHSA 3DOFA 4AF8A 2GHTA 1OC2A 1C7IA 1GRCA 4YP9A 2NU9B 3ZQJA 1DTSA 4EX6A 1BJKA 4GPEA 5HCNA 1KE2A 4EUKA 4ZMRA 5LWHA 1EUDA 1UPXA 3O2NA 1K3FA 4PZZA 4ZODA 2EX0A 2QLMA 2ZYWX 1CZHA 2YJZA 3D4NA 1NVFA 5TPWB 1C4XA 3L07A 4POAA 3ROPA 4CF6A 4BZWA 1JHZA 4TQUS 4EGQA 3U61B 3S8EA 2P11A 1FNCA 3WKCA 1TZKA 3L4JA 5KYNA 2WJYA 3GDGA 1FYFA 2COUA 1M5UA 3DHVA 3ZLJA 1U6IA 4RK1A 3OFNA 3HDVA 4QOGA 4KIUA 3DO6A 4YRTA 5ALUA 4CEIA 1QV6A 4HAWA 1U5BA 1XQYA 2D0IA 2JGEA 2GJAA 4OEHA 1EJBA 3D8BA 1GLGA 5C1BA 4TLCA 4RZHA 1Z26A 3D3WA 4JLSA 1E7MA 2JEOA 4BFXA 2BMJA 4RF5A 3I0NA 5D7BA 4UVGA 5I4IA 1DADA 2FY8A 2I3BA 1K7EB 1CFJA 1OR8A 4X6YA 2COEA 3PFHA 1BVRA 3QYPA 3WGNA 4BRWA 2W2TA 1MAAA 4L3VA 1OAAA 1V11B 3C3BA 4JUAA 3V8EA 2E0IA 4Y6PA 2ZCUA 5TT0A 4B48A 4KBGA 1U0HC 1W29A 5A02A 3GLFA 4ZEOA 2TMYA 5J2TB 4YJFB 4L8VA 1Z47A 1RJFA 2OR3A 1T6YA 3Q2KA 4C4ZA 4IV8A 1A1SA 4AUMA 1LUAA 1OBVA 3QJGA 1RLOA 1N7IA 5TMBA 5BT9A 2JF0A 3NKVA 3GBSA 3KB2A 3VHRA 5C1OA 1ZOIA 3THOA 4ZK6A 2ZIXA 3TE7A 1UJ2A 1CB7A 1XTJA 1CY2A 3GZNB 3HR4A 2ZGVA 1PV4A 3AVTA 4C4SA 2GAFA 1O5TA 4HHEA 4D8TA 1G0NA 3FUXA 3M5CA 3O0DA 5DBFA 3H5AA 1P1FA 3Q10A 3EZXA 4NEQA 1RXVA 1Q0RA 3F5DA 1V8ZA 3BEDA 2R1UA 3EBLA 4GKJB 1XSEA 3W5CA 5HFJA 4IIDA 2ES4A 4Y2GA 1ZLXA 3ZCPA 1P39A 1TYDE 2A9KA 2ORWA 3NUQA 3ULKA 1KIFA 4Q1EA 1U7XA 2GHQA 2QTAA 1J39A 1TPYA 3A1VA 3IA2A 4G0ZA 1P9OA 3LY7A 4OBXA 2CLIB 4OF4A 1OU0A 4R9UC 4BZPA 1H8EA 1WUYA 2R1VA 4YMGA 3KQPA 3EZ2A 4DIBA 1U0GA 4ISCA 1UINA 3GJRA 3PGJA 1T9GS 4LJ5A 4GHWA 4OYLA 4YMIA 5DGXA 5AVVA 4CV0A 1SC9A 2C4UA 4YJKA 1YZTA 2H16A 1B6GA 1QO0A 4G0MA 1KHTA 1KRHA 4RFSB 1WMEA 4HDOB 3V33A 2QN3A 4IJUA 4NDNE 1RZ3A 3HZOA 1WHSB 5L3VA 1XUOA 