3NEAA

Crystal structure of peptidyl-trna hydrolase from francisella tularensis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
187
structure length
187
Chain Sequence
PKIKMIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNPKLNCNLAKVSIDYNNVVLVFPTTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHLGTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNGICFLDDIINYKLEPVMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structure of Francisella tularensis peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Hydrolase
total genus 58
structure length 187
sequence length 187
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3neaA00
4QAJA 4QD3A 3VJRA 3KJZA 4IKOA 4P7BA 1RYBA 2Z2KA 4JX9A 4ERXA 4HOYA 4ZXPA 5B6JA 4DHWA 3TCKA 2NAFA 2JRCA 5IKEA 5IVPA 4YLYA 3OFVA 2Z2JA 1RYMA 5EKTA 3V2IA 3NEAA 4OLJA 4QT4A 5IMBA 2LGJA 2MJLA 4FYJA 4FOPA 4QBKA 4LWQA 1RYNA 4JY7A 3TD6A 2PTHA 4FNOA 4JC4A 4JWKA 4FOTA 3TCNA 2Z2IA 3KK0A 3TD2A 4DJJA 3P2JA 4Z86A
chains in the Genus database with same CATH superfamily
4QD3A 1KI6A 3IUNA 1MHPA 3EFHA 3T1NA 5B6IA 2VDJA 4QGHA 1YZVA 3VGJA 4BQFA 3QX8A 5DHRA 1SU6A 2DFLA 2H0RA 4Q15A 1B15A 1SOUA 1X39A 1JIQA 2BGRA 3MTJA 4PQFA 4ZO4A 4LQCA 1AQ6A 3GBSA 5F3DA 1VBKA 4PSKA 4C6RA 1Y1LA 2CNNA 1FU4A 4ZT5A 5FUQA 2CXOA 3UHJA 4CCAA 4OQXA 3K1YA 4OHOA 1BKSB 1QFXA 3EFBA 3E84A 2FMXA 2GTIA 1C3XA 3DLHA 1KP3A 1UOQA 1WMFA 3HCEA 1ZL0A 5ARDA 4ARUA 3UBMA 4UMVA 3LXXA 2VXYA 2C04A 2R4QA 3TZEA 1VHTA 3MF4A 5LQKA 2ZSAA 3FF4A 3R7SA 2VBFA 1ETUA 621PA 4C7OA 4QM6A 4HWOA 1UJMA 4RPIA 3PGXA 5DEIA 5FIUA 4XKJA 1G17A 2FR1A 5BSRA 2X5XA 1P1FA 4K6HA 1Z38A 2N47A 3L7IA 5L4LA 1KP9A 4L75A 4MHOA 2R1TB 2KLBA 3KXDA 1UAAA 2QRGA 1XR3A 2QTNA 2Y2VA 1CR2A 4XIJA 4IEEA 2G9QA 2Y2UA 2CXNA 5T41A 3E4CA 3SOPA 3W2EA 4EUSA 1HT2E 2IOQA 3EWSA 3E18A 1CHNA 2D1FA 2PGDA 3JAKA 1EZ4A 1EVYA 1RJGA 5CD1A 2HMTA 4LOIA 2WWVD 2E5FA 4RSMA 2HM7A 1J7JA 1GQRA 1I3MA 3HACA 2O3JA 3GROA 1Q1ZA 4GX1A 5JCJA 4TTTS 3TOVA 5LOVA 2QN9A 1EDOA 4P80A 2GPJA 3DNFA 1R27A 2Q5HA 1XE3A 3WS7A 1I4EB 3MQ4A 4XR4A 1E60A 3ADKA 1Z73A 2PU5A 5BV1A 5FTWA 4ZTUB 2WUDA 3G0DA 5IVDA 1YJQA 3R7BA 2VYCA 5K0NA 3SYTA 3EY4A 3ENZA 3EIOA 4E1BA 2IPLA 2VP6A 1PW5A 1QNFA 2FCRA 3Q7SA 5ETJA 4DNFA 3C6YA 1PJCA 3F98A 1E3SA 1N0HA 1NFFA 3HDYA 5FUBA 2UYQA 2O3TA 1XA3A 2VYND 3A6ZA 3JQ6A 1R6XA 4FFWA 3UMGA 3NXSA 1IZYA 1Y1PA 1OF1A 1DEKA 4B9EA 4YRKA 1E94E 1C1XB 5CLJA 1QP7A 8AT1A 3CEMA 1EXVA 2C99A 1PR5A 2YV1A 2EQAA 3WLEA 4G8CA 4P0TA 4URZR 3DYVA 4ZHSA 3E0QA 1PJRA 2PDAA 3GPBA 3QUQA 4MI9A 2BIFA 2CXQA 3PU6A 2OYSA 2BZGA 1YA6A 1JG3A 1ZNXA 3HYSA 5JIBA 4HTFB 5JC1A 3WKAA 4CIVA 3PF9A 1M0EA 3CIOA 3O31A 4QJ5A 5I5GA 2HRZA 2J30A 3VYTB 4EGAA 4NH4A 3GA7A 1J07A 4D98A 2G4LA 3CJTA 2GBLA 3GCXA 1YFZA 4TN5A 3L7LA 2NIPA 2ONJA 3ZXYA 3HE3A 4I5IA 3FLBA 2WFLB 4JX8A 4LF8B 2Q7OE 4P9NA 3NDIA 2YXBA 2FZ4A 3T4XA 1FFSA 3JWIA 2Z8YA 4A73A 1U98A 3UY4A 4DLRA 4M8KA 5AW4A 5KOHB 2J9FA 3C1AA 4RH1A 1S9DA 3K0BA 1E61A 1LKZA 2XOXA 4FGWA 3FBWA 3HYTA 3JYQA 4JK3A 3ZE9A 3I09A 1PS9A 1T4CA 4J4HA 2NO9A 4PPFA 4BRSA 3OPYI 4BNNA 2EF1A 3NZEA 1Y5LA 5EKTA 1QYDA 2VBGA 3SXUA 3PDUA 4OLJA 4UTVA 3H2BA 4K1LA 4CEIA 2FJUA 1UMBA 5D7BA 1Q3TA 2W6OA 1R12A 4G0QA 2IH5A 1ZEJA 1P31A 2A9KA 5C5IA 4C7BA 1Z62A 2JLZA 4D43A 2J3QA 3G85A 4XGKA 3TQFA 4RMGA 2PZMA 1EFVB 3RIXA 1QR6A 3OAAD 2LCFA 2JJ2D 2C2BA 1YH3A 5EHNA 1AIPA 3QOXA 1GCGA 4BQOA 1WUYA 5J9FA 2Q4DA 3FVVA 1ZXXA 4ZYZA 5DP2A 4IG9A 3BCHA 3PG5A 4II3A 3IIMA 1KIFA 2X5NA 4WZAE 2QL5A 3QYFA 4ZOBA 2FUNB 2QVYX 4JQYA 4PWYA 5F2EA 5B1DA 4I4LA 1OFTA 4NXMB 3B2EA 1IHPA 1OBHA 1W85A 3FHCB 3KNZA 4Y2UA 5LXTB 2G9ZA 3ANXA 4P4UA 1KYXA 1Z5UA 3L1JA 3COJA 1X1CA 2P4QA 4WZBA 4ESEA 2DE0X 4F4DA 1EP2B 1JUDA 2G9VA 1U4OA 5DN9A 1R0RE 2J9GA 2LIVA 5KQRA 2W42A 1JG6A 3WB0A 4GLJA 2AZMA 3KQHA 4M0UA 5EQJB 5AJVB 5CIYA 3QWBA 2V45A 3I1YA 3TVTA 3HVIA 4WOKA 5EL0A 4PZDA 2FN3A 4N3NA 4EKDA 3IERA 4EG6A 3A9UA 1KL7A 4OQLA 3BMCA 4D0GA 1NQTA 4AIIA 1G1AA 5HEKA 4EFKA 4N7JA 1JHYA 1ORIA 5AKEA 3UJ9A 3KQUA 2ZJ4A 2E37A 3F73A 2BFDB 4RETA 4YP9A 1J5PA 4HDQB 4NMWA 1GV0A 3OIWA 2A0WA 4BX8A 1KFJB 4EKEA 1EQ2A 1FFXB 1SU4A 2VP5A 1DKQA 3K31A 2HSGA 4H60A 2EGUA 2P0EA 4JZYA 5DJ5A 5JAHA 3LYLA 2QBYB 2XCOA 2IQIA 1Z68A 2DTXA 1ZVQA 2XUOA 4Z1MA 1Y4UA 4IGFA 1I0IA 3QE9Y 1WAMA 1OX5A 4RK1A 7AT1A 4DLVA 4G8BA 1ZONA 1Y6ZA 1J09A 3MCWA 4OK6A 3LX6A 4F2DA 2OD7A 2Y99A 3B9BA 1ZXBA 3INTA 3LFHA 5ILQA 3WL6A 2JASA 2SICE 3K6KA 4AL4A 5K3BA 4MW5A 5AWFC 2O8DB 4CMIA 2BF7A 3PPIA 4ZC8A 4RJJA 5JSHA 1Z0IA 3E35A 5JJCA 5FTNA 3HGTA 3KXIA 3VPCA 5EZSA 3G5MA 4XCXA 4JJ7A 2A30A 2PJZA 4JKIA 4QBKA 1PJ8A 4A1FA 4ROSA 1N9KA 1T2CA 5T8KA 1LQTA 4B0OA 5C1BA 4G5SA 1BCSB 1RXWA 3NNDA 4QUJA 1PNVA 2V9PA 1PR2A 1RYHA 3CLKA 4W4TA 3UIEA 1ZM9A 1HZJA 4RX1A 3HU1A 2R7LA 2PK3A 4LC9A 4DCCA 4EUHA 4IKOA 2C84A 4EHAA 5GINE 2CV2A 1AH2A 2GB4A 3FOWA 3IPRA 5GQSA 1X77A 3KEGA 3L6DA 4ZOAA 5GP1A 1CJCA 4OHZA 3B38A 1BVHA 1OU4A 3QVTA 4E12A 1JLSA 1WDTA 5J3JA 3JQCA 1LLQA 4HAVA 3ANTA 4JC0A 4JJGA 1RM4A 2DWPA 4PZYA 4RGQA 3MXTA 1HE8B 1JEQB 2G04A 4TSFA 3JZAA 4XQCA 2NQ2C 1IVYA 3QBDA 4D8TA 3JQ8B 4RF5A 3DAFA 4R6XA 3KVVA 4TS9A 1SMKA 1P1BA 3DZJA 3GCZA 4I8XA 