1FJ2A

Crystal structure of the human acyl protein thioesterase 1 at 1.5 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
229
Chain Sequence
MDPEFMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human acyl protein thioesterase I from a single X-ray data set to 1.5 A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (ACYL PROTEIN THIOESTERASE 1)
total genus 70
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.4.39: Alkylglycerophosphoethanolamine phosphodiesterase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fj2A00
1TIBA 2XUHA 3ZWQA 4M0FA 4DM7A 1FJ2A 4H7FA 2WQZA 2R11A 5AM4A 3AZQA 3C70A 2YASA 2WTMA 2QJWA 2CUTA 1W76A 1N5MA 5K3EA 3JWEA 4JNCA 1GZ7A 2HDWA 2AJ8A 1JU4A 1F8UA 2OCKA 4IH4A 4FFWA 4H18A 2Y6VA 2GBFA 3R3VA 4EA6A 3VJLA 2RHTA 5T4BA 3A2MA 5ALJA 1TK3A 1Y7HA 2ZYRA 1GQSA 1YS1X 4J3JA 1UOQA 1CIJA 3KWFA 4N5HX 4QWMA 3L1IA 4ZXFA 1CUWA 5LP1A 5D6OA 2PU5A 1TCAA 2CEKA 4W1RA 4RNCA 4KJXA 4J03A 1FFBA 1QIDA 1QO9A 2PBLA 2XMSA 1D07A 6YASA 4L3WA 5ALYA 2H1IA 2WIDA 5ALWA 3STUA 5ALVA 4DMHA 3DCNA 4CIBA 3CCBA 3WKDA 3WA6A 1O6GA 5SYNA 5K3DA 3G0CA 1W52X 1HQDA 4DLNA 5ALOA 4ETWA 1UT6A 1YASA 2R8BA 3VVMA 5A7GA 1CFJA 1Z68A 3GELA 2BJHA 4G4JA 4DSAA 4Q34A 2DHCA 1CV2A 3CCCA 4LIPD 5IVKA 3X3HA 2XB6A 2O2HA 2VF2A 4W1SA 1DWQA 2VQ6A 2OAEA 1CQWA 5I9IA 4FTWA 4BCCA 3TEJA 1MT3A 4G1FA 4C87A 2WJ6A 3G9TA 3ZLTA 1TCBA 1XQXA 5A6VA 2W6CX 4ARBA 4D9JA 1W4LA 2QS9A 1TQHA 2G63A 3GUUA 4F0JA 2OPHA 4FBLA 3HRHA 4OPMA 1EINA 1QE3A 3DOHA 3C6XA 4MYDA 5EGNA 4F21A 4UHFA 4QDZA 5AIAA 5DYWA 4B80A 4KRYA 3I6YA 3ESCA 2WU4A 3G9UA 2OQVA 3VXKA 4J0HA 3ILSA 3A2NA 2Y2UA 1CRLA 4CI9A 2OQIA 1Y37A 5AM3A 5DYYA 1M33A 1GPNA 3E0XA 5E4JA 1CPYA 4X90A 3DOIA 2WKWA 1ZJ4A 1TAHA 3N0TA 4M0MA 5FPPA 3WL8A 2ACKA 1DWOA 1X70A 5AI9A 1UK8A 2ONCA 1CUAA 4I4CA 5ALLA 1JJIA 3C8DA 3FSGA 3A70A 3IDAA 4GWLA 2EEPA 1XZIA 3NUZA 5AI5A 4AMZA 5ALQA 1GQRA 2BAGA 5AM1A 5BWBA 1QJ4A 3DEAA 4ZGBA 1ZI8A 4GI1A 2JBWA 1J06A 3YASA 2HRRA 3KDAA 4FMPA 4H7HA 2H7XA 4HZGA 1WB4A 5BWCA 4RE6A 4BCBA 1ZD5A 1YR2A 4U2FA 4G9GA 2XMCA 4L72A 1BE0A 2AJDA 4NZZA 1FFCA 3WWDA 3H2KA 2WJ3A 3KXPA 3FLEA 2JGJA 3F8SA 4FLEA 2VJAA 4FHZA 5LLSA 4OCZA 2OAGA 3ZLVA 1XQYA 3G8YA 3E4DA 5JD4A 4F5ZA 2C58A 2I3ZA 1DT3A 3LIIA 2HFJA 2O7RA 4MWTA 3R3UA 4Z49A 3BL8A 2ZJFA 5KWIA 1ZGBA 4KE9A 2QVBA 3DL7A 3IUJA 4E46A 3AIMA 5D3KA 4LHEA 2XUDA 4XVCA 1ZD4A 3EQ8A 2WJ4A 2OG1A 2DQYA 3QMWA 2V9ZA 4GBGA 3D7RA 4Y2SA 3HLKA 1GT6A 2YYSA 1CUEA 2XUJA 2ROQA 4H77A 3W04A 5AI4A 1IZ8A 4G5XA 5CTAA 5IVIA 3W9UA 2XUOA 3LLCA 3SWWA 1CUBA 3PDCA 4H7JA 4OD0A 1CUFA 2HADA 1DQZA 5BOVA 4NMWA 1A7UA 3D2BA 3AILA 3NWOA 2VJCA 1GXSA 3RARA 1AMNA 5DTIA 3JYHA 2GYWA 5LYYA 5IVDA 1VA4A 2WHRA 3O4HA 1LPOA 4BCDA 5ISMA 1WM1A 1DINA 2DHEA 4PF1A 3RKSA 2E3JA 3F98A 1E89A 4QEKA 5FRDA 1QGED 4MQMA 1BEZA 1P0QA 1XRPA 2OLEA 3R3WA 2PSDA 2EDCA 5AI6A 2PKYX 3W06A 1E8DA 3BWXA 2RGUA 1LPMA 2BFNA 3MUNA 3BF7A 3C6BA 5DNVA 3DQZA 2WFZA 3DDUA 2PSHA 3V1NA 4OUKX 1BU8A 5JARA 5AOBA 5AKYA 1VXRA 3C45A 3G0BA 5FLKA 3DKKA 1AURA 3H0CA 2WU3A 4ZRDA 2LIPA 4EY4A 3WKCA 4WJLA 4OYYA 3FCXA 1ZICA 3I2FA 3L1HA 4IQ4A 1R9MA 4ZV7A 5AKZA 1ETHA 4MEBA 5ALEA 1LGYA 5ALKA 4XX1A 2XMQA 4X7BA 3U1TA 2GBGA 3KSRA 5AK6A 2ACEA 2WFLA 1LPPA 3EIOA 1IZ7A 1CUGA 2DSNA 5A2GA 1QFSA 2OCLA 3HYSA 3QH4A 1DT5A 5EIEA 3FAKA 5CH8A 3FCYA 1OXMA 4HAIA 1ZD3A 4BB0A 1YAJA 2XQJA 5JZBA 4J0DA 2AXEA 3A2LA 4FNMA 3OPMA 2IX9A 3D4LA 2CBGA 3WMRA 1GPLA 3JW8A 3FVRA 4UFOA 1QZ3A 1L7QA 3OURA 3ESBA 1XRLA 1CEXA 1B6GA 2J3DA 5IH7A 4BBZA 5CRIA 5AKJA 1JI3A 1W75A 1CUJA 1WHSA 3AJAA 2Z3WA 4EBBA 1GGVA 3EQ9A 4BC1A 3QPCA 2B61A 1EVEA 2CMFA 4MWSA 1S8OA 5K3BA 1XZBA 5CXXA 3F97A 5HF5A 5KBYA 2RAUA 4ROTA 2PU7A 5A71A 4L9AA 1EH5A 4AO7A 1HLGA 1LZKA 3ZI7A 4BDSA 1XQWA 1U2EA 5LZ7A 4B81A 3H2GA 3SX4A 1VOTA 2QRUA 3H2JA 4H0CA 4IH1A 4UBJA 2H7CA 4K6GA 5JATA 1THGA 2XMZA 4BP8A 5CURA 5CXUA 2HA0A 5DJ5A 5AP9A 4K6HA 2D0DA 3VVLA 4CCYA 4U2BA 3IVMA 4B83A 4DMKA 2ZYHA 1GPKA 2FJ0A 1XLVA 4BAUA 4MEAA 4N5IX 2AJCA 4DSZA 2DR0A 5D7BA 3NGMA 1K4YA 1MX9A 5A7HA 2FJPA 2C5GA 1WB5A 1XZKA 4B84A 2HL6A 1YSCA 1DWPA 5KWJA 1EXWA 3DKRA 3I6MA 4KACA 2GZSA 4M0EA 2OGSA 3D5EA 3F96A 4GHWA 2IITA 3IA2A 1K63A 1ISPA 3GFFA 4G8BA 4BATA 4UBIA 2JGLA 3FYTA 1UZAA 3QMVA 3LP5A 1PV1A 2GBIA 2P8SA 4KE8A 2OXEA 1HDEA 5ALNA 2HA4A 1HBJA 5AM2A 3QMMA 3QITA 2JGEA 1JMKC 2QMQA 4J0IA 1LPAB 4YK7A 1UK7A 3F9CA 5IKXA 1ZD2P 4TVKA 1YB7A 4WFKA 2WTNA 1CVLA 4ARAA 4J0JA 2ORYA 1DQYA 4QDTA 3KWJA 1FFDA 2O2GA 2PL5A 2WG0A 3I2KA 3LIPA 2XT0A 5ALZA 5LZ4A 3AUKA 5ALTA 4W63A 1VZ3A 1AGYA 1TRHA 1H2ZA 5C7YA 1EI9A 5DWDA 3UMJA 2XMGA 5CT8A 4P93A 3G02A 2VATA 4U2CA 4CG1A 1R50A 1VA5A 1SCIA 4K2AA 1Q84A 4FFVA 3STXA 2CKMA 2ECFA 3A6ZA 5LKAA 3WJ1A 5JAPA 1LLFA 2ZJ6A 1P0PA 3FYUA 4YPVA 4A16A 1UK6A 2J3QA 1AC5A 4JEIA 4PSCA 3BJMA 1KEZA 1MN6A 1R3DA 1K8QA 5HF9A 1L7AA 2JEYA 5ALMA 2VAXA 5CBKA 3FVTA 5SYMA 4IHAA 4CCYB 4K6KA 3VDXA 3FSGD 4H7KA 3WWPA 1B41A 2PUJA 1AKNA 3QVMA 4X95A 3W2TA 2XQIA 2XMRA 4RE5A 5K3FB 3DNMA 1FFAA 2ZSHA 5H3HA 5F4ZA 4TPKA 1EA5A 2VT7A 5DYTA 3H18A 2IIVA 2XQKA 1XZAA 3S2ZA 1MNAA 1EK2A 4I3FA 3D2AA 1JT2A 1JJFA 3SK0A 4BAGA 4X91A 3V1LA 3OG9A 3PF9A 4BTVA 