2DUMA 4FP9A 2JHAA 1E5LA 3QFSA 5JMOA 3UQZA 4L5JA 1MAUA 2IE8A 3WAGA 1EE1A 1YCGA 1LSUA 3GBPA 4RY0A 5FFNA 1HY3A 1WVGA 1UAYA 4QXRA 2Z6VA 2CLLB 1E77A 2DHCA 3I1FA 2HMAA 3EEIA 1SBQA 3DT6A 4EJMA 4XQGA 2HQSA 1NI4A 4P5DA 4EH1A 4G37A 5CD9A 3W2IA 1PV1A 2WR8A 4Q0MA 4XYGA 2R4TA 2YMMA 3GRPA 4MMYB 4O8ZA 1Y6RA 1P1CA 3N2EA 4L8YA 4O4JB 4R2JA 3RBAA 2IP2A 2PG3A 3TNLA 1M8KA 2P9YA 4DV6B 5D3MA 2OFWA 5IZ4A 1L0BA 2XCIA 2PM8A 4MAAA 4D4GA 3EZYA 3KKPA 4Q3NA 1JIVA 4NTZA 4P3KA 1R18A 1N6RA 2Q1YA 1X74A 3BXEA 3QWIA 4Z7NB 1R8JA 1NYLA 2PA3A 4MOWA 1S0UA 1SKYB 1LPOA 2DHEA 2FUNB 4LCEA 4Q9KA 2EDAA 2JVIA 3D1VA 3KUXA 5AJVB 3CWQA 1MGPA 2XUIA 4NY1A 4DJ5X 4HYEA 3W2FA 2NG1A 3N8DA 2I7DA 1TF7A 3Q1KA 1I4EB 2ENUA 2FEMA 4FTWA 1HL3A 1XQ1A 1IY0A 2R7KA 4U7HA 3RVDA 4LDNA 3NX4A 3Q7QA 3K6SB 3VKWA 3QKIA 4O4JA 4EWLA 2G80A 4S1WA 3SR0A 2ZDGA 2VTBB 2WJHA 1HE4A 2GVNA 4HF7A 5AHKA 3T38A 5MGBA 4JJ8A 2XVZA 1IIRA 2YVUA 4TMFA 2PSSA 1CQJB 3F6SA 1M2JA 1N2XA 3IVRA 3KQYA 4QLAA 4U0JA 4OHBA 4F2PA 2PLAA 1P3JA 1VLJA 3H17A 2Q1WA 3IS3A 2PHZA 4XX1A 2PUWA 4HR7A 1C2YA 5HQTA 1M8GA 3KYJB 4FQ8A 2QRHA 3FNEA 2PSJA 2QMUA 4WESB 3A4TA 2JLSA 2VTVA 2IHTA 2AW5A 2IYAA 1JYFA 1QBGA 1T2UA 2EVWX 3ORYA 3QVSA 3TSCA 4FOPA 1J2EA 2X3UA 4BMNA 2J5XA 4PBTA 4HFNA 1QHXA 2KLBA 4B8WA 2WD9A 5JSUA 2V9ZA 2XNDD 2YHBA 3CN7A 4KK4A 3WQBA 4IMRA 1XWFA 2Q3DA 1JLMA 1JQKA 1YQ9A 4G5SA 3R0IA 1TCVA 4QJBA 2RHDA 1DDGA 3K8YA 2DUNA 3MCWA 4UUQA 3ICWA 5CUQA 5H80A 2ZITA 3T1QA 4RGBA 2VHXA 5EHNA 2QPLA 4P4SA 3E9ZA 5E6SB 2G8NA 3KJGA 5CLQA 5AFSA 1CERA 3MJTA 2D0PB 5A6SB 5KDOA 1P2FA 1HNZB 2QTCA 2WNSA 1CSEE 4HAUA 5TGDA 3T8YA 1KSHA 3KSRA 3OZGA 4WKGA 4C6RA 1F38A 4Y2RA 2EZ4A 1DT5A 