3NEAA

Crystal structure of peptidyl-trna hydrolase from francisella tularensis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
187
structure length
187
Chain Sequence
PKIKMIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNPKLNCNLAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHLGTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDIINYKLEPVMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Francisella tularensis peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 58
structure length 187
sequence length 187
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3neaA00
3TCNA 5IVPA 3P2JA 4FYJA 3TD2A 1RYMA 5B6JA 2NAFA 4QAJA 4FOTA 4OLJA 3V2IA 2Z2IA 4P7BA 3KJZA 4LWQA 4Z86A 4JWKA 5IMBA 1RYNA 4ZXPA 4FOPA 4QD3A 2LGJA 5EKTA 4FNOA 1RYBA 3OFVA 5IKEA 2PTHA 3KK0A 4JY7A 4HOYA 2JRCA 4JC4A 4IKOA 4DJJA 3TD6A 4QT4A 2MJLA 4DHWA 4YLYA 2Z2KA 2Z2JA 3NEAA 3VJRA 4ERXA 4JX9A 3TCKA 4QBKA
chains in the Genus database with same CATH superfamily
3JQDA 4O33A 3SR4A 5KNBH 3U3MA 2BT4A 3MZ0A 1DEOA 1TMKA 3GVPA 1SIBE 3O73A 2A94A 5JZOA 3OEWA 4FNAA 3OHPA 4N6GA 3WNBA 3FOZA 1APBA 2R1UA 2VJPA 3ANSA 1UKVY 1WZUA 1L3BA 4JT4A 2Q50A 1L5HA 1B93A 1PGOA 3RVMA 4DTCA 1HRKA 5JJBA 1D6JA 2P75A 2V45A 3N0VA 4LJ6A 1PO7A 3PA8A 3VX3A 3RFCA 1VXRA 3DPIA 3WVNA 4OATA 1AXRA 4N8EA 2O8BB 3PYXA 4BNWA 2P35A 4CKWB 1EIWA 3S44A 4IIYA 3RFUA 2DJ5A 3R77A 1J2EA 6NULA 4IRMA 2OHHA 1VTKA 4GI3A 4ZVRA 2OLEA 4AO8A 3I76A 1H66A 1W4BA 1PZGA 4E5KA 4ZGGA 5BNIA 3BOSA 1V2GA 2VKTA 1KVQA 1FSFA 3S28A 3QV1A 3VBEA 4WW0A 5DTQA 2HD4A 5ALWA 5JZ9A 2BE7A 2PSFA 3AGPA 4JZKA 1ZGCA 4TVSA 3ROQA 4ZCMA 5GV7A 4OHCA 2IP1A 3NBAA 1E4EA 3MJFA 1FQKA 4KYTA 1MDFA 2G6TA 2JH3A 2UYCA 1WCIA 4MPPA 1X87A 3CSDA 4PSVA 821PA 4W99A 1Q0PA 4MUNA 3PV0A 1JDUA 4FSHA 1J22A 3FCAA 1G3UA 3OQMA 2D1RA 4CE6A 4BEBA 4MXDA 4IYJA 1QV7A 5H68A 3QX7A 1KWGA 4ZN6A 1TMOA 4P3OA 3R76A 1MO5A 1T8RA 4R1PA 5GP1A 3AEKB 4LYGA 2A9RA 4IYRA 1R5BA 4QGHA 3WR5A 4AJ4A 5JEDA 3H5LA 4N03A 3UT0A 4BFTA 2WTAA 1DQZA 2VK4A 1NBIA 5IXJA 3IAFA 1GGNA 3UK1A 1V8FA 1O87A 5ALDA 4Z4IA 3WLAA 2Q2WA 3EMVA 4HNUA 4NEQA 1DLIA 1MOZA 3SM3A 5KSWB 1PKEA 2W2QA 1WD5A 4NL4H 3OQHA 3WAKA 1Q84A 2WWFA 3GFVA 5FL7D 2SKEA 2I2AA 3DAYA 4KIJA 4NR0A 5GM2A 3W7VA 3O2NA 3R5JA 4B75A 2PEZA 2Y2VA 4IXMA 2BKAA 3KFLA 5IKXA 4PGGA 3PNSA 5FOWA 4UUPA 4DMHA 1UWVA 4XGQA 5K8CA 2HXYA 3DLTA 5LQRA 1KBZA 4JBLA 4AUNA 3TGWA 1Z88A 3O84A 3KYIB 1LDYA 2QTTA 2WF8A 3I5YA 1T36A 1H3NA 1Y1SA 4MPTA 3DR3A 1TK2A 2RK4A 3AIKA 4O8ZA 7REQA 2GNAA 2PLRA 1IJKA 5AVTA 4V0MA 1JPNA 3RIYA 3SZGA 4ER7A 4IOKA 2GLTA 2YW9A 3LLUA 5DBHX 1LNQA 4YPOA 4QQ8A 3G0OA 2BRUC 1Z4PX 4DNFA 1ZHFA 2Q8NA 2WWHA 4N0DA 3CISA 4JJAA 1PNTA 1OVMA 2CL0X 2EX1A 1K2WA 2I8AA 3CNBA 1JBQA 2GAIA 3W79A 3I42A 2FN8A 3UG6A 1TD1A 2HJWA 4FONA 5I7HA 1MC5A 1ZUHA 5AW2A 4OMUA 1E1QA 1Q57A 1TX4B 1JR6A 5BNWA 1VHDA 2C3UA 2MSWA 3SHVA 1MIOB 2BTQA 2O23A 1NIJA 1V2HE 1GG5A 4HNAB 1ZD4A 2CVZA 1DBSA 3OIDA 4A26A 4AUMA 4EX6A 5I9IA 5IRCD 4KG7A 1X8XA 4O6VA 4ZJUA 4YI5A 3RUAA 4E4YA 3NDIA 4UHFA 5K3EA 3EUWA 3L18A 4EKGA 1MAWA 5TPZA 5LLTA 3V1YA 3VTFA 3KQKA 5JI2E 1L4HA 3BFPA 2UZAA 1AGNA 2EV9A 3GZJA 1UKBA 1K4MA 4KN8A 4YFVA 3V6MA 4QAJA 4FN4A 5F5XA 3TLEA 5GOTA 2QM0A 5CFOA 2RGUA 2IF2A 3I2FA 4FYVA 3O93A 2QR3A 2YN4A 1XZBA 1YVRA 4WI1A 1LSSA 4BZPA 1FVFA 4C2UA 1G291 3EGWA 1UPBA 5EJ5A 5J47A 4Y2GA 1L5RA 4FPXA 1GG9A 4G26A 5FA6A 5B2FA 3NHMA 4OI0A 3Q85A 2OV8A 4ZHQB 2PFSA 1SUBA 3GT4A 4NENB 3EVCA 5TNXA 3SN6A 1SOVA 3EZNA 5KKAA 1L7OA 2C5FA 2IXAA 2QORA 4BP3A 2XAAA 3BTVA 3GEBA 3ECCA 1YBHA 5FDFA 2GN6A 3HUUA 5FUVA 4BNTA 2QX7A 1ND6A 2QN6A 4U7HA 3UAVA 3HE3A 1Z2DA 1WW2A 3DDWA 4FCWA 4OBWA 2GA8A 2V03A 2EW8A 3CMMA 3R09A 4JCCA 2HL6A 4NU6A 3NHLA 4WZAB 3GLUA 3LWDA 1V5FA 3IMEA 5CLHA 3HJTA 3OMWA 4WY2A 3EK2A 1HDGO 1HRDA 3AESB 2XXBA 3MQ4A 1U94A 5DLYA 1GCIA 4Y1FA 2QN7A 3SZRA 2NU6A 4XVCA 4DSZA 1NUHA 2E1PA 2GRUA 2ZE6A 3VNAA 3MJCA 1SFRA 2Z3VA 3X2FA 3QFFA 2GXSA 5ENZA 4LXYA 4B45A 3H9EO 2P9ZA 2X14A 4J94A 3T5AA 3U16A 2X19A 3M6FA 4XIIA 2EP5A 2E6UX 1BKDR 2AVNA 3W04A 4LNUA 2W42A 4KGDA 3JQ7B 3D7NA 2IYLD 3F5MA 4K1LA 4MQ4A 3SK0A 3KSBC 1IYZA 3CN7A 1NBWB 4YS6A 2K6GA 1MJHA 4LX8A 5JYEA 1U1IA 4A1FA 4H1TA 2RONA 4BQNA 4CG1A 1JN0A 2FG7C 1LNZA 4E0BA 1BYUA 4I1RA 4NAHA 5F51A 1GKLA 1KO1A 2FR0A 4AIIA 4CHGA 4WKNA 5ETJA 4DN6A 4PHFA 5KYXA 3HV0A 3FMIA 1I2MA 4BNZA 4CM9D 1NRXA 1USWA 4YCSA 5G4KA 5L4SA 3A0UA 1E2GA 4DLZA 1KMHA 1Y7TA 4KPEC 2V55B 3ZWYA 1VKRA 2DQZA 5AVZA 2GR9A 5JJLA 4BFZA 2FWPA 3FOFC 2ASEA 5LP6C 4MVJE 3H5OA 1PN3A 5CJPA 3KTOA 2JFQA 3T0IA 1PS0A 5DHUA 5DK6A 5M3BA 2FDCA 3IMKA 2EQ5A 1NULA 1G7TA 2YRWA 2FEXA 3HWSA 1RE1A 2I55A 1VHJA 3B1JA 2HU5A 2ZRMA 3QPUA 3DO5A 1BVHA 2OCAA 4JYZA 3THOA 1YIOA 3AF4A 1P9LA 3G8AA 1EQUA 5T67A 1PFVA 4OP2A 2ZBEA 2I7XA 3W6UA 3M5CA 3NO4A 2HCRA 3BEOA 5HSGA 2H4ZA 1ODIA 3MWYW 1A27A 1EHCA 3JSXA 4M49A 1C1HA 1DG1G 4ETMA 3KYJB 1WY7A 1YVDA 4RVNA 4UE3S 5D01A 4X1IB 1DQRA 4DDVA 1GG8A 2JBWA 2FR1A 3S2GA 1KYQA 2C4VA 2V9ZA 3KYBA 1UIMA 1Z4LA 1RKVA 1T5DX 4IIUA 4NC9A 4NBLA 2JEOA 5BOVA 1FY2A 1QNLA 1Y3FE 1GD1O 2O5CA 4G5QA 2I9KA 3GT7A 2F3RA 2XZPA 3IA7A 1PZNA 4OLJA 1XDGA 3GLIE 3NHPA 