3NEAA

Crystal structure of peptidyl-trna hydrolase from francisella tularensis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
187
structure length
187
Chain Sequence
PKIKMIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNPKLNCNLAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHLGTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDIINYKLEPVMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structure of Francisella tularensis peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Hydrolase
total genus 58
structure length 187
sequence length 187
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3neaA00
4JX9A 3P2JA 4IKOA 4OLJA 2LGJA 4ZXPA 5IMBA 5IVPA 4LWQA 1RYNA 1RYMA 3OFVA 4DHWA 3VJRA 3TCKA 3TCNA 3NEAA 4P7BA 4FOPA 4DJJA 4JWKA 4QBKA 3TD2A 2NAFA 4HOYA 5EKTA 5IKEA 4JY7A 5B6JA 3V2IA 3KJZA 4FYJA 4JC4A 4FNOA 2Z2JA 4Z86A 3TD6A 4QD3A 4FOTA 2PTHA 2Z2IA 4QAJA 4QT4A 2Z2KA 4YLYA 4ERXA 3KK0A 2JRCA 2MJLA 1RYBA
chains in the Genus database with same CATH superfamily
4MCHA 5BRAA 4C9BA 3M6VA 3NNSA 1JG2A 2B8WA 2PUHA 5BNIA 1X1DA 3F8SA 2QN2A 3P2YA 4G5FA 4LHXA 2CC2A 4W7HA 2IFTA 5CNJA 1WMEA 5FKJA 1G3UA 3ONVA 5FA8A 1DAEA 1F1BA 4ZYLA 4EPYA 3SR4A 1ZH8A 1G7CA 1G66A 1NW9B 3I6ZA 5CLJA 4AJ1A 4QLBA 4X71A 4EKEA 2XA2A 3ER9A 3NVMB 3QOFA 4ZCQA 4CKZA 2XCQA 4QAQA 1QHXA 1W5AA 2I2BA 4DDMA 1CQXA 1L5OA 4RTJA 5F76A 3ZHVA 4G5RA 3QPVA 3AUAA 1HL3A 2VHTA 4MWZA 3UH0A 2AYXA 3JQ8A 4AF6A 3WFZA 1JAXA 1LF5A 5GINE 4MQFB 1I5RA 1UDWA 5K4GA 2BHNA 3PDJA 4B5LA 1KNXA 3PUZA 5ES4B 2WA2A 2J5XA 3OP4A 4LQ4A 5FHRA 1GGVA 4HO1X 521PA 3SKYA 3U4GA 2PX2A 1RLUA 1Y9DA 4KHZA 1S2OA 1C4WA 4K6FA 1GN9A 1UWLA 5IBPA 3CEPB 4H7FA 5DVZA 3BIXA 4H7HA 2RC5A 3QJGA 2HIGA 1YIDA 3AB7A 4NOMA 1KK1A 4RQAA 1C0EA 1SUDA 1I6KA 1SQ0A 5K3CA 2O5CA 3UJPA 2C5GA 2WJIA 3BSSA 3D7SA 4MRPA 4QA9A 2EZ9A 4ZJYA 3AF5A 1JI0A 2H07A 2UAGA 4NU5A 2YYZA 2EJCA 5JATA 3FCAA 4TRMA 5LA6B 1RQRA 2X7XA 1M6HA 3A3PA 3N75A 3O4HA 3PCXA 1ZGZA 4OA8A 3DV2A 4RPKA 3W5BA 4GKJB 3FBWA 3P97A 1V8BA 2VK4A 4Q37A 2ZLBA 4X91A 1RHKA 2WA1A 3I09A 4IZ6A 4MPDA 3D3JA 1KFJB 4KL8S 3MJHA 4CL8A 1BVYF 2IU3A 4N76A 1PJAA 4ISCA 2GM3A 5H82A 2CLOB 3BJRA 4YMGA 2FQWA 4M1WA 5DCUA 2I4MA 3W9YA 4F38A 1KOFA 5A5FA 2NZVG 3SZRA 5CXSA 3F3SA 3NP9A 3GLTA 3Q7SA 2QLTA 4F2DA 3I34X 1C7RA 2OENG 5AW5A 4B8ZA 4E4TA 1CHDA 2XOKA 3I32A 1G8YA 3H04A 4NPAA 3NV9A 1XA3A 4RJIA 2IBTA 5DHSA 1AN9A 1YKSA 2W4MA 4MVJD 3VHQA 1VIMA 1SUIA 2H57A 2JFGA 4JOBA 1FU4A 3HDHA 4IH4A 3M5WA 1IG3A 3A1SA 4PLYA 3O83A 5FBKA 3OZSA 1WXEA 4AY2A 4GZ6A 5A7FA 2YYYA 3OEWA 4NCJA 4HGZA 4MMZB 2JCXA 3DB2A 4H7PA 4AFNA 2XBLA 1HKHA 3KHKA 4TTJA 2CDCA 1G5FA 2GUGA 5GONF 2REQB 3EIFA 1SU7A 3F7TA 4RL4A 4EG7A 5C53B 4M55A 1OILA 3OIVA 2ZTLA 2FR8C 3A3OA 5FDFA 2Z9CA 5CJPA 3FRJA 5B3JA 1E61A 3OM8A 2RCNA 3BEDA 4K6GA 2GZ2A 2IS4A 5K03A 1DDIA 1ZZGA 2B36A 3EQZA 4Z9XA 1FVOA 1MABA 4E30A 5BVGA 5K09A 1W6RA 2PEYA 1T4DA 5FHQA 1GRVA 3WXBA 3FN4A 1UZNA 1LI4A 4NDNE 5COQA 5LZ5A 4MSUA 4C0HA 5IC5A 3NBMA 2VLBA 3Q12A 2AN9A 3EMKA 4FOPA 2Q3BA 3SKVA 4D8UA 3ZHBA 1AKWA 1U3DA 2P6UA 3DWIA 4FCCA 4B2PA 1OR8A 1TTQB 1ESZA 2GSDA 2UZAA 3EY9A 3OEHD 4FSHA 2J9YB 2QN7A 3AONB 3AQIA 3D4BA 2YC4C 2V7QD 2QVXX 2QU7A 3FI0A 4GU5A 5THXA 3ZVNA 3RSFA 2X0RA 1F48A 4EG0A 1UDBA 3QXSA 4URWR 2R8XA 4I36A 1LV7A 1YB4A 3MGCA 2I62A 2WC1A 1L3BA 1U1GA 1NFFA 3C8ZA 4TUYB 3WOHA 1BKYA 2FCAA 4GMHA 3RRBA 3IMGA 4I4LA 3UT5A 4IHJB 2OCGA 2CLMB 4MJ7A 2HREA 3MUFA 1A98A 3WAKA 4DCVA 2XMGA 3C70A 2KS6A 2Q4DA 4K7JA 3WGTA 4EVQA 1EDEA 1ZD5A 4LYFA 4UJ3A 5DRYA 3DCYA 1SUFA 4OQEA 5EZ5A 4X3CA 3SM9A 4V0SA 2OZPA 3KQLA 4LXUA 4YQEA 1NUTA 5EZYF 3X0DA 1J00A 3JASB 1DQZA 1FTQA 3K5PA 4DR4B 1W8DA 1L4BA 3RK0A 2HSEA 5E6RA 2RGNC 3AM1A 3E05A 3OA2A 2AX3A 4PBRA 4BJ6A 4EJSB 4HHEA 5GVRA 5KU1A 1KVTA 1R6DA 2FOIA 3EA4A 3G2HA 2GDJA 4OK5A 3KB8A 4EPVA 3QFCA 4WJZA 1ABEA 2IYTA 4QYMA 1PLLA 4GOXA 5HJ2A 4AKEA 3H2BA 3PDUA 1XMXA 4BV2A 3ASYA 3T35A 1S3FA 4ZOLB 4LHVA 3AI2A 4DVJA 4M0CA 1A82A 1S2MA 1TQ2A 2H4YA 2H8GA 4P1ZA 3W04A 4BNZA 1QRSA 2PUGA 5G2OA 5D6NA 1Q83A 3BE8A 3BTOA 4IFBA 2AC2A 4E6EA 4YRGA 4FM9A 4IDNA 2ET6A 2FTKE 1Q1QA 2DWCA 3ASUA 3HXTA 3RLIA 3V4OA 1DXYA 4HDQB 4XUEA 5F1YA 1DX9A 3ZKAA 4G5XA 5ITVA 4TV8A 1CY8A 2M1ZA 3O2SB 1UUFA 3PWTA 4GZLA 4PQFA 1O57A 5HFJA 4D0LB 2QAGA 3QJ5A 2NU9B 5KSWB 3FGOA 1ZHFA 5U1PA 3VOTA 1AGPA 5IVPA 1ZK3A 4M9RA 4BFSA 2IV2X 4Z4EA 3O8QB 3JQBC 3LLCA 3TGPA 2V74B 1FU8A 3P20A 4HX2A 2R4QA 5ESDA 5IJ9B 2B4AA 3TO5A 2CFOA 2Z8ZA 3EZ9A 4U2FA 3ZQ4A 1OFUA 4DUYB 3B6MA 4QVGA 4E94A 3CEMA 1L1FA 1M9NA 1XZQA 4PQRA 4XVUA 1EUYA 1CLUA 4J0QA 4R2MA 3KYDA 2B5VA 1B41A 3UC9A 2CLDX 3VGPA 4BNKA 1EX6A 1U0OC 4DMLA 3U09A 3OJCA 3ZWXA 3F5MA 5E0KB 1KMHA 2ADFA 1IXRC 3KDAA 1E2GA 3VZCA 2CXHA 5KI6A 3TTXA 5DNCA 3THYA 3V4FA 1YE8A 3C5HA 3AWDA 3AFIA 3EUAA 3ON5A 2FZLA 3ESZA 1AUVA 2NSJA 4WDQA 4YRAA 5A3QA 1RWNA 1V5EA 2O5EA 4CMCA 3QQ5A 3H75A 2H9IA 4JS0A 4Y2SA 4EHKA 1E6KA 4GO1A 2ZUEA 4TPKA 3M1IA 3N2NA 1T9KA 1GQRA 1TO1E 2IZ0A 3AHJA 1VP3A 3MHTA 4D46A 2Q1YA 4IEEA 2R8BA 5AVTA 1DKRA 4KWIA 3KB1A 3SJAA 1EFVA 3QUAA 4LOLA 1BO6A 2W0MA 3GRAA 3IJPA 5EMJA 4NCHA 1XBTA 2ZI7A 1TFUA 3WYBA 1XQXA 5B6JA 4CV1A 