2GK4A

The crystal structure of the dna/pantothenate metabolism flavoprotein from streptococcus pneumoniae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
229
Chain Sequence
b'AMKILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGYEVCLITTKRALKPEPHPNLSIREITNTKDLLIEMQERVQDYQVLIHSMAVSDYTPVYMTGLEEVQASSNLKEFLSKQNHQAKISSTDEVQVLFLKKTPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKNQLQTVQTKEEIAELLLEKIQAYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title The Crystal Structure of the DNA/Pantothenate Metabolism Flavoprotein from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 71
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 2gk4A00
1U7WA 1P9OA 5INTA 1U7UA 2GK4A 4QJIA 1U80A 1U7ZA
chains in the Genus database with same CATH superfamily
4FHEA 1QVWA 2OV3A 3H4IA 4TT3D 3UCXA 3GYBA 2W2LA 1C7FA 1FF9A 2GM3A 2QAGC 5C35A 3EGVA 1HYHA 2JLCA 2D7JA 3KQYA 1OFTA 2V98A 4NYIR 2PJRA 3EQ7A 2BCGY 1RTKA 2PZAA 2ZM6B 1H93A 1MBZA 1RRVA 3AFNA 5LMZA 1PGQA 1ABFA 1GQYA 4QKQA 4MV6A 1TRHA 4NBTA 3A9TA 3G8DA 4NV1A 4TTTS 4LDNA 3I5MA 1WY7A 4MCJA 1XB2A 2ZJFA 3KD3A 4EUFA 3DBHB 3JALA 3A4MA 3S1LA 2DWOA 1T10A 4OHBA 5EYPA 1G7RA 1Z5VA 3A1DA 3IOBA 5EIAA 3B1XA 2AH5A 2IYWA 4X1KA 4NU8X 4KVGA 4AL4A 4PBSA 1K7XB 1UXIA 5AMXA 1II8B 1CJSA 2IIBA 2O1XA 2CNLA 2DFLA 4JP5A 3SHVA 3WGHA 3KSBC 2O2GA 1CUSA 1K0UA 1W47A 2IQIA 4EZEA 3WRXA 3SEFA 1ISMA 1DP4A 1T1IA 4OKNA 3LBNA 5KYXB 3UW1A 3WNQA 3AHJA 1GUAA 1Z8NA 4TZ0A 1WVGA 4PZEA 5DWVA 4DLBA 4N76A 1JQKA 2GJ8A 3TWOA 4FFLA 3A1FA 4DLUA 1WEHA 4IUCS 4JWTA 2IS6A 3DTNA 4MUNA 3JVIA 1NX6A 3OF2A 1P3Y1 3OQJA 3W2TA 4NH0A 4ONEA 2J48A 2GJ9A 2XUAA 1AKUA 4DCJA 1MOPA 2FG5A 5E4JA 1CVIA 2R8XA 3V42A 1XNGA 2DUJA 2PX3A 5K3BA 4BFLA 4EGCB 5K0BA 3UAWA 1BTOA 1MO6A 5KOHB 4XIGS 5ICCA 2FY8A 2QG6A 3GAFA 2O50A 1P6QA 2C2XA 3K1YA 1PJZA 1VSTA 3FOFC 1TKRA 3Q7SA 4JWKA 4PPYA 3VTKA 4BGDA 1XJCA 4DLLA 3FM9A 4UM5A 1LLQA 