2QTTA 2W2KA 4MMXB 3V46A 1Z7GA 4CM5A 5K05A 2EJTA 3U44A 2JFXA 3L07A 5D1NA 1MJ5A 5IPFA 2VLIA 1LTQA 3T5DA 4G9GA 2UV8A 2HT1A 4LZOA 1T6NA 1E7RA 2ERYA 4I7EA 3RRYA 2IBSA 4I4NA 4HD8A 2YDXA 3UPTA 1OXUA 1ICIA 3V5NA 1A5TA 3G79A 2ZWPA 1XPUA 1N3LA 1EI9A 4HAWA 1JKXA 5JU6A 4IGAA 3G1WA 3IC5A 3H1GA 5FAXA 1L5KA 3SX2A 4D3XA 1JIUA 5FPKA 4ND8B 2O5RA 4X1OA 4Q3EA 4PC2A 4KTTE 3GCWA 3N8KA 4MQUA 3LKDA 4IR7A 1DTEA 4URUR 4KE9A 2ZCUA 1U2DA 5DI3B 3IOYA 1EBUA 1H2YA 4HQOA 4U2GA 2O3QA 1BYIA 1H05A 2E6KA 1D1TA 2P65A 2ZSJA 4P7FA 3RHFA 3OMXA 3KSRA 4MGIR 1VIDA 3SIWA 1F2TA 3CUEF 4Z4IA 3NH9A 5FF9A 3BF7A 4W8GA 2H5IA 2J6IA 4KAJA 2RBGA 1ZMXA 3U3MA 1KMHB 2QUBA 4DUZB 2JJMA 5L9AA 5EHZA 4KP7A 5L8VA 1NL3A 3ACBA 4Y1RB 2OZVA 3NANA 3UMCA 1U8UA 4NBVA 1O77A 2JAPA 2J9XB 5AVVA 3TX6A 3OHSX 3N2NA 1TTQB 2W6PA 4FUTA 3D3EA 2ZJ5A 4NCJA 4RKFA 1H2WA 4CI9A 5C8YB 4MLDA 3BE8A 3DAPA 1JE0A 4O59O 3E3MA 3HADA 3CPEA 2R00A 1P81A 4AX8A 2I54A 5ISMA 1E1KA 1NOKA 3HDHA 3ZY3A 3P32A 1J8MF 1ENPA 2JIOA 3VU8A 3TR6A 2GF0A 1TQHA 1G5RA 1F6BA 2QQ0A 5F4BA 3VDNB 1G8SA 1I14A 2FUG1 4MVJG 4P3XA 5EP2A 2HQSA 3B6JA 2O6HA 3IE0A 2XOKD 3LPAA 4DUGD 1LPOA 4PXSA 1PRYA 4I9FA 3CFYA 3F49S 1PN3A 1XXHA 4KUGA 2REQA 2XMPA 4LBZA 4QFBA 3VDXA 3ZWCA 2Q1UA 2X3YA 4V1CA 2I3ZA 5L45A 5KYYA 3HCPA 1WPQA 2ZJBA 1SKQA 3D2BA 4NPCA 3O7WA 1VMAA 2LD4A 2R9VA 2VT2A 4QOEA 3ZDXB 3MOSA 4X3PA 3R7DA 5ECGC 1AKRA 4TV8A 1NVFA 4Z4FA 3AVPA 3I9LA 3IHLA 1XV5A 4KI0A 4TKLA 3OPMA 4W5WA 4NCNA 3RV3A 1IIBA 2FLVA 2CKMA 2Q2VA 4CTKA 2QD2A 3THYA 3TQSA 4LFAB 2JLQA 2MJLA 3E15A 3JSXA 4LQLA 5KTOA 3IPYA 2GWRA 3OD1A 4LCEA 3RODA 2HJSA 3DUFA 2FFBA 1ZA2A 4WE3A 1AMUA 4L9AA 4B4OA 3JS5A 1CUCA 4TVBA 4B33A 1N9GA 1SCAA 2BEUA 4G0PA 5LLDA 4PINA 4QPZA 3WISA 5LD2B 4WADA 1E6WA 1AKQA 3LK6A 4TX1A 4V0MA 1WW3A 2IEDA 1BQEA 5TC4A 4AKIA 5AVTA 3ORYA 4FW9A 3I2FA 3NTOA 1TYZA 4KWHA 1V4NA 3HA2A 3U49A 1FMLA 1NP7A 5KAMA 2LVBA 4JKYA 4H7KA 1VLQA 3SXJA 4A27A 4MKFA 4OAQA 2I80A 2IYPA 5EYPB 5I7RA 4CM8A 4Q3CA 2XDYA 3GPIA 1VRVA 2OHIA 5HE8A 3ZGOA 5AXAA 5BWMA 2CSXA 1TFRA 1V8ZA 3LX4A 3G2HA 3DULA 1E4OA 3QMMA 4RF3A 3TBHA 3UYLA 1E9BA 1JHOA 2HJ9A 2HQRA 3G6KA 3IEIA 2PRJA 3GOHA 1MNQA 3IT1A 3PXAA 4I0WB 4RLQA 3S1AA 3VVMA 4A82A 2JDID 5BXYA 4OQDA 2PUGA 5AJTA 2O8BA 4ZCTA 1E89A 3VSDA 3V3TA 3B2QA 3D3KA 4MAAA 3Q1KA 2V6IA 1GVHA 4PSDA 3C6QA 4C22A 1VIYA 2RKWA 3K0FB 3TQHA 4DCJA 5BUQA 4NXNB 1CUWA 4QQ8A 3IQWA 3IV7A 3VI3B 5ALGA 3NV9A 4U2EA 4YR9A 3BZWA 1POWA 3KBBA 2JB9A 3QVLA 4L9RA 2R8PA 2WFZA 2WJ3A 3BHMA 4GZ5A 2XUZA 4Q3OA 5EZYF 3UJHA 1TJNA 2HZBA 3ZH2A 1HWYA 3H1PA 4YRMA 3DXFA 3K2BA 4M46A 4HAXA 1DQRA 2R6AA 5TT1A 4AZTA 5BNIA 1CSEE 4BKRA 1F0KA 2AR0A 2FZGA 4JIGA 3S1LA 3D1JA 3KEOA 3HNPA 4WERA 4Z7OB 3ZQKA 4XFDA 1DQSA 4YAFA 1NJ1A 1Z56C 4RUKA 5F21A 2Y76A 4TZ6A 3OQHA 3KTOA 3RS9A 3WLAA 1APBA 1MG0A 4MRMB 4EB0A 4FFSA 1ID8A 3TZKA 4NBNA 2XMCA 2OO5A 2CD9A 3H75A 4U0JA 3R40A 5I48A 1ULSA 3Q12A 4FGLA 3D9QX 4OLBA 2PZFA 3HPRA 3PXBA 4HF7A 3V7UA 1T43A 3MWYW 1P1JA 1DIHA 1U3GA 4XJSA 2PVSA 2VPTA 3AIOA 1CETA 1W93A 1A5BB 2ZPAA 1DXQA 3F71A 1PL8A 3LVFO 5KO2A 1IBLB 4LOHA 9MHTA 5FWAA 1SBZA 2WPNA 4GMGA 3VR5A 2XRMA 2R1UA 2DECA 4WFKA 2X4DA 4X7MA 4CXMA 3M3DA 2AD5A 4PAGA 1XEXA 3GQVA 1YR2A 4GP6A 4H3SA 4IIEA 4F56A 2Y0PA 3A6JA 1AF7A 2J6CA 5A0TA 5JMTA 2BONA 2BRUC 2F3RA 2A35A 3GC6A 1L7EA 1P3Y1 3VYVA 1D3AA 2VDQB 2DBQA 4HQRA 4LGVA 1TUBA 3E3OA 4LRYA 5THQA 3UA4A 1WETA 3WJAA 1PWHA 4PV7A 3SC6A 3H5LA 5IJZA 1B76A 3CN9A 4L5BA 3OEWA 2BFOA 3NTQA 1RWOA 3HL0A 1IN7A 3E9RA 5C80A 1TAGA 1Y81A 2CMGA 2O8NA 3CVXA 4HNVA 3CRQA 2FUEA 4LCJA 3L7DA 2WJGA 1C0PA 4UTXA 1XTVA 3OETA 1EX1A 3KOMA 3CWCA 4HS9A 2EKPA 3OZFA 4X8MA 2NU8B 3UWDA 5DB4A 4S12A 1H1LA 4ZOLB 3N8IA 4J49A 3NVDA 2FXVA 3C3KA 4N5IX 2ZSFA 1OI2A 1K6MA 1PLKA 3QU7A 1G2QA 3O03A 5TS2A 3A6PC 1C1HA 2GJKA 1EEXB 3K4QA 1S01A 4G0WA 1A9XB 1FX0B 3UGTA 2FEKA 5DX0A 3LUHA 1XP8A 2QHXA 3CNBA 2CYCA 3OU6A 1MR3F 1BXRB 2CV0A 1DC7A 1LI5A 4YJ2B 2H17A 4MA4A 2Q6VA 1G63A 3A4TA 3NHAA 3DZBA 5CX1A 2IP2A 2WMDA 4QHYA 5C7OO 3LCUA 3WBFA 5BVGA 1RJ9B 2GWHA 1VKOA 4MJ3A 4ROTA 2BM1A 4X8OA 1LQUA 4MW4A 4TT8A 2G25A 1WL8A 3RARA 3DPIA 4Q3AA 3ODPA 4BNDB 2B4QA 2FWBA 3UF0A 4D3SA 2P2CA 3EA5A 3EJWA 4IILA 2QM3A 2XLBA 1HYHA 1JKMA 3KKQA 3NT5A 4WSOA 4JEIA 4CQNA 4Q02A 1A8UA 1KFBB 2OCGA 1WHSA 2VNKA 2I4TA 2XCUA 3S68A 4CDNA 4YMGA 3VNQA 4JBYA 4XEHA 3JATB 3B5EA 3M4JA 4NCIA 1YSCA 4O4LF 5CVDA 1D2NA 2ACKA 4D46A 3LQ2A 3R3HA 3FPLA 3I52A 1ZR4A 3HLKA 1ULZA 3HP1A 1OTXA 2JGEA 1XZAA 2R5FA 3ZXUB 4ENUA 1JW9B 1XYGA 1Q1QA 2IDMA 3EGXB 1E0SA 3CZPA 3IUQA 4FC6A 2CLCX 3N9IA 4KIJA 5CYOA 3ZCSA 4NFYA 1M2VA 4PG4A 4WXYB 2CHVA 1J21A 1KE1A 3N39C 2HK6A 5L7WA 4YRSA 2VP4A 4C6SA 3CMCO 2W2TA 1TGVA 2O7VA 1ACMA 1DO8A 2YBEA 3GELA 5F1KA 1JH8A 4J1NA 4LNUA 3RHSA 3NYIA 4QATA 2Y8EA 1FMCA 1Q2XA 3CUTA 5ALPA 4NJMA 1EPUA 3SZLA 4PYNA 3T7TA 2ADMA 1GYPA 2PRYA 3FROA 4OLFA 5IF3A 2H00A 1VHWA 4O1HA 3W6ZA 4NCBA 1M2FA 5E6UB 3Q98A 2PH3A 3VSAA 4JLNA 5DF1A 1N0WA 2K2WA 1A27A 1X1DA 4EY3A 2AYZA 2XHEA 4N82A 3WI7A 2OQVA 3V4RA 1FS6A 2YFQA 4ZZ3A 3TW6A 4Q1VA 2WDZA 2N1MA 4IYJA 2W0SA 3DT8A 5IYZF 2Z58A 5K4AA 5JMOA 1ZY2A 1W75A 2NXJA 3KJQA 2AEEA 5SY6A 3IO3A 5AK3A 1WU7A 4MRSA 2FHPA 3EPKA 