2ZJBA

Crystal structure of the human dmc1-m200v polymorphic variant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
239
Chain Sequence
b'PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQVELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
publication title Structural and functional analyses of the DMC1-M200V polymorphism found in the human population
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
total genus 60
structure length 239
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjbA00
1VECA 2A5JA 2DWQA 4BGDA 2HUPA 2DB3A 1GKUB 3PG5A 3K09C 4C2TA 2BEJA 3FHCB 4C7OA 3OIVA 5HZHA 3VX4A 2HYIC 1KMQA 3KTAB 1CJMA 4GRAA 3ZLJA 3M4YA 4CEHB 4M9QA 5CIQA 3I61A 2GZDA 1VHTA 3KB1A 1K5DA 3B9PA 1QG2A 4C0HA 1KNXA 3VU9A 2BCJQ 4ABYA 1XD9A 1ZU4A 2FPLA 4FXPA 3RWMB 3K0CA 2YV5A 3PUWA 4HZIA 2V54A 4W5WA 4M21A 4XOIA 1DTSA 1AN0A 3QE0A 2FOLA 1XFAA 4NCIA 3DOFA 3BAFA 3TSZA 2A78A 2J5XA 2GA8A 3U6BA 3KX2A 2X2EA 4R2IA 1NVVR 3EW9A 4KXFB 4RVCA 4I1OA 1OFHA 3BK7A 5KDOA 1G7SA 4UQOA 1XXHB 4JSTA 2JLQA 4AIIA 3Q5DA 3OFND 2ORWA 1W4CA 2G83A 4MYCA 5CB8A 2V7QD 3RNLA 5DIFA 1P7CA 1KDRA 2CVHA 1NSTA 4PAOA 1M7GA 4EAQA 2D06A 5CK4A 5FH9A 2A30A 5KU1A 1TUIA 3A1WA 1VCOA 3CNNA 1Y3AA 2BWJA 2GJAA 1YRAA 5JJLA 1JJ7A 4DC9A 2PEYA 5GVRA 3SN6A 1EFUA 4JBXA 1FQKA 2YJTD 3CRQA 4JIMA 1NSFA 5B57C 1NF3A 4B73A 3HWSA 3C5HA 3I8SA 3WMFA 3TUIC 2AK3A 4C30A 1P6XA 1CLUA 3U3RA 1NY6A 1ZC3A 1N5KA 4GI7A 3QJYA 1TU4A 5G40A 3W6PA 1DEKA 4TYNA 1YZQA 1P9WA 4C4PA 4QFMA 2IXGA 2ZSDA 4QHSA 3RVBA 2ZE8A 3LX8A 1OXVA 1Z6TA 2IYZA 5E7IA 4DLYA 2J7PA 1KJZA 2W2XA 1ZM4A 3ADCA 3W8NA 1G3QA 2V1XA 4IOJA 3RS4A 3ZQJA 3S1AB 1EG7A 2ZI4A 3RRMA 1A1VA 2XZPA 4KYUA 4DUGD 1JBKA 4TL8A 3EZ9A 1S4QA 3TUJC 4CW7A 1XXHE 4ZCMA 2ZRAA 4DEXA 4W7SA 3O8RA 1G6OA 4MGKR 4R2HA 2FPMA 1EFCA 3KKQA 1E32A 2G88A 3P1JA 1M74A 4Q7JB 2GEUA 4HSEA 4EFMA 4KHZA 3T1VA 1NN5A 2W00A 4FMDB 2YOGA 1O3YA 4QBHA 2ZRBA 2WSMA 3CUEF 4HUTA 1S8FA 1W0JD 3GLHB 5F9HA 1U90A 4F4JA 3QG1A 1J8MF 4PHFA 3I5XA 4ZCIA 4C0SA 4MDEA 1BKDR 4LJ6A 2H5EA 3LA6A 3OE7D 1G7TA 2P5TB 5FBLB 1KDPA 1KI6A 3IQXA 3IPXA 2BBOA 1G8PA 4OBEA 5KSPA 1KO1A 1TEXA 1TNDA 3RWOA 2BIFA 2O8BA 1UEJA 3N2EA 3BWDD 1LF5A 1TF5A 3LY5A 1IY0A 1E69A 2ZSFA 4M2LA 1NG9A 1K8RA 4QM6A 3K0AB 2H92A 2IT1A 1G4UR 2QT1A 4TZ0A 2ZREA 4LPKA 3OIUA 3QF4A 2JIZD 3A1SA 5KHOC 1DBSA 1ESMA 2JLVA 2XX3A 4WZ6A 4QM7A 3UWKA 1OXTA 5JJKA 2LCFA 4G1UC 2GETA 1BH2A 2IK8A 2VH5R 4I1SA 1FMJA 4ZI3A 3LQRA 1DE0A 2KB0A 5HTKA 3BRWD 3NIBA 4NYIQ 3WP0A 2ZRHA 3VKWA 4RD3A 5AUOB 1FNNA 1UBEA 4HAZA 1U9IA 2P0EA 3DO6A 3HYTA 4IEEA 4LY6A 5FOXA 2VP4A 5EE3A 1N6PA 2YWHA 2CNWA 3MSXA 3UANA 2F43A 4DEYA 2QBYB 4IJMA 2RHDA 1HH4A 5CDFE 5JEDA 3ZD7A 2KWIA 1E1RD 1Q44A 4IOMA 4PHHA 3KQNA 1X8KA 3AF3A 3RRNA 1E2MA 4Q4JA 5KUTA 2ZSAA 1R4AA 4BRUA 1E96A 1OJLA 1SZPA 4Q4AA 2ORVA 1TU3A 2IS6A 3GJXC 1KGDA 1XNJA 4MKGA 4KODA 1PLJA 1GG2A 2FN4A 3AM1A 2OE2A 2R2AA 4G5QA 2AFIE 1GVNB 3VHXA 2ZYTX 1S0UA 2WSSA 4LYHA 4M1KA 3LD9A 4W9MC 2Q3MA 3ZVRA 1UPTA 1XZPA 2C99A 2J7KA 4IFBA 4URWR 2RGGA 2JLSA 2BM0A 1DAHA 2Q0HA 2BBWA 5TXGA 2Q9AA 1LV7A 4JLMA 3OF5A 4GMDA 5FUVA 1KJWA 3AUYA 5C4MA 3THYA 1QF9A 3FTQA 1GFIA 3GEEA 2PMKA 3MWJA 4HB2A 5CYPA 2ZUDA 4AKIA 2Q9BA 3L0SA 1CULC 1U8YA 4DIDA 1LF0A 1QHHA 2KBEA 1E1QD 4PO9A 4IFEA 1CJTC 1EFRA 4PHGA 4PZYA 1DPFA 2CVFA 1ZUHA 3IGFA 3CWQA 2QAGC 2DPXA 4KSBA 3QXCA 2FZ4A 2ANBA 4MKHA 5LD2C 4ZV4A 1II8B 421PA 2OO7A 4KVGA 2ZVPX 3C7KA 5JRJA 3PJRA 1M8PA 4IDNA 4LZZA 2FDCA 1R2QA 3K09A 5BW8A 3GJ6A 3SZRA 3K0EA 1YR9A 1TF2A 4EJSC 4WZBE 3K9GA 4RCZA 2GZHA 4XSHA 1OFIA 3G0HA 1XCMA 3ZQ6A 4LV8B 3QEJA 3KJEA 1NBMA 1ZMXA 3Q9LA 2ZJOA 4WZAE 1IJEA 3TQFA 1P2VA 2QP4A 2Z83A 4D0LB 1GTVA 3SJBA 3T61A 4JLKA 4A8JB 1YU9A 1CTQA 2WOJA 5CK5A 5DN6A 4HB4A 5FTKA 1LVGA 1T3SA 4Q4HB 3CR7A 1AKYA 1T8TA 5AUPB 1N5IA 5E4FA 1P5ZB 5FPHA 4OHVA 4TQUS 4M8NE 1J7KA 2ERXA 2NO0A 2GJKA 2WWIA 2F9MA 3BIFA 2P6RA 5GJVC 3QPUA 4Q1CA 1ZVQA 2PMDA 4UNNA 5FUXA 5EP1A 3BBPA 2B21A 2V1UA 3CPJB 3L2OB 4DCVA 2R6DA 2X77A 3HYRA 4MKFA 2O0KA 3TMKA 4DDWA 4PQYA 4JLJA 1MO4A 1VYUA 3C14C 4PAMA 1VCNA 3U3KA 4AG5A 3HU1A 3B82A 3EA5A 1Q12A 4JT4A 1AZTA 3MCAA 1OB5A 4NCNA 2IHBA 3RSLA 4QHYA 2O8DB 2FGKA 2UKDA 3L0OA 3R8FA 2RGDA 2ERYA 4CEJB 1GL6A 1E4VA 4IOLA 4RFVA 3CX6A 1U98A 1P3JA 1XMJA 4ESHA 2H7VA 1S9DA 1EWRA 1MT0A 1OIWA 4EQ6A 3BH0A 1OYWA 1T6NA 3FKQA 1PJRA 3GJ4A 2CHGA 2BJWA 5K8UA 1JXMA 2O8FA 1IN7A 4PR0A 4WBSA 1VHLA 2NTYC 2BKUA 2H18A 5M04A 4D4LA 4DLSA 1AGRA 3SYLA 3QXSA 1U94A 2NO6A 2WM9B 2EYQA 3BB1A 3NEYA 4NL4H 3WNBA 5L3VA 3ETLA 1Z63A 1OHHA 1T0JB 4US0R 4TSFD 3TVDA 1ZJ6A 4NHOA 4EFNA 2QGNA 4OQFA 1NL3A 1BMFD 4MA4A 4AYWA 1E79A 2EVWX 4DSUA 1YZTA 2GF9A 1HEIA 4P33A 2E9SA 221PA 1WDTA 2QAJA 1JPNA 3MWLA 3PITA 4ZDWA 4ASUA 2Z5FA 4US2R 4DT1A 1RRFA 5HKKA 4LYFA 2ATXA 3WBKA 1SVSA 3BE4A 4LWZA 1D9ZA 1H8ED 2ZJZA 4B47A 5KNDA 3BB3A 2IBMA 2HT1A 4TMVA 2CJWB 3GLFB 2XXAB 3CPHA 2WOOA 3BGWA 4E5UA 1SVWA 2IYYA 5H68A 1WMSA 1R8QA 3FPAA 1E94E 1MR3F 3PV0A 5DO9A 1E98A 2I3BA 4BFTA 3U4QB 3R7WA 3TVTA 3IEUA 1XEXB 1P62B 2CE2X 1RRGA 2WJJA 2C98A 2GF0A 3O47A 4BLRA 4A82A 2GDJA 3A36A 3MJRA 2IL1A 4PSKA 1DAKA 2DFNA 1JALA 4C9BA 4E07A 