3NEAA

Crystal structure of peptidyl-trna hydrolase from francisella tularensis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
187
structure length
187
Chain Sequence
PKIKMIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNPKLNCNLAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHLGTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDIINYKLEPVMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title Structure of Francisella tularensis peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
total genus 58
structure length 187
sequence length 187
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3neaA00
3TCKA 3TCNA 3V2IA 4QT4A 4DJJA 2PTHA 2Z2JA 4QD3A 2LGJA 3KJZA 4DHWA 1RYBA 4FNOA 3P2JA 4FOTA 4JX9A 4JY7A 4QAJA 3TD2A 4FYJA 3KK0A 4IKOA 4HOYA 4LWQA 2Z2IA 4FOPA 3VJRA 4Z86A 2NAFA 3NEAA 3TD6A 5IKEA 4QBKA 4JWKA 4P7BA 4JC4A 5B6JA 5EKTA 5IVPA 4ERXA 2JRCA 4YLYA 1RYNA 4OLJA 5IMBA 3OFVA 2MJLA 1RYMA 2Z2KA 4ZXPA
chains in the Genus database with same CATH superfamily
4IZIA 5TR9A 1XYGA 4LNHA 4LAFA 3DFIA 5IVHA 4P32A 2HNBA 3H86A 1EUYA 1ORRA 4LV8B 3UAOA 4TS4A 3I92A 2XWBF 1Z37A 3FTQA 1LDNA 1TM2A 4O5AA 3ND6A 3DKRA 3I39X 5FWYB 3MUNA 3STTA 2C4NA 4RM2A 5E1BA 5G0SA 3ZIDA 4BMXA 1DRVA 1DFIA 3RV4A 3A25A 1AM4D 3IKVA 4CMKA 4W5NA 4C22A 1N1GA 4B35A 3ZLVA 1DXYA 3L7BA 3I9OA 2RI0A 1EFAA 3FOWA 3LQ1A 2IYWA 4Y7DA 1BD3A 1CVIA 1F4VA 2QN7A 2AQIA 3PC4A 3QTBA 4M1KA 5PNTA 5B12A 5F64A 3K8OE 2HADA 1Z2PX 1Y63A 4KXNA 3ROKA 1NMXA 4ZTZB 4Q82A 4DHWA 4I8XA 1LX7A 1NRJB 2Z57A 1JHXA 1CUDA 1XKLA 1HF3A 3WNCA 4BNDA 3LC7O 4HZUA 4JLUA 4PCAA 5FPQA 3UPUA 5DYWA 5CLFA 4DM4A 4MVCA 1NX9A 1IUKA 2IW3A 3EODA 4J0KA 4F3KA 2GAJA 3D59A 4OJNA 3M2PA 1CBUA 3OSZA 4HFJA 2EWWA 3TZCA 3VHQA 1DIRA 1G0OA 3D5EA 4L5JA 4DBVO 4ZIRB 2JLZA 1M8JA 1UBFA 2PWAA 3C1UA 4A03A 1MVLA 2BT4A 3B82A 3IAEA 1QCYA 2HQOA 2PLRA 4XM2A 3C3BA 4US0R 4LF6B 4B9AA 4TWBA 1FS5A 1ZD3A 5CP8A 2V9ZA 2Y0PA 4ZVTA 4DWVA 1PJAA 2R1UA 4JEMA 1X39A 3ZGZA 5CT9A 3DJYA 3RSQA 2C95A 4GLFA 1JE0A 4G1EB 4P1ZA 1ZWKA 1QP7A 3DO8A 3PDCA 4FHCA 3T7EA 3OQMA 3PTZA 1RWPA 1IC6A 1UJ5A 2CDRA 4M36A 2AJDA 2WAAA 4BNJA 5GVSA 4OB6A 1R9GA 4DSAA 2AKYA 1QU3A 4EA7A 3SDSA 2NO7A 4BMZA 1CNMA 1SY7A 4R3NA 5HQJA 5J47A 3PQ7A 3P45A 1K5PA 1TLFA 1ZSNA 2OQ2A 2BOVA 4KQ1A 4ZOLA 2NUAB 4D5GA 3ZJUA 1FF9A 2EKQA 2XB6A 2CJPA 1JH8A 3GAAA 3ETGA 4MYSA 1L5LA 1KQPA 2QQGA 3BGSA 2VHXA 3RTBA 1W30A 3TNDA 3VDNB 1IY8A 2YBEA 2ZIZA 1L3BA 3CWZA 5BOSB 3VXKA 1HUQA 1CJUC 3LBHA 3PGA1 1FVXA 1ZI8A 2B2NA 3VUFA 3IQHX 1ID1A 4BNTA 1GPYA 4D8WA 2BD0A 2VZ8A 3T7AA 7MDHA 2MYNA 1VMDA 3C6ZA 1BHO1 1WDWB 3AR2A 4Y2YA 1JR6A 3VR6A 4K6GA 3ILYA 2A35A 1F38A 1YAJA 2RJ3A 2XLBA 3DAHA 4R2IA 4YRPA 3UG7A 5I9LA 4E5NA 5AVXA 4OYRA 2JIZD 1Z2CA 2JVJA 4YO8A 3R8FA 3E23A 4KR3A 1U80A 1XRJA 2VG8A 4L6AA 1GJRA 1CULC 3A4IA 2O8DA 3VR4H 2Y2UA 1WKBA 3ZV4A 1Y8RA 3GFPA 2GCPA 2XCUA 5FKJA 3T3OA 4DLPA 4F3TA 4IIYA 2PX0A 4MQEA 1YJ5A 1Z4JA 4JVLA 2KLBA 4R0NA 2AOUB 1YS6A 3KWLA 1MXHA 2HLNA 9LDTA 2OESA 4QUGA 4UULA 1IDN1 4FFDA 3VTAA 3FH0A 4IX1A 3OVMA 4EB0A 2H3HA 3N2LA 5HKKA 3PX7A 5H02A 4GUDA 3PD0A 1VG1A 1JXOA 5HOQA 5FLKA 3PFHA 3BH7A 2ILTA 4RYDA 4BB0A 3WGOA 2B4YA 2SHKA 4EHDA 4RHTA 2PX3A 3T06B 1JWAB 4EF4A 2KX7A 3PNYA 5A9RA 4O4HB 1IIBA 1COWD 4UAUA 4EI9A 4L0CA 4G0UA 1IPFA 5FYQA 3ZKAA 4EY4A 2IUSA 1MN6A 2VZEA 3BZBA 4RVDA 5BSUA 1W0JD 4X7BA 1KMQA 2AX3A 1ULTA 4YJGA 1WBDA 1M5RA 5E3HA 2DE0X 2QU8A 3OSUA 4M98A 1E62A 1UEJA 4C7XA 3RWOA 4CKCA 3DOJA 1T13A 3K35A 2GM4A 2BMJA 4XD2A 2K2QB 3GRKA 3JYNA 3JQAB 4B40A 2DERA 3LIPA 3KLPX 2HT6A 2FX5A 3OOYA 4RLHA 2XT6A 1W5FA 2VN8A 1Q57A 3RNOA 2X14A 3VU3A 3LUPA 4U0KA 4Y9UA 3ZD6A 1KA9H 2JI8A 4MK4A 2HWWA 2J9RA 2CUKA 2C2XA 2R6FA 5SYNA 4HQKA 3DHYA 1A5SB 1IJKA 4N0QA 3KLMX 1GZ6A 2YOHA 4AN0A 4YRDA 3WRYA 1UKAA 2O05A 2BKXA 2Q3CA 4G09A 3DE7X 4ZGGA 4TQAA 2R1TA 3EGVA 4NZOA 4DY4A 1PWHA 2QRNA 2ZROA 4CF7A 1T15A 5CK4A 2BTEA 4D25A 1NBAA 4IMJB 2QVZX 1IUPA 5LNK1 3IV6A 2VT3A 2Y93A 4YAOA 4QDOA 2ZSJA 1Y98A 2I6TA 3A0RB 4ZQFA 1OLSA 2PSFA 3AIKA 3ZWYA 1OFHA 1VSVA 4FR5A 2RKBA 1BWRA 3FXAA 1SELA 3QG5A 3M6VA 2FSIA 3TZEA 2VF8A 1KSHA 3GP5A 1QV9A 2IITA 4MGEA 4GL2A 2Y05A 4FEYA 4BP3A 1YK0A 2ZUUA 3LPDA 3C7CB 3I28A 2EQBA 5B3JA 2H06A 1E9FA 1HURA 4O63O 4RVUA 3RYTC 1X7GA 1SQGA 4JR0A 4EBBA 4QO7A 3ZWPA 3E84A 4WNYA 1XDWA 4N0DA 3HLKA 1Y3IA 2PWBA 2QN8A 3Q2OA 4WECA 1QE0A 4RX1A 5JMOA 2UDPA 5EWJB 2QF7A 3BE6A 1ZGZA 2FLKA 1E92A 3NIBA 4D81A 1RLMA 4QT0A 3G23A 4OQDA 5HRUA 3ZR4B 5AVJA 2ZRLA 2OK8A 2V4MA 4OBEA 3R9XA 1LS1A 2XUKA 3EZFA 3FYUA 1KO7A 1ZHOA 3DKPA 3CO0S 3L0PA 1GTRA 5IW8A 1KE2A 3CUVA 1JHQA 2RONA 3SHFA 4RS3A 2OBYA 4LRSB 3IJEB 2A9PA 3AM4A 4YDHB 3WYDA 3FOZA 3C2QA 4R41A 1NUPA 4ZAXA 1NULA 1F51E 1ZI6A 5DV9A 5JZMA 2PKCA 1EUCB 2NV2B 3VR0A 1GKLA 1JSCA 4DXAA 3FTPA 5MFZA 1NFQA 2BKEA 2YXPX 1RXVA 3WLTA 1AIPA 3RJTA 4MW5A 1DAHA 3MCZA 4GU5A 4YRMA 5AESA 1XRPA 2XTZA 2O8EB 3DYBA 1I7SB 1NQWA 1EFPA 4U7FA 2O2IA 1C7ZA 3A04A 1XN1A 2B5OA 5EP3A 1C29B 5J4YA 1RZRA 2Z6QA 4PYLA 3AF0A 2AI2A 3EJ6A 3W5CA 4GG1A 4DUYB 2CT8A 3OEWA 1GUFA 4OG2A 4O59O 3VR4A 1PJ2A 3R8XA 3GG9A 5CBPB 2ZM5A 2AQKA 3ABQB 1TF2A 1U0JA 2QUHA 1F6BA 2H16A 3TS1A 