1FJ2A

Crystal structure of the human acyl protein thioesterase 1 at 1.5 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
229
structure length
229
Chain Sequence
MDPEFMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human acyl protein thioesterase I from a single X-ray data set to 1.5 A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN (ACYL PROTEIN THIOESTERASE 1)
total genus 70
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.1.4.39: Alkylglycerophosphoethanolamine phosphodiesterase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fj2A00
3BE8A 4AX4A 4E15A 3V1NA 4AO6A 4E11A 1UK9A 4G8DA 2WLSA 1R50A 4UFPA 3FWHA 2PKYX 3E3AA 5ALRA 5AICA 5A7HA 1XRPA 3LCRA 2QUBA 2XUDA 2VT6A 3CN7A 2JGLA 4LYEA 1WB4A 4X94A 2WU3A 3EQ8A 3M3DA 3H1AA 2O2IA 5JIBA 1H2XA 1KEZA 3KXPA 4HRXA 2VJDA 1UK6A 1ZI6A 3D0KA 3WKEA 1YS1X 1H23A 1O6GA 3AINA 5AKKA 1QOZA 3R3ZA 5AI5A 1Q84A 1ZD3A 2GYUA 5FXMA 1VJ5A 1MPXA 3VKFA 1FJ2A 1IZ8A 3RLIA 2BJHA 5EHXA 5HFNA 2XMDA 5CRIA 4CIAA 1SCIA 3PICA 1MO2A 1U4NA 2BGRA 4LXHA 4GBGA 2XI4A 4BVJA 1K5PA 4UFNA 4J0HA 5FP0A 3TEJA 2D0DA 1MNAA 3A70A 5C8ZA 1XLUA 3H19A 4WY8A 3R3UA 1BU8A 1G66A 2QR5A 1AUOA 2DQZA 4MQLA 2XB6A 3LLCA 4BE4A 1VXOA 5HF9A 5AIBA 1K8QA 1EDEA 5CT4A 1TCBA 5HF8A 4H18A 4W1PA 1AKNA 1AZWA 3WK6A 4U2CA 1GKKA 4EY5A 4UHDA 4Y2PA 2ONCA 2WG2A 1CQWA 4AXBA 5I7UA 4I19A 1UOQA 3R0VA 3VJMA 4JNCA 4M0FA 1XZCA 2XMSA 2OAEA 2XUIA 1I6WA 1R1DA 1LBSA 4EY7A 5T4EA 1LPNA 3IUJA 5CT9A 2ZSHA 1EDBA 3Q0TA 2XQKA 2FJPA 5JASA 3DCNA 3KWFA 1UFOA 1EK1A 4UHHA 4L3WA 5CMLA 4N8DA 5LYYA 3ED1A 2DQYA 1FFAA 3V1MA 1THGA 1BROA 2OPHA 4K5QA 2HADA 1XRNA 5LZ8A 1CRLA 4QDTA 3DQZA 1EXWA 2PSJA 3HACA 2WTNA 5ALFA 2WFZA 1JMYA 1GT6A 2WIGA 4BE9A 4IHAA 5DYTA 1QIDA 4B80A 4Y2VA 4P92A 3AUKA 5AO9A 2JIDA 5IH7A 5AKYA 1JJIA 2XUKA 3I1YA 4L72A 2RIPA 4H7EA 4B0OA 3NOXA 4WJLA 3EF3A 4QEKA 5I8PA 4BRZA 4G9GA 4UBKA 1IUPA 1TAHA 4Q1VA 3H2HA 1DX6A 2C58A 1DWQA 4UHFA 1S8OA 4MQMA 1XQYA 1XKTA 2WFLA 5ALSA 4YK7A 3H2GA 3ESCA 1TIBA 2O7RA 5IVDA 1HLGA 2H7CA 4PNZA 2OXEA 5ALLA 1UK7A 1U65A 4BCCA 4BTLA 5HKAA 4H7IA 2WJ3A 4BP8A 1U2EA 4UUQA 4PF1A 5IVIA 1CUFA 2Z5GA 1LZKA 2CEKA 5T4HA 2R11A 5IKXA 4GECA 5AM4A 4TVKA 2BAGA 1LPOA 3C8HA 3FSGD 2QRUA 2BUCA 2HA3A 1RWQA 4CG1A 1ACLA 4EB0A 4IQ4A 1CUSA 5JD4A 2V98A 4Y2QA 5JZ9A 5ALGA 3LIPA 4X6XA 4X6UA 3FOBA 3O9MA 4G4GA 3FBWA 3OPMA 1QIGA 5LZ2A 2OCIA 1C7IA 1E8NA 3K9BA 4DMFA 1N5RA 3I6YA 1CIJA 5HK8A 4X3CA 1VZ2A 3IVMA 1QO7A 2XMZA 2CMFA 3FLBA 4K6HA 5AP9A 4ZV9A 4J0JA 3STWA 5ISMA 2VT7A 5AM1A 5K3DA 5CURA 4EA6A 1C4XA 3RM3A 3QITA 5DYYA 4W1QA 4CCYA 1E66A 5D3KA 1A88A 4G5XA 4HTAA 5AI9A 4F5ZA 2ZYRA 3C6ZA 1QIIA 1DQZA 2HA4A 5E4JA 2XMQA 3G9XA 2Y1KA 4HXFB 5K3CA 5DLPA 1BEEA 2HA7A 2RI6A 3WWOA 4GI1A 3QZUA 2WQZA 5AM5A 4J7AA 4EY4A 4P9NA 5FDFA 5AJHA 1XLVA 5AKIA 4YPVA 1BCSA 2DFPA 3V1LA 1CUIA 2WFMA 5EIEA 3WZMA 5AOCA 1QIKA 2XLCA 4KAAA 4EY8A 5D7BA 3TRDA 1XZBA 2WJ6A 1EI9A 4X93A 1XKLA 5HF5A 3D7RA 1PV1A 5BWCA 1TCCA 3PF8A 4OB6A 2WFLB 4QWWA 1THTA 1P0QA 4FNMA 1BN7A 2QTBA 4NS4A 2WIDA 3ESDA 4PV7A 1FFCA 4N8EA 2GYVA 2OCKA 1QIEA 4AB1A 5A6VA 4AN1A 1VKHA 4B85A 3FAKA 2PPLA 4OU4A 2VQ6A 3DOIA 1LPMA 4WY5A 3E0XA 2JGEA 3BWXA 1SFRA 4LYDA 1WPRA 1LPBB 5CXXA 4Z49A 5HZGA 1ZICA 1LLFA 1K6EA 1R3DA 3F67A 4YASA 3I6MA 5C8VA 1EB9A 5CBKA 4BZWA 2Y2VA 4AN0A 1QO9A 2HA6A 1UK8A 4HAIA 3H2IA 2HL6A 1ZD2P 4P93A 1LPSA 2BGNA 3FNBA 5JD5A 1E8DA 1DTEA 2HFJA 1LBTA 2V96A 4B82A 5JADA 2PUHA 2JGMA 5BWBA 5ALZA 4DNFA 1CUAA 4UBJA 1VOTA 1UOPA 3RARA 1H22A 3RK4A 3GZJA 4AMYA 3CCBA 3WKBA 3KWJA 5LZ9A 1Y7HA 1CUWA 2HRQA 3WWDA 4OB7A 5AOBA 1EVEA 1QONA 2VSQA 4C87A 2WHQA 1HKHA 3BJMA 3EQ7A 3ESBA 1CVLA 1NU6A 5AKEA 5AK4A 4UBNA 4JEIA 3WK5A 2H1IA 3G02A 3B3QA 5LP1A 3KOOA 5CT5A 1IMJA 4Y7DA 4KR0A 1HQDA 3QBJA 2PSDA 5CXUA 2OGZA 2HA0A 1GPNA 3WZLA 2WHPA 2D5LA 1Q0ZA 5AI4A 1WM1A 3PUIA 5EI5A 2CZQA 2E3JA 4H7JA 3F97A 1XLWA 4FLFA 5CTAA 3CCCA 1F0PA 5YASA 5I9IA 2OGTA 4Q3KA 3LP5A 1G5FA 4BP9A 1N1MA 4BRSA 2B61A 3WL6A 5LZ4A 4OPMA 3IDAA 2OG1A 4CFSA 1GPKA 5JD6A 1XRLA 3I2FA 1XZEA 3QPCA 4OD0A 1QIMA 4H7FA 4UBIA 3WIBA 1K4YA 1CPYA 1A7UA 2W6CX 1NU8A 4FNGA 4G8CA 3O4JA 2WTMA 5AK6A 3K2IA 4N5HX 2XQIA 4OUKX 2XUAA 3FSGA 1CUCA 1TKRA 3EIOA 4CCWA 3HZOA 4FFWA 4WFKA 1CUGA 5LIPA 1TQHA 1MNQA 2ECFA 3X3HA 3WK8A 2OGSA 4BZZA 2XUOA 1CR6A 2JGKA 1FFEA 4ETWA 3EBLA 5CT8A 5KBYA 2G5PA 1ORWA 4OB8A 4BB0A 2XDWA 3AFIA 1L7RA 2PSHA 5AI8A 4ZREA 1ETHA 4LKOA 1CUHA 4J0CA 2XE4A 4P08A 3GBSA 2XMGA 2GZRA 5K3EA 3AZQA 3ICVA 3IUNA 3IUQA 4MXDA 5AOAA 5ALNA 1YA8A 5ALXA 2XUGA 1YS2X 1ODSA 4NVRA 4GLBA 1WOMA 3V9AA 5JAUA 4X95A 1GZ7A 2GBIA 2LIPA 3UMJA 2ACKA 3FYUB 2WM2A 2VJCA 4DMCA 1GPLA 4C88A 2QMQA 2Z3WA 2WILA 4JYPA 5HQ3A 5EIAA 1N5MA 2OAGA 2Q0XA 1UWCA 1AURA 1CUYA 4W9RA 5E2IA 1L7QA 4WDRA 5FOQA 2B9VA 4XX1A 2R8BA 1VXRA 5ALHA 1XZAA 3MUNA 4MJ3A 2PVSA 4F21A 5K3FB 2XUHA 2XUPA 1RYYA 1Q83A 4QLOA 4UBOA 4YX9A 1VA5A 4QA9A 1B6GA 1UT6A 2OLEA 3QPAA 5AKGA 4DMKA 2ZSIA 3DYVA 2J3QA 5ALTA 3UUFA 3T52A 4J0DA 1MT3A 5ALOA 3HJUA 3B12A 4S0XA 2GYWA 1W1IA 3VVMA 4QZVA 4X90A 3OG9A 2FX5A 4L0CA 4KYVA 4RE5A 3JW8A 4B6GA 4W1RA 4FKBA 2I03A 4DTCA 1W75A 5JATA 4KE8A 1OILA 4NMWA 3ZWQA 4MWSA 