5HF8A 1CUIA 1YAHA 4YX9A 1MAAA 1XRMA 5EIAA 1HL7A 1BCSA 2WFLB 5DNWA 1IMJA 3C6ZA 3PFBA 4FDMA 1WCYA 4UHCA 3WKAA 1EB9A 4HRXA 3O0DA 3WK6A 2Z8XA 5I7UA 1YA4A 4DMCA 4U2DA 2BUCA 1UXOA 3QPAA 3V1MA 4CG3A 1AUOA 4EY6A 2JEZA 4CG2A 5ALHA 3STWA 4RGYA 3H2HA 1SC9A 3G0GA 3HJUA 5AIBA 4FLFA 1C4XA 4X00A 5JAUA 1QONA 1GKLA 1JKMA 4B0OA 4X6UA 2WIJA 1EK1A 5CH5A 1CUCA 4OB6A 3B5EA 4PO3X 1JMYA 3MVEA 4Y7DA 4HXGA 4B82A 4CCWA 4FWBA 4QLOA 3WWCA 4BYMA 3WZLA 2PUHA 4Y2QA 4GXNA 3ICWA 1UWCA 4BTLA 1YCDA 2QXUA 4PNZA 2VJDA 1MO2A 3G0DA 4ZREA 3W05A 4AO8A 1K6EA 1CUHA 3QYJA 4G4IA 2WHPB 2RI6A 2FUKA 1J1IA 1ZI6A 4B9EA 1NX9A 3STVA 2Q0XA 1SCKA 3ZLUA 1UOPA 1UFOA 3BIWA 4RPCA 3G9XA 5EHNA 1VE7A 5CH3A 4UUQA 1T4MA 3O4GA 1XZLA 4Q3OA 5J3JA 4BAZA 1FSSA 2PM8A 4QDUA 5AH0A 5CT9A 1WPRA 3FOBA 4HXFB 3FBWA 1P0IA 2JGKA 5E2IA 3N2ZB 1T2NA 4I19A 3DD5A 1KU0A 2PPLA 4KAFA 4F60A 4QDXA 3WK7A 3B12A 1ZIXA 3BXPA 4A5SA 2WUDA 2I03A 2DHDA 4GEGA 5HQ3B 1E66A 1HKHA 1ODCA 1MNQA 2JGFA 1OILA 1ACLA 2C5FA 3ESAA 3STYA 2VA9A 4WFIA 4E14A 3DYVA 1AX9A 2VTVA 2PSFA 5AK3A 5JAOA 5C8XA 4KE7A 4Y2XA 1A8SA 1J07A 3NOXA 3WKEA 1YS2X 3DL4A 1F0PA 2XUFA 2HIHA 2C4HA 4GECA 3C87A 1A8QA 4ZI5A 1XLUA 5FP0A 4JUIA 3WK8A 3KOOA 1EVQA 5K5EA 5KREA 2XQFA 1BROA 3M3DA 4L0CA 4BRZA 5I8PA 2XUQA 4AXBA 1ORVA 4EZIA 2Y1KA 4N8EA 2X5XA 5HK8A 2XUGA 4Q3KA 5DTJA 3PUIA 4BC0A 3V48A 2HA7A 4JH0A 5AKHA 5T4HA 5AKEA 3I2GA 3R3XA 4PW0A 2WLSA 5HK9A 3WIOA 2WUEA 5AOAA 4KYVA 1F0NA 2VAVA 4DMFA 2I78A 1P0MA 3QZUA 4GDMA 2X76A 3VJKA 3IULA 1CUYA 4Y2RA 1LBSA 3D0KA 2VJBA 4B7ZA 1MX1A 3QPDA 3D3NA 5AJHA 1JFRA 1OCEA 2X8BA 1CUDA 5CW2A 4B9AA 3DLTA 2ZYSA 4UPDA 2G5PA 2HA6A 2AJLI 2QXTA 3HSSA 4WCVA 1RP1A 4Q1VA 5FV4A 5FOQA 1H2XA 3AFIA 1BS9A 1SFRA 1JU3A 1U8EA 4HRYA 4O08A 1CQZA 1IUOA 4X6XA 5EIHA 1VJ5A 2RONA 2WM2A 3TJMA 4OSEA 4UHEA 1ZIYA 1CUZA 2HM7A 3WYDA 5AI8A 2PVSA 2WFMA 4A23A 4W9RA 3WZMA 4BRSA 3D2CA 2K2QB 3DYIA 4QA9A 3O9VA 5AK5A 3WK5A 1ORWA 1G4HA 3PI6A 1QIFA 2HU5A 1Q0RA 2JF0A 2RHWA 3R41A 5AO9A 5AKGA 4AX4A 5K3AA 1XZFA 2DCMA 1O6FA 3RM3A 5C8VA 4K5QA 2HU7A 2GBCA 3UUFA 2G5TA 4B85A 3I2IA 1XZEA 3G9ZA 1QIHA 1JJBA 1HPLA 1PJAA 3WWEA 4QZVA 3FLBA 5FKJA 3CN7A 4HS9A 5AI0A 3WKBA 4OU4A 2B9VA 5EHZA 5HF6A 4FNGA 2GZRA 4Y2PA 4INZA 3WL5A 3FNBA 4ITVA 1SOMA 3E1GA 1TKRA 3DJYA 3H1BA 1EDBA 3M83A 4LXIA 5K3CA 4UFPA 4Q3LA 1EDDA 4BP9A 1DX4A 4H7EA 1QFMA 2BGRA 5CT6A 4NVRA 2PSJA 3ZPXA 4AB1A 1X2EA 3D59A 3PF8A 4UFNA 3TRDA 1PFQA 4OB8A 4Y9SA 4KAJA 1A88A 3LS2A 4LXHA 4BVLA 5JZSA 2DQZA 2HU8A 2OCIA 2HRQA 3EQ7A 2WIGA 1VZ2A 4E15A 1R9NA 3CXUA 1MJ5A 2Z5GA 2HHAA 4DGQA 1AZWA 1UK9A 4MYSA 2WIKA 4U2GA 2ZYIA 3WL6A 4UHBA 2OGZA 5LKRA 5AKXA 1E5TA 3ICVA 3K9BA 2QM0A 1XZDA 4KR0A 2Y6UA 2AJBA 2NW6A 1Q0ZA 4EUSA 2XUAA 1EHYA 3HXKA 4OU5A 3RK4A 1LPBB 3O9MA 3B3QA 5HKBA 4KRXA 4BE4A 4HXEB 5BV7A 4QWWA 3WLAA 4BZWA 5ALSA 1W6RA 7YASA 1NU6A 1QTIA 3OTQA 3K2IA 3MUOA 4EY5A 4BVKA 5CT5A 1ZJ5A 2WILA 3ESDA 4X85A 1CLEA 1LBTA 5DLPA 5A62A 2H9YA 3I28A 1UKBA 1XZCA 3IUNA 4AN1A 1RYYA 3QM1A 1TCCA 4LXGA 4DTCA 1Q83A 3IBTA 1XROA 4Q82A 5AK4A 1DU4A 4KAAA 1BRTA 1XZHA 4Y2TA 5A7FA 1QIEA 5JIBA 4HTAA 2G4LA 2BKLA 1XZMA 2J4FA 5AM0A 2XQGA 4DNQA 4B6GA 4S0XA 4P08A 1USWA 3G7NA 2ZJ7A 4X97A 4EY8A 4AO6A 1ZOIA 2HA5A 3HABA 4W1PA 4X92A 1R4ZA 2CZQA 5LZ2A 2Z3ZA 3BDVA 4TGLA 5E4YA 1R1DA 2C7BA 2YXPX 5FUMA 5JD6A 5LZ9A 1G5FA 3DS8A 1LPSA 4DNOA 3V1KA 1VLQA 3BDIA 2EDAA 3Q0TA 3WJ2A 5EI5A 3TGLA 3R3YA 5HFNA 3I6ZA 4DNPA 3I1YA 4B0PA 5FPQA 3L1JA 1EB8A 1CUUA 3M82A 3VKFA 4UBOA 5AKLA 3GBSA 2C0PA 2QKYA 3OC0A 1THTA 3AIOA 1WOMA 5T4FA 1XKLA 1QTRA 3WYNA 1H2WA 1VKHA 1BN7A 5T4EA 1NU8A 3HI4A 1CR6A 4G8CA 1MPXA 4PQEA 4AZ3A 5JAHA 2XUIA 3FLAA 2V98A 2JIDA 4C6HA 3EF3A 5ALPA 4AN0A 1ZGCA 3F67A 5HZGA 4C89A 5ALXA 4LYEA 3ANSA 4G9EA 3P2MA 4CIAA 1R88A 1ZI9A 4AMYA 4GLBA 1DX6A 2QUBA 1CUSA 4H7DA 2BCEA 2C0QA 3WIBA 5ALIA 5HKAA 5YASA 4X3CA 2ES4A 2XDWA 1QIIA 1J2EA 3IIIA 2HFKA 1UOOA 2Z8ZA 3I1IA 3ZV7A 4X94A 1XKTA 3Q8WA 2V96A 5FXMA 4WDRA 3AIKA 5CT4A 2I3DA 4Y2VA 1A8UA 3IUMA 2GYUA 5JANA 4XWGA 3E3AA 5FDFA 5JD5A 4FLMA 1U65A 1LZLA 3O4JA 2VEOA 2RIPA 2OGTA 1LPNA 1LNSA 1MU0A 5ALDA 3HC7A 2O2IA 2QOEA 4QLAA 3PE6A 1H23A 4N8SA 2O7VA 4JYPA 3EBLA 4QNNA 1WPXA 4X93A 2PX6A 3BF8A 3PFCA 3T52A 2WUGA 2V97A 4MJ3A 3C8HA 3G0IA 5IVHA 2CJPA 3UUEA 5C8ZA 3WWOA 4C4YA 1E8MA 4FOLA 3V9AA 5E4TA 1EX9A 2BGNA 2DFPA 2WUFA 2BUAA 4QE3A 4IO0A 4UHHA 5JYCA 1MTZA 1SCQA 4ZV9A 4UBKA 4UBMA 3WK9A 3AZOA 4FKBA 4EY7A 4P9NA 1BEEA 1IUNA 2XI4A 4W1QA 2YH2A 1WHTA 1E3QA 1I6WA 4FBMA 4ZWNA 2WG2A 1QO7A 2XUKA 4AZ0A 1QIMA 3H2IA 1G66A 4OYLA 5LZ5A 4C01A 3BIXA 3AZPA 3KD2A 5AHXA 4C4ZA 2GYVA 4EHBA 1ODSA 2WG1A 3T4UA 3GA7A 1VXOA 3WL7A 1XRRA 3VISA 3IURA 2WHPA 2XMBA 4JYMA 1CUVA 1YA8A 1XQVA 5JASA 3R0VA 3WI7A 4J0CA 3HEAA 3W9BA 5HCUA 1IUPA 4LYDA 5DNUA 5ESRA 4KEAA 4WFJA 3VJMA 1N1MA 3H1AA 4WY8A 2XE4A 2XLBA 4P92A 3HACA 1EDEA 1H2YA 3AINA 1N5RA 2UZ0A 4V2IA 1QIJA 4Q05A 1XZJA 5AKIA 3ED1A 3IUQA 3C5WP 2WIFA 1VE6A 4N8DA 4XIIA 1AQLA 1C7IA 4BDTA 2VSQA 3O95A 4DNFA 3C6YA 5HQ3A 2QTBA 3U0VA 2D5LA 4J0KA 2ZVDA 4UBNA 4X6YA 4WY5A 5AOCA 3MGAA 2J4CA 3R3ZA 4PSUA 1KU6A 3I2JA 1UKAA 3H17A 4Y2JA 3K6KA 4KE6A 1Y7IA 4E11A 5CMLA 2XMDA 1XRNA 3H04A 1F6WA 