2GPYA 3HG7A 3OTOB 4JSTA 2XXAB 1XIVA 1TZBA 5KNDH 1Q0PA 1SVOA 1XDSA 3NKVA 1B6RA 4BVKA 4R1TA 621PA 1QFJA 4ZXFA 1REQB 5E2AA 1PKXA 3G7UA 3IBTA 1I4DD 3PSHA 3UC5A 2AMYA 1EJ0A 2OBXA 1KYYA 2X15A 3EXIB 4U63A 2YCLA 3L4EA 5BNWA 2WWFA 3KJFA 3H5RA 4H3SA 4QXMA 2Q4EA 2Y1DA 1E3IA 2GNOA 2OV1A 2HWXA 2Z2KA 3BJIC 1NN3A 5ALNA 3H2JA 3L0OA 4TYYA 3Q6NA 1JXAA 1T6BY 2F9FA 2XF8A 1E4OA 3L3BA 3R6TA 4MWCA 4WTOA 1RYEA 4IJ6A 2XRZA 4RCZA 1RT9A 3HHEA 4FXPA 2CXUA 1XJCA 4IGAA 3ZHOA 4L15A 4BVJA 2JIOA 4UZEA 2W4IA 5B2ZA 2NUBA 5CA1A 5K4HA 1I1HA 3IX7A 2DWCA 3RFVA 1ZWLA 1GIAA 3PIDA 4YLGA 2CHEA 2ZQZA 4O4JB 1K98A 5K0TA 1WXGA 3I9JA 3P9ZA 3ZKWB 3ITNA 4MR8A 4TTSA 2HMWA 1UOEA 3OZIA 1XJWA 3ER6A 1OYOA 4RA6A 3HUTA 5DXFA 3OPVA 3V8VA 2FDCA 1AC5A 5LZ2A 3HKCA 3LP6A 2GO1A 3GDHA 4JN6B 1VRCA 3AR3A 1AK1A 1DRWA 4BIIA 4XRRA 4EGSA 2PCLA 2I33A 2O48X 2JS7A 1U1FA 3B1KA 1MG5A 1I4TD 2I6XA 1YAHA 3EFOB 3MFYA 4HADA 4LNUA 4TTPA 2IWRA 5DHPA 3ZZMA 4LYDA 3OQNA 2V54A 1WMAA 2CF5A 3L7JA 4BWYA 4N12A 1N5IA 5ALLA 2BSQA 4JSRA 2UYQA 4GAEA 4WIAA 2IEDA 4J3FA 4X1IB 4MTCA 2PMWB 2YZ2A 2WYOA 1WEHA 4B6PA 1Q21A 1NXPA 2QNRA 4A7PA 3V6MA 1R5NA 1YRHA 2H8GA 3H11A 4ND6A 3ZWOA 4MVJP 2H52A 1IVNA 1JFFB 2ZE5A 1NSFA 4XGQA 4BLUA 3BFVA 2OQIA 4KVAA 3DG9A 3OLXA 2VDPB 4PXYA 5E2IA 2A88A 2DC1A 2UUPA 1OFGA 3Q3EA 3V2HA 1SBZA 1OGIA 1K66A 1L4YA 2DM6A 3L8FA 3DFKA 4RF4A 1NSTA 2QRUA 3VVCA 3C7TA 4DSNA 3WQHA 4F06A 4BMCA 1MDFA 4J7CA 3C5EA 3GA5A 4POOA 1INLA 1XZIA 2O1XA 4B33A 2J1LA 1I2CA 3CLRD 5JO9A 1KSJA 1BRTA 1OH6A 2WJWA 1CNEA 1N5JA 4IP0A 2JIBA 4TWIA 2ZRGA 4OTZA 2ZI5A 3HBNA 4MVJF 3H1AA 4M49A 4OJKA 3SR0A 4Z0PA 3RTDA 2W58A 1NIPA 2DH5A 1JHPA 4R83A 4MMXB 4WVLA 3C14C 4C0XA 2PYIA 5LKRA 1XOIA 2EEPA 1UINA 4PG4A 3CLUC 3LVRE 1ECLA 2BIFA 1T6NA 1Z0KA 4LMBA 2QJWA 1DXHA 4F5ZA 2ZRAA 3PQ2A 4QSMA 2XVZA 3WLEA 2EFJA 2JFOA 2XT0A 3ML1A 3C4QA 2A59A 1GZ7A 3JW8A 4U02A 1HLPA 4WUTA 5LM3A 2PTHA 1N3IA 2ZSBA 1ESCA 1KOGA 3EDMA 4YQEA 2BBSA 2JKYA 4KRFA 1FNSA 5KZMB 3F1KA 2WM8A 2YJ4A 2ECFA 1GZ5A 3TBKA 4BO1A 3A9UA 4E13A 4WJLA 1M33A 4CEHB 4EY8A 2PZGA 1JJ7A 1WXQA 4X95A 1Z4LA 4H4EA 4NMWA 4CQMD 2V7GA 5K0JA 4ER5A 5EOVA 1J22A 2A9RA 3A4NA 4Y18A 1WCIA 4R68A 2R65A 3CCCA 4A10A 4EL0A 4AUEA 2I6FA 4N7RA 5GV7A 1E8MA 3KOYA 1L4BA 4PPYA 1HK7A 1JZTA 5TRTA 5F9FA 1KAMA 5GZ1A 3UPDA 4ZQIA 2LRHA 3K8YA 1UPCA 3CUEF 7ABPA 1LD3A 1M83A 4M55A 4MWEA 4WX2B 4KQ6A 3L18A 2ZRCA 4GOLD 2PRKA 1MO2A 3G0BA 4FHDA 4LC0A 1Z8HA 3WSVA 3EZ7A 2FWMX 2IYFA 2QTFA 2BEUA 2J3MA 1EXWA 1JKJB 2OOSA 3MGBA 3O1HB 1A3CA 5DGDA 5FBQB 5KNDA 3OWXA 4B3TB 4HDNB 4HDRB 2PS0A 1JDSA 1SB9A 2X23A 5AKZA 4JI1B 4JOCA 3E5MA 4M0KA 3W04A 3AHJA 3DAOA 6CHYA 4ETMA 3I5XA 2Z9CA 3W7BA 1NVVR 4EGAA 5BWOA 1M67A 1IN8A 4CIWA 1NJ2A 4F2GA 3Q8MA 1JLLB 4CT4B 3OZWA 5CVVA 4DVJA 2FMUA 1YJBA 3PEUA 4FYVA 4E2YA 1J97A 4YP1A 1RXEA 2C8LA 3FPBA 4M9ZA 2JJ1D 2K5UA 3BB1A 3R7NA 3RH0A 3C4VA 1W85B 4RV4A 3VPXA 4YJ2A 2H17A 5KVVA 2AUNA 4X8MA 3RQIA 2FETA 3QVOA 4RZHA 4DA6A 2P9GA 3R0XA 4E51A 5AJUA 3AL0C 3FOEC 3JAWB 2VXYA 4QECA 1MPXA 3EZ2A 1GA6A 2WVGA 4Q6BA 5DI3A 2H1FA 3W8FA 2D6FA 5DNUA 1NMEA 4FLMA 4L9WA 3SF8B 4GE3A 3TJRA 3W5IA 3A9VA 1N75A 2XGSA 3UWMA 5KHAA 1R0BA 3RYHB 3ZY3A 2Q8QA 5A3RA 4OU5A 3COZA 2QL7A 1RYNA 5ALDA 4K2HA 3RAJA 5DO9A 5L3RA 4KVZA 1XYYA 1JQ5A 2JAHA 2ZP1A 3K20A 3NCTA 1D4AA 1XLTA 4HQRA 3O2JA 4LSMA 4TQUS 3V4SA 2VZLA 3B2NA 8GPBA 3ZDFA 3AJEA 1F60A 3VBCA 1NBMA 3NRBA 2AC4A 2FW7A 5ABPA 5JARA 5EJ9A 1NBME 5BQ5A 4WLEA 4Z9BA 5H1YA 5CB8A 5ALGA 1EX9A 3UKOA 3WYFA 2CVZA 2B30A 2ZT8A 1A72A 5JNRA 1V2HE 4Y1RB 3MMNA 3L0SA 3A26A 2HMAA 4TV8A 3LLVA 4L72A 3KTFA 3HY6A 3D4OA 1ODLA 3FIJA 5MF6A 4A8TA 5HPYB 1U2GC 3HKEB 4J0FA 3OZUA 2C78A 2YJGA 2HREA 2NZWA 1O1YA 2GBPA 3H1BA 3MAAC 4LIPD 4XSVA 1KDYA 2O4CA 3AEQB 1CF9A 1C8KA 1NOKA 5AW6A 3BE8A 3HYNA 4U7PB 1W2HA 5AK3A 3W4IA 1VSBA 1T9AA 2J6IA 4HAOA 4URUR 3CW2A 5IJAA 3LWBA 3ZHUA 2XMBA 4IKOA 2QQ0A 1E2MA 4L1KA 3ZEIA 2FUCA 2QY9A 2HEIA 2WFAA 4HTAA 1KE1A 3SDZA 3QU2A 3LW7A 4ND5A 3QOFA 2GN4A 2GK7A 3HP4A 1JEYA 2R4UA 3H7IA 5JJIA 2VHVA 5CLHA 1TFUA 2VBFA 4BKPA 1G19A 3NWOA 2JFBA 2CB0A 2M6RA 1JI0A 2VPQA 4LI0A 4RE5A 3PJEA 1Z6XA 2CFRA 3H1EA 4P3OA 4YGXB 3UY4A 3VZBA 3O21A 4ZO9A 4TOIA 4QL3A 2DCUA 2QVBA 2G0TA 3QNMA 2ZJ1A 1EEHA 3L40A 4IXNA 2D54A 4EYEA 2V7QD 3K9WA 4WN9A 5EZ6B 3HXLA 2Q6LA 1M75A 5BT9A 3RK1A 3JAKA 4BO7A 2VYQA 3VPDA 1WXXA 3EUEA 2OC4A 5JLAA 3SJAA 2I2XB 3HDJA 1MFPA 6LDHA 4LI3X 4N0MA 5BWBA 1W0KD 2GBFA 1DBSA 2VRCA 5FQNA 4CM4A 2QG6A 4E5KA 4V1CA 1OIXA 2EKZA 4FGUA 1PWZA 1QCDA 3CEJA 3EZYA 4MCJA 5BXYA 3PJRA 4IH1A 3FYHA 2VNIA 4GDMA 2JGRA 4LA4A 4PLZA 4YP9A 5ICFA 4F4JA 3L01A 1JA9A 2JVKA 2XMGA 1DEKA 3E4CA 3EVZA 1QH0A 2BGJA 3HVIA 4ALMA 5BUQA 5JD4A 3DZJA 3VU9B 2Y77A 1Y1PA 1M2OA 1QTNA 2YN0A 4UM8B 1NNLA 3LX6A 4FR2A 4FFPA 4Q1EA 5DHUA 4AZTA 1N2HA 1CUAA 1WB6A 4R1SA 4C3ZA 5HQ3B 3X3HA 2X8LA 4F3YA 1GYPA 1UDXA 4UBJA 3R3HA 2DFLA 4UDXX 3UIEA 3O4HA 4AWAA 4NYJQ 3ZE9A 3EEBA 4LY9A 5HMMA 3K1ZA 1P2FA 4RGVA 1IZ0A 1JDUA 2YTZA 1XA0A 1PBTA 2Q1XA 4Y0VA 4A15A 4N7JA 1K7SN 4KFSA 2P2YA 2XCOA 1H6CA 3WLAA 5C4IA 1T1EA 3CVOA 1QHSA 1L8XA 4ZAWA 4UJ5A 2YZ7A 5KKNB 4N8DA 1RM3A 2P65A 4NTZA 3ZTTA 3I4CA 3QXXA 3MHTA 1Z5WA 5F2KA 3TAXA 1JJAA 