1B41A 5H3LA 1ZW1A 4DILA 3AESB 4DT1A 2IDZA 2WHEA 1PT7A 3EAGA 2WM3A 1JX6A 5FR1A 4FILA 1P8AA 2MWMA 3O2QB 2FH5B 1Z7EA 5T6MA 3I34X 5CLQA 1ZJYA 3VFDA 3TD6A 2UAGA 4GMXA 4YJHA 1I32A 4ZTZB 4BJHB 4CF4A 4YGYA 3URMA 2A9JA 2AJ8A 3PHLA 3QEOA 2PQ2A 4KX5A 5DGIA 2FDRA 4ZVNA 2V5AA 2D7DA 1ONNA 2PLAA 1TQ4A 4KGDA 4EJSA 3O8QB 5CVJA 3HWSA 2FSSA 3GGPA 4MARA 2EOAA 5JANA 3ROZA 1L7VC 1CUFA 3OO0A 1D2CA 3GT4A 1QHFA 4B75A 4B7AA 1J1ZA 1U7HA 3PDCA 4QRDA 1BVRA 4QWWA 2JGDA 1Q21A 2CVFA 3OBBA 1DIRA 3IPCA 4HLCA 4BN0A 2ZS8A 3AFMA 4ID3A 4AJJA 3N3BC 3K0KA 5K8LA 3HEMA 3VR0A 3NHJA 1EU1A 1SRQA 3JD4A 4EEZA 2NOAA 3OQVA 4BLRA 1XLWA 3PQ5A 1PSWA 3EG9A 4FR2A 5CR9A 3PE6A 1C3JA 5J4LA 3EBLA 1PQYA 2ZUCA 2VF7A 3K05A 2ZAOA 2H1FA 4RY9A 4BO0A 3T5TA 2H06A 1TADA 3ELBA 3GJRA 3LBNA 1AMNA 4M0PA 1J20A 2ECQA 3K2QA 3KAQA 3KKKA 4GI3A 3CNOA 2W2MA 4NPHA 4P0PB 2Z43A 3NBKA 2F17A 5AI8A 2ONYA 1C1DA 5EY5B 1AHNA 3H1EA 1NJ8A 3WK5A 4AY5A 5JXGA 1N1DA 3THWA 1O95D 2J9ZB 2H0QA 3P8ZA 4M53A 5AM3A 2UVQA 4YRQA 1DPFA 4Y7DA 3QMPA 4RL4A 2VK1A 3H2ZA 3IDQA 1P4JA 1KH2A 2A5LA 3FYUC 1GILA 2ZRPA 1S2OA 4LDAA 1EGHA 3AB8A 2CVPA 1DTWB 1G9SA 3GFSA 2O0LA 3G1TA 3N76A 3NVAA 2H7CA 3OCUA 5H4GA 2BFEB 3WMWA 4TL7A 4LE1A 4BE9A 4QTYA 1ZL2A 3NIFB 4OHVA 1ZAYA 2D06A 2D1SA 4XUGB 2YFYA 2RJOA 1R0BA 4NG5A 4ZN6A 3OTWA 2AOVA 2ZJAA 3UB4A 2FEOA 2PZGA 1XVIA 3SF0A 4LF4B 2HAEA 2HPVA 1XDDA 1Q0TA 1W36D 1U7UA 1DV2A 4PO8A 1JB9A 2LP4Y 4M0MA 1J23A 1A7KA 1AURA 1VI2A 3UAVA 3WBBA 5LUAA 2D7CA 1GITA 3ZW8A 1R16A 2F3QA 3VYSB 4F4FA 4YFVA 7ADHA 2C3MA 3LRPA 5HKBA 1CUXA 4OJTA 4R4JA 1B8NA 1UDXA 3ROGA 4WINA 3LLCA 5BW4A 1VZ2A 3N8HA 3NOXA 3RU9A 3D02A 1ZINA 2A1IA 4XFJA 4PTZA 1EG7A 4R98A 2NVBA 3H9UA 3OM1A 4FFPA 5K8IA 3PQDA 1YDHA 3ZWDA 2C97A 1WZIA 2X8JA 3BIOA 3C7KA 4RC9A 2WYWA 1FDTA 1KYWA 4QXAA 1KJIA 4L4UA 2JKVA 2CVOA 1Q0ZA 1DUSA 3AHHA 1ZGCA 3M2PA 5G53C 2VDWB 1OUMA 5FKJA 3V8PA 4Q1DA 1JHXA 3R7NA 1E1LA 2NXNA 1QAQA 5A6SB 4EI9A 2C03A 2IZ1A 3DM9B 4IF6A 1XZNA 2E4YA 2IP1A 2DUMA 2CMFA 1UDCA 5IH3A 4ESVA 1EAMA 3PLNA 1PJAA 1RU3A 2WYUA 3GJ4A 3VZBA 1TLFA 1FQKA 2HO5A 4B8YA 2WIJA 3TQQA 3NWJA 2DH6A 2O6LA 1O6FA 2H54A 5KX5B 2AQ8A 2P2NA 3FHOA 2CHUA 2XUQA 3N6VA 2H2IA 2XUDA 3PHBE 3V1YA 3WP0A 5F4ZA 5F2KA 4WL0A 3ZYCA 2W6ID 1UQUA 1PJSA 3L0IB 4RXTA 3VPDA 1YTLA 1P8JA 3K20A 3ADCA 3AR7A 4L08A 3PHHA 2HTEA 1GPMA 3VU1A 2O8VA 3AVOA 3G0OA 1PSZA 1JP7A 1U0NA 1KARA 1ZH8A 1ONOA 2EW1A 2QRUA 2P4UA 3GAFA 3HRKA 1P4RA 2H2AA 2Q5OA 3MMZA 4P4SA 5EE3A 3RC9A 4GNKA 5CITA 1HKUA 1ZX1A 5HIAA 3WKEA 2YXNA 2JFQA 2AOXA 1PYGA 4QTXA 2OFOA 4TLAA 5D84A 4CKEA 4Z8XA 4OMFG 5HMMA 3GAZA 3PTAA 4I50F 3BB4A 3RVKA 2AN9A 3WGTA 4R1TA 1K3TA 4DCSA 1B8UA 5CTAA 1UF9A 3CQ9A 2JJYA 4QDXA 5D5QA 2GKGA 4W1RA 5HJ7A 5JR3A 1EFUA 2I7DA 1CUJA 2QXTA 2WAOA 1ZJWA 3VJLA 3LDGA 221PA 3DLAA 5IH7A 1MJGM 3PKIA 5JV5A 1NX6A 1T9CA 2R7AA 3WGMA 2WMYA 2GI4A 5KNCH 3ZWMA 4G4IA 5IVHA 1QGOA 4IJ5A 3SQXA 5JAIA 3V00A 2YTZA 1CY6A 1UBUS 1ZVJA 1DJOA 2JCYA 3AH8A 3GT0A 3IUSA 4Z54A 5IZ4A 9ATCA 3B1WA 3QKUA 4ZQEA 3ZHXA 3QFFA 2YZKA 3O1HB 5B1IA 2R1VA 3TFQA 1LRJA 3GQBA 3MN1A 1DZ3A 1MDFA 2OZLB 4JAVC 2FQYA 3G9ZA 1QCYA 5AJUA 2QF7A 1B93A 1WTAA 3RSOA 2PGLA 4DRXA 5BNZA 4HDAA 1MVLA 3PDIA 3ZU4A 2HY7A 3E03A 3OX1A 1E1NA 3ILHA 1NOIA 1BWQA 2C2XA 4XAQA 2GQ0A 4LI3X 5H5JA 2FLWA 1SBQA 2XZPA 5JARA 3G0HA 4DQDA 5AP9A 3LZ6A 4XZ3A 1FDWA 1PDOA 4HRYA 4RD4A 4RVSA 3SQMA 2O0KA 2ZR0A 1JQKA 3RTGA 1ZK0A 2GK7A 4FN4A 1IY8A 3NFYA 3AU9A 1X3LA 3K0AB 1NWCA 2OWDA 2V98A 5KBYA 1DQZA 3EUFA 1X1EA 2AQHA 1W94A 4X5OA 1G59A 4JUFA 2YCLA 3QWIA 3ZZMA 3RYCB 1TF5A 3VRHA 4LCBA 4BFLA 3QOYA 4E5DA 1JEYB 3N2KB 1OI7A 2JJ1A 4JLUA 2FOIA 1YC5A 4LRWA 4H0NA 4MH0R 5DN6A 5FBWB 2ZW9A 5HKLA 3CVUA 4AC9A 4C87A 2FK7A 4DGQA 3D7KA 3KR9A 1DAGA 3KEQA 4ETWA 2JH8A 3QF4B 1M6HA 4CHTA 1NBAA 4TS4A 5JLAA 1K2VN 1G9XA 3OUZA 4WRRA 3DT9A 1NF3A 1XCGB 1E7MA 1JLLB 1VSUA 1XIVA 5FBHA 3GT3A 1IK6A 3FRJA 2KYRA 1WEKA 2ON6A 2O3RA 4M6WA 2PGXA 3I4LA 2WHQA 1VP9A 3HDGA 2RHCA 3RRMA 1JLMA 1DXOA 2D2XA 3FZYA 2XUGA 5EJMA 3RHTA 2CKDA 3FSEA 5CM9C 3BTOA 1W6RA 1HDRA 2VSXA 3KLPX 3VNRA 3FD8A 3LBFA 2YWJA 1XZIA 2Z4TA 3ZHVA 3WNVA 4BTEA 2ILVA 3KYCA 4FD3A 1M6NA 2V5VA 2WAYA 4MJLA 1K75A 1QWOA 2IC5A 3I5AA 3U26A 1F2UA 3AEUB 4TUYA 1G3QA 2GLTA 2VAPA 5DIFA 5BT9A 2NZ8A 4CCWA 2YY7A 1XROA 2OV4A 4QNNA 3R20A 4M22A 2UUCB 5H80A 1EBFA 4LDZA 1AS2A 2XDQA 1WCIB 2HOQA 3JQ7A 1FP2A 2REBA 1FDOA 3Q7TA 3I5YA 4ETNA 4QUBA 5REQB 1F3LA 2B2NA 1DINA 1Y3FE 3I4FA 4XIGS 4KL8S 4EZBA 4CKZA 1YRBA 3ZD8A 3HLYA 4FSDA 1SHUX 2H18A 4TXHA 4DG9A 3MS7A 5JASA 2KJQA 4HWRA 2OXRA 2PTGA 2HF9A 4MKRA 4YRPA 3BXGA 4BNLA 2Z6QA 3D8HA 3GLQA 4JVMA 4TKUA 3JASA 2GZSA 4D8VA 1M33A 2ODEA 3OEEA 3ETLA 2C5AA 4Q4AA 4DLBA 1SCJA 4F97A 3UB2A 2VDRB 3B2NA 3NPAA 4TRNA 4ER6A 1G8JA 1ZBQA 1RLJA 3CJRA 4PYMA 4RVUA 1CE8B 4MYRA 5DW3A 5F7ZA 4BKPA 1FXUA 3PQ2A 1IOWA 3D64A 3UH0A 10MHA 5LQJA 4DDVA 5I7FA 2F7SA 2R8RA 3L6OO 4BQPA 1QGED 3ENKA 1K5DA 4DS3A 1YTUA 2JLUA 5BWBA 3Q10A 1CVIA 1WMEA 4LVNA 2P2DA 2FPWA 2V6BA 1KDZA 3DEJA 4I55F 1BDMA 4LZJA 3I5UA 5EI5A 3GBPA 4CG1A 4XB6B 1YI0A 3GFTA 4EHIA 2PBFA 2ZP1A 1FZQA 2N1BA 1A76A 1KNXA 3DE1X 3ZWKA 2DMRA 4E6PA 3LBAA 1WUJS 1DT5A 2EL7A 5I7WA 3D6UA 1H69A 5ALUA 3LX8A 