1MTOA

Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
319
structure length
319
Chain Sequence
b'MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTWVIEVMGRHAGDIALYSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEALANKHTIDQRMYALSKELSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphofructokinase
molecule tags Transferase
source organism Geobacillus stearothermophilus
publication title Reversible Ligand-Induced Dissociation of a Tryptophan-Shift Mutant of Phosphofructokinase from Bacillus stearothermophilus
pubmed doi rcsb
total genus 100
structure length 319
sequence length 319
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2002-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mtoA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mtoA02
4KXNA 6PFKA 1S2GA 2A0KA 4FYHA 2F62A 2IZ7A 2KHZA 3O8NA 5AJTA 4JELA 3U39A 2F2TA 2F48A 3IMKA 3OPYB 2Q4DA 2IZ6A 4I36A 4I4IA 1F8XA 4LJLA 4KXMA 3OPYA 2Q4OA 4MEJA 2PFKA 4I7EA 3PFKA 4MCJA 4PFKA 4OHBA 4JEMA 2A33A 1S2DA 4JENA 1YDHA 2NX2A 5ITSA 3GH1A 1KZHA 3O8OA 3SBXA 4U1RA 4RH3A 3QUAA 2KLHA 4FYIA 5AJUA 3O8OB 4FYKA 1ZXXA 2IZ5A 1S2LA 3UQZA 4A3SA 1F8YA 4KXLA 2PMBA 3F5MA 1T35A 1WEHA 3EHDA 4HX9A 2HIGA 3MAJA 1RCUA 2F67A 1WEKA 4NPAA 3BQ9A 3O8LA 4P5DA 4OHRA 2F64A 1S2IA 1MTOA 3K2QA 4P5EA 3HNOA 1PFKA 1S3FA 4WL0A 4LJRA 4LJKA
chains in the Genus database with same CATH superfamily
3PWKA 1E2UA 1HE1C 4Q9DA 1RWVA 5F52A 2F1IA 4WZBB 3KZVA 5EA2A 1CB7A 2AEFA 4G9EA 1HY3A 5SYNA 3GVXA 3EVCA 2FSFA 4X6UA 1P2GA 4KW7A 2IA5A 1P39A 4UBJA 1DCMA 4G5GA 2WKPA 4KQXA 5EFOA 1KFEB 4ASUD 4CDGA 2HHLA 4DGQA 4DJ5X 1GRVA 1K06A 2O3UA 4JUCA 4IIXA 2OCYC 1DV2A 4W1QA 1W8DA 1A82A 1XZCA 1N2CB 4MV7A 2BPOA 2PUFA 3KYIB 1MIOB 4XI9A 4YMTA 1TZ2A 3E2PA 1Y6RA 3QFCA 4BMOB 1U0GA 4UATA 2C4KA 5HM8A 1KIAA 1IY9A 3L9XA 4EL0A 1QRSA 4EA9A 1A5ZA 1X39A 5LSAA 3L8CA 3OOEA 4RZQA 4YACA 5LQCA 2QRVB 2VPPA 2WD7B 3NOQA 3ZBTA 1PNVA 2R4TA 5IKPA 2J5BA 1Z73A 2FUKA 2X1VA 2ZI7A 3HI4A 3BXPA 3GLQA 3LUGA 3P7MA 1TF2A 2YHIA 3IPXA 1KK0A 2BN4A 3SSOA 1CVIA 3DVQX 1O89A 2ZIEA 3MPOA 4OCZA 2Q1YA 3H9CA 3LDGA 1C30A 2IIQA 4HMQA 1PDWA 2B99A 3LU1A 4PRKA 4WX2B 3RRNA 4D3FA 3NP7A 3ZGYA 4OTZA 4FFDA 4M9CA 1Z4PX 4E2WA 5A03A 2R8XA 1I4TD 1L0BA 1VP3A 2I1WA 4ZRNA 1PJBA 3PRYA 1SRRA 5E2BA 3RIEA 2V54A 2Y0BA 4CR8A 2IOFK 2V59A 4PLHA 1X80B 3GJYA 4RKRA 2JGJA 3A9WA 3AUAA 2P2NA 3BYZA 2RBKA 3PGJA 3PGVA 5FF9A 4OXXA 3KOUA 1T3GA 4XVCA 5A9TA 3O90A 2CUZA 3OX2A 3IBGA 4MUMA 3SHVA 3ZHRA 1QHEA 2PN1A 4F2WA 1M2FA 2HA2A 3DMNA 3HDHA 1M0WA 1YKFA 3CT4A 3DVLA 2DSNA 2G4VA 1LDGA 1VYVA 2AOVA 3QLJA 1XDZA 3L8DA 1ETHA 2ANBA 3B13B 1IL0A 3E9CA 5CYGA 1RI5A 1E5TA 3B60A 1Y80A 4RA9A 1NW4A 2WICA 1DXQA 2JIRA 3CGGA 4HD8A 1DFGA 4K7JA 4BE7B 4D7AA 3A0RB 1XVVA 3CVJA 4IKPA 4MW4A 5B4VA 3W5AA 1VP9A 4RTLA 3CG0A 2MSDB 2Q3EA 1QRAA 1Z7GA 4RQTA 5L51A 2RHLA 4IGKA 3VUEA 4F04A 2XVXA 2GCOB 5JD3A 5IM4F 1QCDA 4OK3A 2YWEA 2CFOA 1LC3A 3D6UA 4HRXA 4Q1DA 5SYAA 5IFLA 3ZD6A 3CZRA 1QDLB 4MKFA 1SZCA 4ZJUA 4YUXA 1E7WA 1GZ7A 4DIOA 1JHPA 4MUIA 4MWTA 3GP3A 1N5IA 3G8AA 3RE1A 1OV4A 3ZHQA 3HXTA 4YI5A 2LKDA 2CC2A 3D6VA 3VR2D 1U0FA 3H9EO 5AVYA 1T36A 1AG9A 2CL5A 3FUTA 3OLYA 4QOEA 2JIOA 5K4GA 4OM7A 1L7PA 4PX3A 2EBUA 1S3FA 2DHRA 2B5OA 2VPWA 4V0SA 4AJIA 3PNOA 3IIKA 4ZT6A 4RPKA 1A96A 1JWAB 1QV9A 2BZ0A 1X2EA 3A1FA 4NOMA 2VHYA 3RJTA 1YNSA 4LJKA 5K3EA 1OLSB 4R8LA 4UDNA 2QRMA 3TFWA 3ZNPA 3KT6A 4JXZA 2XOKD 5CA1B 2HHJA 1YF3A 5CAEB 3O83A 3FBTA 2B1IA 2JCVA 3E0XA 3G49A 3PUXA 3OIYA 4JLJA 4QPJC 5C18A 4FDUA 4HDCA 5KYYA 1RM4A 3OQNA 1W47A 4LDZA 3X43A 4WECA 1I4WA 3BZBA 3H75A 3HN6A 3MPUA 4WZZA 2ZDHA 5I4BA 4F9FA 2XUDA 1YBMA 1GPKA 1II8B 2PPLA 3CF6R 1P1IA 4B5KA 2X58A 4TL8A 2V03A 5TQVA 5J2TB 3LKBA 2C07A 1J22A 2VF2A 3L84A 3W05A 4DBLE 4E3ZA 2HW8A 2O0KA 3LPCA 3R4CA 3QOWA 4KX3A 1UJCA 2Y66A 1BX3A 3N0WA 4Y2TA 3IA2A 3OICA 5DFAA 5FOUA 1FFEA 2XD4A 3DONA 2CE2X 3FXAA 5JVDA 3AI7A 4NBUA 1H85A 1XTRA 4N47A 4AIRA 1SHKA 1QK5A 1JT2A 4BP1A 3FRHA 2X5XA 3I2KA 4ND4A 2VLIA 1Q0SA 2HY7A 2V98A 4G84A 4XB2A 3RSHA 3E1SA 1QR2A 2VYQA 1THGA 1LSUA 2RGYA 5TXGA 2A0YA 3QSYA 4K1XA 1F7VA 2J9RA 4ZQHA 3B5EA 4L3OA 4C7VA 3X3HA 1FP4A 3SYMA 4AO6A 4EEKA 2YRXA 1Y8RB 1M2KA 4QDZA 5TIIA 5T64A 1BX1A 2EG5A 4D3SA 1B00A 1REQB 5TJHA 3E9EA 3BMCB 3D1JA 5E95A 5EZSA 3AZOA 2NUAA 4X7PA 5AKJA 1CG6A 1DOAA 3B20A 5E1DA 5T3UA 5AJUA 1M83A 1XTJA 4COOA 2H07A 4US2R 4YRRA 4KWEA 1RQRA 1CLEA 1XMJA 2IF2A 3DMFA 5D01A 4W5JA 2FPGA 2NTYC 2F90A 4GYJA 3DFKA 1NU6A 3NJRA 4IUCS 5T4HA 3Q3GE 4WFJA 2ZIFA 4GMXA 3KPVA 4EI9A 4R1PA 1ZKDA 5FTNA 1KI1A 1TW3A 4IDNA 3O31A 1Z5VA 1UQUA 4N12A 1UBTS 1QZXA 4HX5A 1V26A 2NZVG 1FTGA 3FTDA 4JVLA 4ENRA 4DXAA 2C5EA 1LLDA 4BNGA 5LQDA 3DWIA 5MHTA 1E2DA 5HKKA 3HY3A 3M5DA 4JJ8A 5A71A 2E87A 1SHTX 2X6QA 3CZCA 4H7DA 4ZVQA 3EPPA 4ROSA 1KJWA 4LXQA 3DBHB 4BFTA 1T24A 2RHHA 3SC2B 3H5AA 1Z0DA 4KIWA 4QUGA 2B30A 4RIGA 5FAXA 2OECA 4CFZA 3A25A 1K7CA 1TVEA 5HQJA 2GCGA 4G5SA 3RS8A 2YFYA 2V9PA 1SUIA 1ULSA 4CVNA 1PD1A 3VU3A 4MKRA 4LC9A 4PYKA 1N5JA 1P2BA 4Y6RA 1WHTB 1JILA 3WQSB 3ZXXA 5BSMA 4H27A 1SXJE 4D5EA 3MJSA 4DCCA 3H5OA 4AT1A 3ETGA 3ZV3A 5JBIA 3Q7QA 2WJJA 2C2XA 1EE1A 3GLHA 