4QARA 1D6NA 3U19A 5AHWA 3JPYA 2NU8B 3PRYA 3VOAA 3HSKA 2H16A 2JH9A 3DWGA 4H4DA 3H11A 3CPEA 2OQVA 2PZEA 4HH1A 4EG6A 3DPIA 3SBOA 3IV6A 1HKUA 1Z33A 3K1ZA 3LDUA 3ILVA 2J7KA 1C0EA 1Q0ZA 1T5IA 2P30A 2Z1MA 3K3PA 3IBYA 3NXSA 4Q15A 4FM9A 3LLVA 2WJWA 2IUSA 3SJBA 3GN1A 1F06A 1GNVA 3DDWA 4BCBA 2PGOA 2XCQA 2CL6X 4FQ8A 1EUCB 1G7SA 4DTCA 1JIJA 1YBHA 3EA0A 5TVGA 4EG4A 5EHZA 5FPYA 3EZ7A 1DXHA 3HBMA 1JDZA 1WRBA 1DUIA 3ASZA 1BXGA 1JR3E 5G53C 4H15A 4WXRA 3UMBA 3SHOA 4MAFA 1ZK1A 4ALJA 2QSZA 5GADl 4XCVA 1E60A 4PVDA 1Y6GA 4MIYA 3AUKA 4BVEA 3OJWA 5HFJA 2J3HA 3L18A 4F3NA 1XXHA 2GT1A 2ZROA 1LRLA 3FPLA 3RFVA 3N8DA 3CX7A 4JSTA 3S3TA 3PHJA 4II2A 1FTWA 1QHHA 4B6EA 1PJAA 1OI7A 4OLJA 5DN9A 3BJIC 4NG4A 4OHFA 4ZOLA 1N33B 2FP4B 5D5HA 2RKOA 4UATA 2YZKA 4IHJA 1ZD3A 1L5MA 1NQAO 2JIBA 1C7QA 2VHYA 4B6OA 1U2SA 1N6NA 1K3TA 2VJAA 1UJ2A 3NEPX 2BMVA 5C0OE 2C7RA 4RIIA 4E0BA 2QD1A 4Q4AA 3UTDA 4AUNA 3M7IA 5ENVA 3AEYA 3F6RA 2ZOSA 3V4OA 1MMFB 1RXCA 2CL0X 1RYZA 2ERYA 4G36A 3V3KA 4BVLA 4CKWB 4HT3B 1U2PA 5CITA 2PLWA 5DF1A 4ZVKA 4TMWA 3HZHA 3LPDA 4M7OA 1Q14A 1OXKB 1U2DA 3IXMA 1PE0A 4BQQA 1ECCA 1JF8A 3V32A 1CQXA 1JVSA 2EKPA 3G5AA 3R4VA 2FMIA 3B70A 1A9XB 2Y1OA 2PUDA 3AF6A 1LDNA 4KUEA 5JI2E 4LRXA 1NBEA 1UAGA 3MWGA 1PWYE 1D07A 2O2IA 4JB0A 4DMLA 5FUQA 3U9TA 3O7MA 4C0HA 1Z15A 2BBWA 2GN2A 4JOCA 4LE1A 4RKRA 3GCGA 3U7IA 4M87A 2HADA 4ZO6A 3QLTA 1EFKA 1GTVA 2P5SA 4IJQA 4ZU3A 4R31A 1QF6A 2CLSA 4TKUB 5JCXA 2R7LA 3H65A 1OXBB 1KO5A 3EVGA 2VK4A 1ZP6A 2JFXA 2NXWA 1NQXA 1Q20A 5CLGA 1AE1A 4ERNA 2A9RA 2UYOA 4GSYA 1ZN9A 3PJFA 3A0UA 3MG9A 1T0HB 1S1MA 3GJ6A 3A36A 3K32A 4AQ7A 3WZMA 4RK0A 4I46A 5THXA 5JHGB 3FVVA 2J6HA 3VSEA 4R7TA 4QYTA 1L2TA 1TQHA 1YE5A 4MV5A 1RPNA 3OY2A 1PQWA 3H9EO 3KT8A 4DL9A 1M1ZA 4X7BA 5ERXA 3HVRA 3JZMA 1NBHA 1OWLA 2J30A 1NXTA 1E5QA 4P92A 1OHHA 4P3KA 4LDAA 3F7TA 3H9CA 5CX4A 1KY4A 1X7ZB 5JS2A 4EVQA 2I78A 1JKXA 3MINB 2W4QA 3CVYA 3AJDA 1E98A 3E3AA 