2GK4A

The crystal structure of the dna/pantothenate metabolism flavoprotein from streptococcus pneumoniae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
229
Chain Sequence
AMKILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGYEVCLITTKRALKPEPHPNLSIREITNTKDLLIEMQERVQDYQVLIHSMAVSDYTPVYMTGLEEVQASSNLKEFLSKQNHQAKISSTDEVQVLFLKKTPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKNQLQTVQTKEEIAELLLEKIQAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title The Crystal Structure of the DNA/Pantothenate Metabolism Flavoprotein from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
total genus 71
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 2gk4A00
1U7UA 1U7WA 1P9OA 2GK4A 5INTA 1U7ZA 4QJIA 1U80A
chains in the Genus database with same CATH superfamily
3K09A 3STVA 1DRWA 1W1UA 4Y2HA 5LMZA 1NJFA 3KSDO 4FCVA 1W75A 2P2CA 3GT7A 4AN0A 2I9PA 2QTTA 2WT9A 1FSGA 3HYNA 3NV9A 4UJ3A 3EX7C 4ZAWA 1PL0A 2QTWB 1DLJA 3P9SA 3R3JA 2C99A 2FWMX 4CTKA 2CYBA 5AM1A 3HB7A 5GZ3A 4ZVKA 4OHRA 3G0BA 1SQ6A 1DLIA 1WZEA 1YIDA 3IEPA 4GMDA 3AILA 2HSJA 4DMKA 5A4FS 1HM5A 3UGJA 1N5IA 4DJDC 1DTSA 3BMXA 4WHMA 4XGRA 2JB9A 3ZI4A 3M89A 1EUCB 4QQRA 4XPIB 2KJQA 3A6DA 4C5CA 1FX1A 3K0FA 6CHYA 1XP8A 5A4JA 5HKAA 5FV4A 3COPA 3AEKB 3CVWA 4L1KA 1JZSA 3AVWA 1B15A 3ZLUA 1TU0A 3O0TA 1OXVA 2BDUA 4G8JA 4C4TA 3JD0A 1TYCA 4AWXA 4C4YA 4CIBA 1YD7A 1BEUB 3RTEA 3IOBA 3ZDFA 3IHTA 3K8QA 1M67A 3ZE6A 3DZKA 4BGVA 1RM3A 3HO6A 5AI4A 5AIBA 3I23A 3NTUA 1GKUB 1U6KA 4OHPA 1BS9A 3PTLA 1LJUA 2XE6A 4QGBA 3DXZA 1AO0A 4OHYA 1X94A 2VZ9A 2FSSA 3BBPA 3L8GA 4FR0A 2PQMA 4M2LA 1DBPA 4KV9A 1DV1A 1ETHA 1W5BA 3AP2A 4WX2B 3EK2A 1RM4A 2BZ1A 3F46A 2IPNA 3HMQA 3EH2A 4I3FA 4BE7B 2J4FA 1CQWA 4G0YA 3N7TA 3EOZA 3LYUA 3I37X 3EXFB 3ZGOA 2JVKA 2E7ZA 1XZPA 4FFSA 4LDPA 3ROEA 2Y1OA 1HI9A 1KFBB 1UDBA 3BFJA 4DN6A 1CEEA 4UVGA 3C3JA 2NZ2A 2LIVA 3AI2A 2YIVX 3CF0A 1C41A 4NZNA 5EKDA 3HP7A 1C3OA 3NC0C 2D8AA 2OESA 4FNOA 2XOXA 1TAUA 1Q1EA 2YS6A 4ABTA 2QLNA 3BRWD 4IEFB 4G0ZA 2QRGA 4MRVA 3VC2A 4LDRA 4DWOA 1MO2A 4Z4HA 2WF8A 5ESWA 3AUXA 1T5HX 2D8MA 3RHTA 4DJ5X 4L85A 2JHCA 3JQPA 1EBBA 3TE6A 4X20A 3UF0A 4C1NA 5KDOA 1Y7IA 1T4CA 1FUKA 3D81A 4AKGA 1SH7A 3NOQA 3ZCXA 3DD1A 3EVGA 1SFRA 1QKIA 1M8GA 3TZCA 1DHRA 2A14A 2H1CA 4RGBA 2PS0A 1NQOA 3RVJA 3GR6A 3JQAB 4IIJF 4P3OA 4I14A 4MKHA 1JMVA 1O95D 3UYLA 1W4ZA 3R3VA 1U8EA 4KRYA 4DMGA 1KEPA 1ZHFA 1CHNA 1P2UA 2XUJA 2GBPA 4FSXA 4DW8A 4G23A 2FKNA 4ER5A 2H1OA 2WKWA 3AB7A 3EWAA 3PVZA 4JU9A 2PL9A 1NDHA 4WLFA 1M6VB 4XEHA 3S29A 2YOFA 4P6VF 1IMJA 2C1EA 1YR7A 3RAGA 3AIMA 5DNCA 3KOYA 4HP8A 2EIXA 2VCHA 3A32A 2W11A 4KODA 4FYXA 1Y63A 1AQNA 4PICA 1EHIA 1TT7A 4WY8A 4NL4H 2W0SA 2JDIA 2AN9A 1Y98A 1GPMA 4ZCMA 1SAYA 3K70D 1GPWB 4FGSA 3S55A 3BTUA 4IEIA 3S6JA 5AHWA 3M4ZA 4UTRA 1YQUA 5CT6A 1VMIA 2ZTMA 1GCOA 3IHLA 4U2EA 1LC0A 4DLNA 2OBBA 3PUXA 1A8IA 3DULA 1TVKA 5BYBA 1Y1KE 5B30A 3HGTA 3KVOA 4RBNA 1TI7A 2RSLA 3PC7A 1PFGA 1DCMA 3PQ7A 1JEEA 3FYTA 3LUKA 3OY7A 4FILA 2BKEA 3GC6A 2YICA 3OJLA 5CGQB 3RHFA 1ILEA 3VOTA 4JBNA 1T1IA 4DQXA 2FSPA 3EXIA 4TLDA 3UJ7A 4DLTA 2ORVA 3ZV4A 2WMYA 1SOVA 3B3FA 1N36B 4MCIA 4W1QA 4Y2PA 2Q45A 3QBJA 3VYRB 2OE2A 3QTBA 1YACA 2VATA 4IHQA 1UXOA 5AESA 4MLZA 5FI1B 3QLUC 4COKA 2CLHB 2HH9A 1YRHA 3PJFA 3KQYA 3HV2A 4DIKA 2I91A 3DTYA 4NCAA 2YRXA 1D5CA 5FL7D 3CLSC 4BBPA 1J2EA 1UMDB 3AY3A 3ISTA 3FHJA 2GF9A 1KEVA 3OICA 3BZUA 4IDFA 4M1OA 4CHTA 3RFVA 1TAQA 3VC3A 4O4JB 3DC7A 3E8XA 1B3RA 1EEHA 2Y1GA 4US0R 1BIFA 1VRWA 1YXMA 3ANMA 1JIQA 1P44A 1XQVA 1KY3A 1B2RA 4EF4A 1ISJA 3HRHA 4N47A 3U80A 3R3XA 4E1BA 1FJXA 2HQ1A 4HDNA 2VRCD 4E13A 1QU2A 2WWGA 2WVJA 3EARA 3LXXA 1PL7A 1Z6QA 5IC5A 3TLEA 1FUYB 3MJRA 1N5DA 5AM4A 4EJFA 4IQ4A 1YTUA 2UVQA 5BNWA 1XQYA 9LDBA 3VNRA 3HL0A 1LI4A 2DWCA 2PJZA 1P6XA 2QMQA 2Y2UA 2TMYA 4QICA 3RF7A 2CZGA 2FZCA 5F98A 1SOUA 4M0LA 5KOJA 2LIPA 2OV6A 3G8DA 4IGFA 4N5NA 3CRRA 4YA6A 4W4TA 4ZI7A 3TX2A 1V2HE 3MAAC 4GI1A 3D5QA 3T1NA 2XOKA 4FFNA 4F4FA 2GPBA 1I94B 3SLGA 4UCFA 1PJLA 4WW0A 5LU8A 1BWSA 3JQGB 3E7XA 5F4ZA 1IN7A 4BO3A 2HDHA 5JWHA 1ZD8A 1XTKA 4RIEA 2C9MA 4MUYA 5BRNA 1FVHA 4N0DA 3LWBA 4UHJA 3ZVLA 3GROA 4D3XA 5KNCD 1K3TA 3OQHA 3TNYA 2PGOA 3SDZA 3RRBA 3GGCA 4Y3UA 3TCXB 3WR5A 1JHPA 5ALNA 5FV7A 3L06A 3SKYA 1JAZA 3RGGA 1DIRA 1TUEA 1FZTA 2YHSA 3T5MA 2OXCA 1G17A 5IH7A 5D87A 5FCDA 1JR3D 4NZMA 4XKJA 4JP1A 4OXXA 2P41A 1VMAA 2J3JA 5TQ0A 1AHPA 4D25A 4RYLA 1E89A 1C30A 4CM6A 2JAHA 4EO4A 3FN4A 4FFDA 1I9CA 1C50A 1N8TA 1V5WA 2GPSA 2J3DA 4F9EA 5JAQA 1UP6A 1GN9A 3UB2A 2QX9A 4NMMA 3HDHA 1Z2AA 2IS2A 1T91A 2WJ6A 5BSUA 3W2EA 4CIXA 1A2BA 1ZONA 4YDSA 4QASA 1ECFA 4PQFA 3FNIA 5D2CA 3L46A 4YRQA 3FFXA 1BE6A 3KZNA 5B1DA 3T5GA 3CEAA 1C3JA 5LP6A 1SKAA 2WEKA 2XEXA 3HO8A 4YV2A 1CEYA 1UC5B 4S04A 2EG5A 4MR9A 3LLCA 3H17A 5DZSA 4AMZA 4DYVA 3I3OA 1CF4A 2P91A 1M2NA 2ILVA 3B5JA 3E7WA 1NYTA 3OECA 3TDNA 1E5DA 1HE8B 2G5TA 4HXYA 5JEEA 2X41A 5DCWA 5LJLA 1LSSA 1NI5A 3SXUA 2IEYA 1I2BA 3PUVA 5JFTA 2FEXA 2WMOB 2GFQA 1C80A 2RHDA 3GVIA 3SBDA 3MBOA 4HEA1 3LKDA 1QH1B 5HIJA 4MGEA 3P27A 4V0KA 1J9ZA 2AN4A 1UBRS 5LLTA 2XNCA 4G37A 4LRUA 5EA2A 3ZDEA 2B3DA 1NUQA 4FJ0A 4E70A 1AVTA 