3D3KA 4DA0A 2PZBA 3MLAA 2PO5A 1XAJA 1GFZA 5ELXA 1UBUS 1W8DA 5I9SA 3I4FA 1L5ZA 4NIMA 1L4NA 3FHJA 2W00A 4HQ0A 4JROA 3ZIDA 2FPSA 3SF8B 4AZSA 4BNGA 3O4RA 3NOOA 4HVLA 2HI0A 2VS1A 4BMVA 4L0DA 5JAIA 1PUXA 2QGNA 3KJGA 3P94A 2PAAA 3ABSB 2DY0A 3ICVA 3P2KA 4CF6A 2JGIA 3CG0A 5BMVB 1H6BA 3Q5GA 3GUYA 4KGZA 3F6CA 3KWLA 2X3UA 3JZAA 4TQGA 1WCIB 1YD7A 1TJ4A 2DUJA 2VSYA 3PKZA 1WU7A 1FQJA 2G9UA 3F5DA 5L3QB 3AEQB 4W8OA 1B7GO 3TLXA 1J56A 5HRAA 1JSRA 3ETGA 1M8KA 3WK9A 4BX8A 3HUFA 2OFXA 3G2HA 1EFAA 1E6MA 3RSSA 2PGNA 4OUDA 4BMCA 4MSUA 3P9PA 4QQRA 2PFKA 3AR4A 3FUWA 4FHCA 2H8GA 2Y8EA 2G9QA 1J5EB 2POCA 3JYPA 4P1ZA 2H16A 3HBAA 3L1KA 5EGNA 4BQQA 4F7DA 3ADCA 4IDEA 5IAAA 3EN0A 1Y9EA 4X71A 1RIFA 1PWHA 1ECLA 1XDUA 4XASA 4AYWA 1W85A 1DAKA 4MQUA 3QYAA 3LPAA 4C0SA 3G2LA 2ZYWX 5FUMA 1FSGA 2FG5A 3KJNA 4Y2YA 4BX3A 4LHEA 4R0NA 4L75A 3VPSA 2XQJA 5LQAA 3T34A 4CQNA 2KYRA 1ZVKA 4XWKA 1JJAA 2Q3BA 2AOXA 4ECEA 2NSLA 2GDZA 1K6JA 2B7LA 1U0BB 2AR9A 4F9GA 4X41A 4X66B 1WSBA 3HCEA 1IIRA 3I34X 3KBBA 3N8KA 4QDKA 2W11A 3OCCA 3SY8A 4C4AA 5AJVB 5LQDA 2A58A 1D8AA 3FZQA 4BZQA 4IRXA 2YASA 1JG4A 1XU9A 4PF1A 1UC4B 5EL0A 3M3DA 3VVBA 4U7JA 4F4DA 1M2WA 4GX5A 4AROA 4C0KA 2DXIA 1P7YA 3TIXB 1AMOA 5BYKA 2A0YA 3O8RA 5DX8A 1GP2A 1A77A 1JAIA 1XEWX 2RH5A 2E21A 1E0AA 4GMDA 4QEDA 4UZEA 4YI3A 5LP6B 5C52B 1L5FA 4CN8A 3RUPA 3RVSA 2FUKA 4HXEB 1K8XB 4M54A 5LA6F 3W2HA 3HSKA 1YU9A 3LX6A 3SLGA 5JH7B 2H65A 2V1XA 5TF4A 1L4FA 3HCPA 3CMCO 4UEJA 2P78A 3C70A 3G9ZA 4KE7A 5JCOC 2PD3A 5KTTA 3RWOA 1KI6A 4Q3DA 2X58A 3VSCA 3P96A 1YRLA 2MINA 1JIXA 3UC9A 5CDUA 1Q92A 2Q2OA 4OCZA 4EPXA 4B7UA 3EYWA 4JBGA 4N5DA 2C9MA 7AT1A 3BXOA 2A5GA 4NSNA 4RO0A 2QI9C 4FEYA 1E66A 2X23A 3C5CA 4RTRA 1ZMTA 4FUTA 4WK4B 2VPZA 4ZT3A 1M0EA 1TM4E 1D6MA 2GQ0A 4EG5A 3H2YA 1DV2A 3AEUA 5DMHA 3GYBA 1FEZA 3DC7A 1WSAA 3E5NA 5A9TA 1NZDA 2C2XA 3I01A 4UNSA 4BGUA 5LDHA 1ZUNB 5G1OA 4HRAA 1ZHHA 3R6LA 5GM1A 1SBQA 3VDNB 1DEXA 1W35A 1HFKA 1SOWA 4L72A 4TMVA 3SNHA 4XWOA 1EWTA 1UKAA 2VJMA 5TDHA 4OU5A 3V4RA 1NXOA 1JEJA 1W73A 1WAMA 1XUOA 2QAGB 3LYHA 4GNKA 2AG5A 3S55A 1B8NA 1RXCA 2OVBA 2XNHA 2Z04A 1Q3KA 4FCTA 4Z9FA 1LTHR 1EUYA 2BKLA 4LRYA 4AJHA 4E2XA 3GP3A 1IOWA 4XFDA 2X0FA 3TR5A 5A9SB 4GZ6A 3W5CA 4J0DA 3A37A 1A7UA 1C41A 1S8FA 3P9SA 1T1EA 2DPGA 5E9WA 1NNEA 2EKQA 2G83A 4CL3A 4ENUA 3E5MA 1BX1A 3H9JA 3URMA 5FX2A 2C3MA 4GL4A 4ZVPA 2BM9A 1YR7A 1AUPA 1VL1A 4PG5A 1E0KA 2YJ4A 1MX1A 3AL0C 1OBVA 2XD4A 5ELLA 1DIOB 1G21B 1II8A 3P2EA 2DLCX 3CRVA 2YXNA 4ZVVA 4FDUA 5E9JA 3RODA 2B1IA 3LQ2A 5GGXA 2AK2A 4IIEA 4DJ5X 5FAKA 3VC3A 4V0NA 5SZJA 1YF3A 3I39X 4Q02A 3S6JA 3DE5X 5KX5A 1L4YA 2CMGA 2RFLA 3ITNA 1G0OA 4MVWA 2H4HA 1KFKB 4PYOA 4I1SA 1EUCB 3OEHD 5HEKA 1KZ4A 1DARA 2H63A 1DAPA 3DDHA 1C3OA 2E4WA 5DNVA 5BT8A 5EKSA 3BD6A 2HBYA 3OWHA 1E5DA 3N05A 4I1IA 3ZX4A 4B43A 3FVTA 1E2JA 1V6AA 3WLMA 4R1SA 2BRUA 2HK9A 4ZZ1A 2HMVA 1EUCA 1E62A 3L1HA 4FD2A 3JALA 2VR1A 1VI2A 2GM3A 2X42A 1PJLA 2JGAA 3LX8A 4UHBA 3ROXA 4A16A 5JSZB 1YRYE 4LYFA 1Y5RA 4MKFA 1NR1A 3I4LA 3UMGA 5D3KA 3DMDA 1OGJA 1OE0A 3VISA 4JLNA 2EFEB 3OTIA 1LRJA 4ON9A 2P9TA 3TW6A 3HC7A 4YXFA 1EBFA 1V7ZA 1CF4A 1BCSA 1PWZA 4XGKA 2HZBA 5TGDA 1EXMA 3FBTA 4BECA 5IVPA 1SA0B 1CTQA 2HHLA 3A6JA 3EE6A 4DBVO 4UUNA 1DPGA 2B21A 3C48A 1GLVA 5J58A 3CF4A 3K0CC 4QXRA 4RD6A 2ZI7A 3EA4A 3CZMA 3GJQA 3W77A 4XM2A 3E9MA 2WJ6A 1IB0A 3UOAB 3BICA 2F1KA 3RRYA 4EUFA 4ENQA 4H7PA 4PCAA 2CK3D 3PCRB 3KB2A 1WKVA 2VH5R 4GAEA 3T5BA 2H9YA 2QJFA 5LL6P 1GLGA 2Z2XA 3SS8A 3QZUA 4L5JA 2EAUA 2YXBA 2OGSA 1Z0FA 3RV3A 1FYFA 4PLTA 3SBDA 2BMDA 3SLRA 1QHEA 3D2AA 4GDFA 4P2BA 4ZMSA 1TPYA 3WBJA 4MW0A 1TVKA 3DULA 3AIIA 1ZS9A 5CXQA 1H93A 2WSIA 2C7OA 1M66A 4PHCA 1RADA 1YJ5A 1I24A 1N2IA 1W9MA 3DONA 1Y63A 1O97D 3N2IA 5KSPA 1GVHA 2MIIA 2WD7A 3B5JA 3E7XA 4FGWA 4FYYA 4XRRA 2YWBA 3DBLB 4KYVA 2IL1A 3AI3A 4L6IA 4ZHQF 3LRPA 4MVJH 3P9YA 4NMXB 3AJ8A 4QOHA 2EFHB 3NTQA 4H1UA 3JYOA 3GGOA 2O7VA 4QO7A 4OM8A 3TLYA 4BX0A 1U0TA 1AKYA 4PG4A 5FTLA 5LQMA 4IUYA 1OMOA 5JSKA 5AUNB 2QK4A 4MKGA 4MRMB 1PZHA 1XRRA 1DJOA 2I1WA 3QWIA 5JVDA 2WJ4A 5IM4A 3BFJA 3HB1A 4IJQA 3K6RA 1YUMA 1L5VA 4MVJF 4RK4A 1QOQB 4PRKA 1NPTO 2OXCA 4IJMA 3O7MA 3DMFA 3IVAA 3N75A 4JFAA 4D5GA 1VSBA 4ZPXA 2H52A 5JVDB 2V58A 2BGUA 2ZI9A 1PR9A 4HX5A 4NDAA 4B09A 1G38A 4G0UA 1JSXA 2QRGA 3UJCA 2ZQZA 3VU0A 1JHDA 1LDGA 1PR2A 4L5AA 3R7DA 2UDPA 3U17A 1YC2A 2H11A 1EEXB 1Y7LA 2XWQA 3E8MA 3U31A 5KREA 1E2PA 1PIWA 1J09A 3BK1A 3DUWA 4UD2A 3STYA 4JT8A 4HVAA 1L7PA 3MJTA 3GOHA 4IHJB 1I6WA 3WRWA 3FUXA 3ZIAD 5F52A 1X38A 4BVGA 1Z7WA 1GGKA 2EFGA 3EXIA 1TYEB 3GFQA 4MI6A 4XR4A 5BN5A 1U6JA 5SYMA 3U7HB 5JPIA 1G1MA 2OBYA 4ZANA 2J45A 1FP4B 1CUHA 1YU6A 2I6FA 3LOPA 3LW8A 3M0EA 1PJSA 4Z4GA 5LQUA 2FZEA 3HADA 4XGIA 4HRVA 4D0RA 2XIJA 1UM9B 1XSEA 1FX0B 4MJ7A 3GLKA 4J75A 5A3QA 2WM9B 4MEBA 4WY5A 2H51A 4IQ4A 2HK8A 2I7CA 2QRLA 5E1OA 3AUTA 3HJFA 3IMCA 2BFMA 2R47A 4KLAA 4FGKA 4K9RA 4OFXA 2GDJA 5K3SA 1V3QE 4K05A 4DIBA 4F4CA 2XA9A 2RGWA 2ZU6A 4MVJD 1D2AA 2AR7A 4RIEA 1ZGJA 3O21A 4G1BA 1A8QA 2P11A 5EESA 4PC7A 3LGAA 4OMDA 2JFZA 4FE3A 2DWQA 2D2FA 3KZNA 4NE9A 1O5TA 1JSCA 3LHDA 1RKBA 4N5NA 4PYKA 1PEKE 1P4RA 1ES9A 3HLTA 4RDHA 