1CUHA 4KXMA 4UCWA 3REQA 1G1MA 4ISCA 4R8MA 3BF8A 3W6PA 5CDTA 1ZD8A 2J3KA 3GG2A 3LWDA 4D4IA 4OY3A 4IYJA 5EESA 1NIJA 4W9NA 3URKA 3J7TA 4D9JA 2CJXA 2QL9A 4FC7A 5JRDS 2R8OA 5KX5F 4CIXA 1QKKA 1YDFA 1CD5A 3FBGA 4RWEA 4DLYA 3CMCO 1N9GA 1EJ2A 2IX3A 3A7EA 1PX2A 2FSSA 3MD9A 1CDEA 3QJGA 3TH5A 2BGLA 2IDMA 5EIEA 3U7FB 1NR1A 1DZIA 1OE0A 4M1OA 4UAJA 2PGJA 2D3WA 1YVDA 2H1FA 2I7CA 3DDSA 1P81A 1BGWA 3EWAA 3K92A 4KIFA 4TRMA 3ZW8A 1NUUA 4XVQA 3FLAA 4EABA 2PGAA 5KSOA 4IILA 2PXHA 5C3UA 1XTKA 3BMOA 3T3MB 3AHDA 3HY6A 3L4BA 4R0VA 5J63A 1FDSA 5AM4A 1QAOA 4I3GA 2VJOA 2XB4A 1J70A 4BN5A 3H5OA 4U8HA 4AECA 1P1BA 4YNBA 1RWWA 1F6DA 2W8ZA 5CFPA 1UJNA 1XK7A 2SHKA 2Q49A 3VU1A 4V0QA 1HSOA 4J0KA 2OD9A 4C2TA 2Q3EA 1RRMA 3IB6A 4I8DA 1XTZA 4UCXA 2IPXA 4CUZA 4US2R 1S2MA 1ORTA 4WHMA 1L7OA 3S8EA 4XJSA 1L7DA 1M8KA 5CDGA 1PO7A 1DS6A 2NAPA 4XFDA 2FPIB 1CR2A 2P90A 2RB4A 1J9EA 3BK7A 3CZQA 4FUQA 4OQZA 3E9RA 4U0JA 5GOZA 1ETUA 1A95A 1F4LA 3TRHA 3I0ZA 5HZKA 2IHZA 2AV6A 4P34A 1WCIA 1N1EA 1SPBS 3HB9A 2AUNA 1ZWLA 3K5IA 3L40A 5EGNA 4FW9A 4TZ6A 4CQMA 4IWYA 3AF3A 3MBOA 1Z2AA 2H4XA 2NO4A 3MTQA 5EUQB 5ILQA 3ZWAA 4CLXA 2E4YA 1S3FA 2V5UA 3PX2A 4Q1CA 5BNTA 1VA4A 5H3LA 2ZIAA 1KO1A 1JFVA 1QLJA 5KTKA 1OXMA 1O5IA 3UJPA 5H5JA 1HL3A 3QHAA 5CX1A 1E63A 1G8SA 4NMLA 1ZICA 4Z53A 1XKLA 1A5ZA 4F4UA 4TYQA 3WI7A 2PG3A 1OBCA 4FYYA 1KMCA 2Z04A 1O5OA 3HO8A 4DFDA 4BNYA 4BUJA 2ZREA 1RXWA 1EJ0A 4JUDX 3D6JA 3C87A 3T5MA 4E6EA 4FN5A 4M98A 4Q4CA 4FEAA 3T9DA 4C7OB 3IIIA 4G8CA 2CJPA 2XXBA 4O4JB 4A9AA 2G5PA 3QVMA 1YJQA 4PSCA 3CO0S 2O8FA 1SUEA 4DCMA 5F98A 1XCJA 1NOJA 5U4XA 3BICA 4XEUA 3UKJA 4EY5A 4H4CA 4GXRA 4YAEA 521PA 2GPWA 4S35A 2W0SA 13PKA 4KPUA 3RWBA 1T9CA 4IL5A 5I9LA 1I2AA 1Z0JA 4LDJA 4Y67A 3H5VA 3G2HA 3UO8B 2EX4A 2FQYA 2HNKA 1MTZA 4BMXA 4BXOB 3JQFC 3I5UA 5J58A 1E9VA 2BSQA 3CWQA 1N5RA 5DK6A 1DTWA 1XMJA 3GLGA 2ZYRA 4LVCA 1KYIA 1OLXB 3FWHA 1NVXQ 1D9XA 2ABWA 1KAGA 3TRJA 1Z6XA 3QUTA 