2PCJA 2FPMA 4Q05A 5C8YF 5ITWA 4IIJA 2FP4A 1ZGAA 4MHSA 2HF8A 4UAVA 1C8LA 1XX6A 4OY3A 2BJVA 1T8UA 3DD5A 4D96A 4RXUA 3GYGA 3GEDA 4KVAA 3NONA 5DHPA 5C4GB 4PZZA 3W1EA 4AS2A 1WD5A 4TVSA 5KYWA 3LGXA 4DR7B 4YGXB 4TYWA 5LZ7A 4UUMA 2YZNA 1UDBA 1BE6A 1XN4A 2X9QA 3HY6A 1Y7TA 1L7XA 4LTMA 3LDHA 4YMUA 2CJPA 2HLNA 4AWXA 3C3PA 1L4FA 3RROA 2O0JA 2GOYA 1AKUA 4HZUA 1OY1A 2VWHA 4OHYA 2QJFA 5EIWA 4AMUA 1K4KA 3B3QA 5FPQA 3NW9A 2Q8NA 1LW6E 4XE5A 4BZPA 1XMJA 5I47A 1O5TA 2IQ5A 3PJEA 3K5IA 1J1IA 3REQB 3VKWA 5TARA 5HGJA 3T3GA 1AHHA 2WYHA 5DWVA 1U3TA 4KIGA 4WESB 1QHNA 4TTVA 5C37A 2CLIB 1PK7A 2BW0A 1IWPB 1II0A 4QHTA 5T3YA 4EY8A 4CMKA 4D0LB 5I9SA 3JRNA 2QDXA 1NVUQ 2VOJA 4F8JA 5KOIA 2O2GA 1FY2A 4MVJM 3NHYA 1HDGO 5IP5A 3DLBA 3HG7A 1VMEA 3DG9A 4J0KA 3R76A 3NKFA 4WT7A 2PTHA 2YQZA 4G26A 3WKDA 4AQDA 4DCTA 3GIWA 3HBAA 2RGGA 3HR8A 1RZVA 2R8YA 1LDBA 5AHXA 4GRIA 3TNLA 3PC3A 3I39X 3PKJA 5I9LA 2FW9A 3OLZA 3SZUA 3U4HA 2NNLD 3LDAA 5ELLA 4RWEA 2XTAA 3W2GA 1TMYA 1GL6A 1KQOA 2JJ8A 5KWSA 1P33A 2PA3A 3U1BA 2NVUA 4OBXA 4TWAA 1Y8QB 2WICA 1F4VA 1M7BA 1OLSB 1MJNA 3DMNA 1C9YA 5KTSA 2FOXA 1NVAA 1OLUB 1RT9A 1NWHA 4HDNA 4OI2A 2QORA 1QRSA 2GN2A 3MIZA 4CLRA 3MINA 3NAQA 1EUQA 4FYKA 4Z4QA 2PHZA 1MEOA 4ES6A 3EQ2A 4ALMA 3CKMA 1RR6A 2I29A 2B78A 2QTCA 5ERYA 3ACCA 3PD7A 3TTVA 4JDPA 1NVGA 2JI9A 2WRZA 2BISA 4OSPA 1QDUA 2Z83A 2MT9A 2C98A 4HYQA 1SUEA 1B3RA 1KK3A 1RI2A 2ZTSA 3AUYA 3G2PA 4H0CA 5F5XA 4GGMX 5LQRA 3EXFA 3E2MA 3PUVA 3SVZA 3TRHA 5JATA 3U6KA 1K06A 1Y7IA 2DH5A 2P68A 3O4VA 4RPHA 5EINA 5GONA 4BVGA 3ONEA 2EBFX 4ZHQA 2VEOA 2EBHX 4DBZA 2M98A 2JK1A 1S8FA 4CMCA 1HNXB 3WIDA 2HKIA 3ESXA 5H68A 5IW8A 3U4GA 2CMHA 2OCXA 3F67A 5EAIA 1QFMA 2CLHB 4DLPA 4HEJA 3DKVA 1DQPA 1X1SA 2I9KA 5IHPA 2OLKA 1D9XA 1WPGA 4NDAA 1W9HA 2XA9A 4X41A 2AHOA 2QY9A 5FBRB 3EPRA 1S7GA 3DC2A 4DMGA 4U9UA 4C29A 1T9DA 1M6VB 2ISQA 2ZYRA 3OCJA 4K46A 1WUIS 4Y2VA 4TTSA 5ECYA 1OAAA 4UDNA 1IUKA 2OXIA 3HB4X 4KQEA 4A6XA 2QMEA 4NICA 2WJ4A 4PNHA 2BZ1A 3GJ0A 4PSCA 4S1NA 2BP7B 5EHQA 3QXJA 2WAMA 3DKKA 3G7NA 5FFNA 3U7JA 3ZY5A 3D3WA 3EPLA 4QU8A 1A5AB 1JEDA 1ZAKA 1EUDA 3VYWA 2VHZA 3GLIE 3E82A 3QOFA 4Z9XA 4XCQA 5BORA 3CLRD 1ZM3A 3KZ1E 1EE1A 4DPKA 1XQ6A 3N5KA 4JLOA 3WYGA 3ZKWA 1GY8A 4C0KA 5CDFE 5JVDB 2JFVA 1KPHA 3DBIA 4FEEA 4AZ0B 3Q7RA 4WUTA 3TBKA 5C1OA 1IXZA 3AONB 4GT1A 2XNCA 4JMLA 5CH5A 3EXG2 4FM9A 1ADJA 3D4NA 3R0IA 1J9GA 3HN7A 5EEHA 1AUPA 1CERA 3CLHA 2AFRA 3GZJA 3OZXA 4CIWA 2XKKA 4M9CA 3T5BA 4YRTA 3ZU5A 1CEQA 3K8YA 3CZAA 3IJ5A 2EZ4A 1D4OA 1U2DC 3BMOA 3ND5A 3TAXA 3ABQB 4WKBA 3WNDA 3RLFA 5JEEA 4PX2A 2H8GA 2EW2A 4AJKA 3LUJA 5EWJA 4Q9DA 3A26A 3BWVA 1NR5A 4GOJA 4KYUA 3UKDA 3MBOA 1U0SY 5LA6B 3VH1A 3W3AD 4DIFA 4ZAYA 3SLKA 1I5RA 3IESA 5AJHA 1CTQA 2G6TA 2HMAA 3W9SA 3EX7C 1P6XA 3DBHA 1RNLA 4Z99A 2ZAMA 2DHRA 1EESA 4WFIA 3U4MA 4ALIA 2FWIA 5ED4A 1O87A 3LWBA 3MFQA 4FDTA 4TTJA 2MOKA 1REQB 1NUUA 1KEKA 2IYNA 3EOAI 4W5QA 3BJIC 4CQMD 1H2AS 2R00C 1O1YA 4CZ2A 4M1WA 4EEKA 4ZDIA 1K63A 4BPRA 3MCZA 3QELB 4IJ6A 4PYKA 1AKTA 3OJXA 5A5DA 5EJ8A 2OHVA 1GPKA 3ICCA 5ILOA 2JAQA 3IE1A 4BNWA 1CIJA 4IINA 1NW9B 3CLSC 4Q19A 4QBGB 2XBMA 4H6XA 4I4TB 1RRFA 1HXHA 1QG6A 1OYVA 2Z6AA 4ND2A 2X42A 2PX5A 5D2CA 2PS9A 1V45E 5IM4F 4C78A 5JHHB 1CP2A 3WIUA 3ZWQA 2BZ0A 3O1JC 2GEUA 4EZIA 3QVGB 4Y30A 1DAMA 1KTVA 1U1GA 4JMPA 3TQIA 2JLWA 1QQTA 2WJPA 4OQYA 5KJ6A 2Y1FA 3KTAB 4J16A 4KR0A 1L5LA 2IXEA 2ROQA 4Q6WA 1Q83A 3R8XA 2QG9A 3UFBA 3HXPA 1SUBA 1UKEA 3MT9A 5A71A 3TIVA 4DLTA 5JD6A 5KPDA 2JH3A 3TQRA 4MIKA 3D6VA 1JVNA 4IUYA 1I7SB 3RYHB 4FX5A 5E2IA 2G07A 3PUKA 3ZTYA 1ZEMA 4NJEA 4G1UC 1VPTA 4NOMA 2IYSA 1KVQA 4LRXA 3CH6A 2OV8A 1F8UA 3AXTA 3JQEA 3PENA 5EFOA 4B81A 4UFPA 4JA0A 2XVAA 1HOTA 2VTBA 1LK5A 1F7VA 4R05A 5FA5A 2OKGA 3QHQA 1ENYA 1ZYUA 3TZHA 5F7OA 2YH2A 4KQCA 3QY9A 3P5SA 3WR5A 3BIWA 3DFIA 3EASA 1D2MA 2RGCA 5C1IA 4D79A 4JLMA 1DOZA 2CCGA 4NTZA 4H7DA 5KTPA 4CEJB 1NN0A 3SF8B 4G8JA 3EMBA 5BSTA 2FCAA 1LPAB 4Y18A 2V7QD 3N75A 4G0ZA 4WN9A 3TZQA 3X1YA 2Z98A 5CA1B 3B51X 3PWSA 1NW5A 2QAIA 1B0AA 1KAMA 1NPYA 2MTBA 1E9EA 3TLBA 4A0RA 3T4PA 2V1UA 1ELOA 1XEFA 4BMVA 1H2RS 3I9JA 1XJQA 1EJ0A 2QP3A 2EG5A 2QAGC 4FYVA 4LPKA 3LT4A 5SZJA 1PZXA 1DCKA 1WNFA 2KQUA 2OHXA 3AR4A 1WIWA 1W0KD 3HVJA 4KSCA 5ALKA 4CL3A 5CNIA 5I51A 1BQ3A 1YS9A 2P9QA 3CUWA 1UMDB 1LDEA 1BG6A 2XH8A 3BMQB 3F5FA 3N7TA 3QVVA 5G3ZA 1L1FA 3LO8A 4RJTA 1M75A 3O4HA 2RHMA 1QLJA 3EQ9A 1YMQA 5JZBA 3AETA 3DW1X 5U1PA 1NVVQ 5L51A 2VT6A 4CFSA 1LNSA 2R6CA 3S2YA 1UZUA 1DDOA 1P9WA 2OORC 4WXEA 5JE8A 1GNTA 4C6HA 4YI3A 1ZXLA 1OC2A 1XKQA 3CRRA 3OIYA 4RQAA 2DBYA 3RH0A 5DT9A 4G4SO 1II8B 2ZBGA 4OOFA 2Y1DA 4Q3LA 3SEFA 2NU9B 1IEQA 4KKVA 3VO8A 2QPTA 2B8WA 4ZO6A 2ZREA 1ORHA 3AKCA 3NVMB 1R4MB 4FBMA 4KXXA 1V6SA 1GZSA 5K3SA 4HLUA 1G3UA 2WPDD 2A58A 1HFWA 3CM0A 1KZHA 1PNTA 1OA1A 2RK6A 3A1NA 4PW0A 4QYIA 4UM7A 4UTZA 4MYSA 4XH9B 3WSWA 3ZHTA 1Y8CA 1DWOA 2QE7A 3IVGA 1FFDA 3NIGB 4FYYA 4TWZA 1H8EA 5DXAA 4Z4GA 4G67A 2IU4A 1FXWA 2OO5C 3FB1A 3ZX5A 1PG5A 4Z9FA 1DRWA 3H8VA 3VR1A 5SZIA 5G0VA 3Q3IA 1JR3D 1PP4A 5CHYA 2MDTA 2ZI5A 2IV7A 1FYDA 2JIBA 3V42A 2GPAA 3TS1A 3OE5A 2WU8A 1Q7GA 2G9UA 4YCBA 2HA5A 2ZUFA 3IB3A 2QPAA 1NXXA 1V11B 