1Z28A 2J0UA 4H9GA 2ZR7A 5F3WB 3SDZA 4KJZA 3X2SA 5IK2D 1IXRC 2FSFA 3E1SA 4LSGA 3REFA 3CRW1 1KKLA 4BWYA 1N0WA 3C5CA 1ZM2A 2A3RA 4LBVA 2IUUA 3A37A 4NPHA 3QPWA 1IXZA 4GT1A 2P67A 4RZXA 1YQTA 4JSYA 2PJRA 1VTKA 3RSOA 1Q1QA 4FIDA 1OH6A 1XD2A 4HYYA 1NI3A 3FKSD 5DHAA 5DNYB 2YVUA 2J87A 2GCNA 2GXAA 1W2HA 3IUYA 3OHMA 5FTJA 1XJQA 2ZM5A 4PQRA 1COWA 3TSOA 2NQ2C 1B0UA 3U7EB 3LVQE 2DBYA 3AP3A 3SU8A 5A5GA 1G1MA 5P21A 3AGPA 5ANRB 3EASA 4ARZA 3GLFE 1HV8A 4DLVA 1T0HB 2BHRA 1LS1A 4LYJA 3T15A 2DHRA 1UF9A 4P4UA 4A36A 4HZUA 3TK1A 2ZEJA 2AD1A 1G8YA 1Z0DA 4UXJA 3EPLA 5EP2A 2GESA 3FVQA 1DO0A 1RIFA 1E2JA 3C16C 2B8WA 5JHGB 1DELA 2XZLA 4MYTA 3GLIB 1AM4D 3GFOA 4XJXA 3SC3A 3PENA 1XPOA 2BC9A 1NLFA 2VSOA 1KI4A 2D4HA 2EWVA 4JL8A 1OH8A 3KKPA 2ZUCA 3Q8XB 4RD0A 3WXMA 1OFUX 1D2MA 4ZKDA 3ZZ0A 1L8QA 4NCHA 2HCBA 4RD1A 3TJZA 3QVVA 4PXAA 2YWEA 5GVSA 5FOWA 3GEHA 721PA 3GLGA 3JVUA 5TMPA 1L7VC 2R44A 1NIPA 3LLUA 4M1OA 3CH4B 4Q03A 2KJQA 2WJGA 1M7HA 2OG2A 2JLWA 1MRSA 3CF6R 1F60A 3RRYA 2JLUA 5G3YA 3CLVA 4M0LA 1DS6A 3B60A 3B1YA 1MABA 3AVQA 4L16A 4ACAA 4V0OA 1SXJD 4YDHB 4AK9A 2B7BA 3SFZA 3EZFA 1F2UB 4JT2A 2IWHA 2C9CA 1QHSA 3I5YA 1CEEA 3RS5A 4EJSA 3EIEA 3E2IA 3B5JA 5L3QB 1OKKD 2BEKA 5IT5A 4AG6A 4XD7A 5AWFC 1CBUA 3X1XA 1XD8A 1CRQA 3IILA 1W49A 5EXTA 1SXJB 1QRAA 4QBFA 3FE2A 1X86B 4IDHA 4YLGA 3X1ZA 2H17A 4ACBA 2YZ2A 2ZJBA 4TMTA 4RZ3A 3LLMA 3SFVA 4AYTA 1IJFA 2FFQA 1F2TB 3GLIE 2EFEB 1TTTA 3AVXA 3RS7A 4ZDKA 3AVUA 4NE2A 4I4LA 2QE7A 1L2TA 3O8BA 1QVAA 2OXCA 3K8YA 3P20A 4Q19A 4XVQA 2BM1A 2PX3A 2GCOA 2WKPA 2ZRFA 3OIYA 4G0NA 3ZD6A 3ADBA 3U44B 3HPRA 2C5LA 1J2JA 1ZUIA 2FPKA 3NDPA 4BPBA 3LDAA 3I1FA 1DAMA 2ZAOA 2EYUA 1Z0IA 1OPXA 3O8CA 2OESA 3UATA 3OIWA 2FA9A 1CJUC 3TLXA 2YWFA 2W6JD 4DHEA 4WIAA 4CT5A 3QKSA 4GBMA 5JI3E 1WB9A 1VMAA 1Z06A 4Q9IA 3F5FA 3U3JA 2E87A 3FMPB 4IW3B 1XMIA 4TTQA 5SZIA 2D3WA 3B13B 3GPLA 2NGRA 3IO5A 1VKJA 1W4RA 3THXA 4A1FA 3PEYA 3B78A 4FINA 3W6OA 4TYWA 1OW3B 1KKMA 2VP2A 5G3ZA 1GP2A 1LW7A 4B2LA 3QY0A 1FW6A 2FE4A 2PZGA 4B33A 1G41A 3VNUA 1GUAA 4LRWA 4LHWA 1RW4A 1SXJE 2PLRA 4Q02A 3LH5A 1AKEA 3BS4A 4NYJR 3DZ8A 1JR6A 3QBTA 5JWHA 5KDLA 4URYR 1VPLA 4R71A 2IC5A 3ND8A 4IDPA 4NMMA 2XSZD 4O2RA 4U5XA 2PCJA 4EPTA 1ZUNB 2JEOA 2QY9A 4TYPA 5FPSA 4EPYA 4CT4B 1D8TA 4X8LA 1SHKA 4CEHA 2VIIA 3U5ZB 4HLDA 3SR0A 3LQQA 4TZ6A 1KDTA 1R5NA 2YC4C 1WQ1R 2XNDD 4HLUC 4XTCS 4RJLA 1V5WA 5C4GB 1W5SA 3B1XA 1QVRA 4A8JC 1JECA 5BN5A 1CJVC 2CE7A 2QPAA 3GJ7A 4ON9A 1KK3A 4ITRC 5LB4A 2WMNB 4B74A 5A4JA 2WWWA 2OBNA 3RC3A 2XJ4A 4LBWA 1N6RA 1TAGA 4OQXA 5TV2A 3V00A 4B32A 3AF0A 1R6BX 2XOKA 2VQSA 3B85A 4UJ3A 1PVOA 1XXHA 4TMKA 1E2KA 3BH7A 1Q0UA 1GNRA 1QZXA 4N1AA 2IF2A 1AJEA 1RRCA 3V4FA 2FWRA 1CIPA 1SKYE 4BLPA 1KOFA 1IHUA 2QMOA 1ELOA 3EWAA 4FMCF 2ONJA 3THOA 3D7MA 3U61B 2IYXA 2WJIA 1M7BA 4KFTA 3TKLA 1GWNA 1JPJA 2JJ2D 3FHOA 5SZKB 1KSGA 1QHGA 4PX9A 1GDDA 5EP3A 4HLCA 3QSYA 1VG9B 1GILA 3OEHA 2ODBA 1C4OA 3IHWA 1KO5A 4BLQA 4V0ME 2J0QA 2CCKA 3IIJA 2V7QA 4OJQA 3I8XA 4YDSA 4B3BA 5EE5B 1IOZA 1ZNXA 4Q4LA 1Z22A 1U99A 3CNLA 4DVGA 5KNCA 1TL7C 3ZVNA 3WBJA 3BH6A 4DB4A 3BFKA 2ZJAA 4IVRA 3VKHA 1P73A 1F3OA 1YR6A 2XB2A 1KSFX 1GL9B 4NP6A 2ZRNA 2RGEA 2OUKA 4LJ7A 1E2QA 2ZRLA 4ZCLA 4QHTA 2QSZA 1N3BA 2ZI6A 5K8TA 4B76A 3S1AA 2VYFA 3UG7A 2F3RA 4NYMR 4M1WA 1ETUA 3DMNA 2QTVB 2R6FA 4RFSB 1D2EA 4XSGA 4D4KA 4OI0A 1XJ0A 1KAGA 3AB3A 4GMXA 4QC2A 4BFZA 3KB2A 2D62A 1VG8A 4IDOA 4GPTA 1SVIA 4IRUB 5FPYA 2BVNA 4MRVA 4F92B 2BKEA 2QA5A 2PH1A 4F4IA 3K70D 1E2LA 3ZIAD 3EZ6A 1YR8A 4HUQA 2OEPA 3LWNA 1G5PA 2G0NA 1IM2A 4LX0A 1BIFA 5DISB 5CDFA 4DUGA 5F9FA 3OEEA 1KAOA 1G7CA 1QHIA 1BYIA 1MO3A 2W6IA 4MRPA 3EWSA 3UMFA 5J4KA 1Z6XA 4BZPA 1RJ9B 3RS3A 2HLDD 2ODNA 4M1YA 2REOA 1E0JA 3MWKA 3VU9B 2ZRCA 2QPOA 3T06B 1P4SA 1UDWA 3U7GA 4NH0A 4ZIRB 3KKOA 1KJYA 3CW2A 1MO6A 3CO5A 2CCJA 3K9NA 3SQXA 2PZFA 3SBEA 4Q1DA 5L3RA 1Q22A 2C78A 2J59A 4QG7A 1UEIA 4G01B 1KY2A 4R98A 3WY9A 1KI1A 2NIPA 3LRPA 3PR1A 1DAFA 2ZAMA 1UAAA 1NP6A 4HDOB 2REXB 4EPVA 1T5IA 3ASZA 1K5GA 2NPFA 1Z2CA 1W48A 1LTQA 1A2BA 1I4LD 2VTKA 4KSCA 4OQLA 1PUIA 2CEAA 3CKLA 2ZTSA 3GCGA 5FBQB 4B6EA 4L8GA 5JS8A 2ZI5A 3QF7A 3TE6A 2J1LA 3JZMA 2HV8A 3X1YA 3Q5EA 2FEOA 5AJXA 2YWGA 1G4AE 4TL7A 4DSTA 3KJIA 2OCBA 4URVR 2D2EA 2Y8EA 4DDUA 1ZAKA 2O8EA 4HB3A 1K6MA 3TGPA 3D31A 3QXJA 4B44A 5FTLA 4XWAA 5DYIA 4AWXA 2I1VB 1X8LA 4KITB 1I4TD 1DADA 4PHTA 3IDQA 4TYQA 1P2SA 4A2WA 2QBYA 3DM9B 3L43A 1FL9A 2J7PD 3GJ8A 2ZYVX 5TY0A 2X8AA 1W36D 2GEVA 2QENA 3Q72A 4B3CA 1E0AA 2PJZA 4TYYA 4HAUA 1PUJA 1PLLA 3RDPA 3W8RA 4MDFA 4OYHA 4BEJA 1JQJC 2CLSA 3B8HA 3QXXA 2X2FA 5JWOA 2G1KA 2BJVA 2JLXA 3CX8A 1E1RA 3EIHA 4KYIB 2PEZA 2BMFA 2HXSA 4TLDA 2QU8A 2VRWA 4WXRA 2ZU6A 4ZO4A 3GFTA 1KMHA 1NG1A 1J8YF 1GL7A 2AXNA 3KQUA 4A2PA 1NKSA 2WJHA 3PFIA 3VX3A 2VF7A 5JZVA 1YJ5A 1FPMA 3WNDA 4TMWA 3EPKA 5D3MB 4POAA 4ZI2A 1HY3A 1W5TA 2HJVA 3NBFA 1Z2AA 2CK3A 2OT3B 2ZS7A 4Z1MA 2ZE7A 1A7JA 1OSNA 4QGAA 2GHIA 2BBSA 2RGAA 4QGHA 4TLAA 3SS8A 3QVUA 2EW1A 1QHNA 2F1JA 3GLHE 4OHZA 1NMZA 3K0SA 2JDIA 4V0NA 3AVWA 4B35A 2OAQ1 1CRPA 2VSXA 4UNQA 2C96A 4DWJA 4Q5IA 3UXMA 2WWHA 1GAJA 3F0TA 2GBLC 3CIOA 4Q47A 4WW0A 1KI6B 2IWRA 4A0GA 