2ZJBA

Crystal structure of the human dmc1-m200v polymorphic variant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
239
Chain Sequence
PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQVELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
publication title Structural and functional analyses of the DMC1-M200V polymorphism found in the human population
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
total genus 60
structure length 239
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjbA00
4EPYA 2PMKA 1UKEA 3TAUA 3BFXA 4EJSB 3T1TA 2DWOA 4WVFA 1KJZA 2CDNA 4LRWA 4UNRA 2ATVA 5DLQC 2P67A 1OXXK 4D26A 2XZPA 4MQBA 2NPFA 1M34E 2JCSA 3IPXA 1ZUNB 4ON9A 4MKHA 1TAGA 1W5SA 3L8YA 2H18A 2OLJA 4GZLA 2OZEA 4QC2A 2OBMA 4Q9JA 4PAMA 2EFGA 4B48A 2W6IA 4DCTA 5JS7A 4M4SA 4KXFB 4PQYA 2WJIA 2SHKA 3T34A 2NO7A 4QNMA 4NCIA 4TLBA 3EZ7A 4V0ME 2FPMA 3IQXA 3T15A 3THXB 4M2LA 1TTTA 1T0JB 2YOFA 4MA4A 2QTVB 4XSHA 1JXOA 1DEKA 5AUNB 2XZOA 2FN4A 2ZJ5A 2GZAA 3K0AA 2DWPA 1F48A 1ZC4A 1JPNA 1OXTA 5FOWA 3U44A 4BGDA 1EG7A 5B30A 3QG1A 4GP7A 3NHAA 1UFQA 4C2TA 3KZ1E 3UWOA 1OJLA 2OT3B 3CR7A 4LPSA 1D6JA 3DEFA 5BYJA 1YJ5A 1EFTA 1X8LA 1IQPA 4JLVA 1J70A 1EWRA 5KTYA 3DMNA 4DCSA 2F55A 4C2UA 1N5JA 5UKDA 1XPRA 1KI7A 2W2XA 3PUZA 4TYNA 1JB1A 1ESMA 4FMDB 1DG1G 3U5ZB 1IY1A 3SFZA 1ZM3A 1YZLA 3E1SA 2ZTSA 5FI0B 3G0HA 4Q47A 1JJ7A 3A1VA 4RKFA 121PA 4FD2A 4QBFA 2X1VA 2IS6A 4BLOA 1NKTA 2ONJA 1OHHD 3ZQJA 1Q12A 3OIYA 4HUQB 1ZD8A 1IBRA 2Z4RA 4V02A 1GG2A 2OAP1 3P4XA 1CRPA 2H8KA 2IYVA 1OXVA 1RRPA 1RRCA 2ZJYA 4PX9A 1FX0B 2CVHA 4GP6A 3VX4A 4BFUA 4RFVA 8OHMA 1XEWX 1ZNXA 3M4YA 4LPKA 1OH6A 2F1HA 1G3MA 2CHGA 3R20A 2WHXA 2JLZA 4O0MA 5CIQA 2XSZD 3RC8A 3VHXA 5DYGA 3CB4A 4NYJQ 2DY1A 2FH5B 4QJ5A 4OK5A 4URUR 2AN9A 1OFUX 221PA 2HUPA 2ZXUA 1EFCA 2C04A 3BRWD 3AVWA 1N6PA 1J99A 3ADKA 2V54A 2O8CB 2O0KA 3ZDQA 4M53A 1JQLB 1UKVY 1MH1A 3K1JA 2GXUA 3RABA 4MRRA 3FHTA 1QHHB 1M7HA 2GETA 5IDVA 1UEJA 2OCYC 3CNNA 4LK2A 1UDXA 2FEMA 4W7SA 3I73A 3BC1A 4DBLC 4JVLA 2A5FA 3AV0B 1Q3HA 1WCV1 1N5KA 4FWIB 4ACBA 1ODFA 4RZUA 1JAHA 2IYXA 1MABB 2FGKA 1G7TA 5H1YA 3O8RA 4LBZA 1T3HA 5KSYA 1R8QA 5KOYA 1KO8A 4PXAA 4IRUB 4C0AC 2J0SA 3CRW1 1NVVQ 5D3MA 1E2DA 1ZAKA 1E2MA 2NIPA 2YWFA 3UKDA 4EPWA 4PPQA 5L3VA 1E2JA 1YR6A 4IEIA 1FQKA 4KVGA 4OQNA 1KDOA 3KKMA 3PUYA 1RYFA 2ERYA 1Q1QA 2BV3A 4YLGA 4V0KA 1N25A 2QT1A 5AJXA 4H1UA 4TL8A 4LCBA 2F1RA 1G64A 1TNDA 1VKJA 4NP6A 5CK4A 2EWWA 2OHFA 3CM0A 2BDTA 3ZVRA 4C0KA 2ZSDA 3O47A 4US1R 2ORVA 1AGRA 2YNMA 1E1QA 1P73A 2WMOB 3THWA 1KI4A 4GL2A 1RC8A 3EC2A 4AIIA 2ZI3A 3CWQA 4DXAA 1G16A 4Z8YA 4C9BA 5EXXA 1JNYA 2ODWA 3EW9A 4RZ3A 5IK2A 1U8ZA 1AKYA 2GCPA 1ZD1A 3KFXA 4TMTA 3EWAA 2EFDB 4MYHA 4G5SA 5FTJA 2NOAA 4QBIA 3B1YA 1OF1A 5DHFA 2J7KA 1NBMD 4OJQA 2C8VA 4IFEA 2C78A 1YZUA 2G77B 2ZRGA 1QHXA 2JAQA 4C0QC 3KQUA 2ERXA 3QUSA 4IOMA 4LBWA 3BXZA 5DI3B 3VTKA 2J5XA 2G6BA 2ORWA 2IWRA 1CRQA 1IY2A 4ACAA 4JLAA 3M1IA 4XVRA 2QM8A 3ICQB 4GFDA 4NYJR 3EASA 3VX3A 4EPVA 3DM9B 1CP2A 1CF4A 1O87A 2NG1A 2ZRIA 3LBHA 3RHFA 2O0HA 4URVR 2FV8A 1YR7A 4A0HA 3QG5A 2ZU0C 1A2KC 2IXFA 1PLLA 2JLUA 1FP6A 2RGNA 3SFVA 5IT5A 1OT3A 2CHVA 1HYQA 5CDFE 3F5FA 1YZQA 3V9PA 4MH0R 1E9EA 1OFTA 1ZC3A 1Q44A 4MKIA 3LO5A 3LW8A 2BMDA 2DCUA 2ZANA 1OIWA 1T8UA 1G7SA 2ZI5A 5EUMA 5BN5A 2ZVPX 4XH9B 2QBYA 3UG7A 1V5WA 3ZGXA 4Q9IA 1S8FA 5BXQC 1NVVR 2AKYA 3FMOB 1P72A 4HLUC 3A37A 2XXAA 2RGDA 1N5LA 5E7IA 4ASUD 1MO3A 3BERA 3AUXA 1W0KD 2Y8EA 2H1LA 3MRSA 1DELA 1KZ7B 2Z0MA 3PV0A 2QPAA 5DH9A 4YONB 1KOFA 5FOXA 1DAHA 3MSXA 1Z06A 2Q9AA 3AH8A 3P27A 2ZITA 2KBFA 2DFTA 3PEYA 4DRZA 1N6KA 1G291 1W49A 4XWOA 2IUTA 5IF9A 5SZKB 3O8DA 2HCBA 3K0AB 4QNRA 5EUQB 1NSTA 3RRMA 1AN0A 3RWOA 1QVAA 3QY0A 1J8YF 1ZNYA 4Q7MB 1R0ZA 1KNQA 2PX0A 3U44B 4TT3A 2W0MA 5F3WB 2ZAOA 3DMDA 5JS8A 1W47A 1F2UA 2O8FA 5A5GA 1HV8A 3TKLA 1W36B 3AM1A 1R6BX 2JDIA 3BJIC 4NCHA 4PC3A 1RVDA 4QL3A 5DGXA 1OKKD 2GXSA 1XTSA 1HTWA 1G21E 2A5YB 2YOHA 3HDTA 3NIBA 1JR3A 3OESA 3LAWA 4OHWA 4Q02A 1XDBA 2HJGA 1W0JD 4FMDF 3UMSA 1AQUA 1ZYUA 1TUIA 1M8PA 3TQCA 1R0WA 2VH5R 1J7KA 2QUZA 3I92A 3B1WA 4HZIA 4KHZA 1S2MA 3A1SA 2F9LA 4GMDA 1CJTC 1Z3IX 4ZI2A 2JJ2D 2F7SA 3DKVA 4L16A 1MO5A 1GM5A 1XP8A 3K9NA 3LLMA 1GUAA 2C9OA 5JEEA 2DWQA 4P0TA 3SN6A 3BIFA 5DSZA 5KNDA 2BKEA 3CF2A 1GNRA 2ZJ8A 2E1RA 1DAEA 2FSGA 2ZRMA 3GQBA 1XTRA 2IW3A 1Z08A 3M0EA 1KI9A 4D82A 2A7QA 3TNFA 2NO0A 2RGEA 4BFVA 1E9RA 2AD1A 3ZIAD 4CGZA 2NGRA 2YV5A 3MAAC 1W48A 5FPSA 3RS7A 1KSJA 4MYUA 3PVSA 3D8BA 2C95A 4A82A 1VDZA 3U7EB 4LV8B 1R5BA 3OEEA 3CX7A 1G7CA 2ZRPA 5FTNA 2VL7A 4JBXA 4LYHA 4WAUA 2DFNA 1GDDA 2GJSA 3PENA 3B82A 3OIUA 3TSZA 2V6JA 2GNOA 1F60A 3BK7A 3ICEA 1SKQA 2QAJA 3T5GA 1E2FA 4BLQA 1X86B 4PTLA 4KVAA 2QG6A 1IOZA 2WIBA 2BOVA 1D2MA 1JQJC 4JLOA 3RNLA 3DVLA 2CMKA 4PHGA 5BW8A 3NBXX 4F4JA 1ZNZA 4G5RA 4QOSA 3DZDA 2FFHA 3FMFA 1M7GA 1N6IA 3QEJA 1IY0A 4QBGB 4BFXA 5FPKA 5AUOB 1BO6A 5F98A 4BFWA 4LZZA 5HZHA 1K5DA 4DSNA 1ESNA 1HUQA 1RFLA 4I81A 1VG1A 3EXAA 2JEOA 3LNCA 3DM5A 3HJNA 4M21A 5D3MB 1HT2E 2GJAA 3REFA 2PZEA 1S3GA 2FSIA 4A92A 5TMPA 2REOA 2DB3A 3KJGA 3LX8A 4LYAA 3WP0A 2GCNA 2GK6A 2QMOA 4B3GA 