3PUKA 4KNWA 2I7XA 5DT9A 2JFUA 5JJBA 5LYYA 3E70C 2NYVA 4R2WA 3AUUA 3AXSA 4MS1B 3P4YA 4OFZA 4AIIA 5C7IO 1H2EA 1HTTA 3HBLA 3DVAA 2R1VB 5EP3A 1HT1E 3D8RA 4OF4A 4A27A 4HQKA 4CKEB 3AGQA 3ET4A 5GJWC 3FROA 4DLSA 5JHHB 4RCZA 5KYTA 4H6PA 4AJEA 1DI0A 2P3LA 4YAOA 2GN4A 2V8OA 3JQ8A 1M2HA 1PV1A 3DHNA 4KBGA 4ESOA 1TOAA 4P4NA 3TSCA 4G23A 4GR4A 3QI2A 1UEJA 3Q8LA 1V39A 1STOA 1V25A 1QHHA 5TPWB 2O8BB 4D26A 3PGXA 4Y2JA 3W8RA 4DQXA 3FUXA 2OV3A 3M1LA 1GL7A 2VHVA 2KW5A 2HK9A 3HJUA 1GGHA 1R4NA 3G02A 1I2DA 1TU3A 3RC1A 3N2KA 2FWNA 4Q0MA 4R3WA 2HK7A 2BFDA 2YOHA 5B1DA 4YRFA 1TADA 1UIMA 3EQ6A 2HB6A 3D7SA 5K3SA 3SDSA 3W77A 3RUDA 4CR6A 3P9RA 5KSZA 1S2OA 3BRWD 5D8DA 2WPDA 2RAVA 4EW2A 1X9IA 2G82A 3RHZA 1Y3FE 2RARA 3MGAA 4M9QA 5KSYA 2E7ZA 1OU0A 1DDIA 1V16A 2WYHA 2XYQA 5KQPA 2QMEA 3LDUA 3QVOA 5REQB 3X1XA 2IEAA 3ZK7A 2Z9CA 4GECA 3WLOA 1FNBA 3AF0A 1EFVB 3MS4A 4N8EA 3DOUA 4B4VA 4U00A 4QGGA 4DV5B 1JA1A 3AR8A 2ONJA 3A7DA 3V8NA 1NRJB 2PUAA 2F3SA 4H60A 1VL0A 4MVJF 4M0KA 4C6RA 4I5EA 3EGDA 4O8ZA 2LBPA 1J0BA 1XZHA 1JKJA 3MWLA 1H6DA 4U6NA 2CKMA 1XLUA 3GLIA 2GYVA 1A5SB 1SVSA 3RO7A 3A7EA 2XE6A 3CZAA 4FYMA 4HGQA 4K5QA 2WTBA 3IP1A 2V55B 5LQMA 1OA1A 2EX4A 4P92A 4H17A 5FPHA 3SFTA 1O6BA 1QFYA 4RW0A 4WTOA 4EB6B 4OYLA 2AE1A 3ZGNA 2WU4A 2OLEA 1ISGA 1GPAA 1ODIA 2Y6VA 3I52A 4GXNA 5FFNA 4LJ8A 1V3TA 1DQRA 4JOQA 2GCEA 3GNQA 3UT6A 4PN7A 1OREA 3T61A 4YMIA 5JZ9A 1CUEA 2Q49A 3AOEA 3MG9A 1I2MA 4KVAA 4TMZA 2FFBA 3ACCA 5B6PA 2G07A 1HLFA 4BEWA 5FV7A 4NPHA 1D4FA 2NU9A 4QECA 3W4JA 1A9QA 2W43A 2BR3A 1II0A 2HCFA 1YZ3A 2VP3A 2VN8A 1Y7HA 1N0WA 1SOMA 1PP4A 3I9FA 1NV8A 1DOHA 4IDHA 1BE1A 1V95A 3MN1A 1FQKA 5M2QA 1KY5A 1IXRC 3SVLA 1XTSA 3TQTA 3WYGA 3MOSA 2XXAB 4GLFA 3WWYA 2CK3A 1WCIB 5AOBA 3GLFB 3F3KA 3O4RA 3UBMA 1BWPA 1H93A 2WUGA 2ZSAA 3OZTA 3PG5A 3Q7EA 4JJ7A 1O8BA 1PFYA 3CBQA 4PE5B 5IDVA 4AJPA 4R9UC 5LNK6 5LD2B 1PFKA 2W6JD 3DAGA 4YQZA 2PL3A 4O4JF 721PA 3DE2X 3CW8X 3JU3A 3H8WA 2F4VB 1FNCA 2HRQA 2X9QA 3EF1A 4HG2A 1XRJA 2PUWA 4OHXA 4QODA 4ZVSA 5T4BA 4E09A 1E1MA 2Z8ZA 3CPSA 1KQFA 1JG7A 2M6KA 3U44A 4PHCA 2X19A 4DR7B 4PNZA 1RPTA 3D31A 1BDBA 3H11B 4RMIA 4REQB 4TWAA 3WOVA 4TL9A 1PX0A 5FX2A 4YJFB 3K0SA 4V24A 3G7NA 4OQDA 5CA1F 1A9YA 1ONNA 1II9A 1RWXA 4TKUB 5CIWA 4ZT3A 3V46A 1IHPA 4MDFA 1GN9A 1Z6AA 2BFBB 3TSWA 1PT7A 4CLXA 1Z45A 5FA8A 5EE9A 1ZMTA 3VA7A 3EIUA 4LXHA 2QRVA 4R0VA 3SOZA 2AR0A 4JQSA 1FU4A 3PEWA 1RRPA 2H2FA 2VTKA 5IXSA 1K3UB 5DM70 2PQ0A 4WH0A 4PC6A 1MJHA 1KSJA 5JXGA 2N47A 5HE9A 1QH8B 4NYMR 4OQLA 4D4IA 2J9FA 2DLCX 3DC2A 4M6WB 5U4XA 3BRQA 5AW9A 3R76A 5D6OA 1RMYA 4WN9A 1FE8A 2XD9A 1OB5A 1NLZA 5E2IA 2HRDA 5EHZA 3Q5DA 2PAAA 4CMHA 3MBKA 1IXSB 3U3ZA 2H4FA 1EX1A 4DV1B 4R6WA 2BIFA 3RVNA 1H2BA 4NXMB 3NORA 3IYLW 3QKTA 4WV3A 5BSEA 5CCBA 1YRLA 4A16A 4BVJA 5KYXA 2IWHA 3TKYA 5BXQC 1D9ZA 2ZIAA 4AAYA 2GT1A 2WMYA 1ZY2A 1S1CA 3C3EA 5LXTF 2R1UA 1VI2A 2VK2A 4RF3A 4ER3A 3TM4A 3I9JA 3DQZA 1LVGA 3Q0TA 4IXDA 3ZTYA 2EZ9A 4CT5A 5I9BA 1ZONA 1ZM4A 2H2HA 2YC2C 3AJAA 1S5PA 1GZ3A 5CLIA 3QLVC 1TRHA 4IKEA 4BGEA 3P9IA 1LU9A 4G1EB 3PVCA 3RVJA 2GFHA 2C2YA 4D1YA 2TMYA 3NHYA 3PZBA 4QUHA 2JRCA 4JBYA 4GX0A 1FFXB 3GFBA 3H9JA 4A8JC 4GAEA 3INYA 4FI3F 5HFAA 1PR6A 2YIVX 4EMBA 1IIRA 1PJCA 1M67A 1Z0IA 4N8SA 3HA2A 5LDGA 1E59A 1ECPA 5JJ5A 5TQ0A 2EJVA 3PE6A 2JCXA 4D45A 1UFOA 3FZEA 3T95A 3KDSE 2NM0A 2XVMA 4IOKA 4OQ4A 3WL5A 5A04A 1JVBA 2UXDB 5KTRA 4DQUA 1BWQA 1ELOA 2OFWA 2QNBA 1JJBA 3DBRA 3LWNA 3ZIAA 1MB2A 1YKGA 2MINB 1FSZA 1P4RA 5I3ZA 2PMEA 4KR9A 4CM1A 1QH0A 4HUJA 4EFMA 4ZAVA 2HJSA 3UT0A 1FP7A 4UOZA 3JRWA 3BIOA 3EQ7A 2CE7A 1TUIA 2HQOA 1MHPA 1NA5A 2J09A 1ETUA 3L82B 1C9EA 4H1TA 1C8BA 3R7NA 4EHHA 4UOEA 5IXYA 1QE5A 1QIDA 5IH3A 3TGPA 4JLWA 4EO9A 2H1RA 1P2DA 4HDOB 4L9SA 2NO5A 4NBVA 4LYYA 2QN9A 3RFTA 5KKNB 5G0VA 3MB8A 4YQYA 1J2RA 4DLRA 4E33A 3N7TA 4NCXA 3DTNA 3HBFA 1IZ7A 4JP8A 4UM9D 4Z7OB 2ABWA 5HKAA 4KSCA 4ZVVA 1SUAA 1BXRA 2P9YA 4JASB 1ZK0A 4Q05A 3W3AD 3EA5A 2QJWA 4M2LA 2I99A 4RPHA 2Z58A 4Q3AA 1U4OA 2Y4NA 3N59A 4OLHA 3H5NA 1AKWA 1KARA 3DZBA 3K4HA 5AHWA 3BXGA 4LK3A 5JNRA 1MBZA 2QMQA 3HN7A 5HKKD 3VNUA 1NXPA 2OUKA 3H5WA 4M7OA 2OYCA 2PSEA 3W3ZB 4BEJA 2ZU0C 3F9IA 1IVNA 1V8BA 4G85A 3SC6A 1E7QA 2CNBA 3A37A 1QRDA 3A3KA 4RD2A 5J23A 1EINA 4JT8A 4D9EA 4NCKA 1ESDA 3OCUA 4CHGA 5L6MB 1F8UA 2DFVA 3QFFA 1OPXA 4W5OA 4M53A 4QLBA 4R1QA 1EVZA 2RKWA 3EMVA 4DBZA 2JLWA 1S02A 3NU1A 4MUXA 5IUKC 4HDKB 5J47A 4JLVA 2OORC 4KMRA 4LPKA 2BAGA 2Z2YA 4X24A 4Z9YA 1H2HA 4XH9B 3PT9A 4EX6A 2QN7A 3A4LA 1SXJB 1BE6A 3K8QA 4LGYA 1LK0A 3RYHB 1AXGA 1MAVA 3H4TA 3HCWA 1SCUA 2PGXA 3B6IA 4Y1EA 3ZTWA 5EJ4A 1BA3A 3AVVA 1NVMB 1R16A 3V33A 2C31A 1FMTA 2G1JA 2IUEA 1A8SA 3BH0A 3PQFA 3VBEA 2AF3C 1ITZA 1P7ZA 2HIHA 4AO8A 8ADHA 5EL0A 2A1UB 2RJNA 3L7CA 3MUEA 1TJ3A 3EZ9A 3AR3A 4RC9A 3WYCA 2PCJA 2C5AA 2G4CA 3A1UA 4AY2A 2KJQA 3EZYA 1YVEI 3N2KB 1VE5A 3AKEA 4L16A 2X3UA 3VPBA 1NTRA 4D6YA 1E9BA 1LWNA 1GLGA 2UZAA 4C03A 1HLPA 4QQKA 4J3JA 4AF6A 3F5SA 1TW2A 2POCA 4O2AA 3TGLA 4RZ3A 1QNFA 3A6LA 3QVMA 3PSAA 2FQWA 1CJUC 3I09A 1T43A 2D2XA 2QRUA 4ZK6A 2J0UB 2EWMA 4PSDA 1M6EX 5I7OA 2WHYA 2JGFA 4OXRA 3S70A 3GD7A 1ZN7A 2P65A 3L1UA 4FZ5A 1YJ5A 4OQFA 1E1QD 1NLMA 2W2LD 