1WB6A 2HA3A 3WA7A 4X71A 2Y2VA 4U2EA 3FYUC 1ODTC 4NS4A 2H7YA 3OOSA 3C43A 3I2HA 1H22A 2WHQA 3OM8A 1XZGA 4BZZA 4G8DA 3M81A 5JZ9A 3BE8A 4AQDA 5HFAA 1N8SA 4DYHA 4J7AA 5LIPA 1X2BA 2W22A 1GKKA 5EFZA 4EB0A 1XLWA 4YASA 5JADA 4J0GA 1BCRA 5AM5A 5LZ8A 2JGIA 4G4GA 1DTEA 1E8NA 1G42A 2PSEA 5EHXA 1XFDA 4UHDA 1K5PA 2ZSIA 4WDQA 4LKOA 5ALRA 3HZOA 2QUAA 4XJVA 5AICA 3O4IA 4H35A 2BUBA 5ALUA 2JGMA 4OB7A 1U4NA 4BE9A 4UBLA 3WK4A 3C5VA 4IH9A 2HA2A 2OCGA 3FYUB 1UKCA 1W1IA 3WQHA 3LCRA 4CFSA 3BJRA 4Y2UA 4PV7A 5ALGA 3SC2A 5D3ZA 1QOZA 4BVJA 4QDOA 4HVTA 1IVYA 2WSLA 4C88A 1QLWA 3R40A 1C7JA 1XRQA 1RWQA 4GW3A 2QR5A 4DIUA 1QIKA 3CN9A 1BN6A 2B20A 5ALFA 5K3FA 2XUPA 1MX5A 2VT6A 1YB6A 4H7IA 5AKKA 2QT9A 3PUHA 3GZJA 4Y2YA 1L7RA 5C81A 3S8YA 3FWHA 2B4KA 3H19A 3STTA 4C4XA 2QJRA 2FX5A 3IB3A 1MAHA 1FFEA 4PSDA 2QZPA 4MXDA 1QIGA 3ANTA 2XLCA 3QBJA 4MQLA 3RLIA 5JALA 1CUXA 3PICA 3GROA 5EHQA 2CB9A 1ACJA
chains in the Genus database with same CATH superfamily
2XUHA 2J9ZB 1UPFA 1GU0A 2XAAA 3ZWQA 1UM9A 4M0FA 1W9HA 3OA0A 3L1VA 5IARA 7MHTA 3MLEA 5U4XA 1OFIA 4H7FA 1TKCA 4RKFA 1KZ4A 5FFMA 3GLFB 1JQJC 5AM4A 3AZQA 4R2IA 5L45A 2YASA 3W1EA 1QRAA 4HAYA 3HCDA 4CF3A 1NRIA 3HVKA 1RADA 1H6DA 5K3EA 1XQ6A 2NUTB 3G59A 2G9VA 5LMCA 2XDQA 2DQSA 2DLNA 4YRMA 4MWBA 3VVCA 4HFJA 2Z6VA 2PZJA 1EFHA 1T6ZA 4ZAYA 5JDCC 3HADA 1NAHA 4P35A 1Y9AA 2Z43A 1F8UA 2OCKA 3JQ6A 2OT3B 1CZLA 3KZXA 3Q3JB 2FUCA 4BZPA 4ZYUA 4QTZA 1QYWA 3PD1A 4C0WA 1EUCB 4IH4A 1ZR4A 5B1SA 1E2QA 5FWXB 1TLFA 3WBJA 2Q5FA 2PJDA 3KKZA 1M75A 2B9EA 5JUWA 4RGVA 1O97D 2RHTA 4O2BA 2JLVA 1L5VA 5JAMA 3T5DA 5ALJA 3OWXA 5LMNB 3U0BA 5K0ZA 1Q0UA 1M76A 1YS1X 1WPGA 3ZIAA 6CHYA 1G19A 4MLCA 5AW6A 1KH1A 1UOQA 3C97A 9GPBA 5K3OA 3RUHA 4AX8A 4Q16A 5JPIA 4GDFA 2C8LA 5JRJA 1Z5OA 4DV0B 3TLXA 3MJTA 1W5FA 3M9XA 2UUAB 3RF6A 2GILA 2MYTA 1RBZA 2B5WA 3ADPA 3LT2A 1OT3A 3OECA 3PXDA 2QAJA 4YGXB 4GSYA 5TLSA 1T29A 1UDAA 2NSDA 2PU5A 3PQ6A 1Y6GA 2GJKA 5A6SA 1QRSA 1SMKA 4LWPA 5KDLA 1QU2A 1UP7A 2XRFA 2AF4C 5EJ4A 6ADHA 2H5EA 4KJXA 3HJBA 3A06A 1R16A 4D45A 1QO9A 4TWIA 2MTBA 1JIQA 4IP0A 5CEJA 2XMSA 4GKBA 3SJCA 3RU2A 4R2LA 3BMNA 4L3WA 4CXMA 2JLUA 1A96A 1R5NA 1Y3AA 1I5EA 2H1IA 3AEQB 4OA8A 1XMIA 3PCTA 4D3SA 4ZHSA 1QZXA 2IQ5A 2DPHA 2OLJA 1IJKA 3O31A 5AVKA 1DUIA 3LYHA 1ECJA 1ZVJA 4DCGA 1OMOA 4X1IB 2CBZA 3KVNA 4PVCA 4G26A 4QTTB 5SYNA 2QORA 1DKOA 1Y1SA 4TMFA 2CHQA 1W52X 2QLTA 1HQDA 2QMYA 4JL6A 1DXQA 2GCOA 1KRXA 4RS4A 2PZAA 5DHUA 3F73A 1UT6A 1A5SB 4X9XA 4BKOA 5HW0A 1D2NA 2OG2A 2ODQA 5ARCA 1K7CA 4FS8A 4DDMA 3UXMA 5C5DA 1ZL2A 2FKNA 5GZ1A 4GPBA 4CM6A 4LF5B 3DE3X 2C4MA 1NXSA 2NZVG 1NN1A 3A25A 4UHJA 3CCCA 4KFSA 4GGOA 5JHHB 1I4OA 4NBWA 5JSZB 4XQ0A 1SWVA 1G21A 4PGMA 2A9VA 3GD7A 1PHRA 3BMNB 5LWHA 4YT4A 5FAKA 2VYQA 4BNIA 2NVBA 1OHHD 1TNDA 4W1SA 1J24A 2LR0A 2IRWA 2P9QA 5CLQA 1E4OA 1TT5A 5B36A 1B73A 1OXXK 4E5DA 5P8WA 4ND5A 4E21A 4FR2A 4EJ0A 2HJRA 4EHLA 1PJLA 2WJ6A 3DVAB 3GJ3A 4KV7A 1NATA 1ZUD1 1RBQA 2FAXA 1D6MA 1IMOA 1X1DA 2PVCA 2QRKA 3QELB 3BHMA 4AWAA 4Y6OA 1W47A 4OQNA 4DR4B 1XQXA 5CA1F 1QX4A 1EWQA 1T2UA 5DIZA 2R2AA 3F5SA 2XCSB 1KJWA 1DMRA 1S1MA 1WDWB 1WW3A 1OC4A 1O95D 3AWDA 2QS9A 4D9JA 1VPVA 2EGGA 1TQHA 1YTLA 2G63A 3O82A 3OP4A 4PU0A 3W5BA 2PAFA 5ARBA 2KI5A 4F0JA 3CLSC 2AQ8A 4MS1A 3A0RB 4TV9F 2RE8A 1B23P 1XZNA 3FSJX 4DRYA 3FTDA 1N2HA 4H15A 3P9QA 3ZZTA 1XNRB 1QE3A 1N4AA 4FJ0A 1NSYA 3PRKE 2POCA 4KLAA 1PWEA 4PIVA 4OA5A 1SCUB 4PLTA 1R2QA 1AXGA 1L4MA 1OLSB 4F21A 4YQYA 5TV2A 1FNBA 4M46A 2G0NA 4QDZA 4S12A 1Y1QA 1T13A 4RPKA 3GT0A 2ERYA 3HP4A 3COPA 3QXSA 5AIAA 5DYWA 2R6DA 4AICA 4B75A 4DDWA 4ZIRA 2VUHB 5AUOB 2PX3A 5KKNB 4LQCA 2PO7A 2QW1A 2PLRA 2WU4A 3G9UA 4PX5A 3V4SA 1DB3A 3T61A 3SJ7A 1V95A 4J0HA 1YE5A 3BULA 3EHEA 3UICA 2EX1A 1CW2B 3SQNA 5A4IS 3A3KA 3BWDD 3WGQA 3FHTA 2AX4A 5IANA 1CRLA 1O1YA 1OSNA 4OHRA 4CI9A 2GPNA 2NQ2C 1DQPA 2AYZA 2ETVA 3O2JA 1B7GO 1SULA 1OQAA 4G25A 2IF2A 3AVQA 4OFZA 3DZHA 4IGKA 5JSKA 1NVGA 4C3UA 3EXHA 1JEYB 2R96A 1EX7A 2CMHA 1IHOA 3TRIA 1LRKA 2BOVA 3D6NB 1GPNA 3LDGA 4IHJB 3E0XA 2HHHB 1CY6A 1SC6A 2I7CA 3HUFA 4JP2A 4MYTA 1KEUA 2W4MA 5BWOA 4L9RA 2IX3A 4LJ4A 5IX8A 2H9IA 4QUIA 4CKBB 3AEYA 1KHTA 2W6QA 4K9NA 1TAHA 2DRIA 2PQMA 1F2TB 3KEQA 4X1KA 3ZK7A 2G9RA 3WLNA 1FFXA 3L0CA 4LZWA 4A6DA 5FPPA 5JMOA 2SKDA 2ZBUA 1IY9A 4V3CA 1BXGB 1ZDMA 1JG4A 1DWOA 3T0GA 2QYOA 1USIA 3G6WA 3NJ8A 1E6KA 1WLSA 2A1UB 3BRSA 5AI9A 4UTNA 3RFTA 3T3DA 2WF9A 3K5PA 1UK8A 3K9FC 5CLJA 3NIGB 2A7XA 5ALLA 2WTBA 1KYWA 1Z38A 4OTZA 3ETEA 2AK2A 4P7BA 3WYBA 3X1DA 1G0OA 1WDLA 4LSGA 1EM8A 3C4JA 2HSWA 2V74B 3K4QA 1L5LA 4YV2A 3TNDA 3NEYA 1IBLB 1HKUA 5KTSA 2OORA 1WMBA 1FMFA 1KAOA 3EJWA 4GYYA 4KO4S 4YRBA 1KO5A 1RI2A 5JXGA 1AUVA 5ALQA 4AMZA 3IAAA 1WMEA 4WPGA 2QN6A 1Y7PA 3AEKA 1XFAA 2XF2A 3JPYA 1XJ0A 1QJ4A 3I34X 4JIGA 3CRQA 1W35A 4NULA 3SC2B 5E95A 2PD4A 2H2HA 1ARZA 5IS2A 4P5PA 4TTTS 1VSTA 1IEVA 3HRIA 4YP7A 1E6LA 3CF4A 5IPFA 2OO3A 2ZWVA 4IDQA 1NJ2A 2QNBA 2C57A 4GPAA 2RGGA 4ZD6A 3KKQA 5F2OA 3FDJA 3SFVA 1SG6A 5NULA 4OH1A 5BWCA 4DUGA 3E5HA 3I12A 4XXHA 3GEEA 5SY6A 4QFCA 4U2FA 1CY0A 1G3QA 2F62A 2OZLA 2QRQA 1AZTA 1N2ZA 1YJ5A 3CZ5A 1K5DA 3BG5A 3Q88A 4UD6A 1V48A 