5E7JA 4IW3B 4Q4LA 1NI3A 1U99A 1QHIA 2CLSA 4JYBA 3TGPA 5EE1A 3U6KA 1D2NA 2J41A 1NJGA 4B76A 2D74A 3N2EA 3W8NA 3WRXC 3WY9A 4B2LA 1IJEA 5TB5A 3LXXA 1HT1E 3THWB 1DARA 4B6FA 4YDHB 2QMUA 4A6XA 4RCZA 3K9GA 1YRBA 1KJWA 5EQTA 4NZYA 4NYMQ 2RGGA 3ONWA 4LHWA 5JCPA 4B3XA 4PZLA 2IT1A 1XEXA 1XEWY 1OHHA 4LUCA 1KI6A 2VF8A 3OEHA 4HLQB 3TH5A 4B3CA 1JPJA 2AFIE 1EWQA 1FUUA 4MRPA 2WWHA 3JVUA 4FXPA 5JJLA 1KY3A 3KQHA 1GOTA 2G83A 3ASYA 2VRWA 4PC2A 4F91B 4GZMA 1IXRC 3I5YA 3KKPA 3PCRB 5FTKA 2YKGA 2QM7A 1WDTA 2QNRA 5KU1A 1ZU5A 3IIKA 3BORA 3WBKA 1KO7A 4AKEA 4LDJA 3R9WA 2R65A 4A9AA 1E1RD 2BM1A 3BWDD 3FB4A 4M1SA 4F4CA 5J4LA 3IIJA 4YXWA 1SXJA 4MDEA 1N6HA 4DVGA 3DPUA 1A1VA 3MMPA 5GJVC 1DAKA 1DAIA 5CLQA 4DHEA 3GFPA 4B32A 4OK6A 5G3YA 4RFSA 1KZGB 2YC2C 2IF0A 4EUNA 4Q1AA 4US2R 2GBLC 1FUKA 1PUJA 1AKEA 2P6UA 1UBGA 2JA1A 1JJVA 2TMKA 3PUWA 4QM7A 4MRSA 3K0EA 1YRAA 3D31A 3OAAD 4BPBA 1KO1A 3IGFA 3K09A 2A5DA 4Q9HA 1NN3A 3QBVA 1F3OA 5KYKA 3CH4B 3T06B 3JZMA 4QGFA 4LI0A 4E09A 1ZU4A 2QBYB 4QKQA 2BVNA 5L3RA 1C1YA 5EP4A 1Z6XA 3GLIE 4JLJA 2XXAB 2YINC 2ODEA 1ZW6A 2WSSA 4PSAA 4CEHA 2ZYVX 1N2CE 3ZH9B 5J4KA 1ZUHA 1GITA 4R9UC 3KXKA 4I1VA 4UXIA 1LF5A 1HE8B 2PT5A 5SZJA 2W58A 2EW1A 1KDTA 3SDZA 1I4LD 4LHZA 3LWNA 3PQCA 2A2ZA 4RD3A 1T8TA 1YZNA 4N0DA 3GEEA 2GWHA 4D2IA 4ERNA 2OEPA 5DI9A 4GT1A 2VP5A 1XCGB 4G3XA 1GVNB 5TVKA 1ANKA 3AUYA 4OL0A 4BLSA 3SZRA 3HPQA 5L3QA 1XXHA 5AK0A 3K0SA 4NYMR 2O8FB 1F2UB 1RRGA 3VR2A 1Y63A 4JVSB 4N1AA 4HAXA 4BEJA 4DWJA 4JLKA 1E2GA 2DHRA 4WA7A 4B2IA 1P60A 2QMHA 5JI3E 2ZREA 5AJZA 1ETUA 2ORIA 5DHAA 4NU0A 3WXMA 2NO6A 1MRNA 3L43A 1IN5A 1GRRA 3GJ5A 3CRMA 3W90A 3K0FA 3U7GA 1WXQA 1EK0A 1N0WA 3MG9A 1BYUA 3CZPA 4Q1FA 3P32A 1UF9A 4B34A 1GKUB 1XMIA 2BEJA 4PO9A 2UZ3A 1ZINA 3NC1C 1Z0KA 1G7RA 5GJBA 3B6EA 1XRJA 3LX5A 1SULA 3UK6A 2FE4A 1Z8FA 1BMFD 2QE7A 3F3YA 4LYJA 3V4RA 4MITA 3BBPA 2OFOA 4L5BA 3WNCA 1KAGA 3RC3A 4C3ZA 2RKOA 4CW7A 5BWMA 1Z0FA 1QDEA 2WVJA 4FWTA 2OBNA 3L8ZA 3QVVA 3LA6A 2BWJA 1PZNA 1UKZA 2ECKA 3FFBA 2O8BA 3TUZC 2XNDA 2NTYC 2AD5A 2IYQA 5EP3A 2J9RA 4DUGA 3GLFA 4TTQA 2BBWA 3HR7A 3ZLJA 1Q57A 2V1UA 2CK3D 4JJKA 1VPLA 3B5JA 4BFSA 2BMEA 1OYWA 3TVDA 2C9YA 4PR0A 5FUVA 5IRCD 2A3RA 2I4IA 2ANBA 3OF5A 3T1OA 1XTJA 1NMYA 3A1WA 4OQMA 1VIYA 2ODNA 3CF6R 5E7MA 4JSTA 3I62A 2Q0HA 1E9FA 1LNZA 2B92A 3U3OA 1KJYA 2WPDD 1UBCA 1E9DA 3C14C 3NH9A 3OFND 5FL7A 3T1VA 2QSZA 4W9MC 4Z8XA 4FIDA 1KNXA 1OV4A 5KPDA 2ZJBA 1XTQA 1AS3A 3OE7A 1XZPA 2KJQA 4S2EA 1E2EA 2WWFA 4WXPA 1E94E 4JL5A 1XXHE 1G41A 3QBTA 3U3RA 1NLYA 4HZUA 3OZXA 4Q7KA 3NDPA 2WWGA 5FI1B 4RY2A 2PEZA 1EGAA 3KDSE 4P4UA 4WW0A 1SQ5A 5EXTA 5P21A 3UWKA 4D80A 4ZKDA 2Z6VA 1X3SA 5LB4A 2X2FA 1NG9A 4CRWB 1VTKA 3DO6A 3ZD6A 4C0LA 1CJKC 2JLRA 3OIWA 3RS5A 4L4UA 1UEIA 5C4MA 1KGDA 1U94A 1MV5A 2AL7A 2H57A 4A6PA 4DCNA 1Z0DA 1FTSA 2J3EA 3GP8A 5AJYA 2QEQA 1BYIA 2B8TA 1GAJA 2KE5A 1M6NA 3AEZA 3LVRE 1OKKA 2ZI9A 4A2WA 4E5UA 3VR1A 3C5HA 1XNJA 2HXYA 4PQFA 4FMBB 4Y0VA 3AGQA 4DDVA 1Q3TA 3SS8A 2LKDA 3M6AA 1UPTA 1R7RA 4EKDA 3GEIA 4EQ6A 1G4AE 4QHSA 3CKLA 1VG9B 1CR1A 4YMSA 3FKSA 4JKYA 3RRNA 3ZVNA 4DT1A 5DO9A 3QF7A 1XEXB 4ZDJA 1Z6AA 2VO1A 1KI6B 4BRWA 4RZXA 3RS2A 5J40A 4LJ4A 2OUKA 2HT1A 2VHCA 1JEDA 3NBZC 2A5GA 2XITA 1SVOA 4LWZA 1OSNA 5IHPA 4KFSA 2WAYA 4QBHA 3IILA 1ZIOA 2DBYA 4IXNA 3A4NA 1XCPA 4DZZA 2QZ4A 5AUPB 1UAAA 1S4QA 3LBIA 2KB0A 1J8MF 4DSUA 1RJ9A 1LS6A 2HJVA 4KV9A 2ZSEA 4ZDWA 4JIMA 3O8BA 1SXJB 2GJ8A 2MSCB 2WWIA 1ZVQA 3EAQA 4G5QA 3RANA 3VU9A 2VPPA 2XOKA 1R2QA 2V9PA 1IN8A 1KO4A 1L4YA 5DE3A 3X1DA 2Q6TA 1G3RA 2VSFA 2WKQA 4Q7LA 1Z6GA 2IYZA 2J46A 4RFSB 4TQ9A 2G9NA 3K0CA 4DLWA 5JCZA 4HEJA 3LDAA 3SJAA 2QENA 4Q5IA 1P7CA 2OBLA 2HCJB 1AIPA 1SVIA 1VG0B 2JLQA 4JVNA 2P0EA 1IN4A 3Q9LA 1MO6A 3KB1A 4UNSA 4ESVA 2IK8A 5JEDA 5AUQA 3QEOA 1G5RA 3I8SA 4IFBA 1I2MA 2N1BA 4WZAE 2FA9A 2ZJAA 4AC9A 1US8A 3BE4A 2PJZA 4L8GA 5L3SA 5KDLA 2J0UA 3EPKA 5E4FA 3VR5A 2QSYA 2JIZD 4KFRA 4PANA 3BFKA 4HUTA 1LVGA 1TUEA 3KJEA 4DLSA 4Z54A 4CEHB 3R7WA 3QVUA 4DLXA 2RAPA 1NLZA 1AS2A 1NIPA 3QXSA 3CUEF 4WOPA 1HQCA 1NVXQ 3PR1A 3EIQA 4LJYA 5FUWA 3T12A 3QE0A 3LQRA 4BRUA 1X8KA 2AHOA 3MJRA 5SZHB 3BS4A 2WWWA 4OHXA 1E79A 2CL7X 1ZM7A 5KO2A 4F38A 1NKSA 3GLGA 4GSYA 2CJWA 1U0JA 2IS4A 1SKYB 1T5IA 4KU4A 1HH4A 3CPHA 1P62B 1N3BA 1E0AA 4ARZA 2P3SA 3SJZA 5L3QB 2CBZA 1XXHB 2WJYA 3KTAA 3FHCB 4FCTA 1CU1A 4M9XA 5J47A 4M1TA 1IJFA 2FJUA 2W2VA 4MRVA 4ZKEA 1SHKA 2P6NA 2GESA 4KLZA 5HE8A 3L0PA 3ZYCA 5C46F 2HYIC 1OH5A 4NYIQ 3P26A 1HA3A 1IAQA 1KHTA 2B21A 2IXGA 3TAHA 4Q00A 2D3WA 1LY1A 1XMJA 1S3SA 3L82B 4PAOA 5AJVB 3K0FB 1XX6A 3RRYA 3C7KA 2BKUA 1P9RA 3RWMB 2IYTA 3ETLA 2AR7A 2WBLC 2ZU6A 3HPRA 4KO8A 1Z07A 3K9HA 4B2PA 5M04A 5CM8B 1Z6YA 2WJHA 4AD8A 3EC1A 5L8VA 1DAFA 2BHRA 3MWLA 4Q4HA 1I2DA 2CCKA 4G5OA 3VAAA 1DOAA 3TUIC 5K8LA 3KKNA 4M1YA 1T9HA 1LS1A 1KK1A 2VQSA 4KBFA 4QGHA 3W6PA 3RS3A 4GRAA 2O8BB 3A36A 1YKSA 4EJSC 3SJCA 4DSTA 4XWAA 4HAZA 3TIFA 3GLFB 5G41A 2FGJA 4CVNA 1UADA 1D2EA 1S9HA 2C96A 2RGCA 3AB3A 4GPTA 3W9YA 1ZRHA 5HPYB 1NL3A 4IDQA 1SVLA 2R8RA 4XD7A 5GVSA 4R2HA 2R9VA 1CJVC 3K70B 2D2EA 4GNKA 2BMFA 2R44A 3ZZTA 1QRAA 2ANCA 1JEEA 4KFUA 4IHQA 2QQEA 4TYQA 3GPLA 