1SKAA 3A9SA 2W8BB 1TDJA 3DDOA 3SIWA 3TI9A 2GAJA 3LX6A 4ZREA 2X7JA 3CLSC 4LJAA 2XCRB 2QVYX 5DIFA 3ONWA 1O97C 1WV1A 5EL0A 5ISMA 2P6PA 1CETA 4FONA 1HRDA 3I2FA 3O4JA 3CRQA 3EZ7A 4M8SA 2OGUA 2JLYA 1DDOA 3GFSA 4XSVA 1U1IA 3PNBA 4MIYA 5G0SA 1YFKA 5EY5B 3AETB 4Z4CA 4D5EA 4U2BA 5FUMA 1LPMA 4B3MB 1AZLA 2FUCA 1QGZA 4N4AA 4MV8A 4QOSA 3GD5A 1JEYB 4KC0A 1ULUA 3PC2A 4NCHA 1HMYA 5IBRA 3NPMA 2XCUA 5BSMA 4PBSA 2I9KA 4WDRA 4WLFA 4IIJA 2QR2A 5KWVA 2ATCA 1K27A 3FLBA 2OBYA 4JI2B 2HSWA 1TU0A 2B98A 2O1SA 1FFAA 5HQJA 2MTBA 3AIKA 2YYZA 4GI2A 4GLFA 4IVNA 4RK0A 1UFVA 3GFGA 4RPCA 4A6PA 3NHWA 5HKBA 2NXJA 4AO7A 4A6XA 4CKCB 3ND6A 5HJ5A 2JLWA 2BBOA 2NO7A 2YRXA 2PLRA 5EERA 4Q4HA 2GF2A 2O19A 3DBHA 1Z6YA 4HWTA 4IH4A 4JLPA 1SC1A 4ZRDA 4KR9A 1D03A 2BN4A 1XHLA 1VL8A 4RIEA 4H1VA 1BOFA 1E8DA 2GF9A 4US1R 5E6RA 3VR6A 4BO7A 4RELA 3OY2A 4BX2A 4ZDJA 4MGZR 5C1IA 5KB3A 1GZ5A 2KJQA 3PEYA 2ECPA 1JPNA 5BSTA 5JD4A 4HK4A 3PS9A 4JP8A 3MILA 1P2SA 4X6XA 2ZJ1A 2YNMC 3JALB 1E3QA 1XC7A 4RZ3A 3Q5DA 3ZWAA 2IWRA 4JYBA 1P91A 2VC2B 1YUNA 1ZQ1A 2W6MA 4BMPB 4UVEA 4FOOA 1M2VA 3G17A 3ZCTA 3R44A 4NBLA 1KOFA 3I09A 3ABZA 1QYIA 4HLDA 5K6TA 4HWGA 1QTRA 1HMPA 2JHGA 1YVEI 3C97A 9LDBA 1J9ZA 1Q0PA 1XZNA 4HC4A 5IPFA 4DV3B 3ZLVA 3TR5A 3DOEA 4YI5A 4EI9A 2OV4A 4KDCA 3TPFA 5AW6A 2WABA 2VRCA 3GB9A 4EL0A 1RYFA 1WXWA 3K0CA 3QVJA 5KKNB 1Z5OA 2CHUA 5EA2A 2OCBA 1GNTA 1NP7A 4UNPA 3Q9LA 1KJIA 1OBFO 1T5DX 2NU8B 1IZ7A 1X8KA 1CRWG 5JYDA 5EPUA 2ETVA 3U1TA 4E2WA 4ZYWA 4FCTA 4Y2QA 3AEUB 5LQSA 2PWZA 1HOXA 2VP2A 4GZ5A 4NBTA 4DADA 5C37A 1HNXB 4QT4A 2C0CA 1LWNA 3FPBA 3UUGA 1GTSA 1DAHA 1XZ8A 3K09C 5C53B 3PJDA 4PLYA 3PUYA 1S2GA 5CH5A 3OQ6A 