2ZJBA

Crystal structure of the human dmc1-m200v polymorphic variant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
258
structure length
239
Chain Sequence
b'PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQVELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
publication title Structural and functional analyses of the DMC1-M200V polymorphism found in the human population
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
total genus 60
structure length 239
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zjbA00
1BMFA 3QF4B 5HCIA 2FN4A 1FMLA 4QBFA 2AN9A 2BBSA 3ZH9B 4IOMA 5JWOA 3B78A 4B71A 4PTLA 3M0EA 221PA 3UMSA 5KNDA 2NOAA 4V03A 1JPNA 1GRRA 1PUJA 4E5UA 3UATA 1DE0A 1OJLA 2OO7A 2QUZA 4MKGA 2VIIA 4IFEA 4Q9JA 2G88A 1SVSA 4HYYA 4G5RA 1D9XA 3BFKA 2WJYA 2BIFA 4KXFB 1XEWX 4BECA 2J87A 1FW6A 3RS0A 821PA 2CNWD 3QXSA 4TYQA 2J7PA 3CWZA 3QBVA 3C5CA 1UPTA 3TAHA 3U6BA 2H57A 1T6NA 1T3HA 1S9DA 1IAQA 3C8UA 3UMFA 2GJSA 1E79A 2JIZD 2DYKA 3LQRA 2QRNA 1CBUA 1GVNB 1GKUB 1G7RA 1KSFX 1Z06A 1O3YA 4PO9A 5SZKB 3GEEA 4XVRA 3CWQA 2P67A 2VP4A 3QI2A 3L2OB 1VCIA 4Q9IA 3RSOA 4CF7A 5F98A 3B2EA 1Z63A 4P4TA 4EPVA 1DAIA 4WW0A 3P4YA 1SKQA 4RCZA 3A58B 3W6OA 2QROA 3Q9LA 4QRHA 1D9ZA 1OFTA 1RFLA 1P75A 1GUAA 2GAOA 1JI0A 2C8VA 1LF0A 1P3JA 1P6XA 2H92A 2VSXA 4FINA 4YDSA 1NRJB 3E70C 1NP6A 3EASA 4QBIA 3VMFA 3SQWA 2YOFA 3D3QA 3R9WA 5JWHA 3IHWA 4PO1A 4EJSC 1NVXQ 4URUR 1H8HD 1OHHD 2X2EA 3QE0A 4S35A 5HCNA 1KOFA 1NBMA 2ERYA 2EYQA 3CR8A 4JL8A 4LV6A 2V9PA 3PUXA 3E2IA 4AY2A 1E3MA 4TMTA 4M9ZA 3IGFA 3PEYA 3VFDA 2ORWA 3AGPA 1X8JA 5LD2B 4DCUA 1HQCA 3ZD7A 3BXZA 3OEED 4G5QA 3OFNA 4L8GA 1UKZA 2VPPA 2WHXA 2GA8A 1DVRA 1Z6YA 5ELXA 1R2QA 4YC7A 1TEXA 2SHKA 3LVRE 5P21A 2CCJA 4IW3B 3QVUA 1U81A 4B6EA 2CL0X 2E87A 4M9SA 2RH5A 4EPTA 3GLIB 1W36C 4ZCIA 2ZR7A 5FPHA 3RWOA 1E2JA 2GXAA 3GMTA 4JLKA 3CX7A 2LWIA 2O8CA 1E2HA 5AJXA 4O3MA 2ZSBA 3BORA 4BFWA 4EPYA 1W4CA 3GFTA 3WMFA 1KMHA 1YR7A 1KK1A 1PZNA 3KB2A 2IUUA 2R65A 3BS4A 4AIIA 4NL4H 1M7HA 4RFVA 4XIGS 3Q85A 2NPFA 4R9UC 1KI4A 4CW7A 3AVWA 4ZO4A 1OPXA 2IUSA 4DDTA 1QRAA 2J1LA 2PX3A 3TGPA 1COWA 4LK2A 3T1TA 3CPJB 1FL9A 3B1ZA 1P2SA 4QHYA 2XAUA 3MCAA 3C7KA 5G3ZA 1SULA 1VCNA 1T8UA 2DB3A 1XP8A 1P2TA 1EXMA 2VP0A 1Z29A 3JVVA 2IBMA 3AF3A 3K0CC 5AUNB 3PITA 1I2MA 2P5SA 2AD1A 4MRSA 5G3YA 1F2TB 2YNMA 3TUJC 5JFGA 4DDWA 2GCPA 3AKYA 4BZXA 3FHCB 1RKBA 4RZXA 4D0NA 2F3RA 1KZ7B 2HXYA 3RS4A 1IN5A 3SDZA 2FSIA 4DCVA 1LVGA 2GKSA 4V0ME 3NEYA 2VEDA 5JS8A 4O0MA 1F48A 4TN1A 1ZM9A 5KDLA 1N5KA 3RRMA 1ZM3A 1XJQA 3UKDA 3KTAA 5EXTA 2QTHA 4YMVA 2WM9B 1XTIA 5TXGA 1UAAA 2OESA 2TMKA 3QSYA 5FBWB 3KKOA 4CT4B 3NH9A 3P4XA 2GRJA 1FQKA 4I4LA 1E2EA 2YJTD 4TTRA 3OESA 3OIUA 3B85A 1Z0IA 3UANA 4HATA 1Q1EA 3IQWA 4Q4JB 3THYB 3Q7PA 3KZ1E 4OHXA 1X6VA 1U8YA 2IYQA 3CF2A 2UZ3A 3OAAD 4CEJA 2D2EA 2GEUA 2IYLD 4HUQA 1N6HA 4V0KA 3SJBA 2FOLA 4TMVA 3KQUA 4I1VA 5EQTA 3EPKA 1N6OA 1VIYA 2D74A 5J47A 4GT1A 1LW7A 2PJRA 2EWWA 3K9NA 1PLJA 3VKGA 4US1R 3BH6A 4C0SA 2VLIA 4NPHA 2X2FA 4BWYA 1W2GA 3AB3A 1XTJA 2R6DA 3AF1A 1IN4A 1UKYA 4A2WA 3WNDA 3U44A 2EVWX 4P32A 4CDGA 3ZZUA 1ZU5A 2B6HA 2A5FA 1P9WA 2BWJA 1GTVA 2F1HA 1P73A 3NXSA 4P0TA 2FV8A 3IO3A 5G41A 3LX8A 1KDPA 5CK5A 4IEIA 2C9YA 4M1KA 1F3OA 1SXJC 3PEVA 1NG9A 1OSNA 4JL6A 4GI7A 4RFSA 3D6TB 1LFDB 1L8QA 4B75A 2WSMA 2GAAA 1G7CA 3ETLA 5DN6A 1BOFA 2IUTA 2LCFA 1ZUIA 1S9HA 3A8TA 1OKKA 1W4AA 4P3YA 1G7SA 4OHYA 5AUPB 3QKTA 4LHYA 2IHYA 1WRBA 4P31A 1WA5A 2GBLC 2J5XA 1ZM7A 3D8BA 3FFBA 5EE9A 5HTKA 4ZKDA 3TR0A 2J0QA 1JJ7A 3EZ2A 4Y0VA 4PSVA 3KJGA 4LUCA 4C3ZA 1SGWA 2X1VA 5B2ZA 1MH1A 3E5HA 5B57C 4NZYA 5CB8A 4JJZA 2BMDA 3CB4A 1MO4A 1RJ9B 3GLFA 1E2IA 2G1KA 2IF0A 1G3QA 3RAPR 3LRPA 4JVSB 3T15A 3MWJA 2Q9CA 1RRGA 2G1JA 3CZPA 2IYSA 2C77A 1RPZA 1W4RA 4TLBA 1T3LA 3WNCA 2RGDA 2YWGA 4C0AC 2KJQA 4CRWB 5KDOA 1FNMA 2F6RA 2QU8A 4V0NA 1KZGB 3QEJA 2OFXA 1S3GA 2V55B 3FB4A 1HT1E 3PUYA 4X8OA 3RS3A 2JATA 2O0KA 4R2HA 4CVNA 4XJXA 1G6HA 2XITA 1F2UA 3CRQA 2RCNA 2VYFA 4B3FX 3EC2A 4BPBA 1YZTA 3GJ6A 1GDDA 2GJAA 1SVIA 3OEHD 5DO9A 3I62A 3DOEA 4LHVA 1IJEA 3X1DA 3QOFA 3EC1A 2CK3D 4QM6A 4URYR 2BMEA 1T4GA 4KODA 5FFMA 5FTMA 3SHWA 3QKRB 5AUOB 4DIEA 1ZRHA 1KI7A 4CGZA 1JAIA 5L3RA 4V0OA 3RRZA 4XH9B 1KO8A 2WJGA 2QI9C 5J5CA 2J0UB 2NIPA 4ZI3A 2PCLA 2JJ1D 1KTVA 3TAUA 1XX6A 4C0JA 1KMQA 2ZUCA 2B7CA 2F9LA 1CR0A 2V4ZA 2PLFA 1BS1A 1KDRA 3GQBA 4OI2A 1ZD9A 1W44A 3EPHA 2GZAA 4RZ3A 1XZQA 5DE3A 3LDAA 4BFXA 2FFAA 3BE4A 3NDBB 1XPRA 5FOTA 4EFLA 1P9RA 2AKAB 1JJVA 4FCTA 2WWGA 4LWZA 3IQXA 4TTPA 3RNLA 4DSOA 2ZSEA 1JALA 2ZS8A 4JLOA 4D6PA 3ZS9A 4E09A 3GJ7A 5F2EA 4MYUA 2P6NA 2W6ID 3EA0A 2BM0A 3L0IB 3PIRA 4LJ4A 5UKDA 1OH5A 4F38A 2PEYA 3AVVA 4PHTA 4RJLA 2A78A 4PZZA 3W8NA 4ZI2A 3TK1A 2O8EB 2ZI7A 5DHFA 2VHTA 3I5YA 1GKYA 4IDPA 1Z83A 1ZAKA 2V6JA 3EXAA 3PVSA 2A2ZA 1FQJA 4GP6A 1N6KA 4M1TA 3S1AB 3W6PA 4BFZA 2ZJAA 1VKJA 3QXJA 1GL6A 2P2LA 3GLIE 3RC8A 2CCGA 4N1AA 2OILA 4B6FA 2REOA 4ZCMA 4A4DA 1NVVQ 2ORVA 3ZZTA 4IKEA 5DI3B 1Z8FA 5KDDA 2ZQ5A 1PVOA 1EG7A 5IK2A 5FTJA 4BZQA 4Q19A 3NDPA 4P4UA 2AR7A 2PEZA 3BB3A 3QKSB 2Q6TA 5A5GA 3CPHA 1DOAA 4DLTA 4HB0A 3TR5A 5DSZA 