2MSEB 1TQ2A 2IEYA 1II8A 1OYYA 2P6UA 3FB4A 4YMSA 3MUFA 3DM5A 2O8BB 1TQDA 4O2LA 2G1JA 3GJ0A 4FWIB 3B6EA 4YMTA 5LB2A 4PC7A 1G3RA 1I2DA 2PCLA 2EFDB 1DG3A 1E2DA 4V0KA 2AFHE 1NJFA 1Z29A 2ZYUX 1X6VA 5F2EA 2AX4A 1YVDA 1AGPA 2CNWD 2F3TA 2IS2A 1Q1ZA 4RD4A 4LYAA 3KQHA 5FI0B 2A5YB 2D74A 3NHBA 3C8UA 4FMCB 3C4JA 3EIQA 4HLUA 4XVRA 5G53C 1GKYA 2GXUA 5UKDA 4A8JA 1GNQA 3MAAC 2W0MA 1QHYA 3MD0A 1GRRA 2VHQA 2P6NA 4Q4HA 1N2CE 1XWIA 3AF1A 3NBZC 1ONBA 1Z47A 3PEUA 3EX7C 5K8LA 5J4LA 2AN9A 3K0FB 2OFXA 2YOFA 1A2KC 1UBCA 1ZW6A 2MSDB 4LHVA 4TLCA 4Q4JB 2WIBA 3HDTA 4F38A 1RYHA 2B7CA 2NO1A 3IBGA 4Q4AB 5CYOA 2WWYA 1HT2E 3SEAA 2WSSD 2JLZA 2W2TA 2IHYA 2W83A 4UNRA 3NBXX 4MH0R 1E2IA 2VP9A 3DKVA 1W46A 3K1JA 1KI7A 2GJ8A 5FBVB 4EUNA 4DB2A 4G5GA 5EJEA 1ZCBA 5DI3B 2PLFA 4X8MA 4FD2A 4ERNA 2O8DA 3L0IB 1D6JA 3KXLA 121PA 4DLRA 4IOKA 3AKCA 5E7MA 4D25A 2ZPTX 4OK5A 4FWTA 4CEJA 2BMDA 3FFAA 1AS2A 4ZKEA 5J4VA 3PCRB 2ZRDA 4CEIA 2ZS8A 2ZANA 1EFRD 4YXWA 1T8UA 2VHTA 3RRZA 4E22A 1OXXK 3PEVA 2IYUA 1ODFA 4D82A 3THYB 4NDZA 4IVPA 4P4SA 5FUYA 4BE7B 1X3SA 4IHQA 2QMHA 4RKFA 3M1IA 1Z6YA 3E70C 3X1DA 1Z6GA 5B58C 1FMLA 4GL2A 4TTPA 4TQ9A 2A5DA 5C2JB 1E2PA 1J70A 1TPZA 2XAUA 5JBQA 4ESVA 2IUSA 2GVDC 3RC8A 1L4UA 2FU5C 5D3QA 4I1VA 4C0QC 2R65A 1N5JA 1BS1A 1XEFA 5JHHB 1E9CA 1ZRHA 4KFUA 2NPIA 3H86A 2IYLD 4PPNA 5E7JA 2G0TA 3A1TA 5BQ5A 2MSCB 1UDXA 1KTVA 2UZIR 3NWJA 3QKRB 1IXSB 1HQCA 5DN6D 3GEIA 1RC8A 4M9ZA 2AWNA 2X19A 4NBSA 3T34A 1QG4A 3WYFA 5FR1A 2HJGA 4Q00A 4TLBA 2N1BA 4L5BA 2IXEA 4C0LA 5DH9A 4LC0A 1HUQA 3UWOA 4B3FX 4M1TA 1CR0A 4OK6A 4AD8A 4PPGA 1Q57A 4Y0VA 4C0AC 1YRBA 1GKIA 3GLFA 2XXAA 1G16A 1XEWX 3KKMA 4Z51A 4QL3A 1EX7A 3WHKA 1E2NA 1NVUQ 2R6GA 3QG5A 5CM8B 1H8EA 1KYIA 1JR3D 2RHMA 4LPSA 3U7FB 3U4QA 1JI0A 2GJ9A 1OF1A 1XEXA 3BD9A 2V9PA 4DCTA 3WMEA 2VHCA 8OHMA 3QKUA 1HA3A 3EC1A 4M9XA 4O0MA 1ZM9A 2FFHA 4DKXA 1T9HA 2D7CA 3A1VA 1DARA 1YHNA 4A0HA 3AF4A 1OFTA 4Q7KA 1OE0A 3BJIC 1ZIOA 1BYUA 1EK0A 3UG6A 3Q7PA 1GITA 2OCPA 3N2IA 5DE3A 2W0SA 3I72A 5HCNA 2LWIA 4H1VA 1TADA 5HE8A 4NYIR 5C1BA 5SZJA 3H1TA 4K8OA 2R6CA 5IK2A 5CIWA 1RVDA 3DPUA 5JFGA 2WWGA 3G5UA 3LW8A 4TT3A 2WWXA 4TL9A 4W5HA 3J81k 4K81B 4TWZA 4OL0A 2Z6VA 4UNPA 1X1SA 1G5RA 1LNZA 3VNVA 1UJ2A 2O8FB 2JAQA 3NHAA 2XTMA 4V0LA 5CB6A 1US8B 1Q20A 1OHHD 1A82A 2AHOA 5B2ZA 2G77B 1U8AA 5FFMA 2NO7A 4NTZA 4QGFA 1XTRA 2V3CC 4QRHA 4DDVA 2WKRA 3I73A 2Q21A 3KZ1E 3DEFA 1U8ZA 3GP8A 4P3YA 2C04A 3AQ4A 2V6IA 4DCUA 5HKKD 4QBGB 4BLSA 1RE0A 3GLIA 3LVRE 1KSHA 2BDTA 5DYGA 2PL3A 1J90A 2SHKA 4B34A 3L82B 2OFOA 3ZH9B 5KPJA 1H8HA 3TBKA 3I3SR 1P9RA 4PSVA 1JR3E 4RZUA 2ZYWX 4HAYA 4DBLC 4DT1B 4A15A 2ZRIA 2GJSA 2CHQA 3M6AA 2TMKA 2WHXA 3EXAA 3LXXA 4C0KA 2A5FA 3D8BA 4UKDA 2F1HA 1OXSC 1UKYA 4AY2A 3AVOA 2QROA 4F4CA 2ZETA 4AKEA 4BQSA 2GBLA 1Q21A 1Q1BA 4D4MA 3KFXA 1N0UA 4YONB 3EPJA 1E2GA 5JEEA 2H1LA 1FZQA 2XNSA 4QXAA 2DFLA 3SQWA 3B2EA 1F2UA 3CONA 1P2UA 3SE0A 4P31A 1NN3A 2YHSA 5CJ2A 4AKGA 4QJ4A 4X8OA 4FW9A 2BCGY 4P0TA 5A0FA 5HPYB 5L3QA 1NMYA 4KLZA 1NVVQ 3AVPA 3QQ5A 5EXPA 4IVQA 1OXUA 3OAAA 1SXJA 1U0JA 1HE8B 3TUZC 1XZQA 2A9KA 4GP7A 4R7ZA 3SJAA 2DYKA 4A0FA 2HDNB 3AV0B 1KZ7B 1OH5A 4QBIA 2O0HA 1RKBA 3IIKA 4JBWA 4BZQA 1OH7A 2QPTA 1A5TA 3VFDA 1NLYA 2AKYA 3ZS8A 3W6NA 1SKQA 1XMSA 5H8WA 3EG5A 4KV9A 5GJCA 4WVFA 1F2TA 4DIEA 5JSZA 4JBYA 4DXAA 1XJCA 4D4JA 2YOHA 3HJNA 1COWD 2ZSEA 3AEZA 4GNKA 1IN8A 4V02A 5JLJA 5CLQA 2WZQA 4PC1A 1E9RA 3U44A 5EUQB 2QZ4A 4LGMA 2JJ1A 1I4DD 5AUQA 4BECA 3EAQA 4B2PA 2ZE5A 3VR1A 2IYSA 4XVUA 1WF3A 2VP6A 5J4HA 1GNPA 4LOAA 3ICEA 4ARZB 1SHZA 5SZHB 3V9PA 1NN0A 5L3SA 2CLCX 2JATA 1CXZA 1SVLA 3EC2A 4O25A 2KSQA 2IS1A 2XITA 1HQYE 2VL7A 3CZQA 2KE5A 2A7QA 5FR2A 2DFTA 3AF2A 4DSOA 1E9AA 5BWMA 1JAIA 1YZGA 3P32A 1DAGA 1BOFA 1WE2A 2ATVA 4LC1A 5B30A 1N6IA 4PFSA 2C9OA 1LY1A 1HE1C 3MG9A 2OILA 3SJZA 1KK2A 3HU3A 3ZGXA 1Q3TA 1RZ3A 4AURA 4B71A 2ZIAA 1AA9A 4TQAA 3SYKA 2LKCA 3KKNA 1E0SA 1GRQA 2WBLC 4V0MA 5FL7A 2BMEA 1W0KA 3GFPA 2EQBA 1ZM3A 4MGZR 2GXSA 4MGIR 3A4NA 4NKRA 4FMDF 2QAGB 2RGCA 3BC1A 2ZJ8A 3CB4A 3R20A 4CF7A 3WYGA 5FOUA 2AR7A 4P32A 2CBZA 1IBRA 4XD7D 1GOTA 1M2OB 1ZU5A 4JVNA 1W1WA 3QEOA 5KOYA 2IX3A 3TNFA 1NVWQ 5J5CA 1N6HA 2HXYA 4URUR 1EFHA 3KJGA 2ODEA 1QHXA 2P65A 5FTNA 1TQ6A 3T1TA 2NO9A 2ZITA 2RB4A 1FTSA 1G17A 2WPDA 5GJBA 4BFSA 2PX0A 1E99A 1ZNZA 3AVVA 4TMZA 3NXSA 3RAPR 4QNMA 1GRNA 1E9BA 2QE7D 1G7RA 3PUYA 4F7WA 1R0YA 2QL6A 3LV8A 4JMPA 3CRVA 1FX0B 3D3QA 5CM9C 1WP9A 1IQPA 1Z3IX 3RHFA 4TTRA 1Q3HA 2FMXA 3AUXA 4PC2A 1XB2A 1FQJA 3VR2A 3DHWC 2J0SA 2O5VA 3BXZA 3W5IA 1UKEA 2XTZA 4LHXA 3TR5A 3SI7A 5JCZA 3KTAA 3PVSA 3U2QA 3QI2A 3TW8B 2GCOB 1ZYUA 2CDNA 1PZNA 1G291 2I1QA 4EPXA 2NZ8A 3T12A 3MGCA 2ZRPA 2V8OA 4MUAA 4Q1AA 2WJYA 2J46A 1T3LA 3ZVLA 3THWB 3CR8A 2ZSBA 1Z83A 1RRPA 3KJHA 4XIGS 1HTWA 4DLWA 4MYUA 3A58B 4L9SA 3FOZA 1W44A 2QSYA 1YZUA 1M1YE 1XTIA 1Z6AA 3THXB 4G5OA 2CL6X 3QOFA 4MKIA 3AP2A 3HP1A 1FUUA 5AJWA 4RCYA 3CM0A 1LFDB 3ECCA 4IDQA 4DRZA 5ELXA 4Y0AA 821PA 2H57A 5DLQC 1XBTA 3HR7A 6Q21A 4JKIA 4BFWA 2RMKA 4LJAA 5EP4A 1VYVA 2PZEA 4Q1BA 1G21E 4NCJA 4BLTA 4ZDIA 4LJ9A 5KYKA 1CKEA 2O8CB 5F98A 4OI2A 2V55B 3OFNA 2A2ZA 3IHLA 4G5SA 