2ZJBA

Crystal structure of the human dmc1-m200v polymorphic variant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
239
Chain Sequence
PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQVELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of the DMC1-M200V polymorphism found in the human population
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
total genus 60
structure length 239
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjbA00
2AL7A 4ZPXA 5C18A 1BIFA 2QG6A 1VIYA 4MRRA 4B3GA 4KFRA 4LY6A 5DYIA 721PA 2ZYUX 1MKYA 4HLUC 4M1SA 4YMVA 1EFHA 1SVLA 2GK6A 2WJYA 2XTZA 8OHMA 1CRQA 2J41A 1D6JA 4XVUA 4QBHA 1AS3A 2Z6VA 3QNUA 3A4LA 4MKHA 1Z08A 2IT1A 3GJ6A 1D8TA 2F1IA 1E9BA 2J45A 4PC7A 2G6BA 3DZDA 2GETA 1R0XA 4LC0A 2W6IA 4DDWA 1GL9B 5J4YA 4A8JC 2WKRA 3I1FA 3P32A 4DLWA 3Q85A 1H8EA 3SEAA 1NG1A 4DT1A 2ZSEA 4I99A 3UXMA 3RDPA 3AVPA 2UZIR 1ZM7A 3Q72A 2OV2A 2W58A 5F3WB 3EA0A 1U8ZA 821PA 4GMDA 4DIEA 3QI2A 4NCJA 3R7WB 1OHHD 2IC5A 1E9RA 2VO1A 4QNMA 4EJSC 5AJVB 5EP2A 1FP7A 1JAHA 3ASYA 3IPXA 3LV8A 1DAMA 4KVAA 1ZCAA 5CIQA 1FX0B 4HB0A 1NN1A 3EW9A 1JXMA 3MWJA 4N0DA 2QBYB 4E22A 4FW9A 2OCPA 5KNDA 2F1HA 2GNOA 1DS6A 3EC2A 1P2SA 1NLYA 1AGRA 4OQLA 1X3SA 4FN5A 2QAJA 2H5EA 3DZ8A 3PCRB 1KYIA 2AWNA 5AWFC 1XTSA 3B1WA 2ZRPA 1F60A 1SQ5A 2BBTA 4D0GA 4JIMA 4BFXA 2HYDA 2NZJA 4B75A 3C16C 5K8UA 2R6DA 3EIEA 3FHOA 3LW7A 4HAXA 5AJWA 1U8YA 1JR3A 2GZDA 3H0KA 4M1KA 1RYFA 3RRYA 1UAAA 1VKJA 2IWRA 1NP6A 4QG7A 4LPKA 3UMFA 5FL7A 1QDEA 4QGAA 5H8WA 4YLGA 4BEBA 2VEDA 2X8AA 3KZ1E 3J81k 1UKYA 2NO0A 1FP6A 4MGYR 3T35A 5FL7D 3SJCA 2GXQA 2D7DA 3SJBA 1KJYA 4O0MA 2YV5A 4WW0A 2WKQA 3W3ZB 1Z22A 2QGNA 4X8OA 3HYRA 4XD7D 2BOVA 1IN4A 3FMIA 4ZO4A 3U4QB 2GEVA 4BFUA 2ERXA 1E94E 3EWAA 3MWKA 3A8TA 5KO2A 2FE4A 2EFHB 2BBWA 1NBME 1S9DA 4GOXA 4D2IA 3QXXA 1XDBA 5SZIA 1NNEA 2GCOA 2ORIA 2VTKA 3IO5A 2ZJYA 3T61A 2RKOA 4NYJR 3KL4A 3NBXX 2N42A 3GD7A 1NKSA 2HXSA 2D3WA 4IEEA 2BIFA 3PUVA 2C95A 3H4MA 1XCMA 4OYHA 3QG1A 1E1QA 3OEEA 3THYB 1T8TA 4XVQA 1E79A 4TLDA 3P4YA 4MUAA 3A1TA 3ZIAA 2ZRIA 3IEVA 4GZMA 1S1CA 3P20A 4ERNA 3LBHA 2FMXA 3AVQA 2O0HA 4HLUA 2W00A 2WWWA 2V55B 1FTSA 3QG5A 1G7SA 1I4TD 3RHFA 1EK0A 1R0ZA 1DAGA 1KNQA 3CPJB 1W0KA 1Z0DA 4XJXA 2JJ1A 5FOXA 1XU4A 4CDGA 1SULA 1N5LA 5A5GA 1XTKA 1KDTA 3AUXA 4LDJA 2CJWB 5EJEA 3QPVA 3A37A 1W0KD 4RFSA 4F38A 4P0TA 3W6PA 4XWKA 1FPMA 1UDWA 2OLJA 2PH1A 1KO5A 2VP5A 5KYKA 2R6CA 3KKNA 3R9IA 4V0NA 1YR7A 1UDXA 3K8YA 3TQFA 4A2WA 2O8BB 2IYSA 1G3QA 2JAQA 5HZKA 4LYFA 2V1UA 2VQSA 2V4ZA 3D7MA 3TUZC 2QORA 4JBYA 1G7CA 4ZIRA 4C0SA 4TLEA 3O8DA 4V02A 2YOFA 2CK3A 3W3AA 2G3YA 2F43A 4MGIR 5FTLA 5JEEA 4CEHB 3X1WA 1KO4A 1N5IA 1ONBA 1UM8A 3AVOA 1IJFA 2ZS9A 2IYZA 2IYTA 3SNHA 4LHYA 2JLWA 2ZI7A 1YZQA 4ZDJA 3LQQA 4W9MC 3MRSA 4OHVA 5FOWA 3VR1A 5LDDC 4F91B 2WJVA 4FI3C 3PEWA 1OE0A 3ZZTA 1IXRC 1XTQA 2O5VA 2WWIA 4FCVA 1UPTA 3EZFA 4V0OA 3T1TA 4JL5A 5B64A 1G6HA 1KNXA 1XCGB 3WY9A 5FBWB 4MYHA 1E79D 3IGFA 3SYKA 3K9GA 1E96A 1TQ4A 4TSFA 2NPFA 1K6MA 2IYWA 3L2OB 4Q03A 4PSVA 4KXFB 1XJ0A 3E70C 2PJRA 4QGHA 4D0LB 4DDUA 2ZITA 1JR6A 2F7SA 4AYWA 4D0NA 2W83A 3D31A 2MSDB 2WJJA 2FJUA 1FFHA 1JALA 1D5CA 3ZVLA 4CRWB 4RCYA 4URUR 1KZGB 3CPEA 4D26A 1GG2A 2V6IA 5L3RA 2RCNA 1JAIA 1DAFA 121PA 5TARA 2VIIA 1KKLA 3RANA 3VR6A 4WOPA 3CO5A 5FOVA 3NTUA 3JZAA 4B3BA 5JSZB 4AY2A 4EKDA 2VA8A 1NLFA 3QPUA 4ZDIA 4ZKDA 2RGNC 5K8LA 3CIOA 3G82C 2TMKA 4G5SA 1ZUNB 5G41A 2NZ8A 1SVKA 2HF8A 5GVRA 4PO9A 3PR1A 5FBLB 2HT6A 4YMWA 3X2SA 5FI0B 2D4HA 1G8PA 2C04A 2VP4A 1PLLA 3PITA 4JVNA 1GZSA 4OI2A 3GLHA 1D2EA 4UNQA 4BLRA 2IXGA 4LJ8A 1GKUB 5SZJA 3REGA 5KSOA 4EPRA 2JLRA 2JGNA 3RRMA 2YWGA 3KXLA 5KSZA 4M8NE 1VHLA 4R9UC 2R62A 3QF4A 2FX3A 4MKGA 4NP6A 3DOFA 2PEYA 3LXXA 1HA3A 3CONA 1MRNA 2P3SA 1GOTA 4EJSA 3EPJA 3FHCB 3GMTA 3L8YA 5J4VA 1J8MF 1J99A 2GCNA 5CDFA 3BIFA 4YMTA 2HXYA 4N3NA 2ZJOA 4FINA 5IK2D 3PUXA 4C7OA 1E2JA 1R10A 4Q9LA 3SR0A 1Z29A 2XJ9A 2NQ2C 5EZ6B 1T8UA 2QMUA 1N5JA 4EPTA 2A5YB 4PAQA 2P6RA 1WB9A 1RRFA 1W36D 2ZVQX 3WBKA 3KUCA 4FXPA 1NBMD 4XTRA 1KSJA 1S3SA 4US0R 4KV9A 1NN3A 2EQBA 3TRFA 2OZEA 1DARA 1KJWA 1P9NA 4G3XA 2BM0A 4TTRA 3ADKA 2BEJA 3NVAA 1GITA 3BWDD 1LNZA 1HUQA 2GAAA 4C0BA 2AN9A 4NU0A 4A8JA 3R9XA 1VYVA 4V0KA 2NO9A 2O8EA 1OKKA 1XMIA 1XTRA 1W36B 3B5JA 3TSOA 4HLQB 1MOZA 1DAKA 4LHZA 3RS0A 1U99A 2R44A 3NDPA 2QPOA 1XCPA 2V54A 3LQRA 2CL7X 4FWIB 1JBKA 2E1RA 2JATA 2YC2C 2ZUDA 3LH5A 4TL9A 4TQAA 5DO9A 2VHCA 2R6GA 4YMSA 1RC8A 2OEPA 3QKSA 4KVGA 3RS2A 1X86B 3KTAB 4Y0VA 2WWYA 3GJ0A 3QBVA 4WZAE 4RD2A 5KHOC 4RCZA 1SVIA 1SKQA 5B58C 1CIPA 4L8GA 4AC9A 3THXB 2IYYA 1OXTA 5TVKA 2R9VA 4O2RA 4KSCA 2CNWA 1VG9B 2ZYWX 2G88A 2ODNA 2GA8A 1MO5A 1IHUA 2QE7D 2I1VB 4OQNA 5DSZA 4PXAA 3TAUA 3UMRA 5HE8A 3BFVA 1NJGA 1PZNA 2ZRFA 4LV8B 1XBTA 3QXSA 4MYUA 3U44A 1J2JA 2EVWX 3QENA 2UVQA 4PO8A 4FD2A 3VX4A 3OHMA 3B78A 2QPAA 2N46A 2P5TB 1NMZA 4CEIA 2A30A 1XEWX 1M6NA 2OSBA 3A58B 1OH8A 1JQJC 5EP4A 2ANCA 1CJUC 2A5FA 2H7VA 5FPYA 1ZD8A 3GQBA 4M9ZA 4UJ5A 2OBMA 2YINC 1G18A 4LYHA 2GBLA 2CL0X 1E2PA 1QHSA 2ERYA 4Q4HA 2W6JA 4BZXA 5HKKA 3WP0A 1G17A 3ICQB 4Q1BA 4DCSA 4CW7A 3MLEA 2XOKA 