3AEZA 3TXYA 2WA1A 1CJCA 4OEHA 2NOAA 2RGNC 3OG9A 3MT8A 2J0SA 4GMHA 3H13A 1FX1A 1PHRA 3LTEA 3P4YA 3V4LA 4XVRA 5HKBA 3GFBA 1W6RA 1KI7A 3E7PA 1JV2B 3GVXA 3P9NA 3PIDA 4IX1A 3VAZA 2H4YA 4HGPA 5BSHA 1JQJC 4I1VA 2OCKA 4X6LA 1GZ7A 5DTEA 1ZNXA 2ZI5A 4B7CA 3JQBC 3O1IC 3DL7A 2YHSA 1K7EB 3P0FA 4C7VA 4OP1A 1S3FA 3CC8A 4QDOA 1JP7A 2V7QD 1HMPA 1AG9A 2A5LA 4PTLA 5BOSB 2RB4A 3LBFA 1TJPB 2YMQA 3IX7A 3UJBA 4C3ZA 3WA7A 2O8FA 1H2BA 3AHDA 3OQVA 5FTWA 4AKTA 3VHQA 4EHBA 4W9MC 4DG9A 1F38A 2H59A 4BRZA 4GMXA 2QM8A 1YOBA 4RHUA 3VC1A 1EDOA 5D85A 3PXCX 4QDTA 4GS5A 3TLCA 1THTA 2L0XA 1FXSA 4A0FA 2HWWA 4AO6A 5DHQA 2IPXA 3HDGA 2JEYA 2XW6A 4UCQA 2OORA 4N9WA 4YB8A 2DFNA 4WNYA 2BYTA 2BFFB 2PT6A 1P45A 3M3HA 4LE1A 2KBFA 4UPEA 5EIAA 3VAYA 3DV2A 1ZXXA 3PC8A 4LTNA 1E2EA 1G8KA 2X40A 4INAA 3LWBA 4I1YA 4DJDC 3V3KA 2FMKA 1R0CA 3ER9A 4AJKA 1C0LA 2FMXA 3NZEA 1SCUA 5DHRA 4F3KA 1XTTA 1VMIA 4ZCTA 4ZRNA 4FYKA 5KPJA 4ZI7F 1G20E 4GLOA 4KXXA 1YJAA 1E1LA 1X70A 2H9IA 3A3OA 5LR6A 3VNBA 3Q9LA 2WAAA 3VAAA 5BR7A 5ALVA 1FDSA 5KBYA 3ZJTA 3D81A 3UAGA 3V1TC 3AEUB 4BAGA 3KXPA 1V1JA 1VLLA 3B2NA 4PZYA 5EWJA 3STXA 5C1OA 2WJIA 4G1CA 2NN3C 4CEHB 4LY9A 1NY6A 3L7DA 1CRLA 1ENYA 1LJUA 1SXQA 4WKPA 5KX5F 2P2ZA 3C4QA 3DW3X 3EG9A 4GC9A 3ND9A 4OHBA 4HDQB 5CYFA 3NYIA 2D0PB 3UHAA 3G7UA 1SVLA 1P81A 5JFOA 1G64A 4GKJB 1ZIPA 3ONNA 3H3JA 4TLMB 4A6EA 3KR2A 2CV0A 1DRJA 5B3LA 3OQNA 4ZO8A 4IRUB 1PSWA 4TYWA 1T9GR 3Q3HA 4BMNA 1JLHA 2WIDA 2VH2A 4ODIA 4CU5A 3SEFA 1Y48E 2QRZA 3FMVA 3LVRE 1XEXA 3O74A 3SHTA 5DP2A 4OGGA 4NJOA 1ZPDA 3T4PA 2OUKA 4EZBA 2W93A 2WMDA 4EYQA 3F78A 2EFDB 4FMDF 1Y82A 3DE6X 2BHTA 3DFUA 3DMTA 1FFAA 1NONA 3DL2A 1EWKA 4PGHA 2DFLA 1DKPA 5ES4B 4HZUA 1WD7A 1KFCB 1H6DA 1UEXC 3NWBA 1FRNA 4I4NA 4MV5A 4D8UA 5LBTA 2G5GX 1NUPA 4RPKA 4NOMA 3WQRA 5JZVA 2R6GA 2ERYA 1R4MA 1LTKA 3REQA 1DRUA 2AVDA 2GNOA 1EE1A 3I2YX 3ME5A 2JEZA 4GI7A 3X2SA 2XZOA 2GTHA 4PQFA 3JQEA 4RGYA 1YQQA 1ISIA 3FRHA 3LM8A 4HTAA 3I05A 4J7CA 2PV0A 4P7JA 5CYPA 4AW9A 1EZ4A 4UAVA 3N8IA 4A0HA 1RU3A 2W2VA 5AUPB 4FDMA 2ZRDA 2NADA 3PEVA 4XI9A 1Y8ZA 4LJRA 3ESXA 4KDRA 4FI3F 2P2CA 3BIWA 4MWZA 4NJEA 1BCRB 1UINA 4IEIA 5DMXA 3QG1A 1K7SN 4RA6A 3P9RA 3WI7A 2YZKA 4KCGA 2WYWA 3CA8A 3WDMA 4E03A 1C3OB 5CDHA 2QD1A 2VJLA 3NVMB 4HP8A 5CVVA 2AE1A 5LDGA 4G6ZA 2XQGA 4IHJF 1NPDA 3RVLA 3OIWA 1TCBA 3ZHOA 2Y66A 1UDWA 5CDYA 1IIBA 4IG9A 4TSFD 2LIPA 1B6RA 3EIQA 1B16A 1Z4OA 2A1TS 3FPBA 1P1BA 3SIXA 3N0XA 3VO9A 4MGEA 1M54A 1YZ3A 4DLYA 4BVJA 3TQIA 1F9EA 2AF3C 1X7ZA 1K5HA 2B94A 4J91A 3X1XA 3L7CA 3P5SA 4RBNA 2G8NA 4WOJA 4KR9A 2ZRAA 3IURA 1MTZA 3OIUA 2YFYA 2PRJA 4N41A 1VRCA 5A5GA 1WVIA 3DNMA 3JQ8A 5BVHB 5LD2C 4E5NA 1CY8A 4MWTA 3BGDA 1I5RA 3BIXA 3CJTA 3CLTD 1MA3A 2DLDA 4AJOA 1E61A 5SY6A 1DGQA 4E33A 1BIFA 1J2TA 1NV8A 3C3BA 3HWRA 3B70A 1ZHOA 2WMNB 3FSGA 1FTQA 3H1PA 3OIVA 3IIJA 4KO4S 4PC6A 4KRGA 1UFQA 3H0KA 1ZH2A 2FDXA 3VKGA 2XAUA 3GRKA 3G9TA 3REGA 2W9XA 4Y1EA 5LA6B 3ZCTA 1NR5A 3B20A 5FOUA 1SOMA 3T3PB 1GUBA 3C1UA 1TTHA 4F1JA 1NUUA 3NBYC 4IXDA 5BWCA 2CW5A 3QELA 1Y5IA 2LCIA 3EVNA 3NVDA 3BMNA 4NAUA 3OM9A 1C3VA 1GY8A 1FTYA 1N6IA 1E6WA 2MSKA 1ZINA 3S5JA 3RB8A 3U0VA 3LC7O 3GELA 4WGFA 4X3CA 4AN4A 5JHGB 2ODQA 2DUNA 3H17A 4CYMA 1U0GA 3ZXUB 1ENPA 4BCBA 4WE3A 1UC9A 4NH0A 4CMJA 1E4EB 1BROA 1R9GA 4CIDA 2DC1A 1GZSA 2JKVA 4P4NA 1BH2A 5KYUA 2BFDA 2AZDA 2Q3EA 2DMRA 3RE1A 2FPOA 5L4LA 3IO5A 2D1SA 3E9DA 3ANYB 2GCEA 2R00A 5CK5A 2VHQA 3V33A 2CZGA 4ZMBA 3B1FA 1RWBA 3FNGA 3QQ5A 1CUCA 1Z5OA 3VZRA 3CU5A 1XL1A 2PKQP 3ONEA 2AXPA 2VAPA 4IKEA 3C85A 3OJOA 4PSKA 3ZQKA 4UTVA 1YA6A 2M6RA 3FMOB 2C29D 3SR0A 2VSNA 4H1HA 1CUWA 2G5TA 4IVRA 4MV0A 4KXFB 1OA1A 1Z4JA 2BUCA 1ZN8A 1AO3A 5HQ3A 3KLMX 2OGUA 3Q7TA 1WW3A 4MV3A 3RIGA 3TZ6A 4XVQA 4AJPA 2IGTA 3L40A 4C6HA 1NJ1A 3OKCA 3AFGA 1RNLA 1X1RA 3PPXA 4FE4A 3LWZA 3CEAA 4DLAA 5EXPA 4ZT2A 2P1DA 4Q7MB 3FNHA 4KHZA 1YMVA 2AQ8A 3E9EA 1EK2A 2CXOA 5M29A 2YOFA 1C4XA 5AI5A 5E38A 5NULA 2WYHA 2HADA 4ZEVA 1O6ZA 1VE7A 1Z56C 4ZEXA 3LG2A 1A7KA 3LYUA 1DU4A 1IM5A 1QS0A 4PWZA 5E3HA 2ZVPX 3LY7A 3WLJA 4LF9B 3I04M 5FULA 3M4NA 1XNHA 2X41A 4X6UA 5KOHA 3C1TA 1XMOB 3Q7IA 4HCJA 4IDPA 4FFBB 4P5DA 2XOEA 3TQHA 1XD8A 1MG0A 3MEQA 4YIKA 4B2LA 4Q1CA 1WXIA 4PAOA 2G1UA 3DP7A 2WRZA 3T7TA 5KTPA 3TBKA 5TS2A 2PZFA 3H9CA 3R4CA 4REQB 3HCBA 4KDEA 3WMGA 4IDDA 1VG9B 2ZIWB 4PBSA 3VI4B 1CVRA 2YY5A 1IHYA 1AS0A 4C87A 3RJMA 2JIZD 3RYHB 2VCEA 4RGQA 3OLZA 1SG0A 3WNVA 4CM3A 3Q8WA 5K0GA 3KPJA 1N32B 3BREA 4LBYA 4INZA 5JSQA 1E1QD 4NCXA 3CIOA 4GQIA 1QGDA 2EEPA 1LSJA 2HJ9A 1ZI6A 1T6NA 4MW4A 2IHYA 3I9V1 1RWPA 5TEWA 1U81A 1XMJA 2R5FA 5JZBA 4ZOLB 3QNWA 4UNPA 5L7YA 3D6JA 3OT5A 4L4XA 3VJKA 4ALLA 4BC0A 3ZLTA 1T6YA 4JKOA 4X92A 3THWB 2UUAB 2W2MA 2JI7A 3QUCA 4KO2S 2XB2A 3IERA 5EWJB 2GN1A 4PIMA 2V3WA 2AE2A 4E09A 3KKKA 3D3JA 4PCUA 2IYOA 2NSYA 2XYHA 1FFCA 5CH8A 4X64B 5SZHB 2CXNA 2WG2A 3JQ9C 4QE3A 1DHTA 1PFUA 1AKRA 2P8JA 3MLEA 5BSRA 2J87A 3GRAA 2LGJA 1NW6A 3HR8A 2IV3A 2V6FA 3SXJA 1CWUA 5HQTA 2JARA 5J5CA 4JBYA 3E8XA 3LVFO 2G80A 4DSNA 3FVQA 3EZFA 3F9RA 3MWDB 5F5NA 1OBOA 3HP1A 3JATB 1H8HD 1NHWA 1NJFA 1UBLS 3B3QA 3QXSA 4G0ZA 5F98A 1X77A 2BGGA 3OETA 1H0RA 2NZXA 3GBVA 4L2IB 3LXXA 