4ZYUA 2B7LA 2B4AA 2LDBA 3H1FA 4G4SP 1N0UA 1QAQA 2Y9PB 4Z1MD 1J0BA 1RABA 2I2WA 3A31A 4GKBA 2GLTA 4ZRMA 1MC5A 3PNMA 4QFDA 4C3UA 4FYIA 3KYCB 2W00A 2O8NA 4MJ3A 1XMJA 4RIGA 2PU5A 1ZAYA 3WMXA 4XUEA 3BL6A 3H42B 1ZJ4A 3CKKA 4S0XA 3DVAA 4B7AA 3SLGA 5B1IA 2P2DA 4JYZA 2GESA 3A2NA 1KO1A 3N07A 2HK8A 3UT5A 1GL3A 1CNFA 2Q1YA 2C4KA 5T4EA 3DBLA 2NU9B 3JVDA 4AL4A 4LNAA 1BROA 4LYGA 5BVGB 1N4DA 1AZWA 2C7BA 4JHXA 4ZOLF 1JDNA 1SUFA 1T3ZA 1V6SA 4KAFA 5JTUA 3EFEA 1DHRA 5D7BA 1QDLB 5IYZF 2J46A 3IIJA 4NULA 4KQIA 1HLFA 2JI4A 3QLUC 3U7GA 4IHQA 3MCUA 1SUBA 4Z9XA 4PSVA 1KMNA 1MAAA 1UEIA 5U4XA 5K5EA 1TVCA 2VQDA 4L4UA 4QUBA 5ALUA 1T36A 2V1XA 2Z8YM 4BFTA 5E4TA 1SQ5A 3TR6A 4ZDKA 5CH5A 3H2KA 5BV0A 2REQA 2QQEA 3LI2A 1RJDA 3EEYA 3WGLA 1KOJA 2GBIA 3NAZA 3CYFA 1IMOA 3DPSA 3WK5A 4HGNA 2HU2A 1U3WA 3A7EA 1XTIA 4EO7A 1BVYF 2AT1A 3PQ8A 4KIJA 1PKEA 1UP6A 3CPSA 3W5AA 1W94A 2I2FA 4A8JB 4PZLA 4X94A 4LSGA 2QT1A 1QGYA 3W9BA 3BL5A 2OZPA 5ER6A 3AY7A 2NM0A 3W2IA 5IASA 5J23A 2ZAYA 3SZLA 1U8AA 1TYEB 1MJHA 2BE9A 4P58A 3ZE1B 4ZOQI 2QLFA 1YMQA 4C6HA 3WO0A 2O8BB 3FI9A 4A6DA 3LSYA 3VAYA 2D1TA 4OHBA 3DXFA 4KXMA 2F67A 3JQBC 3HFGA 3ZJTA 4E6EA 3GDOA 1TO2E 1VKOA 1Y5MA 3FN4A 2BSXA 5D6OA 4R8LA 1G59A 5L9AA 4WPGA 4L8GA 5BNTA 2H92A 3GEMA 4NSNA 3UHJA 3FD8A 4QO8A 1E63A 3THSA 4YV1A 4JLOA 3F2IA 4JODA 1KWGA 1M2KA 1Z36A 3KZOA 3A2LA 5MHTA 2ZSUA 3EC2A 4RSMA 4P35A 3ASYA 1SOMA 2AFHB 3QV1A 4IDHA 3O03A 2YZGA 2PU7A 3OX3A 5FTKA 4EAAA 1W36D 1E4VA 1OT5A 1VECA 2RGNA 1C30A 1YZNA 5A4JA 1YC2A 3UB2A 5I9IA 3T35A 1PJQA 1K6XA 4RMHA 5H81A 2YQZA 4OBWA 4ITRC 4II3A 2C5FA 4JZYA 3DFUA 4TXLA 4EMSA 4D9FA 1VHWA 4I4TB 3FTCA 5AHRA 3T5TA 2BKVA 1MJGA 3A6FA 2FPGA 3C7AA 1QJ4A 4O8ZA 4BL5A 5BR7A 2EARA 1JQJC 1SO8A 2QW8A 4RXUA 3F6BX 4ZO7A 3L0ZA 3ZDZB 3I72A 2HNAA 4GUAA 4HLUC 4EGJA 2I3DA 2Q9CA 2FMTA 2X5NA 4FEEA 4A2PA 5DOVA 2UZIR 4LJLA 2C1ZA 3GZJA 4JK3A 4KN6A 3TBHA 2ZRNA 2H11A 3ILSA 3C8UA 2LD4A 3HZHA 3JQGA 1EMDA 2OT3B 2Y1LA 4WFKA 5G4KB 2XHZA 3GJQA 5KSPA 3AY6A 3N8NA 1WLYA 2H48A 4BJ5A 5KKCA 2N46A 3ZD7A 3DL7A 3K0KA 1L5ZA 1NE7A 2I87A 2VBCA 1BXGA 2IQ5A 4QQNA 4UHBA 3DLAA 1L7RA 1U5AA 4NZYA 2F3SA 3LVFO 4NBTA 1F7VA 3FCOA 5KPJA 5E9QA 4ZDJA 2CXOA 3EVGA 2JAWA 2IY7A 5AVUA 3BMQA 2NIPA 2ZCVA 1OCEA 1Q1EA 1Z35A 1J39A 4IIUA 4JLNA 1W19A 2WA1A 4MTLA 4Y6RA 5CM8B 4JGIA 5A03A 1YF3A 1E2BA 1FLDA 4OSPA 5HCIA 1ONPA 2XH8A 4PNZA 4B47A 2I3GA 3PQDA 3TEJA 2ODPA 1ZR2A 1Q1NA 2Y2VA 1MBZA 2H63A 4KMOA 3AUTA 3RREA 4PG8A 2XDYA 2G82A 3L9XA 3FGZA 2QE7A 3ELDA 3OJXA 3LOQA 2IUTA 1AA9A 1QK4A 2HJHA 2Q2QA 1S01A 3LC1O 3HI6A 3WBKA 1HEYA 5A0FA 1NUTA 3BWDD 3HA2A 4IJMA 2YJZA 3BDAA 3IAXA 4W4TA 3BIWA 1XEWX 4B5LA 2RHLA 4HNSA 4HDSA 4BIMA 2WQ6A 3MBIA 1HDEA 1DTWB 2AW5A 2GPSA 4XSHA 3M4YA 1XZHA 2I4TA 3PC8A 4LOHA 4YB8A 1H3FA 3G59A 3OM8A 4OLHA 3ZLTA 2HRCA 2NADA 3L92A 3QVWA 3C5VA 4FGKA 4LSZA 1QRSA 4RAQA 5GV8A 3D3NA 2Z56A 1KIFA 3OX4A 3UAZA 5DN6D 1SCQA 4DLSA 2IZOA 3QWHA 1HQYE 1PFYA 1YACA 4ZOBA 3OIVA 1GPH1 4AC9A 2GXUA 3IPLA 2WM2A 4DEXA 3QQ5A 1RQGA 2FEXA 4DLLA 5JAPA 1Q0RA 2AEMA 2GZSA 1ZH2A 5C8YA 2DWOA 1E98A 1VLJA 3DBRB 1K88A 1C3XA 1GUDA 1LW7A 2XQKA 2M6SA 2OV4A 2W6ID 3ABIA 2J67A 4N01A 4MW9A 4N0PA 4PHHA 4KL8S 1QH8A 4U6QA 5COAA 4FLFA 3TPZA 3VYSB 5KMGB 5LD2B 2H2DA 3PTAA 1C1DA 4DZZA 1QBGA 3VJRA 3G85A 5AMXA 2YJ3A 4OP2A 1OXKB 4KQMA 3FRHA 1SU6A 3NW9A 3G2LA 5J5CA 1QAOA 1T10A 5CFNA 2GMWA 1PW5A 2WICA 3PX3A 2Y1CA 4QDJA 3H4MA 4V0LA 1KTIA 1AO3A 1JPNA 2P7HA 4F5WA 1HE5A 1VJRA 2ZRDA 3AR9A 5LB2A 4IY1A 4BNWA 2G9RA 2ZPAA 3H1TA 5ITWA 3NJ8A 2CV0A 3I1YA 1Z5VA 1P61B 5D01A 4CEJA 3EOBI 4OQZA 1KU0A 1THTA 4NV0A 3VO1A 2HU5A 2XMPA 1YRQA 3ZH2A 2O3UA 2CNBA 3L8CA 4P8RA 4ZVQA 2FP4B 1GYRA 4UHDA 1RXUA 5AH0A 1TO1E 3S1AA 4L5CA 4PLVA 1KDOA 2D13A 3EFHA 3OETA 1OTHA 5E4JA 5AKLA 2XEXA 3ILHA 2NTEA 3OCWA 3QFSA 2J3JA 3SQDA 5JSKA 2VTBB 4XVRA 4LZNA 5I9NA 2IS1A 2YC4C 3AT1A 1Q84A 3ISTA 4ECEA 2L82A 5A05A 2G9ZA 2R47A 3WLOA 3E8XA 2CCJA 1YCGA 2IYNA 2V3VA 1YR9A 1P7WA 4MZDA 3SXUB 3VHXB 1MB2A 4FDMA 1WKVA 4YFVA 5CB4B 3BCHA 1DDGA 4Q15A 1RI5A 1OXVA 1K7YA 3N7UA 5JVDB 3P2OA 4I3GA 5DKFA 3ZHQA 1V11B 4DTIA 3WLHA 4OI4A 3MHPA 4OBBA 4FS3A 4HVCA 3KL4A 3BRSA 4KDFA 1RQ2A 4G0OA 3P4UA 3WQSB 5CA1F 1IHXA 1M8FA 2PGOA 5EIBD 3MWLA 1OXSC 1QGZA 2HHJA 3UWKA 4OK6A 3GX1A 1S1MA 3I1IA 5L95A 4ZHQB 1NRXA 1U7TA 1UBUS 2XB9A 1MJNA 2RIPA 1UUFA 1Y3DE 4YROA 3ZU3A 2OBBA 2PUJA 1D0IA 3SICE 1QCZA 2R97A 121PA 2YFYA 3SZUA 4ZDIA 4ZK6A 1SCIA 3T0FA 3U5ZB 5DTQA 4L5IA 1FFAA 2B6HA 2YHSA 1P1FA 1LC0A 5C7YA 2WZBA 3CISA 4E11A 4FFNA 3ECAA 1C9MA 4MA5A 2P69A 2RBEA 3N75A 2XDWA 2GD0A 1N5LA 2CMHA 2BUAA 3U81A 2VUUA 4UOZA 4DCNA 2GARA 3MQ2A 3VNUA 3C3JA 4CF4A 3FDIA 1Z2AA 3P0IA 5JNLA 3IEVA 2G72A 3QTTA 4YRSA 1TVKB 2IYAA 4X3PA 1HDGO 1H6DA 5HCUA 4AFNA 2SCUA 3PXCX 2FVYA 3W0LB 5CEFA 3RHSA 1KMCA 1MORA 3QKSB 4LHXA 2WUGA 4LSWA 3RADC 2CB9A 2AZTA 3QU4A 3M1LA 4L2IB 4V3CA 3ODGA 1T9CA 3JVVA 3B9RA 4JB2A 2MMCA 3GRYA 3UC9A 2JEZA 2ZANA 1WAMA 1L7AA 4PAQA 3H8JA 2NXWA 1FDOA 4LPKA 2PT5A 3U39A 3HJTA 3R6GA 5B3LA 4LQ4A 1PX0A 2R7NA 3R75A 4IPTA 3VZPA 2JNWA 3SC4A 3WIVA 4WOJA 5YASA 2XNJA 1KZGB 1TD1A 1Y8CA 3MYYA 3EXEA 3BKXA 3AIOA 2ZITA 3VX4A 1M34A 3JQFC 1PQUA 