2WUGA 2O2HA 1EVQA 4UHBA 1GQSA 4B9EA 4LXGA 1F8UA 1OXMA 4BC1A 1JU3A 1F6WA 3M82A 2WUDA 2JGFA 5FUMA 3O9VA 5AKHA 2RHTA 4EHBA 1GXSA 1MTZA 1CUJA 4PSDA 1JJFA 1ODTC 1PJAA 4RPCA 2XMBA 3WI7A 1VZ3A 3JYHA 5AKJA 2X76A 5ALIA 2QOEA 5H3HA 3BXPA 2J4CA 4XIIA 1WHTA 1J1IA 4M0EA 1Z68A 4X91A 5DNVA 3GUUA 4AO7A 3HI4A 5CT6A 1CUBA 3KDAA 1XQXA 5AIAA 2WU4A 3D5EA 3HRHA 3L1IA 4FDMA 7YASA 4Y2RA 3WL5A 2GBFA 2GBGA 2PU5A 3PFBA 4DSZA 1LPPA 2WIKA 3FCYA 1IUOA 3O4IA 4X92A 5ESRA 3DEAA 1DWOA 2DSNA 2ZJ7A 4NZZA 1EDDA 4BDTA 3WMRA 2AJ8A 3AZPA 4Y2XA 3STXA 2O2GA 3DL4A 5FKJA 3YASA 1SC9A 1UKAA 2WHPB 2XLBA 4L9AA 1QTRA 2B20A 1AC5A 3ILSA 2G63A 5JAHA 1YB7A 4Y9SA 3FYUA 3QM1A 4QNNA 1ZD4A 4DM7A 3ANTA 5JYCA 5ALUA 2BFNA 5HFAA 1R88A 2OCGA 3OURA 4H77A 1XQVA 3W9BA 2AJDA 2BUBA 5HF6A 3DOHA 1J2EA 4BATA 1TCAA 3ESAA 3OC0A 5AKZA 5JAPA 3C6BA 3WK4A 1FFDA 4MEAA 3G9ZA 4BYMA 3O4GA 3N0TA 5SYMA 4RE6A 2QKYA 3F96A 3WWCA 1XZGA 1G42A 2YASA 1QIJA 3V1KA 2K2QB 4X71A 1MAHA 5ALJA 4JYMA 2G4LA 2FJ0A 4MWTA 3ZI7A 1QZ3A 2HU7A 4B9AA 4CCYB 2IIVA 5JANA 4UPDA 2WHRA 5D6OA 3L1HA 4QDUA 4DLNA 3IURA 1M33A 2GBCA 1WHSA 3AILA 3DD5A 3DL7A 4U2BA 4PW0A 1UXOA 4GXNA 4M0MA 3I1IA 4X85A 3R41A 5KWJA 3HC7A 1H2YA 3PE6A 1EHYA 5FPQA 3BF8A 3I2JA 1EA5A 3QMWA 2ZYSA 1XQWA 2AJCA 5LZ5A 4Q3OA 5FPPA 4BCBA 1E89A 4B83A 5ALYA 4FBLA 5AHXA 2HA5A 2WIJA 4ZWNA 3WKDA 4V2IA 1FFBA 3VDXA 2FUKA 4EY6A 3GELA 1IVYA 1LNSA 4W63A 3G0IA 1QFMA 3DKRA 3G0CA 1P0IA 5KWIA 4KAJA 5E4YA 1XZFA 3D2AA 1MX9A 3W2TA 1D07A 2BCEA 5EHQA 5DJ5A 4LIPD 4GEGA 1QTIA 4H7DA 3H17A 3S2ZA 4BCDA 3C43A 1A8QA 5CH8A 3W04A 3D4LA 4AZ3A 1ODCA 3C6XA 3G8YA 1XZIA 3IULA 1MAAA 1XZHA 4ZV7A 3C6YA 2BUAA 4ZXFA 2RONA 1AGYA 3AZOA 4IH9A 1IUNA 4D9JA 4MYSA 1ZIYA 1HL7A 1VE7A 2VA9A 1XZDA 4DNOA 3G9UA 2JF0A 1XFDA 5ALKA 3I2HA 2PBLA 5JALA 2DHEA 4WFIA 1H2WA 2C4HA 1QIFA 1YCDA 2ROQA 2JGIA 2J3DA 4FFVA 3IA2A 2HIHA 5K3BA 2XUFA 3H0CA 4QWMA 3WQHA 5LZ7A 4G8BA 1YR2A 2QJRA 5EFZA 2XUJA 1TRHA 2HFKA 3R3WA 3N2ZB 3WIOA 3H1BA 3ZLTA 3JWEA 2XMCA 4XJVA 5EHNA 2C0QA 3R3YA 5JZSA 5E4TA 1DWPA 3G7NA 1QLWA 4FLEA 1HBJA 3MGAA 1W52X 1ZJ4A 2Y6VA 1YSCA 4BDSA 5HQ3B 2WKWA 1XRMA 2HRRA 3I6ZA 4LHEA 5LKAA 4Y2YA 3W05A 1MX5A 1GQRA 3PFCA 3DDUA 1YASA 4FLMA 1VA4A 1LPAB 2CUTA 5JARA 4MEBA 4CG3A 2OQVA 4QDXA 3A2NA 3H2KA 5A2GA 2GZSA 4INZA 1MX1A 1VLQA 3PDCA 4C01A 1AMNA 4ARAA 3M81A 3LS2A 5DTJA 4EZIA 3F8SA 4EUSA 4W1SA 1EX9A 4J0GA 3IIIA 3D3NA 1R9MA 2AXEA 1RP1A 1X2BA 3WL8A 3DNMA 3F9CA 3BIXA 1B41A 4IH1A 1ACJA 4DYHA 2OQIA 3K6KA 3WJ2A 1DU4A 3WLAA 4X7BA 4KJXA 1U8EA 3BJRA 3QYJA 5DYWA 4C4XA 2QJWA 3I2IA 2Z3ZA 1UZAA 3AIOA 4UBLA 1MU0A 2VJBA 2WJ4A 4PQEA 4Q3LA 3R3XA 4F60A 3H04A 1ZIXA 5T4BA 5C7YA 2WG0A 3MUOA 4ROTA 3IB3A 5ALPA 4C6HA 2AJBA 4BAZA 2YYSA 2XQGA 1ZI9A 4Q82A 1CUXA 2BKLA 2VEOA 3V48A 4PSCA 4IO0A 4BVLA 1WCYA 4LXIA 1ZJ5A 3NWOA 3NGMA 4KE9A 4BBZA 1YAHA 4OSEA 3DJYA 5AK3A 2PM8A 1JFRA 4Q34A 4Y2JA 4PSUA 3E1GA 1H2ZA 3B5EA 2C5GA 2DCMA 4KACA 5J3JA 4G1FA 3C5VA 5A7GA 4BAUA 3HSSA 2YH2A 1R9NA 2W22A 5A62A 3HYSA 4K2AA 4A5SA 2XQFA 1USWA 3BDVA 5D3ZA 4I3FA 2HDWA 5EGNA 3Q8WA 4GWLA 1EB8A 2NW6A 3DLTA 4QDOA 1WB5A 1ZOIA 1CUDA 3W06A 2ORYA 4H7KA 5K3AA 1CUZA 5AI6A 1C7JA 5ALQA 5SYNA 1SCQA 4B7ZA 2J4FA 1ORVA 1F0NA 1MJ5A 5ALWA 1W76A 3G0GA 2CB9A 5BOVA 1L7AA 2EEPA 1G4HA 2PSEA 3D2BA 3O0DA 2QXTA 2C7BA 1CUEA 3QVMA 2JEYA 3HABA 2ZJ6A 5AM2A 4KAFA 2Z8XA 4QDZA 3CXUA 1CUVA 2WIFA 3FYUC 4FMPA 1LZLA 4DIUA 1UKCA 3FVTA 4TPKA 2AJLI 5DNWA 2WSLA 1UOOA 2JBWA 2EDCA 3DKKA 1HPLA 2WUFA 4X00A 4QLAA 3RKSA 3G9TA 3PF9A 4CI9A 1J06A 2X5XA 5ALMA 3WKAA 1Q0RA 1J07A 3AJAA 2PUJA 4DNPA 2QZPA 1QGED 2PU7A 2RGUA 3IUMA 5LKRA 4QE3A 2ES4A 1R4ZA 4KRXA 4CG2A 1MN6A 3SX4A 4HS9A 3SWWA 3I2KA 4X97A 1W6RA 2JGJA 2G5TA 3PI6A 3P2MA 4N5IX 4AQDA 3GFFA 1ZGBA 4MYDA 1P0PA 4ZRDA 2V9ZA 1OCEA 1E5TA 3S8YA 3I28A 4K6GA 3WJ1A 1W4LA 3VJKA 3WKCA 2O7VA 5F4ZA 5KREA 2HHAA 2QT9A 2I3ZA 4HXEB 1DT5A 1PFQA 4DMHA 2X8BA 4E14A 3QH4A 2Y2UA 3ZLUA 1CLEA 4G4IA 1KU6A 1XZKA 4TGLA 2VTVA 3D2CA 3OOSA 1DINA 3ANSA 2DR0A 2WUEA 4Y2TA 4FOLA 1LGYA 3ZLVA 4J3JA 4C4ZA 3FLAA 4I4CA 3NUZA 2CJPA 5JAOA 4UHCA 5CH3A 3TGLA 4A16A 5CH5A 4C89A 4B0PA 4HVTA 3SC2A 4DSAA 3VXKA 5HCUA 3LIIA 4ARBA 4H0CA 1EINA 2ZYIA 3CN9A 2B4KA 3I2GA 3STVA 4OU5A 3SK0A 3WA7A 5LLSA 3FLEA 3WK9A 3ICWA 1QE3A 4XVCA 3QMMA 3VJLA 3QMVA 4K6KA 1XZJA 3F98A 1X2EA 1AX9A 2I3DA 3A6ZA 1XRQA 4BVKA 1BN6A 1VE6A 4EBBA 4IH4A 4GW3A 5C81A 3C87A 1X70A 3PUHA 3WYNA 5AM0A 2ZVDA 3ZV7A 2V97A 3HEAA 3WWPA 2I78A 3FYTA 4GHWA 1BRTA 4X6YA 2C5FA 4HZGA 3U0VA 4U2EA 5ALVA 5ALEA 3U1TA 3BF7A 4HXGA 5AM3A 1ISPA 1JJBA 2VAXA 3UUEA 3R3VA 1K63A 2Z8ZA 3O95A 1JKMA 1DX4A 5DWDA 1Y7IA 1CEXA 3TJMA 3BL8A 5BV7A 3H18A 4J0KA 1BEZA 3W9UA 4JUIA 4RNCA 2C0PA 1JU4A 5FV4A 3KSRA 3E4DA 1QFSA 4E46A 4BAGA 3O4HA 4KE6A 3STTA 3D59A 1E8MA 3WWEA 5EIHA 3DYIA 4XWGA 2VAVA 4KEAA 4WDQA 2OCLA 1AQLA 5ALDA 3MVEA 4FBMA 2ZJFA 5AKXA 1GKLA 5AH0A 4J03A 1DQYA 1BE0A 5EHZA 1BS9A 1CUUA 4H35A 4B84A 5FRDA 4G4JA 4FWBA 1JI3A 1N8SA 5AK5A 3WYDA 1ZI8A 2PL5A 1XRRA 2HA2A 4C4YA 1CQZA 4HRYA 1T4MA 2H7YA 3IBTA 1TK3A 3VVLA 1SCKA 2HU8A 3OTQA 4OYLA 4BC0A 2QM0A 3M83A 5HK9A 5K5EA 3T4UA 1E3QA 3H2JA 2CBGA 3L1JA 1CFJA 2H9YA 3A2LA 4UHEA 3AIMA 3G0BA 