3ZVKA 2A0UA 2IEYA 4XPIB 1QGZA 4RQTA 3Q9SA 2A5JA 3AKEA 4AUNA 1BU8A 5ALDA 1GSOA 1TCBA 3TLJA 1TUIA 5IAAA 1ICEA 2D0OB 3H13A 2AXEA 5DWQA 4PZ0A 1P2DA 1ZSNA 4FFNA 4HNRA 1PD1A 4HMPA 3ROMA 4D4KA 4X7RA 1CR0A 3U61B 2IYZA 2D13A 3N59A 2O2IA 2W9XA 1E1QA 5MDHA 1GTG1 2QN1A 4X8HA 1Q44A 4FP9A 5JLJA 2GCGA 4N49A 5FPTA 1NIJA 1QOPB 2BH2A 1XHFA 2HFKA 2PUFA 3NHPA 3QX9A 3T9DA 2R48A 3DOUA 4CMHA 3ZOKA 1NSFA 2PAAA 3ZCXA 5B7GA 2V7WA 4GOOD 4P5EA 3BB3A 3STHA 2W6MA 3GRPA 1U9JA 3K1JA 4JBXA 1XZHA 3I2JA 2H1VA 3OMWA 5ALTA 4D92A 4AJ2A 4QFCA 5JPDA 5KPJA 3MJEA 4CMBA 1ZM4A 3D6AA 5JMPA 5FWYB 1O08A 3FFXA 3M7IA 3ND6A 2N46A 2UXBB 1G18A 1QZ3A 3L41A 1ABEA 3RVBA 1VECA 1E2HA 3DMHA 4P08A 1MAAA 1SOAA 3GVCA 1KTIA 4LY6A 1I2BA 5E4FA 2YS6A 3RIYA 4DR2B 1XF9A 1H0SA 5IC4A 4P3PA 5C1PA 1W87A 3ENNA 4JEMA 1IMOA 2WTMA 1VFPA 2AXQA 1R0YA 3FGZA 5AI5A 2ZTUA 4TZ0A 2DM6A 3QXXA 1M72A 3I58A 4D80A 2XJ9A 2WHPA 4R8MA 3UK6A 1NF9A 4KQFA 4QJBA 2FZVA 1FTGA 2BEVB 2FK8A 4JVNA 4E33A 1DKOA 3AHDA 3P4XA 1RWMA 2H51A 1QXSA 3OZDA 3JV7A 1T5OA 3NJRA 5L4NA 1K0FA 5IJ9A 2FGKA 1FB5A 2J1LA 3ZHOA 3D7SA 4Q24A 3ETDA 1XTJA 5KNDD 2HHJA 1QX3A 1EHCA 1VLJA 1DKPA 2Z09A 2I6FA 5LP6B 2PWAA 3R5HA 1MB4A 2I8CA 1D8AA 1P9OA 2GBFA 2ZSUA 2F1KA 3GLGB 4D0NA 4N8DA 2RGWA 4R16A 3KZNA 1HH4A 3AJDA 2LKCA 1L2TA 1QQ7A 3JQ9A 1JALA 1JNXX 1N2CE 1SOWA 3AF2A 4WA7A 2Z95A 4B82A 3HN6A 3WLKX 2JFUA 4MKIA 4UHKA 4YJ3B 1P74A 3AJ8A 4UC0A 1DX4A 2BD0A 2G5TA 2HBZA 3QKRB 4X66B 2PYIA 1ECGA 3W7BA 5IVKA 2JBAB 5JZVA 5KOYA 1HO3A 1AS0A 4RK7A 5F52A 1UZAA 4IX1A 3CF2A 4EVIA 2CLSA 3T61A 3I6YA 1CHDA 5HF9A 4U2BA 1KQNA 2XZTA 1FSPA 4YUYA 5FTLA 1OWPA 5JAOA 1JG7A 4INPA 4ZVKA 5M2QA 3IXLA 1EX6A 2A5FA 3D8NA 4K8RB 3KR1A 5CFPA 1JHPA 3Q2OA 4M83A 1P3JA 2I4LA 1QK3A 5T57A 4BMOB 1YO6A 1VKHA 4C21A 2ZXUA 2O52A 3T9BA 2ISCA 3QBVA 1K27A 3TTYA 1A9OA 1PD0A 3PVSA 1SOMA 3P1JA 3HO8A 1ZMTA 5HFNA 3OY7A 4X7PA 2C2WA 1O94A 1OFUX 1OI4A 1XZPA 4J0CA 4EVSA 1JQAA 3O91A 1V16A 3G9UA 4JVSB 4RABA 5FADA 4W7SA 2E49A 2INGX 5KYNA 2SCUB 4EFDA 2AYYA 4B3GA 3QJGA 1HL7A 4UTOA 2RGUA 4BBJA 2DYKA 3DTTA 2WB4A 3NUGA 1U8TA 2H9YA 1KFKB 4ZJPA 1P9LA 1UXHA 3DAHA 2Z2YA 3ONWA 4FWIB 4X85A 3SVLA 1VPVA 5L3SA 2BBSA 2F9LA 1NJ6A 3A9SA 4J6FA 1FS4A 3OCVA 3RRFA 3JR3A 2FJ0A 3R4CA 4B3RB 1MIHA 2OGZA 4XFKA 4ZVSA 1GYQA 4KZPA 4BKOA 5CDTA 1DMSA 4BGIA 5CXUA 5TQ2B 1U3VA 3X1ZA 1JR6A 2NU6B 4PPQA 2DUWA 4LHEA 2J4DA 3D6HA 2WZQA 2C4NA 2E5WA 3A6EA 3DTVD 4Z86A 1DKUA 4I6EA 4F3RA 2GJ8A 2BFMA 4EG5A 1SIUA 2DLNA 1WZNA 2FWRA 2QVCA 1W30A 1NRIA 1GM5A 1PW7A 5IDVA 3DL7A 4PLCA 3AYXB 2AN4A 3I2HA 1NVEA 2WNSA 4KOAA 5C8VA 4ARAA 2BHSA 3RUIA 1EFDN 2BHNA 2FWPA 1SQFA 3FPFA 4OUDA 4Q82A 4ZQHA 4KTVE 4MEAA 4F2GA 4I9GA 4WCFB 4H17A 3TIIA 3QEMB 1J9EA 4A8JB 4F72A 2PXHA 3M8KA 4PN7A 2IUSA 2X58A 4YMTA 2ZUEA 4PPYA 2EAUA 4MA5A 2FWAA 3EYWA 2NP7A 2DG2A 4EJSC 5AI6A 2NTJA 4G5OA 2W2NA 3H97A 1V6AA 3DVAA 4JYCA 1CJMA 4IAOA 3M6WA 3STTA 4AMYA 3VYUB 2E7ZA 1E8DA 2OVFA 5IEJA 1Y6FA 3VH2A 1NZJA 3QBEA 3A9VA 3HDJA 2ZI6A 4MCAA 5DLEA 2YWBA 3SJCA 3WRVA 1LLFA 4MS1B 4FPXA 2EFDB 1BDBA 1E2MA 2NU7B 3HWX1 4L9SA 1E5TA 5DTJA 5FYQA 4OI1A 4PN3A 2DXIA 3F7OA 1HLGA 5K3FB 4Z0TA 5CAEB 1KYTA 1NONA 3DHVA 3LVBA 4F85A 4KCGA 4G37A 4MWZA 1ETHA 1JXAA 3ETJA 4UDXX 3SEZA 5HUJA 3DDSA 1FP6A 4OV6B 2JAWA 3DR3A 2F8LA 2VDUE 3WAKA 2AW3A 3IDOA 4H35A 4H4CA 2UXDB 1N1MA 4DQVA 3FKSD 5BSWA 3MILA 1XEWX 1Y33E 2ZIXB 3EVGA 4XOIA 2CL6X 4N40A 3JQDA 3CNQS 2BTQA 4QUEA 4F06A 4YAIA 3AUKA 2RC5A 1JDSA 1R64A 2Q6LA 3N0RA 4Y0VA 1E3TA 3LYHA 4J9VA 1DEOA 2FDCA 2XUHA 1KH3A 1WQ1R 3FKJA 3QWHA 4H59A 2ATEA 4UAUA 2C5EA 4B3XA 4D4HA 4F3CA 1DQNA 2B30A 3A4NA 3RQSA 3NDJA 4OGWA 5LB4A 4BMSA 4DIKA 5B3JC 2IF2A 4DGSA 4Y6LA 4H77A 3QYAA 1GPWB 5ARBA 1P6UA 1TZBA 2HGZA 3ED5A 2V0CA 4Z2AA 1EBBA 5AVQA 4B3FX 5IG2A 2EWWA 4XLLA 1B73A 4KE6A 4I1VA 4A8TA 3AVWA 1UJ4A 3A1UA 5GIPE 4L6CA 3OZBA 1JQ5A 3CRNA 1F8YA 3HBLA 3ZLBA 3WSVA 1OXXK 5AM1A 4EQ6A 1SK9A 2IX9A 1OVMA 3FNFA 1D07A 1K2WA 1SUIA 3BMNB 3KB8A 2JEYA 3QG5A 4HEHA 2P2ZA 3PGVA 1YZ3A 5I4BA 3OQ1A 4JB3A 2EJCA 5IEBA 4WLFA 3EGOA 2XEDA 3MSCA 4WNAB 2PRSA 3VR6A 4ED9A 4EDHA 1BW9A 4Q9JA 1HQYE 4OQZA 5CIQA 3KYDA 3CX4A 3MTGA 4EG1A 2RE8A 5CRIA 2M6KA 1IJEA 4JLBA 2E1PA 4YACA 4E4RA 1NF8A 3OURA 2IS4A 2O8CB 4TTQA 5ALZA 3DZFA 3E8MA 3P2OA 2Z3ZA 5GJWC 4F2HA 2HU8A 1IE3A 3NG1A 5HUQA 1JMVA 3EFEA 5M29A 3JWEA 1KZ4A 4CYMA 4QFMA 2RGNC 1ENOA 2X7JA 2ACVA 5FBQB 3ZJ4A 1UIMA 3SHOA 1YJCA 3T3OA 2KS6A 3W8NA 3UUGA 4NX2A 1P2BA 1ST3A 2UDPA 5E9JA 1BDIA 1XG5A 5HE9A 2QPLA 2EX1A 3TX2A 1Q91A 3WL3A 3EIQA 4DQ0A 2AZXA 1HFJA 3IHTA 5JSFA 2BKUA 4DQXA 3LUAA 1X1QA 3W5CA 5AK4A 4G56A 3KOYA 1HZZC 2C82A 1Z6YA 1OLXA 2JK0A 4G2NA 4WTOA 1JE1A 1T0HB 3AFIA 3SP1A 3SYKA 1JAZA 2QUIA 1WRBA 3AI2A 1C4WA 3N2YA 4C2AA 4MVWA 1TZMA 1FBTA 1QYCA 1FP4A 4ACBA 1TF7A 3HJCA 1PVVA 2CK3D 2O54A 1D5CA 3AEQB 3TB4A 5E1BA 4ZI7B 4BHTA 4J1TC 3W6NA 1ZHFA 1AZLA 3AJEA 4UBKA 3SQDA 3U3RA 3VC7A 2P30A 3EGWA 5C3UA 1QYVA 2V7BA 5CFQA 1L4EA 1XWIA 2I6GA 2M1ZA 1KBQA 1MO4A 2TMDA 4HPWA 1U90A 4OQ4A 1HE5A 3TL2A 4C3UA 2DULA 3DBLA 2NO5A 3ZNPA 2P9GA 3BDAA 3KV1A 4YIHA 1Q57A 4L5JA 4QYMA 4F9EA 1QRDA 1SIOA 2Q1SA 3H11B 1LD3A 1Y48E 1MV5A 3G2OA 1N77A 2HCBA 3GXBA 5DLDA 2X9VA 5EJAA 