3K20A 3AHFA 4XIYA 2IUYA 4CNQA 4CTNA 4ZU1X 3NBUA 3E2MA 3HEAA 4FGLA 4BNZA 5IG2A 1C9DB 2ZIVB 3VXKA 2C7BA 3I2HA 3WWDA 3TXAA 3V9PA 1RIIA 1ZVJA 2GNPA 2QUAA 2ZT6A 4UC0A 3PS9A 1N6RA 4HLCA 2PX2A 1KP2A 4RELA 3GLIB 1KGDA 3CZ4A 1KIFA 2JJ8A 1EFCA 4IH4A 4QU0A 2QTCA 4HKTA 4OBBA 2EV9A 2O5CA 3ZEAA 2ORWA 3LP6A 3L0BA 1E9CA 3DXZA 4IIFA 4G01B 2H17A 4EY5A 5M34A 3NHFA 1A9XA 3ZU2A 2Z30A 1ZDMA 1RSZA 1IIBA 1RZVA 4FSXA 4IRUB 4DLBA 4O3MA 2O19A 4IINA 4AF7A 1X7GA 4Q02A 1NBOA 1XQVA 2HJWA 2UVPA 3QUBA 1E9AA 3CM0A 1FC0A 3AEYA 3MOGA 4YAUA 4U39A 2PXCA 3KO8A 2WM3A 1ODJA 2QP4A 3GLVA 1ZP6A 3KCNA 3LC2O 4RVFA 3YASA 3R3JA 1XMXA 5CB4B 1T9ZA 5EHNA 2BGMA 5FNVA 1OXKB 3IL2A 3O73A 3L0PA 4ALJA 4HH4A 1K86A 2IY7A 4MYRA 4FQ5A 1LB1B 3TBFA 1SPBS 1QANA 1RI4A 1YC2A 3P0RA 3NATA 2D5BA 2QGZA 3D1VA 3N75A 1S89A 1FDOA 3RT1A 2UAGA 4DY4A 1ADFA 3G2MA 3IBYA 2VXYA 1OA0A 3EGWA 4OOFA 4QEZA 4YCCA 2Q6IA 3N9IA 3EGCA 5LBIA 1GGJA 2JW5A 1L5MA 3FOFC 3C7KA 4MVJM 4RJTA 2MMCA 3L8EA 2GN2A 2W70A 3HCPA 3U4MA 4GNKA 2JVJA 3DA8A 1DSSG 4ZVOA 3WRYC 3COYA 4V1CB 2OZLB 2JI8A 1MW8X 4YMLA 3UO8B 4IHQA 1JDBB 4YAJA 3HZRA 5REQA 3PQCA 2HCRA 2Q2NA 5DGHA 4EKNB 2W93A 2H1VA 1W6UA 1ODCA 1BIFA 3GEHA 1I8TA 3P2IA 3PXDA 1E1QA 2GUWA 2W2LA 5AKXA 5EE1A 4B71A 3C7DB 5DXJA 4B17A 5GZ3A 4M8LA 5AVRA 3MT9A 3TVYA 2W0SA 1TKAA 3RYFA 2G9QA 3TK1A 1Y42X 1WW3A 2BFBA 1TCCA 2ATEA 5JAUA 4JUBA 4MUHA 3DFUA 2J9ZB 4IIJF 4ZVPA 2R7KA 3L7IA 4IWYA 2PMFA 5CVCA 3V1NA 3VHLB 3KHSA 2JCGA 4KE9A 3G0GA 1YR8A 4TTTS 1MJGM 4UASA 4WEQA 2XNHA 1Q1GA 4HVAA 4AMYA 4MPPA 5DLQC 5IAKA 4B73A 4F1JA 1PQPA 1MGPA 2R751 3BT7A 1WHTA 2DJ5A 1UAYA 2JATA 1TTTA 2NMVA 1L4GA 1OW3B 1XI2A 2R7NA 4NYIQ 5KDLA 2OHHA 5L7YA 4ETMA 1V6AA 3V2UA 3RS7A 1W4AA 5KMGB 5LXTB 4ZDKA 3KT8A 3NTLA 3STHA 4D8XA 3IDAA 3D02A 2GPNA 4QXMA 4YCMA 3WIEA 3Q8WA 4OQPA 4MS1A 2H7CA 1I5OA 1Y98A 2R00C 2M1ZA 4GH5A 1L5YA 3WGJA 1N6NA 1MLDA 4AF8A 3AVUA 4RDIA 5C5IA 4RZXA 3X2FA 4LCJA 1F38A 2IZ5A 1W25A 2DY0A 2WFLB 4ENUA 2I4IA 4HFJA 2O2XA 1KDTA 3OFSA 1RC1A 1EFPA 1NQUA 5BOSA 2GSDA 2WHRA 3G6KA 1AKUA 5D85A 2ZRHA 1TMGE 3OM8A 4J8PA 4XIFA 3EBLA 2NU7B 1V71A 4GM4A 3S2GA 5AIAA 5K1ZA 4Q01A 2H2IA 5TRTA 1ADCA 1YVUA 2OYSA 2Q5LA 2BKAA 3PWSA 4KAJA 1C4OA 3DOCA 4HZUA 4KVZA 5FBRB 3SKVA 3W2TA 4KXLA 2I2AA 3LGSA 2DFNA 1MFZA 1P6UA 3EOBI 1UWKA 4KWIA 4MQFB 5HCUA 3VX3A 4KH1A 8AT1A 3AVXA 1QZZA 5J4VA 5JAMA 1QFZA 3S1SA 1EK0A 2QAGA 4QOHA 1OZ0A 2C96A 3L0OA 3L8FA 4AY6A 3K1ZA 1KWGA 3WK5A 3C1UA 4XYLA 4HHEA 4G1CA 2FR0A 1G8PA 5KNBD 2H5LA 1T9AA 3NTVA 3OEWA 4HTAA 4IF6A 2BD0A 5E9QA 3KSBC 2W90A 3UY4A 1KI4A 3KQMA 4HLNA 3ROFA 1BCSA 2Q1TA 2ZBFA 4L85A 3H11A 3AF2A 1JHVA 4HGYA 1GZ6A 2BJWA 3O9ZA 3DBVO 3B8HA 1BCRB 5DK6A 1EQUA 4K1LA 2WYOA 3CISA 5HZHA 3LT1A 4KN5A 1R18A 3SX0A 4D8VA 2QD4A 4DMLA 1HT3A 1QP7A 2VDKB 1F2UA 4JLUA 1CUUA 2AJ8A 5IJZA 4DPLA 2Q8PA 2RHBA 3QPWA 5DHRA 1UR5A 3O03A 4C4XA 2XMCA 3A3NA 5IZ4A 4UM7A 3KYDB 3KD3A 5A5EA 4Y2PA 2CWWA 5JO0A 4ZAZA 5G02A 1QIMA 4AW9A 3BE8A 4I1OA 3OEHA 5EZYA 1J2YA 3S44A 2WNIA 1ORRA 2PWAA 3T7IA 2WSBA 3BWMA 3WWEA 4PW0A 3PD0A 4EY7A 2GN6A 3SSMA 1W5SA 2XRMA 1QWOA 4G1FA 2YWHA 5GP1A 2IDZA 4EJSC 1ZLXA 3G9XA 3KUUA 3NC0C 1KY2A 1UPUA 2J4DA 2AKYA 4QL3A 4ZOLF 2DT5A 3TLAA 3KAKA 1CR4A 1SU4A 2HV9A 5DH9A 5EXXA 3JYNA 2A5DA 2OY0A 1CQJB 1D2AA 4ZEWA 2IHZA 3WDMA 4CF7A 4CJXA 2NZWA 3ZDQA 1I7PA 3K9HA 4XGIA 3PLAE 3QFSA 2EX1A 2DSTA 2GAFA 2VH5R 1P2UA 2WKQA 4J7CA 5AI4A 1IWBB 2G80A 5BR4A 2OXRA 3IALA 4I5GA 2QRKA 3RF6A 5TLSA 3D4IA 2J7PD 1UOEA 3AOGA 1YQQA 2QYHA 4MW9A 3JQAA 5EHXA 1N1EA 4PYLA 3I01A 2DECA 3CLHA 1Q1AA 3NHWA 2V6MA 4HGPA 4DVJA 3ZLJA 3OM9A 2JIBA 3KJFA 2RG7A 2PNJA 4UVDA 3W6ZA 4F8JA 2XDQB 5K8VA 1E3MA 1AUOA 1P7PA 1Z6PA 3QVJA 2G70A 1EVEA 3QIAA 1LC0A 2PUEA 2J48A 3FA2A 1QGOA 4I2NA 2PBFA 1U7XA 3E7XA 4TLEA 2GEVA 1XRQA 4GC9A 1A9XB 5AI5A 2EFCB 1OWMA 2H00A 1CZLA 3G0HA 1J5EB 1E94E 1PT9A 5CX4A 5FUXA 4CTJA 3PNLA 5EFZA 4BEVA 3KSRA 2KI5A 4H35A 4UU1A 1BOFA 1YB5A 1GZVA 2H6EA 3QFTA 1GNQA 2Y0EA 5E7MA 3E18A 4MO9A 2RGUA 4DL9A 3ENVA 4PZCA 3UQYS 2WF5A 3FVVA 4FBLA 2H4JA 3SF0A 1J9ZA 2G83A 1USWA 6Q21A 4Q9AA 3JAKA 3DBLB 3PC7A 4INJA 5CU7A 2J8ZA 2R2GA 4GE3A 2ZAIA 1AHIA 3DAOA 1FUKA 3L79A 4QGHA 2JFVA 3H3XA 3G2OA 3LCMA 4WINA 2IYFA 4F6CA 1MA3A 2B8WA 3EHDA 1XC7A 4G26A 3PQ2A 3GPBA 3QNWA 4MMXB 5CDYA 1BTOA 1AY0A 1IEQA 2ZDQA 3GB9A 1E1RA 3MMPA 4KKVA 1UJ6A 4TLDA 3G1WA 5KZMB 1KF0A 1DIGA 4MS4A 3L7DA 2BWJA 2IXAA 4K9QA 2OBXA 2QMUA 4S1TA 4DQVA 1QF6A 2CLSA 1P8AA 2VRCA 1ENZA 1QPGA 3E9ZA 5AO9A 4QATA 3C8UA 5EE5B 3DS8A 2OC9A 5HS6A 3K0CA 4KO3S 5ICFA 1O0SA 4B76A 5JI3E 2EW8A 2X7JA 4J94A 4LF6B 2XUHA 4PONA 13PKA 3T4EA 4ENTA 5AXAA 3FWZA 4RE6A 1UZMA 2O1EA 4DRYA 1ABFA 1FVFA 3NDBB 1QOZA 2V5UA 4OP3A 4B82A 1YZGA 5BSKA 5HVNA 5KVVA 1UKYA 1P0IA 1XZFA 3C70A 4KTTE 3T4UA 1X1CA 1XWIA 3HA5A 1NNUA 4DCGA 3HU1A 2Y0DA 3G5MA 1THTA 4LBVA 1T8WA 4Q37A 4RS3A 3GF4A 3O4JA 4ABYA 1GUBA 2VQDA 3O2JA 1CS4C 2B3DA 1H8ED 3DTVD 1SG9A 3PB3A 1RRCA 1UKZA 1GGKA 2J5RA 2PT9A 1O77A 7REQB 2XGMA 1XEXA 2AOTB 4XQGA 3RB8A 2PMKA 1OHHA 2P8SA 5KS2A 1RQPA 4HQNA 4ISCA 4K9KA 3RTBA 4W5RA 1XZ8A 1B6TA 2VSQA 1A76A 4M9UA 4F06A 1H4SA 5IVHA 1DKRA 5AI8A 1YRAA 1V37A 1CRZA 2EEZA 3GZTB 5EWJB 3F1LA 2GCOA 3SZ3A 3S0JA 