1XZMA 4G9EA 4AO8A 3GA7A 4GDMA 5FLKA 5IVHA 1Y37A 4Y2UA 1DT3A 1XZLA 4U2GA 4J0IA 4KE7A 1T2NA 1GGVA 4Q05A 2IX9A 4BTVA 3WK7A 4CIBA 2YXPX 5AI0A 1WB6A 4O08A 3BDIA 2VJAA 3HXKA 3STYA 4ZGBA 2EDAA 5AKLA 1YA4A 4WFJA 3VISA 4OYYA 4F0JA 1IZ7A 1XROA 2IITA 4PO3X 5CW2A 4AMZA 1WPXA 3STUA 1FSSA 3WL7A 4ITVA 1A8UA 2DHCA 2QVBA 1KU0A 2QUAA 4Y2SA 1HDEA 2PSFA 5K3FA 1O6FA 4DGQA 2VF2A 4RGYA 3BIWA 1SOMA 4UBMA 5DNUA 5HKBA 2Y6UA 4U2FA 1CV2A 1JMKC 3C5WP 1YB6A 2RAUA 3AIKA 1ZGCA 2QS9A 1QJ4A 2QXUA 1QIHA 3A2MA 4N8SA 1JT2A 4DNQA 2XT0A 3WA6A 2P8SA 2UZ0A 1UKBA 3EQ9A 5C8XA 5IVKA 3OM8A 3G0DA 1YAJA 4B81A 2HU5A 3C8DA 4WCVA 2RHWA 3GROA 3FCXA 2JEZA 3FVRA 3QPDA 1EH5A 6YASA 5A71A 4KRYA 3C70A 2ZYHA 4ZI5A 1EK2A 3ZPXA 5JZBA 1A8SA 2XUQA 4H7HA 2DHDA 1P0MA 2H7XA 4U2DA 3R40A 1NX9A 2XQJA 4A23A 2CKMA 4FTWA 2HM7A 5T4FA 2PX6A 4FHZA 2ACEA 2WG1A 4AZ0A 5A7FA 1BCRA 5DTIA 3C45A 4UFOA 3HLKA 4OCZA 2XMRA 2VATA 3DS8A 1ZD5A 4JH0A 3KD2A
chains in the Genus database with same CATH superfamily
3MJFA 5G4KA 5FYQA 4IR7A 4JBWA 2XCTB 4AX4A 1VCMA 2GZ3A 1F20A 1EFVA 3O3MB 1E2JA 4O4LF 4R8SA 3T95A 4AWBA 1GUDA 2FRVA 4RA6A 3FWHA 5AVXA 3FPGA 4QTTB 4YRCA 3F7MA 3PPYA 2VSNA 2PY6A 4KQCA 2O52A 4V02A 5A7HA 4DMLA 3TECE 1UBEA 3R44A 4HBGA 3N07A 2G1PA 1Z45A 1DRUA 1R6BX 4R6XA 1QB8A 3K9GA 1NTRA 2R6DA 3AONB 4MW6A 4NBRA 2PR7A 4R1NA 4AP6A 5JSHA 3N76A 1L5WA 4LYEA 3NJ8A 3FSEA 5CLIA 5A3SA 2RGNA 2R2AA 3E58A 2F59A 2CBXA 2X5OA 5G41A 1XPOA 1Z16A 1ABBA 1SU6A 3NZEA 1UC5B 1QANA 1S2MA 3R1IA 2P2YA 3H1AA 1JHOA 3D7SA 5JIBA 5JSQA 2QJOA 3CO0S 3TL2A 5C1OA 3A3NA 4FOTA 3H9BA 1KEZA 3X0DA 5JNWA 1VPLA 2Y66A 1ZI6A 3D0KA 3WKEA 3RRJA 5CFZA 3EARA 4MHSA 2R68A 3AINA 3C2QA 1WMEA 2AOUB 1QOZA 3R3ZA 4IDAA 3E3NA 1Q84A 5AI5A 4C2BA 1F0KA 2ZR0A 2DYKA 4EG1A 4U63A 1A8IA 3QUQA 4DJEC 2GPAA 2JJ8A 4ZOAA 5D3QA 2LCQA 2HMYB 2Z2JA 4JITA 1K7XB 4ESVA 4BUZA 1FJ2A 4DVGA 1Q7TA 1AUVA 2XKJE 2B5OA 3E9MA 2DH5A 3UWDA 5EHXA 5HFNA 3RD5A 3R74A 3NRJA 2XMDA 4C3VA 5CRIA 4JC0A 4NYMR 5HHTA 1KFKB 1SUEA 1D8AA 2C9OA 3CX8A 3ELBA 5EIWA 1ZUHA 3Q87B 5CGZA 1P39A 3PICA 1PLKA 2GUWA 5GMOA 3SBXA 2PGOA 2PH7A 3OKPA 5AW4A 5BNWA 4GU5A 3TL6A 1UFVA 1B14A 1MO2A 5EEHA 5FH9A 1Q1GA 3R6GA 5HFJA 3QVJA 2BGRA 2SECE 4LXHA 1TIKA 4PBTA 3ZW9A 3TAUA 5BMVF 4QOGA 3IDFA 4BVJA 1NN0A 1LSJA 2G6TA 3JU3A 1XIVA 3OQBA 5E1BA 3VR3D 4YMHA 4E5DA 2JD1A 2D0DA 1VL8A 2G9NA 1A0OA 1KR2A 4HYYA 3TQSA 4EJ6A 4TYYA 3U49A 1LK5A 5E2AA 3SR4A 2XGSA 1G5TA 5DM1A 4YCJA 3KX2A 4WY8A 4YV0A 5CDGA 1BU8A 1T6XA 2LXNA 1VIAA 2DQZA 2O0MA 5EUCA 4MQLA 1GNRA 4ID9A 1H4SA 2O14A 2XB6A 5DN6A 1X42A 1OGYA 5KINB 1KH1A 1C7FA 5HF9A 3ZG6A 1PFGA 1TX4B 2QV7A 3QJYA 3IT1A 5JJCA 2YIMA 1DXOA 1XJCA 2RMKA 3GMIA 5HUJA 1OFVA 5JAQA 4KR3A 1IULA 4JT2A 3EFBA 1RTKA 2C2YA 4BJHB 3IODA 4XJSA 1J33A 1Q3KA 1UBSB 1JNYA 2IQIA 4ZOLF 5AJTA 3SDBA 4B2YA 4WK6A 3A9RA 4TXJA 1TCBA 1RAFA 2W2VA 4EG8A 4OXNA 4PG8A 3U3RA 2CUKA 4W1PA 2YFQA 1ML3A 4BECA 1JG3A 1W5BA 1UXHA 4LQ4A 3WK6A 1JKJA 3DBVO 3PLNA 1Z2OX 3FAZA 3JQQA 4Y2PA 3DDZX 1PZGA 1CQWA 5FI5A 3PCXA 5IDYA 4CNQA 1OPXA 4X7RA 5ETJA 1AJEA 2OT3B 4AKTA 1HMPA 4F3CA 1K27A 1QYWA 2CDNA 1NWCA 2WSYB 3K1AB 4LQDA 3P19A 2XMSA 1RZRA 3ELYA 4C03A 2HF7A 3ORRA 4BKOA 2WSMA 2PMWB 1JG7A 1I6WA 5JXHA 2YWHA 4U3JB 4W8HA 1LBSA 5IDVA 3PQ7A 4W9NA 1EFLA 1PJ8A 4L9WA 1GUYA 4HUQA 3L40A 4XJTA 2C03A 4P36A 2FJPA 2I29A 2LKCA 2NYUA 1X7XA 1XCOA 3IP1A 2R2GA 2GEDA 2IYLD 3PGXA 4ZQGA 4OSOA 2QZSA 3TGWA 3KWFA 1PQUA 1J8FA 1H0HA 3L8ZA 1P1JA 3K53A 1TZCA 2R8ZA 2G83A 3EDQA 3QF4A 5KKNB 4WXRA 4JVSB 5IT5A 4AKIA 1KRHA 2DLDA 3HFJA 5CMLA 1P6QA 5JRZA 4B3FX 3TUZC 1KI2A 4N12A 2E4ZA 5LQMA 3MFQA 2QENA 2EFDB 1C0LA 1VIDA 1FNNA 2PD6A 1P1IA 5AWFC 3JAMA 2BMDA 1BROA 4QFDA 1DAMA 2HADA 3W5SA 1RKXA 4E51A 4KN6A 3KU4A 2FVYA 5LZ8A 3WO1A 5AHKA 1E2PA 5J4YA 1PR0A 5T8KA 4GKJB 1AM4D 3MTJA 4YRFA 4MVWA 5KHLB 2D8AA 1U31A 3L1VA 1FP4B 5FFNA 3EOAI 4HUQB 4TXMA 3LFTA 3NEYA 2WFZA 5TY0A 3A6PC 4BQOA 4BWFB 2XMPA 2P0YA 1G8GA 2V3WA 4LRUA 4S3MA 5KOHB 1TI7A 4J8PA 1HXHA 1Z8NA 1EGAA 2MSKA 4IRXA 4NBLA 3TCKA 4CL0A 5DSXA 2YOHA 2NG1A 4N0EA 4PGGA 5E6SB 4EK9A 5MN4A 3KU1A 1G2PA 3OFNA 2D59A 3EVNA 2BTEA 1HL3A 4ZQHA 3EH2A 4BNWA 3V8RA 4UHKA 4BGIA 3CISA 1ZM4A 4J9VA 4FDVA 1QKJA 2IZOA 3WLNA 1SQ0A 1M7HA 2QPAA 2PV0A 2YNMD 3JQ8A 2VTBB 3RS7A 3BFVA 3UQYS 3C16C 3ZVLA 1Z37A 1CDZA 3FNFA 2A5YB 1TU4A 5CNIA 4NXNB 1PNTA 2EYUA 2CB0A 1HE1C 2I67A 1JDJA 3NOXA 2AGVA 2BW0A 3DV2A 2D5AA 2FB9A 1VHLA 1EJ0A 1N8KA 4TV8F 3S1LA 5I8PA 2OY0A 4PBRA 4PONA 5B2FA 3ER6A 5DPMA 2J08A 2JD2A 4KUEA 1TAHA 4K9LA 4W7IA 4KRGA 3OUUA 4QOFA 5BR4A 4LAFA 3TSWA 1RC8A 1J25A 2CHQA 1S8OA 1A71A 3B3JA 4GPBA 4MQMA 1JILA 4BQFA 3PX7A 1XQYA 2YICA 1IWPB 4V3BA 4KDCA 5GVSA 3HHEA 2OD9A 4GPEA 3V3TA 3I04M 3M8KA 3NBYC 2EW8A 2Y9PB 4FGKA 4EAQA 1UJNA 4Z3DA 4YVFA 2G77B 4MW4A 5IVDA 3ZQJA 1GV0A 1K7SN 1NQTA 2H7CA 3GOQA 4IIYA 3DMNA 4PNZA 5KQSA 1KMHA 1UK7A 4UUPA 3X1YA 1RM5A 4BCCA 2AVNA 5K0FA 1POWA 3CB4A 2FUCA 3GZNB 1JNXX 2AYZA 3TSOA 3W5HA 1JEQB 1N1EA 1TPZA 1ZY2A 2OD7A 2WHXA 3K32A 4KFSA 4YJ3B 4R8KA 4BP8A 1QWSA 4P3OA 3U7FB 1WVMA 4RZSA 1ILEA 4RM2A 1LD3A 1QHNA 2H07A 2Z5GA 3RROA 4GOXA 2G1UA 5T4HA 3BD7A 3QELA 4HUTA 2CWWA 5IKXA 3VR6H 2N1BA 2ZTMA 