5D1NA 1N7HA 1DTWA 1GZSA 4QWWA 4YASA 4CG0A 5GVSA 4DR6B 2QE6A 2OFPA 4JXZA 1M6EX 3ZLTA 4GG1A 2JJ2A 3PC4A 4AS2A 2GRAA 2V4ZA 3AB3A 4RJIA 4EG7A 3HPQA 3IE2A 3M2TA 1UJ6A 3BE6A 1GHTA 3DW1X 3R5FA 1GZVA 1EK0A 4GYKA 4PXSA 1N6KA 3LTNC 1U2RA 1P6QA 1QP7A 1NJ1A 1GUYA 3CRNA 1DAIA 3HEMA 4AK9A 2O0MA 1YMQA 4IV8A 1DXHA 1MRSA 4CIWA 3NHZA 3Q3CA 2XJ9A 1TJYA 4E32A 4LY3A 3EGOA 3FZGA 1XXHE 1NASA 1F5NA 2VK1A 4QU0A 3TUJC 2LUOA 1BSVA 2VUTA 1NULA 1QCYA 5FIUA 1VCNA 4A16A 4LF7B 3L7IA 3MAJA 4LISA 1T43A 4BMPB 2YC2C 1FYEA 2YWBA 3H9BA 1P2FA 4F38A 3EQ6A 1PZXA 1MC5A 3I1JA 3JQQA 2JJ1D 2PUDA 2ENUA 5REQB 3IUSA 1I5EA 4FGKA 4HRXA 1WW8A 2H7XA 4L9WA 5ALJA 1KMMA 1YL6A 4A26A 3BKXA 1B0PA 1MOQA 4JMLA 2PD6A 3DHNA 5CT5A 4E2XA 2ERXA 2PDAA 3H1BA 3CONA 1R10A 4UQLA 5FEMA 4N3GA 1VQ1A 3BIXA 1T35A 3ESDA 3TQTA 3K70B 3NASA 2GZ3A 4MW1A 3FSGA 1G5TA 2NV0A 3IIIA 2W2PA 3BDVA 1IULA 4EIWA 1BQ3A 4TUYB 1ZIOA 1XOIA 1L4MA 2X6TA 3PL1A 4TMKA 5HKKD 4MA0A 3PTAA 1CQIA 4MWOA 2AR9A 4R6WA 2H08A 2JD1A 4LZZA 1GKYA 1KBOA 1U81A 2OAP1 4EBFA 1U63A 1J25A 2DBRA 1K6XA 1U0OC 2H8GA 1EA7A 4US2R 1S2OA 5IEBA 3W5UA 3A0UA 1H2ZA 4ZT7A 3VNBA 1ZM4A 1GIAA 5G0UA 3UH1A 5A9RA 2DWOA 4NXNB 3HJGA 1GPAA 2WKPA 1PNOA 5I9TA 3GEHA 4RHCA 1HSZA 2GMWA 3COYA 4DG8A 2B78A 2GILA 2NZJA 4HKTA 1Q20A 5DGHA 3H0EA 1ZIPA 4H7HA 2DCUA 2ZVPX 2FZWA 5AVSA 4FEGA 5CIYA 3BK1A 5FTJA 3SC2A 2GF2A 1OGYA 3PGKA 3T5PA 5ABPA 1RPZA 1EDZA 3E5MA 4NFLA 4P8RA 4ZVRA 4BZZA 4NDNE 4OSEA 1LRKA 3B9RA 1U8YA 1N4AA 1ENPA 3SI7A 2QPTA 4GS5A 3SXPA 1RBMA 3B20A 2PFGA 1ZNYA 1SWVA 3K9QO 3FF4A 3MTJA 1N32B 1EP2B 2B5OA 3JYNA 1KZ9A 4BX0A 4HUTA 1ZXXA 2X76A 3A3KA 4LXGA 4PONA 3WB2A 3IQGX 1QRSA 1NBMA 1OYOA 3ND5A 3NEPX 4TV8B 3ZE9A 1RRMA 4D8TA 3QWIA 4KQMA 4TTAA 5JMOA 2AHRA 2XRFA 1Q11A 1NAIA 3ES9A 2I8CA 3WYDA 3AM1A 1UQRA 1YHYA 4Q1DA 4ERNA 2RGGA 4PYQA 1YJ8A 2Z4RA 2HGZA 5C46F 1SHKA 1XC7A 3HDTA 3MD0A 5IARA 3ER9A 3OY2A 4CNQA 4FGLA 1L5YA 4CM5A 4O5AA 4IX1A 1RYEA 1O89A 1VL8A 4OREX 4B2LA 3JVVA 4N5MA 3TOCA 3DUFB 3WLPA 2X7JA 4KQGA 4U6NA 2PUWA 2OGUA 1B43A 4Y1RB 3OEYA 4TLMB 5LQKA 1RP7A 2Y6UA 4RJ2A 1P1BA 5DTMA 4FHCA 3VM6A 2CEKA 4XB1A 5EZQA 4ZAZA 2VJAA 1SXJA 2OK7A 1D04A 3LQYA 4UMVA 3WLRA 4C7MA 4DLRA 4P4UA 2GD2A 4RPHA 2B7CA 4PZDA 1KDVA 4YDQA 1S01A 4FLFA 1SN7A 5FI0B 4BNFA 4D3YA 1G8FA 3KYBA 3N2EA 4PGGA 4EPVA 1HGXA 1VCMA 3D8UA 3OC6A 3PT5A 3QWAA 4PZ0A 4C7VA 5C37A 5GIOE 5DXJA 2OFFA 4Q4JA 2D0OB 2CLFB 2ZT8A 2I2WA 3UB4A 1CDDA 2G8NA 3DXXA 2Y3IA 3WL4A 4WN9A 4C06A 4MLCA 3I6QA 3ABIA 3IKLA 2INGX 4KC0A 1X7YB 1ZD2P 5C5CA 5KZMB 3DW3X 2NZ8A 3THOA 5FBVB 1CB7A 1H8EA 2A94A 2FPMA 1DQRA 1UKVY 1AKUA 2XRMA 3M5PA 2ZIZA 3NKLA 3MF4A 3GFTA 3CRW1 1MEJA 3JASB 4DREA 3IA2A 1VI5A 3W1EA 7GPBA 2IP1A 2R4UA 3WMRA 3Q10A 4B83A 1VPEA 2QW0X 2YX1A 5JJLA 1AZSC 3QUAA 5K0EA 1DUVG 2DFVA 3CTPA 4KK4A 4N0EA 3LDGA 5CH5A 1JTFA 4DLWA 1AV6A 4V03A 4KR6A 4AJ2A 5JYBA 5HF9A 1TB4A 4X7MA 2WIKA 2PGAA 3HYTA 1XTBA 4IFBA 5FUBA 2ZAOA 2EZ8A 1FB5A 2PX4A 5ALVA 5L9AA 3QX9A 5F3WB 3PR1A 1OWLA 1YZKA 4BMYA 2IX9A 3FXAA 4YMUA 1M3SA 2DWQA 3RSOA 3U7EB 3DBOB 2H0AA 3R6DA 5HTOA 5D1HA 4Z0TA 1RACA 2I8LA 1Y6RA 5C5EA 2NM0A 3HR7A 1XFDA 1GNPA 1YR9A 3Q6IA 2Z5GA 4I50A 1O9HA 4B3HA 2ACVA 3BJIC 1KAOA 5HVNA 2V96A 4IDCA 1G59A 4XJSA 3NGMA 1G2QA 1N7GA 3Q9UA 4GMXA 5EIBC 3ZNNA 4ARZB 4MHTA 5D7NA 4E30A 5K09A 3T15A 5LQDA 3QF7A 2OHIA 2PKEA 3DO5A 1ZLYA 4NDZA 5C8YF 4GPBA 1Y8QB 3EXHC 4Z7QB 1ZICA 4H4DA 1E58A 4NPHA 4X60A 1DINA 1E1DA 2VXOA 4UULA 2WZDA 1J33A 1D6JA 1PWZA 2PWYA 3H5WA 4B48A 5J1TB 4NBRA 1JSLA 4HN2A 1HNXB 1EQAA 3FW1A 4JGBA 3GLFB 2Q2QA 4G9BA 3SEQA 2FMUA 2FZLA 3IR7A 4BKRA 4E09A 4TKVA 1G0NA 3HCCA 2R68A 2XZOA 3BKWA 4IUDS 1VJTA 4ZEMA 2FUEA 2WV7A 5E9WA 3JD4A 1QH8B 4ZYYA 1CNFA 3HU5A 3RSSA 3SHVA 3GFSA 5CLJA 3OKAA 3EIUA 2ECKA 1W0KD 2YWDA 4DV3B 3L4SO 2NXCA 4XFKA 1IM8A 1RSZA 1UKCA 1N9GB 2ZE8A 1PJQA 3SK0A 4ARUA 3X44A 1WNTA 3RVSA 3U7FB 4O63O 2BR3A 2OLKA 2OECA 1PZNA 5JRDS 2QRVA 1H8HD 1UOEA 3PNPA 1NVGA 1XWFA 3LM8A 4A8JC 3L02A 1ADCA 3L0OA 3IMCA 4ZPJA 4HK4A 2C4VA 3Q3EA 2P79A 1VDMA 3MYRA 4FC7A 1UBJS 1NW3A 3JD2A 4OUKX 1W5EA 4KO2S 4X94A 4Z8XA 5GADl 1KO7A 1Y3BE 2PZBA 1CX9B 3JZIA 5AJVB 1QNLA 3CY6A 3PR3A 4L3VA 4LDNA 4EHDA 5JZMA 1VGQA 1VSTA 5DKFA 2CNWD 2Y1CA 3WGOA 3WISA 4EENA 3QEAZ 1KDTA 4HSEA 5K3EA 3ONVA 5E1OA 2RAFA 1F06A 4Y30A 3GJTA 1C9NA 1ZGCA 1E2IA 5LBTA 1F48A 4W82A 3UAZA 2Q0HA 1I1QB 2YINC 2WSIA 2ZSIA 3CKKA 1I4WA 1C2YA 1E9VA 5SY6A 4CUJA 3WDMA 1XYVA 1J0DA 1WX1A 4D9KA 3HABA 3BTVA 3WYCA 1SZPA 1C0IA 1R6UA 2E6KA 5BV1A 3B9PA 3EZLA 1RT9A 3NTOA 1KDRA 4OUDA 5K3SA 4X1KA 3MGCA 3EIQA 1I1HA 2OORA 4B3IA 2B8NA 4W9NA 4UCWA 2ZJ1A 3A2NA 4OQZA 3S68A 1T5LA 1Z16A 1XF1A 4FX2A 5LMUB 3C97A 3DE3X 1T8YA 3GH1A 3K32A 4G1BA 4TV9B 3OJCA 3R7FA 3ONFA 3UGKA 4YROA 2PL1A 3OPYB 4G67A 1YDMA 4JKIA 4YAFA 2QQGA 5D5PA 5AVOA 3D6FA 4KCGA 4NU5A 1TIKA 4OOFA 5DHAA 1T34A 4AF8A 5CDTA 4MV6A 5DM0A 2IP4A 2HLPA 1KY2A 2DGDA 3A3YA 4ZEXA 1CZUA 2ZQZA 3EGVA 4Z86A 2M1ZA 1SEVA 3I0MA 3EOBI 4TPKA 2FW8A 3OLXA 2HQRA 1YKGA 3X2SA 1RRKA 1X1DA 1P3DA 2D6FA 4TTPA 3H19A 3SSNA 2ZQ5A 1NG1A 4GW3A 2EHDA 3O1JC 4DJFC 4RC9A 1KQGA 3PDJA 1U2ZA 3GFBA 3IMEA 3OEEA 4QARA 1NVKA 1WCYA 4NENA 4OXYA 4BX9A 5JW6A 2O1WA 2Q46A 2YBEA 