4UXJA 2AXNA 1RKBA 3W6NA 4DLUA 3E70C 3R9IA 3U3MA 2V7QA 2QPOA 3N70A 1X6VA 4ESHA 1XD9A 2CLCX 2CXXA 4YDSA 4PO8A 3LH5A 1KSGA 3BGWA 1D8TA 2CCGA 3D7MA 4GDFA 3KX2A 2GEVA 5K8UA 3OHMA 4HZUB 4X8MA 3AP3A 4LJ8A 2PH1A 4Z1MA 4OHYA 2F43A 1G3QA 3FGNA 3KJHA 2DYKA 1NJFA 2QAGB 3FFAA 1G3IA 1NP6A 3S1AA 4PZYA 4QHYA 2J7PA 1COWD 2IYUA 1OIXA 1R8SA 3KQLA 2ZR7A 2QRZA 1X8JA 4QJ4A 5FR1A 1II9A 5C2JB 1Q21A 3LY5A 1U9IC 1Z63A 5FBRB 3NC0C 5DN6A 2HLDD 2X19A 1OFIA 1XPOA 4P32A 2AWOA 5FL3A 5EP2A 2MMGA 3QXHA 3CRQA 2UZIR 2BBOA 2V55B 2JJ1A 4I1SA 4D4JA 5H8WA 2GF9A 1FZQA 2VHJA 2MMCA 4NYIR 4UNQA 4AURA 2RHMA 4EQ6B 2CLDX 1LB1B 3B85A 1NSFA 5JECA 1UKYA 4ILEA 3F0TA 2B7CA 2ZAMA 4C7OA 3PEWA 5HCNA 4DT1B 2Z4SA 1KMQA 1D5CA 3AP2A 1TEXA 4Q9LA 1H8ED 3NBFA 2XGJA 521PA 3QPWA 1MOZA 1OPXA 3QF4A 4LHVA 3TSWA 1I4TD 2GZDA 3QXCA 3AVYA 3PEVA 4NCNA 4A8JC 4KITB 3EZ2A 1B0UA 2ZPTX 4FCWA 2EFHB 2GXQA 1RZ3A 3EPHA 4POAA 3H2YA 3AVOA 1JAIA 4NKRA 2QGZA 4P31A 4OK3A 4DB4A 1DE0A 1RJ9B 4TMVA 1D9XA 1ZNWA 1G6HA 4TLEA 1BIFA 2LKCA 2JATA 3N5CA 4QGAA 1WB9A 3JVVA 2RCNA 3C16C 1AK2A 1G8HA 2AK2A 3VU9B 2IXEA 4PC6A 4TSFD 3L0SA 1CR2A 1U81A 1TQ2A 1VYUA 3N2IA 3DL0A 5B64A 4MRNA 721PA 1NY5A 1NY6A 4PHHA 4NHOA 5FBWB 5JSZA 3C5CA 3G82C 4M8NE 1TX4B 3KB2A 2GJ9A 1EFRD 2JJ8A 1QZXA 2VEDA 1NLFA 2IHYA 3GJ0A 2RGAA 2J1LA 2C77A 3GLHA 1IM2A 1R5NA 3VR4A 5FTLA 1US8B 1FOEB 4IOKA 5L3SB 1YR8A 1Z5ZA 2J0UB 4TL7A 4X8HA 1PLJA 1JECA 5C18A 2CL0X 2W6JD 2ZEJA 2WV9A 3SR0A 3R8CA 1H65A 5JHGB 3PUVA 2ZYTX 4WIAA 3U7HB 4PPNA 2GXAA 2V4ZA 2VLIA 4P4SA 4ZCLA 3R7WB 1NRJB 4I1UA 3EA0A 3QENA 3TR5A 1T6NA 1YQTA 4BEBA 1H8HA 5LD2B 2IS1A 3QQ5A 1IN6A 4BASA 4BWYA 1HEIA 2AKAB 3AF1A 4V03A 2CNWD 1N0VC 1OB5A 4U00A 3WNBA 4D81A 2VSXA 5TDHA 4FN5A 2QQ0A 5FH9A 5C4GB 5JI2E 3GLGB 2FMXA 2CJWB 1SVMA 4JKIA 4BZQA 3NXSA 5GADl 2IWHA 1BS1A 5CJPA 4ARZB 4CEJA 3QXXA 2IEZA 1DO2A 3BAFA 1ZCBA 4HB3A 4OI0A 3KTAB 3AGPA 1E32A 3I5XA 4J0QA 3L0IB 2WIAA 2HDNB 4NE2A 4OBEA 5DNYB 4CIDA 2OG2A 3MWKA 5CIWA 2ZI6A 2WSMA 4LV6A 5KDOA 4A2QA 2ZIAA 2XNSA 4D4MA 3TQFA 3U4QA 3BH0A 3VHLB 3MFYA 3GJ6A 2LWIA 4KLNA 3W3AA 5SZIA 1PVOA 1MT0A 4URYR 5D3QA 1ZUIA 4BFTA 1JR3E 4QHTA 2XEXA 4GOXA 4TZ0A 5KSZA 3FWYA 4NBSA 3QNUA 4LBYA 3SJBA 5HTKA 4C0BA 2RMKA 2R6CA 1Z0JA 3CF0A 1JR6A 4Q4HB 5JJIA 1YZGA 1TPZA 1Z47A 4KI0A 3ND8A 1NVWQ 2LCFA 2Z43A 4OI2A 3VQTA 4EIWA 3I32A 1L4UA 3IHLA 2FU5C 4Y0AA 5KPJA 4TLCA 2F1JA 4MGYR 4AYTA 3QI2A 2ZJZA 4OHVA 4Q4JA 5G53C 1XBTA 1EXMA 4JSYA 4LJ5A 1HY3A 2GVZC 2EYQA 4P4TA 4F93B 3NVAA 3WP1B 5FFMA 1E4YA 3KXLA 3ZZUA 3AVQA 3T1QA 4D0GA 1N6LA 4RCYA 4HYYA 4OQFA 2ZRDA 4XIGS 2YWEA 1VIAA 4PZZA 4QG7A 2WWXA 2HV8A 5FUYA 2H5EA 3PIRA 2GF0A 3A4MA 4K8OA 3K53A 1U2RA 4HDQB 3KL4A 3B9QA 4A0RA 1KO5A 5DIFA 3SNHA 5HKKD 1TU4A 3Q5DA 2C2HA 3HYRA 3HWSA 4OKSA 3PFIA 3MWYW 5FOTA 3UPUA 2FFQA 3Q72A 2R2AA 1LF0A 1F6BA 1T3LA 2PLFA 4OQLA 1JI0A 2BJVA 4R7ZA 2XSZA 2FPLA 3EWSA 1ZMXA 5JWHA 3H4MA 2F43B 3X2SA 4JLNA 1Q1ZA 2BBTA 1GP2A 2JGNA 2ZS9A 5KSOA 2XTZA 3S1AB 1GRNA 4PHTA 3KQNA 2WM9B 2ZRFA 3GJ7A 4B43A 3AVTA 5CJ2A 3SYNA 3MLEA 1CEEA 2F9MA 4MDFA 4IKEA 5EXPA 2XJ9A 3IKJA 1XD2A 4A0FA 4US0R 1G5PA 1E2NA 1P2SA 3CW2A 4HAWA 4URWR 2W2TA 1VCNA 2N46A 3A4LA 4M22A 1PJRA 5TY0A 1YZKA 1ELOA 4UJ3A 1DG3A 2DFKB 4PFSA 3QKSA 3H86A 1GZSA 3Q5EA 4MUAA 4JS0A 1U90A 1E6CA 1CJUC 4JZKA 4FMCB 1VMAA 3TBKA 3SOPA 3ZQ6A 4KODA 3ZD7A 2ZE7A 4R71A 2E9SA 2AK3A 2ZYWX 4C7OB 4AK9A 3LVQE 2D4HA 2IBMA 3UG6A 3VNUA 4G01B 4HLCA 2GA8A 4RD0A 3TE6A 5BYKA 1MKYA 1E98A 2QRNA 1OXSC 2KSQA 3QF4B 1E1QD 2O8DA 1Z83A 1W4BA 2OXCA 2FSHA 1W2HA 4TMWA 3GJXC 1T4GA 4KYUA 2JASA 1OYYA 4ZIRA 4A1FA 3ZVMA 1I4DD 3GJ3A 2L0XA 5IK2D 1IXZA 2JLYA 1QHSA 1TL7C 1L7VC 1XTKA 1E2IA 3MJHA 3W5JA 4OYHA 1R0XA 2J0QA 1LV7A 4V0LA 4Q4AA 3T5DA 3CO5A 1FMLA 3MGCA 2VP2A 1FNNA 2I1QA 3I1FA 2XB2A 1ZM9A 2D7CA 1GKIA 3FMIA 4LC0A 2Q21A 4HLUA 1ONBA 2WOOA 3K9LA 3NTUA 3FHOA 4EPTA 1GL7A 3MWJA 5DYIA 3WRYC 5JLJA 2ZRKA 5JSZB 1SXJE 3AP1A 4RD2A 5A0FA 3U3KA 1NBMA 2IHBA 1UDWA 2X77A 4MKFA 4A8JA 1M7BA 3J81k 3AVUA 5F9FA 3LW7A 1P5ZB 1XMSA 4YMWA 3GLHB 4DEYA 4B75A 2ZSAA 4IEEA 1R10A 2PX3A 2V1XA 2WJGA 2R62A 1A4RA 3CR8A 4Q03A 5HZKA 1E9BA 3IPYA 3UATA 2AFHE 4K81B 1W44A 3DDCA 4LJ7A 4CT5A 4I1OA 4EDHA 4PC7A 3H0KA 1COWA 4PAQA 4JT4A 1HURA 5LBIA 2WWYA 1UBFA 3V00A 2ZI7A 4P4SB 3B60A 3IBGA 1LTQA 5BN4A 4GI7A 4IJMA 3A6PC 4LOAA 5TXGA 1N6RA 2FZLA 2O52A 1TF5A 2W00A 1G8GA 2IC5A 4Q1DA 1P61B 3D3QA 4WBSA 2ZUBA 1G17A 4P33A 4O25A 4TL9A 3GFOA 5EE5B 1TF7A 4IVPA 4BLPA 2D2FA 4Q7JB 1SVWA 4N0EA 3F8TA 4H1VA 1XU4A 1CS4C 4CEJB 3BOSA 1C9KA 2ODBA 4YQFA 1YVDA 3HU1A 4U02A 1OH8A 1DADA 1R5OA 1SKYE 1TQ4A 3E2IA 3GJ4A 4ABYA 1XTIA 4ASUA 3NBYC 1W0KA 2IYWA 2V8OA 4JLMA 2VYFA 4NDZA 4YMVA 4DB2A 3T35A 2OLKA 3IO5A 2IYRA 4TT3D 3CX6A 3U4QB 1Q22A 3PG5A 2GJKA 4GMXA 4M9SA 4XVUA 2IYLD 3SQWA 2AWNA 2JDID 2QU8A 2ZUDA 1NBME 3IDQA 5FOVA 4V0MA 3FVQA 4B74A 2GTPA 2RGNC 2FFAA 3CH5A 1JR3D 1OH7A 3AVVA 1W46A 1E69A 3TSOA 1GSIA 2O5VA 4R98A 4W5WA 4BZPA 4KYIB 3CRVA 3WYAA 3ECCA 1GRQA 4NH0A 1U98A 1XD8A 4JLDA 1D9ZA 1KSFX 1F5NA 2VHTA 1MRSA 5EZ5A 1J90A 3CONA 3IBYA 4MGZR 2C98A 4UJ5A 4Q4JB 3RS0A 1EFRA 1W0JA 3EARA 3NEYA 1ZIPA 6Q21A 1E9AA 1KDRA 5HR5A 4CEIA 