1OWLA 3D3EA 1DJQA 2IUSA 2P3SA 2AXNA 4J6EA 3TIIA 2XY4A 3QEAZ 4LWZA 3IBFA 5KQLA 3PG5A 1D2HA 1PEAA 1NW9B 3GHYA 3ICOA 1BJKA 2CL7X 3AESA 4UW9A 3T4EA 5LBUA 4XUEA 2WV9A 5JNWA 2FMFA 2WIFA 4WUVA 4Y9DA 3C3JA 3F3KA 4MGHA 2EJTA 3K0AB 4L51A 2O3JA 4Q6BA 4S0XA 3FFWA 3BCHA 4RD4A 1H2YA 3BQNB 1DJNA 4JKYA 4LKRA 3GLHE 4MW9A 2J3EA 2A1UA 2MR5A 3FGNA 1X9HA 2AT1A 2CFOA 3TLKA 2XUPA 4PZ9A 1TCVA 1Z33A 5IANA 4MAFA 3B36A 1NG1A 1TZCA 5G3ZA 3DF9A 4RA6B 2IEBA 2QE7A 2BGLA 4P8RA 1S1MA 3G2MA 1QP8A 4RPCA 4IP0A 4DSUA 3CSSA 1PR1A 4DGQA 2HCTA 2ZG6A 3QLJA 1EWRA 4WTOA 4ZO9A 4BMXA 4H9GA 5BUQA 4Y7CA 1NN3A 2Q07A 2VP4A 4JVMA 2Y0BA 3DXXA 3QVTA 1PNOA 2EJUA 1M5UA 1PF7E 4NICA 3CCBA 4OGFA 1JG3A 4UM9D 4MUIA 4XJSA 2PS1A 3JZDA 2GBPA 3NHWA 1M76A 2YIDA 3OJCA 3T61A 2W6OA 4WEQA 3S2FA 1XB2A 1PV4A 2OHGA 3WBKA 1U7HA 4A4DA 4P80A 2PTHA 2Q9BA 2LVBA 2Y76A 1E4OA 1P1JA 2VHWA 5D3ZA 4E1AA 4ZV4A 1CVLA 1M2NA 4E3ZA 2PX5A 1KDPA 2RGXA 1H23A 1AMUA 1Q7BA 1VPWA 4Q7KA 2PUFA 4D74A 2WSMA 3N59A 1C0KA 4IVNA 1SKMA 2H3EA 3JQAA 2J30A 2POQX 1YSCA 2HGZA 3B12A 4ARIA 1N1DA 3ILSA 3RSZA 2GPJA 3A4IA 3I23A 3UK6A 1SCBA 5AK6A 3WGTA 3A28A 5B1YA 3NDRA 3UQYS 1G8AA 2WJ3A 3N8NA 3GQVA 4RJ2A 4RY2A 2GF9A 2O0KA 3RASA 5JARA 4O08A 1T5BA 4YMIA 1NKSA 1BAPA 1USGA 2WUFA 2YR0A 1SVSA 4FR0A 5EJAA 4I1UA 4ND2A 4QYTA 1FP7A 2D5CA 5DF1A 3ADBA 4PIVA 2DP4E 2JFHA 5CYOA 4O0MA 1Y6QA 1T0BA 1OC4A 3DB2A 3OKPA 4GUAA 3TS1A 5BMVF 4YAJA 4EBFA 1B8OA 3LXUX 4KODA 4WNAB 4BX2A 1MZPA 1GGEA 3G2QA 5FBQB 2ECOA 1E3DA 1E1DA 1H8ED 2NVUA 3CURA 4IDGA 1QU2A 3MGBA 2TMYA 2ZJ2A 4MICA 1XJWA 3OEHA 5MFZA 4UTOA 3AI2A 5F2KA 4P4SB 4RZ3A 2O6HA 3Q7RA 1MIHA 5DHAA 4R9SA 4OP3A 3VPBA 1SB8A 2OCYC 2GHQA 5COQA 2A78A 4RS3A 3IQZA 4JJFA 4CM5A 1JHAA 1U28A 2FXVA 1LXCA 1T4GA 3UGTA 3OWXA 5CURA 1DAMA 1UK7A 2P9EA 4D9MA 1S9DA 1JBKA 2H92A 2UVDA 2VT2A 1X8LA 1V5IA 3ZIUA 1MOSA 1X13A 2H00A 4R3WA 1V8PA 2ZK7A 4MV9A 4OH1A 4X60A 2VUSA 5BSMA 2H2FA 2VYND 3Q5DA 2IHJA 5HPYB 1JAYA 4PO1A 4RNDB 4FLMA 3L6DA 1I33A 1B8PA 1XZKA 1HTTA 2Z57A 1PR5A 4UC0A 2H5JA 1ZMRA 3Q6NA 1B74A 2RKOA 3EXIB 1W49A 4FFPA 4NG4A 1NKTA 1X92A 4IMJB 3A2KA 2ZBFA 5JY1A 1MF7A 2J3KA 4L28A 3W8NA 3BTUA 5AICA 1RLIA 3MWGA 2DY1A 2J6HA 4CR8A 1MRNA 4JSRA 5EJGA 3GLQA 5GZ6A 3H16A 2BFEA 1YS2X 3V8QA 3NP9A 3R3SA 4WZBA 5D86A 3U1VA 3KXIA 3CRQA 4U1RA 3U4CA 2LBPA 2ALJA 3MTBA 1O0SA 1CJMA 3U5TA 3GDHA 2XUDA 2LDBA 1OREA 4O4JF 1DO8A 4RKWA 4OHOA 1W581 3DLAA 3NKVA 4BN5A 1A2KC 4MARA 4IG4A 3EHDA 2QRNA 3R2JA 1E7MA 4TRJA 5J2TA 1F8GA 1PLKA 3L82B 1HR0B 1XMQB 3SZMA 1AQ6A 4FXPA 2Q49A 3BFKA 4QBIA 4NYIR 4L1KA 2O52A 3HDVA 1DDIA 4WKCA 1Q7TA 5D2CA 2GO7A 2Z5LA 4TT8A 5K3DA 2VEDA 4AKSA 4AS2A 3HVKA 3TPCA 3DZBA 3Q7EA 2HBRA 3S8EA 4RTSA 9LDBA 3R9XB 3G59A 4DF3A 1YHZA 2GPBA 1VKJA 3GT0A 4PN3A 1K98A 4QNNA 1XAHA 3N3AC 4XXHA 1H9CA 1E3LA 1P1IA 4XTCS 2CVPA 2FEAA 2Q1TA 3A3NA 3FDXA 1ZJYA 5KYVA 3WRYA 4ML3A 1NATA 2WB4A 4DIKA 1WEKA 4R1QA 5JNLA 1EXVA 4NV1A 3TEJA 1C29B 4BDTA 4K88A 4OUKX 5BV1A 2RHCA 4DCCA 1FFYA 5FPKA 2I3BA 1FE8A 2D5IA 3ES9A 4BNMA 4PFQA 5KDLA 1JRLA 5EIFA 3W3AD 2R44A 1Z26A 4IEFB 4TKUA 4CV2A 4RHCA 1R74A 2J1LA 2O1SA 4EM6A 3IRUA 1EVEA 4B3GA 1WOYA 1YB4A 2VRBA 4NZNA 4EH1A 3EIFA 1AGYA 4MVCA 3B9QA 1JVSA 1TKAA 4WOKA 3TZQA 2G67A 4OJTA 5IAOA 2QW1A 2HJRA 5ALJA 4WZAA 1WVMA 1XMPA 3E1KA 3GDOA 3OX3A 4LNAA 1NQAO 1JKJB 4PY2A 5DXFA 2IEDA 3TD2A 3DMPA 1E9SA 1ZEJA 4LJYA 2N3ZA 2PY6A 2IFTA 2XYPA 3D7MA 3L8GA 2DT5A 3DXYA 1WTCA 4CT5A 1TRKA 1RS0A 2ZRIA 3EDMA 5K4GA 2EGGA 2NT4A 1PYGA 3HYNA 2BI7A 3JQ9A 3O94A 2R00C 5ALXA 1USUA 1N5OX 4P32A 4U2EA 1SBZA 3DOIA 4BQEA 3EDYA 1XJQA 1X9IA 2E4UA 3EY4A 3AXSA 1IATA 3HCOA 3L0BA 4KFSA 3ABZA 4C04A 5CVJA 3MJHA 4P4GA 1PNQA 1N0WA 4RENA 3BGIA 1K27A 2B4AA 1REQA 3G6WA 3JR7A 4KAAA 1RLTA 3H3XA 3Q7SA 5ALMA 5DWDA 1Y9JA 3IE1A 4ZYUA 1EFHA 1LX6A 3PJRA 1G5HA 2YJ3A 1C7EA 2Q3MA 3U3KA 1PSZA 5J9FA 4BYMA 2P9CA 4I4IA 3QA9A 1UPCA 3KT8A 5F77A 3CX6A 1RYYA 3IDAA 4MV6A 4ANFA 4D45A 1UAGA 1IE3A 2VPQA 5KNCA 3O6VA 4D6XA 2WUVA 1FLAA 2ZBRA 3CHYA 2IOYA 3MTQA 1Z4IA 2CSXA 2NP7A 2IV2X 3PCXA 4AZTA 4ARBA 1DIAA 4LOAA 1N4AA 3JYQA 2XZDA 1XP5A 4E5PA 3PHHA 3WTBA 2C5LA 4KI7A 2FW6A 1C14A 3ELDA 4RTMA 3MXOA 1LLQA 5A7GA 5FPPA 2PGAA 4JJZA 4LYDA 3P0EA 2MCFA 4LRUA 3BB3A 3P1JA 3NHAA 1OFHA 3ODPA 2ZJ7A 3PQ3A 1DS6A 3OP1A 2WHEA 2QMEA 4XA8A 1VE9A 4OYLA 3TOZA 3KR9A 4CETA 3VR4H 2O0MA 3M6MD 4DLTA 1JILA 1IM8A 2IYVA 2CNOA 2PT9A 4JGGA 4QOIA 2YN2A 1DT3A 1DO2A 3MS4A 3OTGA 4IOMA 3FTEA 5FR2A 1YJQA 4X24A 3COZA 2GBCA 2RBGA 3UPUA 2OKGA 3QY9A 1KC3A 4X1YA 1CP2A 5H70A 2V9CA 4RF3A 4MW7A 4LISA 3VUFA 4EMSA 2OZPA 2QAGC 3IXMA 4BC1A 2BEVA 2XWBF 5FFNA 4BU1A 5CIYA 3UJ7A 4UJ5A 3RD5A 2WIBA 5AVXA 2OFWA 2ATVA 3C1AA 1P31A 3KE8A 5ALLA 4BNVA 5JMWA 1I94B 3SE7A 5FWYA 5AJUA 1DWQA 4TYPA 5BV2P 3CNLA 3BWYA 3FRJA 2VA8A 5I8ZA 1SHLA 4Q6WA 2A9JA 4GVPA 2CB9A 2V6JA 3R5HA 4MPRA 4ZYZA 5DOVA 2XSZA 4L8GA 4YWHA 2H3HA 5LWQA 2Q5LA 3ILVA 4AY6A 1UBHS 2X0JA 2ECKA 1P2FA 3MSCA 2C2MA 4DQ0A 2X22A 4GE0A 5EIOA 4ARZA 5ANRB 3E22A 3I0NA 4U3JB 5L40A 3IQHX 1TQHA 1U3VA 1SXJD 1X74A 1C9MA 1K0UA 1B2RA 2ST1A 3H1AA 4TXNA 5AD1A 2HREA 2Z2JA 3MUFA 1KDTA 3G2OA 3OY2A 4AJIA 1P2TA 1G98A 2FSFA 3SSOA 1Q74A 2QZSA 2H4WA 4C06A 