4HZUA 4LVOA 3WLRA 1GNQA 2VS1A 3N5KA 4JP2A 2FOLA 4TVKA 1M74A 3M6MD 1LPOA 3F78A 4JLWA 1RKUA 1N75A 3C8HA 1ZINA 1TUBB 3S40A 4X1KA 4UU1A 1OF1A 1L5ZA 2HA3A 4AJ2A 4CG1A 3E8SA 3NO4A 2W4IA 3U7RA 2W98A 1E9DA 1P7PA 3I6IA 1SGWA 3G88A 1D6MA 3OZIA 1Y9DA 3WFJA 4BNNA 5IYZA 2VHVA 3SXPA 5KNCD 4XWYA 5HX7A 5D87A 3PUXA 4FB4A 1KZYC 4Z0HO 4UDNA 5ALGA 2HIAA 3INRA 3O9MA 2AR7A 4G4GA 2YY7A 4A1FA 2FW7A 1QX4A 5KKAA 2QM7A 3HJGA 3V3KA 5EAIA 4D3FA 2YXNA 1CJVC 4BWYA 3O9ZA 1A5AB 1AK2A 2WAMA 1J6UA 1C7IA 4RORA 1VBFA 5BSVA 2CHVA 4KB5A 5CR9A 5ER9A 4D82A 3SY8A 1U90A 1FPQA 1NXXA 1SHKA 5KDOA 5JH7B 2YVUA 3CNQS 2ZU0C 3OZUA 4ZCTA 3WR5A 3E35A 3PHJA 4H7PA 2C7OA 1SIBE 2DBVO 1SK8A 2BV3A 1YNOA 4NICA 5HK8A 3GCDA 5TGDA 1C1YA 3E5NA 1VMEA 3EF1A 4DRXA 4ZK2A 5KQRA 2XMZA 1RRFA 2PIDA 4K6HA 4ZEWA 4BLVA 2A14A 3QJ5A 1Z7EA 1VHTA 2IIQA 1T9AA 2N9UA 1EJ6A 2RDMA 2XAAA 3KCQA 1E5VA 3TYXA 2J6CA 1J24A 3IDSA 3ZDEA 1VG9B 1QMGA 3EGEA 3U3OA 3C1UA 4CM5A 3STWA 5ISMA 3COZA 3QE9Y 2Z4SA 1ULBA 5AW3A 1RAHA 2YDXA 4XRRA 1TYEB 1YGYA 3OQ6A 4R31A 3SEAA 4H4DA 3TIGA 5KJ6A 4BNJA 4E5YA 4WI1A 4ETIA 4IGKA 2X7JA 3MCAA 2W2NA 1NBMA 1GYRA 1X39A 4IDHA 3RS4A 1YDGA 1NVFA 3EBPA 2OCXA 4JB0A 1ZITA 2A35A 3IOYA 3S70A 5EXPA 4QYXA 4RXTA 4YAWA 1MG0A 5J59A 1D0SA 1WZCA 1W30A 1A88A 1ILWA 1QK3A 2A57A 1R18A 1I8TA 2PWBA 3EMDA 3GFTA 4IGIA 1WCIB 3ISVA 1L9XA 3ZDYB 4O8ZA 2J46A 4UMVA 2BH9A 1ZCJA 2YJ6A 3GEPA 8AT1A 2Q1XA 3VPFA 2CSXA 2B6HA 4WRRA 3TBFA 2ODAA 1TKCA 3G9XA 2Y1KA 3OMWA 3NHMA 3EXHC 1VKRA 4WOCA 3CEAA 1QJCA 2QQGA 3UXEA 3W8DA 4AZTA 1BEEA 2IDMA 4YV7A 2VPIA 5B37A 4Z2AA 5F23A 2HA7A 2RI6A 3NG1A 3ODGA 3QUSA 2GFQA 1UIMA 1XXHE 1GV1A 3CG4A 3IR7A 1WBDA 2BM8A 2P68A 2VHZA 3T41A 1XK6A 3FROA 2QAGA 1RWNA 3GBPA 3L0CA 4IVRA 4GI3A 4EY4A 2C9YA 4MGYR 4P9NA 1L5NA 1L5YA 1JL3A 3GFSA 4ZI7A 3R0IA 1DIGA 4V1CI 2GO7A 1XMXA 1MOQA 3FKQA 3KNZA 3ND7A 5HS4A 1K68A 4RMJA 2DFPA 5AKIA 3SQMA 4YPVA 4IX1A 4DLKA 1S2DA 4ENSA 1G5IA 5EIEA 3WZMA 1VGQA 1WZIA 2ZJBA 4DR3B 1SC4A 2P77A 4ZJUA 1TEVA 3RUEA 3OOHA 1CLUA 1XCMA 5BWNA 3TNYA 4R69A 1QHXA 1I0LA 1X1DA 4FYXA 1RWWA 3ZE0B 3TXAA 1BW9B 1UZLA 2QTTA 4DA6A 1VC2A 2RHCA 3NHAA 2GJ9A 4AZVA 1J2YA 2XF2A 2VP4A 2P2ZA 5E1OA 4Q24A 2WU8A 1NV9A 2Y27A 2CXRA 3H99A 3OTIA 3R3SA 5HF5A 1T5HX 5LC1A 1PV1A 3OZDA 4MNTA 4LHZA 4YACA 4AUMA 2R97A 3V46A 1JKXA 4TTSA 1L7NA 4WXEA 3PF8A 5AJXA 3AJ9A 4DJ5X 5TQ2A 1MFPA 3NTVA 2O3QA 3VDMA 2F1OA 4OB6A 2YQ5A 5L4NA 1A2KC 2IYXA 2J9XB 2OKCA 4OQLA 4KIJA 2GD1O 1GZDA 3FUTA 4B3GA 1BDJA 3ZCSA 1IJKA 3GPCA 3T9FA 4QULA 1TO1E 2PH5A 1R66A 3C5EA 2ZDHA 3CZPA 3PR3A 3IOCA 4ITRC 2FUEA 4OIFA 2Y71A 4A0HA 3G2MA 4EJ2A 5IC4A 5L9AA 1RQ7A 3DOCA 2P9HA 3LY5A 3MYYA 1FFCA 4OHCA 1UIRA 4TX1A 4BVHA 3A04A 4MRNA 2DERA 3ENQA 2RH4A 4Q9LA 4X1IB 4YJ2A 3PQ5A 4TKZA 4YYEA 5A6VA 4CHGA 4AVYA 1VKHA 4NONA 2B3DA 2IV7A 1QDEA 1TJYA 1XD8A 2NO1A 2PPLA 3A9CA 1J9EA 4TWZA 1E1KA 1GRRA 1NHGA 4MS3A 4OXQA 4R01A 4RQTA 4EPWA 3PEYA 2ODWA 4P34A 2WV7A 4ZEMA 4R3WA 5AMXA 1QZTA 4V0LA 3D8HA 2VH2A 4YUVA 4XYGA 2JCSA 4AP5A 3QE3A 3D4IA 4WOKA 4F1JA 2W8BA 4M0LA 4Z49A 5HZGA 1ZICA 3LVQE 1LLFA 4GC5A 3H87A 3QP9A 1DUIA 1NZDA 1AQ6A 1R3DA 3V8MA 4BNZA 2PWYA 3L0ZA 2FSUA 4F6RB 4EGCB 3TLAA 2PZ8A 4MAMA 5CBKA 1ZNQO 3R0JA 1AOXA 2E18A 1QS0A 1BEUB 3M2TA 4BGVA 5LYJB 4MPRA 3T3HA 4ZI3A 2EERA 2QD5A 1NUPA 5IJ9A 4AN0A 4DZZA 1B3BA 1E3WB 8ABPA 2O8BA 3OCCA 4HL6A 1VPDA 4NCIA 4NU6A 1GZVA 5HOEA 2PUGA 1CR2A 3WGTA 2EBHX 3TW8B 3H6GA 5A5EA 5TB5A 1R4AA 2CYAA 3VMMA 3C3KA 2PUFA 3MOSA 1C8KA 2ZJ0A 3V42A 1T34A 4MINA 1XA4A 1YE8A 1RJDA 1KQNA 4RVNA 4ESEA 1KYTA 3BTOA 4JROA 3BOSA 2LZ0A 4YC7A 1BXKA 1FXSA 3UPUA 2DHRA 3HDVA 2Q9UA 3AUAA 5IARA 3TQOA 4YP5A 1GA4A 4Q4HA 2VF4X 2XECA 4MW9A 4PX5A 4CDRA 4Z3KA 3CNNA 4FDUA 1WULS 5ARCA 1X8KA 4A5OA 2X77A 2B36A 1LPSA 3CM0A 3P9SA 5HIJA 1USVA 3FNBA 2G08A 3EW9A 5EHIA 4JHXA 4LJ7A 4CU2A 4PLYA 2AIRA 2P9ZA 3EXFA 1LBTA 4RL6A 5KJEA 1DB3A 3R9WA 2P5SA 3HNRA 4KXXA 3C3MA 1MGOA 4E1BA 3PL5A 2PGIA 1D9XA 4G0OA 2WWVD 3Q7SA 4RJLA 4FD2A 3UUWA 5H0IA 3BSSA 2WTXA 2H08A 2X8JA 3IALA 1FU4A 1W36D 2DUNA 2ZVQX 2ASVA 2H5EA 2ETXA 3OETA 4QPPA 2BHSA 1V16B 4OHKA 5FPHA 1CUWA 2QLMA 5A1TA 1ZAYA 2OHIA 2Z6QA 1TMYA 1L8LA 2X6QA 3K4PA 2NSYA 3KKEA 3O8NA 5IAJA 1BH2A 1XQ9A 3ACBA 2BTOA 5AOBA 1M2OA 1C3OB 1EVEA 1QONA 1N5OX 4UTZA 2ZWMA 4ENUA 1E7RA 3L01A 3K8OE 4HK4A 1JFTA 4LRSB 1RHMA 4QJ4A 1FQWA 1HKHA 1A97A 4U0KA 2H2HA 3H9JA 1V47A 3GEEA 2FG5A 5EVJA 4KI7A 1CVLA 1I24A 4NOJA 1ODJA 1M83A 5LM3A 2I3BA 1PFUA 4RZXA 1TEZA 4LECA 2ONKA 4R2WA 2NNLD 4HDQB 1O0SA 2FPGA 4OUDA 4TS9A 1W4CA 3NVDA 4UBNA 1E9SA 5AK4A 3TPCA 5I51A 4JEIA 3DLIA 3WK5A 3ZHQA 2PZAA 3TR6A 2IYRA 2R62A 2V6MA 3LYUA 1GDDA 1XYVA 1ND6A 3M89A 4HH3C 3BEOA 3KOOA 5CT5A 4CBVA 2JD0A 4KR0A 3GAMA 1NVAA 1ZCAA 2VT2A 3QBJA 1PHPA 1W8DA 5FPSA 2BVNA 2BISA 2P6PA 4BOYA 1L7OA 5CDYA 5CXUA 3K70B 3JTEA 4HDRB 4LC0A 2HA0A 4BO3A 1YIDA 2IZZA 4DLUA 5FWDA 1PSZA 1PKEA 1Q3HA 2BMWA 3QWBA 2WEKA 4V0RA 5CM2Z 4BLTA 1OFIA 1RRPA 4AD8A 5BW4A 1QHIA 2WHPA 3TRIA 3W1EA 4O59O 2D5LA 2DLNA 1EIZA 2OO3A 4G2TA 4K9KA 4YJFA 5TMPA 1OZ0A 3OPYA 4WBNF 1T4CB 2A7QA 3G0OA 3UPTA 3T5PA 5CEJA 5K8VA 4OHOA 4JI8B 3FWZA 3NX4A 5L53A 2G0TA 1O0CA 4DE5A 4QPJC 5CJ2A 5BSMA 