2OOSA 1OLOA 1Z34A 2BMVA 1FMTA 4O6VA 2IEDA 4CEJA 2IYRA 5JQWA 5A03A 1UJ4A 1T43A 2QD5A 3IBFA 3U26A 4A27A 2C94A 3K0SA 3UG7A 2KBFA 1KE1A 1AA9A 4ZJUA 2XCUA 3L40A 1UDBA 2YWBA 3PEUA 5B6IA 1VLLA 3KTAB 3OQBA 5EAIA 4DUYB 1ZMXA 1MIHA 3OKPA 5CTJA 2JFQA 4DLSA 5KNDA 3VDQA 1XN4A 3R0IA 2YV5A 4ARVA 2C95A 3B3GA 2M1ZA 5F33A 4KUGA 1N3BA 4KR2A 1V43A 2Y67A 1EAMA 5JFGA 3WIEA 1L5GB 2C2HA 8OHMA 1KYQA 2PZKA 1RDFA 4FLEA 4JUAA 5CW1A 4FR5A 4KQEA 4OFBA 2VJAA 3KR1A 5G0VA 1N34B 1P17A 3B1WA 1IXRC 3HR7A 4EOGA 1LU9A 3NBKA 3VZPA 4X1YA 5L7WA 4MR7B 3ZLVA 1XQYA 3AIIA 5BNZA 2H52A 2WD8A 3L8MA 4FJ1A 5EE3A 1K7XB 1X80A 4ENTA 1PS0A 4F5ZA 2HF9A 2C58A 2HJ9A 2I3ZA 1DT3A 3GJTA 3PFIA 3WHKA 3CF2A 4BP1A 1IAQA 5SYAA 4QXRA 3DNPA 1KVUA 2EJVA 2O7RA 4MWTA 1G5IA 2N1MA 2QX9A 1L5SA 1T0BA 1XNGA 3R3UA 4B4KA 2HREA 2KSQA 4K2HA 1OI7A 3G2IA 5BV2P 3CT4A 3TX2A 5SV2A 5KWIA 2FZVA 1O87A 3LCVB 1DELA 4TWZA 1TVKA 3WS7A 3K0KA 4EF6A 3BRWA 3AVTA 3NTXA 1U3FA 4YJFB 3L04A 3SSMA 1U2TA 4Z54A 2QBYB 1X13A 3RGGA 3DONA 3FFWA 2R9VA 1D3AA 3IXMA 4OI4A 4NMMA 2XB9A 4RFLA 1S3SA 2CVFA 1E32A 1VIYA 3GJ8A 3WGOA 4MQBA 3O8RA 1YCGA 2HC9A 3MWDB 1IJEA 2PMEA 4QOIA 4CUKA 2VNAA 3OIVA 4FT4A 1XTPA 3RJ5A 3HDJA 1PT7A 3ENQA 4HN2A 5I8ZA 2HJHA 1FMLA 3I23A 2UV8A 4C08A 4FYJA 2D1FA 3F1LA 4OMDA 1YKGA 5FTMA 3TUJC 2V9ZA 1Z0DA 4FFNA 4M21A 3QU5A 3BTOA 4GBGA 1ONBA 3D7RA 1IRXA 4JJIA 2IBMA 1SU6A 1I7DA 4CQMB 4WN3A 1S9HA 4QU8A 5A5GA 5KZMB 4LOLA 1ZGGA 1XNJA 2IWRA 2XUJA 1PLLA 4FZJA 3ZE0B 2XWBF 3O1LA 3QXCA 5AI4A 3O8NA 3OIYA 3GPDG 1DG1G 4G5XA 3SJAA 4Y6GB 5IF9A 2PMWB 1AKYA 4DUGD 4WKBA 4EKIA 4EYQA 3SWWA 1OW3B 1RQ7A 1UDWA 2CNBA 1CUBA 2F3PA 2ZYVX 4RCYA 4Y2HA 4DXAA 2IZ0A 3NDPA 5LA6F 2C92A 4R2XA 1DV2A 1CUFA 4TXLA 2HADA 1PR2A 3C6MA 2D1SA 1RTTA 1DQZA 1MV5A 2OP0A 1O89A 1R66A 2QF7A 3ANMA 4IHJF 3IVCA 4L8VA 4QATA 3S1LA 3EVBA 3LBFA 4YUXA 2ZOSA 1ZU5A 5B6PA 2X8JA 1XA0A 3D2BA 3F7NA 3BMXA 4O4LB 2VJCA 1FQKA 3EQ2A 4ND4A 3RARA 1XTIA 3ZXUB 5JJBA 3JYHA 1P77A 2GYWA 4XQGA 2VR1A 1J0XO 2GN4A 4D0SA 1GZUA 2JJ1D 2P0AA 3VC2A 1DKUA 1C3OA 3U2QA 1WM1A 3VR5H 3FFBA 3K0FB 2VS1A 3WMGA 4QUGA 2AFVA 2VHZA 2WF8A 3N7TA 1GL6A 4PZUA 3VR2A 4DV1B 2J9RA 5K0TA 4KWCA 3HO8A 3FF4A 1E89A 4GF5A 4QEKA 2SBTA 3DBLB 4QJIA 3RCBA 4MQMA 4FB5A 3IT0A 1BEZA 1WG8A 4B3DA 1QGAA 2X0JA 3UBMA 4WNCA 1WZ2A 2BONA 3RSZA 3MTQA 1C0KA 1RWOA 4BVGA 4JEMA 3VHXA 2A1UA 2PSDA 2UZ3A 4BV8A 3V2HA 2QIPA 2VK1A 2DFLA 3GA5A 3MB5A 3EXIB 3DEZA 1XEXA 1KK3A 3OICA 3PDIA 4KQIA 5AI6A 3T38A 3ZWBA 5PGMA 4GMFA 4QARA 3GRAA 1LJLA 3BWXA 3H13A 3A6HA 2RGUA 3P9XA 2RGRA 3VOBA 1P2SA 3BF7A 2YYZA 3ITEA 5BSWA 1CS4C 1VMAA 3B9PA 3AEQA 1QHHA 1JA0A 3DQZA 4KDCA 4NS1A 5J63A 4D9GA 2OMEA 2VYND 3NBUA 2WJIA 3RABA 4FW8A 1U98A 3ESRA 1RLJA 3HJAA 1QNFA 4OUKX 1CVIA 2D1YA 4J1NA 4JBIA 4XGRA 5DO9A 3WRWA 5AW7A 2XCTB 2CV2A 4H1VA 5EUMA 2C4TA 3DZDA 3EPKA 1DEKA 1PP4A 1ESMA 1CS0B 1KAHA 2WDZA 3KUDA 4WZ6A 1VXRA 2C78A 3C45A 5AKYA 2YRXA 5E6RA 4RTNA 4BYGA 1B0ZA 2DSTA 4UCQA 1DDOA 1TIPA 4MH0R 4QUEA 1UPBA 5IM4A 3R8FA 4RJLA 1XKQA 2JAQA 3NHLA 1D9XA 3H0CA 5BSUA 2IH4A 2ZSKA 2WU3A 1GSOA 2IYSA 3HBFA 4FKZA 1H1LA 2Y27A 4Y9DA 1CHDA 2LIPA 4C22A 5BRJA 4DDKA 3CQ9A 3WKCA 4OGLA 4HLUC 4B3HA 1VPEA 1Q7TA 2P4SA 1DHTA 1H93A 4QU5A 1NVTA 1XCPA 4L4SA 2AR0A 1ZICA 1ITZA 2RH5A 3DZ8A 3L1HA 3S3TA 5IJ0B 3HJFA 2N3ZA 4MDFA 5AKZA 1ETHA 2Q4EA 3HY4A 4FT2A 4HYTA 5E6SB 1JHAA 1SUDA 4U1RA 4HN4B 3UOWA 5ALKA 5TE9A 4LC1A 1ZH4A 5HA5A 3VDMA 2UZ4A 1NM5C 4ARCA 1Z4MA 4YTEA 5FPHA 2XMQA 2LVBA 3PK0A 4YMIA 1HMPA 3ZV3A 5HIMA 1KZ9A 3ZUGA 2AOVA 3L7OA 2XCLA 2GBGA 1JH8A 3T7TA 5ELXA 1GAQA 1PJBA 4JI0B 3JXEA 2I1VB 2O20A 2D00A 1LPPA 3I9MA 4RY2A 4WIAA 2AMYA 4HH4A 4PYNA 1DQSA 1UQRA 2OXCA 4QULA 4YC7A 4PAOA 2E49A 4GGPA 1LK7A 1CUGA 1SXHA 2WU1A 3PKJA 2V6FA 4KTTE 1UC4B 4KXLA 1I33A 1FRNA 1NSFA 1Z2NX 2J3MA 4CKXA 1ECLA 3UMMA 3I37X 1B8OA 4XVRA 3JSAA 4FGJA 3CW9A 4MCIA 5M3BA 4LRTB 3GVHA 2AVNA 3I92A 1GL9B 2QRVB 2D7CA 3AV3A 3EISA 3LPMA 3P45A 4JSYA 4E6EA 6GPBA 3RVPA 3C98A 4BB0A 1YAJA 1RAEA 2XQJA 1P9RA 1SOWA 2NVUB 3OCXA 1USKA 2AXEA 4ER5A 3T9AA 2FMHA 1Q77A 3SIRA 2WJYA 3QKWA 2VZ0A 1ZN7A 3EASA 5BR7A 2P75A 3QVGA 4GVLA 1M72A 4NRDA 1NDUA 2G40A 1L5ZA 3P2IA 1VC2A 1N2SA 1UMBB 3AR6A 4IEIA 2QSUA 5JPDA 1Z5NA 3ABZA 1RE0A 3P9SA 4RDIA 3PFNA 1H8HA 3HGTA 3FVRA 4U4AA 1QZ3A 3TBKA 2VNHA 3ZIAD 4YJFA 1C4OA 3RFUA 2ZRKA 1MEEA 3NHRA 2FY8A 4HQ0A 3ESBA 3RFVA 2A3NA 1URPA 3BEDA 1D1TA 3PT5A 4WADA 3VYUB 3HJCA 4MVJF 4QGHA 4AF8A 2A5JA 3LRTA 2Q4BA 3HXLA 4PLHA 5IH7A 4X62B 5ABPA 2IU6A 2J45A 3DD1A 1GKIA 5DBFA 5BMVB 5AKJA 1JI3A 4RGQA 4YUVA 3RS5A 3VDRA 4TZ0A 2Z3VA 3DV0B 1R15A 1CF9A 4TL8A 4GM0A 3AJAA 1A69A 3L7LA 2BMAA 3FGPA 4EBBA 4IJQA 4YUZA 1N3LA 2H29A 1QPZA 1H9AA 4YXFA 1JIKA 3NWBA 1S8OA 3IESA 2K5UA 4BLRA 1F2VA 1P31A 1ZK4A 2OC9A 4N01A 4K0RA 5KTMA 1BH6A 1HDRA 5KBYA 5LP6A 4Z99A 3WNZA 1KI2A 3GA0A 4WNYA 4K6CA 5KQPA 1BVRA 2DKNA 2LRHA 5A71A 5K05A 3ENKA 1GYPA 1T1GA 4KXXA 1EH5A 3A1VA 4AO7A 1E6UA 5DNEA 2VWHA 1V25A 1YS7A 3ZXSA 1LZKA 1FUUA 3ZI7A 2ZJ8A 3HO1A 3I64A 3KQLA 1K89A 2R85A 3I09A 4FGSA 4LOAA 4PHFA 5T5QA 1QYXA 1WP4A 1NJ1A 1T0IA 3ESZA 2A57A 2J3EA 1P61B 3UJ3X 3A36A 1Z47A 3DVQX 3SYKA 5AW5A 1VB3A 5IZCA 5ED4A 1Z16A 