2GWHA 5L3QA 3F8TA 1O87A 1T8TA 5FOSA 2XEXA 3OZXA 4PFSA 2XX3A 2NO6A 4JLMA 5C1BA 3WYGA 5GVRA 4H1VA 3KXIA 1N2CE 1XTKA 2ZRAA 1OIXA 4NYJQ 4DZZA 2XGJA 3QUSA 3AVTA 2WAYA 2WOOA 1ZINA 2XXAB 2DY1A 4IRUB 2X8AA 1W5TA 1UEIA 3EX7C 4GP7A 3LWNA 1NMXA 1GWNA 2ZXUA 3OIWA 1PUIA 2C04A 3PEUA 5EE3A 5JEDA 3AF2A 5CYOA 2VP2A 1NJGA 1OFUX 3RS5A 2PZFA 3MGCA 1Z22A 4AYXA 2GXQA 4A8JB 1KI8A 3JZAA 1R8SA 2VBCA 4WZBE 3T35A 4BLRA 4WXRA 4KCGA 4QFMA 5AJVB 3GP8A 2ZYTX 4H9GA 1KO5A 2ZVPX 4U02A 1P5ZB 4MRVA 1TQ2A 4A2PA 4ON9A 2Q3MA 2NO1A 2PZGA 1Q12A 2YC2C 1VCMA 5EUMA 2H18A 3MJRA 4LV8B 2FPLA 1DAEA 3CM0A 1T91A 3GLGA 4RD2A 5LB4A 2H7VA 3SU8A 1UDWA 4FMCB 1ZC4A 2WPDD 3B60A 4TMZA 1NSTA 3K0AA 4GMXA 5C2JB 3ICQB 1GAJA 1E2LA 2D7CA 1G7TA 1FTSA 1YVDA 4A2QA 1VIAA 3FKSD 4PAOA 1MR3F 4A0HA 4GSYA 1AZSC 1CJMA 4Q01A 3W3ZB 4JLVA 4BUJA 1AGRA 2ZIAA 1BO6A 3PCRB 4V0MA 4Z1MD 1N5JA 4DLZA 1AQUA 4JMPA 4TLCA 5GJVC 4DDVA 5EJEA 4LV5B 4UNNA 3LXXA 1LS6A 4F92B 2VSFA 4C2TA 3TRFA 2JLXA 2CMKA 1CEEA 5CDFE 3X2SA 3A4MA 3BRWD 3FWYA 1MO3A 4UQOA 3TSZA 4ZDIA 2NQ2C 3ASZA 1KO4A 4DLWA 2P6UA 4DEYA 4LHXA 3ONWA 4V02A 4NCHA 3RC3A 1DG3A 1M6NA 2XOKD 4JVLA 2IS4A 2NMVA 1P7CA 4HSEA 4HZUA 3QF7A 3GJ5A 5DISB 1I4TD 5TDHA 1MABB 2ZE8A 1US8B 4TLEA 3ZVNA 1Z47A 1G5RA 1SHKA 4FMCF 1GL7A 1D5CA 3FGNA 2O8BB 4YDHB 1OIWA 1SVKA 1U8ZA 1C9KA 3R20A 2YC4C 1BYUA 4DHEA 1XZPA 5EZ6B 1F60A 2IEZA 2FG5A 3IKJA 3NC1C 3HU1A 2PL3A 4OI1A 2G9NA 2DCUA 4Q1AA 3TUIC 1E4VA 2AFHE 1NY5A 4OHWA 1SXJD 4UNPA 4G5SA 4R2IA 3QF4A 1SQ5A 2HF9A 2C98A 2L0XA 4XD7A 4DRZA 1KNXA 2R6AA 5D3MB 3THXB 1YHNA 2ZYVX 1G6OA 1L4YA 1ZBDA 4BFUA 3DZ8A 1E2QA 4L5BA 1II8A 2A5DA 2EYUA 3T12A 2ZTSA 4LYAA 2OT3B 2WWIA 5E95A 3WNBA 1HQYE 5EXXA 2O52A 3BERA 2RKOA 2OCBA 2PLRA 3KKQA 2ZI9A 4MITA 4US0R 4EDHA 3AVXA 4C0KA 3EG5A 1E2DA 1XMVA 4II7A 4EJSB 1AS0A 5DLQC 4ZCLA 2OXRA 1N6RA 5EP4A 3W8RA 3FHOA 3MFYA 1UF9A 4DUGD 4YXWD 3IO5A 3A36A 3TQCA 1KAGA 4KV9A 2FZLA 4M1YA 3QBTA 4OK3A 1TPZA 1K5GA 3RYTC 3QENA 4MGYR 4IVPA 3H86A 2QGZA 4N3NA 4IXNA 2R62A 2AWNA 3Q7QA 5CIWA 3EIQA 3AVQA 4I99A 4PXAA 3SYNA 3LBNA 5JEEA 1P4SA 1XXHE 2BCGY 4F91B 1L2TA 2ZRGA 3ND9A 1OW3B 3CONA 4ESHA 4O2RA 5FI0B 3H2YA 4PC2A 3PEWA 5J4YA 2AD5A 3B8HA 2FEOA 4Z8YA 1FUUA 1G21E 1DADA 4ZKEA 1N0UA 1NVVR 1W36B 1Z6TA 5J4VA 4B32A 3QVVA 2JLUA 1E2FA 4TLDA 4CEHA 2E1RA 2WKRA 3I4LA 4EIWA 1T0JB 2P65A 2XB2A 3R8FA 2OLJA 3VR2A 3L0SA 1D2MA 2DFKB 4Q66C 4OI4A 1ZM4A 1A7JA 3X1YA 5TV2A 4OK6A 1YQTA 1J7KA 1Z5ZA 1U0JA 4Q03A 5CLLA 1E9CA 4M21A 5JI3E 4MDEA 5IHPA 1YZUA 4EQ6A 2XZPA 1XCGB 4JLBA 5FR2A 4DCTA 5JSZA 3U3OA 3UWOA 5GVSA 1CRQA 1GILA 4NYJR 1AA9A 2FWRA 4TLAA 4WZAE 4DBLC 2AK3A 2ZRCA 4RZUA 2QSZA 4X8HA 2GJ8A 4HAVA 3WBKA 2QN6A 1G9XA 1ZNZA 3CX8A 4E03A 2XSZA 3SR0A 5JRJA 1UBGA 3O8BA 1J8YF 2JCSA 2OHFA 3P26A 3UWKA 2OBLA 4M1WA 4UJ5A 5L3SB 4MKHA 4M0LA 1R8QA 3GLIA 2OCAA 4LHZA 5GJWC 3TMKA 4RKEA 3FYHA 3SFZA 1ZM2A 2N46A 3HJNA 4D4JA 3BAFA 1WBBA 1UBFA 5DGXA 4A92A 1AIPA 3ASYA 4LC0A 3K9LA 1IXSB 1UKVY 2OM2A 3CNLA 3ND8A 4MA4A 4UNQA 5SZJA 3P20A 2DHRA 1TU3A 3WRYC 5FTLA 3GLHB 5KSOA 2QM7A 4GOJA 1GRNA 1NBMD 2IXGA 2BKEA 2BMJA 3G0HA 4FD2A 1XD2B 4AKGA 1NKSA 5TARA 1NJFA 2E9SA 3M1IA 3K0EA 1G8YA 3BH7A 1VCOA 4JSTA 4QJ5A 1RYHA 2ANCA 2J0VA 5CJPA 5HZKA 2WMOB 1N25A 4Q1BA 1ZU4A 1E96A 5KOYA 1B23P 3R7WA 3OFND 4KYIB 4ZDWA 2ZU6A 4MGKR 2FE4A 5FI1B 3SBDA 2KI5A 3BJIC 5DYGA 2CHGA 3AKCA 4D0GA 1OXSC 5B64A 1Q57A 4B3GA 1KO1A 4B35A 3DEFA 5FBLB 3VTKA 1W2HA 3GEIA 4KAXA 1IXZA 5AJZA 3HPRA 3TKLA 2JJ2A 2PMDA 3AVPA 2ZAMA 4Q9LA 4IDNA 4A1FA 4UXJA 1KKLA 5AK0A 3ADBA 3KJIA 2WTUA 1SKYB 3AUYA 2ODNA 3GFPA 3MRSA 1RRCA 1SXJB 5JI2E 4DVGA 2ZSAA 1W0KA 4PAMA 5CIQA 3EIEA 2ZJBA 3TJZA 1HTWA 4TZ0A 2Q3HA 2IYVA 3DMDA 4RZ2A 4I1SA 2VP5A 4FMBB 4HAYA 5KTYA 1RC8A 4BLPA 3ZQ6A 3ZS8A 5D3QA 4TQUS 3DHWC 2IS2A 3NVAA 1GL9B 1GNRA 4M9XA 1XEWY 5G53C 3GD7A 1ZVQA 2A30A 2WKQA 2XTMA 2GCOB 2V6IA 3BFXA 3NBXX 5H1YA 4Q4JA 2JJ8A 3LLMA 1D8TA 4B47A 3THYA 3MD0A 2AFIE 2B7BA 2I3BA 3K53A 4AG6A 3FMFA 1IOZA 2H5EA 2VP9A 1AM4D 3BH0A 1ONBA 2ZJ5A 2FNAA 2CNWA 3BB1A 3L0PA 5BN4A 3IIJA 1S4QA 1XEXB 4UXHA 4TMXA 3ZYCA 5DH9A 4OHZA 2BDTA 4LJ9A 4HLCA 3ICEA 1E2NA 4MUAA 3MMPA 4Q4HA 2GDJA 4RKFA 1VTKA 3UMRA 2O8DB 4TL7A 1ANKA 5J40A 3ZLJA 1E2KA 2CLSA 3ZVRA 4Q7KA 4BRUA 4V0LA 2GJ9A 4LYHA 4U00A 5CDFA 1KK2A 1BIFA 5FTKA 5JJKA 2ZRFA 2RB4A 1KNQA 2REBA 2FH5B 4JYBA 1E6CA 4DLUA 2EFHB 4Q1DA 3ZJYA 3KUDA 4P33A 4QNRA 5FL7D 2WBLC 4NCKA 3U3KA 1GSIA 4D81A 2C78A 3L0OA 2QMOA 1KKMA 2D06A 1ZYUA 4C7OA 2DPXA 3AP1A 2NO9A 2WJVA 2A5JA 2QENA 4DWJA 2GEVA 3BGWA 1TL7C 3DKPA 3CX6A 1YZGA 4NCIA 1OH7A 4PANA 3N70A 1H8HA 1OHHA 1IXRC 1NF3A 2IYZA 4M53A 3HP1A 2C9OA 4Q4AB 3MG9A 1YRBA 5DYIA 4XSHA 4ZIRB 1U90A 4LZZA 5HKKD 1N6PA 3B1XA 4WXPA 3A1WA 2DFTA 2DR3A 1JR3D 4PC3A 1JPJA 5E7IA 3EZFA 4GZMA 4C0HA 1KI9A 4QXAA 3OEEA 2QPOA 2MMCA 3RANA 4L9WA 3AF4A 3UG7A 2RHDA 4GOKA 1G8GA 3OF5A 4NYIR 3VKHA 4DKXA 2A9KA 3FMOB 2GF9A 2B8WA 2YWFA 3CW2A 8OHMA 1IJFA 5LB2A 4EFNA 3CPEA 2NTYC 1JXOA 4WVFA 5K8UA 1KI6A 6Q21A 4TT3D 2IW3A 2OBMA 5IF9A 2BHRA 1A82A 1G4UR 2CJWA 1D2NA 2UVQA 2YHSA 5JCPA 4IHQA 4KLZA 1FTNA 2R9VA 3KJEA 3L8ZA 1FX0B 3RRYA 2Z0MA 1M7GA 4ACAA 3H0KA 2F43A 2ECKA 2ZSDA 3AF0A 