4RSGA 1JBKA 3BCUA 4PSDA 1KBOA 2ZK7A 3CISA 4DLBA 4E5VA 2RH4A 3M9XA 4AY4A 3NJRA 3KQSA 4BOYA 3TZBA 3CUKA 4YLYA 3P2IA 4JI6B 1APBA 1ND5A 1YZYA 2XZOA 1Y98A 3HABA 1JG4A 1ZZEA 4CIAA 1ZVJA 2BRUA 2YWJA 1AURA 2HU2A 3T5TA 1B26A 2VWHA 1S1CA 3U3MA 1GFIA 1Z33A 1T8YA 2YWBA 4DLRA 4EY4A 3R7AA 1ZHFA 2RBKA 1QIJA 3BS4A 4HN2A 3F67A 3W5IA 4DSTA 3DUFB 2WW8A 4UREA 4ZJYA 3EPHA 4BJ5A 1ORHA 3WI7A 4YRSA 2GERA 2ZFUA 3TMAA 1SB8A 1F0KA 1E2GA 221PA 3NNSA 4RZXA 1Z08A 5HTOA 1YS1X 4A16A 2AUNA 2AYZA 1ZOLA 4HB4A 4O0LA 3OQOA 3CYFA 5A7FA 1LB1B 2VAMA 4ALNA 1C0PA 1C7JA 3OU7A 5B58T 1WAMA 4P3XA 1EFVA 5B7NA 1Z4MA 1JSXA 2IHYA 4GICA 4IDNA 4MW6A 3TLBA 3VDQA 1AO0A 3CNQS 1B23P 3K2EA 4B4DA 3GVHA 1VHWA 4BVKA 4HAYA 3BHMA 4LXTA 3H9QA 3TGPA 2PWBA 1PNVA 2XXAB 4O02B 3BTUA 5IBPA 2PA0A 3CV3A 3PT9A 1WXGA 2HSDA 1E1QD 3Q41A 4H60A 4RPLA 5AVOA 3HBAA 4LAFA 4M8KA 2IDJA 3LQYA 3TLZA 4B3RB 1CNEA 3T4UA 2Q3BA 2UYQA 4K40A 5IAOA 1OC4A 2O6LA 2WVAA 1SBNE 2JARA 3OQNA 3L06A 3HXMA 1QMGA 2I6UA 1EBUA 3W6OA 4O4LA 3IJ5A 3VH2A 1MX1A 5LQNA 1GDTA 2QR3A 4KH0A 5F9HA 1NNUA 1KF0A 1KY4A 1GN9A 1Y9EA 3HHPA 3ST7A 3UJPA 1PZMA 1Y37A 1VJGA 3E3AA 3V5NA 4F91B 2JJ1D 2VDWB 3LIPA 1FIUA 1EFKA 2R8ZA 3KU4A 2Q4BA 3QLEA 4L7VA 1C30A 1X8LA 4RD0A 1DIHA 2HBYA 4XDGA 2BH2A 3ZY6A 1JDTA 1NXXA 3SIPA 2QPOA 1QZ3A 3ITNA 2C4HA 1C5KA 3PQ4A 1SUSA 3H1FA 1R6AA 2WFMA 3QOXA 5LXTB 5JQGB 3C7AA 1C4WA 1J1IA 3C6BA 1V0JA 4PC2A 3K92A 4JS0A 3L7JA 1RI3A 2Y27A 2WICA 1OE0A 4F60A 3HLTA 1F8UA 1EVYA 5ERYA 4YEDA 3BD8A 4UBMA 4ZQGA 1M66A 1HTWA 3VH1A 1EGMB 1IRIA 1ITZA 2EZUA 4LXHA 4ZJUA 3EG5A 4GOXA 2ZTUA 5EHXA 2NTVA 1MC4A 1UBLS 4B3BA 4Z7OB 4BP3A 4YRLA 3LWZA 3A9RA 4DMFA 5AVKA 1Z5VA 5REQA 