3UJBA 4YWHA 1NTOA 1G66A 4L3VA 1QKKA 1KTIA 3COZA 3Q40A 2ZITA 1GPDG 3HDVA 4N8DA 2H48A 2H8GA 2P5YA 1MOQA 1PV2A 4PC2A 3V2GA 1ACJA 3OLZA 1J8MF 4FM9A 3QX3A 5JNUA 1N25A 2O2DA 4R8MA 4PTYA 2EBHX 3IMCA 2R6HA 2ZQYA 3ZHVA 3MTDA 1ZVVA 2V58A 3NKVA 1U31A 1D3AA 1RLTA 1QDUA 2FF7A 3ETEA 4Q9KA 4EHAA 3U4HA 1DKUA 1Q3KA 1J6UA 4GPTA 2QAJA 4JBHA 4WY8A 2QZSA 3T9CA 1Z16A 4CU2A 4X1KA 2OBLA 1KMHA 2NSJA 3E3MA 1TM2A 1YDHA 4LKRA 1U1DA 4ZEXA 5I7RA 3MINB 3G2IA 3G0BA 5AOAA 5EZ6B 1SXGA 4QG7A 1Q95A 5JFTA 2IYZA 3E9YA 4P3NA 1YB7A 4IRMA 4CODB 1OI2A 3FRJA 5G0SA 1EXDA 4Y7CA 2O23A 3PFNA 4ZOAA 4LPSA 4D9JA 4DN6A 1VI6A 1Q1EA 3AL2A 3IOBA 3EC1A 1ZMOA 5LA6B 3N87A 4TZ0A 4NENB 2WHPB 1GP2A 3D3KA 4M76B 4Q9JA 1UZLA 3KU1A 4WXEA 4XOIA 3FNBA 2FMHA 2FW0A 1Y6GA 1I01A 2P2LA 3T7CA 3CZQA 3RABA 3WBKA 4WNCA 3WHLA 2BM8A 4TVKA 4F86A 1UOOA 3PX2A 4P3KA 5EKTA 3R7WB 1YIAA 5FNVB 3F49S 1UANA 4OSEA 4RHFA 4X20A 4Z54A 1F4PA 4X8HA 3ACDA 1DBIA 1Q3TA 4UHFA 3NHLA 3VPHA 3TPFA 2R60A 2WQ7A 3T9FA 1L4MA 3HWX1 4O3FA 3DL7A 1IG0A 5BYBA 4OUDB 4W5QA 4PSCA 3RF7A 3NUGA 3M70A 4X71A 3UENA 1OH7A 2DBRA 2N46A 3ILHA 3W1EA 4FE7A 4MDHA 3BQ9A 1WCV1 3LUCA 1YAJA 4KWCA 4XJVA 3P45A 3C1OA 1AZWA 3HVJA 2YJ6A 1SQ5A 3H5VA 4CKWB 4FGZA 4HP8A 4KWHA 3NYQA 5ALFA 1WCYA 3TI9A 2DH5A 4N3GA 3SIRA 3H1FA 3GFFA 1JSLA 1ICEA 3NBKA 4UREA 2YZMA 4RK7A 4E51A 3MTIA 2WB2A 1U8TA 1A9TA 3F71A 3TKAA 3NAGA 2W7TA 5EN4A 2HMVA 3MNFA 4JUIA 5HDQA 1KY4A 1NR7A 4J9VA 1KGSA 3GJRA 4IIDA 2W0MA 3EZ7A 3MB5A 4A6XA 1SXJD 2P9HA 4Q9IA 4EDHA 4DT1B 5JWOA 2G5TA 1ZSNA 4Q24A 3THYB 1NT4A 5LZ2A 2HF7A 4D79A 1TJ5A 2LIVA 2W58A 4BQPA 2IIPA 2WSLA 2ZJ1A 2H11A 3IXMA 2HWUA 4RKEA 2ZP1A 1SKUA 1R37A 3ONDA 1WBBA 1J0AA 4NK4A 4Q6BA 2C04A 4P4LA 4FMBB 5AK0A 5FP0A 1N5RA 1PIWA 4M38A 3SICE 5HUHA 1OH6A 1H2ZA 2V96A 1P3Y1 3KYDA 1K66A 3L4BA 3VKWA 1RAEA 1Z7YA 4YHBA 4FFMA 3OX1A 2YC4C 1QAOA 2D0PB 1T2NA 4HNAB 3IMEA 5JS2A 3NEPX 2I1LA 5FUQA 5EQJB 1KYXA 3RUEA 4NU8X 3TLMA 1CJBA 3C5HA 3HI6A 1RYYA 1VPEA 5WRFA 1R8QA 5DN9A 3ZOKA 4DRZA 3KDAA 1UMDA 5H0IA 4HWSA 3C4VA 2ZYTX 4JB2A 5AK5A 3QOFA 2XB9A 4MR8A 4MTCA 3EFEA 5DTIA 3R75A 4KG7A 1XAHA 1F6WA 2RHDA 3ANYB 3DNPA 3QWAA 3SSNA 2XHZA 1ISMA 1CP3A 1QMPA 2BFCB 3BE6A 3RTGA 1F0PA 3M5CA 4ALMA 5BOSB 3EIEA 3M81A 1D03A 3N5KA 4ZRDA 4D02A 1J1IA 3UJ7A 1LTKA 2QQFA 1DCTA 1QC5A 2FRXA 5CX1A 4P3YA 4K3UA 4TSFA 1J99A 3SCZA 3VZCA 5TS2A 1YFLA 1SKMA 3N8GA 4F8EA 3WLHA 2B5VA 2H2AA 4KEAA 4LW8A 1IMJA 5CT6A 1REQA 2FR8C 3ESAA 5GZ6A 3UOGA 4EQ6A 1ZIXA 1G8JA 4K9SA 5CNMA 1UM8A 1EPUA 3MWDA 3BMNB 3QPVA 1HO3A 1RPZA 2NZJA 3FZQA 1F60A 3OAAD 4IYRA 2HUNA 4LCEA 3SXPA 2FPGB 3AFOA 2PQMA 5K2OA 8OHMA 1EJ2A 1NOJA 1Z7BA 3SJBA 3RFCA 4BO7A 1PFWA 6ADHA 1VRVA 1N2EA 2HGSA 3TX6A 1QJCA 1EZ4A 2YBEA 1E2IA 4RFLA 5BWOA 4EPWA 1TO2E 4PZ9A 5CCXA 1G9TA 2IF0A 3SIPA 4JI2B 1J2EA 3JZMA 3IEPA 3VPAA 3ZEIA 1BQ4A 5KTTA 1T15A 4XQCA 4OFXA 4ZV9A 1K0FA 4KGZA 1ULHA 3PQDA 1EFLA 4KL8S 4RVSA 4Z0HO 1M3SA 3U48A 4CIDA 5H5JA 1QFXA 3ZLUA 1SNYA 1JG3A 4RVCA 4IFBA 5CLLA 4DCMA 1WXEA 2ZPAA 2ZJ3A 3E5RA 4PGFA 3K71B 3E58A 1K88A 3T41A 3WZ2A 4MHOA 5BWCA 3UEOA 2X6RA 3GD5A 5DNDA 2H2GA 3KXDA 3DE1X 3OE5A 4I6JA 5D3QA 3BTVA 4UAGA 1L4UA 2QPLA 3R0XA 3CBGA 4KI0A 4MVJP 3ZN2A 4CKZA 2E1RA 2PX8A 1EWRA 1SD1A 3B70A 4LHXA 1U98A 2CHFA 4FE3A 2B36A 3QRWA 3KOMA 4ZYTA 4FIDA 4ETWA 1SQGA 2VHQA 5DCWA 1NJ6A 2WM2A 4R8VA 5CFNA 5KQLA 3DEHA 3ITDA 4GPEA 3R7FA 5K0NA 4ND1A 4E13A 5EWJA 2FFJA 3PF9A 4DM3A 3HB5X 4YRKA 4PQRA 2INGX 1SA0A 1A7KA 3NIBA 3STXA 1TGVA 2E21A 3G23A 3H2JA 2J1LA 2B2NA 1RXUA 3C98A 4HWKA 2PKCA 3D43A 2A0KA 2Q6VA 2YOFA 1B76A 3L6CA 2EIHA 1H6BA 1NRIA 3AF4A 3PT5A 4XWGA 4MR7B 1OLOA 2HAEA 1Z4JA 1SK8A 4J16A 1KXJA 1ZN2A 4K46A 4D57A 1EVIA 3WQQA 3CGWA 3WO1A 4F84A 5AJTA 4YO8A 3OCJA 2GEJA 4DMHA 3GQBA 4IL5A 3MQ4A 3BB3A 3AFIA 1MQAA 1T26A 2F1RA 4NICA 4FDTA 4NZYA 4ZO8A 1EX9A 2G28A 3WZMA 1H5QA 2VF8A 3M6FA 4E5NA 1EWTA 2FEKA 1WP4A 1X8JA 4IF4A 3DMTC 3NTRA 5C3UA 5SY6A 5KWIA 2RCNA 4QSMA 2MYUA 4MMYB 2OGZA 2G88A 2GCNA 1LBTA 2V74B 3BIWA 3GN1A 5J58A 1TGYA 2O1SA 2LCFA 2O1XA 3AESA 3OZDA 4G36A 3C6YA 1XTUA 2CHGA 1SUSA 4IUDS 2FG5A 4U6QA 2C4UA 3VZSA 2XTAA 3C41J 4FDMA 4HGOA 5DNEA 1DRWA 2FETA 2VZ8A 2FFRA 1A9PA 1XDUA 1BCRA 2RJ3A 1R6BX 3K35A 3DZIA 1QLJA 2NQ8A 3Q98A 3KWFA 1CWUA 1QCZA 2H8KA 3EA4A 1XX6A 4Z49A 4P93A 2YYZA 4HUTA 3BKXA 4KOAA 2CV0A 2PZLA 1JSZA 1OAKA 4R1TA 1DXOA 1U1CA 1LF0A 1KMNA 2WTNA 3VPFA 2WVHA 1VSBA 3IEMA 4TM8A 1EWVA 1F3OA 4ZXPA 1YHNA 1EM8A 3HCFA 4JS0A 2A1IA 3KQVA 2O8FA 1IHXA 1WDTA 1JKJB 2Q62A 4S1VA 4U6SA 3I5XA 4LJYA 1SULA 2MSKA 1HBJA 3HU3A 2FMFA 3TQCA 1YS2X 4TUYB 4QBGB 5HFJA 5AHXA 2GPSA 4C05A 1LGYA 1Y1PA 2Q07A 2ZVPX 3MHPA 3N8DA 1E7YA 2CMFA 5ULLA 5FLYA 1JQJC 2B4RO 2DR3A 3P9XA 2O52A 4CM4B 2XI4A 4N82A 2BGRA 4X1IB 3BZWA 3UM9A 4CDNA 3N74A 1DU4A 4I6EA 5JNWA 4DLPA 2W4QA 2GK6A 3UWMA 2ZTVA 1LRJA 2NZ2A 4HJXA 5LL6P 1Y1RA 3WMEA 4BVLA 2QYTA 1ZR2A 1WEHA 4WCDA 3KOZA 5CLQA 1HETA 2D8AA 3R3ZA 3CX6A 3N2GB 4MRMB 2HM7A 3ORRA 3PGKA 4HYTA 1BWRA 2G4LA 4HPXB 2NVOA 1HC7A 4F3RA 1G5PA 3GZ4A 1VJDA 4L51A 3BCSA 3TWOA 3TW6A 2DFPA 4Z99A 2D0DA 1SFRA 3BBLA 2ALJA 4IFEA 4P5DA 4A8JA 4P0PB 3LLUA 3L6RA 3EN0A 4I3GA 4TGLA 2WWHA 4YT8A 1BYIA 3EGIA 3SR0A 4OMFG 3FWPA 3B6KA 