5CB4F 2NYVA 4MV3A 1H8HA 5ISMA 4YP1A 1A9ZA 1JG6A 3QX8A 4GX5A 3VZDA 1W75A 1JHDA 2J3QA 5E4YA 4B73A 3THYB 1I4EB 3F7OA 3P9YA 4XQ0A 4BLRA 1UH5A 5ED4A 1A69A 2R5WA 4S1VA 3Q1LA 2G09A 6Q21A 1VIVA 2BT4A 1VOTA 3OVMA 4J1NA 1UK7A 5CNJA 4DSUA 1FYVA 2HSZA 5DASA 1RYNA 2DC1A 1HE1C 2DH5A 3SYLA 3VZCA 5JXGA 2R6HA 1FFHA 3MAGA 4BYGA 1QANA 2OG1A 1RMTA 3KJNA 4I1VA 2R85A 4YP0A 4RHUA 5I8PA 4OHYA 4KQMA 1VMKA 1FDVA 2OO5C 3H5AA 2GZSA 3O2NA 3CSDA 3TMAA 4WZZA 1JALA 4PN7A 4TVKA 3A0RB 1Z5ZA 4FYHA 2JAPA 3IPLA 4MAAA 4OIFA 1JR6A 2DR0A 4XPIB 4WX2B 3LQYA 3KOWA 2EWMA 1OFVA 2QM3A 4ZYYA 4UMVA 8AT1A 4UREA 2J5BA 2CYAA 2VZ9A 4G0WA 3E84A 3H75A 3EIUA 3TI7A 4I5GA 4F7DA 3D6TB 3EFHA 2B92A 4YLGA 3ZYCA 3I2GA 3GX1A 4G4GA 4JLNA 4OA5A 2WSSD 1A76A 1X7YB 2XI4A 1FFCA 3IL2A 3HYLA 4QUEA 3HXMA 1X3SA 2IYTA 3VYUB 5AVRA 1UXOA 2MINB 5LIPA 1XZ8A 1H69A 4GOLD 2ZVPX 2AGVA 4FP9A 1ID1A 2DFNA 3WR5A 2DR2A 1DO2A 1T6NA 1K89A 2UVQA 3D3NA 3FYCA 3MWKA 4FMDF 1OH8A 2UAGA 3NTXA 1O87A 2QWXA 4Z1MD 2OZPA 2ETXA 3C3WA 3I6YA 2JZOA 1O8BA 3STXA 3VKFA 2B6HA 3KQOA 4NULA 3IMKA 3KQTA 3EGIA 1VLZA 2RI1A 4TZKA 1UWKA 4LAFA 3DCIA 3U3OA 3KAQA 4KVFA 5BPFA 3H83A 1QYDA 1Q2XA 3L7JA 4X6LA 4FSHA 3NALA 4GSKA 3UJ9A 3KRTA 4N5DA 2X0RA 1EB9A 3B1ZA 3FH0A 3I4LA 3R75A 3CJQA 4ZRDA 3LBIA 4F4HA 1YDWA 4XPZA 1U8EA 5AUNB 3BOSA 4GWLA 4WJKB 3EGWA 1FTSA 1MH1A 4DBLE 1TCVA 4IIUA 4BDTA 3ISTA 1GZ6A 3FMGA 2W4IA 2P2YA 4JGIA 4L95C 4U3JA 3N2GB 2PLRA 3KJZA 3QIVA 3MWEA 4MDHA 4XGNA 2ZT6A 2GAIA 3PA6A 2QU8A 1HLPA 1SC6A 3IBCA 1G4UR 4GP7A 1PIWA 2GOYA 4JYMA 4F60A 2QW1A 2V96A 4MVJA 4V0RA 5GZ3A 4D9BA 2A0FA 2EJUA 3K8QA 3NYQA 3CPHA 1OGYA 3DBVO 4FYWA 1S2GA 2P6NA 2XWPA 4N82A 1Q1QA 1XVAA 4IWNA 5EVCA 1ZVQA 2VQFB 3G8AA 1Q1BA 3QVKA 4QHSA 4F5DA 3E18A 4NONA 3BG5A 4P80A 4XGRA 5BVHB 4Q4JB 1D0IA 1F7UA 3FZQA 2VH5R 3M8KA 5FORA 5TS3A 1OPRA 3SZ3A 5JNSA 4PV7A 5HUQA 2CLCX 3RTCA 4B3XA 4ES6A 1DAHA 4AO6A 1MB4A 2EBHX 2EL9A 4PCAA 4C4AA 1ISGA 1ZLYA 1FFXB 