1J5PA 2Q9BA 3SX4A 5A9SA 4A2CA 3OQVA 1Y42X 4N49A 2PBRA 3UGJA 2AYXA 3C1AA 2H7CA 2P5UA 3BK1A 2I2WA 1PZGA 3UMFA 4QHYA 2PTGA 4F2PA 5CURA 4UXIA 2FZ4A 5A6SB 1ZONA 2XNHA 5CXUA 3ICEA 1MLDA 1W2GA 5EP4A 1HLPA 2AFIE 3ZZUA 4AZ0B 1V5FA 1NF3A 3K2BA 1O0CA 4MUBA 4DQKA 3PNLA 2UVPA 3LWDA 2ZEJA 2MWMA 1XE3A 3VVLA 3QMPA 4JBGA 4CCYA 1JFSA 2VN8A 5C0OE 3W9YA 2VT3A 2FXIA 3VU9B 2BDUA 4RETA 2I66A 1W5AA 1H4QA 1ZCFA 2HMTA 4DMKA 2HH9A 2I7TA 3Q10A 2REXB 3O8LA 4MYUA 1NSTA 3QFFA 4MI1A 4NLLA 4POAA 4WN9B 3RO7A 3S7ZA 5ADVA 3LBIA 1XN1A 1UJBA 2NYUA 3R5HA 1XLVA 4XR9A 4C89A 2CVHA 4FFDA 4QQFA 1NNI1 2VTKA 4QIHA 5GV7A 4EEZA 4B48A 2JVKA 3DBLA 2V4ZA 2NNLD 3MN1A 1EP3B 3B7GA 3LO5A 5LQNA 2B4RO 2JAWA 2Q3DA 3K15A 3OEEA 2R1TA 4DSZA 5L7TA 2G82A 3JARB 4CVNA 2O3UA 3P52A 2J08A 4ONEA 4QOSA 3BB4A 2VP6A 4WEOA 5D7BA 3AHEA 5EIBC 4R0VA 1H2RS 4NJMA 1CJTC 1K4YA 3RUAA 4B7XA 3GPIA 1UZLA 3OZDA 4TS9A 5TS2A 3DMTA 3PR2B 2PX8A 3BT7A 2F7SA 3E9EA 1U6KA 1DAPA 3H1PA 3OEHA 4M54A 4Y1GA 1CYEA 1UXHA 4F7WA 3IP8A 4M88A 3EIHA 3C7KA 2FG7C 1XZKA 2A0UA 2HL6A 1YSCA 4ENQA 5TARA 5ESXA 1ID8A 3PFKA 4HH3C 3DTVB 4L51A 1MB9A 2WWHA 4TVBA 5BSFA 4M0EA 5E7QA 5LD2C 2AWOA 4D8YA 3F96A 4J4TA 4GHWA 3ZYZA 5KINB 4DR2B 4F4UA 2ZU6A 2ZB2A 3VJRA 4IV0A 1HT2E 4FFOA 3LXXA 4JCOA 4J4HA 5E0OA 1ISPA 2WM8A 4FK8A 3GFFA 4I4TB 4TOIA 1NVAA 4MMXB 3H4VA 1BQ3A 3FJ1A 4YMGA 5I7AA 5CLLA 4WI1A 3F6RA 3SHVA 5SY4A 5HUJA 1JZQA 3HWX1 1UZAA 4MP8A 4UW9A 3VVBA 3QMVA 1CG6A 1F7UA 2WZDA 1TYEB 2VAWA 3LT4A 3U49A 3EFOA 3TOZA 2ON6A 1I9GA 3ELBA 3GHYA 2BH2A 4UAJA 3A31A 3AHGA 3L0IB 3TNFA 3M5DA 4Z7OB 3HYNA 3DTVA 1V1MB 5E0KB 1JJVA 4M37A 4TLAA 4YMTA 1HBJA 3EVDA 4ID3A 3LUJA 5LJIA 3QMMA 1N92A 4MV3A 4I6GA 2E6UX 3IL2A 1GFIA 4ZIRB 1GG2A 4TKVB 4L4UA 4P31A 2E55A 4YRCA 3T5AA 1FDRA 1IZYA 3NNDA 5JAQA 4B2IA 2VJNA 1JVBA 1FMCA 2BFEA 3F9CA 2X9NA 4QVKA 4H6XA 5TGDA 3HA3A 2QPLA 4YR9A 2XEDA 2CNLA 1RC8A 2Z6QA 1EQUA 4WFKA 4ETIA 4DG8A 2XE7A 1PKEA 1TYAE 2B21A 3IQHX 2VNJA 2CV1A 1T36A 4HN9A 4N5LA 1ZCZA 3L0DA 1P1JA 4MV9A 1ZAYA 2SCUA 5BWMA 1SCAA 1N9KA 1QDUA 2BC9A 1HDZA 3G5AA 2A94A 4HNTA 3MJHA 1YQTA 1SBTA 4GO1A 1VE9A 1R8SA 1OIWA 3FHLA 3CKMA 5FBZA 2VJLA 1CKEA 3NNNA 6ABPA 3HMQA 2XVMA 1FDOA 1U0HC 1EM6A 2FEWB 2W58A 1VL5A 1IFXA 2PDAA 2BEWA 4O3MA 2W6OA 3A1DA 4TMXA 1I2BA 1ODLA 1UT5A 3BK7A 4E09A 2NTJA 5BVGA 4MB6A 3IOYA 3M6VA 4TYYA 3SZMA 4HQLA 2LKDA 3ZLJA 2CWDA 2RAVA 1JLKA 3C4VA 4UDXX 2C2KA 1BOFA 1VZ3A 5BSEA 4MR8A 2HIAA 4NBSA 3QF4B 1OU0A 2PQ2A 3LG2A 4Q4AA 2IDJA 1TU4A 2YFYA 5AUPB 2C1XA 3N39C 1EI9A 1Q2UA 3MT7A 4I7EA 5DWDA 2LXNA 3TKAA 2V6IA 4HVLA 4P93A 4O4LA 1UBOS 3IFSA 3OQHA 4G0XA 1EM8B 4ZAFA 3M6FA 5F52A 1JSZA 2YJ4A 2VK2A 2R47A 4DGSA 3CW8X 4EUFA 4HZUB 1QGDA 4IILA 4W5RA 3A27A 1ECFA 5HX7A 1ANKA 5TSDA 4UVIA 3ID6C 5A3VA 4BNVA 1CR2A 4BO1A 1JIUA 3P97A 4XD7A 2EGUA 2WMNB 1F7VA 2GESA 9LDBA 4K2AA 3G13A 3RYFA 1W581 1Y8CA 3AR5A 1RJFA 3KJQA 1XGKA 5H81A 4BWFB 4MUXA 3UPDA 4V1CA 4MNTA 3EF0A 1NMEA 1E4EA 1ZG3A 4AI6A 4IOLA 3IT1A 4F92B 3TMKA 1TAQA 2V4UA 3T3PB 4B32A 4OL9A 3WJ1A 5KTYA 4WT7A 2XKBA 2JJ2D 4RK5A 2B37A 3HUUA 4WRRA 4Z2YA 3AUAA 4PYLA 1NLZA 1KYVA 3FNFA 4F6LA 2V7XA 3FYUA 3RRJA 3NWPA 4TRJA 4A16A 2VQEB 1UK6A 2QZZA 5FWNA 5LDDC 4YP0A 4GAEA 4WW0A 1E2DA 3NHZA 2IF0A 1NLMA 4TL7A 3GRKA 3HDVA 4KAXA 4AP9A 3VZRA 3IHTA 3IKLA 3SOPA 4Q3BA 2Q4DA 4RIEA 4EUNA 5E9JA 2P62A 2D1QA 3OM9A 4WLFA 1CP2A 1L7AA 3GLRA 3MERA 2PX5A 5DGXA 4ETMA 5H16A 5IYZA 4E13A 3DPIA 1M73E 1E3DA 2WIBA 4D9EA 2VAXA 4M4SA 2YDYA 4CCYB 1JXMA 4FIDA 1KAEA 3D5TA 2PIAA 4DFDA 2AB0A 3G49A 4Z7JA 4IWNA 4DC1A 4H7KA 3ASUA 3WTBA 2FK7A 3W5JA 2W4QA 1M7BA 1Y1KE 3B7PA 2JHCA 4LECA 5BSHA 3PHIA 2I9PA 5IAAA 4ZQGA 5EJAA 2DE0X 4X0EA 1OXKB 3FI0A 4X95A 3QLUA 4A5OA 4WXMA 2XMRA 4LBYA 3AT1A 4RE5A 3LYLA 1KHHA 4EI8A 2JLCA 3FKSD 1JJAA 2ZSHA 3W1WA 1NKTA 3HK2A 5F4ZA 3CRNA 2F1IA 3I42A 4TPKA 1XPOA 4F4IA 1RXCA 3N5KA 1KO7A 4MUEA 3JARA 1O97C 1XZAA 4IV8A 4P36A 3TZBA 4EHHA 3GLGA 1CRPA 2IYPA 4QYIA 2AF3C 3H8WA 3ZHUA 1C9YA 3PT9A 3PSHA 4K26A 1JJFA 5BRNA 3TRHA 1CTQA 1ZCBA 1WL8A 4L8LA 1GDDA 3Q2KA 4MDHA 4BAGA 2ZT6A 1IEQA 2EKPA 5I7OA 1DO8A 4FI3F 1JLLA 3KOYA 4XD2A 1V3QE 3NJRA 2G1UA 2C2GA 3SX0A 3DVLA 1V8BA 1TJPB 2PUFA 1XRMA 2X8AA 2YFHA 3I45A 5EIAA 1C0EA 1GAEO 2PL1A 5EWLA 1Y4UA 1MZVA 4TKMA 4ZQHA 5DWQA 5H1YA 2ODEA 1JQ3A 1V5WA 1MH1A 1TUBA 3E22A 3KAJA 4ZAXA 5MN6A 1NM5A 3DAPA 4NJOA 2V6JA 3IQEA 4HRXA 4OHUA 1M6VB 2YWJA 1DXYA 3F7TA 2W48A 3KSUA 3BJEA 4YH1A 3WR5A 4LMBA 4DV6B 4F2DA 3ROZA 4WJKB 3GLVA 1Z56C 1BYIA 1KO1A 3E9ZA 5TPZD 1JHPA 1WZUA 2YW9A 1F20A 1Z5VA 2QRVA 3K0CC 3LQ2A 1UXOA 1E94E 2CGEA 5JY1A 4RDHA 1WY7A 4BLOA 4EHFA 3FPLA 3CGGA 3OD1A 3IOMA 1IY1A 1C7ZA 3PQ4A 2J31A 5ALHA 2RHMA 3OU2A 1QHGA 1J23A 2RARA 3KV3O 1ESZA 3L5KA 4H31A 1YB1A 1X7XB 1SC9A 3G0GA 3HP1A 2JGDB 3A4TA 3IDZA 3FTFA 5ILGA 1K2WA 3DL2A 2WHXA 3QX8A 4FLFA 1KEEB 1SUWA 2HHLA 3F3YA 4WX2B 4H4CA 2VSOA 3NBZC 2PFKA 4XQCA 5CH5A 4BO4A 1CUCA 3DVAA 4HNVA 2YJGA 3T41A 5KU1A 1W73A 1BX0A 3HYRA 2HTFA 3G1UA 3KJFA 3OUTA 1DAMA 3E53A 2HNKA 4HY3A 2V7VA 2ZRGA 1H6CA 3C7AA 3FCSB 4PO3X 4KX5A 4IG9A 4O4HA 5B5SA 4QOGA 3I8OA 2I4IA 3B1YA 3OPYI 1NVVQ 2ST1A 3DDNA 1QYVA 3LBAA 4G0PA 4QELA 4UJ5A 1G2IA 3A28A 