4II7A 3WGMA 2HK8A 3C3JA 1T6XA 1V5EA 1AB6A 1YJQA 1T2DA 1V7CA 1XTBA 2N1MA 2GZSA 1IY1A 3KCQA 3NYWA 3O92A 2V1XA 3ROMA 1L4KA 1QHFA 5JUWA 3JALA 5T6BA 2QLNA 1C0LA 2ZJ2A 5AOCA 2XLBA 4ARSA 1DAKA 2Z5VA 4AWBA 3DNFA 4FYYA 3WGIA 2OZVA 3PRKE 4NCNA 3OLQA 3FCAA 3R7AA 1OGYA 4WOPA 1CLUA 4B8WA 1S2GA 4HB3A 4MROA 5F78A 3W2IA 3G2LA 4H31A 3WJ7A 3RS9A 1JNYA 3ZCSA 2GAJA 1SOWA 1E1CB 4COKA 1EWQA 4IHKA 3ORYA 1P7CA 1P4AA 4UD6A 1OZFA 2JAUA 1GU0A 2R4QA 2BTOA 3COWA 3K1TA 2AMYA 3HPRA 4MW1A 5I8PA 1FRFS 5KVQA 1QU2A 1UBEA 1NFRA 3AF5A 3G2JA 4RTMA 4ZC8A 2I80A 5DCYA 7ABPA 1TQHA 3V8QA 3U4DA 4RM2A 4UMDA 4XKJA 5J5CA 2Q4DA 2MYPA 3WYEA 3PYLA 3RANA 5EUBA 1BW9A 4C7XA 2FPIA 3FTNA 1MHTA 1E0JA 5BW6B 1UWCA 3REFA 2OMEA 3L7AA 1Q0UA 2Q3MA 5AM3A 1XWFA 4I55A 1YO6A 3BB4A 2AX4A 3EXIA 4FYXA 1N1MA 4BLOA 1Q91A 4A0GA 2FE4A 4R1MA 1AUQA 3FDFA 3LUHA 2Q2QA 4W5TA 2GN9A 4Q34A 3U3XA 1AZTA 4F1WA 4CCYA 3QUQA 3U3JA 4LYEA 3V2HA 2C2GA 3VISA 4J4TA 3MLEA 1AK2A 5B7NA 4P3OA 1G5FA 2D2EA 4UVHA 3U44B 4UVGA 1RC0A 2HBQA 1PJ3A 1XRLA 4YFVA 4WKCA 4F4CA 1PTKA 5CITA 2IE8A 1N2JA 1MC1A 2AZTA 2NVBA 4POAA 1QE0A 1HDYA 3LHSA 1RPAA 4FT2A 5L3SB 1FZTA 4J6FA 5HA5A 2HXGA 3IV7A 4B6PA 3VO1A 4CHTA 4ABTA 3L4KA 4FILA 1FTWA 4RZHA 3DZHA 3BCHA 1SU7A 4RULA 1NF3A 2DQZA 3H5IA 4RV5A 5ALMA 4P4SB 3GPIA 5HZKA 1EUZA 3U1TA 1J21A 2BY4A 1U0OC 1N9GB 4B4UA 1VL6A 1RKBA 3QKUA 2UZ3A 3GR6A 1GILA 3DW1X 1NY6A 1H8EA 4HH0A 3I5YA 5A1JA 4Y9UA 1RAAA 2FMXA 1RXYA 2IYPA 3LC7O 3CKLA 3SS8A 1KO8A 1WA5A 1U4NA 3EUAA 3CNQS 2HBYA 2HD4A 4KJXA 3ZDCA 3EQZA 3RJZA 1HZZA 5IUNC 3EXG1 4OB8A 3THRA 3A4NA 4FYWA 1TECE 4YJDA 2F67A 2IGBA 1WEKA 1PT5A 4RQAA 4DILA 1FQWA 1K2WA 3WSTA 3RASA 2R87A 1XNJA 3TD6A 2ZT8A 4G0XA 4D96A 4LI3X 5KQRA 1L7QA 4ENVA 4LZOA 4QBIA 5IPFA 3OE7D 4BE9A 2PBRA 3O3NB 3H18A 2J9GA 2MSLA 1TKRA 3H1TA 3PHCA 2AR9A 5EUCA 1DRKA 1KO5A 3UXEA 4UXIA 5A9RA 2YHSA 4MA0A 2I6SA 1IHOA 2UUCB 1CNEA 2WTXA 4I99A 2DMRA 1VMEA 1NZJA 1OTXA 2E49A 4BBZA 1JEYB 1NMZA 1NW7A 5BY2A 5K0ZA 4CV0A 1HSZA 2O54A 5LA6A 2P1ZA 4L27A 2WIJA 3MS2A 4OBXA 2XA1A 3HR4A 2BMDA 2G71A 3OCXA 4NKRA 3B89A 2PL1A 2QX7A 5JAIA 1A95A 5HK8A 3F4LA 2QUBA 1Y7PA 3W9YA 4MNTA 4MGEA 5LLTA 3QXCA 4JWKA 2HSDA 4B8YA 1PGQA 1XCOA 4KQEA 2Y99A 1EUCB 1EYZA 2Y1FA 1ST2A 1XXHE 1AF7A 2P79A 1IWPB 1K27A 4B3DA 1Y6FA 2JLZA 5CBPB 3ESZA 1AT1A 5D3ZA 3GRVA 1DEAA 3OHSX 4J0FA 1K8RA 3VQTA 5BYAA 3Q41A 5EJ8A 2AFIE 4IX1A 2QI9C 5MN5A 1V8ZA 2CMGA 2X7HA 5AM1A 3DXXA 4W9MC 3FN4A 1K4MA 1I32A 1Z8DA 1XN1A 2WSSA 4F4FA 4LHSA 4XPIB 2JLYA 4Y7DA 1EMDA 4DQKA 1J8YF 5DNUA 2FSGA 2Q0HA 4U7GA 3SEQA 3KS9A 4X7RA 2ZYAA 4S05A 3WB0A 1AZSC 3K5PA 4W1RA 3A3OA 4X84A 5EPEA 3BE4A 1UMBB 3RARA 1DB3A 1J8DA 1FA9A 4KIUA 4G5XA 1RJ9B 1E9DA 3FOCA 3TLEA 2ZSUA 2WZQA 3F6YA 5HQ3B 1Z2AA 2Q7DA 4AICA 4O2BA 4ALNA 3L7NA 1UKAA 2FDXA 2HA4A 4MQ6A 4OH1A 5A3JA 5CNIA 4D97A 1KZ7B 5HNKA 3I01M 4BKUA 4GWLA 1N57A 1Y4UA 3REQB 4B7XA 3NWJA 3CXUA 1FVXA 3GJXC 2DE0X 4J91A 1D2HA 1ENPA 1YAHA 1UDRA 2VPYA 1L2TA 4GYWA 5FPTA 1PJQA 1SKAA 4EGQA 3SOPA 1FPQA 4UAVA 1DJNA 2PDAA 1XEWX 3G0DA 3FYSA 2QNIA 2ZXFA 4H59A 1JFLA 2L18A 4QUAA 1ZBDA 4F7DA 2JAQA 1U7ZA 1Y6QA 4Z3KA 1NR5A 4A8JB 1VKOA 2ZBRA 1ZAKA 3K6KA 4RZ2A 1WB9A 1RFGE 2WTMA 1MJNA 1E3SA 1NLFA 4MPJA 2R66A 1BNCA 4N0QA 4UKDA 3TZKA 5TQ0B 4W1PA 1G2QA 2HH9A 3EXAA 1K7XB 3FD8A 1U63A 1KVRA 2BTQA 2NTVA 1XG5A 2QORA 3GW8A 1F51E 2FWRA 3M4XA 3OE4A 4GLJA 4GZMA 1WNTA 4NJEB 5TJ9A 4B2LA 2R84A 3AUSA 5TMBA 3CH4B 4EK9A 2ZSEA 3JYHA 4X1IA 5LMCA 2OD7A 4MRNA 5SV2A 1G0NA 3CUTA 1D4ZA 3D5EA 4M8NE 3TBHA 4DE5A 5LYJB 4E0BA 1MDBA 1FSPA 3TRKA 4F7WA 4HS4A 3OCYA 2AMVA 4NP6A 4CETA 3OO1A 4DC9A 1ID1A 5IDWA 5IHXA 4F1KA 1OXXK 2DZDA 5K20A 1QC5B 1RRFA 1UPAA 3HHPA 1E79D 4AJLA 1YACA 2L0XA 1A27A 4NZ9A 4L15A 2ZTUA 2GK4A 2CXHA 4II2A 3WIVA 4FSDA 3WTCA 3ZZTA 4CPDA 2EEPA 1PUJA 2H59A 5KTYA 3WLAA 3C6BA 3OUTA 4EYEA 3O8RA 2VTDA 4ITRC 1NQWA 3CNEA 2BR5A 3LA6A 3MRSA 4KN8A 4YDHB 5AM2A 4MGKR 1T6ZA 1EAMA 4GZ6A 2EHJA 3OD5A 1AGRA 1R50A 4L07A 1NVAA 1OFUX 2HXSA 2QG9A 3BUSA 3OPQA 1SQ0A 2GYWA 3Q4GA 1BW9B 3TNFA 5JNTA 4NVRA 3SLRA 6REQB 5J5AA 4RANA 1QM5A 2CF6A 5ILQA 3NG1A 3Q8KA 3N6VA 1ESZA 1E9FA 3VPCA 3SR4A 1GG2A 1H0HA 1YMVA 3M5WA 3OZRA 4W8HA 3DYVA 4ZJZA 1Z2NX 4Y1FA 4A0RA 4YDRA 1NYLA 4ZCQA 4DA9A 1X1RA 2BGWA 2CN1A 3D0KA 3CUWA 4FJ0A 4MPRA 1PU2A 1VJTA 3MTQA 1ZO8A 1R6UA 2ZJ7A 1GKUB 1Y5IA 3L4BC 3NR2A 1KDVA 4N0EA 3TJRA 2BFPA 2O20A 4H3KB 1WMEA 2OB1A 3CEJA 3VYWA 1QHNA 1VQ1A 1Z33A 2A7XA 3BF8A 3LS2A 4WCFA 4D56A 1L5VA 2FWMX 2YWFA 1MAUA 2I6FA 4M8KA 2XMGA 1TYEB 4AMZA 4YRIA 2PJUA 4FVTA 5CXUA 1RFLA 4WNAB 4UBLA 3X1JA 4Z53A 3NTUA 3GAMA 1JHMA 1T3ZA 3AC0A 1CIJA 1H1LB 3MJHA 1N7HA 4H4CA 2XB2A 3AX6A 3MRVA 2ZPTX 4B31A 5IWAB 4YR9A 3F73A 5C35A 4ZYWA 2WQZA 3PZRA 1KEWA 2GH1A 1VA5A 4K6HA 1FX1A 3NHMA 1YRWA 1W59A 3SQLA 2GPBA 3GJ5A 1PJRA 2YFQA 2Z95A 2HFKA 3U37A 2G09A 5GAJA 4HATA 1L5FA 4B3XA 1BFUA 4LWPA 1U11A 3RS0A 4Y9DA 1C3XA 1Z4IA 1RCTE 1DHTA 2VHWA 1WRBA 5C8YB 4JCCA 3LBAA 1FMCA 1U8EA 4NI5A 1Z25A 4LE2A 3WLKX 5B30A 3R6TA 1EG7A 3HCOA 3DQQA 1VG0B 4LHYA 4QU8A 4CKYA 1Y6ZA 2W4MA 2XSZA 4QEDA 5EJAA 4UU7A 4ZV4A 4ZYZA 3WE7A 3DV2A 5C2JB 4W5NA 1DEKA 1LK5A 2NU6B 3GUYA 3IMFA 3W06A 3UAXA 3FPEA 3N8IA 1JPNA 3H7IA 4L6AA 