2JIZA 1A4IA 4KE8A 3Q5DA 4PRYA 3UJ6A 5A7FA 3NUGA 2PR7A 2CKDA 4D0NA 3O93A 2B82A 1PJZA 1VBMA 1ZL2A 4RADA 1C7JA 4J1NA 5J2UB 4AX4A 3WSTA 3LHDA 1QPZA 2QUIA 1WMSA 1Y4ZA 4RDXA 3PNPA 1VJ1A 4WW0A 2WB4A 1FTGA 1JG6A 1HT2E 1YDEA 2QRJA 1UBCA 2VLIA 3D3WB 3IVRA 3CPHA 1D03A 3E03A 3VR2D 1UBKS 2VJKA 3UBTA 3DPIA 3JQ9A 4H6WA 3E8MA 3ENVA 3W5BA 2YMQA 1R10A 2C5GA 1PEKE 4V38A 1EQ2A 2CC2A 4JU8A 3WL8A 2QYTA 1I1NA 1LB1B 3FPFA 2GYVA 2OLKA 3W7AA 3WK7A 2AX4A 3NYRA 3S5UA 2PMFA 3BWBA 4FONA 4X85A 4CQLB 1Q14A 1DU4A 3GFBA 1COWA 2DF8A 3FPKA 4JVSB 3N53A 2C3MA 3NVAA 4Q7JB 1G66A 3Q7IA 4TTQA 4TZ6A 2E87A 3QFCA 5H3HA 5IAGA 1G4AE 3AF4A 5K0FA 4PCUA 4RKFA 1W0JA 3OIFA 4DNOA 1AMNA 3TI7A 1KU6A 1IZYA 2FR1A 4IVNA 5LYJA 4BVLA 5GAJA 2IJGX 2C1XA 2IY9A 2PS9A 4PYQA 4F93B 2ZBFA 1OB5A 2IOFA 2R1ZA 3ORHA 3BF7A 2XBUA 3N8DA 5A9TA 5DN9A 4QPPA 3LK6A 1COZA 2QIOA 2AHOA 2RIRA 3FWHA 1W1WA 1NURA 5D84A 1VHLA 3NHUA 4WXYB 3PC3A 1HSOA 1HLDA 1T5IA 3L0CA 1NVEA 3PJFA 3WLFA 1DBWA 3KJEA 1V3TA 4R1MA 4D3XA 5JSZB 4MHOA 5IT0A 2DPMA 4IBOA 2R8PA 1XNRB 2Z8XA 3NVDA 1SQ0A 1O87A 3RU9A 2FEOA 4P4GA 1XI2A 3LY8A 4OKSA 3EVAA 4OPMA 1H3NA 1T1IA 3ZCPA 4GKKB 1XEFA 1YR8A 3I73A 2PKWA 3H1GA 1T5TA 3QSGA 4PE5B 1LJLA 2QSUA 1AQYA 3MS2A 4KN5A 2HXYA 1N8NA 2XZTA 3NHMA 4ZV9A 4D8VA 4MROA 1XMIA 4PZAA 3PHGA 3OIWA 3I5YA 5A4FS 3HV2A 1BX3A 2H5IA 4BJ3A 5C32A 4YJ2F 3IT3A 5F5XA 3TTXA 1OA1A 2IYQA 4JB3A 4RVFA 4WNAB 3BCSA 3WOHA 2PLNA 5A3SA 3CN9A 2QY6A 5K1ZA 5E6RB 4FYYA 1E0AA 1SKBA 3HMKA 4C9BA 4FDVA 3H6KA 4K1LA 2QP9X 4A9AA 4CMIA 2GYUA 4GZ3A 4RY9A 3U60B 3H17A 3PDUA 5IBPA 4F85A 4KE6A 2GEJA 2IP2A 4WDRA 4WFIA 3AERB 3AVQA 4XD7A 1O9BA 1QQBA 3CT6A 4ICIA 1Q15A 2C58A 1L5MA 4M1QA 4MICA 1K68A 1E2FA 1YZGA 3K9CA 1QMPA 2ECQA 2PGIA 3BXEA 3M1IA 4K9MA 4Y6QA 4FGWA 5ESRA 3ZWAA 3E3AA 1YZYA 5LYYA 3LCCA 1H65A 4MUEA 4N3CA 2VNKA 3HCAA 4E2XA 3LBNA 2EDCA 4OGLA 4R69A 3PEYA 1Q3TA 4R8KA 2GRJA 5FUYA 3NDPA 4HVTA 1QF9A 4WKOA 3I53A 2GD2A 4BQIA 2JZOA 4MRSA 1MPTA 1PT9A 4FI3C 2YWXA 3PUJA 4D3ZA 4MLPA 1NXTA 2D1YA 1J90A 1GLNA 2PQ0A 4G86A 4TV8F 2C54A 1MA0A 3ROEA 4EZBA 4J2HA 4KLCA 1JT9A 3K0FB 4YK7A 1R50A 3RUIA 2DFPA 2JBHA 1XKTA 1XTSA 2YCBA 3AFMA 4IDBA 1J8YF 4WN3A 3AKYA 5CB0A 3LHFA 4HC4A 4KE9A 4LHZA 4MDYA 4NU8X 4UCXA 5KYKA 1SCJA 2QXUA 1UC4B 3OFND 4QGFA 2NU6A 3QJ5A 4YACA 4EVRA 1PN3A 4J43A 3UFXB 5IANA 3U3RA 4OU4A 4A26A 3BQMB 3P9PA 2I7DA 3QHAA 4YAKA 2AMFA 1IM8A 4NCIA 4YONB 5ER9A 5HRCA 2OCAA 4KBFA 4WZ6A 4JVNA 2Q0XA 2ZSEA 1DWPA 1E2PA 1KQOA 3KKNA 4RA9B 4YTEA 1JXQA 5T6MA 4J3NA 3T1OA 3WWDA 3L6EA 1YBAA 2O54A 4PU0A 2FZ5A 1CDZA 4QQ8A 1PEYA 2CUTA 3FMVA 1ZD1A 4HATA 4QYWA 3PHIA 4H18A 3N74A 1EK5A 3VC2A 5EWMB 1NMZA 1V5IA 4IO0A 3ISJA 1XPJA 3DMRA 1U2EA 3LMKA 3ZCVA 4KR7A 3AW9A 4LKRA 5L3QA 3INGA 3OPYB 1Z5GA 1JECA 3TNFA 2GA9A 3TX6A 1MEEA 2HH9A 2NUPB 1W7AA 3H19A 1Q1QA 2CYBA 3G82C 4EEXA 1SVKA 2HK9A 3G5MA 1DSSG 5IG2A 1HL3A 2I71A 2OO3A 3FPGA 5ERGB 4ESEA 1RE1A 5KTTA 3W4KA 3OM0A 1VE6A 4QU5A 2VHUA 3V3KA 2RAPA 1FDRA 4JGBA 4FMDF 4CHTA 1XQYA 3U3JA 2IIPA 4PBSA 4DR7B 1MHPA 4IQ8A 5LSAA 3IHTA 3TQSA 1RYFA 3KT8A 2PMEA 4BOYA 1NW6A 1DIBA 2WWGA 2BN4A 3C41J 3M49A 5CHYA 4BFSA 1WUJS 3UNXA 4G0VA 1OV6A 2ZYUX 3M89A 2HJWA 3H0EA 1DXQA 2PSJA 3LL7A 1DXOA 1MW8X 3B1XA 2CLDX 1H0RA 4NEGA 1MQ9A 3VKUA 1RJEA 3SC2A 3ZWNA 1FSZA 1OX6A 4U7HA 3BB3A 4W6ZA 1VIDA 2ETXA 3HSYA 2FA9A 3HXOA 1C3EA 3GMIA 3RVDA 3WMWA 3ADPA 4ZPJA 4IIBA 5E38A 2ANCA 4G0MA 3VISA 3VTKA 5CTJA 1CSEE 1FX1A 2VTEA 3O84A 4Y98A 5HDBB 1TOAA 5FT9A 4NZMA 3GPLA 3P94A 5TF0A 3IUMA 3K72B 2XADA 1N5DA 4YRJA 1RZ3A 3ZLBA 1HA3A 1UKEA 2B21A 4K05A 5ECDA 1FY2A 1SCDA 3BIJA 4CUZA 4HGZA 1FJ2A 1G20B 2O2DA 2WWTA 2ZTHA 3KYDA 4OLJA 4QREA 5J5VA 3TW4A 4E1AA 1NF3A 3ZDCA 2FPIB 1F0YA 2CXPA 1LV7A 2O0HA 3FZQA 3TTVA 2QOEA 1WUIS 3UT6A 4G8DA 4CKBB 3R4VA 1POXA 4A91A 1VFPA 4Q37A 5CH8A 1JMYA 1BN7A 1CX9B 3DOIA 4KH0A 5IH3A 4IHAA 1Y5RA 3DO6A 1J09A 5KJEA 4MV9A 4P54A 1WABA 4U8HA 4KFRA 4MR7B 2QORA 2ATVA 1Z6PA 2P1ZA 4DQKA 1ST3A 4NJEA 5ITVA 4ER3A 1JS1X 1GQFA 1JX6A 1NVMB 3HM2A 3ZXIA 2VAWA 3TN7A 5EL0A 1NYTA 1Q0QA 2HU7A 3HB9A 4HDKA 2VDLB 1Y48E 4MDEA 4AAYA 4UFPA 1ENPA 1U3DA 2W2MA 1TIBA 4US2R 1YASA 2Q1SA 2QMUA 3BXFA 3A9WA 3FFTA 5E7IA 1VHTA 5AXCA 2Q46A 2GSWA 4QA9A 4LDPA 1XD2B 4ZJYA 4MKIA 5HP4A 1SA0B 3D2CA 3LW8A 4AMUA 4EAQA 2JGAA 5EPEA 2XB8A 2Z3ZA 3KYJB 1QVVA 3EVCA 3LTEA 4H4DA 4HS9A 4ND3A 1OLXB 2H08A 5ALQA 3ZHVA 4PHGA 3FZNA 1C3OB 1T0HB 3IDAA 4X44A 4ZOEA 3GQBA 3ZK7A 4G6ZA 5K8VA 4E2ZA 2GN6A 3MJFA 3GPCA 1MA3A 1U1GA 2BGTA 3KPYA 3MTGA 4Y6PA 1VTKA 2GN1A 1RHUA 3BE5A 3GGGA 3GT3A 4P5EA 4G4JA 2O50A 1JVNA 4HHEA 3S7TA 4U2GA 1RHKA 4NCNA 4AG3A 2JHPA 1T9DA 1TECE 3JD1A 3LF2A 3O8QA 5DYTA 4B75A 3K70B 1J1UA 2HSEA 2ZCUA 3F8TA 1P0CA 5BUSA 5CFMA 3T99A 1ZRSA 5BSGA 2PL9A 4HF7A 5JYDA 3K09C 1OC2A 2Y0DA 3FPSA 3B1VA 3L49A 4FFRA 1P7VA 5AM1A 5KVAA 4BGIA 4JX8A 1C9DB 5ARBA 3Q72A 5JD6A 3GJXC 4E5YA 3F5FA 1KQ3A 1NPTO 2C3UA 1GT91 1WNTA 1JT2A 3K0AA 2EGHA 3GL9A 4GNKA 1F5NA 2FGJA 1C3LA 1KJWA 2W48A 5I7WA 1F20A 2QD4A 3ESCA 3IBSA 4HWRA 4YT5A 4DIOA 5TIIA 1SBCA 2H4HA 2V8OA 4WV3A 4XYMA 2XQGA 2ES4A 3DUWA 3CG4A 3CLTC 4M9RA 5F1PA 3FSJX 2O57A 1S2DA 4MQUA 3WIUA 4BB6A 1ZL0A 2ZLBA 3PI6A 1IEQA 1VKJA 