1PFVA 4GWLA 5KQLA 2RCYA 1AZSC 1GSHA 2R6ZA 3L18A 3LIIA 4H16A 5LOVB 1HOXA 1QWSA 2PFKA 2A78A 1U02A 3B1XA 4MYTA 3QZUA 4FMCB 5BSHA 4HB4A 4O4IB 3ZG6A 1SC4A 3H42B 4LQ4A 1IDN1 1TT5A 1U7DA 4PGFA 1JTEA 1D4FA 1NQUA 1WUKS 2AOUA 2GH1A 2W2PA 1UOPA 3QXSA 4K5QA 4QX6A 5JDIC 2GGSA 1P7WA 4WASA 1NVWQ 3QMWA 4LXHA 2QNIA 4PR0A 4MUYA 3UWMA 2YNMC 1FNCA 1XCOA 1QGUB 3DDHA 1U4NA 5IT5A 2O14A 4DSZA 3V4SA 5CDFA 5KQGA 2I2DA 2EGGA 2QW1A 2W2LD 2EZ8A 3AIKA 3PFIA 1PUIA 2YV2A 1RFGE 2CGEA 2D1TA 5A5FA 1NLMA 2HQBA 1IPHA 2VDMB 3TGPA 3AVYA 4BMCA 4Q01A 4IWYA 4V0LA 4M37A 1GNQA 3F6CA 3O90A 3WL8A 1M6YA 1T35A 2TRSB 4LYHA 4KLAA 3BZUA 1UZMA 2VP0A 4MGKR 4TMVA 3H9JA 2BEJA 2D3WA 3PUIA 4IHJA 5AXBA 3H0EA 3EIEA 5I9BA 3KPJA 5CJPA 4BJ1A 4BFYA 4IEIA 4YCSA 2AWOA 3GGJA 4QPCA 5AKXA 5IJWA 5IMSA 2WTNA 5MGBA 3ZJTA 4BU1A 4KMMA 3PL1A 1Z2NX 1CRQA 5TIIA 1A9ZA 3H5IA 3T0IA 3WLHA 2QGZA 2P3QA 5EPOA 3TE6A 3ITEA 4KAAA 3OX2A 1DAPA 1OYWA 2JIMA 3MTIA 4MW7A 3L05A 2PGAA 1J0DA 1YHYA 3IQXA 4OSOA 4YCAA 2O59A 1LF5A 1RYYA 4JWKA 2DY0A 3ER6A 3HP4A 1CRZA 2ZXEA 5TV2A 2IV3A 5KWVA 4RA6A 5F51A 1SUWA 4F04A 5EGNA 3UJBA 4CTJA 1ECFA 1N2SA 2J9FB 2GJSA 2QU8A 3BJMA 5EGSA 2IY7A 3UJ8A 4YXWD 4KQWA 3MWLA 5CA0A 2UVDA 2PD3A 3AM5A 4EUFA 5KQPA 2LCQA 1L5WA 1T4CB 3OFVA 5GGYA 3Q5EA 2GX6A 2H1HA 1TA0A 3CW9A 2JBHA 2WD7A 3O6VA 4RLFA 1VBNA 1UEJA 3SDZA 5LJLA 5ED0A 1SBTA 1XT6A 4CEIB 2V3CC 1U0GA 1UMBB 1CZOA 5GPBA 4ZU1X 3RTCA 3DKRA 3TEMA 3W3AH 4HPJB 4MGHA 1L5MA 4KN9S 1U9CA 2PQMA 4K6FA 3RS7A 1VKZA 3KSUA 1BMFD 4HH4A 2AZTA 3FDZA 4ZV7A 3U56A 3DBRA 1QTNA 3CUUA 1Y42X 5EIBC 3ZCPA 1JI0A 1AKMA 4C5AA 3OM8A 1WXEA 2QIPA 4I36A 1JTVA 4DLSA 2NO1A 4ER0A 4HCJA 2C96A 1YB2A 3ITNA 3RDPA 2XMZA 3BWCA 1IULA 1QP8A 4N12A 1R0ZA 4DKXA 4GDFA 2R79A 2CNWA 1YGPA 3GLFA 2KM1A 1IEVA 1K66A 1OH7A 4LF5B 3OFSA 3L4SO 1RTKA 3LYAA 3OCCA 1JDJA 5DNEA 1DFHA 2D74A 2PL5A 1EFPA 3LI2A 1XQVA 2BKLA 3M5DA 3UGQA 1PHRA 1QG0A 3RAEC 5K3CA 1JBEA 4LY3A 1U28A 4K7JA 3P9PA 2L42A 1RPJA 2HRQA 1C7QA 4RDHA 2Y68A 4CMEC 4X1IA 4RM2A 3T4UA 1LB1B 5J40A 4N03A 2VL7A 1TIKA 3ZVNA 1GAXA 4ITRC 2WD8A 4KNYA 2GXSA 1M5RA 4AXBA 1C9EA 1H6AA 2CL0X 5MN4A 2WILA 3A6HA 1ZISA 3LUPA 3BMCB 3LQRA 4R7ZA 3LDUA 4J0FA 1H0RA 4MWBA 3I30X 3IALA 2NV2B 3UPUA 4MNTA 3GDHA 4NABA 1L5GB 4EGFA 1OREA 2B7BA 1Q16A 4MR9A 1NKTA 4CV3A 1P2FA 4M7PA 3WMEA 4BOYA 1PZMA 4MCJA 5JS2A 2BGLA 2F3UA 3FFTA 4D3ZA 4DREA 1I3NA 5CLFA 2I4OA 1VMKA 4HSGA 5JCJD 4BZXA 4L0DA 1K97A 1VRCA 4DIDA 3ICVA 1BQ4A 4E31A 4F4HA 5DXFA 8ATCA 1RZRD 5KMGA 3C41J 4YAGA 3AJ9A 2E87A 2X0KA 4CTOA 4ZFNA 1RAIA 2H08A 1DELA 3ZZ1A 1H65A 2BFPA 1UPTA 1EFKA 3TFOA 4RTRA 5CB4A 1CPYA 1Q1BA 2ZSKA 4HT3B 5A9SA 1PLLA 1SXJA 3SSMA 2R62A 4CPDA 2HJWA 1E2FA 3WQQA 1WB5A 4E21A 1DKMA 4F6LA 1X6VA 1C80A 5DX8A 3CBGA 3W34A 1M66A 2DKNA 5BWNA 3S2UA 4R1NA 2VIIA 2FZEA 3EXHA 3ZXXA 1FMFA 1NNEA 4FKMA 2BJHA 4NCXA 4FSHA 4COOA 1E79A 1EFAA 4HBZA 3OIVA 4LHZA 4OJNA 2XODA 4QDTA 5DK4A 3SHVA 4I2NA 4DZRA 2DX7A 2J7PD 2YASA 4IJKA 2ZYHA 5HILA 4EGQA 5BMOA 3DF7A 1PNRA 3R9XA 1K7YA 2P3SA 1ZNZA 4FJ1A 2YQ4A 2QJOA 4U7JA 1USIA 3PJGA 3QSYA 1EVZA 4G4GA 4L78A 5BMVF 4RIFA 2HWKA 4XQGA 4BGDA 3UVEA 3P0EA 3C3WA 3AOEA 4Q66C 4TYQA 2G76A 1JYEA 4JROA 2VA9A 1T5SA 4JBIA 5CW1A 3ZKAA 1PVDA 3T3EA 3PGLA 2XBUA 1H9BA 5BW8A 4P4GA 2K87A 1ATIA 3RT1A 2RHBA 4J3NA 1YQDA 2R86A 5IKOA 5F77A 5ESWA 4C14A 4RDIA 3AT1A 1ZMOA 4PLPA 3W1WA 1KZ1A 1ABBA 3U44B 2A1TS 2R8EA 2OESA 1K92A 3IV6A 3S2GA 4V0QA 3FNEA 3EHEA 3PFHA 3ZE2B 4B4KA 3R3YA 1BOOA 3RJ5A 4BLWA 3GB9A 4CETA 1KQFA 5A7FA 1DO2A 4TTIA 4YHHB 3RBXA 3GMTA 1RABA 3I9V6 1W7AA 1MJHA 2XWPA 3DNMA 2HA6A 4H4DA 3IKTA 2WNHA 2AVDA 4Q7LA 1MXHA 4DMFA 2GILA 3X3HA 3KFXA 7MDHA 2OB1A 3NWOA 1NM5A 1AM4D 1AXGA 1HE4A 1YIAA 3HGMA 2NO4A 4FR0A 5GV8A 3TI7A 1CY7A 4NYIQ 3SM9A 4GC5A 3QMVA 1UBRS 1ZVKA 1Y0BA 4CIXA 4RD0A 5HIJA 1X80A 4M9ZA 5BUCA 3HN2A 2XB4A 3U9LA 4DLWA 3PT5A 1KMQA 1SO8A 3D8RA 3EZNA 3IODA 2B1QA 1UT5A 2C1XA 4B71A 5IDQA 4OYYA 1C1YA 4TXLA 3WDSA 4OXRA 3M4ZA 2XHZA 3HI6A 1I5EA 4CBVA 2MSWA 2PRZA 3COSA 4P3OA 4OHRA 5IVIA 5BO5A 5L3RA 4F9GA 2GEKA 1FLNA 4YDQA 4QA9A 5B7QA 1CZNA 1BVYF 3B36A 1TZCA 3AF1A 1PAUA 1C81A 3WIOA 1QCCA 4GR9A 4B2YA 2Q49A 1YS7A 3EB9A 4JJAA 2R1TA 4S1VA 4K1XA 5LU8A 3I61A 4A1OA 3D8BA 2X8WA 4IO1A 4G0VA 3WGUA 4UOQA 1PFKA 5H0IA 4I19A 3WK9A 5KSZA 3R9IA 4MEBA 5J2TA 1YD7A 4JODA 1Z5PA 2QYOA 2QL7A 4KPGA 4R31A 1T0IA 1Y1QA 2ZT7A 2RHGB 2VHXA 3ZS9A 3FA2A 1QE3A 5JNRA 1A4IA 1MT3A 2QLLA 5DM1A 1PK8A 3SMQA 1UPFA 4ZC1A 2XYHA 1ORTA 1QRAA 2XQJA 4BFVA 3FJYA 2IFTA 1XXHB 1BA2A 1GHTA 1GSIA 4UM9B 5A0FA 1P9RA 1KRXA 3WKCA 4DSOA 1E7SA 3LH5A 3PQCA 1IN1A 1JG1A 4DCOA 4JKOA 3C45A 5LDGA 4B8ZA 4IKEA 2BY4A 1ACLA 3HM2A 3MTEA 2GEJA 3V97A 3QEBZ 4HJRA 3T99A 1NXQA 1V7QA 4PIPA 2F59A 5DGTA 5FNZA 4CIBA 5JQGB 2FMKA 5H4HA 2AUMA 3AFGA 1QO0D 4B3DA 4BRUA 4US0R 3ZHUA 5BRNA 1JR4A 1BEUB 3KOUA 1DI0A 2XQKA 5KNDH 3THYB 4OHKA 1R15A 1C1XA 1B3BA 1NE2A 2XGOA 3DUFB 3KVRA 3Q0IA 4RLSA 2DR3A 2ECFA 2W6ZA 2A1TR 3PWZA 4XDYA 4MULA 4BDSA 3E23A 3FZQA 5IKPA 3JVIA 1EP9A 3F4BA 4E03A 2R60A 3PVCA 1FU7A 4FOSA 4P54A 4F91B 3CVWA 1C2YA 2AI1A 2UZ1A 4QPNA 2ST1A 4DNPA 5JH7B 4IS3A 2PX3A 2WLSA 2XE7A 3EVTA 4HTFA 4MA0A 2P41A 1L8XA 4MB6A 4D7AA 