5IZ4A 4W9NC 1Z08A 4MR8A 1A4IA 1MVNA 1UMBA 2I4LA 2GF0A 2O0JA 3GA5A 4K0RA 2E3JA 3KQHA 1H9CA 2XDAA 1T1IA 3G9QA 2QTAA 1D8TA 1P31A 3DWGA 1N6RA 3AF1A 4I5GA 4WQMA 1XLWA 3R7NA 1ONPA 2RIRA 2FCAA 1EJ2A 2ZIEA 2FEXA 1N6OA 1DKUA 4J1TA 2X5NA 4KQ2A 4RA6B 2O8EB 3FA2A 2EHJA 1F0PA 4MWCA 3KLMX 5I9IA 3T5GA 3LP5A 1G5FA 2YVAA 1WR8A 2OFOA 5JW6A 4U02A 4B2IA 4N49A 1XVVA 1P5ZB 3GG9A 4F6CA 3DO8A 1RSZA 1KFBB 4KREA 3A1VA 1X38A 1YO6A 1N2IA 2GVZC 1U8CB 5HKKD 1UBNA 3WL3A 2F8SA 2QM3A 4BVAA 4OPMA 4MR9A 3THWB 4Q3DA 1C7QA 4KXLA 2CLDX 1P1BA 3PFGA 2H11A 1Z75A 2C2KA 2FPOA 4MVJA 5C46F 3AGQA 1GPKA 5JD6A 4CFYA 1FNMA 1HE8B 2HX1A 2O3JA 1LDEA 3TIXB 3VO8A 4JLJA 5L51A 4R81A 1VJCA 3IQFA 2YMLA 3U7IA 1X7WB 4WXYB 1ZHOA 5J40A 5EZYB 4OD0A 1OU4A 3GEDA 1JXOA 3IUSA 3QEMA 5CA1F 1DP4A 1K4YA 2QD2A 3EG5A 1E0JA 4G8CA 5AK6A 1TM4E 3BMNB 1FTWA 5EXEA 4N5HX 2JJQA 2P9TA 5D5HA 3T7CA 1YL6A 3C41J 3CQ9A 1UPUA 5K4AA 3RYFA 2C3UA 1B8OA 1ZMRA 2XQIA 3I9V1 4OUKX 4DV4B 2ZJOA 3EMBA 4DOMA 2O1WA 3LW7A 3TDMA 1CUCA 1TKRA 3EIOA 3PENA 5ELMA 4CCWA 4OBBA 5B4VA 4YN3A 4C20A 3UB4A 1E3JA 2VDWA 1U7UA 3PHGA 2XR1A 4DBLE 1W85B 2IHUA 1QNLA 3QKSA 5CX1B 4CW7A 2WU0A 4ES6A 1GHTA 5KYNA 1DBPA 5KSWB 2GD0A 1U04A 3TLMA 1TADA 1BGVA 3A27A 1Z6XA 2AFHA 1RYHA 4Z8XA 2Z5FA 3A25A 3WICA 5FOWA 1OFUX 4QPNA 3VTKA 3ZWVA 4X41A 1D2EA 5LMCA 1SVNA 1U9IC 3D7LA 4CL2A 4XM2A 4ETWA 5CT8A 3EVBA 4TT3A 4R3UC 2RKOA 2VDNB 3GHYA 3GJ5A 1T29A 1MQSA 3F7TA 4A2WA 3REFA 1JH9A 4RTPA 2GAAA 2AQ8A 3P71T 4IEEA 4LJ9A 4ZAWA 1CRPA 1K0UA 2BEVB 3D8NA 1U0JA 3AFIA 3LKBA 1T9HA 2QK4A 5B53A 4YMSA 1OX4A 2AF3C 3GLFA 2ZQ5A 3ANLA 3QG5A 3VU3A 4BKUA 3VZBA 4RVDA 1TLLA 1DAOA 1E2EA 4FFMA 3MCTA 1I10A 3MWJA 5TQ0A 1ZSNA 5LA6F 1Z6TA 3PNQA 3I58A 1XNJA 4PGAA 4IHQA 1NN1A 3N3BC 3UGJA 4DWOA 1LRKA 1J9GA 1NW6A 1DEAA 3C3CA 4HQ0A 5TF4A 3VYSB 1AO3A 3SCZA 2W4QA 5KJCA 1KDYA 2YY6A 2ZITA 5AOAA 3IQZA 1EUYA 3LCMA 1F9EA 1G20A 1T8TA 1J2TA 1YA8A 2OE2A 3BGSA 4H6PA 4R2XA 1YS2X 2B92A 5ALXA 1ODSA 4NVRA 3FFXA 4DCOA 3QENA 4J0EA 4CODB 1F8GA 3NWJA 1FRFS 2R5NA 3VHLB 3D6MA 3WE7A 2A8YA 4I8IA 2C3YA 4LS3A 1JLKA 2JARA 4WAUA 1TZKA 2ACKA 5B1HA 3FYUB 2WM2A 1M2EA 3PC7A 4E5VA 2ZE6A 2YZKA 5DBIA 4LHVA 2J0VA 1GPLA 3G23A 2FFRA 1F48A 1KOJA 2LWIA 3DEKA 5HZKA 4KVZA 3EZ7A 2ABWA 3KPYA 3FNGA 5HQ3A 5EIAA 2OAGA 1HLDA 4BJ3A 2ZJ3A 5BT8A 3THYA 2YMMA 3B1XA 1SH7A 4HTFA 1R8SA 3QW2A 5GJWC 3OLYA 4E5PA 3LX6A 3HUTA 2HF9A 4K9PA 3RLFA 3VYRB 3LUDA 1OIWA 3DT9A 1ISRA 1K9VF 4QM7A 1M1NB 1MD9A 3MJDA 4W9RA 1SUCA 4RS3A 1RABA 2YVQA 4CQLA 1UC8A 4MZDA 2B9VA 1PTJC 1A1SA 1LDGA 1OKKA 4HSEA 3W4JA 4BMOB 3QX3A 1OT3A 1XZAA 2OV1A 2P9GA 2YZMA 3MUNA 1LF5A 1PE0A 3AUFA 3IUPA 4GWKA 1V7ZA 2Q0QA 5B1DA 4Y9TA 5K3FB 5F3DA 4LE0A 5IJZA 1F3LA 3C7CB 4MS4B 3E9RA 2RSLA 1EHIA 3O47A 3ZIAA 1XXHA 4TKMA 5EKDA 3DB2A 5C7IO 1SA0B 4JUDX 4W5OA 5CEFA 1Z73A 2IVZA 3QE2A 3IFSA 1L4BA 3KV3O 3SXUA 3QXHA 4HDMA 3TBKA 4COOA 1EX6A 1I3CA 2W71A 1SO8A 3FHJA 3NIWA 4UNSA 3V4RA 2ZIFA 2ZJ8A 3GFQA 4TLEA 1ZOPA 5CFOA 1B6GA 1JDPA 1UT6A 4ESOA 2OLEA 3LZCA 5KUTA 5AKGA 4M49A 3DZDA 4OOEA 4DMMA 3KZVA 1JV2B 3BH6A 1TK9A 1ZQ9A 5B2ZA 1W88B 2G9VA 4I5FA 4KQWA 1RC1A 1W9MA 4TXHA 3QVGB 2FDRA 3I76A 1DFGA 4S1VA 2IHJA 4KUGA 3T7IA 2H7VA 4Y0NA 2ICAA 2IFTA 5FF9A 4JJ8A 3MJ4A 4S35A 5DHQA 5C5IA 1E7WA 5EKTA 2CXNA 3HJUA 2Y1DA 4ZGWA 2FN3A 2HNBA 3TAHA 3K70D 1LLDA 2LKDA 2XNJA 3FHCB 3GLKA 4HNQA 3ABZA 4J49A 1OGIA 3JARA 3W4KA 2PMEA 5EWJB 4XIJA 4X90A 3OG9A 2FX5A 5TJ9A 4C4AA 3LP8A 2AZXA 4RE5A 3NTOA 1KSJA 3BG5A 1BX1A 3LWBA 3A1TA 1PNVA 1PSWA 2ZCVA 4FKBA 5ANRB 1LUAA 1UDWA 1WSWA 3IP6A 3W9SA 5HZMA 3RIHA 3HGQA 3CSDA 1VE3A 1E6KA 1EM6A 2H2GA 3PD1A 3DW3X 3FNHA 1FW6A 4DM3A 3IT3A 1IHDA 9GPBA 1AO0A 2QRQA 1ZXLA 5THQA 4DQ0A 3NP9A 4C08A 4PWZA 4MWSA 1QYIA 2I8AA 3OZBA 4RK4A 4A6XA 4QFBA 4DDMA 3G85A 2WUGA 2HGZA 3FDZB 1WUHS 1WZNA 4RVGA 2I91A 2WC1A 1FXWF 4IXTA 5DI3B 4B9EA 1G3QA 3I23A 4EZEA 4BX3A 4CF5A 1T9ZA 1XCJA 3RU2A 5TC4A 1PTKA 1XTBA 1ICEA 3EFOA 1PK9A 1DJLA 2PUWA 1JU3A 2QRGA 4GVXA 1RQPA 2C5LA 2WDZA 3IAS6 1I2AA 3V7WA 5CD1A 5HEKA 3R5JA 3OT5A 4LNUA 3R5XA 3ENNA 2IGTA 2A0WA 3H8VA 3O9VA 4GOJA 4OQXA 1GWNA 1HE2A 3TTTA 4CXMA 3LA8A 2RHTA 4B4DA 3AG6A 3G82C 2WKPA 1DPFA 1C0KA 5LBIA 2F8LA 5FJJA 1KYVA 1HWYA 2Q8QA 2VPYA 2XTAA 3G2OA 3SEQA 1W8IA 4O4IB 4EPXA 4PN3A 3RC3A 5JHHB 2XMBA 3GLIA 4O3MA 3RR2A 1YDEA 5F21A 4CMKA 1W35A 4RSGA 1JR2A 5BVHA 2ORED 1VZ3A 2AI2A 1JGTA 1ULUA 1B8PA 1X9HA 1VFPA 2FPMA 3M34A 2X76A 2FY8A 3LK7A 4XUEA 1S1MA 2BMFA 4Q1FA 4UHJA 1WHTA 2Q5IA 1I7DA 3F3SA 1NYLA 1QBKC 1QV7A 3M1YA 1M9NA 3PNKA 2IY8A 2CLCX 2HIMA 4X91A 4AO7A 1Q57A 3HI4A 4GR9A 2EV9A 4BB9A 2ZM5A 2JH9A 1CUBA 1AS3A 3Q7TA 2POQX 4NMLA 1S01A 3UTDA 1F7UA 2O1XA 3BIOA 3K9CA 3KDAA 4KPGA 2K5UA 2GA8A 3H7AA 5FUYA 1PNRA 3HB0A 3ZIAD 5T7BA 4ZMBA 1NY6A 2Z56A 3ZV4A 3UAOA 4TLBA 4C3ZA 1JQEA 3KTAB 1T5OA 4I14A 2FU5C 5SICE 2DXIA 4CNBA 5A06A 3FNQA 2MYNA 2PT7A 3CEHA 2QTRA 1YJ5A 1KVSA 4R98A 4Y2RA 2EFCB 1FUYB 2GBFA 1QK5A 4TQGA 4Q3EA 2PU5A 3PFBA 4BFTA 4YJGA 5I8ZA 2HQBA 4DSZA 1RJ9A 2GKSA 2AZDA 3FCYA 1OLXB 4J75A 3O4IA 1HTWA 5FBLB 4X92A 4K28A 3L0DA 3OO0A 2ZXEA 1RHQA 2DBRA 1DNPA 2AZTA 1EWTA 3THRA 1DWOA 1L4EA 2DSNA 1BMDA 2CHUA 2JJ2D 1WHTB 2IL1A 