4YUVA 4RAQA 3DL0A 3ZWBA 3HN6A 3TIVA 3BL8A 3LY5A 3ZWKA 5C4IA 2PO5A 3BUSA 4PC1A 1UXJA 1YQ9A 3UM9A 4TQGA 5CBPA 5KNLA 2ZB4A 4AMUA 1NBME 1WF6A 4EW2A 3JQAD 3NBQA 2H16A 4Y30A 4ZPJA 2H5JA 2KLBA 3QSYA 3G0GA 4LDRA 1D5WA 3I2HA 4UBJA 4X90A 3RS9A 4PSDA 2Z6QA 1XKLA 3F6SA 1X2EA 2YMLA 3ORSA 3T7CA 3GFVA 2EYQA 2HMVA 2I91A 2ILVA 4EHHA 4GM0A 1WEHA 2WP8J 2ZYRA 4DOMA 4UAVA 3VZBA 2W43A 3R0VA 3K9QO 1E8DA 2YN2A 1M8JA 2YWDA 2FRDC 3ILXA 1KMNA 2YWEA 2H06A 2ZIVB 1RCUA 1ZOOA 4MV6A 4R1NA 4EAAA 2D5BA 4R69A 1TU3A 1L0BA 3AFGA 4N03A 2C1ZA 2PAFA 2LDBA 5J2UB 3RVSA 1RYBA 1KDTA 1KI4A 4IDFA 4IX9A 4RA6A 2ROQA 4K1LA 4TS1A 4X84A 2EATA 3I9MA 5E6UA 1GQYA 1MC5A 5DTEA 1R8JA 2XEXA 3PXXA 1QF9A 2G1AA 4G5YA 2O8FA 2JANA 2AA3A 1MB3A 4M54A 3LQFA 1V37A 2Z98A 3NAMA 4N7BA 3VDNB 3LY7A 3TR6A 1GG8A 1T3TA 3D7NA 3AF3A 5TV2A 4IHKA 1YHYA 2AYZA 1VPVA 3DUFB 3EVNA 3AVPA 3P26A 1QFSA 1WOYA 3C6BA 3RVOA 4L6IA 1QWSA 1K06A 2CHVA 2VOEA 3P94A 2DF8A 4XCXA 3ROEA 4DTCA 2WB2A 1YHZA 5EESA 5CW2A 3GFQA 1FIUA 1VKJA 1FC0A 2ABWA 3OPNA 4DSTA 2DTEA 5AHKA 1TM5E 2GXSA 2P65A 4NBLA 1G4HA 3ZU3A 3ZJTA 3EQ6A 3BGDA 3BOSA 1KJ8A 3I1FA 4L15A 3SS7X 3BC1A 1XKQA 4A8HA 3CBQA 2HD4A 1JLMA 3PC8C 1U3CA 2PANA 2O57A 2I8CA 3MWKA 2XKJE 1SCIA 1YCHA 1RBQA 3AJAA 3AO0B 2P7IA 2J9FB 3BCRA 2R86A 3MIIA 4Q9JA 1CUDA 2COKA 4BVFA 1B42A 4WNIA 4XYBA 1C3JA 3SXPA 3I92A 2JLRA 3F6PA 1QVZA 1P8JA 1GZ3A 2X3FA 1TYEB 3L43A 1B8UA 1RKXA 1YE5A 4TV8F 4L51A 3G2OA 3PYMA 5CB6A 3A32A 2HO5A 2QX4A 5AM5A 4UXJA 2KQUA 3PRHA 4GI2A 3RADC 4Z49A 4JLOA 5TVGA 4MP8A 3S0JA 3IKJA 3BQNB 5EUMA 4II3A 4HB4A 4Q4CA 2W22A 2YOGA 3D0KA 3FMGA 3FDJA 2AFVA 3E03A 4D4KA 1FUIA 1I5OA 2PBFA 2PSFA 2A9RA 3IIIA 3JWGA 4MA0A 4X1YA 4YYEA 4DLPA 1Z5WA 4KPEC 3PRKE 1U0RA 2Q0XA 2XVYA 3HVIA 4H9GA 3SM3A 4DNXA 1XU7A 2YQ5A 1C9MA 2LZ0A 1C7JA 2GF0A 1B0UA 1SHLA 2PIDA 2V7XA 3CUSA 2W6ZA 2VT6A 5JSQA 3B6JA 4QFMA 2GKGA 3NWPA 4INOA 1K5GA 2OXEA 2JRLA 1P6XA 1YTUA 2G9ZA 2POQX 4WADA 5EP1A 1ZYUA 1WUTA 5JJBA 1VI6A 4U7FA 5GMOA 3B36A 4ARUA 3H17A 3IP5A 1SBTA 4GXQA 5LMZA 2YYSA 2NTEA 5AHOA 1EGHA 2VN8A 2ZR9A 4HNTA 1E2BA 1JU4A 4AZWA 3OU2A 5H3LA 1QIHA 1QLJA 2D59A 4ND8A 3FTQA 3KOZA 2QRQA 4HWRA 3A6PC 4A2QA 4LE0A 3W4IA 3PWSA 4XPIA 4H3KB 4UHCA 3JY6A 3B82A 4YHHB 1C8KA 2YZGA 2Q0SA 2W6PA 1I7QB 3MRSA 1WEKA 1E3LA 3WQQA 2C7PA 2VQEB 5IUNC 1NKSA 1MPTA 1W4RA 3HR8A 3AF2A 4ETIA 4EARA 5JZ9A 2P67A 3RJZA 3V4VB 4MQEB 2XYQA 3OI7A 4EO4A 3SN6A 5EJFA 4L16A 5DP2A 1A8UA 2BDEA 3M5PA 2ZE6A 3U40A 4GRAA 4LMBA 4BLOA 4OF4A 2HT6A 4PLHA 3L8ZA 4QJ5A 3T4XA 4EK9A 4GEKA 3QYFA 1KHTA 2JGAA 3GB9A 1V4BA 3FWZA 4Z9YA 4ZCRA 1M8GA 1G1MA 2QJOA 4WLNA 1I1OA 3CHYA 4OHUA 1HURA 4R16A 5KDDA 2ZSAA 3HVHA 2R60A 1OI3A 1OAOC 3LGAA 3GA7A 1WB9A 2VQ6A 3TBFA 2PCJA 1ADFA 1RQGA 4IS2A 4Q15A 3T1QA 1JEJA 2CFSA 3HKCA 4O02B 3RFCA 1HRKA 1NJFA 4DYVA 5C80A 1HDIA 4YA6A 3VDRA 1SHKA 1X9IA 2KSQA 4LY6A 5HCIA 3D7LA 3TR5A 4B45A 4EY8A 5TX7A 5DGIA 3GPLA 4IF4A 4O5AA 3RVDA 4BRSA 5BURA 1SRRA 2X0FA 2H2DA 4NBRA 3TSOA 3IO3A 1KGDA 5CA0F 2CYCA 3WGVA 1QONA 1E1QD 4ZALA 2YMPA 3GZTB 2CK3A 3FOWA 2EQBA 4KH1A 3RFFA 2WW8A 6REQB 1K7FB 4YAIA 1WNTA 1B2RA 1D8AA 1GUYA 2VUHB 1AXGA 5AHRA 2CNWD 1WXGA 1ND5A 2IDKA 2UU9B 1FYWA 3ZGZA 3QKSB 4RK1A 2R97A 3JD0A 1USKA 3FCYA 1Y5RA 2FW9A 3DE5X 3GWGA 3NEAA 3MELA 3NOVA 1JFRA 3T12A 4E1VA 1PUIA 3U7RA 4JROA 4DLTA 3TF5A 1Y3FE 2BTQA 3C14C 1KFBB 1KU0A 4HDRB 3JQ9C 4NFSA 2G82A 5KTSA 1L5WA 1PT5A 1WABA 2F59A 1E77A 1SB9A 3IBSA 1B7GO 3HWX1 4IV5A 4BNUA 1KQGA 1YRBA 4D3YA 2PPLA 4ZU6X 2GEDA 2OLJA 2O1EA 1EAYA 1C29B 4ZQBA 3U61B 1KRXA 1X77A 1RM4A 2A4KA 4G0UA 1MJ5A 2A4MA 3HHEA 5AHXA 5CB4A 1QANA 3CIFA 3DDHA 1Y3CE 2XDWA 4M3NA 4PNPA 5CH5A 4DR7B 2OQIA 1BDBA 2XJ9A 2XWSA 1RXUA 4XI9A 1WA5A 4J0GA 3Q3JB 4X54A 5CYFA 5AOBA 4KLAA 4BBPA 2AQKA 1G7SA 4DJJA 1XPOA 3N1UA 4TWRA 1T3SA 3WGQA 2RGDA 2GAOA 2IQIA 4MDFA 1JJVA 2HLDA 3UGQA 3UNXA 2HA2A 3SE7A 5BNZA 4XM0A 1NV9A 3MJEA 4X24A 4U7PB 4U3JA 5EWJB 4FZ5A 3SPXA 4Q9AA 1T2EA 1BMDA 1P74A 4HNUA 1OC4A 1O6FA 3W3AH 5JDIA 4G2TA 3T9AA 3MINA 2H4XA 4A6EA 1NI4B 1QDUA 4MLCA 1QHHB 1ISHA 1RYMA 1POXA 3FJYA 2F00A 2F9FA 2HRCA 3GG2A 3PEFA 4X8LA 4BATA 4E31A 5FUQA 5H8WA 1PGQA 1R9JA 2OD7A 5FBWB 1SN7A 2FDRA 2OHXA 4Z1MA 2FCRA 1T2AA 2OORA 2RHDA 2Q5QA 2AHRA 3I01M 1LF0A 3MVEA 5ALEA 1Y8ZA 3FSJX 4AZSA 2A9KA 3FUVA 1T4MA 4IQFA 4MRRA 5K8LA 3E2MA 3RFXA 4BYMA 3CLTC 3OFJA 4LOJA 4CKWA 3DGEC 1I3OA 4PWYA 4XYEA 3H2SA 4DG5A 1BHO1 3PNVA 1U3VA 4QPZA 1SM4A 1UBKS 2CY0A 2FQ1A 1E4VA 3VQTA 2RH5A 4QJ3A 2E1RA 1M5TA 2D74A 1IN5A 4YAGA 2UUPA 5EI5A 2AX4A 2OBMA 1RP1A 5EP2A 4C3OB 4M1SA 4RDIA 5BSEA 5I6DA 5LYJA 1GITA 4IJQA 2EVWX 3V33A 1W44A 2I6SA 2Q6VA 2CDAA 3GRYA 3CZ4A 4WY2A 1IJEA 5DMXA 4AD8A 3AEYA 1B16A 1CQJA 5HKKD 3W6ZA 3OOEA 3T1NA 3CN7A 5FUMA 4F72A 2INGX 4M1QA 1H6BA 1RTTA 1VPDA 2HA5A 4QGGA 4HT3B 3HA7A 3IDZA 1QQ7A 4XPZA 4EKYA 1KPGA 5HM8A 2AXQA 3T7TA 3WNQA 4URVR 1UJNA 3D7MA 3OT5A 4O29A 1XNGA 3HXLA 4BQFA 4GMKA 1PX0A 2G1UA 2I33A 2PVCA 2PZAA 2ZRMA 3D7KA 3C8HA 4YP6A 5H1YA 4ZIRA 1FZQA 5CFMA 4MR8B 1O6BA 3LPDA 5I7WA 4EHIA 221PA 3EAGA 3STVA 1J70A 4R51A 2R6CA 1WBBA 1CS0B 1UBHS 4JXXA 2ACEA 3DPUA 4M99A 1DJNA 3KZ1E 2G9RA 2VPWA 4I08A 4JNCA 4QBTA 4Q9NA 3MNFA 5F77A 5HF9A 