4DLKA 2QQEA 4XQ9A 5KHLB 2FRXA 1SC3A 5C2JB 4DSUA 1IBSA 1RVV1 3PTLA 4DEYA 4HS4A 4NPAA 3V48A 3W5IA 3HR4A 1O2DA 4P3KA 2F55A 1N6IA 4TPKA 4ZAWA 1HQKA 3QKWA 1HQCA 3GL9A 4F1KA 3CNNA 2AI3A 3DOJA 1UKYA 2WFLA 4BO1A 1UODA 5CVTA 3L02A 2ENWA 3QKTA 4M0DA 1WD7A 3M4XA 3D8SA 4GKJB 4M7RA 5KOHA 2ZE7A 1R7RA 3S1AB 1VC2A 2Q4BA 3DZCA 4TMKA 3NM5A 1WU8A 4IFTA 4B2LA 4C9BA 1N4AA 2IY9A 5AQEA 5ALHA 3BD8A 1M2KA 3SZGA 2V59A 1T5DX 1PHPA 3E7WA 4UHBA 4RFVA 4CM1A 4CIDA 2C5FA 2Y1XA 5BR8B 1VL1A 3SGLA 2P5UA 2O05A 4TSFD 2AG5A 2XYVA 1N2JA 1U0RA 1EINA 2DHDA 2XB9A 1H22A 4DADA 1ZUNB 2FJPA 5EJGA 2NYVA 4BTVA 4EM6A 2QLNA 1R2QA 4ZO7A 3VBEA 4TWRA 1IU9A 3HVHA 3INRA 4FE3A 3ZIUA 5I01A 2QP4A 4MUAA 1S96A 4UHFA 1PE0A 3WLSA 3GLRA 4L16A 2O4UX 1KI4A 3PD0A 5AXDA 4TKVA 2PU7A 1F2DA 3MT8A 4X6LA 3UH1A 3UHPA 3V55A 3VDRA 3RABA 4ZIRB 1L1EA 3V7FA 1Y34E 5HS6A 3RGWS 1EA7A 4GM1A 1AD2A 2JEOA 1Q95A 1WPXA 3HRHA 4IFIA 1R6TA 2SHKA 2XUIA 4JB0A 4WGGA 2IUUA 3F6PA 4AO6A 2WUFA 3CWQA 4ESHA 2GM5A 1MPXA 4KLCA 3DDOA 3G89A 1S3FA 2QN2A 2BYTA 1RXYA 1JQBA 4AF6A 1HDYA 5H59A 4XLTA 5LXTA 1LPPA 3UT5B 4AMBA 1C7IA 4R1MA 4OBEA 1K5GA 5DULA 1WXXA 2AK3A 3LQYA 2FR8C 3R1IA 2V6JA 3G8AA 4MIYA 1L8AA 4TGLA 2WKQA 3WYDA 1RRGA 4DW8A 1B74A 1KQ3A 4EKGA 3CVOA 3JXEA 4FFBA 5K0GA 4OFWA 3IDAA 2Z6UA 3L7OA 3AHJA 3KOZA 4PZEA 5ADHA 1NR7A 3PDHA 2XB2A 1RWQA 4MR7B 4EKNB 5HUHA 5MHTA 1JDBB 1FIUA 4MV7A 3C7TA 4X64B 2JKZA 3MWEB 3NBZC 2BEKA 2JHPA 1FS5A 4JDUA 4P98A 5K99A 1RXUA 3RAPR 4NIMA 4MQMA 4JL8A 4WLNA 1FFXA 1MB0A 1MAWA 3GZ4A 2QBYA 5CJJA 3VR2A 5DHQA 1JFFB 1ZGGA 4B6JA 3ZK9A 1Q1AA 1JT9A 1L5FA 2RK4A 4JBGA 1YFJA 1M2WA 3BGSA 2WWHA 3CLSD 1QORA 1AGPA 4LEIA 4PC3A 3RTAA 2OCAA 4A8PA 3FTEA 1QIIA 3FI9A 1KZ7B 4LKRA 5B1HA 3DPUA 2D2IA 3PD1A 3ICPA 4MICA 4ZZ1A 2IX3A 1NG1A 4ADSG 3PNMA 3JW8A 3IDSA 2CBZA 4R7GA 5COQA 1H1LB 1MF7A 1TVMA 1UWVA 4P2BA 1PJ4A 3WGGA 2O8DA 3KQPA 2A84A 2R2AA 4ZANA 1TU4A 4NATA 4YASA 4QEZA 4GH5A 4L0CA 3JD1A 5IXYA 4ZAVA 4F7WA 2Q3BA 5JTTA 5B1SA 4RYLA 5B58C 3B1YA 3MJSA 5FX2A 4PZPA 3LL4A 4IIVA 1G1MA 3K70B 1WKVA 4C05A 2FPIA 1BCSA 2PKQP 3H7IA 1KOJA 4ZGWA 5TQJA 1J1UA 1ECJA 4II7A 5CNJA 4MPRA 4RMHA 4HI0E 2GO7A 5CPBA 1TU0A 3B9QA 3OE4A 2FWJA 1ULHA 4QASA 4QODA 1A8IA 4UNIA 1PL0A 3MLEA 4C4ZA 2H4FA 4P7BA 4AMVA 3MWKA 1A71A 1HYEA 1O57A 1Q7RA 2RCNA 5AUPB 2IYTA 3N28A 4GP9A 2EWVA 2G82A 4EGJA 1VBFA 5C51B 1Z0JA 2QN3A 2B83A 4UCXA 4MS4B 1ZIPA 1JEQA 1GZ5A 2VTEA 4GLBA 3U4AA 2ZJOA 1R9JA 1A82A 1G7SA 2SKEA 2WLTA 3JQ8A 1C0EA 3OJEA 1KYVA 1YUBA 1MZVA 3IP7A 4JFRA 1COWD 1O3YA 7MHTA 3DE2X 3ZY2A 1CRLA 1LXCA 3H2HA 3T7EA 3NETA 1M1YE 1JPUA 2E85A 3OMLA 1L5QA 4XWGA 4GICA 5TMDA 2OSVA 2J32A 3UPDA 1RWKA 2PSHA 3DVQX 3GI1A 4ZXFA 4N7MA 2MSNA 2WVGA 1TKBA 4JXJA 2QA5A 2ODPA 2VFAA 4KZKA 5FWXA 1Q15A 3A27A 1S2LA 2OMEA 3K09A 2OXFA 1GKKA 2XWBF 1LX6A 3GBVA 2DETA 4ND8A 3PB3A 3MNFA 1Y4DE 4IJVA 3H5AA 1A2OA 4LNUB 1LVGA 1OD6A 2V8OA 2RJNA 3N53A 4INOA 3WL7A 4CU5A 4ZGBA 2ZZNA 2F62A 4NJMB 4TQGA 4FDMA 5DI3A 1QR2A 4RHXA 3NLLA 4D9FA 2BL4A 2HUNA 5JSQA 5KI6A 4ZCLA 3DVRX 4ZI5A 3JY6A 2FMFA 1FQOA 4KQ1A 3MUFA 2ZB7A 3H1TA 5A4DA 1Z82A 3I37X 1VE5A 3HO1A 5IKXA 1YAJA 2IF0A 3ZX4A 5CEJA 1GAQA 1XEAA 3EGIA 3JQPA 3PI6A 4KBGA 4PHTA 3LT1A 4BMYA 1P72A 1LX7A 4DA9A 3G1UA 4Y1RA 3PVZA 3ANLA 3NHBA 3RD5A 1UBEA 4IQGA 3N8NA 2YICA 4BVJA 4UQLA 2D4HA 4D42A 3JAMA 5LZ2A 4O2AF 3OA2A 5FJIA 4CJXA 2G7ZA 1M2HA 4FR5A 4QSHA 3A6LA 4DT1B 1C3VA 4M89A 4FHEA 4PLHA 4OHFA 1T5HX 4J94A 2XGMA 1XD2A 4AKSA 2QLMA 1ODJA 3FFWA 3QE2A 4YJHB 5SYNA 3VR5D 3UMYA 2C5HA 5IFLA 2CWWA 1TVKB 2DPGA 3GR6A 2OWEA 4LECA 1G60A 1NBMD 3LZCA 2QX8A 2PV7A 3OQ6A 5I4CA 2A1UB 1KVTA 3OPNA 4GRAA 1A1VA 1Z4QA 3E81A 5AHOA 5IDXA 1MQ9A 1MIOB 5CU7A 2GESA 3R74A 4L3OA 2NYAA 2PT6A 2ATIA 3LOPA 2AJCA 3CNEA 4DDKA 4YRIA 2IEBA 3PPWA 4OL0A 1JS1X 2JGDB 4W9MC 2QG4A 3B13B 5H83A 3RVQA 1WZ2A 4KUHA 1C3LA 4F1WA 4MLCA 1E9FA 2EATA 1YS4A 2XGGA 3BFXA 3O21A 3U1TA 4HVCA 1IYZA 4FFMA 5CFMA 1A8HA 2IZ7A 1P3DA 1NW6A 2ZI4A 1M8PA 3MCUA 4FHFA 3RSZA 1DDIA 2XB6A 3EG9B 1JFLA 2PLWA 2R1ZA 2P5TB 3BJEA 3C8ZA 1FQJA 2QX9A 3M33A 2HGSA 4KLZA 4CIAA 3C70A 1KI8A 2DC1A 4B3TB 1S4QA 2OEPA 2R11A 3EEFA 3FRHA 3Q2IA 1XTPA 2ODBA 3O7MA 1RP7A 3QA3E 1VIVA 2WABA 4R51A 4F11A 1SU7A 3WA7A 3OP1A 1PDWA 1T1EA 1YZUA 4PYLA 3F7NA 1H4VB 2QVZX 1P1CA 2GCNA 2M2IA 1W76A 2AH5A 4PC6A 1RYZA 3ZJ5A 3THWB 2FSPA 2QEQA 1RXSA 3GCDA 4DIOA 3CUVA 3N6RA 4N18A 5LOVF 2QX6A 3IUMA 2Q3CA 4L4RA 4PRLA 4IBOA 3AZOA 5FOXA 2PKEA 1RVDA 4NYIR 4Q9HA 2R84A 3NBMA 4AUEA 4YV2A 4R81A 2XT9A 2DU8A 4P38A 2ZJFA 1AA6A 3G2QA 1P7CA 1Z6ZA 4HXFB 1BE0A 4U2FA 4A5OA 2WSIA 2BF4A 5DYIA 4PCVA 1QO7A 1GGNA 2YN2A 3L7MA 4L4YA 4PYQA 3K0FA 3M6AA 4X60A 4YQEA 4PZ9A 3ZWXA 2X3UA 5HX7A 5A7GA 1KORA 5A3RA 2XGJA 4KQKA 1H2BA 5ICCA 4S35A 3HTXA 3C4QA 3A3OA 4XSGA 3K0CA 4O2BF 1GCAA 1P1HA 1IONA 4UHJA 1FL9A 3VV3A 1TQ8A 4PM4A 1NQAO 3RFVA 5C3MA 1XDBA 1U65A 1Z2OX 2IZ0A 2YW2A 3G13A 3FUWA 3T9EA 1G0OA 2YRFA 2IOFA 3KAJA 5BQ5A 1NNUA 4K9LA 4BJ6A 3T35A 4BKMA 3LE8A 2OBLA 1BMDA 4WK2B 3C1UA 2TMKA 1YRAA 3PC4A 4XASA 1FJXA 4RLHA 4Z2YA 3U62A 1XZ8A 4MRMA 3OQNA 1GG5A 2LWIA 4D9EA 5KWEA 2WIAA 3AV0B 4YUVA 1A50B 5MFPA 2ZBDA 3CBQA 2AX4A 4LZPA 2QNRA 4Q7MB 3W0LB 4CUZA 3N70A 