4FWBA 4YP1A 2I6GA 3WWCA 3HDGA 3VNRA 2XF8A 2PUHA 4KXUA 4YAJA 1OAAA 3Q3IA 4J7UA 4OJTA 4BTLA 2E4YA 1MQAA 1CDZA 3QVSA 1V1JA 1IC6A 3WB1A 2NTYC 2PJZA 5KYYA 5IC6A 4OQXA 5ED0A 3PC3A 4H3KB 5DTEA 1T9KA 3LLVA 4MW6A 2ADOA 1VJCA 3CM0A 2Z95A 4J3FA 4QICA 4QD3A 2ZIXA 2EHDA 3ZV4A 3SBEA 2C04A 3R7DA 2FPIA 1U3WA 1X92A 3QFSA 3IA7A 2VJYA 3H1FA 1M1YA 3GD5A 3VKUA 2G7ZA 1OX6A 3QYJA 1J0AA 2IPXA 4JWKA 3W34A 2WB2A 4RD0A 3R8XA 3P5SA 5KOJB 3F5DA 3MJFA 4INPA 2JBHA 2FUKA 5DEIA 2NUTA 2YVAA 3PL5A 1ZI6A 3ETNA 1IPHA 1F3LA 2WK1A 3LT0A 3SC4A 1ADJA 3O8OA 2YV2A 4GLFA 4IKPA 4L0DA 2XY4A 4A9AA 4EG6A 2ZW9A 3BRWD 4P3PA 3ZH9B 5DYNA 1K2VN 1T5OA 1UFOA 3Q12A 3MOGA 1C9NA 2FU5C 5HJ5A 3CIFA 3KQYA 4X6LA 1NOJA 3P26A 5EHNA 2Y9PB 2Y77A 1NLUA 1ZVMA 2JJ2A 3LECA 3S6JA 1IU9A 4YFVA 5G1OA 4TLLB 4IDHA 4Q3OA 5J3JA 4EMBA 3RYCB 2WBLC 4ZEXA 1FSSA 2PM8A 1QS0B 4QDUA 2DH6A 1NX6A 2WAAA 2F64A 3T0IA 5CT9A 1EIZA 3BZBA 3FOBA 2RH9B 2FE4A 4B7CA 4B73A 5SZHB 1IHUA 1F3OA 1KFKB 2DUMA 1VLMA 1U2DC 5E2IA 3JY6A 2QV0A 3N2ZB 4QJ5A 4E07A 1UWKA 1E4EB 1N7GA 2XNCA 4LWZA 3W9SA 5KPJA 1W96A 2O8FA 4MAFA 3DD5A 1UIRA 1US8B 2PPLA 4KAFA 5C1PA 3SR4A 4AJHA 5JDIA 2OD7A 3ZHXA 4BFUA 3PJRA 4C5AA 1U2GA 2HLDD 3KWLA 3WK7A 3CY6A 4UNNA 5J5VA 4A0QA 4QEZA 1L7BA 1C0IA 4WL0A 2B82A 5DCLA 2CCJA 5FV7A 4A5SA 4RULA 2OO5A 4FHCA 1M1YE 3ZCRA 3BOSA 4MTCA 4J6EA 3O8CA 2GLTA 2OHOA 3QBTA 3ENNA 4IFBA 2HO5A 3M6IA 3SIXA 1RHUA 1WXFA 3RWOA 2W6IA 4FKMA 2D7DA 1GAXA 1AB6A 1GQQA 2PQ6A 3ESAA 2NSYA 4LV6A 1J0EA 1U3VA 3IBYA 1HRKA 2FN3A 2VQ3A 1JP7A 2VBGA 2A86A 5JYBA 5BQXA 1NVEA 3EYAA 1RJGA 2VKTA 2I6SA 2F1HA 3CZQA 4HPWA 4FP9A 4B3JA 2CJWA 3DYVA 1T5LA 4WXRA 1JAZA 5EE1A 2R8RA 4JR2A 2VTVA 2QMEA 2G88A 2HQ1A 1C3EA 2IYUA 5EIFA 2MCFA 5JAOA 4UXJA 3UYLA 1MA0A 1MRNA 1QANA 2Y1XA 3KXDA 4LQDA 1FNSA 1A8SA 1X6VA 4Y2XA 1RKVA 3PLNA 4G5HA 5KNDD 2C7QA 2OHIA 1J07A 3NOXA 4LDZA 1JEAA 3TLZA 1V5EA 2IZZA 3ZCUA 5CDUA 5LDHA 1BFUA 2PWZA 2VJOA 1GR0A 4BB9A 1P5FA 1APBA 4JI2B 1YS2X 3CJQA 3KELA 3GLGB 3ZR4B 4DIMA 1TJ5A 4RD3A 1GQFA 3C87A 4FSHA 2WJPA 1XJ5A 5IDQA 3ECAA 4GUAA 4DCSA 1TADA 2GEKA 2FN4A 3WGYA 2IVFA 1IY2A 1LTHR 1PL0A 3E9QA 4QXPA 4WLEA 3UUWA 4FSDA 1MA3A 3EVEA 4WJZA 4R4JA 3SKXA 3TMYA 5C1BA 1MD9A 3KBBA 4LV8B 3HCEA 4AJ2A 4GKAA 1G59A 3FZNA 3JATA 3ZWNA 1TO1E 4XFJA 4LTNA 1RVDA 2UUPA 4BRZA 1R18A 3INNA 5A3SA 2DWPA 4QREA 3TB4A 4YPOA 4BNWA 1JDBB 2XUQA 1Y6QA 4XM1A 1FNMA 1EJ2A 3BBLA 4FMCF 4EPVA 1A98A 1QLHA 3GLSA 5EJFA 3LNCA 3TQFA 4EZIA 3F6PA 2OXRA 4KO1S 3OE7A 1CCWA 3DXFA 5B2FA 2XUGA 4MQ6A 2R87A 1PQUA 5GVRA 2DWCA 2CD7A 3DW1X 1O0BA 1AGNA 2HA7A 4PICA 1CRZA 1ENPA 4G41A 4JH0A 4NZNA 5AVVA 4AKIA 1EP9A 4YDHB 5T4HA 1DOZA 1A2QA 2BF7A 5AKEA 1SKUA 4QG7A 1GY8A 2Q1YA 4QVIA 1ZUIA 4TN5A 1W4BA 4OIFA 4Q9JA 3U19A 3KHSA 1X7YB 4BB5A 4MRAA 5EIWA 2RKWA 1IXYA 5K0LA 3UC5A 3TZQA 2X13A 3GRFA 1Y3IA 3P9RA 5T67A 2PXAA 4Q4AB 4B3GA 3R9XB 1F2DA 1HQYE 2HLNA 4NCJA 2R8ZA 3U3XA 5HK9A 1JA9A 3VR5D 1E5XA 2J9FB 1JDJA 1HM5A 2XA1A 3MRSA 3B5IA 1PJCA 4JLWA 4GWGA 1TQDA 4BMDA 2PYZA 2VAVA 5AESA 4BO0A 1TTTA 1Z2OX 2Z30A 1ULTA 1CSEE 3N9IA 1G8YA 2FPOA 2XBUA 5A4FS 3L6UA 3OFNA 4RKRA 1YL5A 2XYVA 3QE4A 3A1TA 3DULA 4F72A 4AY6A 3EOZA 3NP7A 4RK0A 5LLDA 3MINA 4NCKA 2AZTA 4HD8A 4Y2RA 5AHKA 3DPSA 1LBSA 4Z7QB 2KQUA 3A7EA 4B7ZA 4KH1A 1MX1A 3MUEA 1H6AA 4L0QA 4CJXA 1DJQA 3FH0A 2YJ5A 5B3AA 3U3JA 3R6TA 4AJKA 2F00A 2AV6A 1FY2A 2CUKA 4IVPA 3RBXA 2CUNA 2SKCA 3FLMA 2M32A 1IEXA 1EFRA 1PW5A 1CY2A 3NHSA 4D4LA 1LQ2A 1Z5UA 2AJLI 1E58A 2B92A 2FEPA 1RWKA 2QRNA 3BSSA 3ER6A 4LISA 1Q0TA 2QXTA 4Z4QA 3KOUA 1P81A 1DIRA 2AX3A 1QOPB 2INGX 3HSSA 1PT5A 3M0EA 3M3HA 1RP1A 4WCVA 3PENA 1IN8A 4Q1VA 4YJHA 3RUCA 5CXQA 2ZR0A 1FDTA 1SKAA 2XNJA 5FV4A 2J3KA 4DDHA 1V6CA 4HCJA 1VI6A 2XWJI 4GYWA 2X0IA 5IYZF 5FOQA 3RVDA 3VAAA 2DZDA 2XGSA 2GFHA 1BS9A 1ZEMA 2E21A 4W9NA 4R1UA 4LXYA 3S1SA 1M2EA 1JEDA 3CLUD 3U3KA 3P9CA 4GNRA 1XR3A 1X8JA 4IIEA 5BORA 1A77A 3CRW1 1HK7A 3I9NA 1ZVQA 3ASYA 4WWHA 4RIFA 3AVOA 5H5JA 4CRWB 1DKRA 3TJMA 1PHPA 4TMVA 3W5IA 4J6FA 2OV1A 5CVDA 3WLLA 1IHDA 1H5QA 4NL4H 4P80A 1UPCA 3E81A 4GLJA 4ZKEA 4CHGA 2PZBA 5CCBA 3OE4A 1F5NA 3VYWA 2QTMA 2V54A 2HGSA 2QGZA 4J07A 5AI8A 3ZV6A 1GA1A 2WNHA 1J49A 4CUJA 1A9ZA 4BWVA 2NXEA 2WU0A 4YECA 4BRSA 2RBEA 3KUKA 4Y1EA 5CU7A 1Z17A 2SECE 2W6ID 1T0UA 8ATCA 3I0NA 3FZEA 1IATA 2XNDA 3QU2A 4QA9A 1DVRA 2BD0A 4HR7A 4JSRA 5CA0B 3ESQA 1VB5A 4H7PA 1ORWA 1HT0A 2FUNB 4I6EA 4XUDA 4BKRA 2HT1A 3VTKA 4AU1A 2HYIC 3ROPA 1SD2A 4PQYA 4Z9XA 1IVSA 1XXHB 1I51A 4H9GA 3UT0A 1QIFA 1GPYA 1YE3A 3GPBA 4LJ5A 2JF0A 3T1QA 1ADFA 4RELA 5JLAA 1DIOB 3AP3A 1GPWB 3FETA 3R41A 2QE7D 1ZC4A 5AO9A 5C8DA 3Q85A 4QXMA 5EWJB 1PR1A 5BOSA 1Y6RA 2HWXA 4U7JA 3RM3A 4CIWA 1YNOA 3WIDA 1PFVA 4Y8VA 4XJXA 1NPTO 1N3IA 4YUAA 1CEYA 1YTUA 1RYMA 3F7MA 3CNBA 4FFPA 4BECA 1P3DA 1Z0UA 3KKLA 4I8IA 1Q0HA 3N5CA 1LY1A 2L69A 3UUFA 3VPGA 1JGTA 5E9AA 2G5TA 4B85A 3IX7A 3PUXA 1JSLA 3I2IA 5K0BA 4BV3A 1XZEA 3G9ZA 4IOMA 1QIHA 3KLBA 2FE1A 1NVUQ 3TAUA 2UU9B 1JJBA 2ZKLA 5FOUA 1P7CA 1PJAA 4QZVA 3DE6X 1V1RA 2BFBA 4IIYA 5FKJA 4HMPA 3ZCQA 3PC2A 3BKWA 3NH9A 1TAUA 3KTFA 4LF8B 4KX3A 4GQIA 3WKBA 2ZWAA 1ZOSA 4OU4A 4R68A 4U2KA 3JQ7A 4M6WB 3C7TA 3HO6A 5HF6A 