1MKYA 3QKRA 4K81B 2EQBA 4BRWA 2Q9AA 1QHHB 3THOA 1Q1ZA 1YR6A 4KVAA 5AWFC 5IT5A 2ZRPA 4OQLA 1ESMA 2GJKA 4ZDKA 1Z28A 1TQ6A 3TQFA 1XXHA 1ZCBA 4QBGB 1QBKC 2JLRA 2XNDD 3V4FA 1M34E 3W3AA 3HU3A 4D4MA 1PLLA 4MKIA 4GDFA 2JLYA 1ZUHA 3NBFA 5CYPA 4YMUA 3BK7A 5FBRB 4TL6A 2OAP1 4B73A 2CL6X 1TQ4A 4C0QC 4Q9HA 1UFQA 4EPWA 1TF2A 3K09C 1B0UA 1KSJA 4B2LA 5FPYA 2CL7X 2ZREA 5CM9C 2G83A 4ZPXA 2IK8A 5DHAA 1XPOA 2ZJOA 3QQ5A 4KO8A 5KSZA 2C95A 2D4HA 3S1AA 4QOSA 4D80A 3NTUA 2HDNB 1W1WA 3LFUA 1K8RA 4BLTA 4HZIA 3F5FA 1LV7A 2EFCB 5FUXA 2OE2A 1U94A 2WWYA 5H8WA 5KSYA 3H4MA 3UK6A 2GK7A 2YVUA 1KMHB 4BFTA 1XPUA 5DI3A 1LTQA 2PT7A 2G6BA 4DT1B 4KBFA 1RYFA 1XRJA 2MSDB 2R8RA 1W48A 1NKTA 1IY2A 2RGNA 1Z2AA 3GLHE 2HJGA 2QAJA 4NTZA 4A6XA 2HLDA 3GEHA 4F7WA 1LY1A 4JBXA 1E1QD 2QAGC 2W0MA 3OAAA 3OIVA 5KSPA 4PZLA 1OFHA 2QE7D 3N5CA 2ZR0A 1E9FA 1Z6XA 2W58A 1U9IA 4B74A 3RS2A 1X86B 1DAKA 2OAQ1 1SVOA 4Q7MB 4QG7A 2ZI4A 2F3TA 3SOPA 4QM7A 1G64A 1WB9A 4M8NE 2A5YB 4MYCA 4DSTA 4KFRA 1BKDR 2B8TA 3I3SR 2XXAA 1EX7A 1D6JA 1E4YA 3NHAA 2WJIA 1V43A 1NG1A 5CB6A 3IILA 1TNDA 1ZP6A 2Z4SA 4G01B 2ZI3A 2RHMA 3T06B 5KHOC 1SKYE 1XEFA 2YYZA 3K9GA 1E94E 1VDZA 1G3MA 1SXJE 1AKEA 4LPKA 1G8HA 1R10A 2ZI6A 3QPUA 4KSBA 5TY0A 1TQDA 4R98A 1YJ5A 3T1VA 3DM9B 3VU9B 2IYYA 4HI0E 3KTAB 4A8JA 2FSFA 4RY2A 5A4JA 1C4OA 2PH1A 1JEDA 3MWKA 1IQPA 1QVAA 1J2JA 1HT2E 4LX0A 3SFVA 5FOXA 2WIAA 1UEJA 4E07A 4L15A 3KKPA 2HF8A 3TSOA 4PC1A 1ZD1A 4JZKA 3P1JA 4RD0A 4HB2A 1A5TA 2I4IA 3RSLA 4LBYA 3FTQA 4LCBA 4XTCS 2Q0HA 1KSGA 4JKIA 2J41A 4CEJB 2OFOA 1KDTA 3H84A 3NEJA 5BW8A 1E0KA 4I1OA 2Q21A 4HUQB 1E0AA 1G3IA 2C96A 2F7SA 3Q72A 3KKMA 1X8KA 1EFRD 2QMEA 1F6BA 2EFGA 2HXSA 3IPXA 3I5XA 4G0NA 1E0JA 4KU4A 1VG8A 2ZANA 1JECA 2IYRA 1RRPA 2BC9A 3SE0A 3QXXA 3CH4B 3M4YA 2GXSA 3C15C 2ODWA 3EA5A 1XFAA 2FFHA 5ANRB 3RDPA 4A6PA 4AURA 2J45A 1P72A 4B3BA 4Z54A 1CTQA 4FWTA 5F9FA 2GCNA 2Z6VA 2PJZA 4GBMA 2EFEB 2GETA 3B1VA 4MYHA 1MO5A 1QF9A 4LJ7A 2IX3A 5KYKA 5FOUA 4RFSB 4B44A 3HPQA 5KO2A 4C30A 1IY0A 3AVYA 3OEHA 4Y0AA 4PC6A 1QZXA 2ZS9A 2OCYC 1E2GA 1Q1QA 1OIVA 3TUZC 3CNOA 1QHGA 2CK3A 2JAQA 2GXUA 3CR7A 4FWIB 3U4QA 2ZRHA 4B3CA 1PJRA 4NCNA 1ZUNB 2ZJ2A 1SZPA 3LD9A 4M4SA 3LY5A 1ZMXA 3FFAA 4LDJA 2DWPA 3DDCA 2JJ1A 4F4JA 1MABA 1EGAA 5B30A 4UXIA 4KFUA 4QJ4A 3SJCA 3VAAA 4TYNA 4MRRA 3BD9A 3O8RA 3A1VA 2QBYB 1W36D 4C0BA 2WWXA 1VYVA 2I1QA 4KITB 1XDBA 3I8SA 2OEPA 4BLOA 5L3VA 1XD8A 3SQXA 2CDNA 5CK4A 3VHXA 1Q3HA 3K70C 2JA1A 4A15A 2D3WA 3A1UA 2DWQA 2JDID 3AKDA 2W6IA 4Q1CA 4NP6A 5FPKA 2A5GA 3A37A 4JT4A 2FSGA 1XU4A 3U7FB 4HDOB 1FOEB 3H1TA 1E9RA 2FZ4A 5FH9A 1NMZA 3TVDA 2ZE7A 1NI3A 3Q3JB 1IY1A 5TB5A 1ELOA 4CZ2A 3BWDD 3CKLA 4EJSA 1E0SA 1N5LA 1WP9A 1H8ED 2W00A 4OQNA 2ZR9A 5BYJA 2HYDA 2ONJA 4TSFD 4XWAA 2O8FB 3HU2A 4D25A 1E69A 2VSOA 3TVTA 4TYPA 3NKVA 2BBWA 3PUWA 1MT0A 1KK3A 3LQQA 1JXMA 2CHVA 3CF6R 2QSYA 3AQ4A 3PENA 4LBWA 4C0LA 1RE0A 2ANBA 1PLKA 3MLEA 1CLUA 4FIDA 2V7QD 3PG5A 3VX3A 4L16A 4KBGA 4DSNA 1NBME 3VR4A 1TEVA 4F93B 3BB4A 1RIFA 1UM8A 4DCNA 5EUQB 2VA8A 1VPLA 1YZNA 2OZEA 4NKRA 5BXQC 1MV5A 1P2UA 2GZHA 1TUIA 3R9XA 3U3RA 2F9MA 2ZI5A 4AC9A 1ZW6A 3B82A 4NH0A 2OUKA 4IOLA 1DO2A 5C4GB 4ARZA 1OH6A 1IONA 1T9HA 4MRPA 3NBZC 2H8KA 521PA 3G5UA 1G1MA 5CITA 5JHGB 1AK2A 1R0XA 3G82C 2ODBA 3BIFA 4HAXA 4N0EA 4KJZA 1UBCA 3A1SA 1W0JD 1G20E 1R0ZA 3LX5A 1CF4A 1XMSA 4I1UA 1LB1B 3DVLA 4BQSA 5K8LA 3FOZA 3OIYA 3OE7D 2A7QA 3ZQJA 2WSSD 3GJ8A 4P4SB 1CJVC 4PQRA 4HLDA 5EXSA 1G3RA 1W5SA 4MUBA 3OHMA 5HPYB 1TMKA 3U60B 2NO7A 4JLPA 1KY3A 1X1RA 2ZETA 3TSWA 2FF7A 1Z3IX 1VG9B 1AJEA 3I73A 4KHZA 1KK0A 4TTQA 4PPQA 3VR1A 1E1RD 5C18A 3B1YA 3ZD6A 2HUPA 4BFYA 4D4LA 5L3QB 4WAUA 2NGRA 2X19A 4BASA 1II0A 3AP3A 1JQLB 1ZC3A 1D2EA 4U7DA 1HA3A 3K0CA 3LBIA 3MUFA 621PA 1DAMA 3FHTA 2WPDA 2REXB 4AD8A 3U7EB 3CRMA 5F3WB 1XNJA 2QP9X 2WVJA 4OBEA 4PQFA 1VHTA 4AWXA 3FKSA 1TF7A 2VL7A 3SZRA 1DARA 2A3RA 4US2R 4QKQA 4C2UA 3P27A 2RMKA 1JAHA 5FPTA 2GEDA 4Z1MA 3R9IA 3I1FA 1G17A 1CP2A 3V9PA 1ZNWA 5HE9A 4LJ8A 3ECCA 2AKYA 2FA9A 1X1SA 2IYUA 2WWWA 5JBQA 1T3SA 1XJ0A 2BJWA 3KL4A 4KYUA 2ZJZA 3GLHA 4M9QA 721PA 3IEUA 2WZQA 1Z07A 4LOAA 3ZIAD 5LBIA 5IRCD 1DG1G 1HEIA 1XD2A 3MJHA 4YMWA 1GFIA 4A0FA 1UKEA 5HE8A 2FFBA 4JIMA 2HV8A 1TU4A 3LO5A 4BEJA 1IHUA 4XTRA 4NCJA 3KFVA 1VYUA 2AXPA 3K0FB 4TL8A 1IN8A 2XOKA 2O5VA 4F4IA 3CZQA 2RGNC 2WWFA 2J59A 1J99A 1G3UA 4GFDA 2W6JD 3JVUA 5KNBA 2XZLA 1BMFD 4ZV4A 3GLGB 1FZQA 1A1VA 5J4LA 1MOZA 5H70A 5JCZA 1P60A 1GM5A 3AM1A 1ZJ6A 2XB4A 1OT3A 3PV0A 4IDOA 4QJ3A 2R6FA 3MWYW 5FUWA 3K9HA 2WWHA 5JWRA 2VHCA 1ESNA 1TADA 2J0SA 4NBSA 1Q0UA 2HCJB 1EWRA 1CIPA 3PQCA 2WV9A 5EXPA 1I4DD 3QNUA 1A4RA 1SXJA 1DPFA 1CKEA 1P2VA 4EAQA 2W0SA 4NDZA 1JR3E 2QNRA 4ASUA 2FFQA 4B33A 1JNYA 4QC2A 3ADKA 2NPIA 1N0WA 2Q9BA 1SVMA 4OJKA 5FPSA 2WIBA 1KDOA 2KWIA 2R44A 2ZROA 4YQFA 3NWJA 4GL2A 2J7PD 4DDUA 4UKDA 4B2PA 3EZ6A 3BBPA 4HDQB 2V3CC 4PHHA 2UZIR 1NL3A 1TX4B 1ZIPA 2QG6A 1ZIOA 4ILEA 3C4JA 4R7ZA 5C46F 1E79D 3L43A 2GCOA 4QGGA 1U0HC 3O47A 4G1UC 1Q3TA 1XTQA 1OXUA 1N3BA 4A36A 421PA 1SHZA 4DUGA 4HAZA 3A1TA 1UADA 4JVNA 4YXWA 4HZUB 2CHQA 2KB0A 4WZ6A 2PZEA 3L8YA 4PPGA 2ZM5A 1CRPA 2PCJA 3BOSA 5KUTA 