1QVAA 1MRSA 3EZ7A 2MMGA 2SHKA 3BFKA 3C8UA 2AX4A 4PZLA 3U44B 1NVXQ 3ZLJA 4EFMA 1W0JA 4M9SA 2EYQA 1F48A 2BCJQ 5FBRB 2JLYA 3SQWA 1WCV1 2HJGA 5CLQA 5BYKA 3TH5A 2PCLA 1U8AA 4TL7A 3M0EA 2OCYC 3EXAA 3EX7C 3OFND 1W4BA 4F4IA 1AM4D 3NHBA 4AI6A 2OILA 4RJLA 1GIAA 2GDJA 3K0AA 4HAZA 2QTHA 4KFTA 1II0A 5B30A 3ZVNA 3BRWD 1Z0KA 2ZU0C 4IEIA 1SKYB 1E2NA 1QHYA 2XEXA 4V0MA 5IHPA 4HI0E 2VP2A 2WJHA 1RZ3A 2J0UB 4C0KA 4F93B 4HLDA 4QBIA 4TTPA 2JLUA 1DO2A 1LF0A 4DLUA 3OZXA 2IS6A 2H16A 2A78A 4QOSA 5E3HA 1W47A 4BLSA 3GEIA 2WV9A 4FMCF 3A1SA 2HT1A 1EFRA 5KNCA 2FEOA 2QI9C 3EWSA 4JKIA 4TLAA 2XGJA 1OFTA 4PHGA 4B48A 4AKEA 3B1VA 5AUOB 3B2EA 3BB4A 1XTIA 2Z83A 2CJWA 4LRWA 2VYFA 1QHXA 1U0HC 1L4UA 3IBYA 3HR8A 1XNJA 3UPUA 1E0KA 2JIZD 1MT0A 1ZM2A 2WM9B 1ZC3A 4LBZA 2FSFA 4B71A 3O8RA 3GLGE 1H8HA 3QQ5A 4IOJA 4KBFA 4BLOA 3AVUA 1C1YA 3BC1A 2ZRNA 2XX3A 5DH9A 4G5OA 1OYWA 2JLSA 1LB1B 2REBA 2GXSA 4Q1FA 3Q5EA 3TR0A 4Q7LA 2GBLC 1CJKC 3B7GA 1YR9A 4LJ6A 5EE5B 5CDFE 3GCGA 4YONB 3SQXA 4C9BA 1GILA 4PAMA 1Z47A 2QP3A 3D6TB 4M4SA 4HUQA 1T4GA 2B7CA 5EE1A 5CM8B 4PFSA 1G5TA 4PC1A 5EE3A 1DELA 3AP1A 4Q47A 4ZCIA 3SZRA 3OIVA 1P60A 3AVYA 2HUPA 1IY1A 3F8TA 1T91A 3L8ZA 1WXQA 2GJSA 3FPAA 4G5QA 1EX6A 1NVVR 1Z2CA 3LW8A 1N2CE 4RFVA 5E7MA 1KDRA 3MJRA 5BN5A 4DCUA 3PG5A 4Q66C 3A36A 3CM0A 4JBXA 1KO7A 4AYXA 4ZCLA 4LWZA 2BHRA 4JJKA 2QROA 2QUZA 1OXVA 2DY1A 1ODFA 2XTNA 2ZRMA 4IFBA 5AK0A 4TLCA 1Z63A 1KI9A 1X6VA 3N2IA 3LVRE 5L3SA 3T15A 2X1VA 2ZU6A 3WYGA 3VNUA 3BD9A 1YU9A 3FGNA 4PTLA 4DEXA 1VCIA 4M1TA 2F55A 2B92A 1XD2B 3RNLA 2GF9A 4UKDA 3VHLB 5FPTA 1UEJA 3QVVA 2ZIAA 2IL1A 3R20A 2ZVPX 4LBYA 4M2LA 1RPZA 4M1MA 1E9DA 1T3SA 1II8B 1TEVA 2QSZA 3N2EA 2ZXUA 3C7KA 3BXZA 1KI7A 3TR5A 2MMCA 1S9HA 3FVQA 4B6FA 2QRZA 3AF1A 3UATA 4FWTA 3RS5A 4B43A 4Q9IA 4KAXA 4QKQA 4MGZR 5AUQA 2KJQA 3G0HA 1XPRA 3LA6A 4GPTA 3PVSA 3DO6A 1IQPA 2FGKA 2ZJ8A 4JKYA 3U3OA 4DUGD 1CR4A 2Q21A 1KI3A 3A6PC 3LBIA 4BPBA 4Z8XA 3S1AB 3W34A 3U3RA 5C4MA 1YZLA 1E0AA 4TTQA 1HY3A 1S3GA 3KKPA 2ZRJA 4M1YA 3IKJA 4OK3A 1OPXA 2HJVA 3AP2A 3EPLA 1XZPA 2A2ZA 2YWHA 3CZQA 4UXHA 1OXSC 5HR5A 3QXCA 2ZRLA 2JASA 4CF7A 1OB2A 1R8SA 2CLCX 1RRCA 4K46A 3RC3A 3K0CA 2ATXA 4DHEA 2FV8A 3KQKA 3QSYA 1DOAA 5IT5A 4GOKA 1GAJA 2JCSA 4YQFA 3Q7QA 4Z1MA 2IBMA 4QRHA 1UJ2A 4ZI3A 5HPYB 4PPQA 1VG0B 1GL6A 3K70C 5DGXA 5E95A 4WVFA 1UBGA 5FOUA 5J4KA 2B6HA 4NCKA 2D06A 4A36A 4PZYA 3GLGA 4BLQA 2FFBA 3FFAA 2F43B 1J8YF 3IUYA 2GVZC 1EWRA 1FZQA 1JQLB 1TTTA 4QHTA 3NHAA 3UWKA 4PC6A 3H2YA 1WMSA 3OFNA 4NYMQ 5CJPA 4TN1A 3TVTA 3CPHA 3R9WA 2B8WA 2BBOA 2V1XA 1I4LD 1X8JA 5EXSA 3FE2A 2OFWA 4JYCA 1E0SA 1KGDA 2FPLA 2GVDC 4K81B 4KI0A 4M1OA 3AF3A 4OI1A 2BEKA 4QJ3A 2AFHE 3DHWC 1XEXA 5KOYA 2GAOA 4LHVA 1M74A 1CKEA 3N5CA 4EDHA 1P2VA 5ELXA 4Q7JB 1SVMA 1Y3AA 4HYYA 5JJKA 6Q21A 5FBQB 2ANBA 1X8KA 4MDFA 4V0ME 5TXGA 2RGGA 4PQYA 2VHJA 1G19A 5FUYA 4B74A 4XD7A 1UKEA 2BMDA 2ZSFA 1G20E 4GI7A 4TMZA 2A3RA 1LTQA 1CTQA 3Q5DA 2OFOA 4W5WA 3ZIAD 1P2TA 3AP3A 4TMXA 1W5TA 3IDQA 4KCGA 1E2GA 3LAWA 1ZMXA 1N0WA 5KU1A 4Q48A 3B60A 1Z07A 3S1AA 2GEUA 1LS6A 1R8QA 1XXHA 3KJEA 1UBFA 1FQKA 1T0HB 2ZI6A 3THYA 4LCBA 2G1KA 3U60B 4TZ6A 2E9SA 3WNDA 4TT3D 1DTSA 5DNYB 3RRNA 2F1RA 4FIDA 3VFDA 3A1WA 1SVOA 1KMHB 4FCTA 1XMVA 1KMHA 2CLDX 1NVVQ 2GCOB 4R71A 2WPDA 4TSFD 3NBYC 2FWRA 2ZE8A 2IYLD 2A9KA 3B1YA 3K09A 3VR2A 3WHKA 2OBLA 4OHXA 1M7GA 2MSEB 2DB3A 1ESMA 1M7HA 2AK2A 3DVLA 3CF0A 4NL4H 1YZKA 2CXXA 4OQMA 4Q02A 3EASA 2MSCB 4M53A 3EPHA 1W1WA 3NXSA 3OAAA 4D82A 1EG7A 2ZE5A 2ASEA 4EUNA 3LLMA 3LWNA 2QMHA 4IDNA 3EZ9A 3M6AA 1Q21A 4F92B 3HDTA 2DFLA 1FNMA 2VP9A 4Z1MD 4US2R 4R2HA 3V9PA 4AG5A 2PX3A 4JVMA 2J7PA 3HYTA 1EWQA 3I72A 1H65A 2Y8EA 1C4OA 5EXXA 4GBMA 1OIWA 1TF2A 3SJZA 3VR5A 2IF0A 1HV8A 2KE5A 3SBEA 5FR2A 4KLZA 4HLCA 3QKRB 3GJ4A 4AKIA 4DKXA 2RAPA 2V8OA 1YZTA 1NMYA 2JJ1D 2G77B 2FFAA 1S0UA 1NN0A 4II7A 3M4YA 5P21A 3BH7A 5HCNA 4Q1DA 1M7BA 3L0IB 2QMEA 1E9EA 2YOGA 1KSFX 4P31A 4PC2A 5FBVB 2ZEJA 4DLZA 1E1RD 3KB2A 2WWXA 3NC1C 4QM7A 2WAXA 2ZSAA 3CW2A 4RD3A 4WIAA 5BW8A 1GVNB 5KUTA 4BUJA 5JWHA 1G16A 1GUAA 4QJ5A 3QEJA 1E9FA 2CE7A 1P9WA 2IXEA 4DEYA 3Q3JB 4ZCMA 4GP6A 4URXR 4NYIR 2LKDA 3D8BA 4R7ZA 5C1BA 1N0VC 1Q12A 3VR4A 2AD5A 3QKUA 2IUUA 1XZQA 4IDPA 3RS3A 2QENA 1ZVQA 4Q4LA 4IVRA 4B3XA 2WPDD 3W5JA 1XEWY 2PJZA 2L0XA 4PZZA 3AH8A 2AWOA 2J5XA 4Q9KA 3W9YA 3Q9LA 4KO8A 1J90A 4P4TA 3TQCA 4WAUA 5TY0A 5B2ZA 1OKKD 4CGZA 4Q9JA 2X2EA 1RKBA 3KB1A 4ESHA 2IYQA 1ZAKA 4FMDF 1E2LA 1K8RA 1RW4A 4QGFA 4CT4B 2PBRA 4RD4A 2ZR0A 3DPUA 3KQHA 1NF3A 1FUUA 4PPFA 4GP7A 5CJ2A 2FPMA 4A15A 2CE2X 1AIPA 3UKDA 1MR3F 3K0AB 1DBSA 1E4VA 2W2TA 4O3MA 3K0SA 2WOOA 1BO6A 4EFNA 5JCPA 4JLKA 4C2TA 3GJ7A 3WYAA 4BECA 2BVNA 2GHIA 3UWOA 1BYIA 2JLVA 3V4FA 2LCFA 5LB4A 2DWQA 3GLHE 1QHIA 4M9QA 5JJLA 2AKAB 4LPSA 1RIFA 1JB1A 4KLNA 4Z8YA 1XF9A 4OL0A 3B82A 4GNKA 3TJZA 1ZBDA 1OB5A 2WTUA 3IILA 3WRYC 1HH4A 2RGBA 2KB0A 3IIKA 1E9SA 1MO3A 3AF0A 5JJIA 2D2EA 1P75A 2GXAA 5L8VA 1RVDA 1ZUHA 1L4YA 4Q1EA 1BS1A 2VF7A 1CR0A 1SXJB 2JJ8A 2J1LA 3C4JA 3LY5A 4YDHB 3TAHA 3ZS9A 1W36C 1RJ9B 4NCHA 4BRUA 5H70A 2C99A 2QPTA 4MKFA 2HF9A 5GJVC 4LV6A 4E07A 2IEZA 2FSGA 4A0GA 3NIBA 2BWJA 