3NPAA 2GFIA 1N7IA 2HKIA 3MSXA 1NR1A 2OCXA 4LK3A 4PN7A 5KX5F 4B40A 5CEFA 3LWZA 1UFOA 3E2PA 3GRZA 2OHOA 3N0TA 4Y9DA 4ZVUA 4C6SA 1LRLA 3BQNB 3DVSX 3ZVNA 5KOHA 1M1YB 4LXUA 4RK4A 5BV0A 4MUFA 2HZ7A 4PR0A 2NO4A 1R8JA 1XMIA 1N2ZA 1HOTA 1QV7A 3I5MA 3VISA 2OSVA 2XVYA 3U48A 4F9FA 2VNKA 1O87A 4MS3B 3EFOB 2KI5A 1H2YA 1TMKA 2QVZX 3PQ5A 4RZXA 2P9CA 4WESB 4Z9XA 3F49S 3U17A 5EJ7A 2AN1A 1PJ2A 2NUAB 2QTZA 1V5EA 1L4YA 1UKEA 1BHSA 2EZUA 2YQ5A 2ZUWA 3D7MA 1TX4B 1YS9A 2BOVA 3GU3A 4PCUA 4QNMA 4UZFA 3M6VA 4C6TA 1F7UA 2GXAA 3ILYA 3P26A 4D3ZA 4X5OA 3L8YA 1Y7PA 1YI0A 5DM4A 3Q1LA 2J7PD 2NQTA 3VX3A 3I2KA 1W49A 3R74A 3IAM1 3RADC 4L4RA 2HU8A 2XGSA 3ESYA 4UW9A 3K30A 4ATNA 2FPGA 2A5DA 4M8KA 2AG5A 2O0HA 3KLNA 3INYA 4JT2A 2J09A 1GPLA 4TL9A 3SJCA 3E5RA 2I55A 2ZVJA 3A1VA 4R2HA 3LA6A 2R4TA 4XM2A 4C7OA 1IUNA 2FSVC 1CR6A 3H1FA 4CQJA 3RWOA 2QTHA 3DHEA 4IP0A 721PA 7MDHA 3B70A 3DBHA 2L17A 4H0NA 3B6IA 2O2XA 3A6KA 1UDCA 3WS7A 5K8JB 1ZUIA 1UC8A 2H1HA 3T9BA 3TW6A 3X1KA 3RS7A 4ID9A 4D57A 4F4UA 2WIDA 4LHYA 2D1TA 1E79A 5ICMA 1K6EA 2JFFA 2VH2A 4Q4DA 2CLOB 2ODBA 1Y4SA 3S3TA 5HHTA 1IQRA 2I7XA 4JOSA 5EWLA 4JLWA 2BI7A 3B2QA 4WNIA 5CA1F 1JJAA 3F6YA 5KNDD 1LUAA 3NHKA 5DH9A 5ALSA 3ZN2A 4HZIA 4FMBB 1FP2A 1W88A 5JNWA 3WBJA 4LS3A 3OCUA 3TB4A 4A3SA 1ESMA 2BHTA 4Z4IA 4YJFA 5DBIA 5JCOA 5A9SA 2FPIB 3A9WA 2Q1WA 1AK2A 4E5SA 1QLWA 4J49A 5BW4A 4KUGA 4BS9A 4HFRA 2I2CA 5B1SA 1A8UA 2O5EA 1C9MA 3SC4A 1RXSA 4AZVA 4PC1A 3NRJA 4ZU1X 5CITA 1JTEA 2YTZA 5K4AA 1I7LA 1Y48E 2WLSA 4F6CA 3DVAB 4YQZA 4F84A 1R18A 2FSGA 3FI9A 2Y93A 4FMCB 2W2VA 5ECWA 4K3UA 2CNLA 5IP5A 3PA6A 1H0KA 3DDSA 3UWOA 1JV2B 2XBUA 1UXGA 4CCYA 1XLTA 1V39A 2ZAGA 2O8DB 2QRPA 3EZ9A 5IVDA 2Z1NA 3C2QA 2H18A 3Q0IA 1T6XA 1XXLA 3L1VA 4ZVOA 1J0CA 2CJYA 2W2LD 4IIUA 4KUHA 4D96A 3U19A 1OIVA 2AFHE 1YL5A 2PGNA 2RHJA 4D97A 2P1RA 3CPEA 3ZH9B 1NVWQ 1MMFB 3X2FA 3FLAA 4V3CA 4FWTA 1WLSA 2FI1A 5FF9A 4ZZ3A 1XNHA 2JATA 5AJHA 1N5JA 4C0SA 4O1HA 1KAQA 1XVLA 3ASVA 4UVEA 2QTVA 1B93A 2AX3A 4JLNA 1Y1SA 4LZOA 3RV4A 3B38A 3GFQA 1CUVA 1GA1A 1SQGA 1UM9A 1ZNXA 1V5GA 3BMNA 4MULA 4MUNA 1QGED 1JLKA 2FRVA 2GDJA 1GXSB 3F3MA 4RVFA 2QLBA 5LJIA 1SBNE 4ZFNA 2YYAA 1R6DA 3A05A 3TD6A 2DF8A 3KV3O 4ZOLA 2GVZC 1GPDG 2RH8A 1ATIA 1ISRA 1MAUA 4ZMBA 1N1DA 2BKUA 1QGAA 2ILTA 1UBKS 4WV3A 2V7VA 3HCOA 4Z7NB 3GLHB 3QLEA 4JLAA 4W5NA 3K5WA 2JD2A 1BWQA 5IBRA 1OKKA 4RPGA 1KZGB 3KM0A 3CEPB 1FUIA 3WLIA 1ZRHA 2CWDA 3TFWA 2GYWA 4AXBA 3R23A 4X84A 1OWMA 3P20A 5ITZA 2X23A 4MUGA 4F9TA 3RK4A 3W6UA 2X15A 3KJIA 1CQJB 1RWQA 3OQBA 3OLQA 3GF4A 4EEKA 1YE3A 1J6UA 3QKSB 4G4GA 1JT2A 1RYZA 3F3YA 4KQHA 5TS3A 4M0CA 1Z0IA 1CPYA 4KFTA 1XALA 4PNZA 4IJKA 3ZTWA 1A7UA 3MXOA 4QVKA 5KTPA 2NVWA 4JX9A 1E1KA 1OV6A 2VBFA 3DNPA 3L6OO 2G71A 4PLGA 2ZRIA 2YZ7A 1NUSA 3ZWWA 4F2DA 4CF7A 3GJ8A 4WFKA 5CJPA 5EY5B 4P4NA 3LVQE 1NKSA 3FZQA 1I01A 3KD3A 3KK0A 2HADA 1EWKA 3N53A 3PFWO 1QLHA 3FROA 5J43A 4CTJA 4BQQA 1JDUA 2YYSA 4FFMA 4MJ3A 4UBOA 1CUYA 1KEUA 4HH4A 4M49A 4BRZA 1OI3A 3VR4A 2AVDA 1KI7A 2IOHA 5IAAA 1AQUA 4ZO6A 1M76A 4C22A 1EFAA 2CE7A 2XMDA 3FG9A 1JJVA 1MO4A 1BU8A 2GAJA 3E7DA 4KV7A 2AYZA 4DIMA 5KBYA 3ZIAA 3RU9A 2Z6QA 4BO0A 3PITA 4OEHA 4WTOA 4TVKA 3OX1A 2EP8A 1P2TA 2FF5A 3LS2A 2IS4A 3UAYA 2Q8NA 2YXPX 3N74A 3HO1A 1IHOA 3EZ2A 3TI9A 3CX8A 3N0VA 4MVJD 4BO4A 3WNCA 5AVVA 1GGMA 1H5NA 1OXBB 2EKLA 3NOVA 3NBYC 4JOCA 4RH3A 3V55A 2RHGB 1KQOA 1KKLA 4Y0AA 1NU8A 4BO8A 2W98A 2CDRA 1FXWF 5G0WA 3LV8A 5BO5A 2IUFA 4B76A 4GPEA 3A04A 5I9NA 5IZCC 3EVZA 1PT6A 1QPZA 1E1CA 5F12A 1T9AA 3B82A 3AF0A 5E6SB 3PKZA 1KFCB 1M0TA 4FYKA 2C9OA 2GZHA 1W0JD 2C92A 4OQLA 5EHGA 4F6RA 4QGHA 3I61A 1WEHA 1E3DA 1GUZA 4UC0A 3G0DA 3D6AA 4RKEA 2D1RA 2F9MA 5K7SA 2K4MA 2QJWA 5T67A 2AXEA 1YR3A 1D1PA 2JAQA 3I76A 2QSJA 4TSFD 3ZY6A 4PY2A 1BXGB 3BJRA 5HRUA 3EAGA 2F00A 3QM1A 1UJBA 4RKWA 3P97A 2FMFA 3IYLW 4WLUA 3U31A 2CHEA 4UM9D 2Z6UA 2B20A 5DHSA 1NVMB 2I22A 5IDYA 3MPOA 3LXUX 2WILA 4KK3A 2XX3A 2ZOSA 4QUBA 4I4NA 2FOXA 1HDRA 3VR3D 3BWMA 2QORA 2VT6A 2MOKA 4CL2A 3WQSB 4X66B 1CY8A 3BCHA 3RRNA 5EJ9A 1PX0A 3O9ZA 1DHTA 3QBVA 1J39A 1NUHA 2CL6X 4KB5A 2EX1A 3G9QA 2GA8A 5D01A 3PC6A 1QFSA 2O8VA 3JQBA 3LJKA 4WFIA 3AUJB 4D43A 1YZFA 3ETCA 1ZVMA 4RK5A 3VMFA 4GX5A 1I32A 2HU7A 3QVGA 3K9LA 1FEZA 3BXEA 2VK8A 1E20A 5LB2A 4JI7B 1YB4A 4IDGA 4W1PA 3I9MA 3MPUA 4TKUA 3KTFA 4B3XA 4KDCA 3RKRA 1EGQA 3ZCQA 2OO7A 1E60A 1NVVR 4G0VA 3D9QX 2DRIA 1PCXA 3M9WA 1FYDA 3QHAA 3MTBA 3CLHA 4Q1BA 1IBSA 3E18A 5G53C 3PNVA 2QUAA 1T6ZA 4IICA 3TLGB 4NJMB 2XCSB 2WHRA 3L3BA 3J7AC 5EIWA 4O0MA 2O1XA 3AKYA 5GY7A 3OM0A 2QN6A 4E7OA 1MB9A 1OXKB 4UHFA 2JGDA 5CM8B 1LDBA 4OB6A 4JL6A 4MIKA 4R1NA 1WUJS 2P62A 1A9YA 2C96A 2HY7A 3HY6A 5EPEA 5CFMA 3B53X 6REQA 2AUMA 3D5TA 2XXAA 3BFXA 5FBRB 1LH0A 3Q7PA 5JZSA 2XB2A 5DU2A 5BRAA 2COEA 3DHWC 1GO2A 1Q92A 4QWMA 4GR9A 4LJRA 3A3OA 4KXUA 5ALPA 1OY1A 2FPRA 3KUKA 1FMFA 4ILKA 4G5GA 1DG9A 3NCHA 5H59A 5K0TA 3NH9A 1T3GA 1KPIA 2VDRB 3EZGA 1PNTA 1ZH4A 2EWMA 5JTTA 3EXG1 1F9AA 2J4DA 5T7BA 2F3UA 5JJIA 4TLEA 4J90A 4JJ6A 3WYAA 1EA5A 3DEAA 2HV9A 3D3WA 2GPAA 2XMCA 3SGLA 2RJOA 3KYDA 2AFRA 4Q4HB 4Z9YA 4JOQA 3UK6A 2O8BA 2Q5QA 3IFSA 4KKVA 1PYOA 1W30A 5CM2Z 5K99A 1TEVA 