4G37A 3UA4A 1XDWA 1VZ2A 1ZJYA 1A2BA 1DTSA 1W5AA 3KB6A 4QHTA 1NUSA 3KJHA 4MYTA 4R1PA 2Z8XA 5E0KB 1NNI1 3UHFA 3DMNA 5IAJA 1LPMA 3DXZA 1XRQA 3K1TA 4UM9B 2CVZA 1PNOA 1UFRA 5DULA 3UK2A 2NV6A 1SN7A 2XUIA 1Z29A 2Q1SA 2A67A 3EWSA 2QAIA 2QTVA 3M9XA 4R5HA 4FE3A 5FD8A 1N0UA 1I01A 1M6VB 2OGZA 1UAYA 1BQ4A 1ULSA 4MYHA 4PO9A 1ZJWA 1V6CA 2VPQA 5ITZA 1ZN7A 2UUBB 5DI3B 4PG8A 2FF7A 4E21A 1JE1A 1OX4A 1XT6A 1YQXA 4L4ZA 3WHIA 1BD3A 5T8KC 2YKGA 1KK0A 2ZKIA 3IEMA 1YAHA 5AHRA 5JRJA 3F9IA 1CFJA 3BJMA 4XLZA 1WSBA 4FNOA 1MA0A 3E7PA 1GITA 2DE0X 3L0PA 4NV0A 2RBEA 3ZD8A 5B30A 3OJCA 1JTEA 4WMLA 3DTVB 1J1ZA 2EF0A 4W8OA 3T3IA 4RJTA 2EQBA 2FUKA 5AVWA 1XVLA 1SU4A 2HWYA 1ZOSA 2FZVA 1E79D 4EDHA 4B4UA 2B69A 1HRDA 1KZ6A 1W87A 2GSDA 2PSDA 1BMDA 1C1DB 2ZI4A 1YBMA 3HLTA 3R0VA 4L57A 2FX5A 2JLXA 3I72A 3AUTA 2XT6A 3CLUC 6PFKA 1CB7A 1MC8A 2XCSB 3AEZA 2HA0A 4ZRNA 2NSJA 1Y8QA 2NZ2A 3HG7A 3ZHUA 3ZU6A 3JSAA 4F6LA 2Q41A 2A9QA 5A5DA 3H05A 1WVMA 1RMYA 3VGPA 4JI2B 1CFZA 3DVQX 3G9TA 4MUGA 3TMKA 2YHAA 1YZGA 5DGXA 2OFPA 2P4EA 3ECAA 4XFJA 2E48A 2GAAA 1DJNA 1GU1A 3EZ2A 3GRUA 1GWNA 4KAAA 3ET4A 3P4UA 4GR5A 4QX6A 1MFPA 2CMFA 3KQWA 1NULA 5IM5A 5F3WB 2ZVQX 3NVDA 4O02B 3W5CA 3SWWA 1XZGA 1Y3IA 1JFSA 3U9SA 3KFLA 4ARZB 1QU3A 4KG7A 1T9HA 3FWKA 4CMGA 4G9BA 3V4SA 2EBWA 4DJAA 5DTIA 4A0HA 2JNWA 4UUAA 2AZDA 2R5FA 3C1UA 2B94A 4A2QA 2RAVA 1H1TA 3T12A 2Q5JA 2AE1A 1Z2DA 3FPGA 3HYSA 5KNDA 4KPYA 1F8YA 4R6WA 3T34A 5EZ5A 3CLRD 4TXNA 1EMDA 1F8FA 2NO9A 1HUQA 2P75A 3IT2A 3RTGA 1NJ1A 2JLSA 3U7QB 1IN4A 2C4UA 5ALSA 1A3CA 3T9BA 3B7WA 3LUJA 2P1DA 3U4IA 1CULC 1ZHFA 3HACA 1NRXA 2HF8A 4M89A 4QUHA 4EVSA 3JW8A 1XBTA 4BIIA 1V1RB 4PSUA 1BFKA 2X19A 3I2FA 1UM9B 3K0FB 3E7FA 1XQWA 1P3DA 3BB1A 4LXHA 1NJSA 3AR6A 3EMKA 1L3CA 5GVSA 4R2WA 1MT3A 2IUEA 4JU9A 4ZZ0A 3MTIA 5IYZF 3WK9A 1KK3A 2JFNA 2ESRA 3I2YX 4CTNA 4DXHA 2JLWA 1Y1PA 2XV1A 3PDCA 4KGXA 1VI6A 4MA0A 4WXPA 1KJNA 2I54A 4F3YA 2PANA 6GPBA 