3KQLA 1VIAA 3NH9A 2XZOA 3ZJYA 4JLPA 5L8VA 3ZS9A 3AH8A 1P9NA 2FSHA 3SOPA 4JYBA 2EFGA 2J0VA 4C3ZA 1N6KA 2C9YA 2R8RA 2XB4A 1OIVA 1R5BA 5FTMA 2GAAA 3CX7A 4EPRA 4YQFA 4CGZA 4D2IA 3CH5A 1KK0A 1RJ9A 1KHTA 4PANA 3IEVA 3IO3A 3QPVA 1S3GA 3VR6A 2O52A 4HEJA 1B23P 1FFHA 2OCAA 1KI9A 1P60A 2XOKD 1NKTA 4M1MA 2J3EA 4LJYA 5E95A 1S96A 2HF8A 5IDVA 3ONWA 3ZIAA 5HZKA 3TAUA 4ZIRA 2JGNA 2ZU0C 3BFXA 3NH6A 1G3UA 2P3SA 4HATA 1DAEA 5DSZA 2QNRA 4KBGA 3A4MA 4M1SA 3QIAA 4M9SA 1E2HA 3ASYA 4TMXA 1NRJB 4U02A 2HLDA 2YC2C 3EARA 2VP0A 5KTYA 1E9EA 2C03A 3A6PC 1UBGA 1CU1A 5EZ5A 2GKSA 2ZJYA 2VSFA 4MITA 1U0LA 4DDTA 1U2RA 2C77A 4I1UA 3OEHD 4OK3A 2IYVA 4Q66C 3VAAA 4C7OB 1JEEA 3BORA 2W58A 3ZVMA 4DZZA 1N6LA 2R62A 4MGYR 1XF9A 2XJ9A 1IY1A 2ZRMA 3C41J 3LW7A 2OZEA 1S1MA 3GLHA 3CNOA 4PO8A 4HAXA 2GNOA 4D26A 1R7RA 1G3MA 1UKZA 3K70B 3GQBA 3FMIA 3QKTA 3TIFA 3U3MA 1ZM7A 3CBQA 2QT0A 3NG1A 4OQNA 4JYCA 2HYDA 2C8VA 2EFHB 1RPZA 1TX4B 4S35A 4HB0A 1W0JA 3ND9A 3PUXA 2ORIA 1QDEA 3SHWA 4DCNA 2P2LA 5BYKA 3G82C 1OV4A 1XCPA 3K9HA 1XTQA 3ADKA 1ZD1A 3K0AA 1S2MA 5AJZA 4PTLA 4BRWA 1KI8A 3OE7A 3Q3JB 5EUMA 1NVXQ 2UVQA 1AQYA 4K46A 2EU8A 4E09A 5FPTA 2QN6A 2XEXA 3R8CA 1XMVA 3K53A 1W7AA 4A6PA 1XTKA 2CL0X 4YMUA 1X1RA 3PEWA 3NEJA 2QMUA 4BLOA 2DCUA 1HURA 4HLQB 2ANCA 3SYNA 4A9AA 2PBRA 1P72A 4URZR 2GTPA 5FOSA 3OEED 2UZ3A 2JIZA 3TW4A 2W6ID 4M22A 2ZROA 5D3MA 1IN4A 2NG1A 2PT7A 3F3YA 3MFYA 4HUQB 4LHYA 1VCIA 1SULA 2H16A 4PC6A 3SHFA 1CS4C 1LB1B 1J99A 4RKEA 1G8GA 5B64A 1KDOA 4KBFA 4JL6A 4LBZA 3PXGA 1AZSC 3GJ5A 3X1WA 3AVYA 5BYJA 1MKYA 4Q7MB 3W5JA 1GSIA 3AP1A 3DVLA 2DFKB 5KDDA 1W36B 1R8SA 2K5UA 2OSBA 3NDBB 2QORA 3B1VA 1XU4A 1E2EA 3ZZTA 2ZI7A 4BEBA 2ZR0A 3DDCA 5TVKA 4GDFA 2IUTA 2Q3FA 1OIXA 5IHPA 3OESA 1KNQA 4Q9KA 4OHWA 2REBA 2QEQA 3RLFA 1ZNYA 1EX6A 1CR4A 3U7HB 2GILA 5H70A 2EWWA 4QJ3A 4HDCA 5JI2E 3RABA 1N25A 5FOTA 4A92A 3T5DA 2IYTA 2QM8A 1RFLA 2VA8A 1EXMA 4JJKA 2OV2A 621PA 1NJGA 1KK1A 3FFBA 2ONKA 4JLNA 1OT3A 1G5TA 1VCMA 2CCGA 2O8EB 3Q7QA 2AWOA 3MMPA 4BFXA 5FPKA 4M4SA 2FEMA 4JVLA 1F48A 4DJTA 2V6JA 1W2GA 1WCV1 2WWFA 4KU4A 1XP8A 1N6OA 1HYQA 2R9VA 5DI9A 5GADl 1Z5ZA 5CJPA 4KLNA 5FBWB 3K0FA 5IF9A 1Z0AA 2OAP1 1MO5A 1P61B 1I2MA 3KQKA 4LV5B 4NONA 1E1QA 5C18A 2VPPA 4E03A 2NZJA 2OM2A 5EZ6B 5C46F 4AC9A 2GCPA 4Z8YA 2L0XA 4LDJA 4RZ2A 3PUZA 1WXQA 3QF4B 3T35A 2P5SA 5JWRA 2W2VA 5JMTA 3Q85A 3TR0A 1SXJC 3E5HA 2QQEA 2QUZA 1UM8A 3WP1B 4BFUA 4EPWA 2CK3D 4Z1MD 4B3GA 3DKPA 2ZI3A 3PUVA 4Q21A 5H1YA 1KMHB 3BFVA 2ZQ5A 5TARA 5GJWC 3VMFA 4N0EA 5DI3A 3H84A 4Q01A 1ZIPA 3QNUA 3ZZUA 3H4MA 4PAQA 2JA1A 1KSJA 2JDID 3HU2A 1TMKA 2F43B 3L0PA 2FZLA 3QUSA 4IEIA 3UKDA 4JLDA 5E3HA 4V03A 3TSWA 1MV5A 3MJHA 3VR3A 4OQMA 1FP6A 3TH5A 5EXSA 2WVJA 1IONA 1KO8A 1R0WA 2AXPA 4JS0A 4QNRA 1E2FA 2N46A 2WJVA 2KBFA 1SQ5A 5FUWA 4D6PA 4EFLA 1VYTA 2GRJA 4U7DA 1KZGB 3W3ZB 2Z43A 3CRMA 3QENA 5K8IA 2C95A 2JASA 4X8HA 1XX6A 4FN5A 4D80A 1SVKA 3U6KA 3ICQB 2VO1A 2IEZA 3DZDA 2RKOA 2RGXA 2NOAA 2XGJA 4JLOA 1CJKC 1MH1A 3ZYCA 4DSNA 1ZBDA 4DLTA 1H65A 1E9SA 1CR2A 4HI0E 2F1RA 4WA7A 2D7DA 4KFRA 1T91A 4OI1A 2RH5A 2FNAA 4KCGA 5KNBA 1DOAA 5JS7A 4A4DA 2FX3A 4GOKA 4TN1A 4MUBA 4YMWA 3TRFA 3CWZA 2B6HA 3QKRA 2VHUA 3ADDA 3P26A 4EDHA 4B3DA 1FP7A 1GZSA 3AKYA 3VKGA 1G20E 3CF0A 2F6RA 4Q9JA 1OLOA 2GVZC 5J40A 2OBMA 4J0QA 4M53A 1GM5A 3NVAA 2DWPA 2MMGA 1JQLB 3MRSA 1II0A 1QHHB 4Z8XA 5G41A 2CMKA 2JLRA 2D2FA 5JCPA 2QI9C 1A4RA 1PV4A 2IF0A 3U3OA 1XPRA 4BASA 2CXXA 1FNMA 2FSIA 5EE1A 5EE0A 5KSOA 4Q9HA 1S1CA 4GFDA 4B2IA 2J9RA 2IS4A 4DLZA 1NBMD 2RGNC 1P2TA 1UFQA 3T1QA 1AIPA 4XH9B 3PIRA 2QRNA 5BN3A 4OHYA 5AJVB 2BV3A 4D0GA 2LKDA 2BOVA 3DL0A 2IYQA 2Q3HA 4BFYA 1R0ZA 4KAXA 1JR3A 2AKAB 2H8KA 4UJ5A 4CIDA 1R10A 3I62A 4HAVA 1FOEB 3EZ2A 1NIJA 4LJ8A 1JXOA 4TSFA 1P75A 1S9HA 3LBHA 3GMTA 4GZLA 2IYRA 4YXWD 2F55A 3AKEA 5KPDA 1SVOA 3CPEA 1BMFA 4CVNA 4HAWA 3EPHA 2ASEA 4C0JA 1U81A 2CJWA 1W4AA 3RS0A 4JLAA 1JB1A 1G3IA 2CLDX 1MRNA 4Q9LA 4ZPXA 3FHTA 3JZAA 4CEIB 3R9IA 4CZ2A 2G3YA 3BERA 3FMOB 1C1YA 2GAOA 1Z0JA 4P4SB 5FL3A 2DY1A 3KXKA 4GZMA 1D9XA 2BMJA 3PQCA 1R0XA 3KUCA 1L4YA 1US8A 2I4IA 3SBDA 4NZYA 4F93B 3KDSE 5CITA 4A0RA 4GSYA 4UXIA 4PQFA 4MRNA 1E4YA 2DWOA 1XCGB 4A2QA 2GXQA 4Q18A 2ZUBA 4PPFA 3UMSA 1II9A 5FOVA 3WNCA 3W9YA 3B1WA 5EQTA 3BOSA 1ZP6A 4NYJQ 3VQTA 1NMXA 4HDQB 1YZLA 3H0KA 1AS0A 2QGZA 3EZ7A 3KXIA 4DLUA 2Q9CA 2Z4RA 1D2NA 1IAQA 1LS6A 2RGBA 4B43A 3TQCA 1JJVA 2IA5A 3W34A 1IN6A 1NBME 3I32A 1ANKA 1M34E 2ECKA 4EQ6B 5J47A 1WRBA 1SGWA 4IKEA 2GK7A 1PLKA 1CP2A 1UKVY 2FF7A 3A8TA 3FDIA 3MWYW 4R9UC 4PZLA 3NTUA 3FKSA 4N0DA 1XEWY 4B48A 5HCIA 4Q48A 3VR4A 1EWQA 3WMGA 1E79D 1XRJA 2OLKA 4PSAA 3F8TA 4QGGA 4LHZA 1AS3A 1YR7A 2QMEA 1NY5A 1ESNA 4MYHA 3VTKA 1Z08A 2AK2A 2RCNA 1G6HA 3HPQA 3P27A 4MQBA 4ASUD 1G9XA 4H1UA 1MOZA 4C0BA 2ZJ2A 4KVAA 2F1IA 2FSGA 4NCKA 4A6XA 3KL4A 4UNSA 1VG1A 3K70C 2Q6TA 1EGAA 3AGQA 3A1UA 4S2EA 1NLZA 3K0CC 4QOSA 2V4ZA 4TL6A 1KI3A 2ZJ5A 1T4GA 1F5NA 2WMOB 2HT6A 3IPYA 3V4RA 2OCYC 4W5JA 2JJ8A 5EE9A 4O3MA 1G8FA 2CHVA 4KI0A 1G18A 3IQWA 4TT3D 4US1R 4AKHA 2FGJA 2EFCB 2YKGA 3IKJA 2KI5A 1XPUA 2OLJA 2JCSA 1U0HC 3SNHA 1N0VC 2A5GA 2IYWA 1AK2A 1NNEA 3FYHA 