3NG1A 1GDTA 2X19A 1DEOA 4K5QA 4E14A 1E96A 4N0MA 1SG6A 4CCSA 2ZITA 3N07A 5CCEA 2VWHA 3B1YA 3KNZA 3NBQA 4DQLA 3G6KA 3K9CA 4ZVTA 4MGKR 4YJGA 1X7ZB 3M4NA 3G3EA 4W99A 3BWEA 1Q3HA 4J16C 2NVUB 5BQXA 2YFKA 3E9CA 4Q7LA 1M7HA 1TIPA 3LIPA 4K9MA 3SFVA 2N75A 4U7JA 2X0KA 4ZZ2A 2AVNA 1CIPA 1SVSA 4XSHA 1AS0A 1AQIA 2AS0A 4QSHA 3WMWA 4EWLA 1BX1A 4B3RB 1TIBA 1JRLA 4NK4A 4RQTA 5B3JA 1QUEA 1XFAA 2DAPA 1M34A 2QRNA 1NW7A 4HWGA 3TDKA 2HK7A 2CXOA 4AN1A 3KQTA 4CKCB 1ZH6A 4U8GA 1OB2A 1GFWA 3H83A 3HZRA 1KBQA 4E2WA 1L8QA 1DMSA 1P62B 4B75A 2H31A 4HJXA 4C0BA 4YCAA 2FX5A 5FHQA 2D0DA 5ADUS 3VPBA 1NYQA 2P1DA 3SBEA 3WO1A 4MDEA 4WZ6A 1EM8A 1R15A 3RIMA 4R1QA 2XMRA 2ZB2A 3ESZA 4TT3A 2C3OA 2ACKA 5C31A 1T9DA 3UFXB 1IIRA 2I3AA 4PQEA 3NMUF 1Y5NA 3FI0A 2C88A 2TRSB 2X8LA 1NPYA 2XKKA 4KWHA 1KZ4A 5FWAA 2CL5A 4H17A 1KVUA 3HJBA 4A5SA 3GIDA 1P2BA 2VG8A 5BN1A 1QIJA 4D5EA 3HFGA 4OATA 1DBIA 2JJMA 1Y8RA 2VJBA 1RE0A 2G77B 2J3KA 2W2KA 3A1FA 1ZH0A 3IMKA 4FHGA 3RU3A 1OAOC 1G7RA 5FWYA 4X62B 4CDNA 3I53A 3WG9A 4YYZA 4RZ3A 4N8EA 5A6SB 4PM4A 3GGDA 3FSGD 1RDFA 4QD3A 4RDIA 4HTFB 1L3IA 4HVTA 4JKOA 3HKDA 1SD5A 5AVTA 1KYYA 5BR7A 3AK4A 4EY5A 5KTYA 2P9BA 1XZJA 2CXXA 4DTCA 1DX6A 3UJNA 1JBKA 3T3GA 4J3JA 1UPXA 4ARZA 2CNBA 5F2KA 2C8LA 4PLVA 2F1HA 1F0NA 2R3SA 5BW5A 5JANA 1OH5A 4MW4A 4OXIA 2GZ1A 4H7PA 1V4NA 1H3EA 3H11A 5HF6A 3ZKAA 4CV0A 3PEYA 5HRAA 2C58A 2X8AA 2O4CA 3ROPA 2REOA 3QA9A 3PDWA 4TVSA 1AH2A 4UTVA 3RAFC 4FUTA 4DR4B 2J07A 1NVAA 1Z8NA 2BTQA 1QCDA 2IEIA 1MH1A 3KJFA 3H3FA 4Y67A 1COWA 1IJBA 4HL6A 4XB2A 7AT1A 2DM6A 3PNLA 5EMNA 1T1RA 1GFZA 4O59O 4LFCB 3NALA 421PA 2ZXEA 1FLVA 3R0IA 4YT5A 2OCBA 3HEAA 3C8ZA 3EG9A 5BXYA 5K6AC 1PVOA 3DDCA 2P6OA 1T3HA 1YA4A 2RH4A 1YS6A 1ZK4A 4CFZA 4QYXA 5CB0A 4EI7A 3FB1A 2AZTA 2VPXA 5E8JA 3QQ5A 2N9UA 5ES3A 5FPTA 4OQPA 3WMEA 1RYMA 3Q98A 4AZSA 4JI8B 1V48A 2HSZA 3LHDA 4O25A 1NBMD 3RNOA 2CWWA 4YCLA 1W85B 4HNSA 4UNPA 3ED5A 4UVDA 1RXIA 2QPAA 3RYHA 3PHHA 5DN6D 1BDMA 3PRHA 4HQKA 5ER6A 2HWUA 5G40A 2IBMA 3G89A 4LXIA 2LBPA 1USKA 1Q0TA 1WUHS 1IRIA 4N8DA 1WXFA 1ZQ1A 1K06A 3JWJA 4Y6PA 3VOAA 4KHZA 4LOHA 1ZI6A 1KE1A 1JXMA 4AZ0B 4Q3LA 2F8MA 1DDGA 1K8RA 4CJXA 3DMFA 2BSQA 3ZWVA 5AM3A 3UEOA 2GUGA 1J90A 3TW8A 2ZUEA 2AC4A 1EUQA 4JXKA 2BSXA 521PA 3X1ZA 4YVFA 1L1QA 2AMFA 3W2HA 3ZKWB 3RNLA 4BZWA 4O2BA 2XKBA 4OLJA 3W9UA 3QPUA 6Q21A 3B1WA 4CIYA 1ZUWA 3TW0A 2HL6A 1VBKA 5BUQA 4F5ZA 4GXTA 1GLGA 3WQHA 1B6SA 1ZNZA 1YC2A 3K6KA 5IJ9A 3OT1A 4BJ3A 4P4GA 2AC7A 4PEVA 2WG2A 3P2EA 4P93A 4CL0A 4WQMA 1C1YA 5EWMB 1V1JA 5J2TB 5I7EA 2WHXA 1W52X 1B42A 2JLBA 4U5XA 2FXIA 5KYYB 1IE3A 4M87A 5GV7A 3VZBA 1UM8A 3FOBA 1YKFA 3CLUC 1M1NB 2BEUB 4F5YA 5FOXA 3B1VA 3DDHA 3Q7IA 1GGJA 3OWXA 3JV7A 3CX3A 3AJAA 5P8WA 1MJNA 1N0VC 4FIZA 1YZNA 3M6AA 4CR7A 4HT3B 1EFRD 3KU1A 3A6JA 4EHBA 4FD2A 1H8ED 5KYUA 5BYKA 3TZBA 1PE0A 4Z3KA 1T5IA 2N0SA 1AKVA 1GL7A 4UHCA 5J5AA 4LJ8A 2JZOA 4B8WA 4ZVNA 4JMPA 5KJEA 5KKNB 2WUVA 1SBTA 4HB4A 1MQ8B 2EF0A 2J0EA 4XR4A 3R24A 3VH2A 1TM2A 4BWFB 2PZKA 3JR7A 4L4XA 2VAMA 3OQIB 2D5CA 2BEJA 3M4YA 3LBNA 3M1IA 2IU3A 2ZDHA 5EE5B 5EZSA 1BCSB 5KVSA 1PSWA 2YNMC 1R8SA 3EVTA 1WE2A 2HGSA 4MQFA 4RADA 2OG1A 4B5LA 2ROQA 2HF2A 1A98A 2VHXA 1ZA2A 4K03A 5CDSA 1C1XA 3THXA 1OAAA 1TQ8A 1QP0A 3AL2A 4GDMA 1XJWA 1R0KA 4IGAA 4S0ZA 2QRZA 3O1HB 5KU1A 2B94A 3FWPA 4QXMA 4FBGA 5H81A 4ACAA 4DSUA 1IBMB 3HFJA 2PGIA 3PTZA 3C5VA 4TZKA 4XQ9A 4DEYA 1XEFA 2PK3A 4G4JA 5GJBA 5KWVA 3WLKX 2F9FA 4PLCA 3Q7SA 4Q5IA 5EOVA 1ZG3A 1HTTA 1GPYA 1G9XA 2HLHA 3TR0A 4BWVA 1RVV1 4RCVA 1PIWA 4BX2A 1VG9B 4UEQA 1AO3A 5D7BA 2WKSA 2MINB 4ISBA 2B25A 3HVRA 3ZYZA 3ABQB 4AY5A 1V8BA 3IUPA 3GMDA 8ABPA 1VSQA 2JFOA 3USCS 1V8OA 1GTSA 2CCGA 2ZROA 1QFMA 2B6HA 5KWJA 1WXEA 1JR6A 4C0AC 4KVAA 2OGZA 1TADA 4RTLA 1NW8A 2XTNA 4S2UA 3VUFA 1PZEA 4L8FA 1KJ9A 4LSMA 3PV0A 4N5LA 5ESXA 3W78A 5A5DA 1OH7A 1MA3A 3GLUA 5JQGF 4CM8A 5BT8A 4ZQFA 2XQGA 4QEKA 4DXHA 2IUSA 4W7HA 1E92A 1SC3A 1Y33E 1TECE 1Q6ZA 1Z4IA 4LA4A 5JSZB 1MX3A 1RQXA 3QVJA 1KETA 3WIBA 5DHUA 1XD8A 5AW8A 4D8WA 2OORC 3ENVA 4CFYA 2H2IA 3QELA 4W9NC 1ZOOA 5A03A 4L57A 3MRVA 1JB9A 2BGNA 2WG1A 3DKKA 1G7SA 3WOVA 4E5NA 1AY0A 3EHEA 4HDRB 2CMKA 3L6RA 2ANCA 1U28C 4MP6A 5EXPA 2EERA 2VHCA 4LRTB 3QV2A 1P7YA 3W5SA 1VB5A 5BSTA 4R68A 2XT9A 5CA0B 5EJ6A 4MUIA 1H4QA 1WO8A 5EESA 5BVGA 2XEDA 3U1TA 2YXDA 1RM5A 1F2UB 2FG7C 4I1YA 4GMKA 3TR6A 1G2OA 4IHAA 1COZA 2MTBA 3RWMB 1H42A 1JKXA 4JL8A 4NMWA 3FM9A 5LA6B 4ZK6A 2EJUA 3FDJA 3Q87B 4KFSA 5G0VA 4AECA 3FJ1A 2O3QA 5A6VA 3G5AA 3PGLA 3MFQA 4PN3A 4PRYA 4BTLA 5B3LA 2ZBUA 3W2TA 5THXA 3ZK9A 5FORA 1ELOA 3TZLA 1ZGGA 3BGOS 5TR9A 4H6WA 3KHKA 5FNVA 4Z8YA 1UJCA 1UXJA 2WWTA 4OFXA 1JN0A 1I7NA 2GEDA 1H4TA 2CJWB 3C6BA 1B00A 3A25A 1Y9DA 3NANA 2Q0SA 2SECE 1H9BA 3H0KA 3L6UA 1ZK3A 2WC1A 2JCGA 5CVCA 1ZCZA 1II0A 2XPCA 1U7ZA 2FMXA 3IS3A 3VNSA 1GWNA 1SCBA 1C1DA 1UFQA 2IHVA 2Q50A 2WTEA 3LPAA 4EPTA 2RB4A 1Z0UA 2WVGA 3DE7X 3RR2A 4BQRA 3IGFA 1QRUA 1ZOLA 2GVNA 3PEFA 4B09A 1VFNA 3U4QA 3NDPA 4QTTB 3HZZA 4OKNA 2NU9B 4ZCTA 3A6LA 1LPBB 4GPZA 1J5PA 3R6WA 4R1SA 1TJNA 5EMKA 1XQ1A 4P4LA 1R0WA 2BFBA 3DEZA 3KEGA 2VRBA 3FYHA 3HP4A 1QK5A 4RKRA 1QVAA 2B4TO 1YR2A 5DBOA 2CUNA 5BN4B 4RY2A 