4Z8XA 4RSGA 2IA5A 1XEXA 4LYJA 5KPJA 2ZVQX 3U3MA 4MYTA 5FOWA 2KBFA 2YINC 4Q4LA 3RHFA 2JLWA 1G16A 3LLUA 3T5DA 1KI2A 4M22A 2PT5A 2VQSA 2ZS7A 5AJWA 1EX6A 2FSHA 2IL1A 3R8CA 2O8DA 2I1VB 1S96A 1CJTC 2F1JA 2P3SA 2RGBA 2DFLA 2VHQA 4FCVA 4LI0A 5GADl 4RD4A 3SS8A 1VG1A 5GJCA 4JLJA 1P9NA 3I8XA 4IOKA 4FN5A 2CLDX 3GFOA 4Q48A 1CS4C 4AKEA 3KQHA 4TZ6A 1CR1A 3KXLA 4LC1A 1U0LA 2Q3FA 2QGNA 1II8B 2CCKA 1GG2A 3IBYA 121PA 1JBKA 2ZE5A 3CH5A 3GJ4A 1CR4A 3JZMA 4JLNA 2FGJA 4PO8A 3IHLA 3TW8B 1W49A 3WBJA 2OG2A 2HT6A 3MSXA 4DJTA 1ZD8A 2AK2A 4U5XA 2EFDB 3F0TA 4PZYA 3WMGA 2RGXA 2OCPA 1R5OA 1XJCA 1ZCAA 1CR2A 2O0JA 1Y63A 5LDDC 4OI0A 2YZ2A 4OKSA 3C14C 1NLFA 2ZRBA 2QPTA 3A4LA 2J9RA 4Q21A 1YR8A 1NVUQ 2PX0A 3LH5A 1Y3AA 4Q4AA 2ATXA 3K70D 2F55A 3IPYA 1G4AE 4ZIRA 3Q5DA 4GNKA 2B21A 1ZNXA 1AN0A 2BCJQ 2OBNA 1F2TA 3K8YA 4MKFA 4QGFA 4WOPA 5GJBA 4RD6A 4PAQA 4A0RA 4Q7LA 5DI9A 3WP1B 4DLRA 2ZRMA 3PUVA 2QPAA 3KUCA 1FFHA 4OHVA 2V8OA 5DNYB 2JLZA 1OLOA 4AKIA 1Z6GA 2QZ4A 4HAWA 4HDCA 1W46A 4UNRA 2VH5R 1XBTA 5KPDA 5HZHA 4CEHB 3THWB 1NN5A 4MGIR 3C16C 1FX0A 1AS3A 3U6KA 2RGGA 3TE6A 2NG1A 3DM5A 4HB3A 4M2LA 2YOGA 3WP0A 2IWRA 1R6BX 2JLVA 1KGDA 3KQLA 2CLCX 3FPAA 3NHBA 1Z0FA 4KFTA 1COWD 1KJYA 1QDEA 3RS7A 3EWSA 1QHHA 1VMAA 1KJZA 2C03A 1V5WA 3B5JA 1KY2A 1DTSA 1K6MA 5CJ2A 4NU0A 4J0QA 5EE5B 2YWEA 3SEAA 2XTNA 4CEIB 4TL9A 3DO6A 3ZVLA 4EQ6B 2QP3A 4ESVA 1R7RA 2QAGB 1AKYA 4LPSA 1Q1BA 4UJ3A 4DXAA 5JSZB 4D26A 2JIZA 3SHFA 1T5LA 2ODEA 2ZRLA 4XVUA 1WMSA 1FP6A 1TUEA 4EPXA 1N6IA 1CJUC 3NBYC 2G77B 3T1QA 3W9YA 3SNHA 4DCSA 1I4LD 1DEKA 3ZZ0A 1HH4A 4A0GA 4B34A 2QA5A 2OXCA 3CNNA 3GJXC 4Q9KA 2W2VA 3I72A 1NMYA 3B9QA 3WRXC 4QGHA 4XWOA 4JLAA 2V1XA 2ZITA 2ATVA 2VHJA 1ODFA 5K8IA 5E7JA 1OB5A 5F9HA 3VNUA 4BFVA 4DB2A 3HYRA 2QM8A 2BV3A 4IOJA 5CLQA 4O2LA 4Q47A 1RRFA 2CXXA 2ZYWX 2NZ8A 3SC3A 4TMKA 1QHIA 5AJYA 1NN1A 4G3XA 1E9DA 4AYTA 4S2EA 3SI7A 4TQ9A 4EKDA 3PXGA 4JYCA 1RJ9A 3QJYA 1R5BA 1WCV1 2BEJA 2JASA 2YOHA 4DT1A 4HLUA 3EZ7A 2GF0A 4AK9A 1KO7A 4EFMA 1HE8B 1GRQA 1HURA 2ZRDA 4W5JA 3ZGXA 1Z08A 3IIMA 4JJKA 3PFIA 4NMMA 4AYWA 3W6NA 3BC1A 1II9A 2J46A 1NVWQ 1YR9A 2ZU0C 3KDSE 4URZR 1GNQA 3R7WB 2ZRKA 1XWIA 2DBYA 2FU5C 3KX2A 1X3SA 1WDTA 3V4RA 3PR1A 1KAOA 3UIEA 1R0WA 1QG4A 3NC0C 3F3YA 4LSGA 3ZVMA 4TWZA 2ZRJA 2RGCA 5JZVA 2AX4A 1K5DA 3GLGE 4LJAA 4X8LA 4BZPA 3D31A 4EUNA 4FW9A 2PBRA 5DN6D 2GILA 1OKKD 4B76A 1ZNYA 3LXRA 3N2EA 1WQ1R 3RVBA 1G8FA 1OXVA 4B3DA 2ZSFA 3AH8A 4KFSA 3VX4A 3LW7A 4QHSA 4LBZA 4DB4A 1GNPA 1NSFA 3C41J 4LJ5A 4PHFA 4QL3A 4DLYA 3TIFA 2B92A 2J0UA 1XCMA 4CT5A 3A6PC 1E2MA 2WICA 4K46A 3D7MA 1E9BA 2VRWA 3DPUA 4BLSA 3VU9A 2IEYA 2Z4RA 5FL7A 1MRNA 3X1WA 2AHOA 1XMIA 3TH5A 1W7AA 3LBHA 5FR1A 4QHTA 1AQYA 3DL0A 4H1UA 2HJVA 3B6EA 3FDIA 3LA6A 4XWKA 3VR3A 1EWQA 3HR7A 2J7KA 2V54A 3ADDA 2QQ0A 1NLZA 4OJQA 3AKEA 2HLDD 1HUQA 2IWHA 3CO5A 3CUEF 1HY3A 1CJKC 5KU1A 2G0TA 2VF7A 4BFSA 4D4KA 3EPJA 3DKVA 5EP3A 1OYYA 3PUZA 2GVDC 2BJVA 3FMPB 2Y8EA 4DLVA 2WAXA 5E3HA 4GRAA 5TMPA 1KSHA 3K70B 2D7DA 2O8EA 2IC5A 1DBSA 2DWOA 4XVQA 1XCPA 5HKKA 2JEOA 1H65A 3T34A 1AZTA 2OLKA 4Q4HB 3CRW1 3X1XA 5JMTA 1JR3A 3TBKA 3U2QA 3TNFA 4JVMA 3LV8A 3TW4A 1XTSA 3T5GA 5JRZA 2O8CB 4PHGA 2NO0A 4NE2A 4LJ6A 3W34A 4BLQA 2KSQA 1P62B 3HYTA 2R6GA 4I81A 4Q7JB 3RABA 4TT3A 5AR1A 2KE5A 3WYFA 4BE7B 3U7GA 5JS7A 1A2BA 4HAUA 2FMXA 2QT0A 3QKSA 4LGMA 3GCGA 1Z2CA 3VHLB 3KJHA 3NH6A 4FCWA 4C7OB 2OFWA 1HV8A 3B9PA 3AUXA 1OF1A 5IDVA 4N0DA 4D2IA 3KQNA 1Z0DA 4AG5A 4D82A 1EFUA 4PC7A 2R2AA 5G40A 2XTZA 2GK6A 1BH2A 2D2FA 2VP6A 3VR5A 4URXR 3KQKA 1LF5A 1R0YA 5LD2C 4IFBA 4KI0A 3REGA 5BWMA 3AEZA 3M6AA 2QT1A 2C9CA 2QBYA 4WIAA 5FUYA 2LKDA 4C9BA 2XNDA 2D62A 2BBTA 5EP2A 3AGQA 3GJ3A 1VYTA 3CLVA 1KI1A 3QEOA 3RLFA 1UDXA 4A82A 1Z0JA 3UPUA 4MGZR 3QKUA 5B58C 2ZJ8A 5FTNA 5FOVA 4Q18A 4YMSA 5FBVB 1OXTA 5L8VA 3BFVA 4AKHA 2MSCB 3K1JA 1G8PA 1J70A 1G291 1KI6B 1LS1A 1EFHA 1P61B 1G19A 1YKSA 5IK2D 2CJWB 3N2IA 1IN6A 3X1ZA 1G5PA 2N42A 5JECA 1QHXA 4FMDB 1YE8A 2F1RA 3EZ9A 4HUTA 2YKGA 1OH8A 2F43B 1L4UA 3GPLA 4PSKA 2QL6A 4XSGA 3LVQE 4M1OA 2O8FA 1AS2A 4JKYA 1YRAA 2BOVA 1FP7A 3VQTA 2FPKA 1OYWA 2JGNA 4MRNA 4EPRA 2W2XA 2GNOA 5JJIA 3KB1A 5FL3A 3KXKA 1XF9A 2GVZC 1DAFA 4G5OA 3WMEA 5J4HA 3DOFA 1T0HB 5M04A 1XXHB 3UXMA 1I2DA 2ZUBA 1VECA 1S1CA 1YZKA 3KKNA 3QPVA 4IDQA 2BM1A 2VTKA 2J3EA 4LJYA 3UG6A 1IBRA 4GMDA 5BQ5A 1A2KC 2QY9A 3U44B 1M1YE 4LBVA 2IS1A 4M1SA 2WJHA 1G41A 1U2RA 2RAPA 4PQYA 1E1QA 1Q44A 2ASEA 2AXNA 2FEMA 3IBGA 4KVGA 3QIAA 2QE7A 1VG0B 4DLSA 1N0VC 3PJRA 2FX3A 4L4UA 1E9EA 1Z6AA 5AUQA 2IS6A 1C1YA 4O25A 1M8PA 1OFIA 2W83A 4DIDA 3IIKA 3FE2A 3ZDQA 3W5IA 2MMGA 4PX9A 3RRNA 4ABYA 2ORIA 4K8OA 2VO1A 2G0NA 1WBDA 3HWSA 4W9MC 5EZ5A 4FI3C 1KHTA 2ZRNA 1CULC 3EARA 4OQMA 4FMDF 3WXMA 3U61B 1Z0AA 1KIMA 2QMHA 3WHLA 4TQAA 2QRZA 1E99A 2BMFA 3V00A 1R4AA 1QG2A 4P4SA 1W47A 3CBQA 1JR6A 1Q22A 1KJWA 4Z51A 1US8A 1E9AA 2GESA 1NN3A 3GLFB 1G5TA 4LRWA 2NZJA 2OV2A 3I92A 2O8BA 4Q1EA 2Z5FA 1DAGA 3AP2A 2R6CA 2Z43A 5EE0A 1X8LA 3SJAA 5FBQB 3NG1A 1M7BA 2JLSA 4PR0A 4NYMQ 3P32A 2HYIC 4G5GA 3K0SA 1U99A 1CU1A 4YMTA 1QHNA 2CVHA 3T1OA 4R71A 3TLXA 4UNSA 2EU8A 5D3MA 1EFRA 3THXA 1F2UB 3QY0A 2C5LA 