1Z2PX 3GPCA 5EJ2A 1KF0A 3VDRA 5I4IA 4GEKA 2CF5A 3ZCPA 4BNYA 1WCYA 3NGXA 2R5WA 3N2LA 4KWHA 1X2EA 3H2GA 1UBKS 4ND6A 2V7PA 2C0PA 2J6IA 3E6AA 3FTNA 2YZMA 2HPZA 4ZQIA 5B7NA 1PD0A 2ZIXA 4OREX 3RVNA 2PBRA 4XLLA 4A6PA 3VVLA 4C14A 5JS2A 1WXFA 1W1WA 3PFIA 5H9WA 1E99A 1PEYA 3NEPX 2DPLA 4NBSA 4BKUA 3CF2A 1W85B 4DWJA 4DR6B 2XUGA 2IBMA 2QPTA 4EMTA 3C6XA 3LZ6A 2VPPA 1UEJA 3AQ4A 4WCFB 3PWTA 1JMVA 1N0UA 1A71A 5HDQA 4EKNB 1M0WA 1JB9A 1TO1E 1P0QA 4M9XA 5CVTA 1T3LA 3T7DA 1MJGA 1SQFA 5EHZA 1PJBA 1FTWA 4KI0A 4C7OA 4XLTA 3N86A 2J48A 2WG1A 2YDYA 2ZI3A 3RIMA 2ON6A 1DPFA 4LWQA 1BGVA 2NYRA 3B3JA 1JEQB 4RZIA 3VSEA 2B2NA 2F3UA 2PBLA 4YASA 3V2UA 3JW8A 5IDVA 1PFYA 4QYSA 2PUWA 4JI8B 5L3QA 4G86A 2GAAA 3CR3C 3GK3A 4BNHA 4BEWA 3IMFA 3IBGA 5CYGA 3HO1A 1O03A 3N7TA 2EYQA 1QHNA 1T4CB 4U39A 4KIWA 3SYTA 1G41A 2ARKA 3VSBA 4N18A 3W9UA 4YYZA 1E6CA 1NXSA 1U5AA 2R7LA 4RPIA 1TCAA 3FHLA 1XVVA 1OZHA 4BJ5A 4EHIA 5FF9A 1JA9A 3HFGA 2V3VA 2PX8A 3T5GA 3FYTA 3GFPA 2GB4A 5JU6A 2VJBA 4JLMA 1GDHA 1DKNA 1TKCA 2Y1LA 3LC1O 2D8MA 5FEUA 1K6XA 2ZQYA 1T0UA 3KB8A 4M9RA 3T5MA 5C1IA 3DVAB 3O5AA 3GRYA 1TVEA 1M2GA 1U99A 3CNOA 4ID3A 3TLBA 4GNRA 2JATA 2VHYA 3WMWA 5IBCA 1M8FA 3DKVA 3UGJA 4EG3A 2QIOA 4PHTA 1I36A 1VA4A 2I71A 5JISA 2ZUUA 1N6PA 2O3RA 3HEBA 4ZDIA 4R0MA 1IHUA 4GMGA 1XGKA 3QWHA 4P08A 2J6BA 3EIUA 3DBRB 4M9ZA 1JQEA 3D7LA 1ZNYA 2W98A 2EFYA 4IO0A 4DIMA 1K3TA 1V26A 2IRWA 5E1BA 1VZ3A 1P39A 5C8VA 1JAZA 3ZGYA 1HURA 4NU8X 1M1XB 3AMVA 5TQ2A 3H4TA 3W5UA 3R24A 1GZHB 3OZXA 4PZAA 3KQOA 1AQNA 3EJ6A 1H4TA 3FG9A 4OQZA 5K1ZA 3N0RA 5TS3A 1ZOIA 4YPVA 2XBUA 5A7FA 5AVYA 2P4EA 5CNJA 5AM4A 4EEXA 1I13A 3ZCUA 1Z12A 2HFJA 2HSWA 5DE3A 1VKNA 4PLYA 1O0BA 3X1MA 2PNFA 3CUWA 1NF8A 2KM1A 4CQJA 4I8DA 1C8KA 2JLRA 2XUKA 2O07A 3NX4A 4N4AA 3CH5A 4OHMA 3N74A 4RJIA 1N92A 3ISTA 4B8WA 3MCAA 4YALA 1FCJA 4CM8A 4AP5A 4EG8A 4NYJR 2IPNA 4GYWA 1YRQA 3KR1A 3TNLA 1HQYE 5CW1A 4O0LA 1NBAA 4FHEA 1T6ZA 4D9BA 1Y3HA 4W9NC 4ZEMA 3H0CA 1HF3A 3PEYA 3OE1A 4LN1A 2MT9A 2M9MA 1GFWA 3D8SA 4Q9DA 3C74A 1OYWA 4BHTA 1D0IA 1PT9A 5KJEA 3H1TA 3D5EA 4FS8A 3AERB 5MDHA 4AJLA 1QVZA 2NTEA 4GR4A 4YMLA 2X4DA 2BBWA 4CTMA 3WGHA 1S8NA 5CP8A 2PX6A 1JLMA 3KNZA 5JCPA 5TF0A 4M0PA 2PZJA 4DSTA 3I9V6 1E77A 5A6VA 5HM8A 3MUNA 2J0UB 3I2HA 1KP3A 5EYPB 3VHXB 4P3NA 4HPJB 2W2PA 3E61A 3LV8A 5KEIA 4YAKA 2F8MA 4TVOA 1YFZA 4MIOA 5IN5A 2BW0A 1D09A 2O06A 4QXPA 1Y80A 1AUQA 3PPYA 4MYHA 4PRZA 3TD9A 1CJSA 4GDMA 3WMXA 2C57A 1DQPA 3AP2A 5DP1A 5A4KA 1TUIA 2QENA 2QJOA 3A14A 3L8DA 2VJYA 4I6GA 5HQJA 1RBZA 3V8NA 4F97A 1QF7A 4RXMA 4B87A 1T1RA 1D6SA 1RJGA 2PIAA 1EJ6A 1PT7A 1MJGM 2QG6A 3FFTA 4L8FA 2GRAA 3K0HA 4YJKA 5F3RA 3FPEA 1LBHA 3SKVA 2EKDA 1ULHA 3CPHA 3NIWA 4NK4A 4Q1EA 3KEQA 3PC4A 3ANTA 5JAZA 1Y7IA 1R18A 2QQEA 3ENZA 2IYXA 4RABA 2FUG6 3LT2A 3QMMA 4WGGA 3VVMA 1D1QA 1J8VA 1XD2A 2DAPA 2I76A 4L15A 4BV8A 1O9GA 3PQ5A 4I66A 2FA9A 4LV6A 2H5LA 2ZU0C 1JDBB 1NJSA 3C6ZA 4JJIA 3HJHA 4W5OA 1YA4A 2X1VA 3A31A 5THKA 1KYIA 3GROA 2WD8A 3E22B 4PXSA 4U3JA 1WMFA 2WZQA 1TI7A 4WLUA 2JAOA 1K66A 3VPCA 2FPKA 3TTTA 1FNBA 4URYR 3PC2A 1RMYA 2ADMA 3LQQA 4KAFA 3L8CA 4Q9HA 1OI4A 2XTNA 4PC1A 3ZW8A 1PBNA 4N82A 3BN3A 3DDUA 1ZRSA 3OO0A 3I6QA 3WNZA 4EELA 3M2PA 1TZBA 3AFIA 2G5PA 4Q19A 4C08A 1I4WA 2NYUA 2ZAOA 3IJ5A 4EG0A 2AKEA 5HJ7A 1Z5VA 4N0MA 3U13A 1GITA 4M1KA 8OHMA 1CFJA 2NWQA 5KDDA 3S1SA 4I2VA 5EKDA 2PJDA 3P8ZA 3GAMA 1RQRA 1GPAA 4IGAA 1QRTA 3J81A 1RYDA 4HDAA 4PIPA 4EO7A 4AY3A 5HGJA 2G17A 4YRZA 3DTVB 4J0KA 1YONA 4MULA 5LQNA 4PW0A 1FXWF 1IAVA 1PVDA 3W9YA 3KWFA 4CKBA 1S1CA 2J41A 1E5XA 4X85A 1CF9A 2FSVC 1JA0A 1XQ1A 1YVEI 4HAIA 3GCGA 4IPTA 4O3MA 3MBIA 4IHKA 3ELBA 3L4BA 2EQAA 2X15A 4Z9BA 1PL0A 4NZYA 5TMDA 2L19A 1B43A 4QU0A 4CDGA 4KUGA 3NHJA 4AC9A 4P33A 4CU2A 5ARBA 1L7EA 2ZULA 3KPVA 4PZUA 3G88A 1QOPB 4QO8A 1M7GA 4AMBA 5JDIC 3ENQA 4EHAA 2QX4A 1SPXA 4MGZR 2VTDA 3IVGA 1G9TA 4MVJA 5JNSA 4HEQA 5EJ4A 3PNOA 3P4UA 4WZBB 2BH9A 2OECA 5IUJC 3IP6A 3QXHA 3LPLA 1T34A 4EVRA 3MYYA 3ZWXA 4RZXA 1PUIA 4UFPA 1AF4A 1V96A 4G24A 2ZP1A 3OP4A 3W5AA 2Q7OE 2PL5A 1MC1A 5CG2A 1YK0A 2R8PA 4AG3A 5IDXA 2J0EA 4JLKA 2OOKA 5H82A 3ZDDA 1T1SA 4HDRA 2J4FA 3P2OA 2EATA 5H83A 2P0YA 5K3FA 3VNVA 4RKYA 3M5PA 4XDZA 3RYFA 2Z6VA 2WJJA 2FMHA 1JFVA 3EQ8A 2JVJA 2YRFA 3Q15C 1KE2A 1B00A 4DUPA 5BSGA 3AUYA 3FHOA 2UYHA 3NAZA 1XNJA 4L5YA 1O95A 4UM7A 4ZI5A 2VQDA 1SXIA 4GW3A 4WZZA 4YCMA 2BHSA 4JLSA 4U63A 3KL2A 4K6MA 4JI2B 1DNPA 1NFRA 5EWLB 2YHUA 3PNVA 3ECAA 4FDTA 3UV6A 3VYSB 3CVUA 4FGUA 2OFFA 4OHKA 1KJ9A 5LPNA 2VO1A 2XT9A 2BFBB 4RM2A 2JAWA 1KBQA 2QLTA 2ZB8A 2PMCA 3CNEA 4MR7B 1D5WA 1XRSB 2Q4EA 2BLNA 3ZUGA 2O4CA 4Z2YA 3R3VA 1TA0A 1V6CA 1A9QA 1HL7A 3NKLA 3DDNA 1IDOA 2QW0X 1GPNA 1K88A 2WWVD 4F2DA 1N7JA 1W5EA 5ICFA 1CY4A 1JR3E 1Y34E 2QRPA 4U2FA 5TXGA 3HEAA 3RKRA 4AG5A 4F46A 3DA8A 3K0SA 4CJXA 1QTQA 2ZITA 3DE3X 3W0LB 4JHLA 2W4IA 4B9AA 1Y8CA 4JYMA 5LLSA 2WD9A 2ORVA 2P2YA 2HYDA 4XQCA 3TX6A 4I0WB 3FDIA 2AWOA 1OXKB 2H5EA 1ZK0A 4KLZA 4O4HB 3RS7A 1Z39A 3TXAA 1CLUA 4EMBA 1YJBA 1OZ0A 1YDFA 2TSYB 3E7DA 2QMOA 3C5EA 3NIGB 1EFUA 1A5ZA 1V7QA 1P0CA 3OLYA 3AEXA 3F5SA 3OQIB 4JBXA 4L5CA 2C7RA 5BVGA 3MTEA 4JQCA 2BZ0A 1VHQA 4DQLA 