5KSZA 1Z8FA 1Y63A 3W3AA 1S3SA 3R7WB 4URXR 1XDBA 4DCSA 3N70A 2QP9X 2N42A 2OHFA 3LBNA 3AKDA 3JVVA 3T1OA 2ZRJA 1E0KA 4WAUA 2F9LA 4BUJA 1FUKA 3GD7A 5EXXA 4RY2A 2J41A 4OKSA 2J0UB 5HR5A 1YZKA 3FMFA 3RYTC 4LUCA 1G8HA 1DO2A 2G6BA 3P4YA 4AI6A 1H8HD 2VF8A 4MRRA 4RSGA 2ZI9A 4UXHA 4CYMA 4KFSA 3AVTA 4JZKA 1OKKA 3ZDQA 3IBYA 3RS2A 5BXQC 4YMVA 2ZRGA 2IW3A 4NYMQ 4Q7LA 3O8DA 3I92A 3B1ZA 2HEIA 2WV9A 1TF7A 2ODWA 4ILEA 3OZXA 5FBRB 1XD2B 3IIMA 2FFAA 4EIWA 4LCBA 1KY3A 4Q1FA 2E1RA 2G9NA 4JKYA 4LJ4A 3C15C 3T5GA 3M0EA 1W36C 2QG6A 5KO2A 2QQ0A 4L9WA 2B8TA 4PO1A 1V43A 1BO6A 1OB2A 1T3HA 1KO4A 2AD5A 2QP3A 5TDHA 3QBVA 3UMRA 1E9DA 1YZNA 2QRZA 4WXPA 3SJCA 5JRZA 4JVSB 2QAGA 521PA 1EESA 2ZVQX 4P4TA 4CRWB 4GOXA 5KSYA 4LBYA 4DLXA 3FGNA 5JJIA 2OFWA 2F7SA 4HZUB 1X8JA 4PC3A 1ZD8A 2YYZA 4B6FA 3OAAD 3CRRA 4B75A 2YNMA 1Z07A 2GEDA 2ZRKA 2W6JA 2WIAA 2WAYA 3NC0C 2FJUA 3LAWA 3KUDA 1VG0B 1XTJA 1TQ4A 1VIYA 5JECA 3CZPA 4I99A 4OHXA 2FG5A 4XWKA 1R5OA 1N5LA 5HE9A 4FI3C 4OJKA 4YC7A 5FI1B 1TEVA 2ZS9A 3L8ZA 3WRYC 4D0NA 3WYAA 2VBCA 3HR8A 2ZXUA 2J45A 3LBIA 1KIMA 4G5RA 4U00A 5DGXA 4BFVA 4I81A 1UBFA 1Q1EA 3I4LA 2FFBA 3LFUA 1ZC4A 4L4UA 1FX0A 5IRCD 3W90A 3WRXC 2NMVA 3LXRA 3R9XA 2FH5B 4BZXA 2WKQA 3GLGB 5AUNB 4Z54A 3P4XA 1M6NA 1DVRA 2JJ1D 1ZD9A 1D5CA 2C2HA 5JSZB 3N5CA 2PT5A 3GJ3A 5AJYA 5DHFA 4JJZA 3A4LA 1IN5A 5LD2B 4B3XA 3LX5A 1W4BA 4XWOA 1MABB 1F6BA 4FMBB 1AQUA 1JAHA 2DR3A 1HT1E 2RGNA 3REGA 5J4YA 1ZINA 2OBLA 2HCJB 2GWHA 2CL7X 3DOEA 2XSZA 3B7GA 4IXNA 4AYXA 3L8YA 3H2YA 1JNYA 4EJSB 1G64A 3NKVA 3THWA 2WICA 4GOJA 1ZCAA 5LPNA 3BB4A 1C9KA 1U9IC 3UK6A 1E9FA 4MRSA 3WHLA 4RD2A 2GK6A 4LK2A 1FTNA 5L3SB 2WTUA 1CF4A 5AK0A 4N3NA 1EFTA 1NN1A 3VHLB 1CR1A 1G19A 4QKQA 1KO7A 3B9QA 4LJ5A 2RAPA 4RD6A 2XNDA 1O87A 4EKDA 4G3XA 3LO5A 2QM7A 4JL5A 4ZDJA 2XTNA 4Q1EA 1SKYB 1WBDA 2OXRA 5LDDC 5FL7D 2ZE6A 4QJ5A 1W0KD 4TLEA 1Z0FA 3EA0A 4LV6A 2VEDA 4CDGA 1DAIA 3D6TB 2O0JA 2R6AA 4GP6A 2O8CA 5LBIA 2ZR9A 3NBYC 2JLYA 1IY2A 1GIAA 1RYFA 2AL7A 3UPUA 4PPQA 2X1VA 3K9LA 1KI2A 3GLGE 2GZAA 1XTSA 4L15A 2B92A 1N6NA 1TUEA 4F91B 3QKSB 1W47A 2JJ2A 1E3MA 4D81A 1E6CA 4C2UA 2VLIA 4LI0A 1SVMA 3CF2A 2WPDD 5BN4A 4FCWA 1WBBA 1ZNWA 1UADA 3TAHA 4JLBA 1QBKC 2HF9A 3R9WA 1WA5A 1JEDA 4WOPA 5TB5A 2Z4SA 3QXHA 4II7A 2QTFA 2WAXA 3VR5A 3UIEA 3FWYA 4KO8A 4XTRA 1YE8A 2BBTA 3NC1C 1T5LA 4JLVA 5AR1A 3KFVA 2IXFA 2QTHA 4PZZA 3RANA 4JVMA 5CLLA 1YKSA 4OI4A 1Z0KA 4FCVA 2YINC 4NU0A 2Z0MA 2VHJA 4IXMA 2VP5A 3LNCA 4RFSA 3U60B 1VDZA 1DG1G 2FV8A 3MLEA 4FCTA 3DMDA 2MMCA
chains in the Genus database with same CATH superfamily
1EE1A 1JVBA 2R47A 4EKEA 2NZVG 3E3AA 4YV1A 4ED9A 2V7UA 5EC8A 5G0WA 1KETA 3L7OA 2VQ6A 2ZKIA 1G63A 1M8JA 2OPBA 3WGHA 2BEJA 2YJ6A 2YIVX 1BGWA 3RJMA 3ZBUA 2WWTA 3VX4A 1QQBA 2FP4A 1KMQA 1BX3A 1CJMA 2ZK7A 3LZCA 3M4YA 4B83A 3MJVA 5J2TA 4CEHB 3MWFA 3ANMA 1XCLA 2GZDA 4TXLA 1NZFA 3I61A 1FIUA 4AJ1A 4XVCA 3C3WA 5B7NA 4LC9A 3S2EA 2Q1UA 3DEYX 3MJSA 1PGJA 5D51S 4L27A 4J2OA 2HFKA 2F4NA 2ILTA 2OO5C 2V54A 4W5WA 5TEWA 3CUKA 4HDMB 3V1KA 4RYLA 1F4LA 1AN0A 1Q1NA 4X3OA 3H9QA 2PHZA 2P9ZA 3PX3A 1B73A 4BO1A 4FMPA 2A78A 2FK8A 3TSZA 1F8YA 3FPFA 3ZE6A 5MFPA 2GA8A 2P78A 4JBLA 4TV9B 2EBUA 3EGOA 4HKTA 4RQUA 1NMSA 1AV7A 3VR0A 1KEVA 2DBRA 1OFHA 4NMWA 4OH7A 5KDOA 1XXHB 5B53A 1D0IA 8GPBA 3AIKA 2JLQA 3QQPA 4RMHA 1X94A 1Y6JA 3ZU2A 3WLIA 3OFSA 3CCFA 4BIMA 1EP3B 1R0KA 1DZIA 1RWWA 4GZ5A 2V7QD 5ICFA 4EY8A 4L9RA 4M37A 1SCUA 1KDRA 3BSWA 2CVHA 3GBPA 1H5NA 4LJKA 2O07A 1TUIA 4UM5A 1PT8A 1XJWA 1UMBA 3NNSA 5LZ9A 4CWAA 2VJKA 2BWJA 2AI1A 5JDCC 4HNUA 1JFFB 4FNOA 3SN6A 1EFUA 1WSAA 3F6PA 3HEMA 4DCOA 1I6KA 2YJTD 1W88A 3EOAI 3IJEB 3KEQA 2VT2A 3RJZA 3GCZA 3VR6D 3H0CA 3BHIA 1N8KA 3V48A 7REQA 3EA4A 5ISMA 3TUIC 3V6MA 5JXJA 3U3RA 1N5KA 2Q7OE 3QJYA 4ZYYA 4TOIA 3ZCQA 3R7LA 3UAZA 3W6PA 3CWCA 1YZQA 5LOVF 3ISTA 3AHHA 3O31A 3K32A 4C5CA 1ONOA 1XKQA 3DF9A 1TMGE 5DM60 3RVBA 4D02A 4EGQA 4DLLA 2IH4A 2A0YA 3BWYA 3FBTA 3K7EA 3LT5A 2WG0A 2HBZA 2J7PA 1DRVA 2CF5A 3TZQA 1H1LA 5A3RA 3ADCA 1G3QA 3UW1A 5CA1F 1T2CA 3RS4A 5CD9A 8ATCA 2A9FA 3PQ3A 3RRMA 4WCFB 4LG1A 2WZDA 1WMEA 3BZWA 4WBNA 5I7HA 2P2YA 3JQQA 2PVSA 1XRRA 1U5AA 1E63A 2XZPA 2GZ3A 3UY4A 3G2LA 2BKLA 1EKXA 3ZV4A 5JJCA 4OHOA 4PIMA 4NEHB 1QWOA 3PHIA 3TUJC 3UENA 2C9MA 5DTJA 5LQSA 2CFOA 3HJRA 1QFMA 3SZLA 4MGKR 2PV0A 4TKUB 1NAIA 1EFCA 1Y8QA 2ZDHA 2HBQA 1X7YA 3KKQA 3P1JA 2NVOA 2GEUA 4EFMA 1M67A 4KHZA 4LHEA 1GV1A 2Y76A 3NU1A 1KOLA 4ZJZA 1ONPA 4YB8A 1P0MA 4Q4CA 2WSMA 4C76A 4HUTA 3PYXA 2WHEA 3JQEA 3KD2A 1U90A 3L4KA 3R6DA 4MROA 2O3QA 1G2IA 3OPYI 1XA4A 4IQ8A 4YTEA 1JPUA 5JAUA 5CFOA 1U3WA 5CNKA 4LJ6A 4C3OB 4FYMA 3LA6A 4O5AA 5M34A 1GU7A 2P5TB 1BCRA 3LO8A 5FBLB 3E84A 4LA4A 1KDPA 2P62A 4GE0A 4HGZA 2BBOA 3RUHA 5KSPA 1YK0A 4BBJA 1KO1A 1TEXA 1TNDA 3REOA 5I48A 5JQGA 2BIFA 3C7AA 4X61A 2Q2NA 2RDMA 4Y0NA 1U3FA 1E69A 2WQZA 4M2LA 5TQ0B 4YJDA 2X4IA 5T4FA 2R1UA 3K0AB 2C7PA 1JIXA 3V4OA 2H0RA 2O7NA 1P1JA 1OLSB 1XMXA 2H92A 1EM6A 1FC0A 2XCLA 2IT1A 3WGNA 3WV5A 1Z82A 1AKQA 3PQDA 4BNWA 4LPKA 4LOKA 2WJZB 1ZS9A 3THSA 2W93A 1ESMA 1GPWB 4LRTB 2XX3A 4P22A 4WZ6A 4QM7A 4HX5A 1JJBA 4B8YA 2IK8A 4CLRB 2VH5R 1Z56C 1FMJA 4ZI3A 