3Q8XB 3I61A 1N6LA 2QEQA 1E98A 4OK5A 2K5UA 2QTVB 4OL0A 2CEAA 1OV4A 3FVQA 2XJ4A 1SVWA 3LNCA 1AGPA 1S1MA 2FPMA 2N1BA 2CE2X 3QXHA 3RWMB 5LPNA 1QHSA 1S0UA 2ZYUX 5CM8B 1TTTA 1WE2A 2QMUA 4DSUA 2CVFA 1BYIA 3ADCA 4JL5A 2RGEA 3IDQA 2F1IA 4IVQA 3QXCA 2IF2A 1QHYA 2X77A 4DC9A 4KSCA 3AVUA 2FDCA 2C2HA 4PPNA 1M74A 3W5JA 3HR8A 1QVRA 3B1WA 5JJLA 2GHIA 3NIBA 4HLUC 5EP1A 4CIDA 5H68A 3HDTA 3DZDA 1RW4A 1L7VC 4GOXA 2QTFA 1JB1A 1IM2A 1XMJA 2ZPTX 3K0FA 4IXMA 1J8MF 1S2MA 2V1UA 1T5IA 4CYMA 2IYXA 3FKQA 3B13B 2IT1A 2ZEJA 5JHHB 4B48A 4JSYA 2H17A 1DELA 1FPMA 2JLQA 4XD7D 5SZHB 4URWR 5K8TA 5J4KA 2P5TB 1KI3A 4PSAA 3CF0A 1FUKA 3VR6A 4W7SA 3WHKA 2FGKA 1HE1C 5TVKA 1IN7A 2AWOA 2CBZA 5A0FA 2AL7A 3GJ0A 4JBYA 4RD3A 4MDFA 5HR5A 3QG1A 3EPLA 2P6RA 1GP2A 2YV5A 4URVR 1OE0A 4B43A 4BEBA 2HEIA 2JDIA 4Q02A 3IEVA 3DMNA 4OQXA 4PPFA 2XJ9A 4JS0A 2BEKA 4X8MA 1FMJA 2ONKA 3QG5A 4WA7A 1YZLA 1W4BA 2BKUA 1DO0A 2RGAA 4KLNA 4LYFA 4Q00A 4XOIA 3W90A 2W2TA 4IJMA 2VHUA 2WKPA 5JLJA 2HT1A 4DEXA 4IEEA 3U4QB 1H8EA 2ZAOA 3B7GA 4M1MA 1JQJC 3MAAC 4GZLA 1CXZA 1S8FA 5DIFA 3KFXA 4TSFA 2HCBA 2H16A 1RVDA 1YU9A 2IHBA 1WXQA 4W5WA 2ZJYA 3SN6A 4ACBA 2IXEA 2MSEB 4ERNA 2QQEA 1XB2A 1SVLA 4Q1FA 3EAQA 3LAWA 2LKCA 5KNCA 2YWHA 2OSBA 2P0EA 5E7MA 1E32A 1NLYA 2V7QA 2EW1A 3AVOA 3IUYA 4JT2A 3EWAA 4GPTA 4OYHA 5L3SA 4Q5IA 3O8DA 3T61A 1ETUA 4B3XA 2IYWA 1E9SA 3CRRA 4MH0R 1U98A 3MWLA 3U5ZB 1G18A 2ZE6A 1GKIA 4E22A 4ASUD 1GOTA 3I32A 3SYLA 3U7HB 1NNEA 1TAGA 4C4PA 1LNZA 1YZQA 2GZDA 1WF3A 1KYIA 3VKWA 2WMNB 4D0LB 1R5NA 4JLDA 3LW8A 4YONB 1MRSA 3WYAA 5C4MA 3FMIA 5EE1A 2O0HA 4AI6A 2VF8A 4JBWA 4TMWA 3EIHA 1Q21A 1W0JA 3C5HA 3SYKA 1UJ2A 4RCYA 3OE7A 2WSSA 4RVCA 4B2IA 1E2PA 4DLXA 1EFTA 1F5NA 3EW9A 2QORA 3U3JA 1DAHA 2XZOA 1Q20A 2XSZD 4W5HA 1VHLA 4LHWA 4QGAA 4NHOA 5BN5A 1JEEA 3K0AB 1RZ3A 2ZUDA 1NIPA 1NN0A 4QBHA 1PV4A 1U9IC 4FXPA 5SZIA 1UBEA 1GIAA 1E1RA 1N5IA 2FJUA 2CE7A 1XD9A 2ERXA 3REFA 4HLQB 3K09A 1OXXK 2IXFA 1M2OB 1HYQA 4ZDJA 3O8CA 1MO6A 2BBOA 4ARZB 1U8AA 1XTRA 1TF5A 4POAA 4TYYA 1EK0A 1GITA 4MQBA 2IYTA 2GBLA 4HEJA 2UKDA 3THWA 3SBEA 4WBSA 2BVNA 1EFCA 1FNNA 3WY9A 4IVRA 1NIJA 4NYIQ 4A8JC 5BYKA 3CRVA 2GTPA 4YLGA 2KBEA 1Z0KA 4OQFA 4QNMA 4RD1A 1GZSA 1J90A 1S3SA 3L82B 3Q5EA 4IDHA 2PMKA 2WJJA 4NYMR 1OB2A 4L9SA 2Z83A 4CEIA 5E4FA 3ZIAA 3QPWA 2EWVA 1NY6A 5BN3A 2WOJA 2C99A 3VNVA 3SJZA 3CIOA 2QAGA 2DFNA 2G3YA 3A4NA 4A9AA 3J81k 3GLFE 2ZRIA 2JJ2D 2QP4A 3E1SA 2H1LA 5FUVA 4NONA 4ITRC 4LY6A 1DS6A 1N6NA 4HB4A 4F4CA 1EESA 2XNSA 2W6JA 4TYWA 4BGDA 3AV0B 1W0KD
chains in the Genus database with same CATH superfamily
3L8FA 5CH3A 2XUHA 3OEYA 5HCIA 3DHNA 2C7BA 1W93A 2Y05A 3H1FA 2Y2VA 3UWDA 1Z33A 1FS5A 1S2IA 4D44A 4D9EA 5AW0A 1H9CA 3LCMA 4XPIA 1IATA 3ZH9B 1ICIA 5JWOA 3B78A 4XQ0A 4C03A 5LLTA 4X44A 2VJMB 4EUSA 4L0MA 3PFHA 5JCXA 2NOAA 2FDXA 1KOGA 4QUDA 1U0NA 2ATIA 1GRRA 1P5JA 1BRMA 1HTBA 2JEZA 3DDUA 2Z08A 3OUTA 5IU6A 3H1GA 1X9IA 5EIBC 1DE0A 2OO7A 3F5MA 4GBGA 4KBYA 4MKGA 1CERA 3O4VA 4I7EA 2JFNA 3CA8A 3NCHA 1SVSA 4HYYA 1SM4A 4MVYA 4N6OA 2O2GA 4G5RA 1FQWA 3HB7A 3BFKA 4EL0A 4F3CA 3P2KA 1ZH0A 5CLIA 2WILA 5SY6A 4O2AA 5TMEA 3WGYA 3Q12A 3RSHA 1WP4A 3N8KA 3ZXYA 821PA 1G98A 2XLBA 4TYQA 3QBVA 3D3WA 4LRQA 1KDZA 3C5CA 1UPTA 4M86A 2BKVA 3PXDA 1T6NA 5T6BA 3TB6A 1T3HA 5BV1A 2RJNA 4WXHA 3UMFA 2GJSA 4B6QA 3ZNQA 2DYKA 4BXOB 1Z06A 3AYZB 5E7QA 4PO9A 5SZKB 3LS2A 3CWQA 2P67A 2BR4A 3AV3A 3R5KA 4GMHA 4FX5A 1K6JA 3D6UA 4G0YA 5KCMA 5I7EA 1VCIA 2IHVA 2TMGA 4ZTBA 4EJMA 5F98A 4LG1A 1YASA 3FTPA 3N6XA 2QB5A 3EUAA 2Q50A 1I0LA 2VNAA 4RDCA 7ADHA 3W1EA 4P4TA 4CQMB 1DAIA 1QJCA 1SKQA 4A27A 3TEJA 1GADO 1M0TA 3AWIA 4E7OA 4EB3A 3PD0A 4IF4A 1BJKA 1HDIA 1E3IA 2QROA 4W8HA 2UXCB 1D9ZA 1OFTA 1T5BA 4ROTA 3HRHA 3KSAC 4HUJA 4M7PA 1VMKA 4J4HA 1A9SA 3GYBA 4RM2A 2JHPA 1GUAA 2XD4A 1JI0A 1LF0A 3O9ZA 4FINA 1UFOA 2VSXA 2WIGA 5FADA 5FFNA 1NP6A 3SGLA 2B78A 5IF3A 1VI2A 4JBHA 3VH4A 4P8RA 1IL0A 1T6BY 4PO1A 4URUR 1H8HD 3X1KA 3A6FA 4S35A 5JUWA 1VI6A 1KOFA 1NBMA 1VC2A 4KLCA 3TM4A 2EYQA 3T0GA 3C70A 1FRFS 4LVCA 4DJ5X 1RXYA 3PQ7A 1OYOA 5K03A 3STUA 1FUYB 4EGAA 5KB3A 1GRCA 1GPUA 1WUYA 4CMHA 5JY1A 1EK5A 3A3PA 5CVUA 1FLAA 1ZJ5A 3RVJA 1TT5A 2ORWA 3VFDA 2Q6LA 3WAKA 3L6CA 2O3RA 3ZD7A 4R69A 3AR7A 4R5HA 3OEED 1BE8A 3Q7RA 4CR8A 4Y6GB 3PQ8A 2P8JA 4NI5A 1Y1QA 4YYZA 2Y1FA 2ZUUA 5GV8A 4AL4A 1M83A 2WTEA 1YJ8A 5AM2A 2BKAA 3UMGA 3C1TA 3ZIUA 2SECE 1EQUA 1RWNA 1UP7A 2PZBA 2PUDA 1TEXA 2HQSA 5KQRA 1L5HB 3OQJA 2SHKA 5F3DA 1F2VA 1KJ9A 2OHJA 4NLLA 4ZT2A 5HK9A 5JALA 1FFBA 2FPGA 3CCCA 1P7VA 1FYVA 4F6RA 2G67A 2YJ4A 2I71A 3KSZO 1U04A 2BFCA 3R3ZA 3QEKA 3EXIB 4M9SA 4C4RA 4F60A 3FOFC 4ZYLA 1DCTA 4F3KA 4R40A 4ZCIA 4YBRA 1E2JA 4BV8A 2QTMA 5CHEA 1X13A 4UC0A 1GTSA 3TTSA 4X7BA 4P4NA 2LWIA 1H9BA 3BRCA 4CM5A 4EUHA 1E2HA 2C3PA 4WNAA 2VQ3A 2ZSBA 1C2TA 4M46A 4IQGA 2C3MA 4DWVA 4F5EA 3H2IA 4CKWA 1KMHA 5JANA 3NT4A 1QPGA 3TLAA 3KKLA 4GE0A 3FUCA 4NL4H 2HJWA 3O2JA 3Q85A 2NPFA 2BGLA 2FEXA 1MBZA 1KI4A 3KCQA 3OLYA 4ZO8A 5BV2P 1IULA 3VYWA 4CW7A 1O4VA 1JJFA 1U7XA 3GIDA 3JR7A 2CUNA 5A4MS 4JHLA 1ISHA 2EIXA 2PX3A 4GP9A 4YMHA 1COWA 1J24A 4X93A 3JYLA 4V0QA 3GA7A 4J1TC 2NUAB 4FNAA 3SKXA 