3IIMA 4I4LA 4BQSA 1IN7A 3FOZA 3BFXA 4Q4AA 4EPYA 1B23P 2YNMA 2GTPA 2W0MA 2XXAA 2G83A 4E09A 2RGEA 2DFKB 5BWMA 3VKGA 2IK8A 2AD1A 2V7QA 4IOKA 4LUCA 4LBWA 3PQCA 4Q19A 1DG1G 4TYYA 3SU8A 3QVUA 5JLJA 1RFLA 3FMOB 5BN3A 3RYTC 1NSTA 1Z0IA 3NC0C 4D81A 3HPQA 4RZXA 4CZ2A 4BZPA 3W6NA 2ONJA 3MSXA 5JZVA 1O3YA 3C14C 3IBGA 4I81A 4Q7MB 4CVNA 1X8LA 3DEFA 4QBFA 1NL3A 1A2KC 3QKSB 2FGJA 3VHXA 4PPNA 2AHOA 2PL3A 1IN6A 4MRNA 4DLSA 4P32A 1E1RA 4KU4A 2ORVA 2FPKA 2IA5A 4C30A 4P4SB 2C9YA 5FPSA 4IHQA 5DI3B 2PMKA 4A2QA 1G3RA 1TNDA 4ARZB 1E69A 2V3CC 4OJKA 1KDOA 5HCIA 2CEAA 1NRJB 1P5ZB 1AQYA 1COWD 1BMFD 1E2QA 1FL9A 4UNPA 4A8JB 3T12A 3VX3A 3K9HA 4URWR 5CM9C 4N0EA 5FL3A 3QKTA 2O0KA 3AM1A 2YJTD 4LSGA 3PEVA 3SHFA 2GJAA 4JLDA 2XB4A 4GFDA 2BCGY 2PLFA 4XTCS 4LJ7A 1SHKA 3G5UA 2AXPA 1EFTA 2NTYC 2J3EA 1SXJD 3BAFA 3RVBA 4GZLA 4JT4A 4O25A 2J0UA 4HATA 5HE9A 3TLXA 4X8LA 1OH6A 3M1IA 1P62B 4B2LA 2XNDD 2W6JD 4P3YA 2Z4RA 1NJFA 2YZ2A 4G5GA 1AK2A 2Q6TA 4HSEA 1E2FA 2ZI4A 5HZHA 2H57A 4C7OB 3V00A 5FPKA 1IXZA 3SFVA 2G9NA 1Z6TA 5H1YA 4YC7A 3CNOA 2XXAB 1DVRA 2J0VA 3A1UA 3U6BA 5IRCD 2FA9A 1VG1A 2XJ4A 3EARA 3DOEA 5LBIA 3AKCA 1N6RA 2WSMA 5M04A 3U3JA 4DC9A 4WXRA 3U6KA 2C8VA 1QHHB 2H17A 5G3YA 1FMLA 4WXPA 5F9HA 4CEJB 3CBQA 5GVSA 3GLHB 2ZYTX 3DL0A 1CJTC 4AG6A 3K9LA 2ZSDA 4WZBE 5EQTA 4A1FA 3W90A 1VMAA 4XIGS 3VU9B 1KI8A 1M34E 2REOA 2ZUCA 2F3TA 2BC9A 4HAYA 2ZPTX 1ZYUA 2C77A 4CEIB 1T9HA 4JLMA 1N0UA 5CB8A 4NH0A 3RWMB 2NPIA 1D9ZA 1HQYE 5JRZA 1XMSA 4YXWD 2WMOB 2A5JA 2GCPA 3MD0A 3PFIA 2JLQA 3PEUA 4JVSB 4EPWA 1CR1A 1IY0A 4A6PA 5CLLA 4A9AA 5AJZA 1HT2E 1Q1ZA 1X1SA 1OFIA 2GESA 1T3LA 3SHWA 4AKGA 4PSKA 3PJRA 4OQXA 3CUEF 1U0JA 2BBSA 3UG6A 2OE2A 5EE9A 3QIAA 2XTMA 4M9XA 1CP2A 3R8CA 3P1JA 3ZS8A 2KBEA 3T5DA 2DR3A 2JJ2A 4HDCA 4LOAA 4LI0A 1N3BA 4MH0R 3WHLA 4I1SA 4TYQA 5LB2A 3FKQA 4D4JA 3E1SA 4R98A 4TZ0A 5EP3A 2J87A 4CEJA 3WNCA 1XPOA 4N1AA 4PHTA 3QEOA 5DYGA 1TQ2A 1GNPA 1UEIA 2D2FA 2FZLA 1U9IC 1EXMA 1U2RA 2VP0A 2XZPA 3O47A 5E4FA 1IY2A 2ZUBA 1VCNA 1DAIA 1E2MA 3QUSA 3AKYA 2ZRAA 2QP9X 2R2AA 3IO3A 4MYCA 4C0QC 4AD8A 4DB2A 3FMFA 1QRAA 3ICEA 1W4CA 1JR3D 4LHWA 1ZCBA 2JEOA 2VHUA 2ZR9A 4YMUA 4C0JA 2ZTSA 4IRUB 2WSSA 4HUQB 2IS1A 2ODWA 4KFSA 2C03A 3FB4A 2VH5R 3NWJA 2HLDA 4JYBA 1I4DD 4U7DA 5AR1A 1QZXA 2HDNB 3SS8A 1OFUX 3FDIA 3PV0A 2P6UA 2CHVA 2EWWA 4L15A 1KAOA 5IK2A 1XJQA 3F0TA 1G4AE 1XJCA 2JDID 2ZJAA 1HQCA 1NMXA 3FKSD 3C5HA 1NSFA 2C98A 4D4LA 5F9FA 1TU4A 3QKRA 1FOEB 3ZVMA 4B3DA 2XSZD 2FN4A 4JLPA 1TAGA 2C9CA 5ANRB 1GRNA 3GEHA 4RFSB 1Z06A 2JIZA 4TMVA 5GADl 3KKQA 5CITA 2AFIE 4GOJA 2J59A 2O52A 4ARZA 4BFZA 4OKSA 4ACBA 3DKPA 1Z83A 3GFOA 2IUTA 1U81A 4XSHA 1R5BA 2W6ID 1WE2A 1KI2A 3W5IA 3PXGA 4D80A 3F5FA 4AKHA 4GDFA 1Z28A 5TB5A 1SGWA 2ZRGA 3GJ3A 1IJEA 2VRWA 5EE0A 1EFCA 2YHSA 2G1JA 1G291 1DO0A 3K70B 1CS4C 1W48A 5JHGB 5A0FA 4DLXA 5GJBA 2FFHA 1E2IA 1NG9A 3IHLA 4WZ6A 3BBPA 1T3HA 1AJEA 2LKCA 3CX6A 3B6EA 3OEED 4GRAA 5FUWA 5KDLA 1BH2A 3LD9A 3KKMA 4PQFA 5KDDA 4DVGA 2IS4A 3AVTA 4W7SA 3L82B 1OIXA 1YRBA 3QBTA 2DWOA 5JSZA 1M1YE 1OF1A 5FUVA 3THWA 5JFGA 1YZGA 1UADA 2W2XA 5GJWC 1XX6A 1ZC4A 1SXJE 4B33A 1N6PA 3WNBA 1KOFA 1KO1A 4ZV4A 3CRRA 4L4UA 3O8CA 2ZR7A 1G8FA 2A5DA 2O8FA 2BDTA 2VP6A 3T06B 2FH5B 3WYFA 1LS1A 3MCAA 1RRPA 1XXHB 2C9OA 1GDDA 2C78A 3DM9B 2QE7A 4BFWA 1KMQA 3T1QA 1JNYA 2ZM5A 4Q4HB 1W5SA 1RJ9A 1OV4A 3I32A 4XWAA 3LNCA 3UANA 5TDHA 1XXHE 3PUZA 4CYMA 2ZS8A 2OFXA 1EX7A 3CX8A 5CB6A 3U3KA 4HB4A 2CK3D 1UBCA 4WBSA 2RGCA 4TMKA 3B85A 4HDOB 2RHMA 3PIRA 5DN6A 2J0SA 3CR7A 3GLIA 2HCJB 1KDPA 4BE7B 1XEXB 1E3MA 1LY1A 3EAQA 1XMJA 4PAOA 3RAPR 5DN6D 4P33A 4ZI2A 2FDCA 3B1ZA 2QQEA 5DLQC 2J0QA 2O8DB 3FMPB 2GK7A 2Z43A 1F5NA 1PUJA 2N1BA 1Y63A 2YVUA 2IYUA 2BJVA 4RZ2A 1PJRA 3B1XA 1XD8A 4Q1AA 4ABYA 3THXA 1G41A 3HWSA 3AVVA 3A1VA 1NN5A 3PUYA 3U7HB 3ZZ0A 1FX0A 4BGDA 2ORWA 3BE4A 4LX0A 4JLVA 2H1LA 3GLGB 3KTAA 4B2PA 4Y0AA 1FUKA 1W2HA 5IDVA 3WXMA 1DPFA 1YR6A 3R7WA 3E2IA 2O8BA 4PSAA 1U0LA 4MUBA 5CYPA 3X1XA 4IDOA 4Q1CA 3W6OA 4NBSA 2WMNB 5CK4A 1E0JA 1Q3HA 1WA5A 2D62A 1A7JA 4Z54A 5J4HA 1U9IA 5AUNB 1E6CA 3HJNA 1KI6A 4KITB 2D74A 1CXZA 1P73A 4LGMA 3SE0A 3BH6A 1G8GA 3EZ2A 2OXCA 1OH7A 3RLFA 4A0RA 4LC1A 1YZUA 1GTVA 1VHTA 5FOSA 4LYJA 4XVRA 3SBDA 1Q1QA 1Q44A 2LWIA 4J0QA 2ZRCA 4QC2A 1A1VA 2HLDD 4RZUA 1FTNA 4EQ6B 3EPKA 4TYWA 5EUQB 1R7RA 1CR2A 1R4AA 5GJCA 5JHHB 3I8SA 2JLZA 1VG8A 2ZRHA 3KUDA 4OI0A 2WKPA 4NYMR 4QNRA 2BMEA 3SFZA 2NMVA 2FSHA 3U7FB 2FFQA 2ONKA 2BMJA 1YQTA 1JJ7A 1RYHA 4ZKEA 4LBVA 2H8KA 3QF7A 2IXFA 3B9PA 3JVUA 2O8CA 4YDSA 4DWJA 1E2DA 5CIWA 4B2IA 4AWXA 3KQLA 4KFUA 5FOTA 2XITA 4TQ9A 2R65A 1OT3A 1IONA 1NVWQ 3B13B 3LBNA 1UFQA 3AF2A 4L5BA 4U5XA 2RGDA 3OIUA 5JRJA 4TQUS 2A7QA 3BS4A 1X1RA 2FG5A 2P2LA 5AUPB 3AGQA 2C96A 4DLRA 1AGPA 2YC4C 1XD2A 4IVQA 3ZZUA 3NDBB 3BB3A 3QF4B 1TF5A 1S8FA 2HCBA 2QEQA 3GEEA 4KSBA 4DCTA 3GLFE 3F3YA 4QBGB 1US8B 3L0PA 3KQNA 4OHYA 1KY2A 5E7JA 4C0LA 1ZNZA 5IF9A 4DLVA 4Q4JB 4NPHA 3C41J 3RSLA 3UG7A 2I4IA 4YXWA 4ACAA 3FWYA 4Q4JA 2FOLA 4RKEA 1R2QA 4C0HA 4AYTA 621PA 5JS8A 1YVDA 3MAAC 1GP2A 3MWLA 2OCAA 2RH5A 2RMKA 5A4JA 2B8TA 4A6XA 4DRZA 1LW7A 2BMFA 4FMBB 4L16A 3UK6A 