2AGVA 3HCEA 4BY9E 4Y6PA 4Z8YA 4YIHA 3ZXIA 5CT5A 4LJAA 4HX9A 4XD7A 3DBOB 2B6HA 2WVGA 1C1DA 4R3UC 4E5PA 1L5NA 3BGIA 1I2BA 2QAGB 5AVUA 3U17A 1HX7A 1L4NA 4BVAA 4CN9A 1G3QA 4HS9A 4KN9S 1Q57A 1VJ0A 2B8JA 2PIAA 2E48A 3BCRA 3IX7A 4HZGA 3PCXA 1CYDA 2ZRNA 5B3JA 1FTYA 1KBQA 3RODA 5BMVA 2PUGA 2BH2A 1H94A 4MRPA 5AWFC 2R8ZA 4GRIA 1ZJ5A 3JYQA 4UTXA 1VCNA 3QVTA 3EAGA 4QHSA 3LGXA 1ZYUA 4J03A 4ZI5A 4D8TA 3V1UA 1CRPA 4PGHA 3RRYA 4WN3A 5DNVA 1A8HA 1WR8A 3B12A 1USIA 2ODEA 3DMPA 2RI6A 3OESA 4A8HA 5JMOA 1GM5A 1E6LA 3EODA 1EZ1A 1IATA 1GN8A 1F5NA 3W79A 1JHUA 4IMIB 1WTCA 4M87A 1WETA 3VHXB 4AX4A 2GHRA 3L3BA 1X77A 3TZ6A 3UCXA 3VSAA 5ALKA 1A1SA 3HCBA 4R01A 2V7TA 3VU9A 3VJRA 1A69A 2PEZA 3HH8A 4LX8A 2I3BA 2P6UA 5FO1A 4LSGA 2QM7A 3A4YA 1ZIDA 4QREA 3EAFA 1R6AA 4B35A 1N2ZA 3D3WB 2WW8A 4Q19A 1TAHA 3MRTA 4KX5A 3DOEA 3OX3A 1A4XA 2RONA 4LJ6A 2F3TA 5FYDA 4JT2A 1KPHA 5CDFA 4QGBA 3VR4H 5FQNA 2FDRA 4YAIA 2D62A 1E69A 4K87A 2NUTA 1BHSA 4EHJA 2WM8A 2WT8A 3NT5A 4IMPA 1KVTA 2QN8A 3L7MA 4KZPA 2F9LA 1CUCA 1XTZA 3B3FA 4HF7A 1OX6A 2E5WA 2HU8A 5AVKA 4QU5A 2HA5A 1EK1A 4CQNA 3D0OA 3EDOA 6GPBA 1UEXC 5FUBA 5T41A 1GCAA 1P80A 2BLNA 4HEQA 3B1KA 2O4CA 2OWDA 3UJ9A 2BGLA 3OD1A 5AKGA 3I2JA 4LRSB 5EE0A 3RC7A 1LFAA 3GXOA 4NE9A 4PFQA 1E9VA 1OROA 2PG3A 4M0PA 1XZMA 1VECA 2V6GA 3EUFA 4H15A 2VK1A 1X1BA 5CB8A 4H0CA 3T9AA 1DTWB 4M99A 3E82A 1GPYA 4X00A 1NQAO 2VF4X 3MTJA 3SJ7A 4W99A 4LHEA 4RTJA 1WUJS 4LV8B 4OQZA 3KVNA 4ZAGA 2W8BB 4LRQA 3CUVA 5KMGA 3GFPA 4BYGA 1TCUA 2YWJA 5C8VA 3IB3A 3JWHA 4DIUA 2BBSA 3IKLA 4X95A 1J2TA 5TVKA 5CHYA 2PO7A 3I6YA 1IRXA 2P69A 1CJCA 3ZLBA 3ZDBA 3O4FA 5EWMA 1U3TA 4F0JA 5GOTA 3RVQA 4ZQIA 1E2GA 1OWOA 5I7EA 2QDKA 4PZEA 3WVNA 3VVCA 2I29A 1RWQA 3IP5A 2CDAA 1W85A 3G9TA 3OIWA 1I7LA 4TYMA 4XYBA 4XJXA 5FHQA 4C0WA 3L4EA 1M7HA 3S8YA 4D6PA 5IASA 1M54A 3KXKA 3QV2A 2NVUB 2XRZA 4WY5A 3G7UA 4CNBA 2GHQA 1WVIA 2PPVA 3A2NA 1JQEA 4NOJA 4NEGA 4JJFA 4NCIA 4RSGA 3VHRA 1QPZA 2OK8A 1YH3A 2P9TA 4JBXA 2HF2A 2HF9A 2WD9A 3K1AA 6NULA 1EESA 2WQ6A 1EFKA 4BAZA 5EIXA 2ISQA 2GBCA 3BSYA 1JG6A 3Q8MA 5CMLA 4PPNA 3T34A 5D3MA 3CRMA 1M2GA 1M2VA 2AKAB 1BJKA 3A36A 1B16A 3L0ZA 4UUQA 2UUPA 3MJFA 3VSEA 1RQ2A 4GEKA 3OBBA 1AD2A 2B82A 1X8LA 2F8MA 1M1UA 1KH1A 1O95D 1DFIA 3KIPA 4PLWA 3VZPA 5CA0A 3NHSA 2H5IA 3U16A 2PLNA 3HGQA 2Q2VA 2VZ0A 1M1YB 5JCOC 4L4RA 1FSGA 4TMYA 1NVKA 4NXNB 1XU7A 2AEJA 4M9RA 3HFSA 2CYAA 4DJDC 3F47A 1BAPA 4TRMA 2BEUA 1C1XB 4L9AA 4EG0A 5H81A 1PGNA 3AVQA 1R5NA 4HK4A 1Z37A 4EW3A 1O5OA 4TM7A 1Y8QA 1SC4A 3GH3A 2NV2B 3Q72A 4LRUA 4G56A 1SKYE 3N28A 3L18A 4O6VA 3G5UA 2Y8EA 5EZYB 1JG4A 3D8UA 2BM9A 1F4LA 2COEA 1M6YA 2YYYA 4G0MA 3S28A 2GBFA 1SCQA 2ZJFA 2PZAA 1TMKA 2WDPA 4RIFA 2E4XA 4GNRA 4H4DA 4LE1A 4RTSA 1RWWA 1V5IA 2WMDA 2ZETA 2P6RA 5CFLA 1HOTA 2JGMA 1S9HA 2W00A 4BUCA 3OPYB 1A9RA 2IZZA 4IIHA 5FBLB 1BMFD 3TAXA 1G2PA 3S2FA 3WISA 5FTKA 1E3TA 2UVDA 4WADA 1LPPA 2QHXA 3AFGA 4G8DA 2ZAYA 1RXWA 2LTAA 1QRRA 4IIBA 4EJSA 4HFRA 4D9KA 5K3CA 3KD2A 3SBDA 2QLJA 3BB1A 1AM4D 2GN0A 3QNMA 3RI3A 1CJKC 2IYEA 3K4QA 2W22A 3LP8A 2B6NA 3A1DA 3KR9A 1KQPA 3Q2OA 2YJGA 4G8BA 4RWZA 4C78A 2HREA 1KMMA 1LLCA 3F4BA 4ER0A 3REGA 3T1NA 1NNLA 2AXEA 2V6JA 5AK3A 3DDHA 4HH1A 4EFLA 5K0JA 3ZVKA 1H3NA 2IGTA 3ZKWA 3GJZA 4O4HB 1S8AA 3BQMB 1Q6YA 2VJBA 1OVGA 4V3CA 3BF7A 2YJNA 4HR7A 4V0NA 5D2CA 4FGJA 4MJXA 2V97A 1PS8A 2BBTA 5L7TA 4R0MA 2DQKA 4YQFA 1LS6A 1LQ2A 2IZ1A 3W5HA 3V97A 1CF9A 4JMPA 5JSQA 2HJHA 5F76A 4K86A 4EHIA 1HNWB 5JSFA 1X3LA 4B43A 1PHPA 4WDRA 1RYHA 1C7QA 3ZZNA 4BX9A 5LC1A 1A2BA 3UHJA 5C8YF 4RKYA 4HAOA 2QTVB 3OQ6A 3L0CA 2PO5A 2Q5FA 2VDNB 3G8YA 1WD7A 3KPUA 3KP1A 2VK4A 1QB8A 1PZMA 2QTFA 3ELBA 1BMQA 4J0GA 5K3AA 2O7NA 3DBRB 3OTQA 3RTDA 3C4QA 3DYIA 4YB8A 1JLHA 2E5FA 2GLUA 3ZWWA 5KNDH 3L6DA 1JIKA 4AU1A 5JAPA 1ADBA 3CN7A 4EIWA 4A2QA 4YASA 1Q12A 3LK6A 4OHWA 1R8YA 2GZ3A 2NO6A 3D6TB 4AZSA 4AYWA 2QMZA 1ZVMA 1S9DA 1G6KA 3RRBA 3OQMA 3DMTA 2XVYA 2JZOA 2YX1A 4XWTA 4H3SA 3TOCA 4HNVA 4BNVA 3THYA 3O1IC 4MUBA 5DSXA 1IK4A 5EQDA 1UDCA 2EKPA 2WV7A 5E4JA 5LIRA 1J24A 5GGYA 1KAHA 2DBVO 2P67A 3AJRA 3KTAA 4EF5A 2XAUA 1MFPA 5CIYA 3NNDA 1QG4A 1CDZA 5IARA 1BEUB 3B3AA 2PD3A 1JDNA 1S6YA 5DLPA 1R8JA 3VI4B 2JIZA 5E4TA 3V3TA 3Q10A 4N65A 2IZ0A 1G6Q1 4NMWA 4FWTA 3UC5A 4O8CA 1E2PA 1DT5A 5DJ5A 3ZZ0A 4ZI3A 3EG9A 3R09A 3I1FA 1QX3A 5FJJA 4D0SA 2NQ2C 1Y8CA 2QE6A 2DUWA 4G6ZA 3AF1A 4K9OA 3U0BA 2B0CA 3EMBA 4C22A 2NLOA 5JVDB 1SCDA 1ORDA 3KZNA 4B1FA 1T5IA 3Q7IA 2P7HA 3I64A 4Q4HB 4R81A 1ZUHA 4OIFA 3LVQE 2X13A 1YSCA 2ISCA 3ZWAA 4IGIA 3VHQA 1T4BA 2B4YA 4IBOA 4BMDA 4UQLA 121PA 2SKDA 3E7DA 3PHHA 3V1YA 1KKMA 2XEXA 1A7UA 1JFVA 4MS3B 5JSUA 1XZJA 1FJ2A 3OIUA 1AQJA 2ZW9A 1IOZA 3GMIA 4C7OA 4R0NA 1TF7A 3LXRA 3IHTA 2BI4A 4JC0A 3T0IA 3TOVA 4MKXA 3USES 1OFGA 4PO8A 1UP7A 3QHPA 1WLSA 2H7YA 4LOAA 4ZP1A 2J0EA 3UXHA 1O3YA 1RKXA 4MQLA 4XGKA 5J2TF 3IQDB 4LYJA 1E6UA 1JI0A 2JHCA 2WKRA 3GDGA 4XIJA 3TH5A 4AKHA 1XU9A 3U4CA 1T5SA 4FGUA 1CIPA 1P9OA 4YK7A 3VTAA 2ZBVA 1XRMA 1CUZA 3A4IA 4ZAWA 1PNRA 2X7XA 5EIBD 3PPXA 4BFCA 4AUKA 3CW2A 5BQFA 3IBFA 2JLSA 1P2SA 4FZ3A 4XWKA 4NBNA 1KORA 4N18A 4O5OA 3QYAA 3UMYA 3JAWB 4BC1A 2JCSA 1FRZA 2EX0A 3P0JA 3QH4A 4U2GA 3Q85A 