4OKSA 4AICA 4BQOA 1FP4B 3HZHA 1DDGA 3ELWA 3JD2A 1OZFA 4TTTS 1R0BA 5CXQA 3ZXSA 3KJNA 1RQ2A 1H2XA 1PK9A 1DPGA 5KDLA 1CX9B 3FVVA 3HP7A 2YFHA 2FPIA 3HRIA 1H5NA 4NDAA 2RHTA 3MWDA 3NDIA 4QQRA 2OILA 4AUEA 5BWBA 2QZSA 1C7ZA 1T0IA 3A2NA 3GGCA 3N74A 4JSYA 5HHTA 4UNQA 4CMJA 2O0JA 2HPHA 1N5LA 2XUDA 3R7LA 4B71A 3P0RA 1E8MA 1RPAA 2QLLA 3WFIA 3K6SB 5HJ5A 3SG0A 1F6DA 1U0JA 2FUNB 1XDUA 3VVLA 3IDAA 4AG3A 2CFRA 2UVPB 2HU2A 1H69A 2L82A 4J94A 1WSAA 1LBIA 5EMMA 1Z73A 4K9KA 1GOTA 4CLOA 4DR5B 1GDHA 1PGPA 4EUKA 4CEIB 1JPJA 1H5QA 2C94A 2WT8A 3QX3A 3EIQA 2FJ0A 1ORRA 4NXMB 3WGNA 1XRMA 1V35A 2IYWA 3PX7A 4YX9A 2XGJA 2J8ZA 1YGPA 4R81A 5GZ6A 3ZV4A 3PE3A 1YULA 2L17A 4WEQA 1NASA 1GTVA 1VPWA 5EWMA 1GAEO 4IPTA 1P3DA 3A6GA 2BZGA 1VE7A 1R10A 4HRAA 3ZV5A 4WZAE 1MLDA 1G21B 4FIDA 2P2NA 1XYGA 1EM8B 1UFRA 2XMQA 4RD2A 3WLSA 4P22A 2X0IA 3IIEA 1CQIB 2HK6A 3OD1A 3SICE 4BFTA 4DMUB 2AJBA 2ZXEA 1XOIA 2CXPA 3OOSA 5K05A 1L7EA 2VNJA 3P9ZA 1DX6A 2A86A 3TFWA 4XX1A 1G1AA 3EBPA 4FKMA 5F5XA 2A35A 4CLRA 3GFBA 1T15A 2X2OA 3IAXA 4D1YA 4D8VA 3SC6A 4LYEA 3GLHE 1QLHA 4EGQA 4OQPA 2X6RA 3A1VA 3KT6A 1Y7LA 1RR6A 2QP3A 1TMYA 1A7KA 2OZKA 4Q02A 4CV0A 3KEGA 2CBGA 1KQFA 1SKYB 1YAHA 5EE9A 4FDVA 4INZA 4Z0NA 4EVRA 4UUPA 9LDBA 5EJ9A 1CUGA 1LLUA 4N54A 1Q0TA 4EYGA 1X19A 3TYXA 1VA5A 2G25A 2XE7A 2TECE 1OKKA 4MWGA 3N8NA 5U9CA 4RPLA 4EW1A 5JSFA 2JIBA 3GCWA 4BKQA 5TPWB 1JSRA 3JRNA 3ZHCA 4KO3S 4O2RA 4BNLA 3DG9A 3KQQA 5LYJF 1K8ZB 5EKSA 2RAFA 4PANA 4Q1VA 3DW3X 4MJLA 3INTA 2Q9UA 3R3HA 4MQFA 1ZI6A 1U5AA 5F1OA 1GIAA 4CCSA 4I4TF 1M5RA 4KWCA 2NZWA 2VZ8A 4NJEB 4Q39A 3FTEA 1U7WA 2PA3A 5EIWA 1O0CA 4XOUA 3HVKA 4O1MA 5ENVA 4EY5A 2EEZA 1I0LA 2HJGA 3HWWA 1XMPA 2CL5A 5EGSA 4J1TA 1NMEA 2FXIA 3FPAA 4PV7A 1JMYA 1ZOPA 3CMMA 2W42A 4XQEA 4IIGA 4IFIA 2Y93A 3ROPA 4R2WA 4BMXA 2W8BB 3U56A 3C6KA 2IEZA 3VSBA 1HQCA 3DOEA 3H3JA 3MIZA 1QZ3A 3VR4A 1QH0A 2GGSA 2XNKA 4TM8A 4D4GA 5DNEA 1FMCA 3ZG6A 1QDEA 5KYNA 2BI8A 3A6JA 1P39A 2RGXA 1Z5NA 3QENA 4WTOA 4BO1A 5A4MS 1OJLA 2VDNB 2GD2A 2PMDA 3BERA 3HR7A 3FRIA 5LA6A 5K3AA 3BX1A 5BUZA 3IPLA 2VNAA 4U02A 4DRXA 4KXMA 3D8SA 4Y6OA 5JYBA 4FMDB 5IYZF 4KQXA 5JZMA 4F5WA 1Y82A 2VBCA 3Q3EA 4AXBA 4C4OA 4LZOA 3AHCA 5KOJA 3F7NA 3FA2A 1KERA 3K0AB 5EERA 4UPEA 2IUYA 3N5CA 4C7MA 4CV3A 4DBLC 2YHIB 3PQ2A 1E3MA 1IVSA 2F3TA 2GO1A 2I55A 1PAUA 3I5AA 1XCLA 1TTHA 3RD5A 5FXMA 4KACA 1JKJB 1Y9ZA 2ZTHA 4PC3A 3ORQA 1UKBA 5T41A 1KZ9A 3RBXA 3PHBE 3KCQA 3WLNA 2Y1EA 3MD0A 1GAXA 1O94D 1MPXA 4A8PA 4PLGA 1UJ4A 1F8YA 1W9MA 2ZSKA 4YR7A 5LP1A 3OMWA 1D2CA 1P1HA 1A9ZA 1JDSA 4X7PA 4ZEVA 4FT2A 1VRWA 2HWKA 1X86B 1YZYA 1YONA 2ZGVA 1ZRMA 2FE1A 2PL3A 3EXAA 3FOBA 1NAHA 3G9TA 4PS0A 5T5QA 4DPKA 1OZ0A 5CX1A 3FUUA 1XMIA 1B23P 2H63A 4IH1A 1REQB 3HDJA 3O0DA 4WDRA 4BHTA 4PG6A 2O3RA 5LB4A 2PFKA 2P62A 3PX3A 2PGXA 1AH2A 5ALQA 3M2TA 3N8KA 4P83A 2VQSA 2GYUA 2IEGA 3ACCA 3MFQA 1CNFA 4ZCMA 1GPDG 3DZIA 2XDYA 1F6WA 2CVFA 1N25A 4IVRA 1NW5A 3OM1A 4I14A 2C9BA 5AQ1A 1FTYA 4GT1A 2FSSA 3ZV7A 4FYMA 4HVAA 4ZVLA 4QOEA 1ECLA 2QMOA 3K6RA 4LSZA 1DGQA 3ENVA 2HQ1A 5NLLA 1M7GA 1TMKA 2FYTA 2XNHA 1LPAB 3NHJA 2NV6A 4MRAA 1IBSA 4BNJA 5KYKA 1FDUA 4C5BA 2IEAA 1YS4A 1P17A 2W4QA 4LA4A 4PEVA 1JDVA 1G20E 1MC1A 4EKNB 1ZISA 3SHOA 2YBDA 2XQVA 1WTAA 2VRNA 1U6JA 3L41A 3WYEA 1C8BA 1U3GA 2ORIA 3HLYA 1ZM7A 3TTTA 2ZTVA 1QFZA 3BMOB 1G5PA 2Z6UA 2V1UA 1E2JA 2C58A 4KGZA 5DBHX 1X70A 3DFUA 3CJTA 3WYDA 3QVJA 1SQFA 4OFWA 4JYPA 3FETA 3C3BA 5C5CA 2IS2A 4LYGA 2YVKA 1WU8A 3K1TA 4LNAA 2FSUA 1EM6A 4TKVB 4TUYA 2XUKA 4MWCA 1WXFA 3I9JA 4C89A 1ZN2A 4MPPA 1BDMA 4DLRA 4IHJA 4LWQA 3NR2A 2D7DA 3DKIA 1GTJ1 2EWVA 3CPJB 1I4OA 3RG2A 4CMEA 1JG3A 1LTKA 1P0MA 3KUXA 2QD3A 3VSDA 6NULA 3O0TA 1JIUA 4YXFA 1XTUA 2HTFA 2O3JA 3LF2A 2HHHB 3FYUB 4NECA 3EFBA 4NESA 3L6DA 5LP6B 1I4LD 3PWKA 1KSHA 3JASA 3KVYA 4F8YA 1TC1A 3ZJVA 3DZDA 1DC3A 1NDHA 4EJSA 2XOKD 3DXZA 2Y92A 5C32A 2RGEA 2P9JA 3RU7A 1QAOA 3NTLA 3FPHA 4D9JA 3NANA 3K09C 3P9QA 5AVJA 4WZ6A 3HTXA 4KIJA 4N3AA 1WIWA 2B30A 2YV5A 3U3KA 4MI3A 4C0AC 3WIBA 5IM4A 4YGYA 1V39A 1QMPA 4RHFA 4ZOLA 2FSVC 1WZUA 5CH8A 2IPAB 1VKHA 2WEKA 3QIAA 1OT3A 2QN6A 1OYWA 3DHNA 4EKGA 4C6HA 1BZYA 1JFFB 4GMDA 1Z6QA 3DBOB 3QVKA 4KQWA 13PKA 4TQUS 4ES6A 2Q4RA 3KPUA 5F73A 1SC6A 1KWKA 1KOLA 1VE5A 4V0ME 1QHNA 1AKEA 1UXIA 2C4NA 2OV6A 3L1VA 4XPIB 3QPWA 4ZI7F 4TKZA 5LZ7A 1A9YA 1IM5A 1QYXA 3K9HA 1YC2A 4GBJA 4GKBA 5CH3A 1L8OA 1PVOA 2J7KA 2YV2A 3FVQA 1E92A 2XSZD 4AJ4A 1IUOA 2J4CA 2NU9A 1T0HB 2ZI3A 3E53A 5HKLA 3I0NA 5TC4A 3K94A 5TDHA 3M6AA 3T3GA 3AKEA 4QVKA 5JPDA 3O3CA 3BYZA 2J41A 5ERYA 2XCSB 2Q2VA 3ZLBA 3DMTC 1UZUA 5IJ9A 3EIWA 4MQBA 5AVOA 3W4KA 2ZSIA 1UPBA 4RDHA 5JHHB 5L4NA 3SOZA 3QF7A 4JDPA 3WNCA 3D02A 2QBYB 3T61A 2R62A 1YV9A 3I83A 3CWZA 4GECA 3WWYA 4NZNA 1EESA 4CLHA 3KQHA 1FRZA 1HFEL 5EE0A 1HYBA 2FWAA 4GX2A 1OCEA 4IFTA 1CR1A 1XDBA 2XA1A 3ZQKA 4BLSA 3QEBZ 1JZQA 2ZS8A 3L7JA 3HJGA 1LDMA 4R8VA 1U9YA 1D8TA 1NR5A 3JARB 3TBKA 1ISSA 4QTTB 4B84A 1V8OA 2ESRA 3CSDA 1NSYA 1RT9A 4JUIA 1ABFA 2OSVA 3OHMA 2OYRA 4N7JA 2YR0A 2JGDB 2FF5A 2PWZA 2EZ4A 1ZMXA 1NN0A 1LJ8A 2ERXA 1TZCA 4ARZB 1MVLA 1XWIA 2VDPB 3JATA 4HWTA 2JGJA 5JCXA 1ML3A 3EXG1 1CZOA 1DBIA 3TQTA 3LT1A 