2IS2A 2Q9CA 1ZNYA 1B0UA 2EW1A 5H68A 1HEIA 1G1MA 4AURA 3NG1A 5BN4A 1KJZA 1E2KA 4JL8A 1R0WA 4H1VA 4JZKA 3R8FA 2AK3A 5FR1A 4LJ4A 4JMPA 4E5UA 1W0JD 3L43A 4X8HA 4BRWA 2OT3B 2QP4A 3UIEA 5K8IA 2NGRA 1Z3IX 5FTKA 2IF2A 5C46F 1G64A 4BZQA 2GXUA 2PT5A 1ZW6A 4RY2A 5J47A 3LXRA 3OAAD 5KPJA 2ZQ5A 1KK3A 1IN8A 1A4RA 2PEZA 3VTKA 1IN5A 5HKKD 5JS7A 2AKYA 4W5HA 4Q9HA 3DDCA 4LK2A 1JPJA 4HB2A 1EFRD 4DJTA 3NKVA 1AQUA 3VR3A 2X77A 3KX2A 2CVHA 3BH0A 5FI1B 2R6FA 1OIVA 2CNWD 2XNSA 2PMDA 2YKGA 1LVGA 2PCJA 1ZM9A 3LVQE 5C2JB 1XB2A 3SOPA 3BK7A 1KY3A 3AV0B 1VECA 4HAUA 1V5WA 2FEMA 3KXIA 2WJIA 1KSHA 2E87A 2XB2A 2J7PD 4JBWA 3KQUA 2BJWA 4Q21A 3U5ZB 1BKDR 1G6OA 4Q5IA 1FW6A 4B73A 2ZYVX 1GWNA 4DSTA 4HB3A 2A5GA 2YYZA 1Z6YA 1VCMA 2V6JA 4MITA 4RZ3A 3X1DA 1N6HA 2CHGA 2VPPA 3ECCA 3TKLA 2KWIA 4PHFA 1SKYE 4PPGA 5JBQA 3VKHA 2X2FA 2IYXA 1J7KA 1JI0A 3RRZA 2OBNA 1Q20A 1FMJA 4TYPA 1F2TA 4GMXA 3E5HA 1E98A 2IW3A 4NE2A 3ONWA 3Q7PA 1F2TB 4DSNA 2Q9BA 3QJYA 3NH6A 4AIIA 1QG4A 2PX0A 2CVFA 4DIDA 4ZIRB 1SZPA 3OIWA 3TIFA 4A92A 3WP1B 4BASA 2EFEB 4A0HA 3VNVA 1D9XA 2ZJZA 1G5RA 3RS7A 1EFUA 3MUFA 2O8DA 3CLVA 2KBFA 4RD0A 3WMGA 4Q7KA 2GRJA 4TMWA 1DG3A 4QJ4A 4JSYA 2ZJ2A 1MV5A 1PLKA 1AKEA 1QF9A 3K09C 3TUJC 2BKEA 4TLBA 3GLIB 4ON9A 4XSGA 1WRBA 2ODEA 4MQBA 2QU8A 3AQ4A 2AR7A 3RC8A 1AZSC 2FSIA 1TF7A 4IVPA 3IQXA 3BJIC 3MFYA 4D6PA 2WWGA 1IAQA 1OH5A 3UMSA 3TK1A 1T6NA 1P3JA 2ZROA 2CCGA 2RB4A 4UNSA 4BFYA 3LO5A 3PEYA 1T5LA 1UF9A 2F9MA 1GKIA 4RVCA 1CBUA 5DHFA 1TUIA 5CK5A 1W4RA 3U2QA 1CF4A 3OIYA 1AA9A 1R5NA 1UKVY 4DSOA 5FH9A 1KZ7B 1OXXK 3IHWA 3WBJA 5JECA 4HAVA 3K9NA 3I8XA 2OCBA 3LX5A 3MGCA 3HR7A 1XFAA 3GJ8A 1II9A 2CBZA 1FQJA 2CDNA 2NO6A 3OESA 4BWYA 1XP8A 3H1TA 1OJLA 5L3VA 2X19A 1COWA 1RE0A 5JMTA 4UJ3A 4B32A 3I61A 1II8A 3CRMA 1Q3TA 1U98A 1Z6XA 1ANKA 1R5OA 2Q0HA 3KXKA 2XOKD 3NEYA 4PQRA 3W8RA 4OHZA 1E4YA 1ESNA 2C5LA 1GNQA 4IXMA 4ZDKA 2XZOA 1GM5A 3KJHA 4V03A 4V0LA 5L3QB 1HE8B 4DDTA 1MH1A 3KDSE 3MJHA 3TW8B 2BKUA 1JJVA 1TX4B 2KSQA 3AKEA 3ND9A 5BYJA 2DFTA 4DUGA 1KI4A 4RSGA 4C3ZA 2CHQA 1R0YA 5L3SB 2QTFA 2DFNA 1F2UA 1JXOA 4I1OA 1DAHA 3CRW1 1GFIA 2WWHA 1VTKA 3V4RA 2RHDA 1A82A 3KJGA 1N25A 4JJZA 4TYNA 4IKEA 4A4DA 3ZD7A 3ZQJA 5G40A 1US8A 2QAGB 5DE3A 4QGGA 2O8EB 4TL8A 3ZJYA 2GJKA 2ZAOA 2WICA 2AXNA 5F98A 1TPZA 5J5CA 1Z5ZA 4O2LA 4PO1A 4S35A 4US1R 5KDOA 4OK5A 2Z5FA 3NH9A 2QTVB 3OE7A 2JJ2D 4OJQA 2ZE6A 4MA4A 4EIWA 2G0NA 1Q0UA 1E2HA 4IDHA 4NZYA 1TUEA 5AJXA 2J9RA 2ZETA 3K1JA 2EU8A 4NMMA 2G0TA 2QBYA 4W5JA 3U7GA 2WSSD 5E7IA 4NDZA 3REFA 2B7BA 1N5KA 3SN6A 2QY9A 5FUXA 3C5CA 4HZUA 1E32A 2GZHA 3CRQA 3BB1A 5FPHA 3ZQ6A 1J70A 1ZU5A 4QHSA 4POAA 3ADBA 3CH4B 1GRRA 4OK6A 5DISB 3Q8XB 1P9RA 1GNRA 4MYTA 1XEFA 4EJSB 2QN6A 5EZ5A 1ZNWA 1G3MA 3K0EA 5TV2A 1JEDA 4BEJA 2REXB 2GJ9A 1HYQA 4DT1B 4RD1A 4NCNA 4A2PA 3IQWA 4C4PA 1NVUQ 4H9GA 1WBBA 3K53A 1PUIA 2Z0MA 4GL2A 3BGWA 4CIDA 2F1JA 3CNNA 4KYIB 4TMTA 2P0EA 5EXTA 1OLOA 1IBRA 1Q1BA 3ZH9B 1F2UB 4C2UA 4BFTA 2UKDA 4H1UA 2CMKA 1D2NA 3TSWA 5JI2E 1HE1C 3A4MA 3PENA 3GLFB 3U7EB 4D4MA 5L3QA 3FYHA 4D4KA 1O87A 2HEIA 5EXPA 5KNBA 3EC1A 3IPYA 3CKLA 2VBCA 3PUWA 1T0JB 1YJ5A 2ZJBA 2KI5A 1RRGA 5EP1A 1LFDB 3W8NA 2QAGC 3I3SR 3GLIE 4UXIA 1G8YA 1VPLA 1S96A 5G3ZA 4F4JA 1XPUA 1MABA 1CULC 5J4LA 2PZGA 1PLJA 1ZP6A 4PANA 4BLTA 3CWZA 1M2OB 1IXSB 1D2MA 1KSGA 4MGKR 3U3MA 2IYVA 1L7VC 2QMOA 1HTWA 4IDQA 3TE6A 1G8HA 5J40A 2JLXA 2VHTA 2WOJA 2RGNA 5SZHB 4C0AC 5LPNA 1N6IA 1GKYA 3TSZA 2IEYA 2K5UA 2I3BA 3NEJA 2J7KA 2QQ0A 4ASUD 1VCOA 5B57C 2YWFA 1AS2A 4FMDB 1KK2A 4UXJA 1KO8A 2ZAMA 1QVRA 2GF0A 1QHHA 4JS0A 3T34A 1OW3B 1A5TA 3CWQA 4JVLA 2I1QA 1EESA 1H8ED 3HP1A 4IJMA 1IOZA 3DMDA 1A2BA 2VSOA 4IXNA 4S2EA 2GKSA 4DLYA 2ZJ5A 2WIBA 1DADA 3AUYA 2OXRA 2EFGA 3DMNA 2HYIC 1Q22A 1Q57A 2DBYA 3GJXC 2FU5C 3EIQA 4X8MA 3LDAA 3P4XA 2ZS7A 5D3MA 1T5IA 1W2GA 3WMFA 1WF3A 1H8HD 4NHOA 1ZNXA 2GWHA 1KKMA 4MRPA 1KK0A 5D3QA 1BYUA 4CEHA 2VF8A 3WMEA 4KHZA 3ZGXA 3LFUA 2DWPA 4HDQB 1VDZA 3L0OA 4B35A 4TT3A 1TEXA 5K8TA 2XAUA 4KYUA 2XZLA 1HT1E 1BOFA 2OLKA 4QL3A 1E1QD 1Z6AA 1ZU4A 2EFDB 3OF5A 3HPRA 3KFVA 3VKWA 3WRXC 1WP9A 3JZMA 1YR8A 2QA5A 3DM5A 3RSOA 2ECKA 3QXHA 4JLJA 4L9WA 3TVDA 2QT1A 1JECA 4ITRC 5KSYA 2CLSA 4B76A 1N6KA 3EIHA 1DEKA 1Z0AA 2PZEA 3B8HA 2P67A 3ZDQA 4B3CA 2F3RA 2C2HA 3DKVA 1KIMA 2VHQA 4URZR 3QY0A 1OXUA 2NOAA 1P7CA 3H86A 3IEUA 3ZD6A 2V7QD 1Z0JA 2ATVA 2EWVA 5JWRA 1VYTA 4DLTA 3AB3A 4LZZA 1Z8FA 5DI3A 3QE0A 4MDEA 1U94A 2P65A 4P4SA 5BQ5A 2YOHA 1V43A 4K8OA 4M1WA 3T5GA 2EFCB 5BXQC 1QHGA 1AKYA 1ZINA 2WAYA 4HZIA 4M22A 3VAAA 1TU3A 4A82A 4LJAA 1ZD9A 3RABA 4HZUB 2JA1A 3TBKA 1XWIA 3VQTA 3ASZA 3N70A 4DB4A 4QM6A 2W2VA 1ZUIA 1TMKA 2CCJA 3AKDA 4P4UA 2DYKA 2DCUA 2QZ4A 2WVJA 3CF6R 3SYNA 4UNRA 4GT1A 4DBLC 4G01B 2YWEA 1G3IA 5HTKA 1OFHA 5D3MB 3X1ZA 1G3UA 1L8QA 4I1VA 2D7CA 1ZIOA 1W49A 4LJ9A 1E9AA 3IIJA 2F6RA 2FZ4A 2QT0A 4A0FA 2RGXA 1I2MA 1UBEA 4HUTA 3EZ6A 1KK1A 2VSXA 1TL7C 4Q4AB 1UKZA 5G53C 3U4QA 2ZI9A 3GPLA 4XH9B 1IM2A 1NBMA 4G5RA 4AK9A 3GP8A 4OI4A 1QBKC 1TADA 1N6OA 2GEDA 2WHXA 2XSZA 3JVVA 1OYYA 3ND8A 2IHBA 5SZKB 1AS0A 4NONA 2PZFA 3SDZA 4NKRA 3SI7A 5KSPA 4DDVA 2PT7A 3K0CC 1SXJC 1XTJA 1EGAA 