3FF1A 1IZ9A 1E3WB 3NO4A 1I2AA 3Q0EA 1U8FO 5JHHB 1Y6GA 1V3UA 2BKVA 3GUCA 2PKCA 4DT1B 1JPJA 2OHHA 2GBLC 2PV0A 1VGRA 2V65A 2W37A 3SM9A 3BHMA 3UW1A 2JIMA 1N2XA 1N3BA 3OEED 2PMFA 3PFBA 2RHHA 2FA9A 4P3KA 2HJRA 3CEMA 4BFLA 4EYSA 5TY0A 1Q3KA 3AFMA 1OOEA 1N5LA 4LSZA 4AQDA 1PQWA 1ZSYA 4K9QA 2XVZA 3UTDA 3V00A 1E5TA 4UVIA 3TQIA 1FBTA 4FEEA 1SBCA 4LAFA 3NWEA 5D51S 1Z22A 3TTXA 1Y9EA 4X00A 4BFTA 3EQZA 1U5BA 5IMSA 2Q29A 2JIOA 2JLVA 4LMBA 1GFIA 3AHCA 1Z6TA 4BP8A 4PZZA 1RAIA 4BIMA 1OBFO 2IH2A 2O2GA 4D6YA 2ZJZA 1X0XA 4WD3A 3SDSA 4FFPA 4BFXA 1Q74A 2JLSA 3TRDA 3KT8A 4TKLA 1Q84A 1QCZA 3CE6A 2FF7A 5BV8A 4Z9BA 3REQA 1KO1A 2ZSAA 1ESDA 3QUTA 2IOFK 4KJXA 4OQMA 2G5CA 3QX7A 4R2IA 1JA9A 4BJ6A 4K88A 2FY8A 3Q5EA 4NBTA 5K5EA 3OUZA 4OYRA 2A78A 5JCOC 1N0WA 4PX5A 3VU9B 2LTAA 1J7KA 2PCJA 3N2ZB 4I6GA 5A3QA 1MEEA 3LQFA 1ZAKA 3U7RA 4BCCA 3UHJA 4I19A 4IRMA 3W7VA 3KSAC 1S3FA 1A7JA 2PWZA 4HSGA 4IAOA 2WMDA 1BWPA 4P5DA 1K6JA 2PMBA 1FQWA 3LT4A 5F1YA 5H02A 1QIKA 3VAYA 1HL7A 1WQ4A 1XRQA 4BATA 3PC2A 3H04A 4GUDA 2ETVA 2ET6A 4HGQA 2I03A 1OE0A 2GNAA 1Z5ZA 2BFPA 2UKDA 3NPMA 4FMDB 5EGSA 4WXEA 3NBFA 2W42A 3J80A 2GNOA 1QFYA 4UCQA 1KIAA 5TXGA 4A0GA 2MSLA 3FIJA 1T8SA 4U9UA 3LRXA 5FWXA 1YRBA 3IUMA 3ZWYA 1XZKA 4I46A 1XE3A 3ZHXA 2J0VA 4ID3A 2B3TA 1O6CA 2GK6A 1FTNA 2A9RA 1UMBA 1YRAA 3GDWA 4GXNA 3O03A 2X86A 2YVUA 5A5EA 4W9MC 1AJEA 2C8JA 3GWGA 4PZCA 2J31A 4RK0A 2E82A 1DPFA 1NP7A 3C74A 3EXAA 4WLOA 5ERXA 2WWHA 1X13A 4IQGA 4NLLA 4RKYA 5TEVA 3ZHCA 1ADGA 1E9FA 1PGJA 3F5FA 1YF3A 3HCBA 4BNZA 1CEXA 2YWXA 1T13A 4G0MA 3VH3A 3CRMA 2QJRA 1EVLA 4IMRA 4GZ5A 1AX9A 1W46A 2E55A 2JHFA 1XPOA 4C4PA 4FWBA 4LWOA 3V4FA 4UM7A 3M9LA 3ITDA 3S2FA 3WLSA 3JQ7A 2FG5A 3BZWA 1ZGZA 1VLVA 2BSAA 621PA 4PV7A 3ZVRA 4EABA 4HCJA 3ETHA 3HNOA 1MX9A 3SR3A 2JI4A 5E4YA 5EP4A 4IH9A 3HLKA 3MVEA 2MMGA 5ESDA 4LSGA 5L53A 4DIFA 4S35A 3UAWA 4EYKA 5JS7A 4MW7A 3CC8A 4UBIA 3EYWA 1WSAA 2Y4NA 3GP5A 4J75A 1V37A 4O29A 3O8QB 4AYTA 5BMVA 3AVUA 5L6LB 4KXMA 1VXRA 2M9MA 3FCOA 3HYCA 3OMLA 2FVXA 2JGRA 4CKBB 3DCNA 3Q8MA 3QXXA 4G85A 3ZNQA 4G5SA 1DG3A 4EARA 1ZY2A 4WE3A 2WVHA 2P11A 4Q15A 1N0UA 5BSKA 2BGMA 1D5WA 1QOQB 3UICA 3FBTA 1EGAA 1CZLA 1GRQA 1TQ4A 1G21A 1YVUA 3GCXA 3LBFA 4JC5A 4NECA 2Q28A 1PWXA 2NW6A 4EFNA 1JDPA 4OLBA 4DG5A 4FEAA 1Z45A 1YA8A 4BB6A 4WZAA 1E2NA 1T4BA 3SQLA 2IYEA 5B6JA 5AVYA 2LDXA 5BYAA 2BBOA 5EJ2A 3OPVA 5EINA 1ZISA 1N1GA 4GXRA 1H0HA 1EQ2A 5K3BA 2Q3DA 3WIEA 1GUBA 5GONF 5C7IO 3EIFA 5TRTA 3PRYA 3CMMA 2B8TA 1XKQA 4DMCA 4M8SA 4NF2A 3GA7A 1P8JA 2YOHA 4HQ6A 1U1IA 3RC1A 3BHNA 2Q6OA 4EG3A 1P91A 2Z8XA 3U3KA 3VOSA 2BEWA 1OKKD 1UJMA 3O3MB 3OZ7A 3UATA 3V33A 2XITA 3WRXC 1BGVA 3U44B 1ECGA 2BHNA 3C48A 4EGCB 1DKPA 1LTKA 2DE0X 2LGJA 4Q03A 7MHTA 1M8PA 3MILA 1XXHB 3LP6A 4OO3A 4BFZA 2W2OA 3K16A 3LDAA 1L7PA 2NYVA 4KOEC 3SD7A 2PMEA 3TD9A 4B6GA 3M6FA 4I5FA 4L16A 4JBGA 1M6NA 3V4ZA 1XTJA 4CT4B 4AC9A 2F43A 2Z5VA 2YJTD 1QE0A 3DO6A 3WLQA 4LYFA 1Q83A 3GLVA 1DB3A 5LR6A 1W48A 3O82A 4D6XA 3EVBA 4QUHA 1F4PA 3EG5A 4QDOA 1YHZA 2ZULA 5KSOA 4A0SA 4DR7B 5BV7A 2ZSHA 3G9TA 1L8LA 5E2AA 5EIOA 4BLWA 4KMOA 3RFTA 3ZXUB 1PAUA 1Z4OA 1IRXA 1NDUA 1R4NA 2VNJA 4FQ8A 4WKPA 3S1SA 1YQDA 3C1TA 5ALUA 2IH4A 3NWOA 2ATVA 2BFCB 3ZD9A 4DADA 2I4TA 1CW2B 2LV8A 4CTNA 3BRQA 3CZ9A 4H6XA 2B21A 4RH0A 4UKDA 3EAFA 4X7RA 1Q57A 3P5SA 4LGYA 2YCLA 5AVZA 2D3WA 3H5RA 4EJSA 4YLYA 5KWEA 5TT1A 3SC6A 4PAMA 3R7AA 2B7BA 1I10A 4DARA 1WEKA 3K96A 4R9RA 1I2CA 4ER0A 5C7LO 1OA1A 4H7DA 1YR8A 1KMIY 4BKQA 3GYGA 1Z4KA 3N28A 4PHFA 4BJ1A 4C0QC 1CP2A 2V5AA 1MABA 1X74A 2B0CA 1Z8DA 1NXXA 2ZSUA 2IXAA 1I3MA 4PC7A 4PVCA 3FKJA 1M2JA 2GRUA 2W6NA 4N6GA 3U39A 1M1UA 1OU4A 1BQ4A 4D9FA 1IOWA 4HRVA 4KO1S 1A4IA 3ZNOA 1IWOA 4RK6A 5CB8A 3F7OA 1JHQA 3A26A 5CFZA 1XD2B 5KJFA 2OFWA 3V4PB 2GN0A 3SPXA 8LDHA 2A9VA 5CHYA 1MOPA 4XTRA 1YS7A 1IB0A 4I5GA 1JVSA 2X0EA 4XUEA 1U1FA 2DHDA 4RXMA 2XYVA 1SUSA 3DKIA 4P4SA 4PTZA 5JSQA 4CEJA 2OV8A 5JZ9A 4C20A 3CLSD 5JCPA 1VLLA 2A5YB 3LDFA 2A35A 4L5BA 4W9RA 3SP1A 4FTWA 4BMDA 4D9CA 4F56A 4R01A 2IF2A 3O4JA 2V7QD 3H1GA 3GRYA 2A6PA 3K15A 1ZW6A 4ZCSA 1N2BA 4DIUA 5GPBA 2P5YA 3U4CA 1Q91A 3U16A 2J5XA 1TAGA 5B2FA 1LCIA 5CVEA 1PJCA 3D0QA 3IOYA 5BW8A 1Y4UA 3I58A 3L2OB 4LZWA 3STHA 3GEBA 2DBYA 3INTA 3F6PA 3NOOA 3W6OA 4AUMA 5AUNB 3E0XA 2CDBA 3V8QA 4O4IF 2PVSA 5I9MA 2VDWB 4C0LA 3ENQA 1THZA 3L7MA 5CVVA 3FD8A 3OI7A 1KI8A 3F8WA 2C29D 3KPJA 4RHFA 3RYCB 4L5YA 4BLUA 3Q3JB 4J3FA 1IM2A 1G42A 3FTCA 1IC6A 1D2AA 2IPAB 1NWHA 1QC5A 2I76A 3GK3A 3PFFA 3MD9A 1Q44A 1ZHHA 3HM2A 4RZ2A 7ABPA 2A0KA 2PT9A 1FFBA 2YJ5A 4LYEA 5KNBA 2FW7A 4CLDA 5LXTB 2FZEA 6ABPA 10MHA 2RGNA 4ZVSA 4CF6A 1QIDA 4M54A 1UWLA 4I4TF 2IC5A 1UZNA 2RD2A 1B1AA 2OP1A 2XNHA 4K9SA 3TRIA 4F71A 1MV8A 1JKJA 1UBHS 4PYKA 4UU7A 5I8PA 4JASB 4YY3B 4MJ7A 4P5PA 4K7JA 1GN8A 2FHPA 3GDOA 2JI8A 4L4ZA 4L4UA 3WTBA 3KQVA 3WNBA 5DEOA 2W6CX 1LK7A 3CUSA 1LDEA 1ZM9A 4UUOA 1W87A 4WLNA 1AKQA 3PPYA 3L1UA 1H6BA 1M5UA 3QPVA 2F1RA 1H9AA 3ZQJA 3OZEA 1V6SA 4AJ1A 4BE4A 4LN1A 1WWKA 4DZZA 2R8RA 3EDCA 1FMTA 2MSWA 3UB3A 3LW7A 2J3QA 1YCDA 4LVOA 4XGQA 2CDAA 1HYBA 1IXYA 4YR7A 2J0UA 1L5GB 4FR5A 3V8RA 2VEDA 1M8JA 4YMTA 2Y1DA 5AM0A 2R1VB 1U2PA 1NKVA 