2AZ4A 4RTSA 3DOJA 3KB2A 5D7BA 4DM4A 3NJ4A 3T1YB 3ABQB 4U1RA 2ID9A 2WJYA 4BNDB 1Z0UA 3BICA 3DF7A 1RU3A 3IILA 3KK0A 3LLSA 2H5LA 4UVIA 2APJA 2XTAA 1WUHS 4P4SB 5D84A 4CFSA 3GJYA 2IEYA 4XM1A 3WGJA 4DGQA 5ADWA 1IUKA 1Z2CA 3QNWA 4LI0A 4BXOA 3BMNB 5HXAA 4ND6A 1L4FA 2WFLB 3ESXA 3I01A 3K2EA 5EUBA 1AKTA 5GJVC 3H5IA 1OROA 4MV3A 3U5ZB 3LGSA 2CNBA 3SZ3A 3LRXA 3R4CA 1B2LA 1G9SA 1RPTA 1P18A 2CW5A 4H1VA 1ODIA 3ND5A 1Y1LA 1JWBB 4C4AA 2V54A 4H18A 1CDEA 5DYWA 4AMZA 3A4YA 2RK6A 1K4YA 1AQIA 4JUDX 2GAAA 4ND2A 4NYJR 4JC4A 4MGZR 1UDRA 1R88A 2Q0HA 2GBPA 3TMAA 5J2UA 2IX3A 1O6CA 4NRDA 2FF7A 4IIYA 4WRRA 5IJWA 3MCWA 5HVNA 4TKLA 1ZC3A 5T4EA 5HBGA 5DM70 1N78A 2X5KO 5AO9A 3IP3A 4CM7A 3ONEA 2WPDD 3O8RA 1VSVA 1GCUA 2MSWA 2PX6A 2OM6A 1HF3A 5JS2A 3DUFA 5KJ6A 4GIBA 3HSSA 5CNIA 3HA2A 1C4XA 1E1YA 6GPBA 3ZK8A 3DAHA 2MINB 1YKGA 1MJHA 4F1KA 3NONA 3P45A 4X95A 5H4HA 1BDHA 1T9ZA 2X5XA 5AVUA 1KJ9A 1MD9A 2F1JA 4IDEA 3D6TB 4MQMA 4ZTUB 3IB3A 1CUUA 2GBIA 4IWXA 4II7A 3NIDB 4UBMA 2W6ID 2F43B 4BX0A 3ITNA 2HCRA 4DMHA 1DAKA 2RI0A 2I2WA 4X0EA 4D3SA 1KY5A 1BGVA 4B17A 1N6RA 2ZJ7A 2B6NA 5EHZA 2A8YA 2J9FA 2PH1A 2IYFA 4G6ZA 1P4SA 4MUGA 4U0KA 4CKBB 2WIJA 5KJ1A 1IBMB 4YO7A 3RSOA 1A5TA 1WKBA 5SYNA 5EJ2A 1AHPA 3NEYA 1EK0A 1JIXA 5M3BA 3K6KA 3VA7A 2OVFA 1MFZA 3VKVA 1XVVA 4BNNA 4M7WA 2C9DA 4DMCA 1JL3A 2OGZA 1XJ0A 1QU3A 4RHXA 4LIPD 3DD1A 3PXUA 4RVSA 3WC4A 2CMHA 1Y80A 3TRKA 1AKMA 1Y81A 4BDTA 3AW9A 3WKDA 4ZAZA 1R18A 3CXUA 2ZUSA 1W4LA 3ZHXA 3V8EA 3VC1A 4KFSA 3KHTA 2D13A 3W1WA 1XTIA 3BXHA 5ALRA 3KLBA 1J23A 1THZA 2HC9A 2G5PA 4ZVVA 4KYTA 2B4QA 5KVQA 2CUKA 4JQYA 1EVYA 3D1JA 4PZYA 4XUDA 3IVAA 1R8QA 2Z4RA 4OXQA 4DLBA 1W2HA 1JLSA 2C31A 1Q12A 2JC3A 1OE0A 1E6MA 4K9PA 4BNTA 3ZDBA 3OZXA 3D4LA 2XIJA 3NOOA 1ZUD1 2DBVO 3F6RA 2CEKA 2BEUB 2WZCA 2FFRA 4FOTA 3OWXA 4DMGA 5KTYA 1GV0A 4M1MA 1KH3A 3C4VA 3H84A 3K8QA 3RM3A 3TOVA 4ZVKA 1YOVB 2DQYA 4LGYA 1V8DA 3TPCA 1CRPA 2XQIA 4F45A 4RETA 2RSLA 4ZREA 4NL4H 3K5WA 5G0VA 2H3HA 1FVHA 1V41E 4LQCA 1JQDA 2RH9B 3ZWOA 4HR7A 2BR5A 3EW9A 1I0IA 4WJKB 5J5CA 1VMKA 4G5OA 3GFGA 4X6XA 2QLBA 3FWHA 2VS1A 1ZRSA 1AUOA 2B4YA 3EG5A 3UKDA 5AI6A 4NZMA 2A92A 2Q3DA 3B6ZA 2CBZA 4YV2A 1TCBA 1Y1KE 4O4HB 5D5PA 3IJEB 5BRJA 3ED5A 3P4XA 4MQEA 5KTOA 3Q6MA 5D7NA 2ZBPA 3WGYA 1EQUA 1D7AA 5ED4A 2A0XA 2TRSB 5LL6P 1T1EA 3K9CA 1FFAA 2VIIA 1FCJA 3L0CA 1Q7TA 3I2GA 3NHPA 1R37A 4FYHA 3HYSA 2C3YA 4NCXA 3RS2A 2ZRGA 3ONWA 3RVMA 1JIJA 1V5WA 1TE2A 5K0CA 3OFVA 4ZYTA 3ICVA 3E9QA 3DDCA 3VVMA 3Q1LA 3DLCA 3U6KA 3ZCQA 2AEEA 5I5GA 3HKEA 5F3RA 2GKSA 4LN1A 2CZCA 1PRYA 2R4UA 4FCTA 4CIDA 3I76A 4DUGA 4ND1A 4YECA 4UW9A 2V96A 5E4JA 3L5KA 4B2YA 1TYDE 2I1WA 3CE9A 4MIYA 2FZVA 4NLLA 1QC5B 3JR3A 3NGLA 1JZSA 1YJBA 2HZBA 5SY4A 3MEQA 4DR1B 4F3TA 1R8XA 3PQ4A 3BZBA 5FTWA 1Q74A 1II8B 6REQA 2GTPA 1JHAA 1EAMA 4KO8A 4ZJUA 2FI1A 1SKUA 5FI1B 1Y3IA 2QMHA 4ZCPA 3X1JA 4NH0A 4BUZA 3GXOA 4KKVA 3WWPA 1BA3A 1ORIA 2BM8A 2OD9A 2IV3A 4EL0A 2GZDA 3JQCA 3CS3A 1RWWA 4GS5A 4RCVA 4Z0TA 2DP4E 3VC3A 1RZ3A 3VDMA 3LUDA 4KE6A 1ZWKA 2JLYA 2VHJA 3AOEC 2MYPA 4JXJA 1GNSA 3SS8A 4QZVA 1Q50A 3IQIX 3LKBA 1JEAA 1JF8A 1HE1C 2H2HA 3K0CC 3KKQA 1G8SA 1H22A 4HDRA 4B33A 5LUAA 2BR3A 3DMFA 1C1YA 4NV3A 1T91A 3BIOA 3ICCA 3SQMA 4BC0A 2RDMA 4S05A 2CKDA 1LZLA 2W7TA 3DM5A 1Z6TA 1V3QE 3ZTWA 1R5JA 2BFEA 3M4JA 4G9GA 5T3UA 1V95A 1OH8A 2V55B 1GUDA 5ETJA 4M8KA 5BQ5A 3GEEA 1W19A 3BHNA 4MVWA 4RY8A 3FCUB 3O3NB 1TX4B 3SZLA 2OCDA 4TL6A 1EK5A 2CVOA 3NTVA 4JLUA 5K3EA 3OTIA 5ALUA 2PQ0A 1Z0IA 4GD3Q 3OCZA 4ALIA 1DL5A 1WG8A 4K9MA 4OFXA 1VGQA 4B1FA 4Y9TA 3S2IA 3K05A 3A7EA 1WZNA 4W5NA 2FX5A 4PAOA 2G71A 2L2QA 4D44A 4RSHA 5LYYA 1WB5A 5JO9A 5T3YA 2VC2B 1TM1E 3WLTA 2OK7A 1PO7A 4RIEA 2FSFA 5B12A 1AUQA 4DMMA 2J9XB 1U2RA 3I3OA 3KL4A 1E2EA 2H54A 2ARKA 2YYAA 4LY9A 4JR2A 1PZEA 1NI4A 3GCGA 3HNPA 5FOQA 2GNOA 1UJ2A 1QHHA 3IESA 2X2FA 4FZRA 1B6TA 3OPYA 2XB8A 3GUCA 5KNDA 3B8HA 4V0KA 1DC7A 1OAKA 3DOIA 3SWWA 1JNXX 1X94A 3W4JA 2PXAA 3CRNA 5IP5A 3EIEA 4F6CA 4D4HA 4YYZA 2IIPA 3FBTA 4I50B 4AQDA 5B30A 3EVFA 4E09A 1P9WA 2QVZX 5FA6A 5DWVA 4M6WA 4L9WA 2QIOA 2P4SA 2Q2NA 1LBSA 1DAFA 2FN8A 3A1UA 4ECEA 4BFLA 2P8JA 3RJ5A 1HO3A 3HCNA 3B2EA 2AMLA 4CM1A 2AG1A 5JT1A 4OHFA 3SNKA 1XP5A 5ALVA 3HUUA 1WMAA 2NPIA 1DAPA 3KR9A 3Q4GA 2IJGX 1YQEA 1I6WA 1F38A 2IHBA 3HVUA 5AUPB 9ATCA 1XAIA 4F5YA 3UHFA 1V7CA 5ED0A 1JSXA 3RUIA 1SR8A 1ODLA 3X2EA 3W9SA 3PPWA 2FWNA 3PUVA 5PNTA 2C7GA 1EWRA 1PZNA 4MV1A 5E1DA 3GFFA 3DBHB 1Z8FA 2F67A 5H70A 1T25A 2BBWA 4YWHA 1BXRB 1F51E 1MC8A 1VJ1A 4X61A 3WSTA 4NWIA 4TTAA 1GPWB 2SKDA 4GGPA 2JFVA 2Q5HA 4RA9B 3ROKA 3UUEA 4A6PA 3C0KA 2WSBA 2JI7A 4HYEA 3RTCA 1EJ2A 2B21A 4OK6A 2XGMA 3EC2A 1P5JA 3NS7A 3Q2OA 4FYXA 1T8WA 1VLZA 1XJQA 1BX1A 4L9SA 4NP6A 4UEOA 3VJRA 4ARAA 1A8QA 4Z7JA 1NIPA 1ST3A 2D8MA 2ODEA 3ANTA 3EBOA 2OCIA 2QTGA 3PIIA 4ZQHA 2NAFA 4I1IA 3PF8A 4I19A 1YJQA 5HIJA 3ZHRA 4HPXB 1FP4A 1WCV1 3DZGA 2HLDD 4H27A 4R6XA 3TW6A 4WD3A 5EL0A 1AU9A 4P82A 4TMFA 3KYJB 5CUQA 3R5XA 1ECFA 1KDZA 2E4XA 5D3MA 4QGSA 2C9CA 1BCRA 2W8ZA 3MRTA 2C2HA 4Y2PA 4QREA 4OP3A 2IHZA 1UBMS 1GAQA 4IY1A 4JBGA 1JLLB 1UBJS 3WE7A 1MV8A 4A0RA 1RRVA 3O7MA 3LF1A 5M34A 2EG9A 3C7AA 2FLWA 1K68A 