4AUNA 2GZRA 2W00A 4BNFA 4W6ZA 4MZDA 3FNBA 3LTEA 4XB2A 5CYFA 2AQHA 3QKIA 3ZHQA 2GM9A 2CNWA 1SCUA 2HCFA 1RQ2A 3C5CA 1ZQ9A 1ATIA 4LGMA 3AY0A 2QQEA 1YFZA 4RPLA 3PI7A 1LKZA 4HDSB 1JWBB 2H51A 3B48A 2JKVA 1ZOOA 2BFDB 4RZHA 1HSOA 1B8VA 2UYOA 3AUSA 3Q7EA 2HPAA 4D2IA 1AK2A 3KLNA 2CEAA 1VJTA 2BTOA 5FBLB 3FCUB 3SX2A 1E9BA 5M7EA 1R0XA 5L6LB 2JLZA 1K3TA 1XMQB 3DKIA 5CT6A 1SCDA 2QX8A 1FPQA 1MVNA 1KMIY 4NAHA 2ZRPA 1WEKA 4LYGA 2XRMA 1P9WA 3D59A 3TRDA 3ZKWB 3QOWA 4QDKA 2O0HA 5B4TA 1E6CA 3O3OB 5BW6B 2CJYA 1E2IA 1GGNA 2L0XA 1G8KA 1N2XA 1QFJA 1WVMA 3AB3A 2VO1A 3A3YA 3PVZA 5J5CA 3RFCA 1YI1A 4K81B 2QTCA 3DDWA 4HI0E 3VAYA 4OQZA 2IIBA 4DWVA 2A1IA 1QB7A 2I3AA 5F7XA 1SPXA 3DWGA 1FMJA 4HG2A 3OX4A 1P9OA 2HF7A 4X1KB 2P79A 5DM60 2VK8A 2PKCA 4NMXB 2IXEA 4FFBA 2BKUA 4E15A 3D1JA 5JG7A 4V1CB 1XWIA 1MJ5A 1KJNA 1NJGA 2HSDA 1BQ4A 1FVFA 3BTVA 3NM4A 4UCWA 3X0DA 1J0DA 4WAUA 3T7JA 3KRTA 5EIXA 4BXOA 4MYSA 1Y0BA 1MT0A 5I45A 3FM9A 3GP8A 2JVJA 5KU7A 4IGAA 4JGBA 2B5OA 5L4SA 1HE1C 3JVVA 1BSVA 4PC3A 1XDWA 2OGZA 3OKAA 3RRBA 3N6VA 3EDCA 4PO8A 1DC6A 2QY9A 4UTPA 3CLTD 1U9IA 4ZAVA 4PZYA 2PNFA 2QM0A 4ZANA 1XZDA 2P2NA 5JXIA 1YOBA 2HRDA 1ZRMA 2X0DA 1XMJA 2PGXA 4DPMA 4GE3A 2A0XA 1YR7A 3C3MA 4MPDA 4BP3A 5IULC 1W36B 3WYAA 1ILEA 1NRXA 3DHNA 3NCHA 3B8EA 2J0VA 1M6YA 2K87A 5F3RA 1EP1B 3VR2D 3B13B 1ZESA 3NG1A 3MSCA 1U2PA 3KT8A 1V3TA 5LMZA 1LPBB 4CGYA 2JLYA 2KB0A 3F2VA 4CMAA 4Q1DA 4X65B 1SUBA 1YZNA 4WOPA 2NUAB 4EY3A 1AMUA 1F8GA 1E1MA 2FTKE 4BE4A 1XDGA 4F91B 4KHPB 4QWWA 3LWZA 1MIOB 2V6MA 3ELUA 4O2AA 2ODTX 1W6RA 4BFLA 2DM6A 3EXIA 4XQ9A 3GJRA 1RWMA 4ARUA 1WW2A 1Q22A 4DDTA 3EJ6A 4NWIA 5DPMA 3AF1A 4DBVO 1CR1A 3OTQA 4BO3A 4QGSA 3K2IA 1MB4A 3ETDA 2QM3A 1E1QA 3BM5A 4AJ1A 1ZIDA 4B44A 3R6LA 1QFYA 4B40A 1YHYA 2TYSB 5CVCA 2Z2JA 3ESDA 1VP3A 1E1NA 1RRGA 1CLEA 2VG8A 3TLEA 1U6JA 3KQPA 2B83A 5DHPA 3EGDB 3ETJA 5CFOA 1U2GC 3DE4X 4KYIB 2W43A 3LSTA 2R4QA 1JB1A 4YJ2B 3RROA 1A9OA 2H9YA 3ODPA 4KGDA 1OI4A 5CNKA 2ABWA 3I28A 4F5WA 1B2LA 2NAFA 5CFNA 4N6OA 5AW4A 2EKBA 3CEJA 1XVIA 3IUNA 3FPEA 4K87A 4BFXA 4BKUA 4L5AA 2BGGA 1Y4SA 3F3KA 1E69A 1VI2A 2CJWB 1UMKA 3DXYA 4LXGA 3VNAA 3TKLA 4R8VA 3ILXA 3EK2A 1NNLA 1H4VB 4G84A 3PTZA 4Z4IA 3NP9A 2JW5A 4HGYA 4CI0B 4BJ3A 3EC2A 4ATNA 1A9TA 4HAXA 3VR0A 1FS6A 3H3FA 3ZXXA 1LW7A 3KSMA 3GEIA 2QAIA 1BRTA 5FH9A 1MQ8B 1JAXA 1AY0A 1NN3A 4Y2TA 5F2KA 3LHSA 4DIDA 4F71A 3I04A 5A7FA 2R1TB 4LZOA 2BKLA 4MIEA 1LI4A 2XQGA 3CVJA 3W6UA 2D4HA 4LK2A 4S0XA 4KBFA 3JZAA 3D7MA 4EL5A 2Z1NA 3R9WA 2Y0BA 2P1RA 1NDQA 4LMRA 4MVWA 4P08A 4JKOA 3Q2IA 4I4TF 3P71T 1Z73A 2OFXA 3V8BA 3J80A 3N76A 4QM6A 3JQGB 2ISSD 1ZMRA 2H2IA 1MP0A 4XI9A 4CUZA 2ZZNA 4F2GA 2Q45A 1HDXA 2I99A 1IG0A 4FEAA 4B6JA 2CLDX 4HH1A 4C1NA 4ERNA 1SXIA 4AO6A 1GZDA 5F2EA 2OZEA 2HA5A 3BERA 3VBCA 4F4JA 1JALA 2D2FA 5K8TA 3C24A 3A9UA 1R5BA 3HABA 2RG1A 1F14A 4ZO9A 3SLRA 3JWPA 3VSBA 3IV7A 4R1MA 4ZAZA 4MSUA 5KCMA 3SCZA 5E8JA 3SY8A 3V8PA 2ZB8A 3Q8XB 5I4KA 3AKYA 4KW7A 4LXXA 2XJ9A 1SHJA 1Y5LA 3OLWA 5CIQA 1A1SA 2XGGA 4PVDA 3BDVA 3NEJA 4B2YA 4D8WA 4E7OA 3S8EA 2BBWA 2R6CA 4K8OA 2JLXA 5AJUA 4WBXC 1D0SA 5E4YA 2C9BA 4W5OA 1Z25A 4GG1A 4V02A 5DT9A 5LOVA 1JSXA 4GBMA 3MRXA 1G8AA 3ICPA 1U7OA 1HO3A 2X15A 3GBPA 1P60A 5LBIA 3LW8A 4AJJA 5I47A 2QUKA 3GFPA 4NU6A 4N7RA 5JO9A 2ZYWX 5FUMA 3VKVA 1FL9A 2OAQ1 3CNLA 5I9BA 1KVRA 2E5LB 3TZKA 2OENG 5HDBB 3STHA 5KVQA 1TK2A 1G5FA 5KQMA 4A8TA 1W4CA 3AQIA 3R5XA 2GXQA 3D54D 5JCJD 2PKEA 1AGPA 2W6ZA 2E5WA 1SZJG 1O96A 1QVVA 1UQTA 4IDDA 1RHRA 4OGFA 4QOHA 3C3WA 3WJ2A 3TECE 4FEYA 2PKRA 5M34A 4C2UA 2DUNA 3OSUA 5J1SB 4EQ6B 2OAP1 5KNCH 4TLMB 4PZ9A 1DTSA 3QEMA 2XEXA 5HFNA 5BW5A 3I6ZA 4HWGA 5CIYA 2C3PA 3LAWA 3W5UA 3WGMA 2DFKB 2WJVA 4Z0PA 2GNOA 2P7IA 3EPPA 5DNAA 5G4LA 2EKZA 3M1YA 3K53A 3K1AA 1JQAA 5TQ0A 5LNK1 1A72A 1CUUA 1P7ZA 3JQFC 4DPKA 1UKEA 2J6BA 3K09A 1X7WA 4DXHA 1M2NA 1OGJA 3A9WA 3O6VA 1VE1A 3QUQA 3U3MA 3AKZA 5AKLA 3U7IA 3DEJA 2VTBB 4NFSA 1EDZA 3NHKA 1CBUA 1TVEA 3MLAA 1MB2A 2XYRA 1IB6A 1NW6A 4QUDA 3SBOA 2IEZA 1NR1A 5IM5A 3WXBA 3Q9NA 1QTRA 3FDZA 1AV6A 3DGEC 3WYNA 2ZJ2A 1M5TA 4PYMA 2P6MA 4G1EB 1VKHA 1L3CA 4PAWA 5KNCD 1UJ6A 5A2QA 4FOTA 4JUBA 5F9MA 1YZGA 4E88A 1GSIA 2GHRA 4R8MA 2J5BA 3WO1A 5J5AA 2IWHA 4C4SA 1S4MA 4BQFA 4FXPA 3HI4A 2EW8A 4P98A 4HLQB 4LSMA 4BNLA 3V7YA 4ER7A 5JXHA 3DW3X 1YZHA 3L43A 2VDKB 5IKOA 3KEOA 1E2LA 3MMXA 4YRLA 3JRXA 3WRYA 1MJNA 3FWNA 2V98A 4HDOB 2JIDA 4C6HA 2BGUA 3EXEB 4AN0A 4EKGA 3C6KA 3AV0B 3SYLA 5GVSA 3C3XA 3F67A 3L4JA 2KWIA 3FWZA 2WHEA 2BGTA 2Q4TA 1UL1X 3BN3A 2YZNA 3CVOA 3FHOA 3OQIB 4PZCA 2LZ0A 3WFIA 1NURA 4PONA 1AUXA 2JIQA 3ANSA 2NIPA 2PKQO 2YMQA 3A05A 1T8PA 3OH8A 3R6GA 1NMZA 4O2BF 1ZJYA 2I2CA 3MYYA 1R88A 3RS2A 2ONZA 3EFEA 2FP4B 5DM2A 1WUHS 2CXTA 1MX3A 1DPGA 1NGSA 1NQ5A 1Z4PX 4JXKA 4AMYA 1WBJB 4GLBA 2QUBA 4FDLA 2FYTA 3BKXA 3K3PA 2P5YA 4KIWA 5CA0A 2PT9A 3WIBA 5CB4B 2WIAA 3IQFA 5J2TB 4KJZA 2FN7A 5ALIA 4GZMA 2ZUFA 2PUEA 4JUDX 1G1MA 3GEDA 1MH9A 1UBNA 4ED9A 1UXGA 4OP2A 1XALA 4XR4A 3U44A 1Y82A 2XDWA 5IT4A 2EIHA 5CAEB 5LBUA 1YGPA 5JD3A 5G02A 1U0SY 3SR0A 2Y1DA 2HFKA 5KS2A 4IDAA 3VGPA 1OBFO 2J9YB 1U5BB 2QX4A 3ER8A 1H4SA 5BT8A 1SVUA 3FVVA 