5KINB 2NNWB 3DH0A 1IBCA 1V6SA 2R25B 3TIGA 5HIAA 1T4CA 3ABOB 4KOEC 4QPNA 1XK6A 2EL7A 3AM4A 1RJWA 3A9UA 3D9QX 3I61A 3KVOA 4ZVNA 1TJ5A 4DVJA 5HYVA 5BN3B 1FMJA 1DL5A 4DCOA 3PQDA 2XUOA 3GH3A 1QYWA 1T9CA 4M0DA 2WFLB 5CA0F 4EJMA 3DP9A 1SMKA 1E1MA 1Y5NA 1UBOS 3M82A 1ISJA 1HI9A 5DBFA 4URHA 2RHHA 1DJMA 3AHCA 3NR2A 4ZXPA 1KO8A 5JZSA 4OLAA 2OC9A 1ZI9A 1J8DA 2XUAA 4FKBA 1NVMB 3OHSX 1VLHA 3ZPXA 5C37A 5J4HA 3WBBA 4OJNA 4D3XA 1JDVA 4ND8A 3TQSA 2I67A 3HCAA 1OPRA 1PW5A 1Q7CA 2OV4A 3A9TA 2AQKA 2IELA 3WMEA 1EZ1A 2GN9A 3M6UA 3I5UA 4G2TA 4WOCA 3R6GA 5C0OE 3ZDRA 2Q1WA 3BHJA 4B35A 4B3BA 3BMOB 2GKGA 2J9GA 1XZLA 4OL9A 1Z36A 5JJ5A 4IIDA 5P21A 3DD5A 3THYA 4URZR 4RLSA 4DQUA 2UZ1B 1M1NB 1T2EA 3T15A 4CXMA 4HGYA 2V8OA 1T1GA 4P6VF 1Q7RA 4N5IX 4KR7A 1UJ2A 3V4OA 2QYSA 3WIUA 4NENA 3HXTA 3WGGA 1XCOA 2A1IA 2YV4A 5G2OA 5EE3A 2AA3A 3Q87B 4MLCA 1Q17A 3FXAA 1PI3A 3KSAC 2IS4A 4LXUA 1YBVA 1KP9A 1YL5A 3FGPA 4KPGA 4XWAA 3ZW9A 4FBMA 1KDYA 3OEEA 3R75A 3SZ3A 5DT2A 5EMKA 2OD7A 3SQOA 3TQCA 2Y0DA 1ZCAA 3ASUA 3E5HA 3KDAA 4R2XA 1TTTA 1WZ2A 2IIPA 2J5QA 3KFXA 2E2WA 4KXLA 4PLPA 3LPDA 1N36B 4Y3UA 3JY6A 3LCVB 4QFBA 4B7AA 3OUTA 3HVUA 1O7JA 4FW8A 4PC2A 3I12A 2QROA 4P3PA 4HGNA 5KCMA 4OF4A 3IDFA 4ND7A 3PPWA 3WMRA 3OM0A 4KZPA 4YDRA 4E11A 1LUAA 3BWXA 3GVCA 4FI3C 5IKMA 3U56A 4G0WA 4CCSA 4WLOA 2N9UA 2FEWB 1Z0JA 4I4LA 1N9GA 2J9XB 1DUIA 1UXHA 2KQUA 3LFUA 1ORVA 4JP3A 5DGTA 3TG2A 3LVQE 4GIBA 3TE6A 4YP6A 4QDJA 1PSDA 1NNUA 2G4CA 1IDN1 4MRRA 4IXTA 4AJ2A 2A0KA 1JIKA 5E7JA 3JS5A 5CAEA 3KOYA 3L06A 3CPSA 4GRIA 3D4OA 4HRXA 5TPWA 3RVKA 3UUFA 2IBTA 5JH7F 4GR9A 4Q16A 2VDLB 2HTFA 5A0FA 5IJWA 3ENNA 4E30A 1YRHA 1XA4A 3ZHCA 5CFPA 2XNDA 1HLFA 2V74B 3CUKA 3F90A 3W2FA 3ZV4A 1UP6A 5P8WA 3UHFA 1HE5A 5EG5A 2CGEA 4H3SA 1FYXA 3F7MA 2QVYX 3GJXC 4X1KB 3L7LA 5H59A 4D3DA 5JJKA 1ZWKA 1LLCA 2QP4A 4QBGB 1EVZA 5AI9A 1CJKC 1Y37A 1N3YA 2ZR0A 3L8HA 4MVJG 1WA5A 2ZJAA 4BEVA 1RRCA 2WEKA 2ZS8A 5PNTA 1R66A 1QH9A 4PSCA 5K6AA 4U2BA 4P82A 1XKLA 3B53X 3DG9A 1OBHA 6YASA 2P7HA 5JROA 3C8MA 4HZUB 5BN4A 3UJHA 2A4MA 2FF7A 1CY2A 1E8DA 3IOEA 3KTDA 4YQFA 2Y92A 2EOAA 3AR6A 4HAVA 1C8VB 3KOXA 4CM6A 5EXDA 1KR2A 1HLDA 3RTCA 3I3OA 3PF8A 4FFDA 5B4VA 2DOKA 4JEMA 1UM8A 4M0CA 2DPHA 3HY3A 5AOAA 4ZODA 1Y5LA 1KMMA 2Q9UA 3HJCA 3VUEA 3QUAA 4LJ7A 5K6RA 4UVHA 2A2ZA 3KQMA 4YRKA 5DNYB 5DTRA 1CC1S 3I6ZA 3LCUA 4PXAA 1NAHA 2GF2A 3OFNA 2E9SA 4FX2A 2QZPA 5BW6B 4GWKA 2QIPA 2Q7XA 3R5FA 3RF6A 4D9NA 2GD1O 3MUEA 1Z5NA 2P65A 3EXFA 2YWDA 4J16C 3ZWKA 721PA 5IG2A 4LF5B 1R4MB 1IM2A 2NSDA 1XMVA 1OJ7A 3TD6A 3CR7A 2W43A 4IKPA 5K09A 4KBFA 4QTTB 2QTVA 4K3VA 4RGVA 4BVBA 3VJRA 4PQRA 5A4JA 4EY5A 1MD9A 1WNTA 1VLZA 5JWHA 1KPHA 1QB8A 2QT1A 4XDGA 3QLUA 2VXYA 1ZC3A 4NS4A 1EH5A 2RGNA 4A1OA 3H5IA 4QECA 4KW7A 5EHXA 4HWRA 4OLFA 3LZCA 3VDMA 3ZKAA 5LXTA 1UWLA 2VDKB 1Y42X 2GA9A 2ZJBA 1RM3A 3T4XA 4MW6A 5AM1A 2ZGVA 3JR3A 3NW9A 2QUKA 2JIMA 2CXQA 3DQZA 3WWCA 1RHRA 1T3ZA 2HBZA 3AVWA 3QSYA 2P3LA 3H2IA 3R6WA 1GNPA 4B2IA 8ABPA 4UMEA 4UPVA 2Y93A 3OPQA 4HBGA 4M76B 1GLNA 2A67A 1R0XA 4M98A 2JBHA 3GZ4A 2FWIA 5A03A 4TM8A 5KKCA 2HZ7A 2D74A 2LR0A 3H1BA 3CCCA 1SZCA 2ADOA 2H29A 1G21E 1N75A 5AUQA 3MN1A 1HNNA 3HDTA 1Z5ZA 5DBGA 1E63A 4MQFA 3RJ9A 4W5TA 4XPIA 4IO1A 3FTFA 2H31A 2JL1A 2XUIA 1F14A 1ZL0A 3I3SR 5ALRA 2W2XA 2OAQ1 1GSHA 2NPOA 3CXUA 1O8CA 1T36B 3DDSA 1P1HA 4PE5B 4HT3B 3OQPA 3RUCA 1QM5A 2XSZD 4Y2TA 1QIHA 1A3CA 4Q3EA 1WXXA 2CLCX 1FS6A 1GZVA 3FKSA 3E0QA 4PAGA 1S4QA 3KP1A 5KYTA 4GM1A 5B30A 2VWPA 2PXCA 3O92A 4Y6RA 2CDBA 1N7GA 4EARA 1R3DA 1U0JA 3GJ6A 1AZLA 4BE7B 4EGCB 3L4KA 3I4CA 5HX7A 3WZMA 1FRQA 1LV8A 3JVDA 2I3GA 1W4ZA 4FVTA 2ODNA 2XLCA 5T4HA 5JBNA 3F6PA 2ZAGA 4W8GA 1WP4A 3QK7A 2WVAA 1B8UA 3DBVO 3HN7A 1YR2A 4UMDA 1V4VA 4BP9A 4K9OA 3S1AA 2KBEA 2VYVD 1PL6A 1CR0A 1EGVB 3VR4A 4R6XA 3AEKA 4AY2A 5DYYA 3WGUA 4DDWA 3MG9A 5C1PA 5LMNB 1BEUB 4REMA 2AYYA 1D2NA 3KUDA 3EVBA 5TV2A 2Q9CA 4QUBA 4X97A 5CDFA 1K7CA 2Q5QA 1LBEA 3KJQA 3B6EA 5HILA 4NG5A 1JEAA 1M34B 1O3YA 3U4QB 3KPYA 1Q1GA 2WP8J 4WN9A 5F3WB 5JIBA 2BBSA 5B36A 5K4HA 4DAEA 1M33A 3IQFA 2D2IA 3P32A 4XM1A 1YKGA 1R9NA 4Q4LA 1E3WA 4C0QC 1SXJC 1ISPA 1WUTA 3K70C 5AVWA 1YVUA 1PE0A 4M1OA 3ZY5A 1ETUA 4HEJA 5TEVA 3VV2A 1YCDA 1HEUA 1PR6A 2BMEA 3QOXA 2X9GA 4A7PA 1NP6A 1TUBB 3WO0A 2Y1GA 1KKMA 2XDQB 5IN4A 1OV6A 1HETA 1P2SA 3EFEA 4Q7EA 5JNTA 1RWKA 5K8LA 4HFJA 1LI7A 4ZVTA 4PRLA 4Y6LA 1G6KA 2HDNB 2X9QA 4II7A 4UAUA 1YZHA 3L6OO 3UW3A 4EFLA 4CI9A 2Q1XA 4ZT4A 3E15A 5EGSA 2P9JA 4Q9IA 4HC4A 3RT7A 2PUBA 1OYYA 3F3MA 2FLWA 3Q0TA 2A9OA 5DASA 4YXWA 3IKMB 1DVRA 4B3JA 1E60A 3ZWVA 1OI3A 4QASA 3CPJB 1IRIA 1U1EA 3KD2A 4KQWA 3K9WA 1N2BA 4P7FA 5TR9A 3PD1A 3PDHA 2X5JO 1Z68A 1ZJ5A 1DBQA 1E2KA 4HQKA 4Z4CA 4B82A 1VKOA 2F64A 4CMIB 4QGAA 1QVVA 3LYAA 4P54A 5EYPA 3PC8C 3NXKA 1Z18A 3VHXA 4DLNA 1WBBA 4BFXA 1YR1A 1XWIA 2RHMA 3LT4A 4UFNA 1K89A 2XTZA 2XRMA 4LSWA 1JXAA 2C2HA 4OD0A 2RB5A 3HU1A 2FQQA 4O02B 3WA6A 5BWBA 1EKXA 1JG2A 2QLFA 5JWOA 1NOJA 1C4KA 3BE8A 3G0CA 4UJ3A 3IP7A 3V7UA 1BOOA 3ZXXA 4AVYA 1IJFA 3J81k 4ZD6A 1NP3A 2GEKA 5L7WA 3E58A 2H0RA 2PJZA 2QRUA 4AZWA 1ZO8A 3N5CA 2OYSA 4FN5A 4Y2VA 1EQAA 1KEPA 2ZRKA 3MWEB 4ZALA 1NBMD 3DZHA 