5AI6A 1DE0A 2KB0A 4HS9A 3BRWD 4FFSA 4F9EA 4AJLA 2BL4A 1UBEA 1ULHA 2QVGA 1T0PA 4B6QA 1PHPA 3L6DA 5JDIA 5EE3A 4DIUA 4D4HA 4UASA 4X97A 3T7IA 2QV0A 3UANA 1V71A 1YJCA 3OMWA 1T1SA 3E22A 2BFEB 1XZMA 5H7XA 1NXSA 2R1TA 1RXVA 1HZZC 4CCYB 2Y1KA 2JGIA 2KWIA 4XLTA 1E1RD 1GGKA 2L17A 4MWDA 3KQNA 5GP1A 5SICE 1E2MA 4PRYA 5K8CA 4I6JA 1P44A 1WUTA 3D64A 3VO1A 2E0IA 2ZT8A 4R7TA 3SSAA 4UOZA 1K88A 4AJIA 3JXEA 4C1NA 3WK8A 4UMDA 7ABPA 1K7SN 3AOEA 3GBVA 3OJ0A 4K9LA 4TVBA 2L69A 2C31A 2IS6A 5CVJA 4U2DA 1IB6A 1P1FA 3MHTA 1YDEA 4TTIA 1PT5A 4N03A 4HQ0A 2ILVA 3KOZA 3VH3A 4UOEA 1PLJA 10MHA 1JVNA 3AQIA 1OY1A 1ZO8A 4JEUA 2WLSA 1LDYA 3RM3A 5I9BA 4EHFA 3SKVA 4L5AA 1FS6A 2MIIA 2GO7A 4EI7A 4MAAA 1W85B 1K7YA 3Q2KA 2VPIA 4LYHA 2Q4EA 3LD9A 4DY6A 2Q3MA 1HF3A 1AQ6A 1UPTA 4BLWA 2C99A 3OZVA 2J7KA 1KVQA 5IDYA 1FMTA 4QT4A 2R2GA 1GUFA 2BM0A 1LC0A 2HDHA 3H9UA 1R4MB 2Q9AA 3CUWA 4L7QA 4KXYA 4OD0A 5E3IA 3E05A 1MB4A 1G98A 1NYLA 1Y81A 2A6PA 1CUHA 3N07A 4H0CA 3H19A 4IS2A 4UBJA 5TMDA 1PNVA 1H4QA 5AVVA 3GEEA 4HB2A 1ZWKA 1VHQA 3VU8A 4OL9A 1JI3A 3TRHA 4C7JA 4DIDA 1QOZA 3FAZA 2KBEA 2BGGA 4IV8A 4ZCRA 1H3FA 1L9XA 4X92A 3GLKA 4PZYA 1FYEA 1DPFA 3IGFA 1GKLA 4GF5A 1EK5A 1Y3DE 4B3IA 4CM4B 2NZ2A 5AVYA 4MKHA 4O4JF 3OX1A 1II8B 1TXGA 4IQGA 4J43A 2GK3A 4KVGA 2FE1A 3CE6A 4OU4A 1PFGA 3SIRA 4CI0B 4IDNA 4FLEA 4LZZA 4MS1A 4PZEA 5I7FA 2JFZA 3I5AA 3KR0A 3DZFA 5KYVA 1LD3A 2PXHA 2DVMA 2PU5A 3FB1A 2QX4A 1N2EA 4GKJB 1LI5A 2FWMX 2XVXA 2A7XA 3ACCA 4TS3A 4EYQA 1SOVA 4II3A 4HNGA 2PVCA 1X38A 3K9GA 2AEEA 2GZHA 1B8OA 4RCZA 4WZBE 3RIGA 1C41A 2QR2A 2XA1A 1UQRA 3MFQA 4FB4A 4XGNA 2AMYA 2X6RA 1N7JA 1M34A 4IJUA 5JO0A 4WZAE 1RJDA 1IJEA 1DWPA 2WM2A 4ZOAA 3P9PA 4MO2A 4YO7A 2EERA 3RU2A 3SJBA 1C8KA 1YB5A 3B48A 2Z56A 3T9CA 1N33B 2J9GA 3IMCA 5DN6A 4B9EA 1ZD5A 4M46A 2AQKA 3SICE 3W04A 1JHYA 4K3UA 2ZJ3A 3JR7A 1RAAA 1VLMA 2XV1A 3GEMA 3GVIA 4OYRA 4Q4HB 5K2OA 1T8TA 1U2GC 1YAJA 4QDUA 5TQ2A 1ZEMA 1ZOSA 3RK4A 4QU9A 1HE4A 4ZYUA 3OT1A 1D7AA 4I46A 2J3KA 2BRUC 4M8NE 2ERXA 2GJKA 3A6DA 3KYIB 4XA8A 3GRUA 1XR3A 1N2SA 4IJ6A 2PKYX 1JMVA 1JU9A 2BGIA 2A9VA 2PMDA 3LI2A 2FI1A 2XNCA 4XB2A 1BGXT 1V8BA 1NAHA 2OCGA 5EP1A 4ZJPA 3LCCA 1VL8A 3VTAA 1I7NA 3QU7A 4MKFA 4D3DA 5IBQA 2WT8A 1JLHA 3TOSA 4DDWA 4L5YA 3GMSA 5DT9A 2FSUA 1SD5A 1WXWA 3K1AB 3GT4A 4YRKA 5AH0A 3C14C 1ZL0A 4HNSA 3IDOA 3JARA 1ENPA 3JSAA 4HDRA 2Y1DA 5IKPA 1YV9A 3SLGA 5KEIA 1O6FA 1U0NA 3G5LA 1U2PA 5L95A 4LE2A 2ZLBA 3VYTB 2YW2A 4XARA 1AZTA 4BE4A 3LUFA 1SEPA 1HDYA 5ARBA 4I08A 4LY9A 4QHYA 1DWUA 2F62A 2UKDA 3L0OA 1K89A 1LBIA 1UPFA 2P9HA 2RGDA 3PXBA 3K71B 3I4FA 3AG5A 2CJYA 4WZZA 3X1MA 4DMFA 1NJ5A 2BUAA 5BT8A 2HPVA 2HQSA 5GQSA 4YRTA 1QLJA 2ZBDA 4PNHA 1QAOA 1ABEA 1UWKA 1XMJA 2PZKA 3M2TA 3WMWA 1EWRA 1MT0A 4ESHA 1OIWA 3T7RA 4DYHA 1VIDA 1ADCA 4DA4A 3BH0A 4R68A 1T6NA 3ZK8A 2IDKA 1PVVA 2VH1A 3QOXA 4L95C 2CHGA 3EXG1 5MF6A 3UXHA 3WJ7A 2IKQA 2LD4A 1VOTA 4EKNB 4JC4A 2V6GA 4PR0A 2C3PA 4MV5A 4Y9SA 5BQOA 1XMPA 2GD2A 3FFTA 2RG1A 1TAQA 4WBSA 4ZRNA 4AULA 1MN6A 1VPDA 1PE0A 2WU3A 1F38A 1X1DA 2NTYC 4E32A 4JYZA 1CW2B 5M04A 4DLSA 3SYLA 2PMWB 3QEBZ 2OOSA 2Z9BA 3PEFA 2PUWA 1B7GO 3LT0A 4JSRA 3Q1LA 3SQDA 2HQBA 1K63A 1T10A 3B3JA 3DCJA 3NEYA 4IQ4A 1IY9A 1Z63A 1S2GA 4UEOA 4TSFD 3TVDA 1ZJ6A 3ZGOA 5BN3B 4YYZA 3GI1A 1CUZA 3ZBTA 5CDUA 3DLAA 4OOFA 1ZOPA 2PX6A 2AH5A 1JLRA 4DSUA 1AU9A 2GF9A 2AF4C 3AR6A 3PHCA 5KJFA 2B2NA 2QAJA 2GBGA 4ZDWA 1R8JA 1E60A 2QI9F 4ASUA 3OQPA 2W6QA 2GRUA 3P45A 5GM2A 5BMVB 2ATXA 3GXBA 2BZ1A 2HMWA 4KDCA 1GR1A 2XMZA 4LWZA 3AR8A 3WGGA 1HMYA 4B0PA 1P1RA 4MZDA 4DJ5X 1CC1S 4RADA 3G6WA 3OOEA 3JQFC 1AN9A 4TMVA 5EWLA 2WNSA 4S05A 2HA6A 1HLFA 3AUKA 2X2PA 1USKA 3BGWA 4E5UA 1SVWA 3KWMA 2IYYA 2OHOA 3GMIA 4KQ9A 2ZUEA 3RVOA 1NFRA 2D5LA 3FPAA 3SPXA 3I30X 3WGKA 3TTXA 5ADWA 5LU8A 2X86A 5G4KB 4PLCA 1QB7A 4BFTA 4QNNA 3R7WA 3U4HA 2FOXA 2Q3DA 3E0XA 4GEGA 1TW3A 2BM8A 1KIFA 3QLVC 2XNHA 4K9QA 2XQVA 4JP3A 4A82A 4PN7A 2R96A 3A36A 3R4CA 3MJRA 2IL1A 3RBZA 4PSKA 4UU7A 2DUNA 3WOVA 5K6AC 1QDUA 5E8JA 5AVWA 4WKPA 1WBJB 1X1EA 2NSHA 2B1RA 2ZR7A 2DLDA 3TIGA 1QFSA 4WA8A 4QU5A 2PKEA 2EP5A 3DTYA 1YIOA 3GBSA 2W2LD 2VS1A 4ZVKA 1NVTA 2YJGA 5T3UA 4LSGA 5TPWB 1K7CA 4G0XA 3UWSA 2WF8A 4MOWA 4CKWB 3CRW1 4O63O 3TG2A 2F8MA 3BK2A 3PDJA 2QLFA 3EQ9A 4BWYA 2LR0A 1OC4A 4MPRA 1ST2A 5AW3A 4OFZA 1X7XA 3ZWAA 3FUUA 2A3RA 4AQYB 2IUUA 2EKLA 3AM5A 4Y67A 3GA5A 2IHTA 1B8VA 2C8JA 2YXPX 2DC1A 3WIBA 2VPYA 2PJRA 3TSYA 4YHHB 3H3FA 4FIDA 3V7YA 5BUSA 1RJEA 5HTOA 2EJUA 1Z2NX 4DS3A 4OXIA 5HIMA 1P2BA 4MUNA 4DMKA 3RF7A 4A26A 4NI5A 4Q0MA 3IUYA 2WEKA 3R7SA 2BP7B 4AW9A 3CRNA 4RH1A 2ZM5A 3RVKA 5GIOE 4AUMA 1COWA 2X8JA 4S0ZA 4X3CA 3U7EB 1GCOA 3VSBA 3LVQE 2QJTA 3IVXA 3UQZA 2AZXA 2NUAA 4G07A 4Y2UA 3I9MA 4ARZA 1T6YA 3GLFE 1HV8A 1HQKA 5BNWA 4GWLA 3TS1A 1XFDA 1UJ5A 4V0SA 3TRJA 3TK1A 2ZEJA 5ELMA 2WY2D 1JDJA 3W9BA 1G8YA 1H2XA 1PT9A 3HLYA 3OX3A 4UXJA 3OKFA 4YP1A 2JKYA 1IPHA 2GESA 2YFYA 3GUZA 1OXKB 2UVPB 1RIFA 2Q8QA 2VOJA 3HADA 4C7KA 2JFVA 1O9GA 3P2MA 3GLIB 1XZAA 3GFOA 4XJXA 1KR5A 3SC3A 2LRHA 3PENA 3PXCX 1SRRA 3G0CA 2JLCA 5DW0A 1XPOA 1L5WA 3M4ZA 5A05A 1NLFA 1XALA 4F4FA 1N2XA 1KI4A 2EWVA 2ZUCA 2ISCA 