3AXSA 3T99A 1E3LA 1WXFA 2QAIA 3LT1A 5G3ZA 4J0EA 4IUBS 2ZCUA 1ULBA 1AQJA 2ZQYA 1RYBA 1SUPA 1B00A 4DQLA 2I87A 3WLLA 5LYJB 3RIXA 1YWGO 4DIMA 3JWPA 4E3WA 3AF3A 4JBLA 2ZUEA 5THXA 2FWJA 2WD7A 3K15A 1I2MA 4FYIA 2IU3A 2P5SA 4KAAA 2AD1A 4UEQA 4DSAA 3RADC 2XYVA 4DDWA 3S5UA 1NTRA 1K4YA 1XZGA 5AOVA 3LOUA 4BZXA 5HHTA 1RZRD 1JLLA 4RGYA 2D4AA 2Q2WA 2IQIA 3O4IA 5HIAA 2H0QA 1FRQA 2W7TA 3E4CA 3RS4A 2CWDA 4RLSA 1JZTA 1XSEA 1YB5A 2BPOA 3U9SA 2ZP1A 4EG4A 2EFYA 4V0ME 2VEDA 3EVDA 4TN1A 4QAQA 3EUFA 5KDLA 1N5KA 3WLNA 4N4AA 1W9HA 3F3KA 1YS9A 3KTAA 4ND1A 3H16A 4QXPA 2PFSA 5TXGA 1UAAA 1L1EA 3N76A 4JUCA 1KMMA 5FBWB 3KKOA 3TRJA 1ZZGA 3VO9A 1XN1A 4TTRA 1Z2OX 2XDWA 2Y1WA 3U9TA 3UANA 5ERXA 1PQPA 3TZ6A 5TQJA 3RJZA 3G79A 4LF7B 2Q5HA 3KZ1E 4CCWA 5ITWA 4MV0A 2RH9B 2GEUA 4PX3A 3TTWA 2FOLA 2PQ0A 5CVJA 3KQUA 3PQ4A 1BCRB 3WE7A 3V3TA 4Q3KA 3MT9A 4E21A 5J47A 3L6DA 4GT1A 1LW7A 2XB9A 1CQIB 4NATA 1J06A 4RK5A 2C1EA 5LYJF 3GROA 1B4DA 1ZO8A 2PS3A 2SCUA 2Z8YA 4BGIA 5BSWA 3FTEA 3LHIA 3L7CA 1UKYA 3KYBA 4XRGA 5C8XA 2V0GA 1H2FA 4PLPA 3FYUC 5E6UB 3EEBA 4EYOA 1G2PA 3HK2A 2D1TA 1P73A 2F1HA 3H6HA 3OFVA 1CQPA 4Y6SA 5G41A 1Q91A 1R4MB 4JUDX 3U62A 4BE9A 2WU4A 1XTPA 4FNGA 1UOEA 4GXQA 2FPIA 2IP1A 5G0SA 3IR7A 2X0KA 1A9TA 3PQ5A 4Y1RB 1NURA 4TTTS 3D6TB 1LFDB 1JIQA 1L8QA 1QTIA 1XAIA 2H5LA 2HUNA 4EITA 2QUJA 3FW1A 4J1SA 5DN6A 5DV9A 4BP9A 2IUTA 3A8TA 3HFSA 1OASA 1F1JA 3RB8A 1G7SA 1OPRA 2D0IA 3U0VA 4CM9A 3EEFA 4HGQA 5A7FA 3AI7A 3BXGA 1T6ZA 3FD8A 1Q74A 2IHYA 4HQKA 1WRBA 3HSYA 5IVHA 5HTKA 3D8BA 1PKEA 4HDMA 4NV3A 1AMUA 2O5EA 1W94A 3UXYA 4Y0VA 3FBTA 2I7TA 3TL6A 4C3ZA 4RC9A 2F8MA 2XKAA 1OX4B 2PGNA 3FZNA 4QOEA 4NZYA 5MN6A 4IGKA 4JJZA 1D09A 1MO4A 3LHSA 4GPAA 1E2IA 3C6YA 5GGXA 1G3QA 1OFGA 4JVSB 3ETGA 4IWXA 3ABSB 3M5WA 4G8CA 2R1VA 4XKJA 1RRGA 2G1JA 2JJQA 4X7PA 2IYSA 1EX1A 2YMMA 5I7OA 3AWDA 3NBMA 4FD3A 1HGXA 1X0VA 1PK8A 2VHVA 1PR6A 4BB9A 1T34A 2VK4A 2YWGA 2VXYA 2KJQA 5TC4A 3PNOA 3AETB 4F5DA 5KTSA 2X6QA 3OQVA 4TV8A 5HGJA 5DK6A 4EYKA 2KW5A 4UCWA 3QEJA 1S3GA 3L1HA 3WIVA 4ARBA 2OORC 4X8OA 3WRVA 2O0KA 4R2HA 3LLVA 1G6HA 1T5TA 4ZEMA 1F2UA 3PCTA 5FCDA 2RCNA 3SMVA 2CSXA 3GRZA 1NLUA 2QV7A 4E5MA 1ARZA 1YQQA 5EIBD 1UJ4A 2GJAA 1SHUX 2D54A 1LGYA 3DOEA 2VYVA 1IJEA 3ZDYB 2QQ5A 5TEWA 1J8FA 4KI7A 1V7PC 3DQQA 1NYRA 1LX6A 1L5FA 2H2HA 3EC1A 3PNKA 4MRMB 3FIUA 4URYR 2XCLA 3SHWA 2D5IA 5FTMA 4XPZA 4Z6KA 5AUOB 4DIEA 4BJHB 1ZRHA 3I2KA 3SEZA 1KI7A 5E4YA 1JAIA 3TRKA 2HHJA 4RETA 3RRZA 2WJGA 3VU0A 2NIPA 3JYHA 2BEVA 3TAUA 2J48A 2G72A 1XX6A 1W25A 3VPDA 1LBTA 4BRSA 1K08A 4RJ2A 4XUGB 2D6FA 2Q8QA 4HTFB 2ZLBA 4BX9A 2JCXA 3GT7A 2UYQA 2CJPA 3B3JA 3GQBA 1XRSB 4IV0A 1O95A 2EX4A 4BJ1A 5HKOA 3IT1A 5GONB 3RC9A 3VZDA 1AKMA 3G6WA 1QCZA 2PZKA 1ZD3A 2ZVDA 3OJCA 1U7PA 3KYJB 5FOTA 2FHSA 3MBOA 3OQIA 4CLDA 1PSWA 3FLEA 4YIKA 1VCHA 5TVGA 2ZSEA 1ZRMA 4KLAA 1U1DA 3U4AA 3ZS9A 1T2CA 4R1OA 3R0VA 1BX0A 3KSMA 4MYUA 2P6NA 2C8KA 4IZ6A 5EIOA 2BM0A 3L0IB 3PIRA 4BGEA 1MC1A 1GUDA 2YJNA 2YXEA 1A8HA 3JD1A 4OFBA 2P30A 4A73A 3TQRA 1RQLA 5CX1B 4UZFA 2V6JA 1D2GA 5ABPA 1FLDA 3PVSA 2ZR8A 1GUZA 4GP6A 4OJNA 2RH8A 3W6PA 4DE5A 2WG2A 3QXJA 4WN9B 4OUKX 1UPCA 2P2LA 3F71A 3VPHA 1KPGA 1L4FA 2FUCA 1PEYA 1UH5A 4K9SA 3PL1A 4FFDA 2I2WA 4GMFA 2OKCA 4HMOA 4MVCA 4ZQEA 5A5VA 3EVZA 5DI3B 2OG1A 3ZZTA 1V5EA 4F4FA 2ZQ5A 5M3BA 1PVOA 1T2EA 1LPBB 3G59A 2BHLA 4WASA 4MWZA 4B17A 5MDHA 4Q37A 1USGA 1DRJA 2O1SA 3ZQUA 2CLIB 1TIKA 2AR7A 3IUBA 3KQPA 4ZQBA 4AF8A 4BO4A 4CDNA 3OZIA 4KQHA 2M6KA 3C97A 4PGGA 3MJEA 1BH6A 5CP8A 4E2YA 5GONF 4HB0A 4M9UA 3TJMA 2VHXA 2EJBA 2EX0A 3TR5A 1UJ6A 3K4PA 3WFIA 5JBNA 2GWHA 3QVLA 3UCFA 1SG0A 1H2ZA 2QLLA 4IUYA 5DCWA 2OCDA 8AT1A 3CLHA 2YFQA 1JEOA 2DERA 2C57A 3OZXA 3IV6A 1RAGA 2NO6A 2OYSA 3FNFA 3LKBA 4JLMA 5ALJA 3PUJA 1PK7A 3RHSA 1N2CE 1ZONA 1UKAA 2OPBA 5EIWA 3EIOA 4TM8A 1P7WA 1OIXA 1NUQA 1R3UA 3DMGA 3BULA 1MN6A 4K6MA 4JD5A 1ZN9A 3HBJA 3M8KA 2WAYA 4MQ5A 4V2IA 2DY1A 3E48A 4LHSA 1W6RA 3IVXA 1SRQA 1I13A 2JFYA 3K20A 2O7VA 4LIPD 4M0DA 1L7RA 1XE3A 2C9BA 3K1AA 4A16A 3LUFA 5F7JA 2PY6A 3AF2A 3MWGA 4IKOA 2FWNA 3G49A 4IIJB 4JXZA 2EKBA 1FVXA 3MGCA 2MSLA 4YCDA 5KYXB 3CW8X 4RTJA 3SEFA 4A8JB 1KI8A 1GJRA 1LJLA 4Q4CA 3OT4A 4QFMA 1K7XB 1BXKA 2XADA 2I7XA 4PS0A 3WDSA 4XR9A 2HA4A 3KSUA 1WV1A 2VZ0A 1C8VB 2CVZA 2GASA 1CK4A 2GYWA 1WLYA 2IZZA 2O7RA 4FYKA 3ORYA 4H1HA 3PR3A 4MS1B 3MWDA 4AN0A 4WK4B 1D1PA 2JLCA 3IEMA 1FYEA 1S2DA 4RZHA 5IMSA 4ON9A 3PHIA 4U1RA 2PZGA 3FTCA 3VHQA 2WRZA 5HRUA 3JYQA 4YAUA 2DSNA 1THZA 2KPOA 4IMIB 2W43A 2BEWB 3GDOA 3CM0A 1T91A 2ICAA 3DS8A 3SU8A 3AJRA 4RSMA 4W9NA 5IMBA 4YRBA 1YQEA 1TCCA 1ZC4A 2WPDD 2WTXA 3B60A 4U7JA 1NSTA 3UOWA 2R66A 4M0UA 4O4IA 4UM5A 2D7CA 4MICA 1L1QA 1YB6A 4L08A 1CV2A 5EZYA 4M98A 1VIAA 4ZGWA 3SQNA 1QRTA 4R3WA 1ZA1A 2WA2A 4R8LA 3QTLA 3R77A 4TX1A 4Q01A 2PL1A 4A0HA 4EO4A 3NIGB 5ALNA 1BO6A 4V0MA 4G0OA 3WRXA 1XQ6A 1K6IA 2BF4A 1EFPB 3O03A 3ORRA 4HWRA 1AQUA 4P5DA 4TLCA 1LBSA 3I76A 1B1AA 3KYDB 3WWPA 3ILVA 4LV5B 4UNNA 3WFJA 5F5NA 2KLBA 1F0KA 3OKPA 2DJIA 4WFJA 1TA9A 3BWXA 3AFHA 4G4IA 4IIJF 3TRFA 4C2TA 3I1IA 2CMKA 1AVTA 3KHSA 5K3DA 5BSMA 1CEEA 3GLUA 3X2SA 3LTNC 5EJAA 3BRWD 5F4BA 4UQOA 