1KYYA 1QYCA 5CHYA 2OFPA 4DA0A 2GN8A 4RENA 4JT9A 4CF5A 5JMWA 1NXVA 4QL3A 1E9VA 2LCFA 2V96A 3B89A 1G2QA 3VTZA 1BWSA 3DEYX 4AMUA 4D26A 2DQKA 4PRYA 5E1OA 4UULA 1I01A 3A9CA 2IHKA 2ZTVA 3SZOA 5TQ2A 3S55A 4L8FA 4I1PA 2Q5HA 2H00A 2OZKA 3H4IA 4UMFA 4ZU1X 4ZCTA 1ZJJA 5CT4A 2I3DA 3FPHA 5K01A 3CVUA 2HLPA 2PX2A 2ZJOA 2PRKA 3AG6A 3FYHA 5FB3A 3NOVA 2JFGA 2W6NA 3E3AA 5FDFA 3KDSE 1EXDA 3RHZA 1K7YA 3T99A 5JD5A 4FLMA 1VSBA 5KI6A 2BJVA 1AE1A 1HZZC 1CU1A 1YKSA 2WSIA 2GTPA 4RACA 5I7EA 1KQFA 2FK8A 3QENA 3SNHA 3ZE2B 3O4JA 4PM4A 3NTQA 1V9CA 2VTDA 1O58A 4NATA 1QBKC 3UPTA 4JHXA 5A4JA 3PKZA 2RIPA 1PU2A 2OGTA 2Q3HA 3FOWA 3D6AA 2CV0A 2OCBA 4IJVA 1YRLA 4UE2A 1U28A 1DSSG 1MU0A 1IONA 3TIGA 4P7KA 4HDSA 2WT9A 3PFFA 4D9CA 1RI5A 1BNCA 1EFDN 5DB4A 2O7VA 5KNDH 2Q6OA 3EBLA 4NPAA 2P35A 2B78A 3HUTA 2FSUA 1KYXA 2F3TA 3PFCA 3IRVA 4PWZA 2YN2A 3DEHA 2X3UA 5DT2A 2VCHA 4YJKA 4MJ3A 3U1BA 1H3FA 3FXAA 1RI1A 2NZUG 3EIUA 4XUEA 3T9BA 1JMVA 5F5LA 4TXMA 1S2NA 1XT6A 3M6AA 2CL0X 3UUEA 3INRA 5C8ZA 1DZ3A 2C2OA 1W49A 4WXPA 1QZZA 3PC6A 5HWSA 4C4YA 1Y33E 2IUYA 2IZ1A 4CT5A 3V4RA 2Z08A 2NU7B 3RSCA 5K6AA 3L82B 3P4UA 3ONNA 1A5TA 3F78A 1Y5IA 4OFWA 4YCNA 1NBMD 3VSEA 1IULA 1UH5A 1W94A 2WUFA 4TYQA 4NBUA 4Y6QA 5FOVA 1OIVA 1KJYA 1TA4A 2GZAA 3ICOA 1XTRA 4BKMA 4QE3A 1RZUA 1NY6A 3BFPA 5JYCA 1MTZA 5CCDA 5FBRB 2YYYA 5E2AA 3IAEA 1GNTA 3FMFA 4J8PA 2YHAA 4HUQA 1QX3A 2DFDA 4K9SA 4F2WA 3HVIA 1PLJA 1QC5A 4ROSA 3LP8A 4E1VA 3M7IA 3KOXA 1BA3A 1TA9A 2OP1A 3BSFA 2O3SA 3TNYA 4EY7A 3BCUA 7REQB 3EB9A 2ZUSA 1Y7TA 1LW6E 1BEUB 3AHCA 3ESXA 4DIOA 2GO7A 4P3NA 2H85A 1WHTA 2YH2A 5FORA 4Q21A 4XSGA 1I6WA 4EJMA 1HNZB 1U0EA 4KQKA 3UMCA 3NHWA 4UC0A 1P9NA 1PUIA 2XUKA 1SQSA 2AUTA 4QEDA 1TAGA 2QG4A 3SBXA 5JXJA 1XTSA 4TWRA 4CMKA 4CKCB 4V0KA 4WOBA 1ADYA 1Q50A 4EA9A 4YP9A 1GV0A 5KTOA 5AHXA 4C03A 2OBBA 2CE7A 1UXIA 4JFAA 4ETNA 2HQSA 3L7KA 2P9TA 4EHBA 3HB0A 4Q7LA 5E6UB 4EHKA 3OBBA 4JJEA 2JIOA 2JIRA 1C41A 4PGHA 3ZDQA 3HCPA 2EJCA 3PNQA 3C3AA 5FIUA 4YRSA 5I51A 5HOQA 2WHPA 1YQDA 1AUQA 4II7A 5JASA 4G3XA 2E48A 1ZNQO 2J3HA 4F4HA 1T2DA 3TO5A 3WXMA 3HUDA 5JS1A 3AM1A 1TPZA 4J0CA 4R3UC 1D4AA 2O0MA 5K2MA 3ST7A 3PJGA 3S29A 3HEAA 1Z7GA 2H11A 4I4IA 4DZTA 1W1UA 1E18A 4ZVRA 3ZHYA 2ZR8A 1JTEA 4MHOA 1RPZA 1RS0A 2I65A 4LYDA 3OZXA 1XO1A 1OC2A 5JE8A 1X1TA 5DNUA 3KNZA 2O7SA 2AI3A 2XD4A 3GT3A 4LFBB 2W6JA 3L8ZA 3PUJA 1EZ1A 1N1MA 1ZEJA 3VJMA 3H1AA 2XE4A 1M2KA 2C83A 3DOJA 3F4LA 3OQIA 4N1AA 3HACA 3CUTA 2N47A 5J2TF 1XD8A 2AUNA 1EDEA 1SM4A 4KYTA 4OK6A 2NU8B 1H2YA 1ZRHA 2CNNA 1N5RA 1X9IA 2QHXA 3AINA 3HHEA 4M0CA 4D4MA 1NVFA 2RJNA 3OFJA 1R12A 2XSZD 3COZA 3LVFO 5AVSA 1JDZA 3D31A 5EXXA 3ED1A 1SBCA 1F9AA 1MKYA 3DTVD 2O8FB 1YFLA 3GLHE 3TEFA 2OZPA 2XTJA 2WYHA 3IAM1 4DZRA 2JAXA 4BJ1A 1PG2A 4QYIB 1YQWA 4MRNA 4BDTA 2R2GA 4M98A 2H5JA 2VSQA 2JRCA 3C7CB 4CM9A 1HYQA 3DFZA 3SGLA 1D1SA 2ECKA 1YGYA 4RTLA 2AZMA 1FRFS 2WVAA 4RHFA 3OT1B 4CDGA 5HQ3A 3HM9A 3AL0C 4P0TA 3U0VA 3G5TA 3FPBA 2D5LA 3UWPA 3BA6A 2ZVPX 2O8BB 3AKEA 4HDCA 2QNIA 3AK4A 1YIOA 5BSGA 1T9DA 2ZVDA 4LRXA 4MVJA 2J7PD 3NFRA 2O5CA 2WA1A 5AOCA 3HY6A 4S1WA 4WCFB 4YT8A 1VKOA 3R3ZA 4GSKA 4Q3DA 4DC9A 3A6LA 4AY4A 4CLOA 1UAGA 3FCCA 3W5DA 3L7CA 3OT4A 4G24A 1Y7IA 3V5NA 4E11A 1RC1A 4LJAA 5CMLA 1XRNA 1D0IA 1Y3BE 2O1EA 3W7VA 5K8IA 4B3SB 1B4DA 5F9HA 1X14A 1SQGA 4FQ8A 1XZ8A 4Y6PA 3DFMA 3AHFA 4YQZA 5F1KA 1UDRA 3NRJA 1B00A 2WWWA 1T0HB 4YCCA 2HA3A 3ACDA 2DWUA 4NG4A 2BMDA 3DVSX 3FY4A 1IZ9A 1Z35A 4IDCA 3G7UA 4UEJA 1R37A 4ZT3A 4BZXA 1IRIA 2Z5FA 4ESHA 6AT1A 4HDMA 1BU5A 1GFSA 3ETCA 5C3UA 1RPTA 2AJTA 5C3MA 2DPMA 1NTRA 1SIWA 4TV9B 1EE9A 2IPMA 2WHQA 1A4UA 1DRUA 3GJXC 3MM4A 4JKIA 1CZOA 1WABA 1BA2A 1UT8A 3BL6A 3DAGA 4I2NA 1WUJS 4IXNA 1ZMTA 5DIFA 3SPXA 1F60A 3E8MA 3OEED 3FTCA 3PRHA 1VTKA 2CD9A 3AKCA 5T64A 421PA 2WJWA 2I80A 4G8DA 4RH3A 5JZ9A 3UVEA 4D5GA 4I50A 3BE8A 2IEAA 1YR3A 1U9JA 2GAOA 1GXSB 1MOPA 4AZ3B 4YRIA 1FEZA 3IUYA 3IPXA 5HFAA 2PWBA 5HKOA 1SC4A 4EQ6A 3OHPA 5LIPA 1PR5A 1T8YA 3D7NA 2X5NA 3EC1A 3QHQA 4XAQA 5KDOA 1NNUA 1P4HA 2C0CA 2GVNA 2XA2A 1D1QA 3MNFA 5T57A 4JR0A 3QX3A 5E7JA 2WSBA 1CZNA 5JI3E 3NUGA 1T5TA 3MTBA 4I8DA 4AIRA 4YCAA 1B93A 1JE0A 1GKKA 2FPRA 4J2OA 4WUTA 5KX5F 4JS0A 4H17A 4M9QA 4L5YA 3ZW9A 3TQHA 4EF5A 5JADA 2VPQA 3N0VA 1QYRA 1MFPA 1XP5A 2JGIA 5CM2Z 1WUKS 4DB4A 3P20A 2YVKA 3PIRA 4QFMA 4EENA 1N5OX 1G42A 3THOA 2ZJ1A 3SJBA 3ZJVA 5KPDA 3LUKA 2DBRA 2HAEA 3KZMA 4MVJG 4LHWA 2CHFA 4J91A 1YA6A 4ZJYA 1J8MF 4KC0A 2GJ8A 3NHUA 5GGXA 4G0YA 2W0SA 4FYWA 2I2FA 1YZVA 4NNOA 3EXHC 4WZBB 1AZSC 2BELA 4US2R 5MHTA 5IW8A 1YJBA 1OH5A 3HZOA 2GVDC 2QUAA 3BWVA 1OZ0A 2HMYB 1ELOA 2PUAA 5ALUA 3UHOA 4OB7A 4A10A 3NZEA 1QK4A 1Z45A 4MPTA 2J0QA 3ZD7A 4JYCA 4ZOLB 5CPBA 1G6HA 3FYUB 4N5MA 4XLZA 4C0XA 2W90A 2JFNA 3ZCPA 4BRWA 4X8OA 3VR6H 3AJ9A 5CLHA 4PYIA 1ZSVA 1T5BA 5KJEA 3WQHA 2I7DA 3B1ZA 2I4OA 3KZNA 2PCJA 3ZDYB 1KY3A 3HB7A 1GPDG 1KPGA 1QGUB 4G86A 4GR4A 4KMSA 3A6PC 2DVMA 4ZRNA 1G5QA 2PANA 4HQFA 4UATA 3KUXA 2AOTB 4W6QA 1KDPA 3RASA 3TB6A 1XAJA 2XT6A 4IMPA 3D6UA 4ENPA 3K9LA 5IYZB 4Q00A 2B7BA 4UNSA 3WRYC 4C4AA 1ZRSA 1XEWX 1TD9A 1UBJS 2ZS8A 3CPSA 4QDOA 3JD1A 4ZVPA 1CC1S 2PGJA 4UZEA 5SZJA <