4B7UA 2UVPA 5BQOA 3RVPA 3STXA 2C3PA 4MMZB 2O50A 1KETA 2ZBQA 4X92A 5TEVA 5JAPA 1ESNA 1DJMA 1GPUA 1WULS 5KVVA 2DLCX 3RUEA 4E5NA 2AI2A 1YZGA 2O8FB 5LKAA 1IUNA 2GZHA 2YL2A 1EGQA 4MB2A 4CFZA 3OKAA 1AO0A 2V5UA 2H4WA 1CNEA 1CDEA 1KFEB 2C58A 4KGXA 5DHSA 2H85A 4XYMA 1XKTA 3DEHA 3BGWA 1BKDR 1XJ5A 4MCIA 2PN1A 2LXNA 3RVLA 3CG4A 3L4KA 1KU6A 5LCXA 4F21A 3NYRA 4UATA 2GCIA 3ILVA 4KXUA 3WHPA 1U9YA 5EIEA 1BS9A 1U3CA 4QT4A 3D7RA 4KN8A 2JFPA 1XZCA 3E61A 3CZCA 3IQZA 3MJCA 2ICAA 4KO8A 5EE1A 4YUAA 4YXFA 1BRTA 2V7GA 2Z30A 4PCUA 2UZ4A 1W4CA 1EP1B 1PU2A 1XHEA 2W83A 2CUZA 1N2BA 5AUOB 2GD6A 2HD4A 5K09A 2ZE6A 3V3KA 3IXQA 5SYAA 3UM9A 1QJCA 3I6QA 3V8QA 4ZOLA 1GKYA 4QSMA 4XVUA 4AECA 1T8RA 2M6LA 4KXMA 1P80A 4XUCA 3BWXA 4HDCA 4CF5A 3TAHA 3DC7A 5AVWA 2QQGA 1I6MA 1R66A 3DHWC 1JSCA 2L82A 2QWXA 5LDDC 2D5LA 3WNZA 2HDHA 2HO4A 2F3PA 1F20A 1QYWA 2B37A 2F8TA 2FRVA 2R1VB 2BKAA 3PQ7A 4YJ2A 3KEMA 3N05A 3DWGA 2B92A 4BLPA 1VJ1A 4ZJYA 4R2JA 4ZU3A 5I3CA 1MX3A 1RJ9A 2G5GX 4J76A 5EP4A 4DRXB 3DWFA 2IV2X 2PJDA 3U4IA 1T91A 3PDIB 5EA2A 2V6MA 2WA1A 3KM0A 4YLEA 5FO1A 2B1JA 1Q1EA 4CVNA 5L6MB 1P0FA 1SQ0A 5LQCA 3QNUA 3ZZTA 2VAXA 3CV3A 3WLRA 3ZCVA 4JP3A 2HV8A 5KSOA 1SVSA 3EAQA 4MV5A 3ETNA 3S2IA 2ETXA 2UKDA 4JJ6A 4KQIA 4ZT2A 1X1AA 1T10A 3KZVA 4M9UA 4CKCB 4OJYA 1KK0A 2H0AA 1J8VA 4HUQA 3RS5A 1XL1A 3EEBA 4QDKA 1EM8A 2HQ1A 3JATA 1O0SA 5KU7A 1LV8A 4R1PA 1F8GA 1TM2A 1F1BA 3HKDB 1A4XA 5HG0A 4RL6A 1UJCA 1HYGA 1VPEA 3EGXA 3WQSB 2WJVA 1KZ9A 3S8YA 3U60B 2JARA 1LBIA 1NLUA 1AKNA 4MRAA 4ZPJA 3KC2A 4DIMA 1CIPA 3CPSA 1N3IA 4FFLA 4Y9UA 2J6BA 2OP1A 3H86A 1W52X 3BICA 4FDUA 4GDMA 5E6SA 5AVJA 5TNXA 4E2ZA 4KPYA 2EJVA 2Q1YA 1T15A 2QMHA 3RNOA 5BV2P 3U09A 4LYDA 3TLGB 1ZD1A 3AGQA 4MQEB 3ZIAA 4AN1A 1OSNA 2OCDA 2OP0A 2XTNA 3NYWA 1Z9BA 4R40A 4K0KB 4L5YA 4FE4A 3G8DA 4N0EA 4BNYA 3AF3A 3LC0A 4DY6A 1XD8A 4MK4A 2PY6A 4DR5B 4UW9A 3EOZA 1SKUA 4KACA 2P3OA 1QSGA 3LJKA 2GHRA 5GZ6A 3SHQA 2AFHA 3ESCA 3OLVA 121PA 1RE0A 3N86A 5FEMA 2YOHA 1O9BA 2HRDA 4DABA 1ODFA 2DQKA 3O75A 4WY2A 4R3WA 5IJAA 3B85A 1KEWA 5FNVB 4JUCA 3WK8A 3F2VA 5D1HA 4EW6A 5TPZA 1N78A 1L1RA 2RAFA 2OENG 4QG7A 1V4VA 1OXMA 1KO7A 3IILA 2G1UA 2YY5A 4DIBA 5KDOA 1SCUA 1JMYA 1HDZA 4FZRA 1B43A 2PUTA 2GDZA 3MERA 2DGDA 1HV8A 1S8NA 2X0NA 3NNSA 3GZTB 5J2TF 4UPVA 3V7NA 3NC1C 4U6SA 2A86A 2VF4X 3ZHCA 2RI1A 2UU9B 2C9BA 4XDZA 3R7WA 1D4AA 3QPWA 3WLOA 3CB4A 4TWJA 3V9AA 1I9CA 3SMVA 4YLGA 1U2TA 2FR0A 4IOJA 4AJNA 3A2KA 1OKKA 4B35A 2ACEA 1YB7A 2K5UA 1B6SA 2V9CA 1SR8A 4ARVA 3QG1A 1U4SA 2GPNA 4K3VA 4Q4AB 1QZXA 5FUWA 3O8QA 5DDIP 3TNYA 4AS3A 1P1RA 1UH5A 1VGRA 2YVLA 2PLNA 4ETIA 2YC2C 3WOVA 4CL2A 5C31A 4MZXA 1C4XA 1JVBA 1RLMA 1EQAA 3HB1A 2Q4OA 5D6NA 2PSJA 3WNQA 3ABRB 3K30A 3M1IA 3P97A 3ZE1B 3NQ41 4ENRA 1W8DA 2A7XA 4FCVA 1W1WA 2ANCA 2DUJA 4O29A 4DZZA 1UC9A 3P9RA 4ALNA 3WFJA 1ACJA 1ODKA 4BX0A 4IIBA 2G3YA 1N1EA 1Z5NA 5BR7A 5AKIA 4E70A 1KBZA 1NT2A 1KVRA 4P2GA 3RFTA 2KX7A 4MVJI 5KVSA 2EFGA 1R0KA 1RYNA 1XDWA 4G24A 3BH0A 3MAGA 4F12A 2Q0HA 5EQTA 4EW1A 5FA6A 1A97A 1BN7A 3PHGA 4GMDA 3ICQB 3A3PA 1U0BB 4IYRA 2CEKA 2Q2WA 4E22A 1ZOIA 4XTCS 1RHRA 2PM8A 2P4SA 3CO0S 3V8BA 5ABPA 3GH1A 4P81A 3SKXA 2FP4B 3KTDA 4W5TA 4EF6A 1Y8RB 4PXAA 1AY0A 5KEIA 4UXJA 1EA5A 3LY8A 4MWEA 5KYWB 1QNLA 2C0CA 3KZKA 3M1YA 2VJNA 4ZVTA 2X2OA 2ZR7A 3WIBA 1AKWA 4ZP1A 1H3FA 3GNSA 3L2OB 3U40A 4R8KA 3V4ZA 1A9QA 2YNMD 1SA0B 1K5PA 3T3NA 1UFVA 3OLWA 3GLHA 1DTWA 5T4BA 3U1VA 4LYEA 4A16A 3HJUA 5E3HA 3F4LA 1S2NA 2IXGA 3WWCA 3E2PA 4TV8F 3OTOB 1RJDA 2ONKA 2ZEJA 1F6WA 3LLMA 3GY0A 1H0KA 4IJUA 4EG7A 2Q62A 4FMBB 4QOSA 3EYAA 4TTAA 3WKBA 1E1DA 1FYWA 1YA4A 2VAWA 4IDQA 3RRBA 4DDWA 3ER9A 3PGA1 1MLDA 3B78A 2J0VA 3L5KA 4ZYUA 3CCCA 2ZU6A 1GQOA 3JVUA 3QLVA 4JT2A 7REQB 4BWVA 3I2IA 2XCQA 1P4HA 1TF2A 3F7MA 5KC8A 3B7WA 2P7IA 4G65A 3L77A 4RSHA 2AB0A 3LHKA 1IAQA 1TEVA 4LZAA 4Z0PA 2KI5A 2OPHA 4L8VA 1N5MA 1TCVA 5DN6D 3UMSA 1IC6A 1WY7A 5ALSA 1Y6QA 2VTDA 4YAUA 5CCXA 1HR0B 3AVVA 2GKSA 2WHXA 1D6SA 1SEPA 1MENA 1Z5GA 3DE7X 5H02A 1N5KA 2VO1A 3BREA 2VS1A 4ISCA 4W82A 3G9XA 3LC2O 3EQ8A 5TSDA 4BYGA 1DX9A 2OL4A 3C3XA 1ZGBA 3H19A 1W8IA 1E1RD 3PTZA 4WXHA 4Q9LA 2RG1A 4EY4A 1F5SA 1PV1A 2Y1WA 1OWOA 3F5QA 2VDWA 1NXSA 4DR6B 4X95A 4M9XA 3R8CA 1YC2A 2P1ZA 4NZNA 4HDNB 5AIAA 2ZVDA 4C7MA 4W8HA 1IAVA 1G7CA 2GBIA 4CLRB 5JDCC 2G6BA 1E1MA 1ZZEA 2XUFA 1YUNA 4RV4A 4WOJA 2ET6A 2QG6A 3VZCA 1G55A 1Z16A 2IEIA 3QKIA 1U31A 2CHGA 3TM5A 1VJTA 1IRIA 2OTCA 4R8RA 2BT4A 3CRMA 3FNIA 4FNAA 1IN4A 4V02A 3E05A 5CJ2A 3R41A 5FAKA 5KX5A 1RYDA 4KPEC 3KJGA 3HHEA 2WYOA 3DQQA 3IVRA 2HX1A 3M3HA 2DKOA 1TKRA 1ECBA 3EXFB 3LO5A 4EF5A 1D2HA 2O2ZA 1SWVA 4EUNA 4GKAA 4KFRA 3C8HA 4ZHQB 4WNCA 3OEYA 4LMBA 4FBGA 5JSZB 1WS6A 1Y63A 2Z9BA 3BJZA 1O4WA 2RIPA 3EGVA 1YWGO 1CZRA 3EXHC 1IQ0A 4GF5A 4H0FA 4B4WA 4CM3A 5B37A 2FVYA 4OKSA 3A9TA 3HCCA 1Z0SA 1QUEA 3HQ4O 1ZM7A 3K8QA 4JJ8A 1DC3A 3HKEB 4RORA 3TTXA 1M10A 3HS3A 3G82C 2QTVB 3U5TA 3P7MA 3WBJA 1U0HC 1V47A 2RKBA 1SBIA 2QTZA 3QV1A 4IXDA 3T52A 3WB2A 3GFVA 5IT4A 3L8DA 4WLVA 3U16A 3BAFA 3T15A 1CRPA 1YR9A 4BP1A 3C5WP 3SY8A 1CD5A 4DJFC 3VUFA 2WUWE 4B45A 3EXEB 3D3JA 4IL5A 4ZMBA 2XUPA 3ABZA 3D3WB 2HT6A 4PCLA 3WRXC 1FDUA 3U2QA