1NQWA 2MSEB 3KFLA 1HDOA 4IH1A 3UG7A 3WK6A 1FNMA 1GZUA 1CJKC 2PLNA 2RC6A 4MYRA 2QV0A 3SEZA 2AK3A 3WLHA 5HFNA 4I8XA 3L7KA 1NQAO 2H48A 3HVUA 3ZYCA 1SOAA 1FXSA 2V6BA 4C2AA 2A59A 1JIUA 3ELDA 1I33A 4JENA 3ET4A 2PH3A 4NJOA 4Z0NA 5EGNA 4OY3A 3HCPA 3RS9A 2CW5A 2PUVA 1E9AA 4LRWA 2FLKA 1OIXA 5CNJA 4CV1A 3AR7A 4I3GA 4F04A 2AN3A 3OOJA 5KQPA 5MDHA 4KIUA 4FVTA 3FPBA 1P9WA 2ZT6A 2EKQA 2QYTA 5I4KA 1HDXA 3A36A 1WG8A 2OM6A 2ZKLA 2OOKA 1TEHA 4X1YA 4Y9UA 2QR2A 5CYOA 4N9WA 2VHTA 2CDNA 5DGIA 4XIGS 1RXYA 3ZDZB 1JNYA 2AKEA 1JEOA 2CCJA 2OMEA 5T6BA 4XGIA 4G0XA 4DR1B 3VC7A 4D4JA 1GAXA 2H5EA 3KKMA 3K6SB 2P9ZA 4XQGA 1JSCA 2ID9A 4HUQB 3WK9A 1N4DA 3AU9A 1IY0A 3N0XA 4UUAA 1R9GA 3GMIA 2XWQA 3FAKA 4J0QA 4ABYA 4CU2A 3CZQA 5KS2A 2G6BA 3HUUA 2WNHA 2QRJA 2B2CA 2AJBA 1E4OA 1ZM2A 1T3LA 3NBXX 4NATA 5FPQA 1SCKA 2PQ2A 1C5KA 2PPLA 4K9PA 4WASA 4YRRA 5CD9A 5JUWA 2VZEA 1W4LA 4QGGA 5LZ5A 5KQMA 2XGGA 3FZYA 1PU2A 3HJRA 2J6HA 3FBWA 5AI9A 4LDAA 4WXMA 1U8TA 2GF0A 2DXIA 1QYRA 3BA6A 1EDOA 5T8KC 1Q0UA 1QHXA 1YFKA 2EBHX 1ML4A 2XDYA 2JH3A 4NOJA 5LNK1 5AHKA 1U9CA 3BAZA 4NYJQ 4A2QA 4JI2B 3N87A 1VJCA 4YXFA 3N8NA 4NY1A 4B9EA 1TO6A 1AGPA 4QYSA 1YCFA 4W6QA 5AI0A 1TPZA 3G02A 3ESRA 3DPUA 1V7QA 2JLWA 4BNLA 4M9XA 4G0WA 2X0FA 2X40A 3W2FA 3GG9A 1RBZA 2CXNA 3S5UA 3VPSA 4JB2A 2IW1A 3I2IA 1DC8A 4OP1A 5ICEA 1Y4AE 3A4TA 4IFIA 5BSFA 1O97C 1W8IA 5LYYA 3WRYC 2WJVA 5K03A 3GDGA 1NKTA 1U4NA 3TNDA 1KI6A 3ZDAA 1EDEA 3PT9A 4ZT4A 4BIIA 3PNBA 2XBMA 2QZJA 3FDXA 1J49A 2VTDA 1XZIA 3RSLA 2L82A 2H1IA 3G8CA 3MQFA 4ALIA 4INPA 1UUFA 1PDVA 1RQLA 5LYJB 3C70A 4F4DA 3K0SA 1E0DA 1IDOA 1MVNA 1DIOB 1ORTA 2F1IA 3CRQA 3MT0A 4UTXA 3VO2A 4FM9A 5EZYF 5FA6A 1PFKA 2YFYA 2H52A 1G8KA 1BXKA 1BKYA 3RRXA 3CSUA 3EUWA 2VLBA 4R9VA 4ESOA 4NJEA 1X8KA 4ND8A 3WK8A 1FTGA 2HCRA 4YMVA 5CDHA 1QXSA 4MEAA 1JT9A 1JAXA 3HUTA 4R84A 4EPXA 1E98A 4NHOA 4F7WA 1R74A 3W8RA 4C3UA 1RLOA 4R1LA 4R16A 5CFPA 1P4HA 1Q22A 3BD7A 4HNHA 1D9XA 5ANRB 3ASUA 1F2TB 2HUNA 3I9FA 3QUCA 5FLXA 1QYXA 3OSUA 2WM8A 3QJGA 1NBAA 2VO1A 2FP4A 2VVTA 4UMFA 4CEIA 4BY9E 3IV6A 4ZQBA 2ZIAA 4IKOA 3QFFA 3T99A 3LQKA 2Q41A 5FTWA 1E7YA 1JH9A 4HJRA 4DEXA 3TTVA 2JGMA 1GT6A 3C43A 2PMWB 2R6DA 2Q21A 3JQ8A 3JVUA 4HDSA 1YNOA 2DFNA 1CUSA 1KOFA 4I0WB 3THWA 3UJDA 2ZRKA 2GTPA 2I62A 4J0JA 4F91B 5DPMA 3CH4B 4R4JA 4BO6A 1IU9A 1U0GA 3QVTA 1NXVA 3KC2A 5PNTA 4D56A 5K3FB 1G7CA 4AN4A 1YZQA 3EGXB 2GBIA 1FLAA 1XZGA 5MHTA 2IYXA 4IIJA 3ICWA 4FFWA 1LLQA 1ZIDA 4EG6A 1LXCA 3VHRA 5J23A 1ST2A 1OX5A 2ZRGA 2WK1A 1JFFB 2IKSA 3QHQA 4MTLA 2BCJQ 2PY6A 5HBGA 4LE1A 1GCIA 5IAJA 5HJ7A 4FYHA 4CFSA 2VAVA 4B87A 2X4LA 4GOXA 1UK6A 1O2DA 4ER7A 1CNEA 4N7JA 1MEOA 2RK4A 3OO0A 4ZK2A 2EC5A 2VTVA 2J5QA 3UKDA 1D8TA 1V9LA 4UUMA 2NU6A 5DYYA 3NX4A 2ZRQA 3U7QA 1O94C 5GINE 3OE1A 1ONNA 2RGBA 1U8CB 2ZB8A 3CWCA 3D31A 1CYDA 4KXXA 4DAOA 2D3TA 4FIDA 1A77A 2BM1A 2JCBA 2V7PA 3KELA 1GA6A 2I87A 4KIFA 4Y2RA 1VMKA 4CKWB 5T41A 3WMGA 4IDBA 2O4UX 2YFHA 3CTMA 4FYYA 4AF6A 1SBHA 3BFKA 4HDMA 4QA9A 1T2FA 3CNOA 3U62A 3CNNA 4IFTA 1RCFA 3O1IC 2H5LA 2Z04A 3DE2X 1BOOA 1AF7A 4PZUA 1K8QA 2I8AA 4ZVPA 1WKCA 3NHRA 4FYWA 4S1NA 4RAOA 5E9JA 4EX6A 1MIOB 4YMIA 4WBNB 5INTA 2ZYDA 3K0EA 4IDNA 4TYNA 1AS2A 1KGDA 1E2GA 4ON9A 4IHJA 1CZHA 1PJZA 2VF7A 2ZJBA 1PT8A 2WHYA 4LTNA 4M1YA 4DNPA 4Q7EA 1JLMA 3E22A 4L0CA 2W4QA 2NU8B 4URYR 3L0YA 5ILGA 3U2QA 3DLBA 3GDFA 2P6MA 3W3AA 3RVPA 4Y2JA 4DUGA 1CUJA 3CISA 4OYHA 3S2SA 1XRNA 3AHIA 4JJ7A 4YJ2B 5JZOA 1G8SA 3T5BA 5EIBD 1SQ0A 5E6UB 1JYEA 3H6KA 1C7EA 3KOUA 1ATZA 1PK8A 3ND6A 1GG5A 1L7NA 1N2CB 1WMFA 4UU8A 2ZLBA 3HXQA 4H16A 1KJIA 2WWYA 4H1TA 1FJHA 1XZNA 5EPUA 1XROA 2IZZA 2DERA 1R12A 2CXRA 3HM9A 1NXPA 4KBYA 2AQHA 2O5RA 3E2IA 2IVFA 4F3CA 1HT0A 3IT2A 4RGVA 3ABSB 1LJ8A 5B3KA 3F9IA 4Q6BA 1Q7BA 3R20A 2AFHB 4OGLA 2B82A 4Q3DA 5KTRA 1WB5A 3R7DA 3WJAA 4FZ3A 1ZMXA 2PTHA 4C14A 1NMQA 1PZGA 1CJSA 3UK1A 2BZ0A 4AJOA 3GLIA 2AV6A 4Z4EA 2KQUA 4OL9A 4MQBA 1PR1A 2ODQA 1EVEA 4UEOA 1SMKA 4E4RA 1SQ5A 4XVCA 2Q5IA 5KDDA 2ZWMA 4S1VA 1N34B 2XY4A 1VE5A 4COOA 2ZM6B 1A96A 2OCDA 4LJ9A 3WGJA 2XODA 4B9AA 2ZIXA 5J2TF 4H31A 1I4DD 1GNQA 2VPZA 1XK7A 2J08A 3EIXA 5DTRA 3HLTA 1CXZA 1I9GA 1UQUA 4JAVC 5HFJA 3KETA 2Z2KA 1YWGO 2Q4TA 4IIDA 1W35A 1Y7TA 2HPAA 1ZITA 4QFCA 1NRJB 1E0JA 4YEDA 4YRMA 1VLZA 5HZKA 1O6FA 1JU9A 2FE1A 4REOA 3TJMA 1VC2A 1WUYA 2QIPA 1JAHA 1QQTA 3FGOA 1T36B 4B3CA 1JGTA 1PJBA 2W4MA 3QE4A 1Z73A 1K63A 4GYYA 4MPPA 5EWJB 3UMCA 3VNQA 4C4OA 3RK0A 3E48A 2WFLB 5U4QA 3A4LA 1KQNA 1FSSA 3TINA 2HOQA 3GT0A 4G4SP 2IPXA 4TXNA 2CUTA 3ETEA 2JBAB 1IQPA 1VJRA 1LNZA 1RKBA 2VAWA 4KSBA 1I5OA 3V4VB 3QPWA 1E7SA 4A91A 1TZKA 1GNVA 2HN9A 4RY0A 1NNLA 1EVZA 2XUHA 1BJTA 3VR4H 3ENZA 3ZY4A 5LZ9A 1WVGA 4QTXA 1RJ9B 3OJFA 5LDHA 1E2KA 4RVHA 3VU8A 4F5EA 1NTOA 3DV0B 4YB8A 3EC2A 4I81A 1P39A 3T7EA 1U2GC 1Z4JA 1P80A 5AP9A 3IAS1 4EKYA 1EFTA 2FK7A 4BC1A 2AEJA 1UODA 2ACWA 1PGPA 1VCHA 2G08A 3WYNA 4WY5A 3AVPA 3VH1A 3S0JA 2ESRA 5I4BA 1SRRA 1YR6A 5IK2A 2QX7A 3EPRA 4XWKA 3ZTYA 2CYAA 2CHUA 4BE9A 3IXMA 4PLHA 1PLKA 1UAYA 3BZBA 1U6JA 5AK6A 4F96A 2IZ6A 3BSWA 1ULHA 9MHTA 3WHIA 5J2UF 2YJ4A 3GHHA 1ZC4A 4K6KA 1R9MA 5A02A 4M0KA 4PX9A 2WNIA 2XWBF 3Q3HA 4XIIA 5TPWA 1DPGA 