5IZ4A 2C9CA 2G4LA 3AYZB 4MQ6A 4F6RA 2IHJA 2EYUA 2OHFA 3SSMA 4BJ3A 2YHBA 1YHNA 3L49A 1A8SA 2AFHB 2VLIA 3MC1A 1CY0A 4QUKA 1I5OA 4EFKA 2Q5HA 4M36A 3BFVA 1G3UA 1L4UA 4Q7EA 2GHQA 2Z2JA 4Q1AA 3Q4GA 5ELMA 2FMXA 1PNQA 4IUDS 4JXJA 2FPMA 4HVTA 4LNUA 3ICPA 4QO7A 2EATA 3L7BA 1MXHA 3NNNA 1UDXA 1XFDA 4M0EA 1DKOA 1VE1A 5I7RA 5FTWA 3MT9A 3FYUB 3F96A 2MIIA 2XQIA 3K0AA 3ZVKA 3MQFA 4IIJA 2P27A 4C4TA 5BSHA 1MORA 2J5RA 1VHTA 1NKVA 3HI4A 1IBLB 3PC3A 4WKNA 3FWPA 4CT4B 1NMYA 2V9ZA 2F1RA 1WB5A 2GYVA 1WPRA 3HZRA 3OC0A 4Q9AA 3KVVA 2C57A 2CNDA 3R44A 3ROTA 2B1RA 1M1UA 1XRSB 4EHHA 3WV5A 4R16A 4P4LA 1ZCZA 4YQZA 1ZN2A 4HSEA 5ER6A 3ZQUA 2Y9MB 2AX3A 1EQ2A 9GPBA 4RTPA 3Q15C 5LP6C 4LFBB 5LBTA 4N7RA 4ENTA 2BGTA 3W8DA 3PRHA 3QX7A 4HQRA 1T8WA 5JNWA 2QGNA 4AG5A 4KTTE 5G4LA 4EO9A 1GA4A 3TLJA 1G5TA 1LNSA 4DWVA 2JGDA 1H2ZA 4CU2A 1Y9ZA 3H9UA 4JL8A 2XMCA 1Y89A 3VJLA 1O3YA 1KI6A 2QTCA 3A7DA 2PWPA 2VQ6A 2YXDA 3G17A 1XQXA 1UT6A 3H1GA 1N57A 4HDSB 1U3WA 5IN5A 1T8YA 5SY6A 1E7MA 3OF3A 3IDFA 3NP9A 1GADO 3TAXA 2QKYA 4CM7A 1HNXB 3AFOA 4JASB 1IJBA 4MUIA 5BORA 3DOHA 4IIDA 1T2DA 1F4VA 1R37A 1RLMA 4YLEA 1Q74A 4JT9A 5A03A 1B0PA 1GPDG 3PD0A 1EVIA 5JFGA 4Z3OA 2YRXA 1IB6A 1JHRA 3B1WA 3QX3A 2ZUEA 1POXA 2WWHA 3ESZA 1GZ5A 1TUBB 1RI4A 1MTOA 1RJWA 1E1QD 1FUKA 2C4VA 2G4CA 1Z82A 1LK5A 4PRZA 5IUJC 4I1YA 3P9CA 2CC2A 1O0CA 3W1VA 3LC0A 2GJ4A 3KSAC 1ZM4A 3GFGA 3DOJA 1K97A 1KPIA 3H1TA 4IH1A 2HW8A 3QPDA 2GJKA 4PC7A 1E2HA 1RSZA 1SK8A 4P4SA 5C1IA 2JVIA 4J3FA 1E7SA 3NANA 3WMRA 4AD8A 1F1JA 3E3OA 4IZHA 2GS9A 1RP1A 3CEAA 3LDFA 4LCJA 1PG5A 1NMQA 3AI7A 4PZ0A 3R9XB 3VR6A 3KLNA 3SICE 3WQHA 2RGNC 3WIEA 4C87A 2EZ4A 3FF1A 1ESMA 3DQPA 3HR8A 4FHFA 2G88A 4UHFA 1FBNA 1ZM2A 4IV5A 2NTJA 3IVCA 1MGPA 1NN5A 2IA5A 3SQLA 3DOCA 3LT0A 2C2OA 4KXFB 1I3CA 1P19A 2P0AA 5E6RA 5GVRA 3TFOA 1ML3A 3OJEA 2OCKA 3ND8A 1XEAA 3LRTA 4B8YA 5ADWA 2WFAA 4DCOA 4DVJA 2JBWA 3UAOA 1MC5A 4AMUA 1RABA 4B6RA 1DJPA 3S8MA 