3RIGA 3ZW7A 2ZSIA 4YV2A 1PCXA 3QQPA 5EIOA 4BMZA 2PX4A 2YOFA 1ZMOA 2VTEA 2ZYSA 3R6LA 4PQRA 4NLLA 3M1AA 2PJRA 4W9NC 1RDFA 1ZXLA 2BUAA 1P7CA 4KE7A 5SICE 13PKA 4L74A 1V1MB 3EARA 4Z5XA 1PJCA 4DB4A 1LW7A 4E1AA 4XEHA 2A1TR 4HXEB 3AIOA 1OXKB 1PDVA 2ZRGA 1FP1D 4C89A 1QX4A 3L0PA 3LC2O 4CVNA 5LP1A 2Z30A 3CUSA 1HK7A 3LXMA 4M1OA 3COPA 3T4XA 1YDHA 2VDMB 3CQ9A 3I83A 4DWVA 4V1CB 4UJ3A 3AM5A 3EQ8A 4DQ0A 4FFOA 3BE8A 1UEJA 3OWXA 2PJZA 3CSDA 4TTQA 5F1PA 4L5BA 4WUTA 2M98A 5BVGB 2I6QA 2PD3A 4R05A 2GZ3A 4XTCS 5FTMA 4ZDIA 2JFXA 5CB4F 4HDRA 3RIXA 1IBLB 1GG2A 3BN3A 4ZQBA 2VATA 3D0OA 4RFSA 4UC0A 4ZRMA 4RHEA 3SYLA 3LPMA 4YMVA 1P8AA 1ZONA 2EQBA 3E3LA 1ZM2A 3P0JA 4DIKA 3E48A 1XFDA 4PZUA 4GWLA 4IQ0A 1E1NA 1WHTA 3N7UA 1B8OA 2YV1A 4EOGA 5KOYA 1XMJA 1PR2A 1N0WA 2R11A 3H05A 4L4UA 4YAIA 4MQEB 4MEJA 3GRRA 4J3FA 4R2HA 3U3KA 2QP4A 1Y5RA 2DFTA 4CYMA 2Y0BA 3DFUA 4D96A 2HSJA 1L8AA 2H5IA 2PD6A 4KGZA 3AKZA 1MJGM 1WEHA 3B7PA 3TZHA 5JAOA 1UZMA 3EY9A 4KN6A 3U7GA 1R16A 3GGSA 1OXTA 2IXEA 4HGYA 5L3SA 1K7SN 2GN9A 3V6MA 3I05A 3IEIA 2ZZMA 3AI3A 5F73A 1M67A 1EG2A 4OHRA 3TRKA 3ZZNA 5A3RA 3QJ5A 4PPGA 3IB6A 1TA9A 2F90A 2GD2A 3VMFA 3J81A 2FZGA 3X1XA 4OHUA 4M7OA 1FYWA 4MVJE 2M1XA 1KZ4A 2P6MA 5IMBA 2GD1O 2YASA 4X5OA 4FILA 1H3EA 2PS1A 1O9GA 2O06A 2E9SA 2ZYGA 2JI9A 2VZ9A 4NL4H 1BHJA 1QXSA 1RM0A 1ULAA 2GEDA 4YDRA 4CM4A 2A35A 3OVMA 3ORHA 2Z9DA 3EQ7A 3SHQA 3JQFA 2H1FA 4KGVA 1NE2A 1UJMA 2WF6A 2BZSA 3K2IA 3QW2A 3DD5A 3EHEA 3E6AA 5CDFE 1PJTA 3QFTA 5KTSA 3L7YA 4B76A 1BOOA 4LE0A 3M3DA 3TRJA 2FJ0A 1X3LA 1CIVA 4FSHA 4BNJA 3EXEB 2Z6AA 3EVGA 2J6BA 5CIYA 3FSEA 1T2EA 4ZEWA 2J3MA 4Z9FA 2VSQA 3QXXA 4DHEA 2DB3A 3OUTA