1C1HA 1VSVA 3G85A 2OV3A 3GRUA 4LXHA 3QUSA 2OQRA 3QI7A 4RFSB 4X45A 3DMGA 3QFRA 4IJ6A 1KR2A 2BKXA 2Q5CA 3C3WA 4UBJA 3SHOA 4BJ5A 1LLDA 1V1MA 1D2CA 1U80A 4NFYA 3PXCX 4LF6B 5KJCA 3GAAA 4HLNA 3LQ1A 3F74A 1LWOA 3OQJA 1X38A 1T2UA 4Y9SA 1FOEB 2WA2A 1ZRNA 3GYBA 1VJDA 5IJ0A 1UMCA 4G24A 1DIGA 3VRHA 2GASA 3OPYI 4E0BA 1TEZA 1TYDE 4JVOA 1HETA 2O3JA 2EXXA 1IY1A 1LRJA 1SA0B 2BF7A 1KXJA 3PHBE 4EQ6B 3IUBA 3WB1A 4P4TA 4KE8A 1A9RA 1UAGA 4R2WA 5ICSA 1N2OA 4L3WA 3HI6A 2ZZMA 1O0SA 4QM6A 1FDTA 1E3LA 2PU7A 2BLLA 2PJUA 3EF1A 5AOVA 5CA0F 3KU4A 1X6VA 3TB6A 2H07A 1CY2A 1S3GA 3L4BC 4OD0A 3V5NA 3WXMA 5K0SA 5KOIA 2IS1A 4F3NA 1F4VA 4FONA 1ODCA 4O2AB 5LA6F 2ZCVA 4Y7DA 1AKMA 4OXRA 3PFIA 5D86A 5TS2A 3LUBA 4BEWA 3I64A 3CSSA 4MRRA 4PS0A 5KVCA 1IG3A 1R0CA 1DMRA 5EVCA 1RYHA 4J0HA 4NEQA 5CCXA 5I4IA 3RW9A 5CD1A 4J0KA 2DLCX 4M0UA 1UBTS 4I1PA 3GA5A 4ZIRA 1MG5A 1M33A 1NXQA 2WP8J 4U7PB 5HUQA 3FLEA 1U11A 2PZMA 2R6CA 1ZC3A 2VPTA 4HDKA 3ABZA 1WHTB 4ALJA 4ZV4A 3PWZA 3WK5A 1ZUNA 5ELXA 4YUWA 3R8XA 1UZUA 2J6IA 1AGXA 1EJ0A 5CNKA 4ZI3A 1JEQB 4RDHA 4Z9FA 3T4UA 1QHSA 3P1JA 3C3XA 2EKZA 1KP3A 2A9PA 4WT7A 1A97A 1GTL1 5L3RA 3AUKA 4QUEA 1URPA 3I1YA 2ODNA 3JALA 4JJEA 3E3OA 1GYQA 5JTUA 3HZOA 3L77A 4B3FX 5KYGA 1OYWA 1Q77A 3DL4A 5G1OA 2HDOA 2KYRA 4DIOA 1KPGA 1SCUB 2FMIA 3I8OA 3B3JA 4N3AA 3EXHB 3LSYA 2CFSA 3H86A 5F3DA 2IPMA 1HYQA 3OZIA 1U3FA 4J2OA 1MUUA 2AX4A 4UHBA 3VUEA 2NP6A 5TPZD 2EJWA 2EDCA 4OM8A 2F64A 3VZDA 1Z5NA 3WB9A 1BE1A 4D9IA 4GRIA 2IRWA 1W6UA 1WIWA 4KTTE 6YASA 3KYCB 2PUFA 5IVPA 5C35A 4HH0A 5DTEA 1RFGE 3A1UA 2PLAA 2GTHA 4M7WA 2HHJA 4C5BA 5C3UA 5AKZA 1IHDA 1IOLA 1KYTA 2D7CA 4A0HA 3KL4A 1XTPA 3GN2A 4LRXA 4D8XA 1O6BA 2BGWA 4D8UA 1MDFA 3BMQA 3OZRA 2C2GA 2I2XB 3AW9A 1S8NA 2ZI9A 3K2QA 1EFVB 1VL5A 2ANBA 1NZDA 1WM1A 1EU1A 4TRRA 3OC0A 5CLFA 1NLUA 3O90A 5L3SA 2GD0A 3CZCA 5AJTA 3U3XA 3EVFA 1CZOA 2CJXA 3HE3A 4FGUA 3HJHA 4ZZIA 3VNUA 3W9YA 3CZPA 3DLAA 4R8RA 4N40A 1F5SA 2GDZA 4U7HA 4H3KB 1DADA 9LDTA 2WQZA 2COUA 3HK2A 3QEKA 5CB4F 5MN6A 5CBPB 4QDJA 3AEUA 1U3UA 3RK1A 3ISJA 4CQLA 4A8JB 4D0NA 1E69A 1WCWA 2HPVA 4IM7A 4JXJA 3MINA 2ZSFA 1GLVA 4MQEA 3ECCA 4JYPA 2JFBA 3CSDA 3FX2A 3L49A 3LUCA 4Q6WA 4Q4AA 4BU1A 4R0MA 4FS3A 3WWPA 4X1IA 3T9EA 3L40A 3PJRA 1RLUA 5HJ2A 4PRLA 2VDLB 5JAIA 1KC1A 1CZNA 4U3JB 4RMHA 5L3QA 5AUQA 3D8TA 2XVXA 4QSMA 5HDQA 4KNWA 3EQ9A 3AF1A 2Q1UA 3AIOA 5J4LA 3PNOA 3THRA 1O08A 1KTVA 3NWBA 1NC1A 1XEXA 4K87A 2JVIA 4NG5A 4EYOA 1P4AA 5JS6A 1STOA 4L22A 4RZHA 1PR4A 4MMZB 4HATA 5KYWA 1HV8A 1EZ4A 3JQ9C 3S1AB 3LYLA 3MOGA 3EC1A 3W8FA 3X1XA 1RPNA 1HDEA 5HA5A 3BSYA 1NN3A 3EAQA 3EFBA 3IULA 3NP9A 2ECFA 3DAHA 1HE4A 3EULA 4RLHA 3V7FA 4V1CB 5C51B 2RHBA 4MHSA 2AD1A 5AW5A 1MAVA 2R2GA 3WGUA 5A5GA 1I1OA 2PYDA 1B74A 3EYAA 3KVYA 3L84A 4XR9A 3WNVA 3ESAA 2FN8A 1TO1E 3LI2A 4KPFC 3C3BA 1TFUA 2IEDA 2F2TA 2FPPB 3NJ8A 2P5TB 3DOUA 2ZETA 2V58A 3T1TA 2G3YA 4A4DA 2ZBQA 2C2KA 3EUEA 3AB8A 1DXQA 4P7JA 3TFOA 3VI3B 1C9YA 3K4HA 5ES4B 4A10A 1PT9A 2HLNA 4BRSA 5JAOA 4F06A 4I9HA 1C7RA 1NOJA 1GUFA 1I0LA 3K0BA 4G0NA 2WDZA 4PPYA 5DOZA 1OLXA 5J4KA 1JHZA 3AY0A 4XCQA 3QVUA 4XZ3A 4YJ3F 2D62A 4AFNA 5B1EA 1KEEB 1OHHA 1NSTA 1ODJA 3SQOA 3H05A 5FAXA 3AF6A 1ESEA 4OK6A 1MAAA 4HF7A 4HN4B 4Q93A 4RANA 1YGPA 2NV6A 5EFZA 1D2HA 5JVDF 4ADSG 3F8TA 2OCPA 2WUFA 3K0AA 1D7OA 1WTAA 2C00A 4ZGWA 4EGSA 3FPHA 3OQ6A 3VR6A 3CE9A 1DNPA 4HAOA 5EHQA 5B2ZA 2X6RA 3WQRA 5K2OA 1PTKA 3WI7A 2AR7A 2Z9DA 1KJZA 1KAHA 3D3EA 4MIEA 4XI9A 1WUIS 1YJ5A 2WWXA 5K1ZA 2WJJA 3S2EA 5FAKA 4V2UA 2NNLD 2GPNA 2J3MA 3WKDA 2EBWA 2WSLA 1J21A 1NL3A 1QAMA 3NGLA 4WBXC 4YP6A 2FCAA 1P31A 1SGWA 4BNDB 1QE3A 1PG0A 3WGTA 2HA3A 4F3YA 4I8IA 3T94A 2SBTA 1EG7A 1M75A 1Q50A 5D6NA 3RIEA 4UQOA 4FXPA 2B9VA 3HCAA 3SF8B 3V8PA 2W22A 1IY9A 3Q6NA 1ZK0A 2RGNC 2SICE 3BBLA 1XMQB 2F3RA 1DAFA 5AKHA 3F0TA 4CHGA 3O4IA 1MNQA 3LKZA 4EATA 1GILA 2RBKA 1A95A 4P35A 4TSKA 4TYMA 5DE3A 1CE8B 4ER6A 5I7FA 3L05A 1UBEA 1UDRA 2UDPA 3TTSA 3ZK8A 3TQRA 3G0IA 4GYJA 4FDTA 4NNPA 4V0QA 3HHEA 2PO5A 2VDKB 4KAJA 5D84A 1KERA 3SMVA 1TUBB 5TVKA 1VE7A 1R4MB 1XBTA 2QJFA 1VBMA 2QF7A 3I2HA 3QVSA 4G5XA 4RXTA 3ADBA 3EBOA 1BN7A 3GJSA 4K3VA 2BGIA 3LBYA 3LD9A 4M1SA 4N54A 1HKHA 1L8OA 2ZDGA 4DDUA 5JH7A 1H65A 2WE7A 1X0VA 4NQRA 2FN7A 3KPUA 3T5CA 2RBEA 4TMYA 4AJLA 3M81A 2F55A 4QIHA 2NU7B 1HQYE 3WIVA 5K0CA 1Q0LA 5BSRA 4I55F 1ZKDA 2XA1A 1TF5A 1UXHA 3FZNA 1B8UA 3GFRA 3D2CA 4FN4A 5CFNA 4UTPA 4RTSA 1DOHA 5H16A 3C4QA 4BVBA 4AUKA 2RHWA 3B6KA 3GJZA 1HA3A 2OYRA 2NWQA 1W2GA 1Y6ZA 2QTLA 2R8BA 5TGZA 3U4MA 2ECOA 2AHOA 3BILA 5DNWA 3BJEA 3M4JA 3N05A 4X0EA 4DZTA 3IEXA 4UAUA 4JK3A 3K35A 2OGWA 1EDDA 1SHTX 2REQA 1Y0BA 4MH0R 2TECE 2WIFA 5K4GA 4MW5A 4R8KA 5EP2A 4UE2A 1BVRA 2SCUA 4NWIA 1WCIB 1X7DA 4IUCS 2F6RA 2ZBGA 4LHVA 4EUFA 2FOLA 2E4WA 2WU8A 3VDQA 1PD1A 3M6LA 4J91A 2Q3JA 4QFDA 3KXKA 4E5DA 4B3TB 2ZE7A 2WTUA 3G2NA 2C7RA 3OQPA 1EXNA 1AT1A 2A3NA 2RKWA 1JDVA 3TIGA 2PLFA 3DKVA 1Q1ZA 3HZHA 2AOTA 2ZJOA 4LF9B 4MR7B 2G36A 3EDYA 4CCWA 1RQRA 1YT5A 5JU6A 1SIWA 1K0FA 1A5ZA 3P9IA 4X20B 3KV1A 3G7UA 4MQUA 4NARA 4JIGA 1I7QB 1ICEA 2V7WA 1VE1A 3DB1A 2OBLA 5DW3A 4X97A 3OWOA 4AYWA 5C53B 3ZXXA 1II8A 1NPTO 1NI4B 3V8VA 1N5KA 4Z2YA 