1FFCA 3MAGA 3QKSA 4PPGA 1HQYE 1AIPA 2CXXA 1UADA 2JEOA 2GLXA 2Z4RA 1E9RA 5M04A 4K6CA 3L49A 2CLKB 3EDYA 2O2EA 3P2KA 2XMZA 5EP2A 1I3LA 3IMGA 3QVSA 4OFWA 4X1KB 2CY0A 5ECWA 1F7UA 2F9MA 2CVQA 1EAYA 1A8QA 2E6KA 1FMLA 2VSXA 3PDWA 1NL3A 4ZHQB 3HBNA 2ZTMA 2P0AA 4U4AA 1OXUA 2DU8A 2DWCA 2Z5LA 1C3EA 4HRAA 4H1WA 4G86A 2I62A 3OP4A 3ZBUA 1D6JA 2HC9A 3C39A 4JLDA 3VVBA 1EVLA 2C7PA 4NCHA 1ZJ4A 1YU9A 1I6WA 2R47A 2IBMA 1FFBA 3W9UA 1P1FA 1Z35A 1WCXA 3FPJA 4WZ6A 1UXKA 3V9AA 4UEKA 4ESHA 1ZGZA 2JIDA 5T6MA 2I87A 5BMVB 3BORA 3OF3A 4X3OA 3H9BA 4LA4A 5LQAA 2C9YA 2N3ZA 1DP4A 4J0HA 2WP8J 4NU5A 4NYMQ 3RSCA 4PZDA 2DUMA 3PSHA 4A4DA 5ICEA 2CYBA 1F6BA 1TIPA 1GYRA 2CLLB 4X60A 2DQSA 3R7WA 5JJIA 1LA2A 5ALZA 4ZJPA 1E79A 3NP9A 4PY2A 4RPJA 1WHSA 1TA4A 2O2IA 3EMKA 3MMNA 1NASA 4PR0A 3V6LA 2WUEA 2PZFA 2OP0A 2C92A 1CS0B 2QM8A 1V3QE 2Y1OA 2JGDB 3MA0A 2O0HA 4CN8A 1Y8QB 2YV2A 3GGGA 2X86A 4O4IF 2G5CA 4UAJA 3O93A 3B1ZA 5JCPA 3ND6A 2JGLA 3CLTD 3UGTA 3ZHXA 4F4UA 2OBFA 4R71A 1XNQB 4D74A 1D1PA 2QT1A 3OVMA 3VOSA 2HMWA 2HLPA 2OM2A 4UUAA 5CDTA 4G5YA 5FA5A 5J4LA 2W6ID 1XVAA 3LV8A 1U3FA 5KX5F 4D6XA 5DK4A 1D2EA 2JDID 2GJ4A 3U7HB 5F2KA 3IRVA 5EMKA 2FX3A 3SE0A 3UV3A 3CQ9A 3AM1A 1XN4A 2DY1A 2EZUA 3IKMB 3IH5A 3QUCA 4MLZA 2RAUA 1SA0B 5I6DA 1Y1SA 5AH0A 4HH3C 1L3CA 2VAXA 1L5KA 5K3OA 1HMYA 4YR7A 3UAYA 1T5OA 4CIBA 3KNZA 4L5JA 2ATVA 2OQ2A 1JBQA 3I4FA 4QHYA 4C3ZA 2YVKA 1DCFA 1QKJA 5EZYF 3OH8A 1XKTA 1BSVA 3QEMA 2YVUA 4RY9A 3V34A 2FVXA 2ZLBA 3TQOA 5I7WA 2FYTA 1AKTA 1WZNA 1D07A 2OB2A 4I4NA 3ST7A 4AUEA 5IULC 2F48A 4YCSA 1V5GA 4BPRA 3ZWOA 3TL6A 4MUNA 2PANA 4CLOA 5IK2D 4A15A 2ACKA 2JH3A 2PLWA 3DTYA 4IVRA 3SSAA 3O8QB 3AETB 1GFIA 2M6SA 4LQLA 1VHJA 2QW0X 5FLXA 3RSSA 4NESA 4DUZB 2J6HA 3ANNA 1OFHA 4HEJA 1G64A 4RBNA 2V0CA 3GLUA 2ZVQX 4EB6A 4DC0A 2GO1A 2O2GA 3VNQA 2PFKA 5KVCA 3PFKA 1QHYA 3PHIA 3VV2A 3GFTA 5IZCA 4NBWA 2AUNA 4JEMA 4TYYA 1DXHA 1WV0A 2E37A 1M33A 3UJDA 3JALB 3QI7A 4X0EA 2VSFA 2FKNA 4XVHA 3TPCA 3ZU6A 1ZCJA 3JPYA 2ST1A 2K5UA 5EKXA 1KC3A 3KUDA 3U61B 3VAZA 2B0JA 1CHNA 2F1KA 2PWBA 1E61A 4KDCA 3C3PA 4U2EA 3S2SA 1GQOA 1R00A 2C5GA 2AG8A 4LOHA 1KZHA 4F2HA 3MTBA 5F2NA 1EWKA 1U0BB 1NI5A 2NVUA 4DSZA 2PH5A 5TNXA 3PNPA 4JBLA 2FPPA 4AP5A 5B3JC 5JYDA 5KCZA 1DKMA 4URVR 1T3SA 1AGPA 2HX1A 2NTEA 5EMHA 3D2AA 5TF0A 2Z2XA 1SVKA 1T9GR 2HNKA 1WCIA 2EJBA 3GLTA 4LX0A 3LKVA 4Y2GA 4C4AA 1CHDA 2B4QA 2ATXA 3HSKA 2D4HA 3TGWA 1DWOA 2G1KA 1DX6A 5BN4B 2GEFA 5CVTA 3Q1LA 5GM1A 2XOKA 3FMOB 3FYDA 1JWBB 3NOVA 4P84A 5FFFA 3HVUA 1NY5A 1O97D 4G1VA 4HDSB 5HIKA 4LY9A 2XECA 4BLWA 4FNGA 5CDSA 5HJ7A 3DF9A 3C6XA 3MC1A 2C9CA 2CKDA 4FI3C 2A92A 3F8SA 4GPD1 4L7VA 4PHFA 3CVOA 1E3WA 5FL7A 2BRUC 1YASA 3CNHA 5AFSA 5JQGA 3CLVA 4QWWA 1DWPA 1W5TA 1G38A 1GSAA 3EAQA 4PCVA 4RLQA 1JJAA 1GUZA 3AI3A 4JC4A 4L5AA 4DWOA 1L4YA 3UWDA 3IELA 4CE6A 3LT5A 3H1AA 4K81B 4XGNA 5JBQA 1CF4A 1EJ6A 4KCGA 2PYIA 3ZV6A 1JYFA 2XUFA 1JEOA 1YCDA 2BEJA 3OTGA 4LJSA 4O25A 3KQPA 5IK2A 2O9JA 4CRWB 4OYYA 1LRLA 1RWOA 2ESRA 3S1LA 3BOSA 4O4JB 3QX7A 4MW5A 3CRRA 1GPBA 5B3KA 2PZMA 3ESXA 3PQ3A 4K6OA 4R4JA 5EMNA 1BX0A 3OKAA 4XGRA 4NPCA 1RLOA 3C97A 2XCUA 4G9GA 1PRYA 1W44A 3GFRA 2GM9A 1SCBA 4MI3A 1SUBA 5HFNA 5BNZA 5JVDF 2CCJA 1G21E 3TSAA 3I2IA 4JIMA 1ID8A 2Y9PB 3MT0A 4PEVA 2VAMA 2G6TA 3FF1A 3ZDXB 5KTOA 2C4TA 4HSGA 4AP6A 4J0DA 4BX3A 4D9GA 5B36A 5KC9A 1Z83A 2NXCA 4QT4A 3E8MA 1TFUA 3AR7A 4FCWA 5K8TA 3KB8A 4J2HA 3H3FA 1WZUA 1DT3A 2IE0A 4HAYA 4PZPA 3K6RA 5G0TA 4Z4CA 1SKYB 4UMFA 1XHEA 4X8OA 2APJA 1RWMA 1T6NA 3HRKA 4RIIA 1J2JA 1AH2A 3BKWA 2RBEA 1LZKA 2BCJQ 2UUOA 2JHFA 1VCHA 1D6NA 3RLFA 4JWTA 5MGBA 3GMSA 4KXMA 4EGFA 2QBYA 5DM4A 1JBKA 2AXQA 1QIIA 2O8VA 3DVSX 4BBJA 4LXGA 3T9EA 1A5TA 1D04A 3FGPA 4IJ5A 4M9SA 4ZANA 5B5SA 5KNDA 2QV0A 3KB2A 3USZA 1KP9A 1U3UA 3ICVA 5KNLA 4YJKA 1TJPB 2NVWA 3URMA 2VT2A 4PG5A 2Z2JA 1RI3A 4HQRA 4DLKA 1VHQA 1KH2A 4I50F 5DWQA 2VZEA 3GH1A 4F4IA 1JKMA 1ILWA 3ONFA 3TUZC 1M1YA 3NRCA 4JJZA 3FB4A 2WU1A 3HWWA 4KJZA 3VYVA 3I9KA 4GXRA 3HGMA 4K26A 3K09A 3ZVMA 1IN4A 4H1HA 3E22B 2ZYSA 1Z5ZA 1ZK2A 4DAEA 2B35A 3WAGA 2KPOA 1GJRA 1KYVA 3CCCA 3HRIA 5ALJA 4C4SA 2XZDA 5EEHA 3UIEA 1EVQA 1F06A 4DLUA 4YRAA 3MWEB 3ODGA 5IT0A 3LYUA 1GL9B 4D9FA 4JLKA 5JD6A 1RACA 2K6GA 1IC6A 1NC1A 1U99A 2RGWA 2GHIA 1JDJA 1N3LA 3UV7A 1DIRA 1RYEA 1UKVY 5EVCA 1SO8A 1Y0BA 4B7UA 4E6PA 3KAPA 4B3RB 3ETJA 3K5IA 4Q7JB 3FWYA 1Z82A 4P4UA 4EABA 4ARCA 1QAQA 1C30B 1JHZA 4N0PA 4DWVA 5KYNA 3K9FC 1UAAA 3RVSA 1BS1A 3ENQA 4TRJA 3IEUA 2DFDA 3V4OA 3ADDA 2IHJA 2WYVA 2MR5A 2PWZA 3H2GA 2HU2A 4MWBA 1ZM7A 3A0UA 5AMXA 1DQSA 4IVPA 3QYJA 2NUPB 4BTLA 2WYIA 1AVTA 5A06A 5GPBA 4KO4S 4GKJB 1DC3A 4YJ3A 1QOPB 3FTFA 3V1KA 1I24A 4QXQA 4H3HB 5FI3A 2ZRCA 3HKCA 4JOBA 1HL7A 4R2IA 1QONA 1FFAA 1QOQB 1Q7TA 3C3BA 4YJ2F 2VEDA 4IZ6A 4ZQFA 5I9NA 1YR6A 1ML4A 1DKOA 3BGDA 4RKFA 1HQKA 1POWA 2QD2A 3PXAA 2Q50A 4UZEA 2FP3A 4Z9AA 2O7QA 2DT8A 1H0SA 1Y5LA 4Q18A 4AUMA 2C3MA 1T8TA 3DWFA 3FMIA 1CUIA 4MIOA 1QTIA 2YNMD 2WBLC 5TVGA 1ZS9A 4AXXA 4DG5A 2OR3A 5FFMA 4D99A 2F62A 2Q2OA 4DLNA 4QLAA 2FZVA 4GICA 3P0IA 4IHJB 3I83A 5C9ZA 1BG6A 2E4AA 3ZDYB 1EHCA 3F7NA 4JBWA 4B6SA 1WXXA 3R5FA 4TZKA 2ZSIA 4JGIA 4C2BA 3IODA 4DREA 2J6CA 4BFYA 