2WJWA 4MJLA 2A30A 4QATA 2GSWA 4XIJA 1M1UA 2ZWIA 1ORWA 1H2HA 1A1VA 3N2ZB 2PDAA 3NWPA 1E8MA 4GP9A 3HXQA 4AYXA 1NMEA 3AOEA 1ORRA 4QSMA 1R3UA 4B8ZA 4FOLA 5KJCA 5LYJB 4RL4A 5E6SA 4MDEA 1WXWA 2EFCB 2P91A 2VEOA 1E3MA 1DCFA 3JAKB 3NS7A 2VXOA 1TEHA 2X77A 4UVGA 2X6TA 3HG7A 3C14C 1CRQA 3WHPA 5K0LA 4JB2A 1YL7A 4OAPA 3EIOA 5CT8A 3QKRB 3R7WA 1OAKA 5FO1A 2BFWA 5LKRA 3ZLUA 2ID7A 5B6JA 1ESNA 4IHQA 1Z6ZA 3OZSA 1W4LA 5C46F 4WQMA 2GGSA 4IR7A 2VJAA 1ZM2A 1SVNA 1H6AA 2Y1XA 3CS3A 3PE3A 5LU8A 5HP4A 2Q9AA 3THXB 3HPRA 1LRLA 1RYNA 2VIIA 1WMSA 5EIWA 1U3GA 5DYWA 1WM1A 3WL5A 4JLAA 4WACA 2NO5A 3ABRB 2RJNA 4HNVA 4DYHA 1TYBE 1TD9A 1XRMA 1ZGAA 1QKIA 2ZREA 3HSYA 3M1IA 3N0WA 4HUJA 2WNIA 5KVVA 3HHEA 4OBXA 1U8EA 3EVTA 5KB3A 2HNAA 2B36A 5CAEB 3RTGA 3R3XA 1C9DB 1GO2A 3AUJB 3CLVA 2BEWB 1PQWA 3P9QA 4QUHA 2BKXA 3GFOA 3I2JA 4S2EA 5F5LA 2XWJI 3AINA 4U9IS 3T7KA 5IKOA 3ZWOA 2QLLA 4LNUB 4UDOA 1CT9A 2H1FA 3PB3A 4LGCA 2PXHA 2WF5A 1DADA 4G8CA 4I99A 4TWRA 2V7TA 2XA1A 2RHJA 2VNSA 1N34B 4N0PA 3LBYA 1WDTA 2VQEB 4CG3A 1ZUWA 1C8LA 2RCYA 1GQOA 4XOUA 3NKFA 2Z5FA 2H54A 1HXHA 4YCNA 3K9QO 3QPBA 5I4CA 2JK1A 4U7GA 1UAYA 1T5SA 2ID8A 1ABEA 3EAQA 3QBTA 4CLRA 5KYXB 2Z58A 2ZXEA 2FHPA 3L77A 3IUSA 4OQPA 3PIRA 2AD1A 5KTOA 2ZFUA 2CJPA 3GBPA 3V3TA 1Z75A 4ZVLA 3ADPA 3Q2KA 1JSLA 1GQQA 1GNTA 1MX5A 1LJLA 2AI1A 2LDXA 2NZ2A 2ZIXB 3L02A 4JLBA 4ROTA 3HCCA 3AU8A 3TTXA 4DLLA 4R54A 3BJIC 4N3CA 3HKCB 1O54A 3LF1A 2JKYA 1VBMA 2OHVA 3NGLA 4GUDA 3DEHA 4HYQA 3UXHA 3INNA 3OKFA 1SU7A 2PSDA 3H9UA 2Z09A 3K3PA 1FFWA 2LTAA 3OT1B 3ETEA 1OFGA 2O3QA 3IJPA 4QBFA 1C3EA 3E9NA 1F60A 2XVMA 5EPOA 1A97A 3TSYA 2DBZA 3ZZMA 1IVYA 3OAAA 4F4FA 3ZWMA 4MV4A 2JGMA 4V0LA 2XDWA 2W6IA 3TL2A 3BMQB 4RY0A 1GAWA 5ED0A 1H8HA 4ZPJA 3RADC 4G0VA 3NBMA 4G0MA 5A1TA 2F1HA 1DSSG 1SKQA 4U0KA 3ZG6A 4NS1A 1GSOA 1AJEA 1XP8A 1NC1A 1SEVA 4HLCA 2ZAMA 2QMQA 1RXEA 2C5SA 4EA8A 4XYLA 3HJGA 2CV2A 1I0IA 3IJEB 2B9EA 2JVKA 3F7OA 1RKXA 4MNTA 3DZJA 4LXQA 1EM6A 1OIWA 4DAOA 1M8PA 2E0IA 2NU9A 2C7QA 3SHWA 5AXCA 1XTZA 5DZSA 3TSAA 5M34A 1JWLA 4ZWNA 4P5PA 5CA0A 2C95A 3FCEA 1EHIA 1WB6A 4QX6A 4TRNA 1OQAA 1NU8A 2ZRNA 4A9AA 1X86B 1U1GA 1A88A 3ILYA 4Q4AB 4F2PA 1FBTA 1H1LA 1Z62A 3GWZA 3IUEA 4QG3A 6ADHA 1IY8A 1VE6A 2P9HA 4FP9A 3ZQ4A 4DTIA 5JSUA 2IU6A 1X39A 2AB0A 2NTYC 2O3UA 3ETHA 3ER8A 3E9RA 3K0EA 4JITA 1UDAA 1P1RA 3U9TA 2J9FA 2C1XA 3U60B 2GEBA 1NW3A 2I1LA 4QOEA 4TPKA 4WIAA 1KOFA 3DF7A 1PJAA 2YZNA 4NRDA 4KQIA 2CY0A 3DVAA 3NUZA 4F2WA 5BWMA 5K5EA 1XVIA 3FFBA 3PFKA 2VSFA 3HGQA 2W8BA 1XVAA 2G0TA 2YYSA 3ZJUA 4G4JA 2ZUEA 2YTZA 1AQIA 1WUIS 3RVDA 4UXHA 1MIOA 2BTQB 1KI4A 4RPJA 2BISA 2VDQB 2P7IA 2REQA 3QENA 2VJQA 3DR5A 1AY0A 2VP3A 3RTDA 1L2TA 3FPFA 2XOKD 2W6CX 2ZE7A 5GONB 2GFQA 3H2KA 1P0PA 4LOHA 4H77A 4RZUA 3N2KA 3GRFA 3H1GA 4D4GA 1A4UA 2R2GA 1B14A 2XQKA 3F3SA 3MTJA 4NZZA 4QPCA 4LGYA 4E12A 3ZWAA 2QN3A 4F3NA 2XF8A 4O1IA 4UCWA 4X1OA 5MN5A 1KL7A 3TJRA 2CUKA 1U5CA 4ZVMA 1G20B 2DZDA 1GGJA 3KCQA 4GYJA 1ACJA 1NY5A 3L1IA 1O97C 2IWRA 1QQ7A 2C82A 4BLQA 1J7KA 3IUQA 3OLCX 4QPPA 3I2IA 1T2FA 2BDTA 2P5UA 5K9ZA 3N3BC 1F51E 1DLJA 2VJKA 4OI4A 4QWWA 4TZKA 4UUQA 2YRXA 2ZRHA 4R40A 5CT9A 4DVGA 3L0SA 4F6RB 1VG8A 1TM2A 2OBBA 2FSHA 3O8QB 2VDWB 3G9XA 3KUKA 2CBXA 5LZ5A 3UTDA 1LW7A 3NTRA 5JS7A 1EINA 1QHSA 2O05A 1KNQA 3I6YA 3LFHA 1X3LA 3PT5A 3UJ3X 3EW9A 1ECGA 3VGPA 1X7GA 5FH9A 3PX7A 3OTHA 3UHJA 2BFCB 3BUSA 3WLNA 4E14A 4RQTA 3ZV5A 1B2LA 1USVA 4HADA 4JMLA 4L07A 2E7ZA 1S6YA 2GK6A 1VB3A 4NFYA 5MF6A 1OFIA 3KT0A 3ZEAA 3OJEA 1VL8A 5L9AA 4AX8A 3MWEA 1KOJA 3OWOA 1GQYA 2ERXA 1GYRA 3MS7A 4RK5A 3U4MA 3M4XA 4OK5A 4FD3A 2ZSAA 4PSDA 3KTFA 4S24A 3VPXA 3DEKA 3VR5D 2BGNA 1P4GA 4HATA 4LZZA 1KK1A 1ORIA 4RHFA 4BOYA 3O91A 1K5PA 2Q27A 3GN1A 3RI3A 1BU5A 3GOQA 3I09A 3GLRA 3JVVA 4CG0A 5KO2A 4BY9E 1XLWA 5JAMA 2ONJA 2GILA 3W5VA 3NYWA 4HDSB 2IITA 2VYFA 1ZIOA 3H5AA 3F6RA 1UFRA 1RHMA 3QKRA 3U3RA 3TG8A 4OHWA 2BHNA 2IYQA 3RROA 1KEUA 2CLLB 2QUJA 4YUZA 5FBHA 3QA3E 3D7RA 1LY1A 2YHBA 3EH2A 4WJLA 1U9IC 5THXA 2WIAA 2GF0A 1U9ZA 3IT3A 1DJLA 3TTSA 2P3QA 4B3CA 1RAHA 4MWBA 2A5FA 1E3QA 5CLQA 4ZT6A 2G8LA 1RT9A 3KHUA 4GBJA 4JZYA 4B6QA 4JCOA 3PUXA 5AK4A 2NU8B 1H4SA 3SS7X 3HBLA 2YL2A 1J8MF 1YWGO 4Q82A 2M6LA 3C6QA 5HCUA 2YFKA 1R2QA 3DW1X 1TYZA 1P2GA 1XZCA 3PJFA 1SD2A 4C0AC 4GBGA 1J8YF 1Q0TA 4DPMA 5IXYA 2I99A 2PMKA 5KDOA 1P1CA 4UQPA 2I9PA 2V7VA 1HDZA 1O95C 3QVXA 3D2LA 3Q0IA 4UCXA 2UZ0A 3LKZA 4AO7A 1HTWA 1C7IA 2A0WA 2WQZA 4ZCSA 1NDQA 3EMDA 2J9ZB 2TYSB 1ILEA 4RU1A 1YH3A 4WT7A 1MU0A 1WLSA 3T6KA 4QYXA 3USCS 1C9JA 1RCUA 4XQEA 3I83A 4LX0A 3UT5B 1H2XA 1ECCA 2UXCB 4N5MA 1QB7A 3BGWA 1X0XA 5CCDA 4Z54A 1E1RD 3UJ6A 5I8PA 3DLHA 5FI0B 4R7ZA 3DZDA 4C4XA 5I3CA 4MDYA 2QRHA 3T95A 1ZH8A 5KYNA 1VSTA 2WU4A 2Y99A 2I91A 5HIKA 2GYWA 1E1NA 4KQ1A 1ZU4A 1R0LA 2M6KA 1RWOA 3JTEA 1NW7A 3LHKA 4BNIA 3DBIA 1DKRA 2HRCA 1QKKA 5EERA 2CCKA 4M86A 1US8A 4U0JA 4J1TA 4PM4A 5I9NA 4DZTA 1DEKA 1EP2B 1RLOA 3Q7PA 1M5RA 1OXBB 1IWPB 1JEEA 1ENZA 4MLDA 3UZUA 2ZBPA 4ZDWA 3OA2A 4UBIA 2WV7A 2ORED 4CTOA 2VQ3A 1E3JA 4DFDA 1HEIA 3IYLW 1QFXA 4OA8A 3WL6A 4ZI7A 4MITA 4XARA 1J1IA 5C1DA 4JC4A 1Z2EA 4OFBA 2OP1A 3L8ZA 4QLOA 2WDZA 1SKAA 1JXOA 3NOVA 