3CXRA 3PGMA 4QWMA 5GGYA 3SJZA 5B7NA 5IZCA 1NJ1A 2DBVO 5AVVA 3V7NA 5LMUB 4PRKA 5B2EA 4JKOA 2P4SA 1F12A 1G4HA 4DG9A 4J7UA 3DDOA 4U9IS 1XL0A 3BZWA 5DIFA 2QX9A 3KHTA 3OJWA 4PC6A 1UPFA 1B8NA 4OGGA 2Q9UA 3GB9A 1NKSA 1M7HA 4H1TA 4PLGA 4OHXA 3TI9A 4QNNA 3EPKA 4GX2A 2R8BA 3KXKA 4F12A 4G89A 1N8KA 1Z8FA 3HYSA 2C4TA 3N2ZB 2VATA 2DFDA 3UJNA 2Y3IA 4RKYA 1MAVA 2RAUA 4FZRA 1JSLA 2DHCA 2OGSA 3FDZA 4LYHA 5E9AA 1L4NA 2A30A 2BZ1A 2WUWE 3SOPA 4Y2TA 4UUNA 3CUWA 3IR6A 4EQZA 3A11A 3JZAA 4JASB 3BMCB 4EPWA 1Z26A 3I05A 4MQFA 5KNLA 5SZHB 1HGXA 4OO3A 1R9NA 3EQZA 3FE2A 3UMJA 4KR2A 1Z0JA 2A0WA 2JCVA 3H5VA 4BB9A 4CLHA 3ZUPA 2JAXA 1RJWA 4BNLA 4WZAA 1P7YA 2GEKA 2ID7A 1UBGA 3AFIA 3NHAA 4WZAE 3WKBA 4JNCA 4L0DA 4M1TA 1U02A 1X7ZB 4NYIR 4DE5A 4AY5A 4ZWNA 2O7NA 3EIQA 1VIYA 4YN3A 2A1UA 1TW2A 4ODIA 3D0QA 1VQ1A 5CDGA 4JOSA 4F4CA 1X14A 3A4YA 4W6QA 1ZXLA 4ENUA 1T29A 2DQSA 3Q7EA 1TX4B 4LZWA 4J07A 1T6YA 4K9PA 5DTRA 1CIJA 4KJZA 1UFRA 3G2KA 2GF0A 1Y8QA 2R7AA 2BGWA 2GAAA 2C9YA 4XIFA 3FHCB 2BHLA 1JN0A 3P71T 2IE8A 3QF4A 5CVUA 3M7IA 3OLWA 4B7UA 4E94A 1TJPB 1LW6E 1UKYA 4Q7MB 3GWGA 1GFIA 1F2UB 4IGKA 3UCFA 5J2TA 2CL0X 4C1BA 3EULA 3CWQA 1ZAKA 1U0NA 3LWZA 2C04A 3DZKA 4NH0A 4RVGA 1NWHA 2ZSDA 5JNVA 1NUHA 5BN4B 2AD5A 2ONYA 2HCTA 2G8NA 1GUYA 1QJCA 1LI4A 3LSTA 4RWZA 3QYPA 4UU1A 3TTSA 3WYNA 3TVDA 4LY0A 1IEVA 1AXGA 4Q1DA 4IX9A 4CUJA 2JAOA 3GCWA 4XEHA 4RUKA 2MU1A 1WMDA 2DJ5A 4WJZA 3MF4A 4IDFA 5F4ZA 5BRJA 3U7FB 2D8AA 2B4QA 2E89A 3CH7A 2N75A 1GU0A 2HPZA 1B0ZA 2V8BA 1UAYA 2GZ3A 2RCNA 3ECCA 3LQYA 4UM9D 3U1TA 3V4FA 1IOLA 1U5CA 3ZD8A 1H66A 3I1FA 4X0EA 4XYGA 1QKKA 4BV2A 4TL8A 3ZQ4A 3I6IA 2FRDC 1X3SA 1KMIY 3IVXA 1V4BA 3FVVA 2JFQA 4GVPA 3VVLA 3FNIA 4W82A 3SMVA 2V7QA 1AUXA 2WJ4A 3DUFB 3GA7A 5ALRA 1FS6A 3ZE6A 5AW4A 1ZJWA 5JJ5A 3BVPA 4ARVA 1E6CA 4KXFB 4XVUA 1QUEA 3FWZA 4X91A 3S2IA 1U8EA 3TZKA 3ZHCA 2H0QA 2RGUA 3QEAZ 3OQVA 4QYIA 3C3KA 2E4UA 3PDWA 1W0KA 3QU7A 3MELA 3EJWA 1SCAA 4JBXA 3D6NB 2DECA 3O4VA 2RHGB 1YVRA 3F4LA 3WFJA 2H1SA 1ENZA 4G23A 3V7FA 2GO7A 2ZXFA 5IAOA 2X19A 3OF3A 2WFMA 3FMIA 3VSDA 3ONEA 3PENA 2G36A 4PBTA 1C4KA 4XX1A 3LIIA 4RJTA 4YEDA 3P0EA 1F48A 1HG1A 3G8AA 4AMYA 2G4CA 3DAGA 4AJKA 2P0EA 1Z7EA 3UJ3X 1FB5A 1X9GA 1OKKD 3GPDG 1QHXA 3OQIA 1E5DA 3E9CA 3VPCA 2E4AA 5H9WA 1P4SA 5TARA 5EY5B 3Q4GA 4BN4A 2ATIA 3MC1A 4XCQA 3OMXA 4RE6A 2GPJA 2WUEA 5THXA 3PNOA 5BN3B 3OT1B 4HJRA 1EK6A 1VYHA 2YS6A 4I4CA 4ROTA 4AUMA 1NFRA 1P31A 3STYA 1N7IA 4BFXA 1TI7A 1T2DA 1LRJA 4YBZA 3ZW8A 3HE3A 3FOFC 3NVKI 4I5FA 1YS9A 2WINI 2ZR9A 2GTIA 3E18A 3GUUA 3L1UA 1P1KA 1KZ7B 3FYTA 2FNAA 2DEUA 4YV2A 1CZKA 4NCKA 4A6PA 4EG8A 3CVYA 1GXSA 2PEZA 1J0EA 3MAJA 2BFCA 1M1XB 5IFKA 4AJ2A 3KVVA 1NQ5A 3WTBA 4KITB 1QG0A 4J1SA 1E3MA 4CMBA 4EGQA 4INJA 2EW1A 1VPTA 2PBRA 1W73A 4Z1MA 1CF2O 1M0TA 1VBFA 3GELA 2C9DA 3DD1A 4DJTA 4M38A 1ULAA 2J7KA 3H16A 3M3HA 3JQ8B 2LZ0A 1L7OA 2WIKA 3FG9A 4JHLA 3ZVMA 4JVOA 4YPVA 4LVNA 5KJ1A 4GWGA 1Y6ZA 3R5KA 4AXXA 5DGXA 2Y1XA 2XZOA 4DJEC 3O3NB 1OU4A 1DDOA 4DDKA 5KYXB 1VSTA 5I01A 4OAOA 2ZZNA 4BNMA 3R7BA 4O3MA 3Q0TA 2ZAIA 1DAFA 4BFVA 1ZIPA 4LF5B 4Q4AB 1IXSB 3FSEA 2A8YA 3PRKE 5F73A 1H1TA 4EEZA 1X42A 1J20A 3EE6A 4TLLB 4WLFA 1P9OA 2JJYA 3WGKA 1ZSYA 4DMKA 1RBMA 3WL7A 3C6QA 1ZRHA 2GHTA 4B3RB 2YHIA 3QWIA 2DZDA 2IYUA 3F90A 3QVLA 4X6XA 4DLWA 1QZUA 2Q3MA 2FP3A 1ZNWA 3BQNB 3TXXA 1QV6A 5KSOA 2AJ8A 2VA9A 3LYAA 4TLDA 2VHEA 4N3GA 1WB5A 3EDRA 3DCYA 1EUDB 1R4MA 1CG6A 4BKRA 2M6KA 2JZNA 4MZXA 1KXZA 4RVNA 1V47A 1AB5A 4L50A 2PZBA 4A8PA 3P2MA 1ODCA 2O7QA 1LF0A 1VC2A 1BVUA 4R7ZA 4L27A 1E7YA 4L07A 1Z6GA 3AH8A 4UD6A 4XFDA 5AK6A 5CITA 4KLNA 3LO5A 4N65A 3LPLA 2CXTA 2IEGA 4BU0A 2IXFA 1T2EA 3P9CA 4P4LA 4EFMA 3MT9A 4HUTA 2JA1A 5MFPA 1YC5A 1QLWA 5I7HA 1FFXA 3S1LA 3UUFA 5FB3A 3CLUD 4CEIA 1VKRA 3HR4A 5CVDA 1KETA 2GEDA 4H16A 4QDXA 3ZY4A 1ETHA 3EYWA 1WD7A 5KWVA 3IMFA 1GPJA 4MV0A 1PL7A 2WIJA 4Y30A 4DWOA 1MV8A 3GYBA 2AG6A 2PRSA 1TL7C 4XDZA 2Q2OA 1YUNA 3ANXA 4Z9YA 3OA2A 4UQLA 1NY6A 1W5TA 1BAPA 2PWZA 4JC4A 3TTYA 1SBTA 4TWRA 4Q9HA 5U4QA 2KWIA 3W79A 4E15A 3WIDA 5IT5A 1X80A 3V46A 2FR8C 2HFJA 2JAUA 1M0WA 3EA4A 4N5IX 4D4JA 1YTLA 3GUHA 3JD0A 1SC4A 2VCHA 2WF6A 4LY6A 5DWVA 1UWCA 2X9QA 1C4XA 3QMMA 1NASA 5LYJF 3BMXA 3MLEA 3IQGX 3ETHA 4FE7A 4KG7A 1JIQA 2ID9A 3DE0X 3WWYA 1ZH8A 3CVWA 1N34B 3DNMA 1J0DA 1JILA 4HKTA 4MGIR 3ZJYA 4XX0A 3MTJA 3SU8A 3QTLA 3UMVA 3RFFA 2Q9BA 2CLCX 2DRIA 1B23P 1IHUA 2CD9A 2XKJE 3KSRA 4HX2A 5LQUA 1VG9B 3TZ6A 4BUCA 1T1SA 1VJTA 2JIQA 2RC5A 4MP3A 3VZSA 3WGMA 3ZK9A 1T5SA 3I3OA 4G2TA 3BSSA 4ZODA 4Y1EA 5DT2A 4GFDA 3GPIA 3OQHA 4MQLA 1PDWA 2X1LA 4DY6A 2WFLA 2Y1WA 1MEOA 4M2LA 3TNLA 4Z4EA 3LGAA 2UXDB 1J07A 3KAJA 3QK7A 5DCYA 3SYTA 4DMRA 1FJXA 3DE2X 3O1LA 1I2AA 1R12A 2BH9A 2BKAA 1MLDA 1UKCA 2JCBA 1OV4A 1D6MA 1G2OA 2C8JA 2Z8YA 1L7NA 1NKVA 2A5JA 2E5FA 2WMNB 3UOGA 3A1SA 4B6JA 4DSOA 3NHZA 3U6BA 3MG9A 2M1ZA 4R7TA 3OOEA 2CLHB 4H31A 3ETNA 3W1WA 1KEVA 2UU9B 1CUIA 3HLTA 3BUSA 3BJZA 2QW1A 3F5MA 1PBNA 4R9SA 4V02A 1J2EA 1WV1A 2X1VA 3ZE7A 2AOTA 4RLQA 2CFIA 3KZVA 3TUIC 3NB0A 4HZUB 1UZNA 4EY5A 1VLLA 5A71A 1M6VA 3M4XA 1Z5PA 4IQFA 3B36A 1WIWA 5JDCC 3HABA 3IURA 1JE1A 3PF8A 1Q0SA 4FUTA 4LJSA 1G8JA 