2YQZA 3PL1A 4HB0A 2HBZA 3V4PB 1MIOA 3UV6A 4YHHB 4YAEA 3LP5A 4G9BA 4KO1S 2OBBA 1G6OA 1I5EA 1LDMA 2X4DA 1V35A 1SU6A 1E1CA 5L9AA 2C3OA 4O2RA 3DEYX 1HDXA 2AC2A 2R62A 4AL4A 1BHQ1 1L1FA 4IQFA 1NXOA 4D46A 4N5MA 3E53A 3K1JA 3LTEA 4WBSA 2REQA 1CXZA 3WKCA 3CC8A 4RZUA 3QU2A 3QLUA 3RVMA 4CKEA 2R5NA 9ABPA 3IO5A 2MSWA 3MTEA 3DEIA 4OI0A 3BXFA 1K08A 3AILA 4QXRA 1XEAA 5CA1A 4FXOA 4WNIA 4PG7A 2H1OA 4OGGA 3FSRA 1KZGB 3L0YA 3UA4A 5TPWA 2O8BA 2VH2A 2QJRA 4D3XA 4F72A 2J45A 4DA4A 5EG5A 4YWJA 1I2AA 3CUSA 1VXOA 5GIOE 3B6ZA 2C5FA 1RQNA 2X0IA 5A9SB 1E0DA 5HIJA 4E5YA 4H7HA 3BHJA 1ZN9A 4HDNB 5DX0A 1UP4A 3EBOA 2IFTA 3A9VA 4GO1A 5F7XA 5IDQA 1M8PA 5LN1A 4RYDA 3EH1A 2ZBEA 4LSMA 3H0EA 5BR1A 1Z5UA 1JHAA 5L3SA 2XUOA 3DLPX 3JV7A 3RT9A 3VU0A 3K9WA 4UDYX 5EKSA 3LVBA 3PHGA 3GCGA 1WU8A 3KTFA 1HZZC 4Q7QA 4HYEA 2UXBB 2IU4A 3FMGA 5C4IA 8ABPA 2HWYA 1YQTA 2JLAA 3IE2A 1GXSB 2XUIA 1U28A 4Q9LA 3GUHA 1N77A 1NATA 1ZM3A 1SUDA 1WULS 2QIOA 3TQQA 3L9WA 4PPYA 2OHFA 4F92B 5IJ9B 3CHYA 4LI0A 4E08A 3FCXA 1M1NB 3QY0A 4GWKA 6YASA 3GJ6A 1U81A 1YHYA 4X6XA 5IBRA 2POQX 4YRMA 5IJ0A 2G1PA 3F3MA 4JYMA 4XA8A 1B42A 4YH1A 2OV6A 4ZDWA 2IV7A 4Q1AA 3I2FA 3SYLA 1BDMA 4Z4IA 1AA9A 1E2QA 3AIIA 3MIZA 1O87A 2JK0A 5THKA 5CB4F 3BJEA 3C15C 2BEWB 4O4LF 4OHRA 3LDFA 4KQCA 2H4HA 4OY3A 1CV2A 3FBGA 4MP6A 4IP0A 4J1TC 1T9BA 2H63A 3P4UA 3W5SA 3GRZA 3UZUA 5HK9A 3CVXA 1P74A 4D44A 3K6SB 1ZLYA 3N2IA 1AHHA 3WK9A 1FMJA 1PK9A 1AKNA 2A8YA 4BGDA 3HXQA 1QB7A 1QIKA 1RJGA 1I7NA 4GPBA 2QL7A 2VUSA 4IX9A 4H7FA 1NBEA 3WRWA 4PZYA 1XFAA 1XAJA 2QS9A 3IOYA 3WR5A 4JB8A 3W5JA 5GV7A 4EG8A 2R6JA 5BVHB 3GC6A 1C3OA 1ZA2A 3KQYA 4FOSA 3WNDA 4AKTA 5AD1A 2GKOA 3IAS6 2VSYA 3ZVNA 4OKSA 5IYZA 3RAEC 4F4HA 2QRNA 4CIXA 4NJMB 4O4LA 3K94A 2J3KA 3LC1O 1CQWA 1O96B 4TRNA 5FUVA 2BTQB 3NJ4A 4IWXA 5B64A 2BDEA 1D6MA 2ANCA 2GPTA 5EJ5A 4X94A 4BWGA 5LPNA 4KQ6A 4Q3KA 4QNRA 1AGNA 3F74A 3C3WA 3LY5A 4RPGA 2WJZB 3QJYA 1EA7A 4YMWA 5HKOA 1HF3A 1TIBA 1CR2A 2XMPA 3UJ3X 2BI7A 4WLUA 3WQBA 2ZYVX 3VJLA 4RKWA 1WB6A 4XARA 4LC0A 1X1QA 4Z2YA 5JPIA 4M7PA 3TXXA 4WJLA 1VHLA 1NI3A 1JHQA 3DHEA 3RYIA 1HNZB 4NG4A 3K0AB 1Q1QA 1T8UA 4MRAA 4RY8A 2A33A 4X20B 2LE0A 5ALVA 3ZH9B 5BUQA 1K5GA 4P9NA 3HJNA 1FDWA 2WFZA 1MB4A 4QYSA 3SEAA 5JMWA 4AG6A 5KYYB 3JD1A 4Q1BA 4DCUA 5KU7A 1NVVQ 5F3WB 1KEPA 3SBXA 4E4TA 1L5QA 4XGQA 2EHDA 1KVUA 2FEOA 2C42A 3CLRC 3CSUA 3JQFA 5EIWA 2OBMA 2PX4A 2V3VA 2VR1A 3ICWA 4GOOD 5EXPA 4E88A 3VR4A 5CXQA 1N8NA 1SPXA 1YGPA 1SUCA 3H0KA 2EZ8A 2R7MA 3T1VA 4BUJA 2FSUA 5CNJA 1UBRS 1Z4KA 2NO4A 2EGUA 1GQFA 1FLAA 1E60A 3K9BA 3UQZA 3ZWCA 2KM1A 4CM9A 1V5WA 1DC7A 4LJ5A 1EEHA 4JXXA 1N8KA 3WGTA 1JSXA 1U7TA 3RTEA 4I8IA 1O9HA 3TQFA 4G8JA 3HEBA 3WK6A 4AKSA 1W9HA 1XTKA 3O4HA 2BHLA 2ZRQA 3EFOA 5F2EA 5EHIA 3GV0A 4EW6A 1U9IC 4OHFA 2BRUA 3UF0A 3EF0A 4BWYA 2X9LA 1GA1A 1I6KA 1USGA 2ZIXB 4PX2A 5EJIA 4EG5A 2COUA 2H1CA 4YT5A 3VKHA 3GY0A 4IUYA 5BRNA 4FLEA 2B37A 2C4MA 3GFGA 4MVJA 1N9KA 3A9SA 1HWYA 4ZVMA 4ZREA 1XEXB 2AOTA 2WV9A 2A0FA 4GGPA 1JQLB 2Q29A 4ZXFA 4CKXA 4ERXA 4YRGA 3WIUA 3LUFA 5GIPE 1YR7A 3NC1C 1DX9A 3KHKA 1XCLA 1CF2O 1YDFA 2QZ4A 2JA2A 3A6KA 1UBNA 3D6FA 4LSZA 4OQEA 1D0VA 5BYJA 4CG3A 5B1EA 1I9CA 1OKKD 2PL9A 1T2UA 1KEEB 3N53A 1AN9A 3MWFA 2IC5A 1HNXB 1MQ9A 4W8OA 2W2OA 3E8SA 3SEZA 2Q1WA 5LOVF 5KO2A 1T3LA 3N0RA 2ZR7A 3QXHA 4G81A 2AN9A 4L5CA 1E1DA 4NK5A 5JAQA 3WLFA 4BU0A 1KY3A 2A35A 3NEAA 2JF0A 4NATA 1Z8FA 2RD2A 4DIMA 2XUQA 3SHWA 1PW7A 5DMHA 2GF0A 3VR5H 4KE6A 1SC9A 2R86A 1SXIA 1QZUA 3C6QA 4JT9A 4CIVA 2JEZA 4DA0A 3EPRA 3MILA 4OAOA 3HKCB 2A94A 4HRYA 4HMPA 2X8AA 4PU0A 5KTSA 1ZD1A 1UJMA 4X1YB 2KHZA 2YS6A 4ZZ2A 3A6FA 3HKBB 1P4GA 1QFSA 3LUBA 5KSOA 2LD4A 1ZXBA 4B2PA 1TO1E 3DEJA 1Z63A 2WY2D 1PJTA 1G3RA 3BVPA 3HCDA 3KKNA 4QO8A 3MFQA 3ZE1B 4WJKB 3GRPA 1ZUNB 2ONCA 3JD2A 3LHKA 5K0BA 1T29A 1V3VA 3U9TA 4CF4A 1W2HA 2NUTB 4G09A 4ZYVA 3QEKA 3O3MB 4Z3DA 4I4IA 1IAVA 2Q3JA 5ALSA 3CXRA 4Y0AA 1N3IA 3M9XA 2BL4A 2OKCA 1IULA 4HTFB 3I6BA 1K3TA 4PRLA 4DDVA 4HYYA 1Q0ZA 2PHZA 1NVUQ 2EQ5A 4C9BA 2ERXA 5IC5A 1OV6A 2D2VA 4Z7JA 1OXTA 5KNDD 3ZJVA 3PF8A 4Q5IA 1C8KA 1A88A 3BWVA 3LXUX 2HU5A 5L95A 1ADGA 2W2TA 2Z3WA 621PA 1H5UA 3TBKA 3A6EA 4YRPA 2XPCA 1Q77A 3R7DA 4W82A 1AK1A 3R74A 3TF5A 5IX8A 3CRZA 3GG9A 4MR9B 1T0IA 4NSNA 2XXJA 2OHJA 4WKGA 3WGQA 1EX7A 4ESEA 1JXAA 2O50A 4NH4A 2I4TA 1A5AB 2RFLA 1P33A 3QK7A 3SD7A 3UWOA 4BNYA 5JRZA 1VXRA 3EGEA 1AE1A 3B9PA 3PTLA 1SU8A 3NLLA 3RIXA 1KOJA 4OJNA 5D5QA 1GZHB 4MQEA 3ENKA 5HIIA 2XHEA 1QO7A 3I61A 5ANRB 4N6GA 3DKRA 2X40A 2P1DA 3DUFB 4ALKA 5IVIA 2BFEA 3F5DA 4IIVA 4A1OA 1P2FA 1LSJA 2FKAA 3IT0A 3MMSA 1JHDA 1NRXA 2CZQA 1QBGA 3I73A 4KDRA 1GPMA 1RCFA 1MX1A 4UM9B 5IM5A 2IWRA 2PXXA 2A59A 1C7JA 1MAAA 4UUNA 1E4OA 3U3OA 1GGFA 4DW8A 3KPWA 1YVDA 2HWWA 3HFRA 2QLFA 3AUTA 5FWAA 4FC6A 4GPIB 1CUYA 4UCQA 4PCAA 3SC3A 1ESNA 1SZJG 3UPDA 4DLYA 1OBVA 4UAUA 3BWEA 1MO3A 2P9BA 4W5WA 1GDHA 3VH4A 2C54A 2FPUA 2ZRFA 2HHAA 2ZRJA 5FNZA 2IHUA 4E5DA 2NP7A 1HTBA 4BB9A 4AS2A 1GWNA 2Q7OE 3RK1A 1KHTA 4HQOA 2ODWA 2ZRPA 3BEDA 4MJ7A 4HAZA 2VBFA 2W2KA 2X5OA 4L7QA 4KPEC 3K96A 2NUBA 3KKPA 4HO1X 2PRZA 2X8JB 4GIBA 1COWA 3AR4A 1DQPA 3I2YX 3PIRA 3GCXA 3NWOA 3M33A 4C06A 3WLSA 2JAX