3IV9A 3KOXA 4HNQA 5C5EA 4RDXA 1XEXB 3Q3VA 3K6SA 4MRSA 3P8ZA 4I6GA 4K9RA 4KUEA 3G6WA 4PG5A 5AJZA 5E6SB 3QJYA 1UXOA 2VDQB 2ZULA 1AKVA 1AQUA 1YT5A 2JH9A 2ZWIA 3CSSA 2A5FA 3HBMA 2J6CA 3IVRA 4Q4AB 5HILA 1GCAA 3AJ8A 5REQB 4CKEB 2VSXA 2JAWA 3CX8A 1ZIOA 4NU0A 4C2UA 4CEIA 1TD9A 2H5IA 3I9LA 4EGSA 4LI3X 4OL0A 1HDZA 4KSCA 5DE3A 2CHGA 2ONJA 3WICA 2AG0A 1K7YA 2Q7XA 2FZKA 4EKIA 4HTFB 4KCGA 4RS4A 3LRPA 5HMMA 4NMMA 3EXFA 2BWJA 3EHEA 3IDSA 5FOSA 1QRAA 4BQNA 3ZCXA 2OM2A 2ZI9A 1IHDA 2XB6A 5DN6A 4RPJA 4YJ2F 2I78A 3VR5A 3FTNA 4AUKA 5JASA 4YGXB 3BHIA 1EM8A 2O2EA 3L6OO 1S3IA 4D3FA 1ISPA 4Q4HA 1KVQA 2CZQA 2YJGA 3B12A 4HVCA 1CQIA 2FPGB 3F46A 3GMSA 4WCVA 1FXSA 2A1IA 4EUHA 2JJ8A 3UUGA 2YWHA 1M73E 1V48A 4A2PA 5FBVB 4BGDA 1UFKA 4US0R 3CLUD 3ZCSA 4YFYA 5JECA 3EPKA 2C4HA 1IOWA 5CVTA 1XU4A 1V5IA 3ZHUA 2DXIA 2F3PA 2DHRA 1PR2A 2Z8XA 3HSKA 4L6AA 4G5HA 4MA5A 4CDMA 4EF5A 3P71T 5ALWA 3LHDA 4TYNA 3HEBA 1V5GA 5LWHA 5A5GA 3JR7A 4GWKA 3FG9A 4UM9D 3ZS9A 2WUWE 3H6KA 4KE9A 1DKQA 1CEQA 4DDVA 4YCNA 3EF0A 3DEAA 3KJHA 2GJAA 2F3UA 2V59A 4IJ6A 4M0MA 2ZS7A 4Q7QA 4UOEA 1RC0A 1XDDA 3CY6A 2Y4NA 1G0OA 2ZI5A 3IEPA 5TPWA 3EG9B 4QJBA 4OPMA 2FGJA 2FOXA 3QLEA 1DTWB 2X4GA 1DBPA 3IHWA 4G26A 4Q1CA 4RZ3A 4XEHA 1F1JA 4JI2B 2B1IA 2B8EA 1MCZA 3IR7A 1ST2A 4JVSB 5C8YF 1OFTA 1YMUA 4RKWA 5FB3A 4JIMA 3SLKA 3FKSD 3JQFA 1L5ZA 5FBHA 3EDRA 3V2HA 5MDHA 2QL6A 5JBIA 3A4TA 1B76A 3LCVB 4PINA 5BVHA 3EQ7A 3V42A 1JHXA 1G6OA 3QLJA 3TCNA 3V4PB 5JQGB 1YWGO 1R5NA 1Z2DA 4HFNA 4BP3A 5CGZA 1Q92A 3URKA 1ZQ9A 1K92A 4AKIA 1A5BB 4HXEB 1WBJB 2IGTA 1VYVA 2YWXA 4KTVE 5JNSA 4M8NE 1QV6A 4OEHA 4Q3NA 3C85A 4M9ZA 3G8YA 3WNDA 4D9NA 1IQPA 2V7VA 4RTKA 1IM8A 2O7SA 5GP1A 4YUYA 1XMSA 4X9XA 4N0MA 4AMGA 4ITUA 4A6DA 1NUAA 1J8QA 1WB6A 5DXFA 4PONA 4G4SP 3FRHA 1PZXA 1V47A 3O5AA 5FORA 1HDYA 1UBRS 1X7DA 2VNIA 3KXKA 3OZFA 3ZE2B 1BS2A 3QPUA 4AJPA 2O8CB 1RHUA 3A4NA 4JQZA 3WL4A 3L84A 4YCLA 1W8IA 4GOJA 2PGIA 1FA9A 3BSYA 1ZLXA 3WX0A 4CTKA 4WNCA 5CFLA 4Q19A 1FX0A 1JHUA 4H16A 5FPSA 5BYJA 1RLOA 4Q34A 1F06A 5K2MA 3K0AA 2QX7A 3S68A 4XZ3A 2YHIA 1N0IA 2FHSA 2NO7A 3HQ4O 4MWDA 1B3RA 5ALLA 5JCOA 4AJOA 4F93B 4FPXA 1TW3A 2F55A 1JEQB 2Z56A 4E5MA 2VDOB 3VAAA 2E82A 2B3TA 4NCIA 4JJGA 3G9ZA 1JKJA 5EE3A 2C7BA 4CR7A 2Y1OA 5C4GB 3LCRA 4UDOA 2QE7A 4YRCA 5C7LO 4WKOA 4RORA 3TOSA 3FKQA 3DVQX 3EFHA 2JKVA 3W6NA 5C3MA 3ZDAA 3GROA 3S1SA 1PZFA 1TYZA 3AY6A 1Q7GA 2P2YA 3LQYA 3EOBI 4KRGA 4KIGA 4P86A 2G4CA 3R44A 1QBGA 2YRWA 4NQRA 4P54A 4ZOCA 5EQTA 5C4MA 4P0TA 1QS0B 4WUVA 2P6MA 1KIAA 3ABIA 4HVTA 4QYIB 2PT9A 3U5TA 5F1KA 1N4DA 4XLZA 2ENWA 4KIWA 3CVYA 1ZGAA 1VSTA 2PJDA 5EJ7A 1DCKA 4EGAA 3LW8A 4EX6A 1MW8X 2MYUA 2BGJA 3QU9A 1KJZA 4CYMA 3UH1A 2WG0A 4L8LA 3H8JA 1F2DA 2OO5C 3NCTA 4PBTA 1SQSA 2CSXA 4UM8B 3THWB 1H1DA 2DTDA 4F6RA 1E0JA 4RHCA 5C51B 3NHZA 1EEHA 2Y0DA 2YHBA 3LBNA 1RQNA 2ZJZA 4I4NA 5I4KA 4OHYA 4K6HA 2JZOA 2PX0A 4AL4A 2H3EA 3P9PA 2PL9A 4I55B 3ZUPA 1CP3A 2P9CA 3NIFB 1ZD1A 5DLEA 1NHWA 1EHYA 5BSGA 4ITVA 5FV4A 1JJAA 1MG5A 1QPGA 1USIA 3AOGA 3AUYA 4RC9A 3VMMA 5IKEA 4NSNA 4KO1S 2VJDA 1YJ5A 3BMOA 2QMYA 4O2BA 3VR4D 4BN4A 2QSUA 3QE2A 1QIFA 5KX5B 2V0GA 2CVPA 3H1BA 1EDBA 2E55A 4XH9B 4TMYA 4ZU1X 4HQRA 3AGQA 2JAOA 1BD4A 3PDCA 4QASA 3WRXC 4IP0A 4TKVA 2XDQB 3HNOA 3ZD7A 3V9PA 1YJXA 2QNIA 5TNXA 1O0SA 4LXXA 4C43A 3L8DA 3REGA 4ZHSA 2ZZNA 3H99A 3HP4A 3V2UA 4E2YA 1RDFA 3L0BA 4PM4A 2WY2D 5B7GA 5BUQA 4ZQFA 3RLFA 3MB5A 5SY6A 3EEYA 5CHYA 5LLSA 3MHPA 4LOHA 2GLUA 4X5OA 1CERA 4GYKA 2WM2A 5KQGA 2R0QC 5JO0A 2BYTA 2WDZA 2J3LA 3QWHA 1RWPA 3CG4A 1LU9A 3UMFA 4V0OA 4Q9HA 3IBGA 4B81A 4DEXA 3DKPA 5LP6A 3NASA 4MLZA 1YRYE 3UPTA 2YRFA 4LXYA 2ZRAA 1WDLA 2WVGA 3IAS1 4G4IA 1ZJJA 3MOGA 4LHEA 1PYDA 5BQXA 2FMHA 4CQJA 3KHSA 4OYRA 4RNDB 4D9BA 4K9QA 1OOEA 1SWVA 4RXTA 4QSMA 5HIAA 2HXGA 4DIFA 4E5UA 1MT0A 1LK7A 1RXCA 3V8RA 1K5HA 3KCNA 2BGMA 3TW8B 5ABPA 3TE7A 1V6CA 3OCYA 2HK7A 4EGCB 3G9UA 4DBLE 2C9ZA 3EC7A 4L2IB 1CRLA 1Y6ZA 3A6FA 3KAJA 4FQ8A 3SQXA 2Z43A 3BSFA 3DAFA 4TTSA 4YAJA 1OFIA 4E2FA 4EUSA 2BMDA 1AG9A 1UWCA 3JQ7B 1U98A 1FUKA 3MS2A 5HGJA 1XCJA 3JAMA 1JFFA 1T9AA 3VKUA 3WGUA 3DP9A 4HAVA 5AICA 5TMEA 5C7OO 1UC4B 2XECA 4BTEA 4WMLA 2IYUA 4EJ0A 4EQ6B 3N2YA 4PYKA 1XLTC 4QT4A 1WULS 3LWNA 2OCKA 3DBVO 5HTOA 4AC9A 4JZKA 4R1QA 3F3KA 2MOKA 2Y9PB 1T9GR 2XYRA 3ZBUA 4ALMA 1V4VA 4ZVPA 2RB5A 1S5PA 4DILA 1O54A 1HE4A 3OOHA 3NDJA 3AVOA 4IVQA 5SYAA 3JQGB 4TOIA 2EFEB 1PR6A 2IXEA 3HWRA 2L69A 2ZDHA 1GRCA 1KY4A 3PQEA 4KVAA 4ZV4A 1HV8A 2EYUA 7ABPA 2FMTA 4S1NA 3PXCX 3KUUA 2WOOA 5HRAA 4INPA 5SZHB 2C8KA 3ZJYA 4AWXA 4X41A 1XZNA 2P6PA 4WY5A 2PMEA 1Q7BA 3L8YA 3WHLA 1F6BA 4UPDA 2H29A 5K3BA 1VG8A 4M0FA 3HUFA 1SPXA 1Q22A 2QTLA 2WU8A 1ITZA 2G09A 3UKOA 5I7EA 4E0BA 1HFJA 3RC8A 5JAHA 1IZ8A 2I3DA 1SUPA 3L18A 4QJ4A 3PFBA 5F23A 4DV5B 4OA5A 4FT4A 4PX2A 8MHTA 1PT9A 3DJFA 1AS2A 1I80A 2YXBA 1FQJA 1X1AA 3BEOA 4BC1A 4HQOA 2C07A 4CF6A 2RBKA 2WR8A 3T99A 5JYDA 4BRUA 5K0TA 2JGDA 4MKRA 5ITZB 1W4ZA 4U7WA 2X23A 5EJAA 3SNHA 3IFSA 2C78A 2KBFA 3AR2A 2D4HA 4H7JA 1A76A 2QTAA 4MW6A 4XE5A 2HY7A 2VAWA 3I12A 1K98A 1A4IA 5DB4A 1H0HA 3G5LA 3HB7A 1Q3TA 5JXJA 4CG2A 3AFMA 3BULA 5I51A 1YACA 3O3OB 2W83A 4HSGA 1EXDA 