3HU2A 4XOIA 4EPXA 1P72A 5JWOA 1YRAA 2F9LA 3RWOA 4PR0A 2CL6X 4GSYA 4LYAA 1TQDA 3AEZA 4OQFA 1JPNA 1G5PA 1W44A 1SHZA 3MMPA 3CH5A 3U61B 2OAQ1 1YE8A 2ZE7A 3CZPA 1P2UA 4RD6A 1JR3E 4ILEA 4ZDWA 2VL7A 3ETLA 4PHHA 1PV4A 4ASUA 3K0FA 4MKIA 5EUMA 4KODA 3ZVRA 1F3OA 1KHTA 2O0JA 3GFTA 4Q01A 1ZM3A 4PC3A 4NYJQ 3NBZC 5DIFA 1E2EA 1MO6A 2UZ3A 1G4UR 5FTMA 2O8CB 1Z2AA 4DXAA 2QM7A 1KAGA 1N6LA 1DAEA 1ZIPA 2B21A 4I1UA 2IYRA 2R6AA 3K0FB 1WDTA 3CRVA 521PA 3MG9A 1KI1A 4RKFA 4B47A 2WBLC 3HU1A 1ETUA 4B6EA 3GLFA 1K5DA 3ADDA 1NI3A 4BLPA 1JEEA 3SYLA 1K5GA 2FF7A 4JSTA 1I2DA 1LV7A 3VU9A 3FHTA 3H84A 2IX3A 2OG2A 3QOFA 4EQ6A 5CYOA 4M0LA 3I5YA 1ZD1A 3L0SA 3OE7D 5UKDA 1OSNA 4MRSA 2VLIA 3THOA 1W4AA 4OBEA 5JEDA 3OEHD 3LLUA 3AVWA 3KFXA 4IFEA 1CJMA 5AJYA 1CJVC 3NBFA 1KI6B 1CLUA 2OAP1 3LRPA 4UNNA 1Z0FA 5LD2B 2WJGA 4LV5B 3CNLA 2PLRA 2NG1A 3BERA 1N6NA 3KKOA 4F7WA 5F2EA 2W0SA 5FTJA 4WA7A 2WIAA 1CU1A 1L2TA 2OM2A 1FNNA 3ZYCA 3P27A 1ZM4A 2GILA 1OHHA 2ODBA 1DE0A 4QXAA 4R2IA 2FNAA 4IOMA 3KJIA 4NTZA 2GJ8A 1TQ6A 4DCNA 2QRNA 4KJZA 1E9CA 4ESVA 1BMFA 1NY5A 2BV3A 4CT5A 2IHYA 2HV8A 2V9PA 3CF2A 1CRPA 2NO7A 2WWFA 1F6BA 4Q00A 4EAQA 3CX7A 3QXJA 3D3QA 4EPVA 5JI3E 1YZNA 3MWYW 2QGZA 1LF5A 1Z6GA 1SVWA 4F4CA 4EFLA 1R6BX 4IOLA 421PA 2CCKA 2ZRBA 2QAGA 3FTQA 4Q18A 1P61B 2ZREA 4UQOA 3FKSA 3BOSA 3LX8A 3C15C 4DSUA 1VYUA 4M21A 1U90A 4DZZA 4B44A 1W46A 2P6NA 2RGAA 4QFMA 3TMKA 2R8RA 1SVSA 3EG5A 3X1YA 1PVOA 4URVR 1S4QA 2WZQA 2Q9AA 4LJYA 1HURA 5C4GB 1GL7A 4TWZA 2P5SA 2OESA 2QM8A 2BM1A 2H92A 5KTYA 3RS4A 1C9KA 4Z51A 1P4SA 4LJ5A 1WQ1R 2NO1A 2O8FB 4G1UC 1QG2A 3VMFA 1NIJA 2OO7A 3OEHA 4HEJA 1G9XA 1QHNA 2JDIA 1AN0A 4E03A 2EYUA 4DCVA 1XD9A 3THWB 2NIPA 1E99A 1YHNA 3HU3A 4JLOA 1NY6A 1Q1EA 3GFPA 1ELOA 1G7TA 4FMCB 4G0NA 2VSFA 2QL6A 5DI9A 4JLBA 4BFSA 3EA5A 3GJ5A 1GSIA 4XWOA 5LD2C 3SC3A 3I92A 3AF4A 2Q3HA 1ZRHA 1NKTA 1YKSA 5KPDA 2Z4SA 2DHRA 3T1VA 2Q3FA 4U00A 3A4NA 2XNDA 4JT2A 4D25A 4U02A 3CB4A 3FFBA 4B34A 1SXJA 4URYR 3TW4A 4QHYA 2H18A 2IUSA 2OUKA 4LHXA 1NLZA 2ZRKA 4FCWA 1W7AA 4HAWA 221PA 1NIPA 3K70D 2GZAA 3CR8A 4IW3B 1XRJA 2J46A 2QNRA 3O8BA 3T1OA 4B3FX 5JCZA 1G21E 1WBDA 3I73A 4JLAA 3AVXA 1G7RA 4JL6A 3TGPA 4NCIA 2ZANA 1KTVA 5FTNA 1MABB 4KBGA 2ZI3A 2Q3MA 1ZJ6A 3AGPA 3QPWA 4L9SA 2QSYA 2ZRDA 4MRVA 3B9QA 4JLNA 4TL6A 5DHAA 1M8PA 3P26A 4NYIQ 4PX9A 2OHFA 3SJAA 5TMPA 1CEEA 1GRQA 2ZI5A 4BFVA 3TUIC 4OHWA 3TNFA 1VIAA 2IWHA 2ZSBA 2DPXA 1S2MA 3I4LA 1S1MA 3I62A 1P6XA 1AZTA 3BORA 3ADCA 3I5XA 5FFMA 1MO4A
chains in the Genus database with same CATH superfamily
4UBOA 1AF7A 2VHWA 4W1QA 1N5RA 4MRRA 4EO4A 1KC1A 1KEEA 2QTZA 5TF4A 3ME5A 1QX4A 3BZBA 3V2HA 1NX9A 4HLUC 5JTUA 3JASB 2GK6A 2WJYA 4FHDA 1T2CA 3RVPA 1UZUA 4QBHA 5IFLA 3FSJX 3QNUA 1LU9A 1Z08A 2HWKA 4RQBA 4IIEA 5JNLA 4IJUA 4V0RA 1Q83A 1UBOS 5H02A 4YUWA 1E9BA 1UQUA 1LW6E 2DVMA 1YUNA 2X9LA 1BS2A 3Q2IA 3GBSA 1XA3A 1SD1A 1K27A 4A8JC 2WKRA 2E37A 1FYEA 4DLWA 1OZ0A 2HQBA 3Q85A 4PYNA 1Z25A 2FSUA 1W25A 5KAMA 3RVMA 3RWBA 3TECE 2KM1A 1JQAA 3W2HA 5KCZA 3QQPA 5IYZB 2UZIR 3KOXA 3PRJA 5IYZA 3KSUA 4PE5B 1GCAA 4XE5A 1IZYA 3ZTWA 3UK2A 1MAVA 1I94B 1MB9A 3D7SA 4LTMA 821PA 1NVFA 1Y9EA 4GGMX 4F9EA 3NAGA 1OHHD 3LWBA 1AUQA 4I50A 3DB1A 3QTBA 3UUFA 3ZJ4A 3ZU3A 5JBNA 3HHPA 5AJVB 3L6EA 5EP2A 1FFBA 2CJPA 1JAHA 3AY0A 2B2CA 3IPXA 3C1OA 3LV8A 5CIQA 4HB0A 1NN1A 1JXMA 2IRWA 1OMOA 4ZOLF 4N0DA 1NUQA 3AXSA 1IBMB 2H52A 1ODKA 2NSJA 3E7PA 3RI3A 1UJ4A 1LJ8A 3GT0A 4E22A 2R751 1G9SA 2HCTA 1Z7GA 2HIAA 1J07A 3OM0A 4HVLA 2DOKA 1C30B 1P2SA 2XHZA 4OQLA 1X3SA 1SAYA 4JOSA 3N8IA 3VDXA 1NXVA 1W34A 5EAIA 5ALTA 3N2YA 3K8QA 2EJWA 3B1WA 2GPSA 2A4MA 2ETXA 2PXCA 2ZRPA 4OU5A 4H1HA 4V2IA 3BCUA 2BBTA 4V39A 3WI7A 2WB2A 4BFXA 3U4AA 4B75A 5K3BA 3HZHA 3MYYA 1Q2XA 1TM5E 3LT4A 4MEAA 4NZOA 3VGPA 5K8UA 4TSRA 2R6DA 3EIEA 2DTXA 4M1KA 2IWRA 1CUVA 5IEJA 5FL7A 2ZIUB 2QSJA 1QDEA 5H8WA 2VDVE 3KU4A 4CDNA 1IBSA 2VEDA 4REOA 2PMWB 2AC7A 2ENUA 1QRSA 1UKYA 2NO0A 4MGYR 4B1FA 3OO0A 2NUTB 3JZDA 3E3NA 2Q2OA 5FL7D 4Q12A 3KOWA 2GXQA 3JRXA 3M83A 3ZY3A 4CIVA 1G8SA 4BRZA 5BN5B 1EP2B 1LBIA 2Q5LA 1KJYA 2DWCA 2A6PA 5H4HA 2W8BB 1Z22A 1O9HA 2QGNA 4MEBA 4K40A 1N32B 3JQDA 4PRZA 1ZAYA 2BOVA 5DULA 4ZO4A 4HTAA 2GEVA 4Q3AA 4BFUA 3K73O 3UEOA 1E94E 2C7BA 4KXQA 2FE4A 3ZHSA 1X7WB 1RI5A 1S9DA 4D2IA 2P35A 1SD5A 2JFZA 1PHRA 4Y1RA 4I1IA 2GCOA 1HL3A 1NATA 1U1FA 1P5HA 4NZ9A 3UT5A 1QORA 1ZH0A 4HGQA 1USWA 2QTNA 3T7IA 3VR6H 1E6WA 3R0IA 4QTXA 4F60A 1TI7A 1ZXXA 3EOZA 3ITEA 2N42A 1VL5A 3HCCA 3HN7A 3EFBA 3EIWA 3IT2A 4NE7A 2C95A 3ZIUA 1LZKA 3DFUA 8ADHA 1XCMA 3T9CA 4K3VA 3QG1A 4WXEA 1E1QA 5CDSA 1EQ2A 4IZHA 3KETA 2IXAA 3PF9A 4HG2A 1T1GA 4IDGA 4OGLA 1RFGE 3ZIAA 1ECBA 5HHTA 1TRKA 1QC5B 1M54A 3IMEA 4YI5A 2VKQA 1ZCZA 4CR7A 1W5BA 2VNSA 2ZSJA 3LBHA 3PGMA 2UUAB 3AJ9A 2W00A 2CVZA 2PKYX 2WWWA 2V55B 4I55A 5F1KA 1FTSA 5TQ2B 1U3CA 1EK0A 5D01A 1M2VB 2ZBUA 5BP7A 1PVVA 4ENUA 2ZULA 3X2FA 5IC5A 3CPJB 1W0KA 1SN7A 2TSYB 1TQHA 3FNHA 5FOXA 1NVBA 3RREA 2ID8A 1JN0A 1XTKA 2FTKE 1HNXB 2Y6UA 3AUXA 5FP0A 1QVVA 5IP5A 4B6PA 1Z2EA 3QPVA 3LDHA 1EXDA 1W0KD 1ONSA 1IEQA 1K97A 2DHEA 3NTVA 3AJAA 4X1YB 1XELA 5DZSA 3SY8A 4RGQA 4NMHA 4XWKA 