4O63O 1V1RB 3RU3A 2PU5A 4Z9XA 1G9SA 1HOXA 1POXA 2XMQA 3OF3A 3CLRD 1LJ8A 4II3A 1G8PA 1HGXA 3OCZA 2ZRFA 1AQJA 1VPTA 3RS2A 3WOVA 5LDDC 1PJ2A 4X7BA 5IFKA 3UMMA 2JRLA 3WNQA 2Q3JA 1BEZA 1VI6A 4D0GA 1QQTA 3NG1A 4D82A 4E1BA 4DV3B 3K35A 1MW9X 5C53B 3QI2A 1TU3A 1Q14A 1KVRA 4GPIB 4AB1A 1LF5A 4WXYB 10MHA 3CLUC 4NECA 4Q7JB 5BQFA 4HRYA 1FMLA 3DLPX 1O9BA 4RTQA 5JAOA 3LQ1A 4NNPA 3DEAA 2AC2A 1P5RA 4DDUA 2EFJA 5M5BA 2OCLA 3DBHB 3ELUA 4M9CA 3TCKA 3DVRX 5AK5A 2IH2A 4NXMB 1YIDA 1KNXA 3V4FA 4KE6A 4HK4A 1RWVA 3P2JA 2YV2A 4P83A 4RFSB 5M7EA 3FDZA 4JB3A 1RTTA 3EDQA 1U0NA 2HNBA 2PX4A 3Q4GA 4N76A 3M6XA 4OBBA 4ZCIA 2IK8A 2WHQA 3S8MA 4DV4B 3H2ZA 4CQMA 2Y1FA 3FSRA 4J16A 4EDFA 1RXWA 4GBMA 5LMCA 3LUCA 1KQOA 4HNHA 4PRYA 2X5XA 1MPTA 5AHKA 4R51A 2VTKA 3ZLJA 4N48A 1ZVMA 1IN4A 3WADA 4EPTA 5HR5A 3ZVMA 1JEQA 1N78A 4WNIA 4KL8S 2GX6A 3M89A 1YVPA 2PLWA 3K0CA 2VG8A 2FHSA 3B1YA 1Y8RB 3TJZA 4W8HA 5DLPA 2QYHA 3HJUA 3GZTB 3K1ZA 4CNBA 4F93B 5I6DA 4KO8A 5F1KA 2ZYHA 3RUIA 3EXHC 1VYHA 1Z0AA 1KKLA 2HF9A 3OX1A 1IEWA 4UHDA 3KJEA 4ZJYA 4MO9A 4Z9YA 1NRWA 4E46A 3ASYA 4GWLA 2E18A 2HHHB 1JTFA 3Q8XB 1TB4A 3A6HA 2Q0QA 3O83A 2QSUA 4Z86A 3QYJA 1TJ3A 4HNSA 3SG0A 4RK0A 3EDCA 3A1VA 4PPFA 2DERA 2OHXA 4QRHA 3CY6A 2AWNA 4LDNA 3DLBA 4MYCA 3TLZA 5KWIA 3KFVA 2C1ZA 2FRDA 4NBKA 5JDCC 4EAAA 2YJZA 4Q4AA 3GLGB 4X61A 5J4VA 1Z2NX 3PNPA 4OQYA 2CFSA 2REQB 1XE3A 5L51A 2VNHA 1Z16A 4K6OA 3KALA 1W93A 1ZGGA 5KWSA 1Z07A 2IU0A 1YB2A 2ATXA 1RD4A 3FMFA 1OH7A 1ZN7A 1U0SY 1IZ8A 1HSOA 1JHZA 2VJMB 2F3QA 1YI0A 4M2LA 2O0LA 4L02A 5LJIA 5EEHA 4Y67A 221PA 2GVNA 3A2MA 4LHSA 1BN6A 4UDYX 2MTBA 5E6RB 3N6RA 3LUGA 1N2SA 3NPMA 4FS3A 5DGXA 3THWA 3GI1A 1EU1A 5DBEX 4PONA 1OWOA 1KK3A 4R3NA 3FKSD 5UKDA 5A9SA 3ISJA 3NH6A 4OXXA 3HXMA 2QVLA 2JGDA 3EDOA 3SX0A 4Q39A 4Q4CA 4UM9B 4FFLA 1N3LA 3DGFC 3IT0A 4Q7LA 3TDNA 2GM9A 3TQOA 1GAXA 1P62B 4YJGA 5ALFA 2QAGA 3RUEA 2V6BA 5IWAB 4NHOA 1ORHA 5AKEA 4EB8A 5KJFA 5JXHA 3BWDD 5DBOA 4UU8A 3H1FA 4JN6B 4HLUA 5JJCA 4NQRA 5AXBA 3ZYCA 3BMOA 1Z4MA 1ZW6A 2DG2A 4US2R 1DOHA 4HN9A 5T8KC 4B6PA 4CV0A 2Q5FA 1A9XA 3L8YA 5DCWA 4E94A 2B34A 2XMRA 1U7OA 3MPOA 5J1SB 5L4NA 3REOA 2VF5X 1ZIDA 2FPUA 5H1YA 1K6MA 5C8XA 3W5BA 3PYMA 3MBKA 3U39A 4OXYA 2PKCA 3HTXA 4YEDA 3I5XA 1E7YA 2GM5A 2RH9B 3NNDA 3UMRA 4ETIA 1UKCA 4EHJA 3UTCA 5FJIA 4R69A 3QF4A 4J0QA 2Y0PA 4EOGA 1S3GA 1TNDA 4C2AA 2W4QA 3KUXA 5GONF 1WABA 2P2LA 4JGIA 2CNWD 1DIHA 3R7SA 2DCUA 1DC3A 2BEKA 5FYQA 3T94A 4Q21A 4G4IA 2Z6UA 1QGED 3M9LA 3PPVA 3RSLA 3RSHA 5AK3A 3WYAA 2QLNA 1CEYA 4RLFA 1VPDA 3HXKA 4AZVA 4M83A 3DO8A 1OZAA 1XYGA 4CL2A 3KSDO 1KK0A 1YZQA 3WTCA 3NETA 5KYWB 1XROA 2IGBA 1QK3A 4IJ6A 2Z3WA 4DIUA 5EP3A 3THXA 4YRGA 1GCOA 2M32A 1P9NA 4RIIA 3ETDA 3RIHA 1LVUA 1TQ2A 3BWEA 3CN9A 5DN6A 1Z06A 2H9AA 1SPBS 1JKMA 4Q37A 3HYLA 1MO6A 4ZCQA 4F91B 1DAIA 2W2TA 3C6BA 3HKBB 3I9JA 3GJTA 2P30A 4A03A 1NQXA 4WOBA 3LDHA 1X94A 4JL5A 5A3JA 3W5SA 2Y1KA 4B79A 4LDQA 1VMKA 4AZ0A 1JE1A 2B69A 5TY0A 3KDSE 3V7FA 4CDNA 3FM9A 4EJSA 1HNXB 1JJ7A 4JI6B 3ZWQA 4FFMA 2BEWA 1MRSA 2NX2A 4X8HA 2KJQA 3C3WA 2CNNA 3EYAA 3IQEA 3WGJA 3CVVA 1CQJA 1RWQA 2QS9A 3U9LA 3KQHA 4EYEA 1GZDA 4LCJA 4ARUA 5IAJA 1MDBA 3GEHA 4AJ1A 1EWVA 2GHIA 2GFHA 2C9DA 1GKKA 2QG4A 3UT5A 4PNZA 3FJYA 3L84A 3MB5A 5IJ0B 4D96A 4YR9A 2O3SA 2O8EB 3QM1A 4XQ0A 2JLVA 2H4FA 4ZZ3A 2OQIA 3MT9A 3V1MA 4DGSA 3V4PB 4LOJA 4FMBB 1T8UA 2OT3B 4D6YA 4JK3A 4QBTA 3SM9A 3DL0A 1DQSA 2O8EA 4DLPA 1A9SA 2GI4A 2GCNA 2IU4A 2JAHA 4PINA 4HDOB 5IM4F 2BGTA 2GH1A 3KXDA 3VMMA 3HN2A 3MBOA 1QTRA 2VZ8A 4I46A 3RSFA 2IWHA 4EQ6A 4YUAA 3SJ7A 1A7JA 1NM5A 4V38A 4YP1A 4L78A 2Y68A 2XF2A 3OO1A 4RMNA 2IY7A 1J8FA 5GJCA 3BCSA 3NMUF 1X1EA 4PTYA 1MGOA 1NW4A 2VPXA 4XM0A 3C24A 2B1QA 1MLDA 4J0JA 2HF2A 2QTCA 3EMBA 5IVKA 1F2DA 3A58B 5EZ5A 1YB1A 3UB3A 4WL0A 4FOTA 1CQIA 1UQRA 1UOPA 2DF8A 2SKCA 3HA7A 3V7NA 4ECAA 2YJGA 3OJLA 2EW1A 1JHUA 2VZ0A 1W47A 1SCNE 3BB4A 1Q50A 3GMTA 4DJAA 3GA5A 2XUHA 4TT3D 3NWEA 3PWZA 2AD5A 1MHTA 1OC2A 1V41E 5U4QA 1NJ8A 1OKKD 2XQVA 4CKBB 1DAHA 4NMWA 3LI2A 1J0CA 1RBYA 2LWIA 3CW8X 1AM4D 1OY1A 2IP4A 4GHWA 1A8SA 3FLAA 4LSZA 2XPCA 4QGSA 4RDXA 4NJMB 3QEKA 2CLHB 4QG7A 3I04A 3CM0A 1NBOA 1FIUA 3DEYX 2X6RA 5ALZA 3GUVA 5G0VA 1JDJA 4CUZA 3CSUA 4N3AA 2XUFA 4Y6OA 3V55A 2GASA 3STVA 4RJLA 5HKOA 4JLJA 5BXYA 5GWXA 1J5PA 2FNAA 4OQEA 2YNMD 2VLIA 5HW0A 4WK2B 2BBTA 1BXRA 5TQVA 3ZC3A 4WBSA 6Q21A 2BGIA 4QLBA 3O4HA 4UEWA 5KYGA 3ZW7A 3ASZA 3D3WA 2XHEA 3EPPA 3G68A 3I30X 3S1LA 2VKQA 4ZDJA 2ZYGA 3GFGA 3MRSA 1NYQA 4ZP1A 4LMPA 2CVHA 3SYNA 4GZ3A 5E4JA 4GR5A 5E6UB 2PH5A 3ZTYA 1XXLA 3LGXA 1JA1A 4LRQA 5E6RA 1E9DA 1XRNA 4OHUA 4YRPA 4F06A 4ZTBA 5DVZA 3UATA 3VHLB 3QMPA 1ZMXA 2B4KA 4PNPA 1XOIA 3SQNA 2YC2C 3UGQA 4M37A 4BKRA 5LZ2A 4A8HA 1QPBA 5DNEA 1CETA 1BMDA 1TYAE 4L9SA 4LOKA 1E96A 3MT0A 3UW1A 3E82A 2E87A 3CTMA 3AHJA 2JHPA 3BCUA 1YRBA 4PV7A 4E5UA 1A5BB 4K6FA 1EJ0A 1CUAA 1I2DA 4J0CA 2DWOA 2WM3A 4K9LA 3OQIA 5BYBA 2FPPB 4WA8A 3IDSA 4TQAA 4WK0B 4CT4B 5HTKA 5CT5A 4EY4A 3F98A 1RBMA 1XTRA 2PKQO 2WMOB 3H9GA 1GNSA 2VDWA 3BDIA 4FBGA 4R1UA 3TBFA 3ROFA 3WB2A 1XLVA 4PSUA 3ZCSA 1NXWA 2ZIFA 4JWKA 1E5LA 1I10A 3OFKA 3PNKA 1KY4A 5I9MA 4WBNB 3U4GA 3DOHA