1U9CA 3N2YA 3ZI4A 4CKEB 1W36B 1OY1A 4WI1A 3VJMA 3THWB 3H5NA 2Q3FA 3PKIA 3ZJVA 1QZ3A 2FWRA 3KKZA 1SBHA 2YXNA 4MVYA 4Y2TA 3UEOA 5A02A 2HHAA 3KM0A 5HXAA 3GFBA 1UDWA 4LF9B 2PQ2A 1MQSA 4G5HA 3SFTA 4D8TA 2QMHA 4NARA 2GHRA 2QLLA 4BPBA 1RXEA 3NHWA 3DVAB 2GUGA 1Z4QA 2H2AA 4MWTA 3TXAA 1W8DA 3E4CA 1YVRA 3FDIA 1SCNE 2PXCA 4UTRA 1VBNA 1Z68A 1MX3A 1CLUA 2TMKA 1PL6A 4GMDA 3C3PA 4YUAA 3ZDCA 3KQMA 3AZPA 4AJLA 5ERGB 2F9FA 1USIA 2OBMA 4PRLA 4LN1A 3TQFA 4BGUA 2YWGA 1VE5A 1MA3A 2HV9A 1FJHA 1VP9A 4GE0A 1NW8A 4XKJA 2HEIA 4PTYA 2YQZA 3QYFA 1DU4A 1JQ3A 1IXSB 2DHDA 1FXWF 1OWNA 1E2NA 1HK7A 3IHWA 4UTZA 5GOTA 3T95A 3WLLA 5CLFA 5AYVA 1Z4JA 8MHTA 4HUQA 4MZDA 2VPYA 1VG1A 4M1EA 3FTFA 4FOSA 3EIWA 3LXMA 3DWIA 2D3TA 2WF7A 4GD3Q 3H9BA 3ISJA 5AJVB 4BWVA 4GBED 4B83A 5JNRA 2FMKA 1Q5PA 1RJGA 1UODA 2C5FA 2OK7A 4W1PA 4EUKA 3HWWA 1U8AA 2WD8A 3MB5A 4CR8A 3IGFA 1RRKA 4GLFA 4HLQB 5JJKA 4BASA 3AW9A 3VOSA 3AR3A 3PZRA 2P0YA 1YB2A 1QP0A 3ZX5A 1NN0A 4Y2SA 2I3ZA 3N86A 4D8WA 4QFBA 4LZZA 3GFFA 3R40A 3SFZA 3K4QA 5JDCA 1Y8RB 4G24A 5M2QA 1J09A 2DG2A 2ISSD 2QT0A 1ZL2A 4JZKA 3DKVA 1DIGA 1CT9A 2EGGA 2FPPA 2WIDA 1EXWA 3FPJA 5CMLA 4ZEXA 4BATA 5JY1A 3J80A 3UATA 5AUOB 3TG8A 1YB1A 1FPQA 2HUPA 2HOQA 3IDQA 5FHQA 3WBFA 4ZDIA 5C53B 1YA6A 4WLOA 5SYNA 3E82A 2R62A 4RMHA 4NFHA 1QFXA 3TFQA 1BDMA 2AG0A 1JQLB 4RF5A 4NCHA 1QUEA 2Z2ZA 3AR4A 3MS2A 1F6BA 4HSGA 1YI0A 2BISA 3GG9A 4KOAA 4F8JA 4OK3A 1NPDA 2I8AA 1Z25A 1V9LA 5A1JA 1SVOA 2W48A 4MUYA 1QHSA 1DX9A 3IPXA 1EFAA 1UJBA 3SSNA 4WPGA 4QQFA 2A1IA 1NOKA 1CQJB 3GOQA 1D2RA 3LUDA 4L3WA 5GWXA 3DB1A 1KDRA 2V97A 3QLUC 1YHZA 4JLDA 4LDRA 4OA8A 1OBOA 1XLTC 2HPVA 1WXXA 2VT6A 4NAHA 5NLLA 3C85A 5BW5A 4D98A 5H8WA 1O0SA 3GLHB 3D3KA 5ICMA 3MMXA 1XPUA 1MEOA 2P1RA 3GNLA 3VPDA 5KOJB 1EP9A 1P18A 2C9DA 2WUDA 3M6AA 3PF8A 3COYA 4J7XA 2ZYAA 3A9RA 4M7RA 4BLWA 4YAGA 5IJ9B 1DRWA 2W93A 3GLSA 4MW4A 4UHJA 3K20A 5IBCA 2D0PB 4QEKA 5C2JB 1DKRA 4BZXA 