3ZHVA 4YCDA 1MEEA 2GD6A 5G1NA 1CUGA 1V8BA 1DJMA 1D1TA 2VP5A 3TRHA 7REQA 5AI5A 3H0EA 4Z2YA 5KS2A 4IKOA 4O2AB 1P4JA 2OGWA 3UJBA 5LQNA 2YS7A 1J22A 1QH1B 4A2WA 3L8HA 4C0XA 3GG9A 2O8BB 2PUJA 3G2KA 4HDNA 1VI2A 5A3SA 5HZKA 4LYFA 3BRSA 3D7MA 2M1XA 2QORA 2C92A 3IJ5A 1G7CA 3UJ3X 2VHZA 1R6VA 4TLEA 3X43A 3MS4A 2YOFA 2I1LA 1XZCA 2QV0A 4D0RA 3A3YA 1X42A 2F43A 3NASA 4ZCPA 1SWVA 5H5JA 3A70A 3ACDA 2V6FA 1KO4A 1N5IA 1ONBA 1WXIA 4HFMA 4UMDA 3RHZA 1ZZGA 3WIDA 5A03A 3AVOA 4IMPA 2DPHA 2ZS9A 5HM6A 2IYTA 3SNHA 4N65A 2VCHA 3P0EA 1YZQA 2Z4TA 3QITA 3KYCB 3UWSA 2XBLA 4F1KA 3UAOA 1O77A 4WXHA 3RROA 4ZV9A 3VR1A 2HH9A 2WJVA 3K05A 2XDQB 1XRNA 3DEJA 3LFHA 4TVBA 3VU0A 2O19A 3I2JA 4GL4A 3ZZTA 1GTL1 2HHLA 4J90A 4UFOA 5EIWA 1OZHA 4N8DA 5J63A 3GARA 2WWIA 4PCAA 3R74A 4MMYB 1LDBA 1NFRA 2AOTB 1FTYA 3ZG6A 3QYAA 3QLTA 1G6HA 3AHHA 1KNXA 2QXTA 1XCGB 3WY9A 2AV6A 1Z5PA 5FBWB 1QH8B 3SYKA 1R9GA 4EABA 4TSFA 3IUBA 5J43A 2IYWA 4IMIB 1J8QA 4Q03A 2XQFA 1G8MA 3ESCA 4RO0A 4S12A 4M83A 3PFBA 4DL9A 5GIPE 3EVAA 2PJRA 1JR6A 2Q1TA 2F7SA 1W9HA 3FROA 4D0NA 4YBRA 3ZGOA 4AQ7A 4AP5A 2MYPA 5HFAA 1NQXA 5L3ZA 3ZVLA 3T54A 1DC3A 2XUAA 3AU9A 4E3ZA 5KNBD 1KTIA 4QLOA 3VPDA 3HCDA 1SH7A 3EQZA 3SC2A 2XRZA 1JIJA 3CPEA 2NM0A 2LZ0A 1L4MA 5KVSA 4E13A 1I5OA 1OAAA 2BE9A 2RCNA 3VOAA 1DAFA 121PA 1PR3A 4PG5A 4XJVA 3SX0A 2X58A 5LVAA 3D6AA 4Q93A 4WOPA 2G80A 5DCUA 4C7XA 3W5BA 4L08A 3K5PA 2P3OA 2WU4A 3JZAA 1F1BA 3LIPA 4CCSA 5C5DA 4J49A 4EKDA 4A91A 5TEVA 3DTTA 3PQ8A 3QPUA 4RQUA 1RKUA 3R09A 4O4IF 4TLLB 2RGNC 3LG2A 3MB5A 4ZDIA 3OA2A 5T3UA 4QRDA 3MYRA 1XDZA 4G5SA 5JG7A 4EHBA 3IQHX 5E0OA 4QXPA 4RHXA 2I4LA 1K4KA 1Y6QA 2OWDA 1ZK4A 1F2VA 3U4GA 3CGWA 1I32A 1A5SB 1U2GC 3NM6B 3PSAA 2C29D 3PR1A 3U16A 2CNLA 3BGVA 2XCQA 1VKNA 2HT6A 4EY6A 3B5EA 3E8SA 2YL2A 5KWJA 3MLBA 2C04A 1Y98A 3LRTA 1KAEA 2PWZA 2PX6A 7MHTA 2OOSA 5CEEA 4E5DA 2B8JA 1JHMA 3ZXSA 4G0MA 1HYBA 1JG3A 2Q4RA 5CU7A 4YAKA 1MC5A 3NTXA 3REGA 3VR5D 2JLRA 2VZ9A 5AJHA 1Z5VA 2VYNA 5AM5A 2O59A 5CDUA 4ZHQB 4HDKA 2ECQA 4QRIA 3NYIA 1SZDA 3U5TA 5E38A 4R8RA 3CT6A 4QTZA 1ZH2A 3KHKA 1XZBA 2PA3A 2QIOA 2FMFA 2Q99A 4E5SA 3CONA 3OBIA 4EJSA 3W4IA 2YV4A 2UUPA 3D02A 4ADSG 3NPMA 1A9XB 3SQNA 3GMTA 4TGLA 5J4VA 3C3MA 4MV6A 4NR0A 1RJFA 4YMTA 2ZB2A 3BIFA 3SHQA 1Z74A 2ZJOA 3QUTA 3RC2A 2WW8A 3PUXA 5AICA 5EEHA 3JWGA 4Q9LA 2Q27A 3DKRA 3VR3D 4B8WA 2NQ2C 3RUDA 1QNLA 1QZ3A 2C3UA 3HXQA 5EZ6B 3RH0A 1IK4A 2YRFA 1N5JA 4EPTA 1NPTO 2Y9PB 2P6RA 4ATNA 1XCLA 5JXJA 2P9BA 3KUCA 1T1SA 1NI5A 3GGSA 4M36A 2NU8A 3LCUA 1NBMD 4LQCA 5SY4A 2OP0A 4O6VA 1VXRA 5ICFA 1GZHB 2BKVA 1L5VA 4OFXA 4TV8A 4M6WB 1I4WA 4P4LA 1SZCA 4US0R 5IJAA 3SM3A 3JYQA 2Y2UA 3RU2A 4TX1A 1HFJA 3FCSB 3DLAA 3TRFA 1DARA 1LA2A 1P9NA 1R9NA 1THZA 1YASA 2B7LA 1WY5A 2YV3A 3A3NA 3AUTA 4KL8S 1R0BA 4TTRA 1EUCB 3NVAA 1GITA 2B9VA 3BWDD 3EXEA 1VE6A 3OZUA 3VYRB 1NXSA 2UVPA 3G5AA 3ZWBA 1YBMA 2FPUA 4RTRA 1JJFA 2AN9A 3MJEA 4NU0A 3VXKA 3U09A 3IUMA 2H65A 4YV7A 2AH5A 1Z4PX 1C7JA 1W36B 5EKSA 4JYAB 2DKFA 1MOZA 5FD8A 3VO2A 2M1ZA 1Z39A 1I1OA 2R44A 3NDPA 4BJ5A 4BMCA 1FNDA 3GDOA 2V54A 4KK4A 2GUWA 4ML3A 1CQPA 2CL7X 2DSTA 1Y5LA 2VTEA 2D5BA 2DKNA 2WF9A 3LH5A 4TL9A 5IUKC 5DO9A 4ZEVA 5I9TA 4XPZA 5LMUB 4QPZA 4BCBA 4HWPA 4TPKA 2O48X 1Y7TA 3OTGA 1FLNA 3WJ2A 4Y0VA 1KQGA 2RH9B 3O8OA 3QBVA 4KH0A 3WLHA 2W11A 2LCIA 4DM3A 1LK7A 4QSHA 1YC2A 2BFCA 2EAUA 2P8JA 1MOSA 3KK0A 1UMKA 4FZJA 1CIPA 1EFDN 1EVIA 3JQGB 4HBGA 1ISSA 1K8XB 5TVKA 3JQQA 1NUAA 3VVCA 4B9AA 1VG9B 2ZYWX 3GUZA 1CNMA 3EVCA 4EF6A 1U3FA 2I1VB 3RPEA 4OQNA 1U0NA 3CVUA 1P9OA 4PXAA 3UXYA 1CB0A 1NJGA 3KOMA 1PZNA 4LV8B 4BIIA 3QXSA 1WJGA 4BJ6A 3BEDA 4PZ9A 3VX4A 3GJZA 3WQQA 4KXVA 1F3LA 3BWCA 3NV9A 4NZZA 1YQDA 2OG1A 3TOSA 3R3HA 2BGRA 4MYSA 3I4CA 1OH8A 3N9IA 4J1TC 4JUFA 1VRWA 2R25B 2Z98A 3HEBA 4UJ5A 3W5CA 1UZAA 1THTA 2WYOA 4HYTA 1QGUB 2F8LA 4W5QA 5IVKA 1O6GA 2EFYA 2JBAB 1IWPB 4ZI7F 1QR2A 1X1DA 1CQWA 1DEAA 3S2UA 1RE1A 2HJWA 5EIXA 2VHEA 5KYNA 3MLEA 1QFJA 3PLAE 1UWVA 1SBYA 2MMGA 1N7JA 2R8BA 3Q10A 1EUZA 3B89A 3GFBA 3UHOA 1AO3A 4Q4CA 3AR6A 4RE5A 1W0JA 3RU7A 4EFMA 2EYQA 1L5HB 2JLYA 1K0UA 5EA2A 1E1YA 1Z0SA 3H2SA 1DRWA 3LFTA 5DWVA 4IGFA 3GLTA 5I7EA 5JIBA 3MRTA 2K7FA 1MZVA 3TH5A 1U8AA 4TM8A 1A0OA 2OCYC 3M0EA 1JZQA 2F64A 1BE8A 1AM4D 1OTXA 1S4MA 3NGXA 4F4IA 4KE9A 1GIAA 4HAZA 1RWQA 5CHEA 3SYRA 3BRWD 4UUOA 1K9VF 3RIEA 3Q3IA 3V8BA 1N5MA 4F3RA 4G81A 4EG3A 5IHPA 2C0CA 2E55A 4K5QA 8MHTA 3YASA 3NHMA 3IP3A 4TTPA 5EWJB 3JD1A 2BFDB 2OBBA 1MQSA 2Q8QA 1G4HA 3ESQA 3KZMA 2OCGA 3OZXA 4OYLA 3JAMA 5E3HA 2E5LB 2HSZA 1W47A 4KQMA 4BLSA 1L3CA 5ITZB 4FMCF 5GP1A 3A1SA 2QI9C 2XT6A 1GZ7A 1JV2B 1M72A 4TLAA 2XGJA 4BJ1A 2GEJA 1PQPA 2BEWB 3P5BA 4PHGA 3KLOA 1Q0HA 4AKEA 4B48A 5AUOB 2QJTA 3OTWA 2GHQA 1OWOA 4HVCA 3VISA 1BRTA 1PQWA 1VFPA 2VYFA 4LSWA 4IHJB 4F45A 2W2KB 5JQGA 3HR8A 1XNJA 3S2SA 2OD7A 2ZWMA 3P2MA 3UPUA 4XIJA 5EHGA 1MT0A 2VAWA 4R6XA 1VGVA 3WJ7A 4BJHB 1ZC3A 3GLGE 3D54D 2G09A 3H2BA 4KBFA 2J33A 3FYUA 2YWRA 2IDMA 3F97A 3REQB 5DH9A 4G5OA 1MHPA 4IO1A 4XI9A 1JDSA 2OBXA 3W2IA 1Z37A 2RGYA 2FPIA 2YN4A 1GEGA 4XM2A 4KWIA 1SOAA 1U8UA 2WF8A 3Q5EA 2Z5LA 2O2XA 3RJ5A 4B3MB 4MI3A 2WF6A 3UJHA 