4BFZA 1GL6A 3AVPA 5DISB 2FOLA 3TMKA 3ADBA 4ZCMA 1RIFA 4D25A 1FQJA 4UNPA 3HYTA 4QXAA 4L9SA 2ONKA 2IUUA 2JJ2A 4NCKA 4DKXA 3GLFE 1E96A 1M74A 4CT4B 4M1OA 3U7FB 2FX3A 2EFCB 3L0OA 1W4AA 1KSHA 2ZJOA 4LX0A 3EZ9A 2YHSA 1X1SA 3LXRA 3U3JA 2J0VA 2WZQA 3IIMA 1E99A 1ZP6A 1S1MA 1TF2A 1XZQA 3PITA 4C4PA 1RE0A 2K5UA 4FW9A 4B35A 2EWVA 4DCUA 3OEED 3AF0A 2NZ8A 1P4SA 3GMTA 3IO3A 2PBRA 1FFHA 2CNWA 4URXR 3C8UA 1P2TA 1EX6A 1HQYE 2QMEA 2J87A 2VP0A 4MGIR 3ZIAA 1NN1A 3GJ8A 4G1UC 3ZS9A 4URZR 4JJZA 3VR6A 2D06A 5TARA 3ND9A 3OIVA 4DSOA 2BMJA 4I4LA 4OI4A 1CBUA 2PEYA 3CNOA 1VYVA 2BJWA 5J4YA 3THOA 1XD2B 5TV2A 5FPTA 5J4HA 1EFHA 3TLXA 2CL6X 1RYHA 4BUJA 2H17A 5AR1A 3DOFA 4KAXA 5GVRA 5FBLB 4HAUA 3U61B 3NG1A 3EPLA 3LV8A 2VP6A 2NZJA 1SVSA 2PZFA 3QKSB 1Z2CA 2XAUA 2IL1A 3R9XA 2ZSFA 3LQQA 2P5TB 4FMCF 2ZE6A 2PCLA 4TLAA 2EFEB 5J4VA 1CR0A 4R2IA 3CNLA 1G6OA 4NMMA 5H70A 1P3JA 2V6IA 3KUCA 3WNDA 1WF3A 2O8DB 2GBLA 2OFXA 2R6AA 2HT6A 2GHIA 1NIJA 3SYKA 3WMFA 3DZ8A 1P2VA 5CYOA 2EVWX 3CX8A 4ZIRB 1NMZA 1CR4A 2ZYUX 2G0TA 4G5GA 2JLXA 2H92A 2ZRAA 4DLYA 421PA 3OEHD 3B2EA 1JALA 1KK2A 1KDPA 1AGPA 4U5XA 1NN5A 1XJCA 1G1MA 3B8HA 4Q4AB 3H1TA 1MR3F 3UMFA 1NMXA 1II8A 4TMXA 5EE0A 4BFYA 2FDCA 1PUIA 1TMKA 2VIIA 3IEUA 1FP7A 2W0SA 4XSGA 2A5JA 3B7GA 2FNAA 4QFMA 3X1XA 4G0NA 5CB6A 2PL3A 2QPTA 5B2ZA 2BC9A 2KBEA 5JRJA 5HKKA 2X8AA 2YZ2A 1XEFA 1W4CA 1YZTA 2CE2X 4BECA 2ZUCA 2WJJA 2NO9A 3X1YA 1KK0A 4AY2A 3TJZA 1E9CA 4YMTA 3IEVA 4A8JB 1GFIA 2ZRHA 1SXJD 3C4JA 4GOJA 4YXWD 2J59A 5EJEA 3VKGA 2P6RA 1FMJA 2RGBA 3QOFA 2Q9BA 5FOSA 4C0JA 2KI5A 4WXRA 1AZTA 2FG5A 3WBJA 3PUXA 2WKPA 4XWKA 1Z2AA 2F6RA 3KQKA 3I3SR 1E4VA 3MD0A 1E1RA 2GILA 2HF8A 5EE9A 5B58C 4LGMA 5KNCA 3C41J 3AKDA 4ZDIA 4WZBE 2QP4A 3CBQA 1XJQA 1G20E 4C30A 2FEOA 3U6BA 4BLRA 2ZQ5A 4A36A 1WA5A 4Q48A 1KI2A 3W8RA 2OCAA 4EPXA 5KUTA 1XCMA 5GJCA 4XTRA 1VHTA 2C5LA 1ZJ6A 2RHDA 3V4FA 4IDPA 3QSYA 5AWFC 4JYCA 3BFVA 1NN0A 3OAAA 1RRFA 5CDFA 2IX3A 4M1MA 1A82A 2WSSD 2IYYA 1ZM4A 4XJXA 3DKPA 2QI9C 4EFLA 3LLUA 1P2UA 5AJWA 5BN3A 4D0LB 4HAYA 5G40A 4ZI3A 1E0SA 2G1JA 1Q1EA 2G0NA 3A58B 4FCVA 4MKGA 1P75A 4GBMA 4IXMA 3GLGE 4JMPA 3NDBB 2ZR9A 2G88A 2QP9X 2O8EA 1F2TA 3HU2A 5K8IA 1TEVA 4I99A 1Z0AA 1FW6A 2OCPA 3SI7A 2CVFA 2H16A 4JL8A 4M1KA 4CF7A 3W34A 3CWZA 3NH6A 1WQ1R 4IOJA 5BQ5A 4QJ3A 1KMHA 4ITRC 1P6XA 1SXJC 3MCAA 3NKVA 5FOUA 2O0JA 2OAQ1 5K8TA 3VNVA 3EA5A 4LYFA 1LFDB 1N6NA 3WHLA 1R4AA 5C1BA 3EIHA 3W3ZB 2N42A 4MYTA 4Q21A 1E9SA 1AA9A 3KXIA 1G19A 2YYZA 3CPJB 5FBQB 3TVTA 1XWIA 3ZVLA 2ZM5A 3ZS8A 4W5HA 4B3FX 4HAVA 4F7WA 1KTVA 4JBYA 1U8YA 1U8AA 5FBVB 3K09C 2GKSA 1IHUA 2C99A 1E2QA 2FPKA 4RZ2A 3VKHA 4TTRA 2I3BA 4HB0A 4RJLA 4EPRA 1II0A 1P9NA 3DHWC 2WICA 1U0HC 2QE7D 2R6DA 4LV5B 2NO1A 2W83A 2YJTD 4CEIB 1DAMA 1YE8A 4PPFA 5JZVA 1Q1BA 2B6HA 1OW3B 2XB4A 3AVXA 1SZPA 4HDOB 1E2LA 3IQWA 4X8LA 2QROA 4E22A 4JBWA 4V0NA 2IUSA 2QY9A 3BD9A 4O2LA 3CLVA 1BMFA 3IUYA 1CXZA 5FPYA 4IDOA 2XNDD 3UIEA 1V43A 4HB2A 4DUGD 1GIAA 2JLWA 1PLKA 4LSGA 4A4DA 4V0OA 3QKRA 3TRFA 5ELXA 2C9CA 1IXSB 4M0LA 4E03A 4AI6A 2P65A 1FPMA 2WJVA 2A78A 3K70D 2VHUA 1NVUQ 1N6OA 3ADDA 4LBVA 3GCGA 1DPFA 2G1KA 2QORA 4Q19A 1QHGA 1E2KA 2CK3A 4X8OA 4DDTA 4Q18A 2IA5A 2REBA 3AF2A 5FL7D 4OQXA 1QHNA 2XX3A 3OE7D 3LRPA 4DLRA 2MSEB 2UVQA 1UJ2A 4LHYA 2FFBA 5CM9C 5CB8A 5JBQA 3GFTA 4Q1BA 3SBDA 3TR0A 2VBCA 5E3HA 1XPUA 2BIFA 4QGGA 2WPDA 4O2RA 1SGWA 3OFNA 4IDNA 3UMRA 3UANA 1M1YE 2Z83A 4QRHA 2ATXA 3NWJA 4RD6A 1EX7A 3W5IA 5B57C 5F9HA 3WHKA 1SVKA 3LFUA 5ANRB 4II7A 4IOLA 5JWRA 2A9KA 2GEUA 2IS2A 1QG4A 2I1VB 5GJWC 2X2EA 3KFVA 2PJRA 1KYIA 3TW8B 3HP1A 3B78A 4ZPXA 1Q20A 3QPUA 3VKWA 3ASZA 3L2OB 4DLVA 2OILA 3X1ZA 2XZLA 2Q3MA 2CHQA 4GOKA 3I4LA 1ZCAA 1VCMA 4PC1A 2ZI4A 2XTNA 2GAAA 4NL4H 4UKDA 1A5TA 5LDDC 3FKSD 4D0NA 1Z22A 2EYUA 1G3UA 1K6MA 1QVRA 3K70C 2FSFA 4DDUA 3U60B 3PJRA 4A2PA 4AYXA 2BCJQ 4U7DA 2R6FA 4RKEA 3PEUA 2ZS7A 3RS4A 3LD9A 2XJ4A 1A7JA 2QTFA 3RYTC 4TWZA 3P4YA 4ZV4A 1B23P 1II8B 2WTUA 2OV2A 2FWRA 3KKOA 1MO4A 2W6ID 5A4JA 1LW7A 1S9DA 3B1XA 1CULC 2WAXA 2F3TA 1Q0UA 3FE2A 4IVRA 4RSGA 3VFDA 2F1IA 3RSOA 2JLVA 4LY6A 5FTMA 1GNQA 4TQAA 2CEAA 2OM2A 2YWHA 1T5LA 2OXRA 2YVUA 4B6EA 3THYA 2GEDA 4FI3C 5E95A 4PHFA 1QF9A 4JL6A 2DFLA 3B13B 4IVQA 2FF7A 2QAGC 1WE2A 4ZDKA 1JXMA 4M1WA 2BEKA 4K46A 1TQDA 2XOKD 3JZAA 3QKTA 4UXHA 1W36D 2WMNB 1ZD9A 1GL9B 1XFAA 2VTKA 1CTQA 1XF9A 5HE9A 4XVQA 5JJKA 2GCOA 3SC3A 1OE0A 2XTMA 1G9XA 1XMVA 1BH2A 4YMUA 1G8PA 1BKDR 3EX7C 2P5SA 3GLHE 1A2BA 5EZ6B 2G3YA 2EU8A 1EESA 3ZJYA 3FPAA 2OSBA 2BBSA 5EE3A 1DTSA 3SU8A 3WYGA 5JMTA 4L15A 3ZZ0A 1IN7A 3HR8A 4AG5A 4RVCA 2GRJA 4O3MA 1AJEA 3SE0A 2OESA 4B73A 2ZSBA 3TUJC 1KKLA 2YC4C 4M9QA 1S1CA 4IDHA 1AQYA 2REXB 2QN6A 3TK1A 4A15A 1E0KA 3WMGA 4B33A 4ZCIA 3SEAA 1K8RA 3Q7QA 4JLPA 3FYHA 1KI1A 4ZO4A 2JIZA 1E0JA 3P1JA 2QT0A 4DLZA 1YU9A 4Q66C 1WBBA 4AWXA 1UBEA 4Q1CA 4BE7B 1E2HA 3A1TA 1GKYA 2H7VA 5HCIA 1E79D 2O8EB 1F2TB 3GLIA 3B1ZA 2VP9A 3EZ6A 4KCGA 3KJIA 2V3CC 2EQBA 1QBKC 4DDWA 4OHZA 4DC9A 1OLOA 2JLSA 4HLDA 1R0YA 1KMHB 4EJSA 3RVBA 3RSLA 1J2JA 3RAPR 4E07A 1E2PA 2VP4A 3X1WA 4C0HA 2IEYA 2ZETA 4PSVA 1P9WA 1W36C 4AKIA 2Z5FA 4PQRA 1L8QA 2NQ2C 4RD4A 2OCBA 