1W47A 1C4KA 2VWGA 4BNDA 5AW8A 2NWQA 4I1UA 3ID6C 2BGKA 5LB2A 2QRPA 4FEAA 3V00A 2IF2A 3BE4A 4URHA 5HR5A 4IG9A 3FCXA 4YAKA 3CINA 3T9CA 3DE4X 3RRZA 3SC4A 1RCTE 2JBAB 1X6VA 4Z4FA 1VG9B 4QQNA 4I46A 4B3FX 4O4JB 4Y0NA 3ZCPA 4NJMB 4PIPA 1CIJA 2GD6A 4O2BF 5DHTA 4D8YA 1U5BA 1Q95A 3ZIDA 1U1DA 5JD4A 4PYLA 1ZSYA 3OLQA 4A5OA 2JI4A 1T6XA 4YRBA 5HPYB 2HBQA 5LJIA 1PJTA 3NBYC 1NUHA 4ZT7A 1EUQA 2EAUA 4XTCS 3B1YA 4JJZA 2FG6C 5FX2A 1XSEA 4CKCB 5KSZA 1E9SA 2ZUUA 2Y1XA 4I1PA 1W1UA 4XGKA 1K7CA 1MEJA 2P75A 1LWNA 2FWBA 3JQBA 4IDPA 5BT8A 1FNDA 2KBEA 4G4SO 3JXEA 4D0NA 3UXEA 4YJKA 2DUJA 4K87A 2GEKA 4KQKA 1CTQA 1G19A 3AL3A 3K16A 4IIHA 3MTIA 5HS6A 3VAYA 1JDNA 2UVQA 5ITWA 5CFNA 1SELA 4GLFA 4CM4B 2X9GA 2XAAA 4L95C 3WQHA 4EG3A 4ZVTA 2I6XA 1N2SA 1D6MA 4L5CA 3T54A 5IHPA 2PA0A 3HPQA 1YZFA 3LC7O 3A4LA 2A30A 1L3CA 1JHZA 1MO6A 1A2KC 3WNVA 5I48A 2BH2A 2C99A 3E9CA 3NUZA 5AM3A 2CWDA 4X7MA 1RQXA 4KDRA 2Z04A 5C8ZA 4RTOA 3W3ZB 1WSWA 1CEEA 1N2CB 1G5IA 1JYSA 2ZQ5A 1N33B 1UPFA 4CEHA 1MTOA 1PDWA 4WKCA 2BFCB 5EIBC 3FZYA 4CLDA 2C5AA 4LF4B 3EWNA 4D74A 1GUFA 3LZDA 2F43A 3JZAA 5KJEA 3UMMA 1Z36A 2QUZA 3R5KA 4IGAA 4W8OA 4JYZA 1LGYA 5MGBA 2JKZA 2P0AA 2V3CC 3IVMA 3C5EA 3G13A 5CYOA 5EJGA 1XNHA 1OV6A 3IJ5A 4EG6A 1ZUWA 1LI5A 3V32A 2I34A 1GKYA 2GZRA 4CKBA 1FFEA 1XJWA 4A8JC 2A5GA 3GUYA 3SC3A 4Q18A 4YMWA 3PNQA 2HCJB 2YIJA 4IRXA 4EPWA 3BGOS 3HI6A 1NKVA 5DLPA 4BNYA 7AT1A 1NLFA 4U2GA 1TUGA 5JPIA 5HQ3A 3BXPA 3VX3A 4HADA 3WHIA 4Y6RA 4LRYA 2RHRA 4K6MA 3LOPA 3LPAA 3HVJA 8ADHA 2WB4A 2Z1MA 4OD0A 3H6GA 3NVAA 4MR7B 5IFKA 3DONA 2Q5CA 4ZEOA 2OV1A 3W78A 3HY4A 2JBHA 2NU6B 1YDMA 4D0GA 1OYOA 1OYYA 3L7LA 1EWVA 2V5VA 2JFUA 3CR3C 5DPMA 3SJCA 2AKEA 3ORRA 1PYOA 1WPXA 1J9EA 3IGFA 4QICA 1PR1A 4J1QA 2PZEA 3DV0B 2VJBA 4C0KA 3K0BA 3QXXA 4IJKA 4OQXA 1OPRA 2D1QA 2B9VA 5EHNA 4BP9A 4M1ZA 1Z4MA 1EE9A 2VJPA 3TLZA 1CBUA 1XUOA 2ERCA 1ZZEA 2BEUA 2QRMA 3G79A 3L5OA 3N0RA 4QD3A 5B36A 1ZIXA 4TLLB 4QBIA 5AUQA 3STXA 4A0FA 1DEHA 5JIBA 1Y9AA 1H8HD 1GA4A 2P4HX 1B0PA 1YOVA 1XDZA 3OTHA 1VBFA 3LHIA 4HPJB 1N6HA 4L0QA 4RNCA 4Z0PA 4CETA 3D54D 1YFZA 3V8PA 4CW7A 3RREA 1H93A 1RPZA 2GNPA 2B4RO 4MV5A 2JIDA 3EX7C 4I9GA 5IH3A 3VKGA 5ALFA 1OLOA 1JQ3A 2PD4A 4H59A 4QGHA 2YVAA 1QX4A 4ZO8A 3RWBA 5LFAA 2XB2A 3H2ZA 3R9WA 1M2FA 3I6QA 3VR0A 1JS1X 2QLJA 4XWAA 4OQ4A 1DQYA 3BBPA 2EIXA 2L42A 3LT0A 4H4EA 4ZI3A 1QQAA 1ODJA 4BO3A 5IKPA 3M2PA 2GA9A 2QLMA 3CPSA 5TPZA 1D1SA 2YX1A 2I2XB 2QLNA 2P79A 4MUFA 1E3TA 4PTZA 4E33A 3M5DA 4ZMSA 4HWKA 4KVGA 2NU8B 3GOQA 4UVGA 1ECPA 3LHKA 3ODPA 4A16A 1KRWA 1W5TA 4OQLA 1UAAA 3IT0A 1NX9A 4J0IA 5G3YA 2IL1A 1HE8B 1URPA 2Q07A 3RJTA 2W37A 1GSAA 2H2FA 3LLUA 3HADA 4JVNA 4LSMA 4MVYA 5TMPA 2EKPA 4ARVA 3EPJA 5KNBA 3LS2A 3UMJA 4Z2AA 1WZCA 3EQ9A 4G09A 2H4JA 1MH1A 3DT9A 1N57A 3GEGA 4LJ5A 5G0WA 3RRFA 2A88A 2FEMA 2HBZA 3VPGA 5C1OA 3GLIB 4MRMB 1XCGB 3SHQA 3T3MB 2UYHA 4TYWA 3DLHA 2D1FA 2G6TA 4FMCB 4LNHA 1OI2A 2D54A 4IJMA 3GLFB 3WMWA 5J59A 2FRVA 3ZD9A 2QQ0A 1II8A 2X1LA 3A28A 1JEYA 4DT1B 1QMGA 3RBVA 1N3IA 1NQXA 4FZ3A 4E7PA 1OC2A 1WMSA 4C2BA 4N0DA 4CV2A 3BBLA 3IQDB 2ODAA 1IONA 3GELA 2VZ9A 3NHWA 3OE7A 2QR2A 2W0SA 4WLFA 1DWQA 1PWXA 3EGXB 1TRKA 1KYQA 3MGKA 3D0QA 3SYRA 3AHDA 2I99A 1U1CA 1NMXA 2M6LA 4JI3B 2ZKLA 1R8SA 1JJFA 2IU4A 5IAKA 4DG8A 1E2UA 5TT1A 4Z3KA 3KC2A 4RF3A 5T8KA 2O9JA 1PNTA 3IKLA 4BLQA 3PS9A 2B4TO 3CLSC 4DJAA 1CUVA 1LPSA 3TRIA 4N8EA 2WDPA 4MHSA 3AI3A 5IUJC 4Q7MB 2J85A 3GQVA 3SBEA 2QMQA 1VLQA 2LCIA 4M83A 5CP8A 4FX5A 2OFFA 1W36C 1H2ZA 2QUKA 1PN3A 4KI0A 4KZKA 3AR9A 2EX0A 1KAHA 3KALA 3KKMA 2NG1A 2Z6VA 3NZEA 4H17A 5AQEA 3TOZA 1ULZA 3I3SR 4G5GA 4I1VA 4U00A 3KXDA 2IXTA 2WJZB 3B9RA 2E21A 2WKSA 5BQFA 1UMKA 5SZKB 3W79A 1BJKA 3U81A 7MHTA 2Q50A 3G0DA 3HXPA 2VF8A 1KQNA 3HJCA 3CR8A 3IEIA 1HL7A 2JBWA 2I1VB 4Z86A 4O08A 5DF1A 5DNAA 4ICIA 4OJNA 5K3SA 3SVTA 1E99A 2G0AA 1FJXA 3KQVA 1H0KA 3UAWA 5EG5A 4LMPA 3LPLA 4O8CA 3ZHYA 5BVHB 1RHJA 1OAOA 2GYYA 2Q1WA 4NFHA 4CL0A 2BJHA 3PFHA 3S3TA 3K70B 4FHGA 3RRNA 4EL5A 5FUBA 2QXUA 3IURA 4WNYA 3B5EA 3DGFC 3FNIA 1UDXA 4MYSA 5E8JA 4NBUA 3WSWA 1MR3F 4EQZA 2LE0A 1M7HA 4XB2A 2CLEB 4G8CA 2EW1A 3S6JA 4YP0A 3UV6A 2WE7A 4NEHB 1RJWA 1IOVA 1JBQA 3UWKA 4RPIA 1RFGE 1TF5A 4P0PB 4EFMA 2J9GA 1N2EA 2BRUC 4Q4JB 3OMLA 5EZQA 1ZCBA 4N4AA 4I50A 4JMPA 1NPDA 1B00A 4IZIA 1ZS9A 1WVIA 1GZ7A 2BF4A 2HA7A 3KKNA 5IAOA 2B4KA 4BAZA 5BMVA 4KLRA 3RFVA 5G1NA 2PIAA 3BILA 4OUDB 1Y9EA 3HB4X 4MP6A 2Q1TA 1V6AA 4WBXC 3O8CA 2WAYA 4FN4A 2VHXA 3L1KA 3EXEA 1W1WA 3UW1A 5I4IA 1QU2A 2UYGA 3K30A 3WOVA 5I5EA 4JGIA 3FM9A 2UUOA 3GIWA 3F9RA 3IS3A 3FF1A 1P60A 1W52X 1QV9A 3QVSA 2P4EA 4TL7A 1YQUA 4Z9FA 4RABA 3UENA 2R48A 4UTZA 1QHGA 1RYDA 4KG7A 1YGYA 3WYAA 3A2KA 3TD2A 4FYKA 2A78A 3FZQA 3A3YA 3PPYA 1SUAA 2C4UA 2CLIB 1Z6XA 2LRHA 3H16A 3DDSA 1L7DA 3MD9A 5HEKA 1KH2A 1J39A 2VPYA 3DBHA 3PF9A 4GMXA 5IBQA 3ZEAA 1HNWB 1DRUA 3DTTA 4H31A 1ZAYA 5KNCH 4G85A 1M33A 1BXRA 4LJ4A 1PP4A 5KYXA 3OF5A 1MAVA 2XQGA 2PUAA 1LPPA 1VHJA 3OIWA 4RA9A 4EI7A 5HS4A 1YJ8A 3V1LA 5K3FB 4LZPA 3RRXA 3QLUA 1M66A 2NTVA 4FHEA 4QBHA 3UN1A 1YVDA 2XA9A 2J3QA 1OB2A 5F9FA 4XRRA 3JQEA 2IYNA 2V4MA 2FFJA 3NTOA 3AM5A 1NV8A 4ZWNA 1O9BA 1YR7A 3MJRA 