2DM6A 1QFYA 2VKTA 3K6RA 3IR7A 4Y6SA 5EE5B 1SXPA 1MPXA 4KUHA 3OMWA 3EEOA 3RRFA 4C9BA 5HNKA 3JWPA 3Q8KA 2BELA 3F90A 3D6TB 4IZIA 1YB5A 1WUJS 4M4SA 3V1NA 1T4GA 2B7CA 2HDOA 3MJDA 1AB5A 3OPNA 3UOGA 1A8UA 4ZCIA 3OIVA 3AVYA 3KJFA 2OECA 1VJRA 4TKMA 2NAFA 4YIHA 3FYTA 5I7RA 4GM0A 2IGBA 3FPAA 1QTNA 1YACA 2FN7A 1NVVR 2VJNA 2YW9A 1M2GA 1N2CE 4RFVA 5E7MA 3V7FA 4JJ4A 1WX1A 2Q5JA 4ARVA 1N1DA 3DXYA 1PR1A 2VWHA 3PG5A 4IUCS 3A36A 3F1KA 1B42A 4JBIA 4C03A 1MC4A 1M5TA 3HYCA 4FI3F 3JTMA 2BR5A 2ZRMA 5CH3A 3NTRA 4IFBA 5AK0A 3LGAA 4TLCA 4EKGA 4FU0A 4RTPA 1RACA 1NPDA 3N2IA 2V59A 1I13A 3PGXA 3T15A 3FSGD 3KXPA 4TT8A 1W4LA 5LOVA 2ZU6A 1JNXX 1SOUA 2C83A 3LQ4A 3BD9A 4XKJA 3C74A 3FGNA 1O94A 3TOCA 1C7RA 3TIIA 3WGYA 4COOA 4EYKA 3A6DA 1NGSA 2V0CA 4BPRA 3URKA 1VLHA 1K3TA 1N5DA 4HJXA 3TE7A 2F55A 4OJNA 2GF9A 2YH2A 4JK3A 4Z9AA 3QVVA 1JZSA 3V4LA 4ARIA 2MSNA 1GGFA 5REQB 1MA3A 1NE2A 2DPMA 4M2LA 1RPZA 1E9DA 5G0SA 2QYHA 4DQKA 1TEVA 4OQYA 1GKLA 5AQEA 3C7KA 4E5PA 4MQMA 4YK7A 3TR5A 1S9HA 4KXXA 3U7RA 2QRZA 3AF1A 3UATA 4J4BA 2OK7A 3RS5A 2R60A 1BNCA 4Q9IA 4EYQA 1GR1A 3G0HA 1XPRA 3RFXA 4GPTA 4KIUA 4DUGD 3TLAA 2EV9A 1U7WA 1CR4A 2Q21A 1XKTA 1RI3A 2ZBGA 3N39C 3N8DA 2EIHA 5B58T 3W34A 3T4EA 3U3RA 5C4MA 4CDMA 3D1JA 2WIFA 4YN3A 1S3GA 1QIGA 3PQ3A 4M1YA 3QHQA 1VDMA 4NOMA 4PIVA 4X94A 3EPLA 2G9ZA 3KE8A 2A2ZA 3T38A 4IWYA 5DTMA 5HR5A 3QXCA 5GV7A 2JASA 2BAGA 2CJYA 1UXOA 1MB0A 1SA0A 1R8SA 5A3VA 2BTQB 1OB2A 2Q49A 2XE7A 3RC3A 5DGHA 2ATXA 4DHEA 2FV8A 2BFFA 2H4FA 4W9NC 2A1IA 1QOQB 3HJRA 1I4OA 3QSYA 1DOAA 4E1BA 4JCCA 1R00A 4OGFA 2WP8J 1JHRA 4DA4A 2QY6A 3GMDA 4Z1MA 4E08A 1ABEA 3CJRA 1UJ2A 4PPQA 2ZXFA 3SC4A 4G1MB 1BX0A 1VG0B 1IHOA 4C78A 5LQMA 5TIIA 2XODA 3I2GA 4UULA 5FOUA 2Q7OE 4G5FA 5JT1A 4JB2A 3BTVA 3DV0B 1T15A 2GPBA 3F71A 1PNRA 3V4OA 1DUVG 1DHTA 2C4VA 3KT3A 1EVKA 2QTBA 4NABA 2DSNA 5HRAA 4A36A 5EHNA 4BLQA 4ENRA 2FFBA 3FFAA 2F43B 4H7KA 3IUYA 4P2GA 5EHIA 1XRQA 2WINI 3TPCA 2AOWA 2VJMA 3NHAA 1KDZA 3UWKA 3A6LA 4NYMQ 3H97A 3I9KA 3KB6A 1I4EB 4TN1A 3TVTA 3VDNB 3KOUA 3HLTA 4ENWA 5DU2A 1RAAA 5LLTA 4LFAB 5BWCA 3A26A 4FFBB 4QWWA 3ROXA 3RGGA 2GVDC 1GFWA 4K81B 4M1OA 1TM1E 3IAAA 1XLTC 3TSAA 5FAKA 3DHWC 3L0BA 3OT5A 4F6CA 2IPLA 2GX6A 4H7PA 3Q2KA 1RNLA 1VSBA 3TWOA 4EDHA 3WLNA 5K0LA 4MA5A 5ELXA 1K8ZB 3DEZA 3P7MA 3DVAA 1X8KA 3TZBA 3W8EA 1J6UA 2WT4A 1PFGA 2ZATA 3Q7RA 4WASA 3WGHA 2E4XA 2SKCA 1NV8A 1VKRA 2ZSFA 3QOWA 1JLRA 3KSZO 4GI7A 3QWIA 5KJEA 1DC8A 3CQ9A 1R4NA 5T5QA 1R15A 2OFOA 4W5WA 4XDHA 3ZIAD 5HGXA 2Q46A 3AP3A 4TMXA 1GT91 1W5TA 2FDXA 1NDHA 4TTJA 4YACA 5F7ZA 4ZVSA 3STHA 2NXNA 1MXFA 2PZLA 4AJIA 1ZMXA 3HKEA 3V4VB 3T7TA 1EZZA 1HLFA 4IUBS 3JARA 2YYSA 3EH1A 1XXHA 4B83A 1KP3A 4BVJA 1MVNA 4P36A 3BMXA 1T0HB 1V71A 1BEUB 1PWYE 3CRZA 1D4ZA 4FSHA 1XZFA 4XRGA 2B4AA 3ITNA 2E9SA 1IK6A 3DDOA 2BM8A 1CPYA 4G36A 5FBHA 1GR0A 5HVNA 4TT3D 3IFSA 4MJLA 3N28A 1O96B 2BR4A 3RAEC 2FYTA 3AUKA 3PBKA 3VFDA 3MMSA 1KMHB 2YIVX 1XWWA 4OUDA 2Z95A 4P92A 4LDAA 1WAMA 1JHAA 1UJ5A 1AN9A 4P7GA 4J9VA 1N2ZA 1NT2A 3PRYA 2XBUA 2ZIGA 3ITKA 1WB6A 3BYZA 1IPEA 4HN9A 4PLHA 4CM7A 4FGKA 1TU0A 4NENB 4LISA 1ESMA 4G5YA 1YQUA 1YJBA 3DVLA 4HHEA 3DCNA 3EK2A 4MWOA 4QYSA 3V1UA 5BWLA 4BCDA 1V37A 2I6QA 2MSCB 2PD4A 5IT0A 2FWMX 3HJFA 2BGGA 1BTOA 4EZIA 1GNVA 5J9FA 4GKBA 3OAAA 3KEFA 1ZK1A 3AONB 4D82A 4BB5A 1YQWA 1UMDA 3LWNA 3HGQA 3S5UA 3EZ9A 4F92B 2JI8A 3HDTA 1OROA 3QEMB 4US2R 3V9PA 4AG5A 2HPVA 5ELMA 3JAKB 5LYYA 4DWVA 1JU9A 1EWQA 3HYTA 3NWBA 4RVOA 2AA3A 2FE1A 1SCDA 1P7PA 3GJYA 4PNZA 2Y8EA 3GV0A 5FBZA 3WK9A 1IUOA 5AKZA 5I9LA 4KTTE 3F3MA 3TXXA 4EG0A 3KEQA 3I9V6 1VL2A 4GG1A 1SCBA 3I9V1 4DMUB 3OCWA 3FAZA 3JSXA 1U0OC 1YONA 2VDNB 4KLZA 3F5MA 2E4WA 1XI2A 5JU6A 1JHZA 2QRHA 2XD4A 2JFPA 4G6ZA 2A84A 1S0UA 1AY0A 1M33A 2FFAA 2JFGA 4MVCA 2HJSA 3WQBA 3UT0A 1GTSA 3OJEA 3W1VA 2QMEA 2YOGA 3HWX1 1Y6JA 4KW7A 4LF7B 2PXXA 4P31A 4PC2A 4MNTA 1JDBB 2ZEJA 4F1WA 1E1RD 3KB2A 3QFTA 5K03A 2BDUA 4LRSB 2YXBA 5FHRA 4YJFB 2DY0A 2X6RA 1B93A 3RT1A 1G16A 1GUAA 3BHNA 3EVZA 4QOHA 3CKMA 5KJ1A 4N0MA 4I0WB 4TN5A 1ESCA 3LDGA 5AKKA 1GUYA 2HPHA 3FUUA 3O38A 4KZPA 3ETNA 3KLMX 1MAAA 4X5OA 3UQYS 2VFAA 1WKVA 1UKCA 1WD5A 1F6WA 5EMKA 2OGUA 2W37A 1N0VC 5KNDD 4DWWA 5BWOA 1ORVA 1R1DA 4S0ZA 3GAAA 5FADA 5HKBA 2Y1LA 4HRAA 1QU3A 1V7QA 2QENA 2VDWB 3H17A 1DJNA 4BQOA 1EM8A 1TVCA 5GTDA 2WPDD 3WS7A 1NRWA 5KX5B 3OVMA 1UXJA 1XEWY 1XCJA 3ES9A 1WWKA 3T7KA 1DP4A 3DKKA 1F0YA 2AWOA 2J5XA 1X7GA 5BR1A 1QPZA 4NS1A 3Q9LA 4P4TA 1GPLA 4O1MA 3KQQA 4AS2A 5C35A 1Z68A 2X2OA 3ZYZA 5TY0A 4TTVA 1OKKD 5B2ZA 2X2EA 1RKBA 1XMPA 3Q0TA 5DNEA 4DUZB 4I4TA 3JQ9C 1YQ9A 4MCAA 1QGZA 1TMGE 2QLBA 1K8RA 1DG9A 3RIMA 1Z82A 3A10A 3ZY4A 1QV6A 4ZZIA 2PBRA 3HS3A 1EZ4A 2ZR0A 5GV8A 3UBMA 3BDAA 1NF3A 3U1BA 2HMTA 4FVTA 4HGOA 4GP7A 5CJ2A 5C8XA 1RLTA 4A15A 3PGKA 1XZLA 2ZUWA 3FSGA 3OU2A 2RH4A 2YVLA 4YP5A 1LXCA 1MR3F 4D6XA 3BWXA 4RA6A 2DFPA 4EB8A 3K6KA 1D4FA 1E4VA 2BT4A 2VOEA 3C8DA 3MUEA 5HIKA 4FUTA 3ELBA 5EKXA 5JCPA 3HXKA 4JLKA 2EKZA 3HYSA 2IE0A 1EVYA 5B6JA 4XWYA 2RAFA 2QWXA 5LJLA 5LB4A 5B3JC 3WLRA 2AW3A 2I3ZA 1ECLA 2DWQA 3GC6A 4M9QA 1RIFA 1JB1A 3OLVA 4KLNA 1J8DA 3B82A 3LKZA 1BHJA 4GNKA 