4FINA 1L2TA 4B3BA 1W1WA 1BOFA 2KWIA 4N3NA 1DAGA 3K0CC 3AKYA 2PMDA 2P2LA 2VF7A 3BH6A 2OE2A 4KSCA 1KIMA 1XJ0A 5KDDA 2IYSA 3Q85A 1IONA 4A0GA 3THXA 2VSOA 1VCIA 1W2GA 4S35A 3BB3A 4TYWA 1VCOA 1OFHA 4MGKR 1NG1A 4F4IA 3SYLA 2D62A 4DIDA 1AM4D 1T0HB 1Z6TA 4DJTA 3SHFA 1O3YA 1K5GA 2A30A 2ZE8A 4TYPA 5FPHA 4NPHA 4EFMA 5G3ZA 1WBDA 3BB1A 1CJMA 1VG8A 2Q9CA 1TQ6A 2AXPA 5LD2C 1C4OA 4BLTA 3D6TB 2CE7A 4PO1A 3RRZA 3EPJA 1TADA 2BM0A 3H84A 3ADCA 1N0UA 3CRRA 2E87A 1S0UA 4LC1A 3W6OA 3GEHA 1U9IA 4BQSA 2CCJA 3QKRB 2ZRNA 3WYFA 4C0SA 4DIEA 5JHHB 4XD7D 4CDGA 3Q8XB 2RGXA 2OO7A 1GTVA 3QJYA 4AG6A 1RW4A 4XTCS 3Q3JB 2FZ4A 3T61A 4HUQA 1YR9A 5KHOC 4M9ZA 4EFNA 2PLRA 4Q9KA 1G5TA 3I8XA 1E3MA 1G4UR 2DPXA 4JVMA 4Q1EA 4HATA 3GD7A 1ZM2A 5JRZA 1JBKA 1FX0A 2V7QD 4PPGA 5KSPA 1WRBA 3PXGA 3P20A 4W5JA 1Y3AA 2WOJA 3O8CA 1VECA 2WKRA 1G8YA 4TLDA 5JFGA 4TMKA 4DCVA 3G5UA 3U2QA 4Z51A 4DEXA 2QGNA 1WP9A 4Z1MD 1EFUA 1W5TA 2BCGY 1W4RA 2ZS8A 4CYMA 4LJ6A 1QG2A 1Z29A 3REGA 2O8CA 2J7PD 3I61A 4TYYA 1AS0A 1KK3A 2D7DA 1FNMA 2GK7A 2GVDC 3AQ4A 4EAQA 4B3DA 3B9PA 1NF3A 2Q3FA 1S96A 2GZHA 2RB4A 3CIOA 4KFTA 1Z0IA 3DOEA 1QHHA 4KSBA 1RPZA 5DN6D 1PV4A 3SQXA 1FL9A 4TZ6A 1KKMA 2IF2A 3AF4A 1UM8A 2VA8A 1Z28A 2GDJA 3B1VA 3C15C 2PCJA 4D4KA 1MABA 2JJ1D 1KI8A 2PT7A 1FTNA 3AKCA 3SBEA 3FDIA 3FKQA 2ZRLA 1GNPA 1T3SA 3HU3A 4TMZA 3LBNA 2HLDA 4OI1A 3KKQA 4AKGA 1G8FA 4NTZA 2Q3HA 3QXJA 4XOIA 821PA 3I72A 4LJAA 3R8FA 3AKEA 4YC7A 2NMVA 5CITA 1W7AA 4L9WA 1OXUA 3K8YA 2QP3A 2HEIA 4TQUS 1QHYA 2R6GA 4AKHA 5CYPA 1DO0A 2DR3A 3VR3A 4OJKA 4KJZA 5F2EA 5FR2A 3SHWA 2HF9A 3A8TA 1WMSA 1VHLA 2ZRJA 4UQOA 4BZXA 1GILA 1M2OB 2PZGA 4UNNA 3QPVA 5H68A 3EZFA 1H8EA 2VHQA 3TW4A 4CZ2A 1DBSA 3THYB 4TL6A 5EP1A 1X1RA 5EXSA 2ZJ2A 4KBGA 1HE1C 1T91A 1ZBDA 2AX4A 2QL6A 4P3YA 3FTQA 2ZR0A 4TN1A 4WZ6A 2B7BA 3UXMA 3Q7PA 4RD1A 3EIEA 3RDPA 2ASEA 4F92B 3WMEA 3NEJA 1OIVA 4DLTA 2B8WA 2QA5A 2GCOB 3CZQA 3BB4A 2ZRCA 3IHWA 4PSKA 4H9GA 5KNBA 3BH7A 3KUDA 4HSEA 3AF3A 1CIPA 4TSFA 1DS6A 2MSDB 1OB2A 4Q01A 5DI3A 2RH5A 4AYWA 1KAOA 4HDCA 2OFWA 4MYCA 5CK5A 5CLLA 5LPNA 5FUXA 4D4LA 3A1UA 3QIAA 2QAGA 1GWNA 1SHZA 1CLUA 3EG5A 1DVRA 4HI0E 1G18A 1CKEA 3FOZA 5J5CA 2ZVQX 1TU3A 1YHNA 4HB4A 4B44A 4B47A 4NONA 2HXSA 1KY2A 2YWGA 2C03A 2ZROA 3E5HA 3MUFA 5JWOA 4JT2A 2ZRBA 1H8HD 2W6JA 2ZE5A 4MUBA 4QM6A 1U0LA 3QKUA 2HYDA 1AZSC 4D6PA 4TTPA 4LJ9A 2YOGA 2J45A 3RLFA 3FMPB 2GAOA 4JLBA 4NCJA 1KI3A 5LB2A 3NHBA 4LHXA 621PA 2UKDA 3GLIB 1NNEA 1VYTA 3VMFA 2QTHA 4B71A 1XB2A 2F3RA 1N5IA 3CPEA 2NPIA
chains in the Genus database with same CATH superfamily
5ADWA 1ECCA 1UKEA 2OBYA 2OGSA 3TAXA 4N4AA 2HN9A 1PT9A 5KOIA 5CDGA 2WTEA 4UHDA 3EZYA 2H7CA 2X3YA 1TIPA 3NBAA 3K8OE 4UNRA 3OG9A 2ATVA 2ON6A 3TIXB 4Y98A 2PGIA 3CURA 2ZBEA 1SK8A 1ZUNB 3F9RA 4ON9A 2V74B 1DQPA 3J80A 1XU9A 2VTEA 1R6DA 2W93A 3L8YA 2YS6A 3TZBA 4GZLA 4DMCA 4QC2A 3H0EA 4HJRA 4B2YA 1PWXA 1J07A 4MYRA 4NE7A 2MIIA 2PKCA 3IALA 4R51A 3EFEA 2BEVB 3JQBA 4CKCB 2WJIA 3T34A 3ZCTA 2J8ZA 1RLMA 4KLRA 4GR4A 3IIEA 1ENZA 5FD8A 3IQXA 3DV0B 2POQX 3THXB 4MA4A 1NUAA 2QLBA 5D51S 1NM5C 5AUNB 3IV6A 2Q4OA 2GZAA 5CFQA 1L8AA 2DWPA 3I5AA 2R6ZA 4AJ2A 1F48A 2WAAA 1OXTA 3KD2A 3DZHA 4IH9A 3W79A 3ZD9A 3TOSA 2PGJA 3QG1A 1W1IA 4LQCA 1WV0A 3NHAA 3I83A 3TGWA 4WNAB 3DLCA 4C2TA 1NX6A 1OJLA 3UYLA 4KR2A 3H6KA 4DTIA 1UMKA 3R4VA 5BYJA 3PUJA 1ZUWA 3F7TA 1EFTA 1HZJA 2GM3A 1Y37A 2QRGA 3PK0A 4N5HX 3FPKA 5FA6A 5K8JB 2XUFA 5J63A 1YFJA 1FLAA 3H9UA 4C2UA 2FF5A 3O2NA 1V71A 4IIYA 3PKJA 4LF4B 4YMHA 3PUZA 4TYNA 1JB1A 1ESMA 1DG1G 2QWXA 4M89A 5D1NA 1V95A 2VS1A 2M6SA 2Q46A 1CHDA 2Z57A 4PLGA 2ZTSA 3C3EA 2YV3A 3SZMA 2PX5A 2XUDA 4O4JF 2D54A 3A1VA 4PG7A 5ALUA 4DARA 3IMKA 1SUPA 2JEYA 2X1VA 2IS6A 2GPTA 3G5TA 2W4QA 4XUEA 1IBKB 3OIYA 1IY8A 1ZD8A 4Z9BA 3B2NA 3WJ1A 5JD4A 3P4XA 2OAP1 2FLWA 4M8LA 1CRPA 3CSUA 2ZJYA 3IDSA 3EWNA 1FX0B 2CVHA 5NULA 4RFVA 4GH5A 1ZNXA 3R3WA 2YMQA 3DNFA 3TLGA 1OH6A 3G8BA 1JFVA 3EWIA 2G1AA 4ZN6A 1CS0B 1S7CA 4L9RA 2WHXA 5E4YA 1BWQA 1RMQA 2HNKA 3EXHA 4Q93A 2XSZD 4WN9B 5FKJA 5K1ZA 2CD9A 3CB4A 1JF8A 4NYJQ 1XE3A 5IEBA 3W9BA 4DPMA 1C7ZA 1F0YA 3F6SA 4OK5A 1QXSA 3DO8A 3KV3O 1Z33A 5EMLA 1VPVA 5IJXA 4WK4B 1A7UA 4J76A 2VJKA 4G09A 3EUWA 2M1XA 2HCRA 4BNLA 2O8CB 2V54A 4CHGA 1JEAA 4WECA 1YE5A 3RU3A 5J2UF 2FETA 3UBMA 3L0YA 2PN1A 3KWLA 2VT3A 3ONFA 2CNOA 3OZAA 2C5BA 4RMJA 5SYNA 3ZEIA 1WR8A 1DCKA 1P4HA 5JDIC 2GETA 3UHJA 3HS3A 3HUEA 2OCYC 4YRMA 2FEMA 3UY4A 4ZGBA 1EG2A 2H1RA 3FOEC 4QDXA 3RC1A 4DBLC 4OHFA 4A6EA 3D4OA 3KOOA 1E8NA 1W5EA 2DF8A 4ACBA 1OXKB 3G0IA 4X97A 2DX7A 3EHDA 4LBZA 2OKGA 1R64A 4OV6B 3ZQKA 3CVOA 3K1ZA 2HA6A 4KQHA 2OK8A 1X39A 1Z74A 1PF7E 4MEBA 1NJ1A 4RF3A 3L3BA 4DJEC 4J0KA 1SCIA 2PMFA 4F1KA 3LPMA 4PLVA 3BE8A 5HQTA 4R5HA 1YR6A 3PTAA 3QUQA 1LSOA 3ODPA 1K97A 3HJGA 4OQNA 3OA0A 1KH1A 2ERYA 3DHYA 1Q1QA 3CCCA 4KXLA 5FEUA 1W8IA 3A1CA 3F1KA 2H65A 2XLBA 1B43A 2QT1A 4A0QA 1M2KA 3IQFA 2IH2A 4LZNA 4GIBA 1EM8B 4LX8A 3P45A 4XGNA 4XSVA 4ZO9A 2OHFA 2OHXA 4YWHA 4C0KA 1Z62A 2X22A 4EVQA 1UZUA 2GKGA 1XWWA 1AGRA 4FEAA 4L4RA 1P73A 1UJCA 3OICA 3W4JA 4G81A 1U04A 4FUTA 2WZBA 4MS1A 1V8ZA 2ZI3A 1Z5WA 4HP8A 3FUTA 4J6EA 3MTEA 4JC4A 