4AY3A 2ATEA 5CDHA 1PFVA 3MILA 4MV5A 4ND1A 3LCCA 2AOTA 2BRUA 3WFIA 3LNCA 3ABQB 1CQJA 1F5SA 1TUBA 3JZAA 4MWOA 1IC6A 4AKSA 2X0IA 1EFRA 1RQGA 1U2QA 1OT5A 3TSAA 1CJTC 1IFXA 4Y2XA 1RXEA 2AQIA 3K5WA 3GQVA 1QE0A 1JVNA 2FMKA 2WYVA 1O87A 2HXSA 2OCAA 4ZKDA 2W2LA 3LDGA 3HRKA 2F9FA 2K87A 2O2GA 1UEXC 1ZVKA 4YRAA 5J2TA 2W8ZA 4X20A 5D8DA 2EBFX 2P3SA 2OA0A 1IZYA 1F8YA 3NJ4A 1BMFD 2Q4BA 2IYPA 3FGNA 4UE2A 3ZR4B 1DEXA 2VJNA 3L0OA 4ZVVA 4CM6A 4N41A 3R4CA 1MAWA 1KEKA 2RH8A 4IS2A 4GMFA 4PGHA 4XVHA 4KPYA 1K8RA 4P7FA 5M34A 1YZLA 4IMIB 2CHEA 3GUYA 3EZ6A 4MIKA 1QTRA 1U8UA 4E07A 3P2KA 4MDYA 1GCIA 2NVWA 1B4DA 2HB6A 5BWLA 3U60B 1A7AA 2FCRA 2ZAYA 5GZ1A 2GM3A 3U16A 3ILSA 2G63A 1J0AA 2J41A 1IXYA 5TPWA 3WRVA 2VWHA 4Y9SA 1F1BA 1E9RA 3QM1A 4N6GA 3FMVA 3NBUA 3B1FA 3ANTA 2GLXA 5FA6A 3NI2A 4V38A 1GXSB 3A9UA 1K08A 3DAYA 4ETNA 4BFUA 5IX8A 3EZXA 5JEEA 3AKYA 4YQZA 4Q7QA 3E2PA 2GN4A 3QA9A 1IQRA 2OCGA 5CYPA 2X9QA 2NO4A 2Y1OA 3OURA 4BLUA 3TIVA 3R0QA 4TV8B 4AY6A 1LDBA 4N5DA 2AJDA 1Z63A 4KO8A 2VYQA 3BJZA 2BUBA 3F6EX 1J21A 2A2ZA 3JRXA 3OZWA 3A0UA 4JWKA 1EM8B 4R1MA 4RFVA 3PTLA 2VWPA 4U0JA 1VCOA 4GGMX 5KNBH 2X5KO 2DBYA 4FR5A 1CR4A 2H4ZA 4MVJM 4WERA 1P81A 2PR2A 3HMQA 1WNFA 1CDOA 2FMFA 2HMUA 3RS9A 5IAAA 1SKAA 5HKLA 3M6UA 2C1EA 5J58A 2HPHA 3FPKA 3K0CC 5AKZA 3ONEA 4ZQFA 3AUSA 5J2UB 1Y3FE 2V5UA 3C6BA 3E1KA 3NLLA 4PFJA 4D96A 3AF6A 1V45E 1FFDA 2CD9A 1SPXA 2KE5A 4UTPA 3C4VA 2KB0A 2O3TA 8LDHA 3L49A 5DW0A 4MQUA 1SUWA 1VE5A 1HLFA 4MI1A 2A5LA 1GTZA 4WSOA 5C18A 5BN4B 2PEYA 2UU9B 1OX5A 1JDNA 1Z5PA 3QOYA 2QKYA 1UAAA 3QOWA 4ZFNA 2DR2A 2W6ZA 1O89A 1H4QA 4FIDA 1MOPA 1XZGA 1B6RA 2CLMB 3BB3A 2ORWA 1Y3DE 2DJ5A 4AJLA 2YASA 2A30A 1G5HA 2FK7A 2JL1A 3ZGNA 2XZTA 2HAEA 2RGEA 1DMSA 4M7OA 4MO9A 4NBKA 4RK5A 2DFDA 3OLZA 1E62A 4O0LA 3JALA 1MAHA 3PYXA 1TYBE 3GLVA 4IUCS 4TMVA 5JMTA 5E9AA 1EP9A 4JYMA 1ENOA 2O2XA 3MCZA 4RLHA 2QE7A 2RE8A 1FA9A 2C7VA 3QLTA 4CF6A 4HV4A 5BR7A 3GLGE 4NECA 3ZI7A 3JAWA 4UEOA 1X8XA 1UBMS 4YJHA 4F84A 3LO8A 3ITKA 2RGCA 2C7RA 2X6TA 4OTZA 4KFUA 3U2QA 3A6KA 1D04A 1E2DA 1T5LA 1WBJB 2GTPA 3MWYW 5GM1A 4B9AA 5JANA 1Z74A 1Z28A 3L1HA 3QI2A 1I4OA 3LUAA 2WVGA 3PJEA 1FLNA 3U26A 2FX3A 4FZVA 2Q4TA 2Q6VA 1PJQA 2IUUA 3VJRA 2YXBA 4BGDA 1A4XA 4FDAA 3M6WA 1HNWB 5MHTA 2GAJA 2LDBA 4ZDIA 5IDXA 3SGLA 1M6YA 4XGIA 3AILA 3HZRA 1GYQA 5FQNA 3C3XA 4PAOA 3ZVRA 4EOGA 3KOMA 1L8AA 3GAAA 4UAJA 4QQRA 1WY7A 3LTEA 4R1TA 3I83A 1KK1A 3ONVA 1RU3A 2YYYA 2IEIA 3HPRA 3CF6R 1UKVY 5LQNA 5JROA 2JW5A 1QM5A 3INGA 3Q7QA 1SXIA 1Z0UA 3O5AA 1M34B 3EFEA 2FPPA 2DM6A 4GXNA 3H4VA 4M0MA 4U9IS 5K0NA 2JFVA 5K0JA 3DHNA 2BGIA 4C0HA 5E7MA 1N4AA 4G5FA 3HC7A 1ZEMA 1PS8A 1I33A 5GGXA 4PS0A 5BRAA 4UULA 1NJ2A 1V7QA 1Y1PA 2JGRA 4QUIA 5T6MA 3ZW8A 2GH1A 3BF8A 2BGTA 4YMWA 2O50A 1JE0A 1HC7A 16PKA 1LX6A 1U2PA 2C57A 4HWKA 4ED9A 3G17A 1Y3HA 2AJCA 1QO0A 3NHFA 4EF5A 4Q3OA 1YFZA 3BL6A 3GCZA 4LCEA 4NY1A 3MTQA 3GRRA 4BCBA 2WKQA 4C6SA 3VHRA 3B3GA 3O21A 3VHQA 2JJMA 2WU1A 4ZVMA 2B94A 5ALYA 3GGCA 3KYCB 3KPUA 5AHXA 2WIJA 3FF4A 4YJFB 3O1HB 3HZHA 1ONSA 2A9OA 3I3SR 4V2IA 2ZDQA 4EF4A 5JO0A 4EY6A 3W7AA 1S96A 3W7BA 4QJBA 3EXHB 4XQEA 1LNSA 3ZV5A 4G81A 1WZ2A 3H1TA 4FMDF 4JBIA 3I1JA 5CLQA 3SOZA 2F55A 1T1JA 4P3XA 1IG3A 5HM6A 4Q39A 1E2HA 1PR2A 4Z9YA 2DE0X 1AU9A 2BSQA 3IDZA 3RTEA 2VXYA 4G5OA 3UATA 1W581 3AV0B 2PGLA 4O33A 2ZT5A 3HLYA 3GZ4A 5JYEA 1XZFA 1UWLA 1MX9A 1Z07A 2QL7A 1JTFA 3W2TA 4KXNA 4QUBA 4MW1A 4GEGA 3AU9A 4UQOA 3E2IA 1X80B 1YJAA 2Q6LA 2EFHB 3DBLB 2VZEA 3H17A 4PN7A 4P84A 4GG1A 4BCDA 5BV8A 5CH8A 3UMBA 1KYZA 1FVHA 5E9WA 2DPXA 3D4LA 3W04A 4DLBA 4E4YA 3UJDA 1MB9A 3LZ6A 1HG1A 1GCGA 3GPLA 4GMGA 1APBA 4MKZA 2XNDD 2QV0A 1IBMB 3QUAA 3TIIA 4RETA 2QSZA 4G36A 1ZEJA 1GNSA 5KYWB 4X7MA 2YHSA 4IF6A 4E5MA 3OCZA 4RHCA 1PJ2A 5ENZA 2D1FA 2R60A 3WXBA 2W6JD 2HUNA 3C6YA 1IXKA 4LBYA 3E5RA 3PHHA 4XDYA 3WDSA 3KUKA 1T2UA 2C3MA 2XJ9A 2CFIA 1IOZA 1IAQA 1UMDB 4KXMA 221PA 4ZXFA 4AUEA 3BGVA 1C7ZA 3ZU5A 1IEVA 1RXIA 1G6Q1 2ADMA 4D9JA 4QGGA 2CK3A 1D4FA 2O07A 1JHRA 1ZIYA 1HL7A 1C1DA 3PNPA 1B1AA 1XZDA 1F60A 1G4UR 2QEQA 3G9UA 3QHQA 2EU8A 1KGDA 5CB8A 3X43A 5EKXA 3T7JA 1AH2A 1OTHA 2FN8A 1EVKA 2HPAA 4I8XA 3SICE 2X8LA 3I61A 4JGIA 5JALA 2PL9A 3DTYA 2DHEA 1XCLA 4WFIA 1VG0B 1YRHA 2G5CA 2VJMA 4U7WA 1TA9A 4QHSA 4NU8X 4ZVNA 1QIFA 2YCBA 3GP8A 1Y6ZA 3CNHA 2J3DA 3PXXA 5FNVF 3WYCA 5J43A 1RJGA 2BE7A 4ZZIA 4CV1A 3OOYA 3HP4A 3Q9UA 5KPDA 4IW3B 2ZXUA 3QEBZ 3HXMA 4P4LA 1NULA 3N8HA 5BORA 5IJAA 2ZRMA 4OBWA 1GAQA 2OYCA 4LOKA 4NNJA 3B8EA 1X8LA 3RFVA 4NBWA 2HRCA 5B2EA 4FYIA 2P69A 4QGHA 4KPUA 5G4KB 3NAQA 1QRTA 1RC0A 2I5PO 3BRCA 4POAA 3RRMA 3KTOA 1CE8A 3PUYA 1NWHA 3ZDDA 3NH6A 3EAFA 1ZL2A 2UVPB 1HK7A 4OHUA 1CEQA 4PCUA 2NZUG 3BHNA 4AS3A 5J4VA 3MTGA 5K7SA 1N2OA 2ZCUA 4XJVA 1T8PA 2YBDA 4M0CA 3OA2A 3GARA 3SP1A 4R40A 4CKWB 4J3FA 2KS6A 3GVCA 1LLCA 3MAJA 4NCKA 3N2IA 4A2CA 3QHAA 3V00A 1L3CA 3KXLA 1HYGA 3MS2A 1JPJA 1MQ8B 1NPDA 5JZSA 3HUEA 1LC3A 1FFGA 2OZKA 2G17A 4INJA 4J2HA 1NAIA 4A8PA 4MR8B 4BN0A 5KTNA 4FOPA 1HBJA 3VKUA 5JV5A 1VL6A 3UMRA 5B7QA 4L0MA 5DTEA 1JSRA 4EHFA 1MVOA 4UC0A 1ZJ4A 1ZMOA 1FW8A 4Q1DA 1O94A 2VPQA 2WKWA 2Y1XA 3ORYA 5HILA 2V7QA 2IYOA 3TDKA 