3VC3A 1ZBDA 5CNJA 1FBTA 2GCIA 1M0EA 3CH7A 1RM0A 3C97A 3G13A 4AMZA 3IIKA 5EINA 3Q2OA 4RJIA 4OO3A 3DLCA 4BVBA 1PFKA 1MO3A 1KHHA 3BXPA 2O4UX 5LOVB 4ZI5A 1G8JA 5LQRA 2YXNA 3OFVA 3P0IA 4OHOA 1YKFA 1ZUHA 4Q1EA 3T0IA 1IBLB 2WTMA 2RC5A 1TM3E 1CR0A 1RWBA 1SXJB 3F46A 4ZVLA 3LY5A 3V8QA 4B3SB 1AURA 1SB8A 3GUVA 3RU9A 4BO0A 4Y3UA 4C4YA 4MR7B 3W79A 1AU9A 5TGTA 4ZP1A 4TZTA 4MVJI 2BWJA 3BD6A 4OX9B 4UM7A 3T4UA 1J5XA 2H0AA 1KJ8A 1FNSA 2FJPA 1DO8A 4GDMA 5HP4A 1Y5MA 3N6XA 2IEAA 1V9CA 2WUGA 3E84A 3OE5A 3EVTA 4PFKA 4UQPA 1GGJA 3T0GA 2G83A 4BVKA 5I5EA 4E09A 3MC1A 2DFKB 2NO5A 2RK4A 3U39A 3SDBA 1R6DA 3VBEA 2AD1A 5CG1A 4LBWA 4MZDA 3VZDA 4TYYA 1P44A 5FI5A 1UMBA 5ADHA 2PVCA 2H85A 3SJ7A 5ED4A 2NZ2A 5HKLA 1WSAA 3FMOB 3RYTC 2XCIA 2Q9UA 1NSTA 2C4TA 2IPMA 4KQ6A 1G0NA 2Y4NA 2BPOA 4RZXA 3VNAA 4CZ2A 2WUVA 2OO3A 3MSXA 4G8DA 3DDZX 2AFHA 2MJLA 3PHCA 2WE7A 4ND8A 3O75A 4PZDA 1QAMA 2FGJA 4K9SA 4PYKA 4AJKA 3JARB 5BSKA 2SBTA 3VHXA 1XE3A 4FYMA 2XWSA 4N3GA 5LFAA 4MRNA 5EIHA 2D3TA 3G1WA 1P3Y1 2ORVA 5KQRA 2XTAA 3SSMA 2DBVO 4KX3A 3T3PB 3GNQA 5D84A 1U3VA 4XGNA 5K8JB 1WMDA 1MN6A 4M9RA 2IV3A 3WDLA 3ZCXA 1JHXA 4ARZB 4YMHA 1H2YA 2W98A 1DCKA 4NMWA 4QYXA 5HCIA 2HB6A 1YBAA 2CEAA 5FWYB 3ZGZA 5LQKA 1P5ZB 1O5IA 2QF7A 3D8UA 4H1TA 3WAGA 4EJ2A 2QK4A 3DLPX 4URWR 1YO6A 1TZBA 2OQ2A 3F6PA 5CM9C 2OYSA 5FL3A 4EVRA 1P1FA 4ZYUA 3I9NA 1N2BA 1T2UA 4LSGA 4PU0A 3FVVA 3BDIA 4MWSA 2GJAA 3GLFE 2R66A 3NBMA 1CE8A 1H9BA 2BCGY 3JQ6A 4H6PA 1FDUA 4BQQA 5CVUA 1C29B 2AXPA 3DAGA 2QVGA 3RVBA 5HQ3A 4C7VA 2HM7A 4K3UA 4AROA 2C9MA 4HATA 4RPKA 3M1IA 1H5NA 2O8VA 4B2LA 2XNDD 1XDWA 5ELLA 2HTFA 4D9KA 1CDDA 4KO2S 4IJWA 4CKBA 1U2TA 3X0DA 1AK2A 4NAHA 1EEXB 1XQVA 2J6HA 4IYRA 5DOVA 3UMGA 1AKUA 1XNHA 2VBGA 3FUVA 4HSEA 4GI2A 4J0GA 3LS2A 1USVA 4MWGA 3T9DA 3UK0A 4C7OB 1U5AA 2OPHA 1IXZA 3ZXXA 3JCZA 4XD2A 4YFVA 5EIBD 2G9NA 1RHJA 4BAUA 3BHIA 4MQ4A 3Q11A 4I5DA 1DVRA 2QW1A 4OQEA 3MTQA 1YFZA 1HXHA 4GSLA 2IH5A 1I0LA 1GGVA 1VG1A 3EARA 2YFYA 2YFKA 3DOEA 5LBIA 3QOXA 4H0FA 4EY3A 3I2YX 1N6RA 1XFDA 3IQFA 4CF4A 1FDVA 3RVJA 4DC9A 4A8TA 1RSZA 3R7NA 5JDCA 1HEUA 1FMLA 4WXPA 5F9HA 1ZY2A 1UK6A 4HQLA 1DCFA 5EJMA 1ICIA 5KQPA 1RZRA 5GVSA 4CEJB 3F98A 1CJTC 3ZR4B 4AG6A 3K9LA 4RQAA 2BZSA 5DEIA 4WZBE 2B3TA 5EQTA 4A1FA 1ZK0A 4CMEA 5LCXA 3FDFA 3IJEB 4B7AA 2REOA 1WUYA 1TQ8A 2F3TA 4YYZA 1IN1A 1VLZA 4HAYA 3PB3A 4J0HA 2OYCA 4WZBB 4CEIB 3BJEA 1T9HA 1Y5NA 1N0UA 1OILA 3L7IA 1YR1A 4QDUA 5CNKA 5CB8A 2WABA 4HP8A 1XMSA 4QFCA 4C6RA 2GCPA 3PFIA 1QU2A 1JSXA 2LTAA 1CR1A 3SICE 2XMDA 4BAZA 5CLLA 4YALA 4L8WB 5AJZA 4DMGA 1T3LA 2E7ZA 2B99A 3GRPA 1MENA 1PG5A 1PJSA 2J9FA 4KQHA 4O4LF 4OQXA 3SJUA 3CUEF 4CM8A 1U0JA 5LQJA 2I4NA 3TXYA 5JZOA 5EE9A 1HFEL 4EY5A 3D7NA 1GPMA 2R85A 1JDZA 4HRVA 3ZS8A 4YFYA 5TE9A 2FWBA 4HDCA 5B7PA 1H9CA 4BV9A 4YRKA 1BKSB 2FPGB 1N3BA 1U7UA 4MH0R 4DEVA 4I1SA 2H1OA 4ARCA 3OOEA 4HWTA 4IGEA 4DG5A 3B12A 3NEPX 4J8PA 1H2ZA 4OFZA 2IZ6A 1A9ZA 3FKQA 1FFYA 4PBSA 3O26A 3E1SA 3P5SA 4ZYYA 3FPKA 3I12A 2TMDA 1OI4A 5IVIA 4WOCA 1ZGHA 2J87A 1TCUA 2PSEA 1L1RA 3BRWA 4N1AA 2L19A 3TM4A 1GAEO 1F17A 4JJAA 2D2FA 1QM5A 2ST1A 3DUFA 1JGTA 1U9IC 3C1AA 5HJ7A 3BREA 3DA8A 3TGWA 1IY2A 1DQPA 1VCNA 1NM5C 4LZNA 2JFBA 4RAOA 1QHEA 2B94A 2ZRAA 1OGIA 2R3SA 4C0QC 4JGIA 1URPA 3MJSA 4AUNA 4PW0A 4UHCA 3UYKA 3FMFA 4U6SA 3QLUC 1W4CA 4AMYA 4LHWA 5IBRA 1Z4OA 4BU0A 4YMUA 4C0JA 1XSEA 2X0RA 4FK8A 3PNLA 5CA1A 4YCJA 3RSQA 2EATA 1GPBA 4X7RA 2D00A 2GRAA 3ODPA 4ETMA 5ALYA 3NWJA 3TL2A 2WYIA 2Y05A 3VZSA 4EW1A 5IZCC 1NWHA 1Z4JA 1H4QA 4JI4B 4JYBA 3SKVA 3IEKA 2G4CA 4RM2A 4XQCA 1Q0RA 1XXLA 4KNVA 1JFLA 4G4IA 1PTJA 4H7EA 1XT6A 3V1KA 2ZBRA 3KWMA 5ES3A 5I3CA 1BFDA 4CN9A 3IUQA 4UEKA 2VJYA 4UTNA 1GZVA 1KAOA 3ELDA 5IK2A 5GINE 1TFRA 4FNGA 3D6HA 1JIQA 3S8MA 1G4AE 2FEWB 13PKA 1SC9A 2H4ZA 2RC6A 2JARA 3IE0A 4ZT5A 5KVQA 3SX2A 4DRYA 2JCXA 3HHEA 2ZJAA 5FLYA 4N41A 1NMXA 1QTIA 4J3FA 3COWA 2H06A 1I6KA 1IRXA 1Z18A 2PD6A 8ABPA 1V4VA 3ANLA 5ITWA 4RZHA 3E9EA 3ZVMA 1V6AA 1M6VB 3FOAA 1RKQA 4GPEA 4JLPA 1TAGA 2C9CA 3B36A 1D04A 3GEHA 4RFSB 5AKIA 2GK3A 2C5EA 3CN9A 3ZHOA 4TMVA 3WZLA 1STOA 5CITA 1GEEA 3VBCA 4J2OA 2AFIE 1YTLA 1YFJA 1VJCA 4GOJA 2J59A 2O52A 4RMNA 6REQA 3ILHA 2W7TA 4PZAA 4XVHA 4OKSA 1Z83A 2UYYA 1AO0A 3U48A 4ND6A 2IUTA 3DVRX 2RBEA 4G0QA 3NKLA 1ITZA 1MX5A 1R5BA 2BEVB 2HJRA 2W6ID 2YVQA 3EGOA 3IHTA 4KIGA 3TLYA 3PXGA 3W5IA 4D80A 4AKHA 6GPBA 1KYTA 3GIDA 2HMYB 1A8HA 4Y6PA 2UYGA 4UEOA 4FFLA 5LZ9A 2OZPA 2C8KA 2G1JA 1G291 5AK4A 2B5WA 1D03A 4P83A 3D8NA 1W48A 3H1FA 5JHGB 3TB4A 5CYGA 1CY8A 1I3NA 2WTAA 4NJEA 1UCFA 2FWJA 3KHSA 3R23A 2I3GA 2N47A 1CDOA 2V5UA 5KDLA 1AB6A 1WCWA 3MK31 4HFJA 4DMMA 1QJ4A 5KDDA 4DQUA 2IS4A 3D4LA 4W7SA 4MICA 3BRQA 4ZPJA 2H6EA 4IH1A 1OX4B 4Y6RA 3DZJA 4EYOA 5JQWA 3THWA 5AVWA 1T9AA 4ND3A 5JFGA 1UADA 1ZH4A 3G0OA 3O95A 2LIVA 3I30X 4UBLA 4NDNE 3ZW9A 2W6PA 2Y0DA 3O8CA 1NV9A 3AI3A 4W9RA 5T4HA 1YZ3A 3LDUA 3NFYA 1V39A 4JBNA 3TLCA 1VB3A 3R3SA 3EQ6A 4LWPA 4PWZA 2HAEA 3CF4G 2XY4A 3T1QA 4KN6A 2ZM5A 4LFBB 4Q4HB 2XUKA 3KKKA 4IIFA 1OV4A 4XWAA 2PRJA 5IBQA 3FCEA 5KQMA 3PUZA 4Q34A 3V2GA 1EX7A 1PD0A 1J0DA 3MOIA 1M1NB 4QX6A 4EF5A 1TVMA 2I2FA