4XDGA 1T13A 1W0KD 1NG1A 3EPRA 4GZ3A 1J0BA 1E69A 1K63A 3I30X 5F1PA 2JW5A 3TI9A 3ZXXA 4AIRA 1GG5A 1FRQA 3A1WA 4MIOA 4NEGA 3UBMA 3F5QA 4DS3A 4MCIA 1YRHA 1JR2A 2QAIA 3LYHA 2WLSA 5MN6A 3HB1A 4XWWA 1KMCA 3G7UA 2X19A 3VHXB 2NV0A 1YJAA 2OZLA 2P5UA 3RUCA 2SICE 1TGVA 4ZVQA 1EFDN 2R85A 4DY4A 1H2HA 1IY0A 1NA5A 4HUTA 5JSZB 3VV3A 5F98A 4UVHA 1C3EA 2KHZA 1O6ZA 3JVEA 1JJ7A 3DXXA 3F96A 1JLLA 3QM1A 2N47A 3QPCA 3N2ZB 4HLCA 1I7PA 3VC7A 4ZU3A 5F7OA 3WLQA 5B7PA 2VQDA 3VO9A 1NMYA 2GPBA 3LVQE 2RKBA 4KWHA 3ZC3A 2QM0A 3GC6A 3LBFA 2NADA 5KNDD 4NOLA 5E6SA 1ZRHA 4G9BA 1UQRA 1O8CA 1F20A 1U1IA 1UIRA 1XYYA 4EO9A 2XYHA 1TZBA 2P2CA 1RIIA 5EPOA 4GPAA 4Q4AA 1EWKA 3N2GB 5REQA 4CKEA 3S99A 3IMEA 3QUTA 3R2JA 4QO7A 3KEFA 2EXXA 2Q49A 2ZT6A 3TAUA 4E2ZA 1TKAA 3EARA 3MERA 2OTCA 1N7IA 4MGEA 1FFBA 1VHWA 3GGOA 3JYOA 3LC2O 3LXRA 3WMRA 4Y2YA 4ZCIA 2OAP1 3ETNA 4RTNA 4HDNB 1EZ1A 4JR0A 2FW6A 3KSZO 3ZH9B 1YZKA 4AX8A 5EFZA 1L5HB 1U6IA 1EBBA 2Y77A 1LUAA 1KVSA 5AJWA 3C3XA 4ENUA 4FE7A 3G8DA 1FYEA 5H5JA 3WO1A 1Z2AA 4QUKA 2JG3A 1EZ4A 3W5AA 4OHXA 5KYWB 4V3CA 2Q29A 1NY6A 2VJKA 3I5YA 1U94A 3R3ZA 2V3WA 1T9GS 4ZAGA 2FPGA 2XMPA 1L5KA 4BVLA 2WYHA 1RC1A 3A31A 3ETHA 3WB9A 4MITA 4U7HA 3WK4A 4CVNA 2FK7A 3GVXA 5F3DA 3NRJA 4ZZIA 4YDQA 3CX4A 1E2LA 2OHHA 4GRDA 2IPNA 3AHEA 1G42A 2I29A 2GPSA 4KDFA 4WKGA 4TYMA 2R7NA 4UAUA 3K1JA 1B8OA 1ZW1A 5BP7A 5JMOA 1PJ2A 1J2YA 1WW8A 2HGZA 1CFZA 1UR5A 3KT0A 2ILTA 2DETA 3D64A 4WFKA 1FOEB 4HLUA 3UB4A 2CBXA 2H2WA 5FO0A 4KQ9A 3IP8A 4QOJA 3JQQA 5EXEA 3CW8X 4LE1A 1P81A 2BFDB 2C88A 1WAMA 4J4TA 3KEMA 2XZOA 3UGKA 3FNRA 5AKIA 4F5EA 4HDSB 1RE0A 4RZUA 4RXUA 4LVCA 3VC2A 3I2YX 4RKFA 4PRLA 4DA6A 1OGYA 1U2GA 1X0VA 4JL8A 3U48A 3SF8B 1P80A 2COUA 1JUDA 3FMOB 1R3UA 4N8SA 4BWVA 3B9BA 5EXTA 4Y7CA 3UWSA 1HDOA 1E9BA 3MTAA 1GTRA 1DTWA 4CN9A 3DYBA 4LDPA 4KSBA 5EPUA 1P5RA 2WHQA 2BDTA 4IIEA 4A15A 2IE8A 2X8BA 4KXXA 4YBZA 3GFRA 2GXAA 4QOIA 2IK8A 2RAUA 3G5UA 3ENKA 1Z7YA 5L53A 1M6WA 3ZVMA 3GUVA 4H7IA 1N6IA 3A9TA 1OBCA 3LA6A 1DZ3A 3E0XA 3RSSA 1EHIA 3P0IA 4FGLA 5DJ5A 2AB0A 3MTQA 1W73A 3HM9A 2Q21A 2ZJ2A 2IKQA 5IEBA 1JDBC 2O2XA 4CT5A 2WSIA 1IBRA 5TQ0B 3PGMA 1IHOA 3FAZA 3TEJA 3V1KA 3OECA 3ZHOA 4B3RB 5F2EA 3CFYA 4Y1GA 1CUWA 3D0OA 2V8OA 2DJIA 4C4PA 2XMZA 2C0PA 2GEBA 1TM7E 4LQLA 1JG7A 3PR3A 4X6LA 3FHLA 4P0QB 2AN5A 4HV4A 1GGFA 1NVAA 1W29A 3BDAA 4FEEA 4OUKX 2W93A 1GNPA 5AJUA 3T3HA 4X7RA 2VOJA 1L4NA 4F9GA 1N8SA 1GKUB 3D8TA 1U8XX 2AW5A 4HATA 4E2WA 4BLUA 2ZUTA 2O8CA 1E7QA 2BEWB 1U8EA 1SXJC 4C3ZA 1NIJA 1OWNA 1S7GA 1WZIA 4G41A 4L3OA 4KLZA 3OJWA 2FG7C 4WXRA 3VR5D 3NDBB 2OKGA 3U4IA 4NCAA 4OXXA 2B69A 3QUSA 3GVPA 3OA0A 3VHRA 1A9SA 3RK1A 5LMUB 2Q99A 4LC0A 3ZE7A 3DR5A 4RESA 1VL0A 1JEQA 1P2BA 1UK8A 1W25A 2Z2JA 3R41A 4YROA 2RI6A 1JQ5A 3O1IC 5JNVA 2WF5A 3GLSA 4I5FA 5BSRA 4AJNA 5AVYA 3L7BA 5JS7A 4W5RA 3BXFA 1DHRA 1L7XA 1K2VN 3IODA 3TLEA 4OHWA 1OBFO 1ADGA 3DFKA 4B6EA 3WYFA 1ENYA 2FPKA 2GVDC 5J2TF 3UEOA 1WXIA 3AESB 5KWVA 4F2PA 2DKOA 3T7SA 2LGJA 3RAFC 4UUAA 1WTCA 1LJUA 3DEFA 4EYOA 3AFNA 3NKFA 1SJ9A 1SKQA 2GDZA 4CUKA 1CJKC 3V3KA 3HI4A 1RP7A 2RGWA 2OUKA 4GVLA 3HFSA 3C16C 3V8NA 4QYIA 4J03A 3SFTA 1UDAA 3V1TC 3H18A 5JJIA 5CDGA 4DSOA 4XEUA 1DZIA 3LLVA 4FZJA 3WA7A 4BU1A 1JG4A 4NICA 3DLTA 3OETA 4MO9A 1ZK1A 4JSTA 3P0HA 1EVEA 3CCFA 1JWAB 1D1TA 3FSGD 1R6UA 1XF1A 1YR9A 4J7UA 3F3YA 2LD4A 1QG6A 1T2VA 3E5RA 4WNAB 5TQ2B 3U49A 3QU5A 4YUXA 4G25A 3VPAA 1FL9A 1R4ZA 3WMXA 4FIZA 3CW2A 2Y0EA 2A6PA 4OB8A 4Z4CA 3MRVA 4AN4A 5JC1A 4MUJA 1H2WA 2OY0A 2HMYB 4XCVA 4WJLA 5AI8A 2QVLA 3HKBB 4U7DA 2A5DA 4IYRA 1AKYA 2WV9A 1RWMA 4I55A 3SBDA 3SDBA 5FLEX 2QKYA 3QF4B 4B3IA 5KQRA 3U4HA 2C8VA 3PLAE 4YUWA 4FDLA 5HGXA 1G55A 4D4IA 1HDGO 5J5AA 4PNHA 4B79A 3NM6B 1P5HA 1YVPA 3B7GA 2J1LA 3KSMA 3ILHA 4MS3B 2ODTX 5AHWA 1BE6A 3EXG2 3INNA 5DEOA 3TIFA 2HYDA 3DCIA 4YJ3F 3OH8A 5KX5A 4K86A 1ZD8A 3TZCA 3E9MA 2GBLA 3EIXA 3HYTA 1BEUB 2XDQA 3FCOA 4BNWA 2AJ8A 5D5HA 4P08A 3TNYA 5FH9A 3IYLW 1RXSA 2VDLB 3GA0A 1E1CA 3EGCA 3IUQA 5DHAA 3ZWWA 2B1GA 1TMOA 3QV2A 4FLEA 4A6XA 4HNGA 1FF9A 4GYYA 3KDSE 4TS9A 4JITA 2F6RA 4RJ2A 1GUAA 1L4GA 1U65A 3MF4A 3S2YA 5LN1A 5MF6A 4QBKA 4M0KA 2DPMA 3AYXB 3B20A 4TROA 1G5HA 1XKXA 2YV4A 4TKUB 1WDTA 5DTMA 4F7DA 1E9RA 3T1OA 7MDHA 1MQAA 5JLJA 3H0CA 3RUDA 4KXNA 4R1LA 5E4FA 1JALA 3TSWA 3OAAA 5A9SB 1ATIA 1QNFA 2Z2IA 3HB5X 3ODGA 4EJ2A 4J4HA 1E4YA 1GPBA 2JH3A 2GK7A 4HDMB 1HQYE 2XVZA 2ECPA 1WLYA 2PKCA 2ZSUA 3H4VA 1RJEA 1XCPA 4XWTA 3E7FA 2CUZA 3CT6A 3E3OA 3G68A 3AVUA 3IOCA 1B1CA 3EJ6A 1RS0A 5K8IA 1UBSB 1QGUB 1ZNQO 3E4CA 4KIFA 4HS9A 2ZCJA 2QTWB 1DVRA 4L2IA 2MSEB 1CUBA 1RJFA 3AFOA 4HDKB 3QIVA 3JTMA 1T36B 1T9HA 3GPIA 3NT5A 3H4MA 3JQ7A 1V0JA 2GOYA 4PR3A 4GNKA 3S5UA 1Z4IA 2VVTA 4POOA 1UOPA 3NV7A 4Y18A 4QM6A 3DDWA 5EIOA 2WT9A 1VM6A 1XK6A 4EQ6A 4EW3A 1R74A 2C4WA 1A77A 1XV5A 3ZGYA 5HZHA 3WLIA 1XWFA 1JFLA 2R6GA 3OBIA 3ICWA 1CR0A 1J49A 3UK7A 3O3MB 5KTNA 3WL8A 3NXSA 4PYJA 1L7AA 1PFUA 3COWA 4X7BA 3GJSA 3NB0A 2R7MA 4M53A 5CPBA 3U7GA 1RRFA 4U7GA 3JQGA 4UBIA 3L8HA 4GVXA 2FPSA 4OSOA 3QBTA 2X42A 4H6PA 1HLFA 1MTZA 1W85A 1D3AA 3QKUA 5GGXA 3RUHA 2G9VA 4DCCA 4A03A 2WZQA 3S5JA 3MYYA 5KOHB 5CFPA 5ARDA 4BV9A 1CUIA 