3HP4A 3V6MA 4BVHA 3V46A 4S04A 1E62A 1ACJA 2NXEA 2BYTA 1UJMA 4MV6A 4B80A 4CM4B 4I14A 4N5NA 4WZZA 5IK2A 4RZ3A 1FTWA 4EW6A 1SCQA 2ILTA 1IUKA 3ERCA 16PKA 3JQGB 1P2DA 1U8ZA 1AKYA 1REQB 2WUWE 4RPJA 1ZD1A 1ZSVA 5JD5A 2J9YB 3PIIA 4G5SA 2BEUA 2H85A 2NOAA 1ZIXA 3OHPA 4MUNA 5ECYA 3B1YA 1RACA 4X60A 4B8YA 2VK4A 4OJQA 4WSOA 1RYYA 3O3OB 4IFEA 1TPYA 1Q7BA 1QNLA 2G77B 2ZRGA 3F67A 4L6IA 2E85A 2PNFA 4YCMA 2JAQA 3ADPA 3KQUA 2ERXA 2HWYA 4IHJA 3S29A 3BXZA 3LXUX 5K01A 1P0PA 2VNJA 4MR7B 2ORWA 3IV7A 2DXIA 2R66A 2QLTA 3OQJA 3ZLTA 4JLAA 1PD1A 1LEHA 4I7EA 3F6RA 2QM8A 1UBSB 1EUQA 5L40A 2YZ7A 1PQYA 1L9XA 3DM9B 4S2UA 5HRUA 1SBNE 1JA0A 2QN2A 1T5TA 2PQMA 1GUBA 2QLFA 1O87A 1NW7A 1AC5A 3RIMA 3F74A 4J4BA 4N0QA 1JDUA 2WVAA 4NBVA 1HYEA 4ATNA 1YR7A 2VPXA 3NO4A 3IB6A 2RJOA 2NM0A 5ENVA 1YDFA 2ZU0C 1OAAA 2IXFA 3LZCA 4M1ZA 1FP6A 1BHSA 3E8SA 1XQVA 1OT3A 3IAM1 1EGVB 1EHIA 2JFOA 4LRYA 3UT0A 4MH0R 1PZHA 1SQFA 1I1HA 1K86A 1QPBA 1NXVA 1ZC3A 4LXQA 4ZK6A 3LO5A 2DCUA 1X2EA 1M5UA 2ZI5A 4MQFB 2RGWA 4D96A 5KWJA 2B20A 1IHOA 1M2NA 2XCTB 1KH2A 2YJ5A 4HZGA 5HIIA 4CLRB 2HU2A 4YV0A 3PGMA 4B6OA 1JU3A 3JRXA 4R83A 3UG7A 4E5KA 4G5HA 2IH4A 3KSRA 2QRQA 4RH1A 4M9CA 2C7VA 3C4QA 5TC4A 3FMOB 1GNTA 3JQCA 4HLUC 4X7MA 1XA3A 4ZT5A 5FYDA 5LIPA 3GAFA 5E7IA 2IW1A 1CYEA 3LT4A 3AIMA 1DKNA 3BERA 3PC4A 3FWPA 2VDKB 1ABEA 2BP7A 4KQWA 2ZZMA 1PL6A 3EZLA 1U0RA 1D2RA 2GX6A 3CFYA 3K15A 3PV0A 2QPAA 2IYEA 1U5CA 3E9CA 5FOXA 2R11A 3I1JA 4RH3A 1LRKA 1V9LA 2HDWA 2P9TA 1THZA 2JJMA 2Q9AA 4W5RA 2Q5CA 3IBCA 3K1YA 2ZITA 1E7MA 4XX1A 3REOA 4DRZA 1N6KA 1W49A 4LWOA 3U9TA 5BWOA 1AUOA 4PZDA 1S2NA 4WOBA 2AXQA 2XODA 2HU5A 4BUZA 2F67A 3RWOA 4F3RA 1APBA 1ZNYA 4Q7MB 1YASA 4Q9NA 2WU3A 5F3WB 4QX6A 5DVZA 2Q4RA 2ZAOA 3PNLA 8ABPA 1LK7A 4YCBA 5COBA 4MA0A 1EFDN 5TQ2A 4BGVA 2YRFA 4LMRA 1R6BX 1H0RA 4AJJA 5IM4F 5CT6A 4FLFA 4IO1A 3B36A 4NCHA 2Q3DA 4OO3A 2X9NA 2B6NA 1G21E 2YOHA 3FPLA 3ZWVA 3NIBA 2VXBA 1C3LA 2LCQA 1I10A 4PG5A 4OHWA 4Q02A 3K3PA 3FW1A 3NBMA 1BE0A 2OB1A 3DNPA 1T3GA 1AQUA 4LFAB 3AG6A 1TUIA 5CT9A 3IE0A 1KZ1A 2PH7A 3NLLA 2QUZA 4L4ZA 4HZIA 4HKTA 4X6UA 2I2FA 3QFSA 4DCMA 4RK5A 2GN2A 4RESA 1CJTC 4ZI2A 1FTYA 3DKVA 8GPBA 2FVYA 2VTBA 1GM5A 4UBIA 3VI4B 1Y7LA 2VF5X 3K9NA 4GVPA 1L7AA 1H2RS 5ESRA 2DT5A 3ONDA 5INTA 4EHFA 1M0TA 4G0XA 2FR8A 4F2GA 3SN6A 1RI1A 3B3GA 5EJ9A 3VPCA 4DKJA 2FZWA 2HJHA 4HH1A 1K9SA 5KX5B 1JEYB 4R2MA 2ZJ8A 2E1RA 2HRBA 2FSGA 2VAMA 1AXEA 5IJWA 3KKZA 4LE0A 1Z5VA 3Q7RA 4BZZA 1RQNA 1YULA 4Z9XA 1XYGA 3VHXB 1E58A 1U3TA 2RGEA 4KE8A 4JT9A 4FD3A 2A0KA 4IY1A 1JHAA 4RELA 3NTRA 4Q6BA 2AFIA 1IEVA 4RYDA 5FXMA 1O6GA 3FTFA 4EA6A 5J2TA 1MF7A 3RS7A 1THGA 3KQSA 1U11A 3KZVA 3L1KA 3D8BA 3PVSA 4Q0MA 3WDLA 4ENPA 4S05A 4DV3B 4A82A 1JEQA 1VDZA 1VKZA 2OK7A 3I01A 3U7EB 2HNBA 3T9BA 2NU9B 2O4UX 2Q7DA 1HEYA 1Y33E 2I78A 2GH1A 2P2YA 2GHRA 3GIWA 4WAUA 2DFNA 4W1PA 3G02A 2M32A 1UIMA 4OKIA 2GBCA 5FPQA 2V6JA 2Z2YA 3BK7A 3HQ4O 3DSRA 5CVEA 3BMQA 2OCXA 3TMYA 1IRXA 4ZXFA 3MMNA 3T5GA 1GYPA 3BYZA 4JUFA 3WGZA 5JFOA 4KVAA 2QG6A 1IOZA 2DC1A 4O2BA 1D2MA 1XNRB 3DVLA 3I6MA 4GZ3A 3S2ZA 1PQWA 3HEBA 1ZNZA 4KP7A 3S5UA 1KQFA 1N6IA 4KLAA 4BFXA 5FPKA 1YNOA 5DK4A 3AK4A 3T3IA 1BO6A 3WGOA 1OWLA 3NHLA 3TZHA 2TMDA 4B8ZA 5CA1A 4N76A 3GA5A 4HNQA 1HUQA 1RFLA 1W19A 4I81A 1VG1A 1JILA 5F7JA 5D3MB 2Q4TA 5K3BA 1SVUA 3KU4A 1DQSA 2J4FA 2P5YA 4WBNB 1V3UA 3KJQA 1PU2A 2PZJA 4FGWA 4J2TA 5FAXA 3UMJA 4N0MA 4ZCRA 2ATIA 3JWEA 3KJGA 1PO7A 1QWSA 1UZAA 1Q16A 2GK6A 2QMOA 3PC8C 5E7JA 3E7FA 4DEVA 4Q4LA 4W1RA 2WE7A 1NI3A 3QGMA 1L4EA 3VUFA 1CETA 5BVGB 3QNMA 3T5AA 1HT0A 3ZX4A 1QNFA 1QHIA 2CLSA 5AI6A 3PRJA 4RPCA 2J41A 2Q0XA 4UVIA 5IAGA 3N2EA 3NW9A 1LJ8A 3E9NA 3WRXC 4BB5A 4B2LA 5CAEA 4JR1A 1IJEA 2D1FA 1K7XB 3LXXA 5EWLA 1DARA 2WQ7A 1L4GA 1YRBA 2OBXA 3AJRA 4OH7A 1JJAA 4TLLB 4RMNA 2XR1A 3O3MB 1ZN8A 1Q11A 3O5AA 4C6SA 1AHNA 1OHHA 4D3FA 3BSSA 1RWBA 2VF8A 4LUCA 1KJJA 3LY9A 4FOOA 4Y67A 1E3IA 2AFIE 1EWQA 3NBQA 1OD6A 4MRPA 3VSBA 2CV0A 1A8IA 4MZDA 3TJMA 1PZFA 3ZE9A 1MX1A 4IIJB 1ZH6A 3W5SA 2W98A 1JIKA 1MAWA 2CLHB 4AZ3A 2WSYB 1V41E 1H3EA 4I6EA 3I5YA 1E3LA 1CJCA 3LZDA 3NHYA 4G1VA 3OCWA 1ZGBA 4IDCA 2AJTA 2H2AA 2JRLA 3D3KA 3G59A 4QE3A 3ZD8A 1KO7A 4AKEA 3BD8A 3R9WA 1GGFA 5EMMA 4A9AA 4GRIA 1E1RD 2BM1A 4M1SA 1ICIA 4ZI5A 3ZCRA 4F4CA 2J3LA 2X5OA 2ISSD 1L1EA 4YXWA 2XT6A 4W7IA 1JX6A 2JHFA 4BWGA 4QWWA 1IOVA 2OXTA 3WGVA 4FFPA 1KIAA 2VQ3A 3E2MA 1E5LA 1DAIA 3KCNA 1E89A 4MMYB 3GFPA 4XM2A 3MCVA 4OGKA 5G3YA 3TX2A 2WYIA 1PN3A 3TNYA 4U1RA 1ZN7A 3RE1A 3WFZA 1QMPA 2ZQZA 1PUJA 3WYEA 3BPSA 1UBGA 5SY6A 2ATEA 3D2LA 4OEHA 4JR0A 2PBZA 2X4DA 2R8XA 2PL1A 3D31A 2P0YA 2XMQA 2LUOA 4BPBA 5I8WA 4FNOA 4I55B 4NS1A 3VTAA 2QSJA 5FORA 3TPCA 4AS2A 1L7MA 4LAFA 1IB0A 3R3HA 5BN5B 2PZMA 5TMDA 4BQEA 4F86A 5DM0A 4ZCPA 5DHSA 2BGWA 4QKQA 3QJGA 1CEYA 1Z6XA 2Q1TA 2W6MA 4CQMD 3KB6A 4DNQA 2YINC 3ZNQA 1ZKDA 3GUVA 1OFGA 1N3YA 2PK3A 3S70A 3OTQA 3QLUA 4OYYA 3ZH9B 4UZSA 1E3WA 1ZUHA 1SA0A 1GITA 4PYJA 1XZHA 4I1VA 4P3KA 1RXWA 1T2FA 1HE8B 2CYAA 2PL5A 3GYGA 3N2YA 3PI6A 3VU1A 4KK4A 2HHLA 2W58A 4K6FA 4CT0A 1TOAA 3TW0A 3IELA 1DBVO 4BQFA 5LP6B 1JG3A 3OQIB 2A2ZA 4G5YA 4CF6A 3MT8A 4NQZA 1T8TA 