4ZDIA 2VBIA 3R74A 4EY6A 3EBPA 2A88A 3WSWA 2VTBA 4CF6A 1SMKA 4DEYA 4KDEA 4LHXA 5T8KA 3ONWA 4AMYA 2OZLB 4H60A 2I3GA 3VUEA 4NCHA 2JGFA 3RC3A 2OWDA 5ADUS 2Z3VA 5CCXA 4HWGA 2RC6A 1P7CA 3HFGA 2ZXEA 4P4LA 1HYEA 4HZUA 5TJ9A 3CW9A 4HEHA 5DISB 3RK4A 5HOEA 5TDHA 3C43A 1NRXA 5TR9A 1RABA 4OQYA 2JK1A 1ISIA 3KJFA 1NJ8A 4WOKA 5LVAA 4F3TA 4TLEA 4B5KA 4GR5A 1G5RA 1SHKA 1UANA 1GL7A 3QU4A 4YACA 5CBKA 1Z36A 2FOIA 6AT1A 1AU9A 3CNEA 1THGA 3PHCA 4NEGA 1GPWB 1P7YA 3I1YA 2AOTB 4QU9A 1XZPA 3QUBA 3C6XA 3ME5A 2WFZA 1MXFA 5BSFA 3HU1A 2PL3A 1ZGJA 4IDFA 4IY1A 2DCUA 1GCOA 4YJGB 4OI1A 3TUIC 1E4VA 2AFHE 3DAHA 2CYBA 1OWMA 1WO8A 2E37A 3V8VA 4UNPA 4JC0A 2VSNA 2QUBA 2ZK7A 4GSLA 4R2IA 5EJ4A 1C14A 1SQ5A 2HF9A 3NUZA 1VSBA 5BOVA 5C8YA 2QM3A 4EMSA 4R9RA 1CQWA 3VPFA 4DRZA 4DXAA 5M7EA 5A1TA 1KNXA 4B9EA 4OLFA 4F2WA 1KJ8A 2Z09A 2IU0A 3SC6A 4H08A 2QVXX 2ZYVX 4HHEA 3Q7SA 2BFEB 1WZIA 3DZ8A 4MR9B 2A5DA 3KQQA 1EP3B 4OA5A 3N07A 1P1CA 4QTZA 2VNIA 4H59A 2IU6A 1Z4IA 1MORA 2VXCA 2OCBA 4J7AA 1VKZA 3C4QA 4NFLA 4US0R 4PCUA 4X63A 1U1FA 4EDHA 1UFKA 1B93A 3EG5A 4C0KA 1RLMA 4ZRDA 4PNEA 3CJRA 1N2JA 1OFUA 3V8EA 3VYRB 5BMVF 3C39A 2GBPA 5C3MA 3CLKA 1CY8A 2RBKA 3QVJA 1DXOA 1JEQB 1SWWA 3G68A 3RAGA 4DUGD 4JC8A 1MB3A 3QWBA 4DCCA 1AQIA 1SWVA 3UXHA 4ZICA 5GTDA 5KKNB 5IC6A 1RM3A 3KTOA 4MS4A 4Z9XA 2OOSA 1K5GA 5DN9A 1GNSA 1ATZA 2XGGA 1QG6A 1EGQA 2Q4OA 3H86A 1JG2A 4LYYA 1P9OA 1T15A 1THMA 4LDAA 4PSCA 5EESA 3IPAA 1ZMRA 2CJYA 2I6XA 3Q7QA 1CP3A 1Y89A 2J9FA 4W1QA 4XWOA 2YIDA 3AVQA 4EKIA 3D0KA 4QSMA 3T3OA 1XP5A 1P4SA 2COEA 2J09A 4DR6B 1L2TA 2VNSA 5K6TA 1CDDA 2AXQA 5BUCA 1OW3B 5FPQA 5L4LA 3D9QX 5FI0B 3M82A 4MDHA 3LMKA 3ESCA 4PSUA 3I6ZA 1MVLA 3I6QA 1PFGA 5J4YA 2NYVA 3B8HA 4G0WA 4G0UA 1ZH4A 1N33B 1G21E 1DADA 1N8TA 4ZKEA 1MJGM 3Q5GA 3RTGA 1IXKA 1Z6TA 4RJTA 4B32A 2LZ0A 4MUEA 4EHIA 4XQGA 3DONA 1YVPA 2E1RA 2W8ZA 1HOTA 1HZJA 3I4LA 3BL6A 4Z3OA 1T0JB 2Y1OA 2OQRA 2WT8A 3P5SA 4P1ZA 1ABFA 2RSLA 3VR2A 3Q15C 3L0SA 3MT8A 3WIOA 5K0EA 2H1FA 1EIZA 3TNLA 3I83A 3ANNA 4OK6A 2IOQA 5CLLA 1PL7A 3R0QA 5BR8B 4QQFA 4Y6PA 2P4QA 4ER7A 2L19A 5JI3E 1R6TA 2JH8A 2H7XA 1U7OA 4DCTA 2HADA 2HMVA 3FPGA 1C3EA 1ODLA 2JRLA 1DJMA 3HNOA 3AHEA 3UWOA 1GILA 4NYJR 1JG7A 3D5EA 3FJYA 1ESCA 3KZCA 2HQ1A 4KQCA 4RZUA 2QSZA 1LPMA 2J3JA 3NEPX 2QX9A 5C8DA 1H2YA 3WBKA 3UICA 1PG2A 1VQ1A 1RJEA 1OBFO 2DH6A 3OX4A 1H23A 1ZD4A 3SR0A 1F0NA 5JRJA 1C7RA 4ZAYA 3G9XA 4E5SA 3PI7A 3GBSA 1CZRA 1ZXXA 2PYDA 2VDVE 3OQ6A 4F21A 5C4IA 4O1HA 2ONCA 3OJXA 4UJ5A 1BCSA 1XRMA 4IQFA 4AECA 4OIMA 3RGGA 4RIGA 1QKKA 3GFQA 5HK8A 4M0LA 2CDAA 2OCAA 3EXEA 4RVGA 1WXHA 6CHYA 3NP9A 1G8AA 5JAHA 2WAOA 1FXUA 4GR9A 1WBBA 2Q8NA 1VPWA 1GT91 3ASYA 4Q93A 2JEYA 2CY0A 4WFIA 1IXSB 4AO8A 4UNQA 5C5IA 1HDEA 4DBVO 1PI3A 3RV3A 1KRWA 2W2QA 5D00A 1XHFA 1IOLA 3GLHB 3IXLA 2QM7A 1NBMD 2G8NA 3CSDA 5YASA 1T9GS 2Z8XA 3OJFA 5FWXB 2I6QA 3G0HA 4FD2A 1SBZA 1ZIXA 1FEZA 4R3UC 5TARA 5KBYA 1IQUA 1DTWB 1D04A 1F1BA 4CR6A 3PSHA 3O95A 4JOCA 1SCJA 5CEFA 1BE1A 1PFVA 2JIBA 4JSTA 1RYHA 1XZEA 3CZAA 4N3GA 1OY1A 5DIZA 1V5IA 1N25A 3BA1A 3M6WA 1ZU4A 3PRYA 4JI2B 1K6XA 3G2JA 5FUMA 2KYRA 3O38A 4MULA 4ZDWA 4QG3A 4FYJA 1N2CA 1DFHA 2FETA 2R4TA 4X3CA 3AKCA 3KLNA 1HC7A 4M87A 5DYGA 4D0GA 1EP9A 4B3GA 1TYZA 3P0EA 2ZIVB 4B35A 3R7NA 5FBLB 3ROTA 1S8AA 1W2HA 2O7SA 2ZYAA 3IJPA 3FYUB 2OHOA 5JCJA 1IXZA 1NATA 3I53A 3O7MA 3JTMA 1ZMBA 2RH4A 3IKMB 4UAVA 1TO1E 4DXDA 4RDXA 2XD9A 5JZ9A 4IDCA 1KKLA 2C8LA 2Y0BA 2F3UA 4PXYA 5AK0A 3WGHA 4J3FA 3ACDA 3FYCA 2QZSA 2ODNA 3GFPA 1P1KA 2QD3A 1NF8A 2DAPA 2JFBA 3GFSA 3WL7A 3ZWPA 4OGFA 3V48A 4EGQA 5CIQA 4EZEA 5DTEA 2ZJBA 3TJZA 2YXBA 2I6TA 2Q3HA 4PYJA 3DMDA 2QRMA 4Z9AA 3OZSA 5JZBA 4HAYA 1RC8A 2NUPB 1VLMA 3P2EA 4C07A 4ZVNA 4YQEA 3HO6A 3BMNB 2IS2A 3M9XA 1GNRA 2DHDA 4M9XA 1XEWY 2B83A 5G53C 2IHUA 5AW7A 1ZVQA 2A30A 2XTMA 3O1JC 1GPAA 2V6IA 4W5OA 3BFXA 5H1YA 1RP7A 2H1OA 3BDVA 2JJ8A 4I9HA 3THYA 3H3FA 1NDHA 3MD0A 1DG9A 2AFIE 2CB9A 2I3BA 3K53A 4I08A 3CUSA 4G1EB 4P80A 2VPZA 2PKWA 4GE3A 1X7XA 3WZ2A 1HETA 1GL3A 1ONBA 3BH0A 2CDBA 4ESOA 1PR2A 2FMFA 2FP3A 3EAFA 3IIJA 4UXHA 1OTHA 3JQ7A 1BHO1 1EHYA 1DWQA 1JB9A 3EJWA 4YV2A 4BNJA 4RV9A 2H2FA 3C6MA 3DBLA 4MUAA 4JT8A 4Q4HA 2VTVA 2XWQA 4Q15A 2A86A 4QDZA 2RHRA 1BNCA 5K45A 2QYHA 1A8IA 1L5YA 1FU4A 2CLSA 2F2TA 1RP1A 2V8BA 3A2MA 2PJDA 1C1DA 3EEYA 4HRXA 3LP5A 3B12A 4IO0A 3TRIA 4V0LA 2GJ9A 3N2GA 5TJHA 4LYHA 3T7TA 3UEOA 4D8UA 1DWOA 3OJ0A 5GIPE 3OY7A 5GMOA 5FTKA 5K4GA 2YY7A 4FFPA 4JYBA 1EVYA 4LXTA 2HMSA 2J9ZB 2PU5A 4L4SA 3UM9A 3ZJYA 1Y33E 1U7ZA 3CN7A 3KUDA 4JJ6A 4K6GA 4P33A 1JYEA 2C5BA 3QNMA 4NZ9A 3SY8A 1TA4A 3TQIA 4DCMA 1SKBA 4JKOA 5CGQB 1Y3CE 5TT1A 1CFZA 3GBVA 2QMOA 1A04A 1PDOA 3JAWA 4C5AA 1TB4A 2I2XB 3I0MA 4Q9NA 1M33A 1UOQA 1Z18A 2AG1A 1FFYA 2A5JA 3VR3D 1NYQA 1KY4A 4DWJA 1TJPB 2VJQA 1TL7C 3GA5A 4NBUA 1EVIA 3ND5A 4FDTA 5JSHA 2V6MA 1YZGA 1ODSA 2WEKA 3AJ9A 4NCIA 4XB1A 2EGGA 1J56A 4PANA 1YHYA 1L7OA 4QTYA 3BTOA 1Q83A 1RAFA 1IXRC 4O2AB 3DFZA 2IYZA 1PP4A 4ZU6X 2FP4A 4AZ0B 3PJDA 2C9OA 3TXAA 3WKBA 2BONA 2E1PA 2H9AA 3D3WB 4HPJB 4MMYB 5EJ8A 1YI1A 1ZK2A 1MENA 3EPRA 3R6WA 1Z6PA 5DSTA 2AFHA 3ZJ4A 4C06A 3KE9A 1MAWA 5EXXA 3OLWA 3C74A 