1TEHA 5HJEA 1KAGA 3VZPA 3PR1A 2ZCUA 1PX2A 1L4EA 1R64A 2DPLA 4EZEA 4C7JA 4JP5A 4QLOA 1QRDA 3Q7RA 4NI5A 3CN9A 4U9UA 4CUZA 2G88A 1WKVA 3KVRA 5LQKA 4PAGA 2MJLA 3R3JA 2B61A 1HT2E 5D1HA 4D0SA 2ONCA 3G17A 1XAGA 3GARA 2IWHA 3U26A 3MPOA 5B2FA 1AC5A 1NP3A 2J59A 3LNTA 3ZGOA 4DGSA 5BMOA 1NJ1A 2WIKA 4EZIA 4R2KA 5LU8A 2Q1UA 4S04A 2KMLA 1IN6A 3AEZA 5HIKA 5ITZA 2Z95A 1MGOA 4FBMA 1HZZC 1YZ3A 3EODA 4MULA 4LF8B 4GXNA 1CZRA 4O2AA 4QPJC 1Z63A 2ID8A 4EATA 3K9GA 4HGQA 2W2XA 3K09A 2H7VA 3LUJA 1YQTA 3LKVA 5M29A 2GCOA 4DMRA 3TJRA 2GAFA 1ZA1A 3V7YA 4RD4A 5TGDA 1DC8A 5ALTA 4OGFA 2XLBA 1J8DA 3F6BX 3FFTA 2RMKA 3W5UA 1NUUA 3ZW9A 2O1SA 2ZI6A 1DS6A 1QYIA 3H2JA 4H08A 3UK2A 4Y9UA 2EZTA 2NYUA 4M1EA 1NBEA 5ALYA 4O4JA 3ZS8A 1LLDA 1RTKA 1DFGA 1S2LA 1J90A 1DXHA 2HA4A 1OV4A 2A59A 2QMZA 2A1UA 2QT0A 2DT8A 4IJ5A 1Z34A 4NJOA 4WWHA 1SUCA 1U3FA 4XJXA 2PJRA 3FOZA 1T0JB 4BNGA 1ANKA 5MN4A 4ZKEA 1GSIA 1IWPB 2H0AA 3FFAA 4JIGA 5FAXA 3R3VA 1T1IA 5A7GA 3MJVA 1GU0A 1YS6A 3BFPA 3QVTA 4GVPA 5EEGA 4IDOA 5K3OA 1DQNA 3OJ0A 3RYFB 5GPBA 4KPFC 4CKCA 2GLTA 5KUTA 3IJRA 5I7VA 2VAXA 2X0KA 3EGVA 5JZSA 3GG9A 1M34E 4GOND 1HTBA 4D02A 3TG2A 4ZVMA 3K0SA 3DMTA 3KQTA 3P2JA 2VZ0A 3C7CB 4I1SA 1ZN8A 3ZE0B 1XA4A 3AVQA 3VH3A 4D80A 1SUBA 5IVDA 1SVKA 5CLIA 5BW8A 1RMQA 2QE6A 2REBA 5EIEA 1TJPB 1MDBA 1DB3A 5DSTA 1A4UA 3F90A 4H7EA 3KPYA 3TSCA 4BB0A 4P81A 3ZLTA 5TB5A 3KXIA 2HBRA 1N1DA 3EXHB 5FYDA 2WIGA 3ONFA 4IILA 1OFVA 2I6UA 1H3NA 3NM4A 4MKZA 1PW5A 5HFAA 2Y1WA 2HMWA 1GZ4A 3QUCA 2QI9C 4KQFA 4M8LA 3SQLA 3WIUA 4ZJZA 1PEAA 2TMKA 1N32B 2QOEA 2O3SA 3EXIB 5LXTB 2PWBA 2BFCA 1KY3A 4S0XA 1IIRA 5IARA 1B6RA 4MVJH 2F4VB 4R41A 3R6LA 4OJKA 5FULA 5JD6A 1GQFA 4HKTA 5C1PA 3VNRA 3G0IA 3MSCA 1YZLA 4AAYA 5A2QA 2MWMA 2OCXA 4OJTA 2UKDA 5L7WA 2OEPA 4X93A 2NO4A 5IC4A 4LYDA 4UFOA 5CDFA 3OTQA 4M36A 1JI3A 2QGFA 4D6XA 4C07A 2XHEA 1PEKE 5F2NA 2BM1A 5AIAA 2VHQA 1BQ3A 1E79D 2YS6A 4WA7A 2AH5A 1V7PC 1V8FA 2Q1SA 1Z4PX 4DLNA 4X8MA 2NO5A 3ZBPA 3ZQUA 1BGXT 2J46A 5DM0A 2PBLA 2Y3IA 2WQ6A 1UH5A 1M2EA 4FI3C 4LS3A 3V1UA 1OLSB 1ESEA 3QHQA 4NPHA 2G72A 1FMTA 2HK8A 5F33A 5AYVA 1N77A 4Q3KA 3OURA 3TZKA 3ASZA 2BL4A 3C87A 3U80A 4HNVA 4KGDA 3H9QA 2X9VA 3FYTA 1TA4A 1NW4A 4B82A 4MYDA 3I45A 2NU6A 2ZAGA 3GDHA 3FYSA 4OGGA 2FUG6 1N4AA 3A04A 1XL0A 3PUXA 1QHSA 4GI1A 4JGBA 3GGSA 1CCWA 4ZFNA 1CR6A 3A25A 4U5XA 4MMXB 1QIGA 5AVXA 3DLPX 2DUWA 3PBKA 3DV0A 2Q3FA 4EFNA 5LDHA 4GWGA 1Y1QA 2XQFA 1M83A 1G8JA 4YV1A 1QOPB 3DF9A 4BLWA 4BO7A 2FN9A 1YH3A 2IY9A 2RGCA 2DE0X 4FNMA 5CURA 2RGAA 4KJXA 1LX7A 3QVWA 2G5CA 1A50B 1XTPA 2XKAA 2IPLA 3DMGA 1ZJ5A 3WK8A 1FFGA 4C1NA 3EUEA 3RYTC 4O2AF 1QGED 1Y4UA 5ICGA 1YMQA 1AT1A 2B94A 3A2LA 1PJ8A 1Q0ZA 4I5DA 3G0HA 4O4IF 3U7FB 2YIVX 5K2OA 2JFXA 1VYUA 3KQSA 1U9IC 1W59A 2ID7A 1FFWA 1T26A 4XSGA 5IW8A 4LISA 2AG5A 2A57A 2O50A 4YI3A 1FSFA 3VTFA 3V97A 1E0AA 3F4LA 4E15A 5BR7A 3JQDA 1UOEA 3CB4A 3GPCA 1P77A 4QXQA 4UARA 3DBIA 1IEQA 4LRTB 2OGSA 3FE2A 4MZXA 5LQSA 1ACMA 3FUXA 3DBRB 3WIEA 4D7AA 3R3SA 2J4DA 4C7KA 1M8FA 4IUCS 1D4FA 2E4AA 4GXRA 4MW5A 4X20B 3GV0A 2NU8A 2QW1A 4GF5A 3K2IA 3CCBA 5IVKA 4IS3A 4A1FA 1ZBDA 3BXEA 3QLVC 4D9GA 5CYGA 4MIEA 1A5ZA 1RAAA 2V9CA 2WM3A 2IW3A 2PRJA 3GVCA 1NURA 5GOZA 5IHXA 5EIXA 4YRJA 3KKZA 1UKZA 1QP0A 4DLLA 2Z5FA 4P4GA 1ZSVA 1PUXA 4S2UA 2IEDA 2MR5A 3BD9A 4YT2A 1FPQA 2WFMA 3EZ7A 1AMUA 4AF8A 5I9LA 1F14A 2VSQA 3E4DA 3B9QA 6PFKA 3GLIA 3SOPA 2YKGA 4PFKA 2ONKA 1V16B 4XM2A 4TMTA 4H0FA 1KR2A 3VYWA 2OGTA 2P9FA 3TIIA 1BH2A 4PO9A 3RIGA 3GLFA 2UUBB 1E9DA 2G76A 2ZTUA 4DT1A 1KOGA 3HGMA 2D8AA 2WTXA 4YQYA 1M76A 3R4VA 4GPZA 2EHJA 2X0NA 2PHZA 1VC2A 1U90A 2JVKA 3EGXA 3CLHA 3ET4A 4OOFA 1X8LA 1I33A 1VLJA 1UWKA 3IIKA 5E9QA 3QFTA 1SFRA 2IYXA 1DWPA 1Q44A 4E5KA 5J4HA 5I7SA 2W6MA 5I9MA 1A0OA 1I13A 4PYMA 2F3SA 2IIVA 5J3JA 1R0WA 3PFKA 1J06A 2NO6A 4GBGA 1XEFA 3IDQA 5ARCA 1UBNA 4B9AA 5JBNA 1Z0DA 2DWOA 4M7RA 1YZVA 2G0TA 4B0OA 3U3OA 3JZMA 3DZJA 1J1UA 1YU6A 2UDPA 4C30A 4YHBA 4B6RA 3AX6A 3GVIA 4TWIA 3WMGA 2NUPB 4X97A 4G0OA 2QTCA 4LFAB 3HMKA 3PXEA 1AN0A 4ERNA 4QYSA 4PW0A 1NT4A 2DUNA 2C77A 4RF5A 1ZC4A 5F2KA 1O3YA 4Z8YA 1H6AA 3W77A 3F0TA 5JDCC 4ZEMA 4PPGA 1T4BA 1QCZA 1Y8QB 1IY8A 3I2JA 1GYRA 1GL6A 5JYEA 2X3UA 1T2NA 1Z3CA 2H1IA 3K9WA 3NHAA 4YALA 1VB5A 3ZK7A 3G59A 2FX3A 3LIIA 1MIOB 4W1RA 3HJUA 1N5KA 1DADA 2CV1A 5AW9A 3AILA 2BI7A 1KEWA 1JP7A 1OHHA 1CUYA 4PY2A 2JIRA 1IHXA 4BQRA 2ZSEA 1YRWA 2A2ZA 3RBAA 4HEJA 1EUZA 2NO1A 3BDIA 4DCUA 3L8EA 5EIAA 5DNWA 1R8YA 4OY3A 3VV2A 5A03A 5J40A 1YNSA 3HJAA 2PU7A 4O59O 2QUBA 1K89A 1SIUA 4D57A 4MVXA 1I3NA 5JISA 2R1TB 4FCWA 4KFTA 3G6KA 1O08A 3H0EA 1HT0A 6AT1A 3REQA 1C1HA 3SZGA 2ZUVA 3RVLA 3HJFA 1A96A 1LY1A 1T5LA 1PFKA 3FAKA 3PUJA 4OMFG 3CNEA 5DIZA 4WBNB 1UK7A 4EYKA 1MA0A 4X1OA 2OSBA 5H3HA 3CE6A 4FDUA 2QZ9A 1XVAA 4JVLA 4UZFA 4RYLA 5KNBD 3Q8LA 3O8OB 4JAVC 4Q4JA 2FPXA 2I2DA 1L7QA 3OLXA 5B53A 5LOVF 1TCVA 1NJ5A 3IC5A 4RLHA 3KJQA 5KKNB 3DMDA 1AQJA 1F4VA 1JU3A 1VMAA 3DE0X 4OP2A 5GONB 3SDZA 3ZWPA 2WJGA 1Q7RA 2BZ0A 1H1TA 4OUDA 4Q1AA 4UAGA 4B7AA 1MJFA 1OIVA 2G1JA 2WE8A 3V34A 1QGZA 4NAVA 4CM6A 1JR3E 5JMWA 1CUXA 2V7WA 2HDHA 3L8FA 4LQDA 3WJAA 1KQ3A 1YIAA 4KN6A 3B1JA 2RGRA 5JS8A