3GEEA 1PGNA 1RAFA 4R1UA 2AN5A 4C3VA 5DI9A 4MUKA 5COAA 3EGCA 1HBJA 4H0FA 4ITUA 3LKVA 3L6BA 3O2QB 1ANKA 4INPA 1QRRA 1TA4A 1VCHA 2P1DA 4OL0A 4YIKA 3PJGA 3HPQA 3R3VA 1XXHA 3SZRA 3ZZNA 4NYMR 2WIDA 4HAXA 3UW3A 5C3MA 1GGEA 3QE3A 2DHRA 2WU0A 4B2IA 3KTFA 1WUIS 5ES3A 1BMQA 1C8KA 5JI3E 2P78A 2EWMA 2O2HA 1U31A 3OJEA 5DHAA 1SH7A 2NO6A 3DUFB 1GRRA 2A88A 1IAVA 3WMXA 3F6EX 3GJ5A 1L5LA 5KVAA 1WXQA 3D7LA 1U0BB 1H85A 1Y89A 3L1UA 5K5EA 1U6KA 2VJCA 2C1EA 2C5EA 2EZ8A 3KVNA 3P32A 2A9JA 1QC5B 2WABA 2FR1A 1X7WA 1LDMA 1ZINA 4JLWA 5F1PA 3ZGNA 4BX9A 3B6EA 5GJBA 1XRJA 1SULA 1YA4A 2DM6A 5T8KA 3R2JA 3F3YA 2QE7A 4WK6A 3UJ7A 3HMQA 4DL9A 5LMCA 1C9EA 2G08A 4BO7A 5LOVA 1WNFA 3BBPA 3DC2A 3OPQA 4LNHA 1KAGA 4C3ZA 2RBKA 1NF8A 1YR2A 4CM5A 4CW7A 1RI5A 1CZOA 4I5IA 3DMRA 4ZHQB 4XI9A 5BWMA 4FWTA 1GV1A 2GBIA 1QFZA 5KX5F 1SU7A 1BU5A 2BWJA 3GQBB 3IMCA 5JRDS 1PJ2A 1J8VA 2ECKA 1SUIA 3FFBA 1WDLA 3T5MA 4XYBA 1WSAA 4DUGA 1RPAA 4M99A 2J9RA 5TGDA 3HY4A 2XKKA 4EL5A 1D7OA 2CK3D 1X7YB 3MINA 3PR3A 2YYSA 1H1LA 1GLGA 4E6EA 2DY0A 5DK6A 3TVDA 4E2XA 5AQEA 1SQ0A 1L5MA 3UB3A 1E6WA 1C4WA 1UKCA 4FWBA 4G85A 4P93A 3D2AA 5FWDA 2COEA 4DV5B 2X1MA 5CHEA 2HD4A 2YBDA 1XTJA 3A6DA 4Y7DA 3IDOA 1JHOA 3UPTA 3KSZO 1KEWA 1T6YA 2ODNA 3AUSA 3MAGA 4ZQGA 2JD1A 5CBPB 3I62A 3WKBA 1GGNA 1E9FA 2RH9B 3U3OA 3C14C 2GHTA 2G8LA 1YL6A 5CW2A 2XZTA 4PONA 3DAFA 3F90A 5KPDA 1FRFS 1XTQA 3OE7A 1XZPA 2KJQA 3C3KA 3RJTA 5KAMA 3JYPA 4MV7A 1AURA 4OLFA 4HQ0A 4FSHA 1NJSA 1AQJA 1XXHE 3FI9A 3MLAA 2ZOSA 5AM2A 1EE2A 1NLYA 4HZUA 4Q7KA 2OGTA 3OU7A 3HY6A 2AMYA 3PNKA 4J9VA 1EGAA 4ZFNA 4P4UA 1SQ5A 5P21A 4D80A 2RJ3A 4OXRA 2ZTUA 3DZJA 5FFFA 5LB4A 4ZKDA 4HDMB 2PJUA 3ZHQA 1IB6A 2YICA 5DWVA 4W5TA 1V35A 3HDGA 3QIVA 1NG9A 2GEFA 1J2YA 1VTKA 3DO6A 4ZWNA 4WBNF 1JMKC 5DM60 1F0NA 2GLXA 2LZ0A 4FMPA 2WWVD 3N6VA 2QN7A 3W2GA 3RTDA 2J3EA 4P5PA 5K05A 5AJYA 4GXQA 2B8TA 1GAJA 1LBSA 2KE5A 1EAYA 4WZAA 5JPDA 1SO8A 3AEZA 2MCFA 4EARA 1OKKA 2DSTA 1FLNA 2ZI9A 4E5UA 1PG5A 1LDEA 4PQFA 3DYBA 4FMBB 5IUJC 4ZQBA 2GYUA 3HRIA 2CLEB 1R7RA 1Q50A 2JIQA 5D3ZA 4EQ6A 1MQSA 3EH1A 4XFKA 2FWBA 4HGRA 4HQLA 4D3ZA 5KYVA 2ZIVB 3S2GA 3DUWA 1L5FA 4RKYA 3FKSA 1HLPA 1VMDA 3BJRA 3GPCA 2PZLA 4ZO8A 1XEXB 2FP4A 1Z6AA 3K30A 1KI6B 3L06A 1ND6A 4O59O 4FGLA 4PYMA 3SYMA 4CNQA 1GZ7A 1J2UA 3IIIA 2X9VA 2Z2JA 3DYIA 4GO1A 4OMUA 4RSHA 5E4TA 1VIDA 1RBYA 3O9VA 3PSHA 4E7OA 2GFQA 5IHPA 4IIJF 4J0DA 4X64B 4FEGA 4HYEA 3ZXYA 1BKYA 4UUBA 3B1KA 2DBYA 1XDSA 4IXNA 4REOA 3RVKA 1SELA 1LWNA 1XCPA 1B2RA 4WLOA 1X1BA 2XYHA 1X7DA 3ZY4A 5AUPB 1UAAA 4TT8A 4ZYUA 4ZYLA 4AIRA 1EDZA 1RJ9A 4RQAA 4RIHA 4KV9A 1EZZA 4DMMA 4BP1A 3Q8WA 1NBAA 4Z86A 1I7PA 4JIMA 4PZPA 2YVLA 3TVYA 5K0ZA 2WWIA 3PDIB 2GEKA 3EAQA 4E70A 2XOKA 4HWRA 3WJ2A 1IN8A 4JROA 1LBTA 2ENWA 5DE3A 5F5NA 1MD9A 5L3ZA 5KWIA 2Q6TA 4G41A 1FFWA 4TV9A 3ZXSA 1BXGA 4B4OA 2IYZA 1FSGA 5DJ5A 2VAWA 4HN2A 3OZEA 1R6AA 4C03A 2G9NA 6REQA 5JCZA 2P77A 4HEJA 2WTBA 3SJAA 4ZEWA 1VGRA 2QENA 5LQUA 4D02A 1OFUA 1SVIA 1VG0B 2F90A 2AFHB 4JVNA 4L2IA 4ZVUA 2BELA 1MO6A 4UNSA 1ZBQA 5HYVA 2GA9A 4YJ3B 5AUQA 5JEDA 3QUBA 4I55F 4CF4A 1G20A 1MA3A 2FYTA 3TZQA 3KAKA 4WZAE 1YK0A 2FA9A 4TTAA 4UCWA 2PJZA 3JU3A 4Y2TA 3FF4A 4AZWA 3EPKA 5E4FA 4IAOA 3VR5A 3EY9A 3KR2A 4ZGWA 2QSYA 5K0NA 3V3TA 4MUIA 1T4MA 4HUTA 1TUEA 1QGUA 1TD1A 1H2FA 1Z37A 3HVJA 2HUNA 2ZIEA 4I5DA 1EFPA 4KI7A 5AJUA 3R7WA 4BC1A 4CEHB 3CWCA 2HQBA 3IAUA 1NIPA 5DPMA 4KPEC 4WOPA 3ANXA 3G49A 4Y2VA 1AQIA 4LJYA 5LDHA 2G36A 2IZ5A 4N5DA 3LL4A 1NUSA 2IFTA 1EX9A 3LQRA 3LSYA 1SOUA 3QE0A 1L7BA 2BGKA 4JNCA 3ZY2A 4C4XA 1LUAA 5HVNA 5LP6F 4BVLA 4MAAA 1MC5A 2VJYA 2X0IA 1E79A 2C88A 4MW4A 4Q3BA 3RR2A 4P83A 4MSUA 3SC2A 4F38A 4H3HB 2DFPA 5BMVF 3GLGA 1VI2A 2PMCA 1RBQA 1U0JA 3DBOB 1XTBA 4BDSA 1P77A 4L8YA 4KU4A 3WKCA 2H06A 2XUPA 4D8WA 1L3BA 1JQ3A 1PJAA 5TT1A 4ARZA 1EFVB 3QFHA 5L3QB 2CBZA 3ZU6A 3GP5A 5ALRA 2JFFA 2BL4A 3VYWA 3ROMA 2HA5A 1GA4A 3T7SA 5FT9A 3A28A 2QW8A 3DE1X 2YUIA 3OZ7A 1JLSA 5AXDA 1UPBA 3ZYCA 2DOKA 3QELA 2G9VA 4C6TB 2HYIC 2RC6A 3PD1A 4NYIQ 3SQMA 1ORTA 3RUPA 1A50B 2B21A 1V1MB 4U6QA 1RSZA 3TAHA 3BVPA 1R5JA 4PIVA 1FNSA 1S3SA 2AT1A 4MVJF 3K0FB 4YJ2B 4HY3A 4CKXA 1KWGA 3Q5GA 1XVTA 4RY8A 1UMCA 1R9MA 2O48X 3P9XA 4OQQA 2AR7A 2ZU6A 2FMTA 4BO0A 1QH1A 2YZNA 1TFUA 3CKMA 4KO8A 1WEHA 1KXZA 1BVRA 2C0QA 2VT7A 2B1GA 3M6XA 2WJHA 5D5PA 3NASA 4HRXA 3BG5A 5FDFA 5L8VA 2C4UA 4Q4HA 2CCKA 2P3OA 1QGED 2OPBA 1E3QA 1Q77A 3SM3A 2JH9A 2FEPA 2IPLA 1QR2A 3HKDB 4ZHQF 1T5SA 2Y0EA 3OKCA 1ZOLA 3IV9A 4LG1A 2VQSA 3B3AA 4ALKA 1BDBA 3DFUA 3KVYA 3RS3A 5C8ZA 5FA5A 3IEMA 3A36A 3Q0IA 5CLHA 5H83A 4ZVVA 4MO9A 4XWAA 4HAZA 2OV4A 1BCSB 2GLTA 3PXXA 4UBLA 3GLFB 1IU9A 1R15A 1UADA 1D2EA 2C96A 3A05A 3AB3A 4GPTA 4IPTA 3UNXA 1ZRHA 3W9YA 3WFIA 4COOA 3QZUA 2IOFA 2QZPA 2R8RA 2H5IA 4R2HA 3RW9A 5JPIA 2BISA 2NU6A 4P7JA 2D2EA 4P3XA 5EERA 2P30A 3K70B 1QRAA 3BHIA 3I42A 1KETA 1ML4A 2CDCA 1KZ6A 1XZ8A 1Y8RA 1JEEA 4KFUA 5C37A 5KS2A 2XIJA 3I0MA 4UXJA 1N1MA 4RW0A 3A0RB 4DLUA 4E1BA 1E5VA 3C8HA 2YHIA 1PW5A 3OCUA 2D5LA 3IUNA 4HNVA 3R9IA 2FRVA 3N70A 3M83A 2GZ2A 3QYAA 4ESHA 3BT7A 3ENNA 1TW2A 1JHPA 2CWDA 2CXXA 2PGAA 2VDQB 3OU2A 4PO8A 3LH5A 1KSGA 