4XQCA 4YNBA 4ISBA 1SELA 3MCWA 4BNFA 1OFUX 3DXYA 2O2IA 3A4VA 2ZYRA 1L8QA 4NCHA 4YQEA 1UUFA 4RD1A 5ADUS 3TJZA 3QVVA 1CY0A 1JKIA 2VHWA 4EHKA 4WWHA 3VPHA 3H5NA 1H5QA 5I9MA 3TPFA 3U1VA 2CZCA 4CFYA 3JAWB 1C9EA 5J2TF 2DMRA 1NFQA 3LQYA 3KD3A 2WJGA 1O1YA 1IHPA 1W73A 3DBLB 1MRSA 1ML4A 2Y4NA 4OYYA 5LCXA 1C2TA 2FQQA 5E9WA 4HL6A 4ZAFA 4B5KA 4Q3LA 4F11A 2OHIA 1X92A 1MABA 3FXAA 4ACAA 4YDHB 1M66A 4XIYA 4AK9A 2B7BA 3MAJA 3CSUA 3X0DA 4JT2A 2IWHA 3TD2A 3QVTA 2C9CA 5B4UA 3M9LA 4RK5A 2X8LA 3HCDA 1QHSA 4MV8A 2PTHA 4EA6A 1Z4MA 1U6JA 3KCQA 3E2IA 3HO6A 1OKKD 2BEKA 4AG6A 4XD7A 3QUTA 5K3FB 1CBUA 3AERB 1XD8A 4UUMA 5A5VA 3EH2A 3MA0A 2CD7A 1K97A 1SXJB 2PUTA 4DNFA 4KKVA 1FBTA 1U1IA 4QBFA 3FE2A 3ZKAA 4IDHA 5BV0A 4RDCA 5DWDA 1PTJC 1HL7A 2ZJBA 4C4SA 1Z7GA 3KR9A 4A73A 2D00A 4RZ3A 1LPSA 4W8OA 2OYCA 5KZMB 3NWOA 1Q3KA 3BJZA 2H7YA 4J16A 5ALZA 5TSDA 1IJFA 3TVYA 4FXOA 2B6NA 5BSMA 2EFEB 1TTTA 1POWA 1JTVA 4O2BB 3RS7A 4ZDKA 3AVUA 3BMOA 5CLIA 4FSHA 4MEBA 2VUTA 3TLBA 5IJ9A 1A9OA 1CS0B 1MFZA 2PQMA 3P20A 1FJGB 2XE6A 3QK7A 4BCBA 2GM3A 2PX3A 2ZRFA 1DV2A 4JQYA 1Z4NA 3EQ8A 4TVSA 2FLKA 3MXTA 5D84A 4YRPA 3ZWBA 3JCZA 2CNDA 3NDPA 4BPBA 3WSTA 2FMIA 2F48A 3M3HA 3D6UA 1DAMA 2ZAOA 4B6JA 1Z0IA 4XRRA 1EZ1A 3CN7A 1GGNA 4LN1A 4Z53A 1JA1A 3BCRA 2FA9A 1CJUC 4DHEA 3NBAA 4WIAA 2Y1WA 2ZYIA 1JA0A 1N5DA 1Z06A 3UAOA 3G9TA 3U3JA 2EGUA 1QZZA 5DEOA 3VUFA 3A25A 3WSVA 1KWKA 3WL7A 1SWWA 3QVJA 3C3DA 3HQ4O 5BNFA 3W6OA 4MVJE 4MIEA 5ARCA 4DA9A 1KKMA 2VP2A 2AQIA 5IH3A 5G3ZA 1E18A 1JKXA 1GQFA 1XQ9A 4WBNF 1TEHA 1KMNA 1LW7A 2IHZA 1CUJA 4G81A 3E35A 4L0QA 1PG0A 4Q82A 4B33A 2RE8A 4WPGA 3LJKA 3SWWA 3CNQS 2BGTA 4ZN6A 3JQAA 2PSDA 1N9GA 2R1VB 1DAOA 5KCMA 2PLRA 3LDGA 3OF3A 1ZN7A 2C3YA 1AKEA 2PH3A 3BS4A 4NYJR 1BS9A 4QIHA 2BE7A 2EDCA 2CLFB 1PWYE 2VJDA 1WUKS 3DZ8A 1TJ4A 4R0VA 5JWHA 4A5SA 4DM7A 5B1YA 4DDMA 1VPLA 4KR3A 4OQEA 3FPGA 2O48X 3R9XB 2C5EA 3BQ9A 3GJSA 4JBHA 4LMBA 2A9RA 2YDYA 4I0WB 3A2MA 3ZWOA 3LOPA 4JODA 2RONA 5ENDA 1UWLA 2I03A 1RPAA 1IC6A 2IYAA 4EUSA 1B8NA 4ZQEA 4EPYA 3IMEA 1EE2A 4X8LA 1A8IA 1IH8A 1SHKA 4LNUB 4DCJA 4CEHA 4ILKA 3H2KA 3P71T 5IM4F 3HFSA 2B5WA 4FI3F 4PYIA 3O9ZA 2V5UA 4Z3DA 2XKKA 2YC4C 4IIDA 4GDMA 1W581 4O6VA 3HWRA 5JQGF 3NV9A 1OGJA 3GWZA 4XTCS 5DTMA 1HDCA 3O0DA 3B1XA 4JIGA 5LA6B 1QVRA 4HDMA 2CE7A 2ZUTA 4R8LA 3IUNA 4HC4A 4B74A 3EMKA 4FD3A 2IPAB 2K87A 2Z08A 4FKZA 4N7RA 2WU0A 4TV9A 4BGVA 1L1EA 1TAGA 1QRDA 2DERA 4NHEA 1M2NA 2VDRB 3NR2A 1XXHA 4JEMA 4TMKA 1FE8A 1RVV1 3OF2A 1UC5B 5FWYB 3PQ4A 3ZVKA 1RKVA 1IZ8A 3IHKA 4YJGB 3VJRA 1CIPA 4M98A 1Z45A 3GGDA 4RV4A 1Y98A 4JJ4A 1KZHA 4FS3A 2I3ZA 2NVWA 2QMOA 3C43A 1E6LA 2EKDA 1PWEA 2ONJA 5JSQA 3KSBC 4MQMA 1R3UA 2DG2A 4YJKA 1X1TA 2ODAA 2IYXA 2WJIA 3DVAB 3LIPA 1KSGA 3ZH2A 3WZMA 3FI0A 3G7NA 4IUCS 1JRLA 3WG9A 3RTDA 1TQ8A 1UIMA 4HLCA 5AVOA 1YRHA 4BX3A 5THQA 4NZOA 3QYPA 1JFFA 4PG4A 2QVZX 3OEHA 5IBPA 5LMUB 1X1CA 4WH0A 2R6JA 2H2IA 1JLKA 2B1IA 5EE5B 5L7TA 3OSZA 5EKSA 2P79A 5F7OA 4DVGA 2XQGA 2O6LA 5KNCA 1TL7C 4LRYA 3K8ZA 5AMXA 1T9AA 4W5TA 3SHOA 3H8VA 3OURA 3WFJA 1T0UA 2RHTA 2JI7A 2WUVA 2IZOA 2YYYA 2XB2A 2XA2A 5FWXA 1RAEA 2AG6A 4NP6A 1QFYA 4L76A 2FN7A 3PNKA 2AOTB 2ZRNA 1UH5A 3KEFA 4OSEA 3U4IA 1ORRA 1VGQA 1Y80A 4FCCA 2PWPA 4LJ7A 4H1WA 1YQQA 4OHBA 5B6PA 4TXJA 1LXCA 3ZDRA 3OWXA 1XSEA 5K8TA 3RPEA 2FK7A 5BN1A 1VLJA 1O57A 1ETUA 2GS9A 3PIIA 2QTVB 1ZHHA 3ET4A 3M2PA 1BXGB 5E7IA 4D4KA 3WGLA 5G1OA 1A5SB 3ABIA 1FVHA 1C14A 3KB2A 2XQKA 2PGDA 3QUAA 1L1RA 3IVRA 4GPTA 3GCWA 2JRLA 3H42B 4IDOA 1G66A 1MW9X 3PU6A 4N12A 4F92B 5CHEA 4TKUA 4KVZA 3KPWA 1EH5A 1E2LA 3FAKA 1JKFA 3EZ6A 3ABQB 3HB4X 4MPDA 5F5LA 2OEPA 3UFBA 5KTSA 2AQ8A 4YGYA 5LKAA 2LP4Y 4GPAA 4LX0A 4DUGA 2UXDB 2CNOA 1F3LA 3UB3A 1TIBA 4TPKA 5TPZA 3H05A 4EF4A 4FJ1A 1B0AA 1XVAA 3HUTA 4JI7B 1NU6A 3L77A 5BQPA 3IDAA 1KZ6A 4YRQA 4BZPA 1A9PA 5EINA 3RS3A 2ODNA 2REOA 3E3LA 3W5VA 3VU9B 3KYDB 2DFPA 3I01M 3T06B 3AHJA 3H9CA 1U7TA 2GQ0A 2XUAA 1UDWA 2Q4TA 3U7GA 3CLSD 3OQIB 4NH0A 3MC1A 2W71A 4NAUA 1A9ZA 3EPRA 3H1PA 2DBZA 1BJTA 3CW2A 1GUZA 4HGOA 2CCJA 2A94A 2AEMA 1C3OB 4GMFA 4E30A 2AI2A 1Q22A 3UAGA 1D4AA 1R74A 2C78A 1IWBB 1PFWA 1UR5A 2H52A 4H3VA 1KY2A 4DMRA 4B3SB 4C7MA 5JALA 1DX6A 2ZDGA 1KI1A 3PR1A 5TQ0A 2C58A 2QYSA 2VHYA 5JPCA 1DNPA 3IMGA 2PGOA 1UAAA 4ZZIA 2REXB 4JWKA 4RAQA 1K75A 1T5IA 4DYDA 4OHPA 1VKNA 3AV3A 3F2VA 5ICGA 3W8FA 1A2BA 1I4LD 4Y9TA 5FBQB 3SQOA 1PUIA 2CEAA 4NF2A 2ZTSA 1EGHA 1P4RA 2PZMA 2X4GA 2X58A 3JVDA 4FJ0A 3QF7A 4L8GA 3TE6A 2JHPA 5AOAA 3UJ9A 4C89A 5JZBA 4CLRA 1N3IA 2FEOA 3Q5EA 2YWGA 1G4AE 4P86A 5CW1A 1Z4QA 4DSTA 4E5VA 2ID8A 5FOQA 2OCBA 3A1EA 3UXEA 2D2EA 3V55A 4RTQA 4H7IA 4RHCA 4HB3A 3PDWA 1K6MA 4MV3A 2ONZA 3D31A 4MWZA 3HL4A 3ENWA 3HFRA 1VL1A 2PRSA 4CDRA 4AWXA 2I1VB 4ZZ0A 2YV3A 1YZ3A 1X8LA 4KITB 5ECGC 3RTGA 3RJ9A 1P2SA 4K1LA 3GIWA 2VZ0A 4A2WA 3L43A 2H4HA 7MDHA 3PZBA 4RW0A 2WYOA 3UV7A 5DOVA 1BU5A 1M76A 2ZYVX 4HDKB 2X8AA 4CCYA 3TECE 2QENA 3T95A 4B3CA 1E0AA 2LE0A 5E1BA 1PJ4A 1RWVA 3OLWA 2JI8A 3WBFA 4EB6A 2CXUA 3L01A 3VR5H 3B7WA 1FRFS 4U7TB 1JQJC 2XRMA 3B8HA 1IBSA 1AKMA 3DT9A 5JWOA 2DETA 3TOVA 3PJEA 2Q1WA 3MYRA 4LJSA 2ETXA 3KVVA 1W9HA 1N9ZA 3TTYA 