1A0OA 1DADA 4QX6A 1HNNA 1HQDA 2G9UA 5DCUA 5THKA 1X3LA 5EZYA 4GBMA 5A7HA 4L5BA 1AS3A 4PWZA 3REGA 1R1DA 4O1HA 2VP3A 2WTUA 1DC5A 1GSAA 4AZ3A 2C7QA 3E5HA 1C0PA 1MC8A 5FULA 2Z8ZA 4N7MA 4GP6A 3IAS1 1JQEA 1KZHA 2DWPA 5EJ5A 4JYPA 2UZ0A 4IQ0A 3L5OA 2X7XA 3ESZA 2HF9A 2QROA 1ZM4A 5TC4A 1KTVA 3ZVRA 1USGA 4F4DA 1MIHA 3U4AA 4PFJA 3PZRA 4W8HA 3S7ZA 3W2TA 4LFCB 3S6JA 5LZ9A 1TKCA 2ADOA 1V6CA 5A3QA 2M32A 2H3EA 3I01M 1FFEA 5DN6A 4C78A 4TMFA 1KKUA 5LUBA 3SYMA 4LOAA 2FWBA 4IDGA 1Z7WA 4XWGA 2YYAA 1FRVA 4NONA 1W6UA 1YQGA 2ERYA 4JQCA 3MIIA 4JL5A 4H7JA 4ZOLB 3NYQA 1U2TA 3NIFB 4I9GA 1UBMS 3GGOA 1DBVO 4BLWA 4IJKA 5IYZB 3RC8A 3BREA 1IBSA 3AEYA 3ROPA 3U49A 4R81A 3IE0A 4TVSA 5CFPA 4MX8A 2R8ZA 2VOJA 3UH0A 3NVMB 4DV0B 1KZ4A 5BT8A 1GR0A 2H9YA 1OX4A 1G21A 2AMLA 2C2MA 3JU3A 1O95A 4K0KB 2AI3A 2NAPA 4O2RA 4J1TA 1G21E 1I2MA 1A9XA 2ZDQA 4ZOAA 3ER9A 2YWHA 3W2EA 5C1BA 1EBBA 1RSZA 4KO8A 5BV1A 1JB9A 1RAAA 1TTHA 2PZKA 4GM1A 4QFMA 2GERA 1GLVA 3F6SA 2I55A 3OHPA 2XUOA 4KQWA 4QEZA 5TSDA 4ERNA 5KTPA 3TO5A 2O8DB 4AZ0A 1OGYA 4FYMA 1B43A 1Y8RB 1BG6A 2HL6A 5J3JA 3VKVA 4MQEB 4OK3A 2RB5A 4Q9AA 1DAGA 1V5WA 2FPUA 3AZOA 3O7MA 2MYUA 3DEHA 4TRJA 2HX1A 4ZYLA 1QONA 3MWEA 4RL4A 4OQEA 2R9VA 1YB7A 3QW2A 2XMRA 5CYGA 4F6RA 2VQEB 2VHCA 1CQXA 2Q4BA 3T7IA 2ZJ0A 2WYUA 3ESDA 4I5EA 4Y6SA 4YWJA 3EVBA 2A1TS 3PG5A 3KKMA 1JLKA 1GPAA 2HWYA 4Y8VA 4C3VA 4TKUA 1L5FA 2YY7A 1AURA 1R0KA 2Q8PA 3NBXX 1UFKA 3ZHZA 3A2MA 2FQ1A 4YAGA 1O58A 4DIFA 1QIDA 4G85A 1AK9A 4M88A 4EF6A 4YJFA 1QANA 1DMSA 3RHFA 1KS9A 2X0JA 2PGAA 4B43A 3AQ4A 3KQYA 5KOHA 1WBBA 4EEKA 2RFLA 2QR3A 1PD0A 4IJVA 4MA0A 5ICSA 4YJGB 1UOPA 1R64A 2OGTA 3RYFA 4PO3X 2HFKA 3NUZA 4CKCB 3H4TA 2PMCA 3P20A 4D41A 3KALA 3MTIA 5L6LB 2QG4A 2OO7A 3TW8B 3UQYS 1VG0B 2VEDA 3P2YA 2XUFA 1JTVA 2G3YA 1DT3A 2ZYTX 4CLXA 5B2FA 3ZCRA 4DC9A 1JA1A 1ZMRA 2I2AA 1ZU4A 4Q4JA 4BFWA 4KNYA 3TE6A 3U44A 3U3MA 3NT2A 3EWAA 3C5WP 1J5XA 1EWVA 2EAUA 1LK5A 1WSDA 2KI5A 2XCTB 3SXJA 1DPGA 4G5QA 1WVIA 2XUAA 3D2BA 1H93A 4ITVA 5H82A 5TGTA 1NW9B 5JAMA 2R8XA 1WTCA 1EG7A 3S70A 3EIOA 4K9NA 2C3OA 1PTJA 5CAEA 2FPKA 1FDWA 3RS8A 2O3RA 3Q3GE 1GSHA 3VNRA 2Q6VA 4Z7QB 1PL6A 2R1TB 3GGPA 3OQ1A 1B6SA 1Y82A 4CMEA 221PA 2BONA 2V5AA 4BLRA 1OVGA 1Y3FE 1Z6QA 5HDQA 4EP1A 2I4RA 4J7AA 4Y7CA 4YGYA 4IMIB 3T61A 2C9CA 2RD2A 2C7GA 4KK4A 3A3PA 5JS1A 1OLSB 1CZLA 3T5GA 2MSCB 1HDZA 1NW5A 4UTXA 3T34A 2ATCA 1EFTA 1LQUA 1FPMA 5D5HA 3HCBA 1UXJA 3EBPA 4XJVA 3R7DA 3ZWWA 5KNBD 1KPIA 2ZIVB 2NYVA 2P90A 3R7WA 2ZSIA 4ZQCB 1U0OC 3AQIA 5JADA 2JG3A 3GCGA 1H85A 1GEEA 4JT9A 1E18A 4Z0TA 3SP1A 4ZT7A 1G9TA 2FJUA 4HRXA 5FI0B 1NLYA 3PFIA 2OCIA 1I7QB 3GFRA 4Q9DA 4X20B 1V9CA 1G38A 2PUGA 4KYTA 1BIFA 2P9CA 4Z3KA 3N0RA 4OI2A 1CCWA 4EZEA 3CUTA 3WC4A 1YB4A 2G17A 2H4WA 1G6HA 3N28A 1P72A 3FNRA 4MV3A 4A8JC 2YZMA 5DK6A 3VR2A 5H4GA 4QQRA 4RO0A 5K09A 5T64A 3UHOA 1U94A 4XDGA 2EKPA 5K6TA 3R9XB 3FYUB 1LK7A 3ADBA 3RKSA 1WPQA 1FDSA 1OBHA 1QOZA 3LRTA 3QQPA 4K26A 4CLRA 3CLHA 4Y1GA 1O94C 3S40A 3ABSB 2IGBA 4LX8A 5F4BA 1RE0A 3DULA 4KQ9A 2IHTA 3VNQA 2B83A 1FDVA 3KEOA 3KUXA 1B26A 4H3VA 1TYZA 2C07A 5FTLA 2HM7A 4H1WA 3DLIA 3OEED 5AKXA 2XRFA 1LTHR 4GLOA 4J3JA 3WBJA 3WRXA 4C4TA 2QU7A 2J6BA 3AUFA 4LYJA 4OHPA 4DV1B 3A3OA 3BDIA 1QORA 3DWIA 4YV7A 1G8MA 4HN9A 4BMOB 4EG1A 3B1YA 2YWDA 3OZVA 2EQ5A 4NBKA 4DARA 5ALKA 3LNTA 1NM5C 2QLNA 4KO4S 1A9SA 1X7HA 3OHSX 5K0GA 2WF8A 5HFNA 2NP7A 2E49A 3A3YA 1ESZA 4NRDA 4W99A 3KNZA 3TIGA 4W7IA 1KGDA 4N3AA 4GX0A 3RABA 1FFHA 3B9BA 1XTKA 1U8XX 3CRQA 4BUZA 4PVCA 1FA9A 4X71A 1C9EA 5JLJA 2H8KA 2R68A 3V1KA 2BDUA 5GJWC 4D9JA 2VWGA 3NQ41 2H2AA 3DZDA 4NOMA 4P3YA 4E6PA 5TQ0A 2AOWA 2ZCJA 1Q50A 5K6RA 3UMMA 1ISIA 1G6KA 3IILA 4LJ6A 4X84A 3T5MA 4EW3A 1NA5A 2X5KO 5BSTA 3OX1A 2XGJA 3OUZA 2PNJA 3LTNC 2F4NA 2ZYSA 1ZK0A 1GNPA 4P6VF 3ZX4A 2AG1A 2YBDA 3K5WA 5LXTA 1DC3A 2O19A 1MR3F 1XRRA 2IXGA 4BP8A 1LUAA 3ADDA 4HB4A 1ZN7A 2CYAA 1ZZEA 1CETA 1HZZA 2H9IA 1VHQA 7AT1A 2XZDA 2UYCA 3GDGA 4FIZA 3Q3VA 1ZA1A 2Y68A 3ZG6A 2V1UA 2HTFA 3DTYA 4DLAA 3TWOA 2G9NA 5C4MA 5CA1B 4CCAA 3AJRA 2RJOA 1PP4A 4DQLA 2Z5LA 2AKAB 1ITZA 2XV1A 4OIFA 2BWJA 2HQRA 4JS0A 2XWPA 3D6JA 4MR8B 4AP9A 4RA6B 2UYHA 3FNFA 4YALA 5LA6F 2CY0A 2FB9A 2FZEA 1J0CA 3HKCB 3ROGA 5M5BA 1QIEA 2OWDA 3TEFA 4F84A 1PSDA 4QT4A 3HBJA 5DSXA 3FTNA 1JG3A 4JBLA 2JGKA 1FU8A 2I80A 2MYTA 3JTEA 3WWZA 2ODTX 2D1QA 4UQOA 5M2QA 1FP6A 2C5LA 2I4MA 4J29A 4MGHA 4WGGA 4OA8A 5SZIA 1TCCA 5K9ZA 5FWXA 2NMVA 2OC9A 1UJMA 2CMGA 3FR8A 5B3AA 3RE1A 3O31A 4IJ5A 4P4TA 3SR3A 3SYKA 4CG3A 3L1IA 2N47A 3LBIA 3JWJA 3M82A 5J2TF 2BGGA 1DARA 1WOYA 2PUTA 4LPSA 1EFDN 1GGNA 3OFNA 1ZN2A 3H11B 4XSGA 4B73A 1EX7A 1R3DA 2FF5A 3U6KA 3FVTA 3TQTA 3EEIA 4FYXA 1W9MA 3DF7A 3N2IA 1FTYA 4HNVA 4NL4H 2ZYAA 3TZLA 4MYTA 2O2XA 2PKYX 3RAFC 2YZNA 1OZFA 1EVKA 2PEYA 2QRHA 3BAFA 4QDTA 1L8OA 2IU4A 2XR1A 1XLWA 3PR3A 4OM7A 4QJIA 4NBWA 4JBIA 4REOA 3SZMA 2OA0A 1FZQA 1H2RS 1CQJA 1ONNA 3B8HA 3QENA 3TH5A 4RFLA 5HOEA 1NXOA 4W9RA 3A8TA 5EJ6A 1IG0A 1AX9A 1LU9A 2R8YA 1IUOA 3L0IB 3THYB 3SZGA 1ABFA 4Q39A 5ALWA 4D57A 1L4LA 1ZMBA 3WQBA 5AM2A 1EE2A 2CK3D 3GMDA 4W1PA 3HGQA 4LMAA 2B4TO 1D4ZA 5I4CA 4S1WA 1K92A 1E2EA 4DJJA 2XD9A 3ZU6A 1H2YA 