1MV8A 2PGOA 3CE9A 3BN3A 3SX4A 3WNQA 4CNBA 6GPBA 2DR3A 1JR3D 3DCJA 3IH5A 1JPJA 2CXTA 1PW7A 4UHEA 3HXQA 4IG9A 3AF4A 4L9WA 4PLYA 4QOFA 2RHDA 3QPCA 4I2VA 3VKHA 2OMKA 1RCTE 1KFCB 5CVDA 2NVBA 2R5NA 2YWFA 3CW2A 5DTIA 5KAMA 2VDOB 3P2IA 4GGPA 2LR0A 4ZALA 1HE2A 1D8AA 4EUEA 3ABZA 1R0SA 1JXOA 1KPHA 3IDOA 4WVFA 6Q21A 1T9GR 4AUEA 1A82A 1GHTA 2ZT6A 3KQSA 4U8HA 2XR1A 2EHDA 3WFZA 1VSUA 3OLZA 3RRYA 2R9VA 4D9HA 4P7KA 4EGJA 2Z0MA 3I30X 4WBNA 1M7GA 2VQEB 1W4LA 3MCVA 4MQMA 3RVLA 3I9KA 1EGMB 4QDXA 3AF0A 4DV7B 2ESRA 2AF4C 2GX6A 4CI0B 5K99A 4N5HX 4PGFA 2JIPA 4XAQA 2A8YA 2Q9AA 3ZUGA 1LDYA 1QHHB 5K09A 3THOA 3SVLA 1HDYA 4FBMA 1N5OX 1Q1ZA 1YR6A 2RI1A 5ER9A 5AWFC 5CD1A 2PAAA 2ZRPA 3AYXB 4U0KA 4EF5A 2BLNA 4MVJE 1Z28A 1TQ6A 5BVGA 1K8YB 4IH9A 3DEAA 2NU7A 1YR3A 3QYAA 2CYAA 1HEYA 2DRIA 2XDAA 5GWXA 2C7PA 3ZGVA 2BUAA 4OXRA 3FOAA 5DP2A 4F3RA 5B6JA 3HU3A 3PXUA 2HK8A 2WFLA 1JT9A 3Q8WA 2PWBA 1TT5B 4GDFA 3FLMA 2JLYA 4AS3A 2J0EA 4E31A 1G21A 4YRSA 1GDHA 3SZMA 1P6UA 4YMUA 5EINA 2O0LA 2X0NA 3BK7A 2CFRA 4TL6A 1PJLA 2OAP1 3S2GA 1SXIA 5LL6P 1TQ4A 1NVDA 4KRGA 3WK4A 1RYMA 1DINA 5C0OE 4C0QC 4ND6A 3NQ41 4AX4A 2R5FA 2WWRA 2FPGB 4K7JA 2CL7X 2ZREA 4HLNA 1UMDA 4ZPXA 2IK8A 3GQVA 5E9QA 5J5VA 4S0XA 1NI4B 4NBKA 4AN1A 2VQDA 3KSBC 4ZQHA 1K1EA 2VYVD 3CGGA 1IZ0A 4D80A 1O2DA 2IKSA 3NTUA 5EJ5A 5TQ2A 1IPFA 2HDNB 1Y3FE 1W1WA 1V7CA 1K8RA 4HZIA 3SXJA 3G8DA 5KYTA 4WNAB 1GN8A 1Q1NA 3MPUA 5H8WA 3KSDO 4CKWB 2GK7A 2IDZA 1KMHB 1XPUA 4X1YB 2QW0X 5MFZA 2G6BA 2Q5LA 4RQBA 4DT1B 1NNUA 1WDWB 4YRNA 4ARVA 1RYFA 1XRJA 2P2YA 4UOQA 1YKGA 4GUDA 2FMUA 1GPKA 1CDEA 3LOQA 2WNIA 2IE8A 2WAMA 1AGXA 2KHZA 4CCAA 1LLQA 2BDEA 2Q99A 3RTAA 4JBXA 3DP9A 3OIVA 3N6VA 3VKUA 3F2IA 4LISA 2QE7D 1ZH2A 3N5CA 5HF9A 4H0NA 1ZS9A 3URMA 5TPZD 2PBZA 3WBBA 4C89A 3HV2A 2OAQ1 3GFRA 4BNMA 4Q7MB 3L7KA 1H66A 2AB0A 4WX2B 4WOBA 5ICFA 2F3TA 2EZ9A 1XROA 1G64A 3NORA 4EJ0A 2C4TA 1EZ4A 2WD7B 2A5YB 2GKGA 4UHDA 4LNAA 3UBMA 5I9NA 3MWFA 4RVUA 2B8TA 2XF2A 3I3SR 4RGVA 4D96A 5I4IA 2WQ6A 1Y3BE 4AJNA 1V43A 1NG1A 2EFJA 3E81A 4HDNB 4Z3KA 3CCFA 1IC6A 3IYLW 5LQSA 5CB6A 3EUEA 2BDUA 1JLLB 3IILA 5LJIA 1Q0RA 1VOTA 3TSCA 3T06B 4ISCA 4G01B 2AMJA 2WIDA 3QMWA 1R4NA 1AKEA 1G8HA 1M9NA 1R10A 2ZI6A 3L18A 5HQ3B 3T1VA 2AG6A 3DM9B 2IYNA 2O3JA 1DQYA 3H5VA 3KTAB 1EFVA 3Q6IA 5EKXA 1OWOA 3WLPA 3ZHXA 1C4OA 1RWXA 1JEDA 2PH1A 3JYNA 1KQPA 3QMVA 4LX0A 1OCEA 3SFVA 2PBFA 5CA1F 5KYNA 1UEJA 4OSEA 4L15A 3KKPA 5F64A 3TEFA 1O08A 4QLBA 1NR7A 3OJLA 4L7VA 2YASA 2YY5A 3FETA 4HB2A 2RIPA 3EGDA 1Y8AA 1U65A 3IDZA 4PZCA 1USVA 4FJ0A 1KBOA 3FRHA 3M1LA 4P7JA 1ZGCA 4RVSA 2OFOA 1KDTA 2OCGA 2X5XA 4G9GA 1ONOA 2Q21A 3ZU5A 2HI0A 2H51A 3LBAA 1YSCA 5C1OA 2NTJA 4LX8A 4LOJA 1G3IA 3WA7A 1E0AA 2F7SA 3ESBA 1EBUA 2P7HA 4ZAZA 1WPRA 3G6KA 5JU6A 1F6BA 4UDYX 3IPXA 3AG5A 1TM1E 1HFKA 1TT7A 3FR8A 3E84A 3LJKA 4LRYA 2AOVA 4EGCB 4ER0A 3I3OA 4K2HA 4KU4A 3U1TA 3ZW8A 2ZANA 1JECA 2IYRA 2RBEA 1RRPA 2BC9A 4LXXA 3D54D 4FFLA 5IYZA 1MH9A 3M4YA 2WHPA 3IHTA 5FBKA 2GXSA 3EA5A 3Q88A 2I80A 2ZPUA 2J45A 4NEQA 4B3BA 3H5LA 1ECJA 3OP4A 3ZV6A 2GCNA 1SC4A 3DOIA 2PJZA 1Y48E 2I99A 4K03A 4WN3A 4EAAA 5JYEA 1Z62A 5EOVA 1F51E 2ZUVA 3GC6A 2FPIB 2IX3A 1CHNA 4Q3OA 1IMJA 4LY9A 3T7KA 4UTVA 5KYKA 2O57A 2XYPA 5FOUA 4B44A 1U1GA 2IOFK 1QGUB 1GYRA 2Q07A 5IARA 3STTA 3AVYA 1TUBA 1NR5A 2FZEA 1QZXA 2AFIA 3WLIA 2YZ7A 1Q1QA 4CKZA 3CNOA 2JAQA 3S2EA 1JP7A 3LQ4A 5GOZA 3S40A 3VYSB 1A88A 1JDTA 2JVIA 3BWCA 2JD2A 4CMEA 1H3EA 3THSA 4FKMA 4HDMB 3DBRB 2Z2YA 1N4DA 3KP1A 3FFAA 4LDJA 3UAOA 3WL3A 4E30A 3IOEA 2H2IA 2E6KA 4KX5A 1EGAA 5B30A 4UXIA 4I50B 2J3IA 4KFUA 4ZI7A 5IPFA 1P74A 2GRUA 5AKEA 3H04A 3LWBA 3O8RA 1XYGA 1J39A 3PYXA 1QE0A 3MYRA 2QBYB 1GVHA 3HZHA 4C0BA 2WWXA 2YIMA 2I1QA 2WF7A 1YMVA 1M2GA 4I5EA 5H9VA 3I8SA 2OEPA 1N2SA 4BLOA 3BT7A 3ENNA 5D6OA 4L4RA 1W6UA 4R83A 3G0BA 4QYTA 3NGLA 3VHXA 3GN1A 1IDN1 5EJIA 4OMUA 4TV8B 5I7SA 4C4SA 4YCBA 3I8OA 4FQ7A 4GBED 2QZPA 4Q1CA 5DASA 1ENPA 1UC9A 2AN4A 1PR9A 5FKJA 1RJGA 1T1SA 4IR7A 4JT4A 3A1CA 1T8SA 4HDOB 2QVBA 4PCAA 1WXDA 2HM7A 5KMGA 1NI3A 4Z9FA 3BWYA 2WE7A 1ECFA 3WDMA 1N36B 5EG5A 3AOEA 3QWHA 1MAHA 4A23A 3BL5A 2DBZA 3MK31 1FXWA 1AV6A 2BHTA 2HFKA 4GX5A 1D5WA 2FY8A 2AMYA 4C2BA 2XVXA 1N5LA 2BAGA 2GLXA 1H8ED 3G17A 1S2GA 5LCXA 2VZEA 3JD0A 3JQ8B 2DQYA 3ITDA 3Q1KA 1XKLA 4XWAA 3ZLTA 1NOKA 1E69A 4D25A 1OI4A 3TECE 5DCLA 2VDJA 4J2HA 3LIIA 1K2WA 5EL0A 2VHYA 2Y27A 4I50F 5EYPA 3QVMA 2JGLA 3GG9A 1EDBA 3IAHA 4C0LA 4KMSA 1E92A 2X9LA 2V7QD 3KDPA 3N59A 3R2JA 4L5JA 4WCFA 4Z4HA 2GM4A 2X4IA 1JLMA 3VPAA 3C85A 4DSNA 1ZR4A 2HIAA 5IUJC 3GZNB 4JUFA 4NENA 3VR4A 3BB4A 2VSQA 4QRDA 4RHYA 4GLFA 2C0CA 2V03A 1VPLA 5B7NA 4LY0A 3AZQA 4V1CA 5LYYA 4HMPA 4YUAA 3HYNA 5LA6B 1Q6ZA 2COUA 2F9MA 2GEKA 5B3JA 1ZW6A 3TL2A 1RC0A 5K4HA 1XAGA 4A2CA 2W37A 5BSEA 1B2LA 1M2VB 1OH6A 5K3EA 3DZFA 3NBZC 3INTA 5CITA 1NMEA 2N1MA 1LUAA 3RGWS 4U2KA 3G82C 4DLLA 3ZU6A 5HW0A 1NNLA 4K86A 3LX5A 1G20E 3DKRA 4KQKA 3N0VA 3P52A 5JD3A 3ABOB 3L46A 4I1UA 2I03A 1LB1B 1TTPB 2ZT8A 3INYA 2VI5A 4BQSA 5K8LA 3FOZA 2Z30A 3MTIA 3L49A 1RQ2A 5GM1A 4ZYXA 4P4SB 1UKCA 2H9YA 4EA7A 2XDQA 1P0MA 3GMIA 3BTVA 3BX1A 1VJRA 4PQRA 2O5CA 1T4BA 5IG2A