1H93A 1DKQA 2GAIA 2QZJA 3T3IA 4KYIB 1ZWLA 3RH0A 2X5KO 2FW1A 3V4LA 3PE4A 4U4AA 3RVMA 5L45A 5LZ2A 2ZU6A 2IYOA 1EFAA 3GFTA 5E0OA 5CB4B 4NV1A 2MHCA 4QWMA 3AEKA 3SAJA 5DM70 1W85A 4AP9A 1J22A 3PFIA 3VX3A 1A8HA 2UZ1B 1YJ5A 4C3UA 3WNDA 1ZY2A 4C4XA 4F06A 3PLRA 2IVZA 2XB9A 1Z6PA 3A6HA 2JH9A 2ADOA 4D5GA 3D7RA 1R4MA 3DBHB 5A4FS 5GAJA 4Z1MA 3HYNA 3DBOB 4PFKA 3VAZA 2GHIA 4Z9FA 3CVXA 5DTRA 3MPOA 4JASB 2BUBA 2RGAA 3OKCA 4YBZA 5B3AA 3GLHE 1RBYA 2VRCD 5CFRA 2KYRA 1NMZA 2JDIA 5B3JC 1VC2A 5EHIA 1DEAA 1ZLXA 3E5RA 2PL1A 1CRPA 3T9BA 4LS3A 4JC0A 2FWIA 2HB6A 1RYMA 4DV3B 4CM4A 2C5GA 4KSYA 3GCDA 1KI6B 3LQKA 5CVEA 3W2TA 4YRSA 1IM8A 2IEYA 4HXYA 1II8A 3MCVA 3TQIA 2XCRB 3GYBA 4N41A 1BD3A 4RS4A 3QU9A 2HA0A 4ZO8A 3SKXA 3LUBA 4O2LA 2JAHA 1G1AA 4FWIB 4M54A 4U2FA 4WFQA 2JKZA 2FX5A 2UAGA 3KVNA 2HDWA 4CMEA 4J8PA 1E2DA 5BPHA 2H9YA 4DTIA 4JKOA 1DHRA 2QTNA 1VB3A 3FZYA 1OR8A 1Z2OX 4I9FA 2I7TA 4JJFA 4XZ3A 3BL6A 3DTNA 4HQOA 3FPCA 2CNWD 2M6KA 3VBCA 3VPAA 3ZWPA 2CW5A 2P6MA 2BF7A 5FI0B 4MQFB 2A5YB 1EMDA 3OTQA 4UZEA 1QGAA 2YHIA 3D3KA 3EIQA 2JANA 4HLUA 4S1OA 3ZKWA 1CZOA 1KIAA 2XGOA 4XB6B 1GKYA 5G53C 5H4GA 3TDMA 3MAAC 3MD0A 5K0LA 3DBVO 3SF8B 2VHQA 3A9UA 3E3OA 1Q91A 3PKIA 3U3ZA 3TSAA 1HDIA 2BHNA 3KM0A 4Q4HA 1XC7A 2WUDA 1XWIA 1Y4ZA 3KOWA 5K8LA 3T0GA 1NW5A 2QRVA 1WDMA 4PINA 3K0FB 4XR9A 2YOFA 3F5MA 4CG1A 2YVLA 3QLJA 4RPCA 3USCS 1ZMTA 2YV2A 1BJKA 2HWKA 3IEXA 4KK4A 3COVA 1VQ1A 4KIWA 4HNRA 5JYEA 4GE3A 1VJTA 1YVEI 3L7NA 2ZIEA 2B7CA 4ZGGA 3IBGA 5ALWA 4MULA 3FZNA 3SEAA 3GEBA 4TXMA 5BSHA 2WSSD 5K05A 2UUAB 2W83A 2ZOSA 4PQGA 4RTLA 2MINB 3D9QX 2XD4A 3FDXA 5LP6C 4DFDA 1L5SA 3HXKA 1RKXA 1Z0SA 2QUAA 2X4LA 3K1AA 3M1AA 1K08A 2PWYA 5H9VA 1MVNA 1E2IA 4PYNA 4BNKA 4DM3A 1THMA 2W2MA 2NV0A 3K1JA 2LIVA 3V1TC 1URPA 2CLLB 3LCJA 4DVJA 2Z5VA 5DSTA 2R3SA 3KDPA 2WQ6A 2VF5X 2TMGA 2PLFA 5DI3B 1X70A 4KQWA 4MUGA 4B4OA 1D6JA 2EJBA 2HDOA 2Q1YA 4XYGA 4IOKA 2ZG6A 3CZ9A 1XQXA 4F3CA 5JATA 1RRVA 2UUPA 4D25A 3BA6A 4ZKEA 3IQHX 1NVKA 5I9NA 4QAJA 1U2ZA 1YL7A 5AO9A 1ODLA 4R05A 2VHTA 5KOJB 4C2AA 4CMAA 1L7OA 3PEVA 2IYUA 5EXEA 1LJUA 5IARA 4OMCA 1ZIXA 1CEQA 5DX1A 5K6TA 2V65A 5ALOA 2OXTA 3Q41A 2QW8A 2VF4X 3IJ5A 3LP6A 4N7MA 3VYWA 1DJLA 3O1JC 5CH3A 1GSAA 1QONA 1T8PA 1Z8DA 2IX9A 3TE7A 5B58C 1TAHA 3DOCA 2CFTA 1NV8A 1KEEB 4BVHA 4TTPA 2QUBA 4C6HA 4BX0A 2B94A 4E15A 1RWQA 1E2PA 1GV0A 2CNNA 1ODCA 2HJHA 2VT7A 1ES9A 4F5DA 2FRXA 2GVDC 2I6QA 5IX8A 1BFKA 1GA1A 3DGFC 2OLEA 3T9AA 3VC1A 4J0HA 5D3QA 5EUCA 3BMCB 1DXHA 1N5JA 3OOSA 3GN1A 1E9CA 2PKQP 1ZRHA 4HN2A 4NECA 1XPJA 1REQA 3FPEA 4RTKA 3I9V6 1XNQB 4Z3KA 3A4IA 4JLWA 3Q9NA 1PX0A 1O97D 2FETA 2MSCB 4PGHA 3OTOB 2R97A 2UZIR 1KFEB 1D0VA 1HQCA 1RQLA 2JGDB 4LNAA 4N18A 2H4XA 4RE5A 2Y92A 2AWNA 2X19A 4S1NA 3T34A 1QG4A 4UVEA 5BMVA 4KLRA 4PO3X 1SU8A 4BO2A 3L0CA 1P7ZA 4OBXA 4Q00A 1QH9A 4Z7OB 1FYVA 1PK9A 2P1RA 1HUQA 8LDHA 3UWOA 5HFAA 1ODIA 4M1TA 5ALIA 1EJ2A 1X74A 2G9UA 4AD8A 1YACA 3E3NA 4FDVA 3BGIA 4D9MA 4YCSA 1G16A 1CUIA 3IBCA 3PX2A 4UAVA 5BO5A 1L5HA 4LW8A 3TI9A 3T9FA 3HXQA 3H2JA 4YALA 3A10A 1P6QA 4JUBA 5CM8B 5AHWA 2JJYA 5G4KA 1H8EA 4LPSA 2CBXA 4ZI5A 4YPOA 2QW1A 3BQNB 1EHYA 1A76A 4Q9NA 1SEVA 3GL9A 1F5SA 1J8DA 1MOSA 3EEQA 4OLJA 3WMEA 4CU5A 8OHMA 5BYBA 2HPZA 3H4VA 3RUFA 3QKUA 4A27A 4UU0A 5JSKA 5KC9A 1O6ZA 1HA3A 3W5BA 3AHEA 1O5IA 5KYYA 1Y6GA 4M9RA 4P1ZA 2O06A 1FRQA 4DKXA 2C20A 2OV1A 1TRKA 5TPWA 3A1VA 4U8GA 1ZD4A 4Q7KA 3LY7A 3KQVA 4CKWA 4I55B 1RLUA 1YXMA 1GSHA 1ZIOA 2CWDA 3ABZA 3UAVA 2C5HA 3CHYA 3GFFA 2W0SA 3K9CA 2B3DA 4R81A 4RK1A 1H2WA 3COWA 4RU1A 5HCNA 2LWIA 3LMKA 3LHFA 1YJ8A 3QVGB 4V3CA 1GADO 2UU9B 2AGVA 3LGXA 3PPYA 4L3VA 1H0KA 3AR7A 5HKBA 1BW9A 5SZJA 3KOMA 1E3JA 4K9MA 4LF8B 1RVDA 2Q5JA 3DPUA 4EI2A 4ZYZA 1I32A 5JAPA 4FDTA 2WWXA 4TL9A 1QJCA 2X2OA 4M55A 3J81k 3MQFA 4I9NA 3N3BC 4DJEC 4JCOA 1JEJA 1L4LA 5COBA 2BP7A 1G5RA 4WQMA 1QG6A 2RHHA 4KR0A 2H1OA 1I3MA 2H4YA 2ZPAA 1BA3A 1JH8A 3VNVA 4R51A 1RBZA 3R74A 5IPFA 2XTMA 4V0LA 4ZOLB 1DQPA 1DKMA 1A82A 4HZGA 2EKQA 5A3SA 2E4YA 2B5OA 4FYKA 1J24A 1KF0A 4P3PA 4QRHA 2AC2A 5SY4A 2J6CA 2WKRA 1NQTA 2EHDA 2GN6A 3LRXA 4YJ2B 3AJRA 3KZ1E 2ZBUA 3AX6A 3GP8A 5DX8A 3E9CA 1FW8A 1C7JA 4P3YA 4AICA 2UVPA 2V6IA 3NYQA 2NXWA 3N0WA 1FLDA 3GLIA 4EMSA 3RUDA 4MHTA 5EQDA 1EFDN 3DFUA 3ZDFA 4HBGA 1TUBB 1ZH4A 2O3TA 3TXXA 5ALHA 2BFAA 2D0PB 3L82B 2C3OA 5I8ZA 5FDFA 5I7UA 5KNDD 4D9CA 5DGDA 4BS9A 1P9RA 4EHNA 4RDHA 2F64A 3MILA 1RAFA 1IG3A 2XWSA 4DT1B 3FOEC 3R5SA 2RK4A 3KEOA 3M6AA 1VFPA 4L6CA 4X1YB 2WHXA 3LXXA 4G1FA 4ZHQB 1UQUA 5K0ZA 8MHTA 4J2TA 2F1HA 1ODTC 3IDZA 3NBQA 3NORA 1UKYA 4Z4EA 1UK6A 2GX6A 1WZ2A 2CYCA 5F51A 3JAWA 4UD6A 4BQSA 1NPDA 4TVKA 1Q21A 4TLLB 3STXA 1N0UA 1KZYC 3DBLA 4WOBA 3EPJA 3GR6A 3O2SB 3H5RA 3PPXA 5JEEA 2VA9A 3GUUA 1LCIA 3OFJA 2DFLA 1MB0A 3ESRA 4QDOA 3O2QB 2QD3A 1WY7A 1SHLA 4X84A 3SE0A 5ADVA 5HYVA 3EDOA 1NN3A 4AL4A 1DBIA 2ZIUB 3CVYA 2GHRA 1HYEA 3MUNA 1HGXA 3HXPA 3HVHA 4AKGA 2BCGY 1Q16A 3AL0C 2RJ3A 4LOLA 4KLZA 1TDJA 2B83A 4MRAA 4TV9F 4B6GA 4AQ7A 1NVVQ 3AERA 3F78A 3PF8A 2A35A 3QXGA 4JP1A 2CHEA 1OXUA 3ER6A 1QFJA 1SXJA 3OAAA 1HE8B 2RI1A 3TUZC 5B1SA 3P9RA 4H4CA 3ILSA 1PQWA 3SJAA 3RV3A 3V3KA 4FK8A