1V11B 2C07A 3KKLA 3OJXA 2HEIA 4QBTA 1ZK2A 1XDBA 4LE2A 3JARA 3OU2A 1HBJA 3HRIA 3UJPA 3KXIA 1XPJA 1H85A 2GD6A 1OF1A 3BTOA 4LDZA 5AM5A 2HQSA 2Q6TA 4MUKA 5H3LA 1FRVA 2EP7A 1RC0A 1GSHA 2OD7A 3WKBA 2FR8A 2RMKA 5EN4A 5TF4A 3TRJA 3OKFA 4F46A 2C95A 3DE5X 4W5WA 1GGEA 2W58A 2YN2A 3DL7A 4N6OA 4BAZA 1V6CA 4Q9LA 1PR5A 1TQDA 5M2QA 3SWWA 1L9XA 4QAQA 3IBGA 4BP3A 2JA2A 2VP0A 3DTNA 1J00A 4RKQA 2VJKA 4NYMR 5AXAA 2O59A 3ORRA 2P7IA 4BB0A 3HWSA 3MWEB 2I6TA 4MV5A 2X22A 2I3ZA 2RIPA 1CF2O 2JPDA 4L51A 4O4LB 2ZU6A 1XZLA 1AK9A 4IDDA 3S7TA 1LEHA 1XAGA 3K4PA 4JBLA 4YLEA 2IVZA 4DBLC 4DWVA 4ZDIA 3EXG2 5I5EA 2QN7A 3UKOA 3U9SA 2H2AA 4HB0A 5JG7A 2VLIA 1UWKA 2J9FA 3IE0A 1CK4A 2QJOA 2O07A 2QLMA 4RPCA 2IYSA 5EHXA 3X0DA 3ZLVA 5HUJA 1RQ2A 3EQ2A 2I2DA 5DP2A 4TKMA 1L7OA 4MV9A 3FOAA 2ODTX 4FBMA 4BRWA 1HLDA 5TNXA 1D2EA 2XSZA 4DANA 1S2NA 2Q3HA 3EXIB 2OZEA 1OJ7A 5DYNA 2W2NA 3BVPA 4Z0PA 1TA0A 2FOIA 3MA0A 1BXRA 4NVRA 3D4PA 2WJGA 2HCFA 2QYOA 3G1UA 5AKKA 1AGYA 1E3MA 3JQCA 3M8KA 1E4YA 3IPRA 1QRDA 4FSDA 1J70A 3TQSA 1UIRA 3MCUA 3P0IA 3R3ZA 3AT1A 4XYBA 4KFUA 1WQ1R 4JLMA 4N7RA 3MBIA 2E4AA 3I3SR 2I9KA 1SVUA 5KKCA 5SYNA 1S2IA 5DNYB 1P1JA 1AXGA 1IY8A 3CG4A 3DPSA 4FW9A 2JI6A 2UYHA 3F2VA 3AEQA 3R6TA 2HHHB 3PBKA 5K0ZA 4IXDA 5BRJA 4DTIA 3GV0A 1ZRMA 2Y77A 4DWWA 3BSFA 1GV1A 1W9MA 2Y67A 4HWRA 2CJPA 4ZKEA 5KIAA 1H93A 4R7ZA 4KXWA 3AJDA 3CN7A 4UUPA 5JFOA 3MWDB 3Q9NA 3KTAA 3V34A 2AL7A 2YUIA 1ZN8A 1JQJC 2FSFA 3T9DA 4GE0A 3VR3A 4LMAA 1CVRA 4ARVA 1E94E 3EXEB 4DV4B 4KQIA 1X80A 3PC8A 4ZARA 3ZWMA 5EIEA 3FAZA 4OQDA 2FZ5A 3GNQA 2CZQA 1UDXA 1P17A 1UKZA 1NFFA 2D54A 1GPNA 4HQRA 4HYEA 4KLZA 2RGCA 4Q1CA 2DWUA 3S2ZA 2W2XA 1JXQA 1RKVA 2OBFA 1VZ2A 5FI5A 3RS0A 1N57A 3L6DA 3RRJA 4KWCA 4M46A 1UK9A 2PX8A 2V0CA 4PC6A 4ZYXA 3C6KA 4WUVA 1YUBA 3HQ4O 1ONOA 2RGRA 5FFFA 3ELWA 3EPLA 2Q3CA 4DV2B 2O0JA 1UK7A 1WMEA 1PO7A 4PZPA 1CZRA 3FUXA 4LKOA 4U7GA 4WZZA 2PNJA 1YBFA 2QZPA 2REBA 2QN3A 4BNWA 4C7XA 2ZBFA 4PHGA 5KSPA 1QF9A 1E4EB 1ORWA 3DONA 5IM4F 4I3HA 4GOMD 4NOLA 5EE0A 3ED1A 1Z5OA 1ZU5A 3WA6A 3OH8A 4MVJI 2R1TB 4OJMX 3RRMA 2IUEA 4BQNA 1U7OA 1AGNA 1T3TA 3E53A 2JFYA 3DP9A 3L41A 1TO2E 1QANA 2E4XA 2VAXA 3GEIA 3AU8A 3MCTA 4XLLA 5H3HA 1D9ZA 3DZHA 1QIHA 1OBHA 3U7GA 1A1SA 3NVDA 1QIGA 4X95A 2XCLA 6AT1A 5A9TA 2GBFA 1NHWA 1HY3A 4HB2A 1RC1A 1EFKA 3L8DA 4DCGA 5HJ5A 4WXHA 4Z4GA 1ESNA 3F6BX 1JKMA 1FRQA 1XTIA 4IINA 4DL9A 4QVIA 2Y9MB 4KEAA 4D3FA 4IOJA 5FP0A 1RWNA 3WGVA 2ZTHA 1XN1A 4LOKA 2FQYA 4MR8A 5DGTA 4YCCA 2FLWA 3QSGA 1G60A 4LQ4A 4MUEA 2PN1A 2J48A 2H4FA 3H5IA 3PIIA 2RE8A 3RWBA 5KMGB 3H9GA 2GUWA 1RHUA 1EM6A 1UJ2A 3W4KA 5FLKA 1BDJA 2CLDX 1NVBA 2WAMA 3IAAA 4FOOA 5K8CA 4AM8A 4BMNA 5JOQA 3A3NA 2O20A 1LV7A 1RYDA 3ZOKA 4UOZA 2WHPA 4X8HA 1SY7A 3OHPA 2FQQA 2XAAA 2YL2A 2ZU0C 5EXSA 4DCJA 3PRJA 1T6BY 3WY9A 5BURA 4AJIA 4A0RA 2UZIR 3CLUD 3SN6A 1BRTA 1EWYA 2ZRCA 3ZDDA 2OD9A 1KSJA 1EK2A 2C4TA 1L5FA 1ORIA 3MMNA 2QLJA 5K6RA 4B6FA 2EEPA 1O4WA 5FOSA 2ZYVX 3I0ZA 4GVXA 4DA4A 1CD5A 4B80A 5IT9A 2WU0A 4ZAVA 3MT9A 1U65A 3Q0TA 4ZGGA 1A3CA 1V8PA 5J9FA 2BW0A 4CMAA 4DA9A 1ZPDA 3AKDA 1EUCA 3DB2A 4XPIA 1THTA 4N4AA 1CR1A 2YWHA 4NAVA 4PZLA 5LB4A 4C4XA 3QKIA 3F73A 2MDTA 3PUYA 3AEKA 1RP1A 3OOEA 3G79A 2AGVA 3PVSA 5DP1A 1FU4A 3U0VA 3T4XA 2NV2B 4MDFA 1NGSA 1J42A 2NACA 5SZJA 3EZFA 3GEGA 5JDIC 1PQUA 2NGRA 3C98A 2YNMD 2CF5A 3HVHA 3TLAA 1A7KA 1L8XA 4E3WA 2YZNA 1S4MA 4NZYA 4H1VA 4M36A 3TEFA 5DHFA 3NBZC 5JR3A 2EZTA 5LOVF 1MO5A 5B1IA 4ML3A 5LDDC 4PQGA 3EEQA 1K5HA 3AY6A 1XLUA 4RF4A 3W3AD 1NLFA 4NCHA 3SU8A 3W79A 5B4TA 2O2HA 2VXCA 1BX0A 1EZZA 2O2EA 2QT9A 1J8QA 1R88A 3BOSA 3R44A 4WINA 5FOVA 4H7FA 3T1YB 3F6EX 1Z2NX 3G9XA 3N2YA 4R2XA 4UJ5A 2FZGA 1Z63A 2A1TR 3DOEA 3EXFA 4G5QA 4ZEWA 3ROXA 1GZ4A 4IOKA 4ZXFA 4UAJA 5FPYA 3VX4A 2V5UA 1F20A 5CPFA 5E3JA 1AQLA 3F71A 3LQQA 5E0OA 4MPJA 2EGGA 2M6SA 2HYIC 4QDTA 3R9IA 1UBSB 3CUVA 3BIJA 3BRSA 1YDGA 4A73A 3KQLA 3FGNA 4KP7A 5LZ7A 3ZIDA 2AQKA 3ZCUA 2B83A 2JGLA 3AVOA 5DM60 3E5NA 1JIJA 3C6QA 5JCJD 1SZDA 4CKZA 3BT7A 4GBMA 3TJRA 3I9V1 3NXKA 3I92A 3QWFA 2CFRA 3QRWA 2O2IA 1CEQA 3A1DA 4FHZA 4JNKA 4ND3A 2I6UA 4MCAA 4ZT2A 5EJIA 1E8DA 1FFEA 3BF7A 2BFEB 1NURA 3MUOA 1U4SA 4IDAA 4INAA 1E2DA 1XDWA 4RIIA 1FA9A 3T9AA 5K8UA 3CVXA 1LKZA 2B9EA 3F7MA 1SVIA 3HXLA 4HQOA 1WHSB 3UJ8A 3BH7A 2X0NA 5M3BA 1DJOA 4JR2A 3BDIA 1M6VA 3HL4A 1R0RE 4K8RB 5ISMA 4HH3C 2IHUA 2BMJA 3KZVA 3WICA 3WYGA 1GGFA 4AMVA 1ZD4A 4WKNA 3HWWA 1IPHA 1T2EA 2QP4A 5AW7A 3FJOA 4XGKA 2NTEA 2D06A 1IVSA 1RFLA 3ZTTA 1VYVA 1GCGA 3INNA 1IHUA 5F7XA 3JQFA 3WKCA 2OZVA 1II9A 4P83A 2YXEA 2WM9B 1EX1A 3FUWA 3N2LA 4KX5A 4F5WA 2JLXA 3PUWA 1IJEA 3D6VA 4GM0A 1QBKC 9ABPA 1JXOA 5M7EA 4O02B 1E61A 4Q7KA 1ODSA 4IIXA 4K1XA 4DMRA 3VMMA 1HX7A 5FTNA 5BWCA 1KIMA 4XJXA 2QSYA 1E2FA 1CNMA 4OHXA 1GTZA 2Y0PA 2IYWA 1OQAA 3MFYA 4RV5A 5TDHA 2FEPA 2PRSA 3CCBA 3G59A 4NE9A 2F67A 4G1EB 4DSTA 1KDYA 3MT7A 1IEWA 1LX6A 1SKYE 2ADMA 2KW5A 3EJ6A 4A1FA 2G40A 4MLPA 1LNQA 4KXLA 4EO7A 4V0NA 4G4SO 4DA6A 1MOZA 2WIGA 3TK1A 3DMYA 1MW8X 3CCFA 4JEHA 1RPJA 4LRSB 3MWKA 4Y6QA 3GLGE 1CF9A 1OX6A 2J87A 4UM5A 3RRZA 3N0RA 4ZTZB 3HSYA 1TVCA 4MLDA 4Q34A 1UMDA 3QUBA 5DB4A 3FPCA 2CLLB 4WN9B 5T4HA 5IK2D