1N2IA 2OKCA 4TXHA 3L6DA 1PNTA 2GRAA 2X0IA 3QMPA 2R6R1 1VXOA 3ES9A 4G63A 1KEPA 1SKQA 1K5DA 1QZZA 3CO5A 3AFHA 5H68A 4B6GA 5FFFA 1KH2A 2X8JB 3L4SO 4MS3A 3W5VA 2FMHA 3DT9A 1ZUD1 4MIYA 1HDCA 1ZBQA 2J32A 2JBWA 4XPZA 4YXFA 2XAUA 3PXDA 5ALJA 5IAJA 3OJCA 1JHDA 5DWQA 1EYZA 1Z2NX 1WCIB 2GZDA 3U40A 1VP9A 2BV3A 1QYXA 3ADKA 2H57A 4N5NA 4ONEA 3WIEA 2CVQA 5GOTA 1LLQA 4FEGA 3WNQA 4LHSA 1O54A 5HM8A 3RANA 1U9CA 2MSNA 2UZ1A 2O5VA 5CVEA 5FOTA 5CPBA 2WKRA 3OKCA 2BEUB 1PQWA 5ED0A 4LFBB 1PK8A 2IODA 1PV2A 1UXHA 2ORVA 5EJ4A 2VJOA 2J87A 3JR7A 2P4UA 2FMXA 2J5XA 4EA8A 2B34A 4DCCA 2V7WA 2H2WA 3SEQA 1JLMA 3TW0A 2HWUA 1I0IA 2OL4A 2WHPA 1Z4MA 2XIQA 3AM5A 3W05A 4F92B 1DZ3A 2I7VA 2A33A 4O2LA 1HG0A 3H6GA 3GDWA 2SICE 4C5CA 5D86A 2GFQA 1UM8A 2O3TA 3OESA 4K9QA 1UAAA 3H5TA 3W3AD 1G3QA 1Z0UA 4BYGA 1M1YA 3LLUA 4IJWA 3TEMA 4H7FA 1ECBA 1M1YE 4PO9A 4Q7EA 4B74A 4P7KA 2WQ7A 4AICA 1CUFA 2BP7A 3JYPA 3UJHA 1D3AA 3FB4A 4UFOA 5EE0A 3T9AA 1VRVA 2FJPA 4E14A 2EZUA 3L04A 1Z7GA 2Q50A 2B8JA 2PFGA 2Y4NA 4M0MA 2WZQA 1SCUA 4GSYA 2QMZA 1KZYC 3K9LA 4I99A 1PL0A 4LDQA 5DI3B 3HA5A 3SKYA 3WDLA 4Z51A 4M7PA 4BRZA 4M3NA 3E70C 2ACKA 2R87A 3BA6A 3FLEA 3Q8XB 4OI0A 1YS1X 4S1OA 4FFLA 2G77B 2XA1A 1P8JA 4IUYA 3NPAA 1WUHS 4R9VA 1QE3A 4RGQA 3PWZA 3MTQA 4X65B 1PZXA 1VMKA 2WTNA 4B6RA 3ENQA 2VT6A 3C1TA 2J5BA 3UQZA 1K6MA 1G5TA 2MMGA 2ZZKA 4X6LA 4RD1A 4TTJA 4YMTA 1HE2A 4U5XA 1G3UA 2QTLA 2IYRA 3DT6A 3C87A 3CLKA 2OFFA 4L4RA 3KOOA 4JCCA 1XVUA 3PXAA 3FGPA 4TV9A 1NW4A 1FNNA 1V9LA 2B69A 2IXBA 1HE4A 3FI0A 2RHWA 3DOCA 3G68A 3B85A 3K2EA 4QM7A 4ZVRA 3W6UA 4D9MA 4OFZA 4P2BA 5D85A 4OJTA 3D0OA 2GZRA 5BYJA 4FCTA 3LRXA 1V3QE 2OHJA 1B1AA 1D2AA 2FI1A 3CNEA 3QHPA 5EWLA 3RRNA 3VR3D 3LYLA 4BBZA 1ZGBA 4YUVA 4OY3A 5FBWB 5LQKA 5JY1A 3C5HA 4TV8B 2PX5A 1LTKA 2IVZA 3LA6A 1VOTA 1MRZA 4PX3A 4ZQBA 5ERXA 1QHYA 3KLOA 3R5JA 1V7CA 3BPSA 3H2YA 5DBIA 5E6SB 2E6UX 3R76A 3T3DA 3ZI4A 1F8XA 5U1PA 1GGMA 3OURA 1WP4A 4YHBA 4F2WA 1PR1A 4ZI5A 3ZNPA 4JLWA 3GLUA 3UV6A 5F3RA 4X64B 2AJCA 3LX8A 3UOAB 2X1MA 4KWHA 2PKXA 4ZC8A 1EVJA 4ZALA 4FUQA 5KYNA 2QSJA 3GGJA 1EQAA 1XK7A 4JL8A 1I9GA 5LBIA 1TEVA 3U61B 3FKQA 4RXTA 1D2NA 3CUKA 1GPKA 2ZSHA 4GYYA 3R1IA 3QUTA 4YDQA 5C5CA 4L4YA 1YDHA 4MR9A 3ZW7A 4F9TA 1I5OA 1L5KA 2IELA 3I6MA 5FADA 3WL5A 5JROA 4FU0A 2KYRA 1JHUA 2Z5FA 2IYPA 4QGAA 1E6LA 1KK1A 1SVUA 2WSMA 4JBHA 3SYNA 4HTFA 5JSFA 1BJRE 2PXAA 4NZPA 1LLCA 2NT4A 1ZK1A 3H8SA 3N7TA 3D7NA 2NZ2A 4PQFA 1NKTA 1IUNA 3PXGA 4NXNB 4D4KA 3PBKA 4LQDA 1SPXA 2C5SA 1Y5LA 2VKQA 1D1QA 4KP7A 3VJKA 3R0ZA 4CM4B 4JR2A 4DPMA 4R2KA 4L85A 5K8JB 1CDDA 4IO1A 3LXRA 3R3UA 2WFZA 4DRYA 4C2TA 1BX0A 5FNVA 3NHBA 5FWAA 1J2YA 5I9BA 3PNLA 1NP7A 2GDZA 2QK4A 3I76A 2A3RA 3PE4A 4ZVUA 3EQ8A 5GIPE 1BRMA 1CV2A 2O4UX 1C0EA 1PLJA 4WXRA 4G8JA 1D2CA 1Q1GA 2P3OA 4Q02A 1JQBA 3DZBA 3RSZA 1SHZA 1W96A 3WX0A 4W8OA 2O3SA 5CH3A 4D8XA 2IH2A 3RHTA 1D5WA 4UBKA 2BCGY 5KNCD 2G5CA 1Q95A 1UMBA 3ZHRA 3IP3A 4UCFA 4AZSA 1N2JA 3I9V6 4DWWA 4Q47A 1LV8A 2AFIA 5ALZA 3RRXA 2QZZA 3VV2A 2AFIE 2CSUA 3ZWBA 3K94A 2P9HA 1ZA2A 3AGQA 3JYOA 3VO2A 4YRLA 5FV7A 1M54A 1JALA 1NQVA 1E4EA 2DVMA 3KD2A 2ZUTA 3T94A 5EZYF 3KQHA 4MUFA 2Q5HA 2VSFA 3KO8A 3QX9A 1YOVA 4HL6A 5EUQB 3UA4A 2V6JA 3TCKA 1QGUA 2BFFA 2D3WA 2EVWX 2D59A 3W1EA 3CURA 4KBGA 4KRXA 2HF8A 1KYZA 3IPAA 2G8LA 1DC7A 1DEXA 1RVV1 1UQUA 2VJMA 1AKWA 2YJTD 3AKDA 4R5MA 4QGGA 1U2DC 1CF4A 3Q6IA 4TM7A 4TYQA 4RANA 4ZCMA 4FFBA 3V97A 4J6FA 1KOLA 1PW7A 3A58B 2O2HA 4ETWA 3KB2A 3AG5A 5B6JA 2ZUSA 2O1SA 4AWXA 4OB8A 1I6LA 3T9FA 4RPGA 3JWIA 3JCZA 1QIHA 3AEKA 1K8XB 3UT5B 1MQAA 4J0QA 4A0GA 1G6Q1 1N9GA 3MEQA 3DBLB 3ZGNA 1RM5A 5DIZA 1PV1A 1TB4A 4NZ9A 4QDKA 2B1RA 1RPAA 4HCJA 5IF3A 2PX6A 3KR2A 3I5AA 4ZKEA 1KO5A 1LVGA 1K97A 4ZVLA 2HA7A 2ZRKA 4NJMB 5HCNA 4LKOA 1JTFA 4BX8A 1J9EA 4JJFA 2QUKA 3L7IA 1A8PA 3O1JC 3LF1A 2CNWD 2AD1A 2F8MA 1VI6A 4OUKX 4UFNA 4ZU6X 3C3MA 3OA0A 2MCFA 1N5RA 3JRWA 3QKWA 4F4FA 1Z25A 1CRPA 2REQB 3IOEA 2A0UA 5IBCA 2FZWA 3SJUA 2BJVA 4IIEA 4AO6A 1JG1A 1UFQA 1UP4A 5B6PA 5JO0A 4ZI2A 3OF5A 1QGED 2FKNA 1NR7A 2GGSA 3JS5A 4OH7A 3ST7A 4JQZA 4LVUA 4F6LA 4Q7QA 1K27A 3STWA 1XDZA 3UAYA 4YPOA 5HNKA 4KWEA 1SXHA 3UB3A 3OU7A 2PT6A 1E3JA 2V03A 3HPRA 4NENA 5GZ6A 4M7RA 1RMQA 2P1DA 4YRAA 4EARA 3MT8A 4IXDA 2SBTA 2ECKA 3EHDA 1R8YA 3RPEA 3EHEA 4UTRA 4F5EA 1E1KA 2Q2VA 3GLTA 3PRYA 1L4MA 1V9SA 2XY4A 1IEWA 4NNPA 1OKKA 2A9FA 2C2WA 3EC1A 1I0LA 2QUZA 3Q3CA 4GP7A 1OB2A 3A28A 4FWTA 3CX7A 1YTUA 2NZVG 5EKXA 1JR2A 3SJBA 4RPHA 3SS9X 1GKUB 1NL3A 2DUUA 3MNFA 5EFZA 1Z5ZA 1I4WA 1DP4A 1RIFA 3TM5A 1RS0A 2GPNA 4BRWA 3PT5A 2A4KA 1TYDE 3AV3A 2W2QA 3ZCQA 1N5OX 3ELYA 4DUPA 4B6OA 1CC1S 4MO9A 3WGNA 5JDIC 2RGEA 3M83A 4L8YA 3R44A 5AQEA 4JIGA 2BCEA 1QS0A 1GTVA 1SOUA 1JJIA 3E2PA 1G5RA 3MJVA 4WKBA 3GT0A 4NFYA 4MW7A 4CIYA 1GU7A 2NZUG 4CR8A 4WE3A 4PG5A 2H0RA 5KKAA 4YHHB 3MAGA 2WSSD 5G53C 5KWJA 1NNSA 1XEWY 5JYCA 4G0YA 1F8YA 4IAOA 4CRWB 2IKSA 3GN2A 3EG5A 5AW2A 2QGNA 5KOJA 5COQA 2LNDA 4DABA 2FPGB 4EHJA 2EU8A 1YFKA 2VJPA 3L7KA 1QKJA 3SSNA 3CGGA 2HJSA 5JAZA 1MQSA 3GFVA 1I2DA 2J9FA 4ANFA 1DJNA 2Q8NA 5CXQA 4DNQA 2QT0A 3X1DA 3T1QA 2WU1A 4B4UA 3X43A 4BX2A 3SG0A 2C8KA 2XE7A 4P80A 2PVPA 2R60A 