3KQLA 2BIFA 1JT9A 1RLOA 3EH1A 1DI0A 3HDHA 5LD2B 3HA3A 4IDEA 4N3GA 3T5BA 4NENA 4M9SA 4Y2YA 2YRFA 3UKJA 3W05A 4E31A 1MGPA 1FDVA 1VSTA 3LC1O 3Q8KA 3D2LA 3IKLA 4LMRA 4XGQA 4WESB 1D6JA 4HAUA 2PRZA 5H16A 8OHMA 2V0GA 1S6YA 1YRLA 3N2NA 2A4KA 1LPAB 1NQXA 4PYRA 5ES4B 2EFEB 1S7GA 3QUTA 4HQKA 4QDXA 1KQ3A 1LI5A 4CG3A 4B4VA 3DV0B 4KWTA 4ZIRA 3A2NA 2ZSDA 2RB4A 1YK0A 2R66A 3AP2A 1VE1A 2BFCB 3B9BA 4FFPA 3BXHA 2EJUA 2VXCA 3L8EA 4IM7A 4OFXA 4FKZA 3SDSA 1R4MA 4GP7A 4DIBA 4URVR 4INZA 2JFOA 3MCVA 3PDCA 2XBLA 4UZFA 2N46A 2OBFA 3TRKA 4TL9A 4L27A 1AUXA 1BWRA 3QKRB 2W6JA 2J9YB 1YR9A 2JRLA 1R10A 4B2LA 1I94B 3EODA 2GEJA 1EX9A 2D2VA 2V3VA 5H3CA 4OMFG 1N7HA 3VA7A 3D3NA 4D42A 5ECDA 3DV9A 4QHYA 1LK0A 2IXGA 4JZKA 4BFVA 4O4HF 1KDVA 2AXEA 2JVKA 4II2A 4ISCA 4UZEA 5G3YA 2CT8A 7MHTA 5KYUA 1X2BA 4HLUA 1EA7A 1PQYA 1MOSA 1MJGM 3NNNA 1F4LA 1QR6A 3F8TA 1ADJA 3P8ZA 1NONA 4PHGA 4L5IA 2P41A 3BDAA 5DU2A 3G5LA 2C5BA 4RXMA 3U80A 2OQIA 5EJ7A 3DZGA 1UBHS 1VMDA 1HKUA 3WJ2A 4ZHQF 4IAOA 4WEOA 1OBHA 5DHFA 2Z5VA 4C78A 4DF3A 3GBVA 4ZHQB 1K7CA 3KOUA 3UGTA 2IHKA 3QYJA 2WJJA 2F2TA 4FEYA 3RC7A 4DBVO 3Q1LA 4CT0A 1YQXA 2J33A 2QJWA 2ZI4A 3AR9A 4FS3A 4HDAA 4DPMA 3C3PA 2QTMA 1KS2A 2AN4A 3ESRA 5DB4A 3CF4G 4ZZ0A 3I5YA 4B6QA 4P7JA 3AIOA 2EC5A 1IG0A 1VTKA 1D2AA 2OCYC 4MMYB 3L7CA 3N6XA 3RFXA 1WSDA 3LECA 4YQEA 3SM9A 3WGIA 4DIOA 5JZVA 3E0QA 4XB1A 3MCUA 3LQFA 3TNDA 3WMEA 1OXUA 3PEUA 4ZCQA 4F96A 1ZIXA 4TVOA 4PIMA 1IONA 1ZAKA 1AMOA 2WG0A 1ZMXA 2VJOA 3IEKA 4E08A 4IOMA 4YDHB 3EZFA 3IB3A 3WGLA 4IV5A 2YMQA 3NTLA 1XJWA 3ND8A 1YIAA 3PFIA 1WU7A 2XQGA 1P2BA 4BVBA 5D51S 4DCMA 3BSYA 4KQKA 3EASA 3N2GB 2JLYA 1ZI9A 2OUKA 3HKCA 1U3GA 4YWHA 1G21E 2HQSA 4QGAA 1GRVA 2B3TA 2O2ZA 4BN4A 2DEUA 3KT6A 3UJ7A 1P3DA 1XL0A 2C3OA 4LXIA 1IOVA 3LM8A 3LYHA 3R3JA 4KE9A 1YHNA 1QHHB 5FAXA 4D4KA 3DZHA 4G0ZA 1XDSA 2I22A 1HO3A 2JS7A 3RVJA 4OSEA 1PFYA 3LUCA 2XVMA 3I12A 3OCWA 2QUIA 4AY5A 3RK0A 1U2GA 1UWKA 1KDZA 5DHSA 3T4XA 4A0SA 1KI6A 2JIRA 2DKFA 2OBYA 5B3AA 1UXKA 3FCSB 4DCPA 2VJPA 4K81B 3QX7A 4OHVA 4M54A 2ZBEA 4BUJA 3DNPA 1JIQA 1WU8A 1U0SY 2EXXA 4ME6A 1O96A 4HDCA 2CNDA 2H4WA 3EJ6A 4U7GA 3C0KA 4GI7A 1RWPA 3RO7A 3BRSA 3C5VA 3RYTC 3OIVA 2CMKA 5HCIA 4MS1B 3U6KA 2GPJA 5KWEA 4R71A 2RAVA 4TZTA 2Z57A 3DC7A 4JD5A 4EL5A 3JPYA 1T8YA 3A9TA 3KQUA 3U56A 3HYSA 3UUGA 3KUCA 4H4CA 3NDIA 4K2AA 2XQFA 4BPBA 1B93A 4JU8A 1DDGA 2FXIA 2WMNB 3GNSA 3C4QA 4IVPA 4CETA 4FN4A 2FMTA 3MRVA 3QU7A 4I3FA 2QY6A 3L7AA 1BO6A 2CEAA 3ROQA 3BILA 1D4ZA 421PA 1Q17A 2E85A 4NX2A 4ZT7A 4OJMX 4BFLA 4Z3OA 2HDWA 5JFTA 3HA7A 4NOMA 2CZCA 4O4JB 4R9RA 5DHAA 1JVBA 1JXMA 4GWLA 1I3OA 2VLBA 4RVUA 1QZXA 3BWCA 1V1RB 2GZAA 2M6RA 1NQWA 3PHBE 4HAWA 2XCIA 4HQ6A 2Z0MA 1SG6A 3T5TA 5CCEA 5K03A 4EW6A 4D45A 4KN8A 2VTBA 1M1ZA 3WXMA 2R1VB 3U5TA 5CU7A 5K3AA 4J2TA 2AD5A 4UAVA 4ZAFA 3MJHA 1OSNA 2B21A 5FPKA 1DQPA 4Z4IA 1Y81A 1IUKA 1C7JA 1AIPA 3FKJA 5AVSA 5JXIA 1T3ZA 3H13A 2QVGA 1SOUA 4F4HA 4M7PA 4B7ZA 1FDOA 3W2HA 4KIGA 1UPAA 2VHQA 1F0NA 1U5BB 4JXJA 5DE3A 5I4CA 1MJ5A 3P2JA 5F5NA 4EMTA 1F7VA 3T4PA 1MENA 2DETA 4RD3A 4MVJE 1ATZA 4CCAA 2ODNA 3KOWA 1NVWQ 1E0SA 1IATA 2L17A 4EI8A 1R2QA 4QUKA 3O38A 1R0LA 1W76A 1CSEE 1I80A 2QIOA 2CB9A 1B0ZA 3E3OA 1JFFA 1NHWA 3EG9A 3GRCA 3GU3A 3HO8A 2YFKA 3LYAA 3GHHA 4JFRA 4URZR 4WNCA 1L7AA 2FQXA 3IAAA 3W2EA 1VJ0A 1HFWA 4U7FA 2V7EA 4UE6A 5EMJA 4PR0A 2IV2X 2ZT6A 3RW9A 3T1NA 2FPWA 4Z7QB 5CAEA 1MDBA 4NCBA 2JIZA 1QRAA 5JQGB 3RB8A 2OXCA 3NS7A 2BFEA 4L8LA 2HC9A 2JEYA 4V1CA 1C80A 3EGVA 3IUEA 3E9DA 1B26A 3GRKA 4YP9A 1O03A 1U0RA 1NG1A 2HOQA 1JAZA 3X1DA 4BEBA 1JAXA 4HH4A 3U17A 3TH5A 2PMKA 2B4YA 4P4UA 1BOFA 3GJSA 1I6KA 3ZOZA 1CUVA 1AK9A 3MMXA 4DUGA 5JPDA 3U1VA 1J1ZA 1YONA 3SLRA 4QUEA 2Q29A 1UKCA 4QNMA 3FVTA 4HRAA 1N6IA 3RU3A 2E4UA 3SBEA 1PQ4A 3UHAA 3IIKA 4BX0A 2IHNA 1W94A 1MAUA 4YCAA 5DNWA 5GPBA 4PY2A 2EKBA 2NO5A 4MP8A 1YTUA 1JQBA 3WRWA 2GN8A 1KNXA 3B9PA 4LZWA 4Z54A 3HCAA 3IT0A 2JG3A 1ZUWA 4YA6A 2VP9A 4YXWA 1K8YB 3I52A 5K0GA 4MROA 5BP7A 2H3HA 1KZ9A 1Z0ZA 2P6NA 3DCYA 4PPQA 4BQRA 4IJ6A 1GUAA 2A1UB 1R6TA 1U81A 4I5DA 4CI9A 2X5XA 2VBGA 2HTEA 2JGDA 1Q0RA 1J07A 1Z6PA 1ZONA 2V9CA 1O08A 4X7PA 1FMCA 1NNSA 3DCIA 3L0PA 3KJXA 2JFNA 4MVCA 1Q0LA 5CLHA 4RTQA 1GUZA 4XWTA 1JR3E 2CNKA 3JYQA 2QZPA 4KNWA 2C88A 2PU7A 3HG7A 5A03A 1EX7A 2RGUA 5K0SA 4I7EA 2IYQA 4XD2A 3CFYA 5GV8A 3IUMA 1SVLA 2WSIA 3ML1A 4EJSC 4GKVA 5E2BA 4FMBB 4PZPA 2R8OA 4E13A 4UTXA 4MW0A 3ZD8A 1SVWA 2OXIA 3LVRE 3ROKA 2VYCA 3PYMA 4KRXA 3ZWXA 3WYEA 3RWMB 3SX4A 3LPCA 2O9JA 1I4EB 1GY8A 1NN3A 3G2NA 2X3UA 4G9BA 4A10A 1E9AA 2QHXA 3MBOA 1DHTA 1C9NA 3RVQA 3V4SA 4DC9A 3KHUA 4H27A 2G5TA 2DT5A 1D1QA 2O2DA 2DG2A 3PI6A 4GBJA 1QCDA 1VKNA 1FFWA 4N5IX 4ZQCB 3U4GA 4AQDA 4DV2B 1ESMA 3EPRA 3GFFA 1FUKA 4UM8B 3OOWA 4LFAB 3PNLA 1X77A 4FVTA 3CPHA 4IXMA 1SIUA 3U37A 1HDYA 4FR0A 1NURA 3FVQA 3I28A 3NV9A 1EFUA 3LU1A 4K6GA 1B0UA 4GPIB 3HWRA 4WWHA 4KWIA 1YCHA 3WJ1A 3KB8A 1X7ZB 4ENVA 1JYEA 4RK0A 5PNTA 2BBOA 2X3FA 1KL7A 1W4LA 5FFMA 3K0KA 3WKCA 1YB2A 5IEJA 3QUBA 1FYFA 1EUCA 3OPVA 3T15A 4D41A 1VI5A 3OA0A 4Q3AA 1N2EA 2QT9A 4K3VA 2HKIA 3RAGA 2KWIA 2OL4A 4YJ3A 1JJAA 2JIOA 2FZWA 4C0JA 1NXWA 3L6CA 