1Y6FA 1G2PA 3CCFA 3ODGA 2MOKA 3A4VA 2HHAA 1C8LA 3KX2A 4KZPA 3ZE7A 4AJIA 1XK7A 2YX1A 1EUCA 4Z1MA 3EVZA 3NV9A 1G8KA 3HXMA 4QYWA 3P2YA 5D7BA 3FPSA 3FFAA 3HKCB 2FZVA 2A1UB 4J9UE 3OFKA 4QHYA 3USCS 1FYWA 3WFJA 4C21A 4QG3A 3I2HA 5JY1A 2XE7A 3KQLA 4CN9A 4N54A 4B7UA 1QV6A 3I0ZA 4HNTA 1CT9A 1X8JA 2QB5A 3G1TA 3LK7A 1BWRA 4QJ4A 1CQZA 5HF9A 3SX4A 1II9A 3GY0A 1BC5A 1Q21A 3PC7A 3V2HA 1U9IC 2P5UA 4YJGA 1ODKA 2PX8A 2B9VA 5B3JA 2HLDD 1XVAA 2PUWA 3ZDFA 1ACLA 4XOUA 1G2IA 2B35A 2IP2A 4WK2B 4KFCA 1NZFA 4Q05A 4V1CB 5BSRA 2MMGA 3QXHA 2UZIR 1ONSA 3OZIA 1QVZA 2OORA 4MS3A 4AJPA 4NNJA 5H8WA 3ZCUA 3NIWA 3KS9A 2IKSA 2RHMA 2LIVA 2O3RA 4O4HA 3LWZA 2CV2A 1GZHB 5IAJA 3KQPA 2JHPA 3L93A 1NSFA 1YI8A 4YVFA 1WOYA 3IBTA 4C7OA 3JSXA 3PEWA 5HCNA 5DOVA 2Z4SA 3R0VA 4RWZA 4WXYB 3AT1A 4PSCA 3WDKA 1E3TA 2FTKE 1TTQB 2CXRA 1MJFA 3GRAA 1AQLA 3UF0A 2GOYA 2FQQA 3WIVA 4MTLA 1BDMA 4P7BA 3MA0A 1MOZA 2QI9F 1Z25A 5HF5A 1LSSA 2JA2A 3DMFA 2ZWAA 5B1EA 3SVTA 3QXCA 4I2NA 4UE2A 1Y4DE 3HM2A 4A8JC 3JQPA 1VA4A 4LKOA 5CA0A 4RK0A 2GXQA 4OGFA 2UUAB 3NHMA 1MIOB 2B4AA 3IMFA 4CL0A 4I6JA 4OA8A 5JDCA 3E5MA 5BQXA 5JCXA 1I2CA 3KYCB 3HCCA 3C6QA 2GQ0A 3FMGA 4HPJB 4LZAA 4RH0A 2W2NA 1L7OA 4P7GA 2LKCA 3N5CA 2JATA 3PRHA 2YXDA 4BP8A 4QGAA 4W8GA 4XYMA 5AJTA 2G7ZA 2VXYA 1Y8QA 1AK2A 1NW6A 4BJ5A 2AK2A 5DASA 4BCBA 4PC6A 5H9WA 5LSAA 1GU0A 4RIFA 2AUNA 3N2IA 5B64A 4QPNA 1JAZA 4PHHA 3CVVA 1TO6A 1CUXA 2AFRA 5B3AA 2BFBA 5L9AA 1GTG1 4W7HA 5JSZA 3W2IA 3CUUA 4IJVA 3RG8A 1GAQA 5EIHA 3PYLA 5EKDA 4TKUA 1QZXA 4MLZA 5AVOA 4DWWA 3H7IA 1NLFA 1FW8A 2IHYA 3QWBA 3D3WB 2X7HA 3C3MA 7REQB 1VE6A 2J1LA 3NHPA 5M7EA 2AYZA 2PKQP 3IRVA 1F4LA 4JHXA 3VR4A 3PL1A 3MJFA 4BV9A 1NM5A 2VPZA 2UZAA 3DAYA 3AONB 3LLSA 2NO4A 4O4IA 1ORDA 1MU0A 2ZEJA 1YRQA 4DV4B 3SR0A 3R8CA 1H65A 3PUVA 3R5TA 1UJNA 3K0HA 2PWBA 4N7RA 4WE3A 2L18A 1T5OA 3T3HA 5K0SA 4PPNA 4WNIA 5E0KB 2GXAA 1RHMA 1XMXA 3D6NB 1G0NA 1DIAA 3I52A 4ZCLA 5LQAA 6ABPA 1LGYA 4I1UA 1MO2A 1KXJA 1Q5PA 4WESB 1UXKA 1H8HA 5ALEA 3EN0A 3THRA 2W6CX 1XTPA 3QQ5A 4QXMA 1SXQA 3WWCA 4UHJA 4KR0A 2GWRA 3AF1A 5EHQA 2JH8A 5HFAA 2CNWD 1N0VC 1JP7A 3AY6A 1NBEA 5TDHA 4FN5A 5B2EA 3RVSA 4V0RA 5C4GB 3AR2A 3ENZA 3N7TA 3OTWA 4QUEA 2PRKA 2FMXA 1PZEA 2CJWB 5DYWA 1QOQB 1VLMA 1HI9A 4QQFA 4AY6A 4BZQA 3U7RA 2IWHA 5DBHX 3FOBA 4CEJA 2LDBA 3AW8A 3JVIA 4EBBA 4HB3A 4QBTA 1QO9A 3PFBA 3PNBA 4NDNE 4QREA 2Z9DA 1RWVA 3I76A 4H15A 3ZIDA 4RF4A 4ZQCB 3E48A 4YRSA 3MBOA 4OM7A 4DS3A 2WZCA 1PDWA 3W06A 2UYGA 3M1YA 1I2BA 4W63A 1N34B 5HK9A 2ZI6A 1E60A 2E5WA 4LV6A 4BXOA 1U8FO 3FFTA 4R1PA 1L7DA 1DUIA 1PV1A 2Q62A 3A4YA 3TQFA 3VHLB 4D4MA 4R68A 4EUKA 3GJ6A 1CDDA 2LWIA 5BUZA 3NATA 1QIGA 2RHJA 4WL0A 3VU8A 3ZGOA 1N77A 1XZIA 3WGLA 1K4KA 1LC3A 4FOTA 4QHTA 3I45A 4YYZA 1GADO 4X24A 4DMGA 4ZTZB 2Z3WA 5IDQA 3T1TA 1YO6A 2OZKA 3QNUA 4Q7QA 1BW9B 1M2FA 1LLDA 4YP1A 1DOHA 1QYDA 2EJUA 1YC2A 4KI0A 5C53B 3O2JA 3OBBA 5JDIA 2ZBFA 4OI2A 5BSVA 1HRDA 2ZQYA 1YI0A 4DHWA 3P9YA 4B6SA 2A14A 3LUAA 4PCAA 1PG0A 2ZB7A 3QI2A 3H1AA 4JY7A 2ZJZA 2V45A 3WLIA 2HZBA 1FFEA 4F0JA 1JSZA 3BE5A 2LNDA 3ZKAA 2VK2A 4Z3DA 2GVZC 3W9SA 1RWXA 4FDMA 2NUAB 3RQSA 3ZZUA 3N0RA 2NUPB 2B7LA 4D0GA 1NURA 3EF1A 3EOBI 3WHIA 4MUGA 1GQFA 1MAHA 2IJGX 3F6BX 4PYLA 2YWEA 3QMPA 5JJBA 3E3MA 1U1GA 2HV8A 5CDHA 1KL7A 2YUTA 2GF0A 1ADGA 1DEHA 3AZOA 3EVTA 1XLUA 3KL4A 8MHTA 2C20A 4A0RA 5HKKD 3Q5DA 5CLGA 4OB6A 3MYRA 4MCAA 3HYRA 1H0HA 3OLWA 4KPFC 1WZEA 5FOTA 4BKRA 4CGYA 3ZVKA 3L49A 4C4AA 3GJYA 2Z2IA 4N49A 4DQDA 1Q6ZA 2W2KB 2FAXA 4MW6A 2R2AA 3KQOA 4NG4A 1LF0A 3F3MA 4YS6A 4BAUA 1MJGM 4ZPJA 2XSZA 2FPLA 3EWSA 1DQRA 1ZMXA 3HA2A 4E7PA 3H4MA 3KUUA 4JLNA 3AMVA 4GX2A 4MQ4A 1L4HA 2ZS9A 1MZPA 2XTZA 4CV1A 3S1AB 1GRNA 2ZYGA 3KSMA 2JB9A 3IX7A 4PHTA 3TRIA 4B43A 1V3VA 2HDOA 1E3SA 4E4RA 3DBRB 2FFRA 1K3UB 1CEEA 4G8JA 1FU8A 3BSYA 5EXPA 1OTXA 3RT7A 2AUMA 1PJTA 1SIBE 4HD8A 4US0R 2C3PA 4L50A 3ZHSA 1J6UA 1P2SA 3CW2A 4EUFA 2YL2A 1R66A 3DDNA 3FPHA 1BVHA 5HTOA 4YP0A 3T94A 3I04M 5TY0A 2G0AA 1KAHA 2IXDA 3JWPA 3PQFA 1ELOA 1FBNA 4PTYA 4ZQIA 4F5YA 5KAPA 4L7VA 2NXCA 1QFJA 4MO2A 4DDHA 4EELA 4EUSA 5KREA 3H86A 3Q5EA 1GO2A 3ZDRA 4JS0A 2VJNA 4GYWA 4FMCB 4UEOA 1AGNA 1KJ9A 2PDAA 3BK2A 2GK3A 3PFCA 2CV1A 5AI0A 2VF2A 4FZJA 4DBLE 4L3VA 4R71A 2AK3A 1Z0ZA 2WE8A 1Z6PA 3MGKA 4AK9A 2D4HA 1QIEA 1QGAA 4R9RA 2JFYA 2VP3A 2GA8A 4WCVA 4RD0A 1X1EA 1DJNA 3MN1A 4XGQA 4MB2A 3L01A 3SOZA 4YRBA 4HGYA 4NECA 2KSQA 3QF4B 4X93A 1W4BA 1O0SA 4I1RA 5IC6A 5BO5A 4HQFA 2PU7A 3LIIA 5A3QA 2JASA 1QRTA 4Y6PA 1I4DD 3GJ3A 1JLLA 1IXZA 3ZBTA 3OZSA 4J0CA 2JLYA 2V6MA 3RYHA 1L7VC 4KEAA 1UMDA 3Q3VA 1XRLA 3ZWQA 3ESCA 1LV7A 4V0LA 2VSQA 3F4LA 3M6MD 3HCEA 3TMAA 4OBXA 1FP4A 1Q0TA 1HLGA 1EM6A 3QEKA 5EJ5A 4QZVA 3A2KA 3OUTA 4LC0A 4UEKA 4PLZA 4HLUA 3WB1A 2Q50A 2NZ2A 1PR1A 1B16A 2RAFA 3R9KA 3B6KA 4ZCTA 4LHSA 3CUKA 5BRJA 1ZXBA 3AHCA 3O1HB 1JA9A 1DBRA 3SQNA 2ZRKA 3GF4A 3ZXXA 5IBRA 4DAEA 3RSHA 3U3KA 1GNLA 2IHBA 2GYWA 4EENA 2HMVA 4X3CA 2BGLA 4H3VA 3FYTA 4F5DA 5CFRA 3SMVA 3EFHA 2YXEA 1A76A 3S27A 4TKLA 3ZPXA 2VJDA 3H5AA 2HWXA 1GPNA 3AR3A 2YVKA 3II6X 1W25A 1E66A 4RTOA 2PX3A 1FC0A 2V1XA 2GI4A 5AW4A 2R62A 1A4RA 4RK1A 3WNZA 4U6NA 5CJJA 4ZO7A