3DLBA 3K2QA 1AXRA 4YH1A 3SIWA 1XXHA 1Q7BA 4PC7A 3TZBA 2Y92A 2ZS9A 2PUFA 3ZGOA 1WW8A 1XXHE 3CZRA 3JQGB 4LRWA 4UD2A 4UEWA 2FWRA 3TB4A 3VSEA 4F9GA 2OGUA 4E33A 3HQ4O 3A1EA 1YDGA 3QM1A 3E61A 1Y4UA 2ZG6A 3B9QA 3NUQA 1BXGB 1P3DA 1TKBA 2JCGA 2JKZA 3L9WA 4TXNA 4CF6A 2WUVA 1CJVC 5HR5A 1IXRC 1WVGA 2FFJA 3PTLA 1V96A 1ZNYA 1PL8A 3KB1A 1L6IA 4INOA 4JP8A 1A88A 4HVLA 3BMQB 3PE3A 4D9EA 3UXEA 4BLQA 1OMOA 2FPOA 3MCVA 2P1RA 3MRTA 1ADGA 1IK6A 4XJXA 2GM3A 4EK9A 2BI4A 3OMLA 4QUIA 4BMYA 4OIMA 1SUDA 2HGSA 1M0SA 1RYBA 1PUXA 2IEYA 3LCRA 5HFAA 2CEAA 2I7XA 3NHSA 4KFUA 2A0YA 4OOEA 2GEFA 3PFFA 2R751 5CU7A 3RVLA 2CL7X 1DRUA 3DAYA 1Q0TA 2QV0A 4DMGA 3FVWA 1R0RE 1SC3A 3ZWMA 1D1SA 4HDSB 2DSTA 3LX4A 6GPBA 3CB2A 1CUHA 3O6VA 2OR3A 4Z54A 1EHYA 1ODJA 2DULA 2JFWA 2XXBA 3KG2A 5JFOA 1BTOA 1F0NA 2CLMB 1V43A 3MWYW 4DLUA 3A6PC 2QTZA 2QYHA 4C4XA 3DQZA 3HVKA 3AILA 2Z09A 1QVWA 1OH7A 3O2SB 2JJQA 2VTKA 3DCNA 5M3BA 1DOHA 3ZU2A 5JRJA 3A27A 1NY5A 2LGJA 3KS9A 5F76A 4U2KA 1G5PA 4M6WA 1KBQA 1YT5A 3V42A 2QRGA 1MO5A 1L5NA 2P62A 3K6JA 1XZLA 5EMNA 1T1GA 3EOAI 2I29A 3PXEA 1WQ1R 3QWFA 4M9CA 4EW1A 1QH8B 1TGVA 3S8YA 1F2TA 1GLGA 2G04A 3GR6A 1DKUA 1E64A 3ONWA 4TT8A 1C1DB 2YR0A 3ZE8A 4EFDA 1IMJA 2VDVE 1EDZA 3HK2A 1F0KA 1AUOA 3IMEA 5LZ7A 1IJBA 5HM6A 4FYHA 2ZYGA 3TQOA 1JPUA 2X7HA 1RAHA 2D0IA 2FE4A 4RF2A 2H07A 4XCXA 3QPVA 5T41A 2JLWA 1NTRA 2NYRA 3ETCA 4JBWA 2W70A 4O4IA 3CLTD 3Q0EA 2RBKA 4L7VA 3E81A 4AU1A 2WDPA 3OD5A 4QOGA 3K5HA 4Q4LA 1IG3A 3EIHA 1JYFA 2OP0A 2VAVA 4ENRA 4B17A 2GF9A 1TM3E 4OLAA 5FA8A 4AKSA 4BFUA 3BJEA 1YQUA 4CEJB 2FXVA 4UM7A 4ZEMA 1RM4A 1X8KA 3F9CA 2PVCA 2JANA 3JALA 1PR4A 2IZ0A 3S1AB 2HOQA 3JQAD 4P4SB 4ACAA 5A2GA 5EERA 5F77A 2NYUA 1IZ9A 2FQQA 3ZX5A 4BEVA 4MUIA 2ZT6A 3RGGA 1ZOIA 1OHHD 1SU8A 4UHCA 3TSAA 4M4SA 1J23A 1KZ9A 2AN4A 4PN3A 2AG5A 4BQSA 4CDNA 5BNZA 2HB6A 2JLQA 4FD2A 2F3RA 4HNAA 3TIXB 4ALJA 5LXTF 2FSSA 1K89A 2FW0A 1JWLA 4WXHA 1T26A 1W49A 2BM9A 1BXRB 1CUEA 1I7NA 4RBNA 4EFNA 4EYGA 4H0FA 4Z9AA 1Z6YA 2P4HX 3I8XA 4H7DA 3UAGA 3HJCA 1A04A 2M98A 4UOQA 3SX2A 2P6PA 3P5BA 2MR5A 1UMKA 5KNBH 4H1UA 4KXXA 2XE8A 2Z43A 3A3KA 1D4OA 2ZT7A 3FLAA 2GA8A 1E7WA 3EAQA 4IZHA 3U48A 3OTQA 3FWPA 4DLBA 1KYXA 2NZJA 4H27A 4PSKA 1B8UA 1RC1A 2C92A 3L84A 4G8BA 1EU1A 5HJEA 2O2SA 2JW5A 1Q1ZA 1WKCA 4ITUA 4PPQA 4GRIA 4OHUA 4QYXA 1ZQ9A 5HMLA 5EJ2A 1K7XB 1VYVA 1S1CA 4MHSA 3PLAE 1WEKA 5AW8A 1EK2A 4FWBA 4M8SA 2VJDA 3E0XA 3V9PA 1JFLA 3L1JA 3O3CA 5J4VA 4HEQA 1R5OA 2CNKA 5KC9A 3HHPA 2XB4A 1VLVA 1GZSA 3AFNA 3N2YA 4YJ3F 5H0IA 3GK3A 4PG6A 4RS4A 1A7AA 2IYVA 2QLTA 2BFDA 2F17A 5DK4A 3ZZTA 1TZJA 4R5HA 2HJGA 2WJYA 2WJIA 5DGTA 3KTDA 1CY4A 1M1NA 2F7SA 1E3WA 4HGQA 4UMFA 5IJXA 1GUAA 2A0KA 3BULA 4BFCA 5B37A 5B3KA 1YZ3A 3D8TA 1Z17A 4UW9A 1YDWA 4WDQA 3M5DA 3C6XA 1OXMA 1DKQA 2DHEA 2GH1A 2J5QA 2V9PA 4V39A 2POCA 2VDOB 3EBLA 3FCXA 2PWPA 3NJRA 5AUOB 1MXFA 3I61A 3KLNA 2R8EA 3Q8LA 1K8ZB 1PZGA 7YASA 3HNOA 4NCJA 3W4JA 1FVHA 4WEQA 1EZ1A 4HGOA 5HF5A 3UCEA 3RTAA 3L07A 2D2IA 3EXHA 4RV5A 3EXEB 4A82A 3IIIA 3BK7A 2H1OA 2AJLI 1A76A 1LS6A 1EB8A 1M34B 1ZVQA 2BMDA 2FW6A 3WLLA 5HUHA 2J3HA 1I3NA 1U0BB 1SHUX 3CVJA 3PCTA 1ODKA 2G1KA 3H75A 5I7UA 2OV8A 4OQFA 1NSYA 1IBCA 2V98A 1Z6AA 3HDTA 9ATCA 1ESMA 2O7SA 4JUFA 1JDZA 2ZREA 1JEJA 2CDBA 4LFAB 4JLBA 4YNBA 1O0SA 4YS6A 5DM2A 3UKDA 4CNQA 5DX1A 1DC8A 2V59A 2PGXA 3QFTA 4L5AA 5EIXA 1IU9A 5DW0A 3ANSA 3OZXA 1G0NA 4FLEA 1NWCA 3OLYA 3BFPA 1IDOA 1WZEA 2FTKE 3TECE 5E6UA 4AX8A 4EL5A 1ABEA 1YR2A 2E3JA 3HDGA 4I8IA 1X7WA 3MWDA 3O0TA 1A4UA 4YI5A 2QMYA 4FBLA 4S12A 3C8HA 4BZPA 1QHGA 3HXTA 1JFRA 1V37A 2Q4TA 3D8BA 4ZYTA 1ADFA 2OHVA 4KLZA 5BR8B 1F1JA 2P7IA 3L1KA 2HCBA 4Q24A 4G5OA 4MULA 4RTSA 3F7NA 3GNLA 3H2GA 4ZREA 5LYJB 3EGOA 1LNZA 3FW1A 3I52A 3MOGA 3BMOA 3UJ8A 4EKGA 2RE8A 2IS2A 2NQ8A 2CLFB 2AEFA 4JJIA 4IFIA 3WLNA 4B4KA 4DXDA 1OH8A 2HPAA 3ZTYA 1V7PC 1R4AA 2BLNA 1E77A 2KHZA 4MO2A 3MMSA 4OA5A 1R2QA 3I01A 1E69A 5G3ZA 5C3UA 1BVRA 1G2PA 3ZZ0A 2HBQA 2JFVA 5LIRA 2GCNA 2DSNA 5FBLB 4DANA 1E1YA 3MJRA 4TSKA 1EVEA 3AUUA 1P2BA 2H4FA 3B48A 2BC9A 4UVDA 2QVYX 1ULHA 4V2UA 1CKEA 2Z6VA 1UBEA 4HDCA 3W3ZB 4F8EA 1XPOA 1T8WA 4EGFA 3UHFA 1SHJA 2W42A 4D4GA 2V0GA 1U7DA 3O5AA 4EY7A 4J6EA 4OOFA 2P9FA 5HIJA 4ZZ1A 2W5UA 1YOBA 3LC0A 2ZVDA 2C4WA 2RI1A 4IINA 2PK3A 4L51A 1XNJA 4QATA 5REQA 2BYTA 5T8KC 3SR4A 3OEHD 3ZNOA 1K75A 1R6VA 3MLBA 3NMUF 1O03A 5GWXA 5DSZA 2QAGC 4G25A 4HX9A 1R6BX 3GGSA 4TGLA 5JZBA 2NSYA 2QUBA 2A58A 4GLJA 4M8LA 4Z8XA 4IRXA 6YASA 1FRZA 1XCMA 5KNBA 1RVDA 2HA6A 4FHFA 4PLCA 2GT1A 2JFGA 3IAAA 3IC5A 3LYUA 2GAOA 1N7HA 5A4KA 4W5OA 3GRZA 4ZO4A 1U2RA 3UJ9A 3GLSA 3W9YA 2FSVC 4EHAA 4QUHA 4RSHA 1TEHA 2ID4A 5FEMA 3PICA 2DGDA 3D8SA 3TKAA 1TT5A 3I4LA 5FUWA 2C2GA 1XHLA 4TKVA 4ZJUA 4OD0A 3RB8A 2JC3A 4WZZA 1ODSA 2D2EA 5EP2A 5FHQA 2Z1NA 1DIGA 2R48A 4Z49A 3U0BA 5AW9A 2Q1WA 1AGPA 5I9MA 1P7CA 3LUHA 5EJFA 4URYR 4CL3A 4TV9F 5TX7A 1VJCA 3F97A 3U5TA 4C20A 1XDBA 4D1YA 4M60A 4I36A 4DSUA 3H5NA 3D8RA 4EVQA 3DV0B 1KZ1A 3GFSA 4I1IA 4TS3A 4Z7NB 2AMVA 8ABPA 3P9NA 2I7TA 3AKEA 4QTZA 3L8YA 1ORTA 3LFTA 2J31A 2C2OA 3NYWA 1Z83A 2QAIA 2ZIEA 3JR3A 2ZRQA 2WQZA 5BN1A 1KYIA 2C8VA 3EIEA 3K6SA 2WHXA 3A05A 4LE2A <