4ZC8A 1WCV1 3BYZA 2UZ1B 2Y99A 2NQ8A 1SCJA 2X8BA 3CWZA 5B3KA 1B42A 1XU4A 2B1JA 4RTSA 1OH6A 1FRNA 1NVVR 4G4IA 1U1GA 4TVBA 5IXYA 3ROMA 1KU6A 1QHGA 1Z4MA 3VUEA 3T4EA 4H1UA 4ETMA 1EXDA 1JHXA 3BXOA 5DMHA 4RULA 2VTVA 1XALA 3OOSA 2GFHA 4CGZA 5HBGA 1KFJB 3ANSA 3CZRA 4OK6A 5A2QA 3I39X 4PZUA 2OAP1 3DOFA 1FX0B 4C76A 1M7GA 4UPEA 4X54A 3SZMA 3WGYA 1GU0A 1EQUA 1V7CA 4Y2TA 1LKZA 2J0EA 4FYPA 2W4MA 2VL7A 3A26A 4IO1A 1LGYA 4QG7A 4B46A 3ZLVA 1WMSA 2I2FA 3H5LA 5A9RA 4FFRA 4J1TC 5EQJB 3AHGA 2PQ0A 3FWKA 4QSMA 3E81A 1DC5A 3T9DA 1PX2A 3WS7A 3UMMA 5CNKA 4IF4A 3GRVA 4XXHA 1V3QE 2DB3A 4UASA 4FFBA 1I51A 2CJPA 3EY4A 3OJ0A 4PC2A 1NVEA 4XLLA 2JZOA 3Q9SA 4Q47A 5CH3A 5D5PA 1XEXA 1L4FA 2DY0A 2GZDA 2VPPA 3RDPA 2JFWA 5KC9A 4B79A 1JKFA 4B3MB 3RFTA 4BNGA 2QMZA 3SC2A 2WIBA 2WJIA 4JCCA 4O4HA 3LIIA 1BDHA 3W5DA 2YJTD 3HA2A 4OQDA 2FWMX 4X9XA 3E7PA 2P5TB 1M6WA 2DF8A 3I2GA 4JYAB 1REQA 3STVA 1GKUB 5LXTA 5AW8A 5LLSA 4JA0A 3ROXA 3ICWA 1KMMA 3SC3A 3C8ZA 2XUZA 1IHOA 4Q21A 4Z1OA 4JOSA 3QMMA 3D3KA 2B8EA 4MKHA 3VJLA 4DDVA 4CHTA 4PO1A 3NM4A 4C7OB 4EHJA 1M1YE 3QF7A 4ACBA 4MI3A 1X2EA 1U2DA 2HIGA 1VLZA 1XRQA 4B35A 3IHKA 1A5BB 4ALIA 1ZP6A 4U6QA 1LQTA 3PL1A 1XK7A 3FZQA 3QEOA 4MLCA 3GGDA 5KQMA 4M3NA 3RYHA 3Q4GA 4J6EA 1U3CA 5CA1A 5HR5A 4C2UA 4TS1A 3KAPA 5HMMA 1ZH0A 1NR7A 1NVDA 4IH4A 4BMPB 3C1OA 4GOMD 4GW3A 4DLAA 5C81A 5KOJB 4PHTA 3ZD9A 4FE4A 2HI0A 3C87A 1PIWA 3D8RA 2X0RA 5G2OA 3I2YX 4DBLC 3J7TA 1X70A 2JJYA 4C6TB 1GN9A 3PUHA 3QNUA 1BVUA 1FU8A 1ZDMA 2GHTA 4HS4A 5AM0A 3SE7A 2GWHA 3LMKA 1U8XX 4R1OA 4TN5A 3ZV7A 1UJCA 2CVZA 2V97A 3HEAA 2MINB 4WNAA 2BFWA 3FYTA 2UYHA 1BRTA 4JQYA 2C5FA 3GRYA 2Y0BA 3NB0A 4NFHA 4NE9A 2OSBA 3IMKA 4WZAB 5ALEA 5H4HA 3UMVA 2IEDA 5GIOE 3L8MA 3E05A 3V4LA 3ZXIA 2J5XA 4PLPA 3DD1A 4Q03A 4KYIB 4MQ6A 4HY3A 1WQ3A 1ISPA 1JJBA 1WETA 3B6JA 3BRQA 2JVJA 4KQGA 1YRQA 3E53A 2O8VA 4YJ2F 1N0IA 2X6RA 4KYTA 2Y4OA 4O02B 2P27A 4YJ2B 4FYWA 4DAOA 2DFLA 4HGNA 4Q7EA 2HEIA 2QLFA 3EVAA 2G8LA 4CM7A 1YZHA 5FA5A 2JLRA 3K0BA 5DX0A 2DFVA 2ZRAA 3LYLA 5F98A 1HT3A 2QD3A 1TGYA 2QLTA 3H18A 3TQHA 1GRNA 3THSA 1DUSA 1H5NA 1KSFX 1P8AA 1SR8A 2ZRHA 3ROGA 4NJEA 2OHVA 2FN9A 2C0PA 2QYTA 3KB2A 3A14A 5CPBA 4D44A 3OSUA 1DKOA 4FWTA 4WKOA 3DDSA 1TQDA 2FFAA 1OV6A 1IEXA 1QFSA 2FW6A 2HH9A 2OZPA 2V4ZA 4BAGA 4E46A 3TD2A 4YHHB 1ZRHA 4JXKA 1F3OA 4KFRA 1R0XA 2QQFA 3FLMA 4GSKA 2W58A 3FG9A 4GP9A 5FLYA 2JVIA 3G8BA 3DYIA 3QIVA 1WG8A 2HU2A 3QXCA 4XWGA 2VAVA 5DTMA 5U4QA 4DANA 4WDQA 5LMNB 2BMVA 5J63A 1E9EA 4KQXA 3WG9A 3IP7A 4PLTA 1OBVA 3HY6A 1JHZA 1C4OA 1Q0UA 3MVEA 4FBMA 2FP3A 5HGJA 2ZJFA 3BRWD 5P8WA 2Y1FA 3PC3A 3VR3A 1Z0DA 4U8GA 2FWBA 5EXSA 4AZWA 2VO1A 3IE1A 5C1PA 2VP3A 1KIFA 1LBIA 1ZCBA 2IU0A 4CM9A 1VSUA 3ITEA 2ZB7A 1E3EA 2W6PA 2WPNA 1T5DX 1BFDA 1SUPA 1FFHA 3NHWA 4V0SA 1Q50A 2PCLA 3GRAA 3I73A 3N7TA 3B2QA 3I37X 2ILVA 1Y8CA 2PL5A 5JLAA 1YVPA 1XRRA 3BCUA 1WXWA 4IZ6A 4C4YA 2D06A 4HRYA 1T4MA 4LZZA 1L4MA 5JZMA 2QGZA 4CQJA 3C3EA 3IBTA 4QPDA 1I7QB 3KYIB 3FYDA 1QC5A 1TK3A 3UPDA 2D1QA 5B57C 3FPEA 3DE0X 4HT3B 1T3GA 4MX8A 3H65A 5DK4A 2JFFA 3SQNA 3WTCA 5HNKA 3E22B 1PKXA 3TO5A 4MV3A 3R5TA 1RHUA 1U1IA 2QZ9A 4OFZA 1WV0A 5K5EA 1S3FA 4NZOA 4EQZA 2CBGA 4D74A 1GTL1 2I87A 2VBFA 3Q0EA 4NL4H 1G8PA 4A3SA 1R74A 2XYRA 4ZT5A 1JYFA 1CFJA 1SCDA 3N28A 3VUFA 5JSZA 1Z13A 4JP1A 2VPWA 4NC9A 1VMKA 3ZHXA 5BYBA 2X8JB 2DQKA 4XQGA 3BK1A 2TRSB 1YZVA 2G06A 3H0EA 3U9TA 5B64A 2IOQA 1AZTA 6REQA 1G1AA 1X7WA 4FEEA 1K4KA 4ZVSA 4YDSA 5KX5B 3FI9A 1VBNA 1ZNXA 4DDKA 1D2RA 3EWSA 2DQ4A 3CLRD 4Q4DA 3MLEA 3OLVA 1YQUA 4ILKA 3DFUA 4Y6PA 2CYCA 1T2NA 2XGMA 4XWAA 5JVDF 4M99A 4YH1A 4BTVA 4NFYA 1GPUA 1M2NA 1OLSB 3DR3A 4RVHA 4CLHA 1R0SA 1WHSB 2Q8NA 3B36A 5A3QA 5F9FA 2FRXA 1X1RA 3I5UA 1V6SA 1U3WA 2WNSA 2ZIXB 1JZSA 1WMDA 2R00A 4NNOA 4BJ1A 1JPNA 5IDWA 3KDPA 3BCRA 4TWBA 1WXHA 4ZAZA 1I5RA 4KPUB 3UW1A 5LNK1 4FONA 2VDWB 2MHCA 4Q93A 3ZCXA 4CKWA 1Z25A 4YGXB 1HETA 3RV3A 2C2ZA 3TG2A 6Q21A 4ZGBA 1HYEA 1GITA 1SKYB 1M0SA 3RJ5A 1C0EA 1GL3A 4HFNA 2D4AA 1SCBA 5M5BA 2NZWA 3PGVA 1MABA 4Y6OA 3C3BA 1EWRA 2PJDA 1TQ2A 4MHOA 2R6R1 3EHDA 4DLZA 1JQ5A 3WGZA 2C7QA 4MGIR 5A5VA 2BEUA 2VHTA 2PZGA 2B8JA 4WFJA 2AUTA 3SFVA 1GLNA 3NHYA 3EOBI 2C9BA 1X94A 1LB1B 1T4CA 2FSSA 2ZYAA 4EJMA 4F1WA 1WPXA 1NC1A 3SKYA 3STUA 3WL7A 3KQNA 4UPVA 2X41A 2HNAA 1A72A 2BEVA 2ANCA 3KTFA 1A8UA 1CS0A 4ITVA 2DHCA 4QODA 2IV3A 4XD7A 5BOSB 2XCSB 5E0OA 1W5AA 2QUAA 5DGCA 1HDEA 5K3FA 1KC1A 1O6FA 4GLFA 4DGQA 2VF2A 4RGYA 1SU8A 2IPXA 2Q2WA 4PRYA 2X14A 3VFDA 3AHIA 1XTQA 2GMWA 2V0CA 5HKBA 1RXSA 2Y6UA 1NFRA 4HRVA 3NT2A 1P9OA 1L0BA 2EZUA 4EB6B 2JBAB 3HV0A 2R6HA 2RAUA 5CVJA 4C7BA 5TPZA 1ZGCA 3E7FA 4LYGA 1MO4A 4LWPA 3WAKA 2VHCA 3PXEA 3S2UA 3ZU4A 1MJNA 4KLAA 1N2CA 3JYLA 1RT9A 2CMHA 3DEHA 4HX9A 4N8SA 2YTZA 3ROFA 2H2DA 1K6MA 3KYBA 2QN6A 2RAFA 1FNDA 3K9LA 5B55A 5LMUB 1N3LA 3BHMA 3RFUA 1G8FA 2W2MA 3WA6A 4ZDJA 4Q6BA 5C8XA 4Q4JA 3OM8A 1ESDA 2YR0A 1UT5A 3G0DA 2ADOA 1U1FA 2IOFA 3GNQA 5LB2A 4KOEC 5G0UA 5ED0A 4UOZA 4WCFC 1YKSA 2ZWPA 3NIBA 3T0FA 4F5EA 3CZ4A 3UMGA 3K1TA 3TI9A 1JTEA 4WT7A 1ADFA 4FSDA 3QVVA 2GUGA 4ZVTA 5BMVA 1H9AA 2H00A 5B4UA 2G5GX 3GFOA 3P4XA 1VSVA 1PWXA 4FZJA 3VZCA <