2SCUB 2OP1A 4UFPA 2JRLA 1UC8A 5J1SB 4O0MA 1QYVA 4XJTA 4NF2A 1V7PC 2RK6A 5HG0A 1I6KA 2GPYA 4KO1S 2WJ4A 3K0EA 4A10A 2HIAA 2MTBA 4URZR 4E5PA 3EZYA 4YYZA 3ZTYA 1K6MA 3GWGA 4LV5B 2X0NA 2DYKA 5CA1F 3KOZA 4GC9A 2B78A 3IE1A 3BWVA 4ZCMA 9ATCA 2RGRA 1UBHS 1UBOS 2PMKA 3ABOB 1PGNA 1QH1B 2YHIA 1EFUA 3FDXA 1WPQA 4K8RB 3K9FC 1XWWA 3L6BA 3QNWA 1H8ED 4DIDA 4TX1A 3V34A 3CVVA 1Y9AA 4QPCA 4JI5B 3EVZA 2RHWA 3PE3A 3I37X 5AUQA 5D2CA 1KYWA 4CTKA 1H9CA 3WRXC 2Y67A 3N59A 4MGZR 2GK4A 5HS4A 4N0MA 4OBXA 3QU4A 2OB1A 1N1MA 5LQSA 1DLIA 1JAXA 1RQRA 1SKYB 2P2CA 2XUZA 1X77A 2BZGA 2Q07A 3D6UA 1SUFA 4DANA 3RADC 5JLAA 2IU6A 2XVAA 4D0NA 3NASA 5KTYA 3E7DA 4MLZA 3MERA 3IQGX 1JNXX 3E9ZA 1UP6A 1P2DA 1AQNA 3D2LA 1N78A 3TKYA 5DNVA 2YN2A 5HOEA 2ZRAA 3GUZA 1NBWB 4ZDKA 1RBZA 3UG6A 4QOSA 1AF7A 2O8CA 2AOUA 1PEAA 5IABA 1DIRA 1TEVA 2BLNA 3H6GA 3BL5A 3R5TA 4JHLA 3MNFA 3WGVA 3DFMA 4MR8B 2A1TS 4OXIA 2G28A 2HTFA 3FOBA 4LSZA 4I0WB 3VR2A 2LDXA 2JFYA 4H6VA 4A1OA 3BMCA 1AS0A 3F6CA 2W6MA 2LCFA 2G06A 4V0SA 3UH0A 3LRXA 4I4NA 3NGXA 5JMTA 5LD2C 4PANA 4CGZA 2PZBA 4MLCA 1T24A 3RJTA 1EB8A 4DSAA 4GVXA 3FPEA 1EEHA 2NTNA 5FWXB 2Y76A 4EY3A 1N2BA 4HAUA 4DABA 2AMJA 3ZVRA 2BGNA 3OQMA 5B7GA 1CTQA 4H7IA 5K8CA 4KXNA 1Z73A 5KJ6A 2E1PA 2AF4C 1CY7A 1LC0A 3MLAA 2XMBA 4UBOA 1SKYE 3QA3E 1CZNA 2JPDA 3TLYA 2G3YA 3S2IA 1ZKMA 2COUA 3NDRA 4F84A 2PT9A 1SQSA 5EXSA 2XIJA 1Y80A 3LAWA 3OCXA 4TRJA 4WUTA 3SCZA 3RR2A 3HKCA 5AKYA 3JQ9A 3RVLA 2XUFA 1Y1TA 5B5SA 1V1JA 2PKWA 3FD8A 3OWHA 4KNYA 1OX5A 4KAXA 1B15A 3A2MA 4RANA 1L7BA 2QMEA 1EVEA 3JY6A 2ZJZA 1RKUA 1T2UA 2OC9A 2TRSB 4HLDA 1QQ5A 1VCHA 4PLFA 5KVQA 2XEDA 3DL7A 1TJPB 3I1JA 4RE5A 3K9LA 4NBVA 2I2FA 4L0MA 4AKGA 1U7ZA 2XGGA 1FYXA 1GVNB 3BGIA 4G81A 3AEKA 3ADOA 3K0KA 3H3XA 5HMMA 3ZX4A 5BR1A 1ONPA 2A1UA 2E55A 3A6HA 4H6XA 1BVHA 1L9XA 2GTPA 2PS0A 2XNHA 5CFMA 3SHTA 1QX3A 4FFVA 3RVKA 3S5JA 1G8MA 2XBMA 5EJFA 3SJCA 1KBZA 3PL1A 2AEJA 4N0PA 3F5DA 4RMNA 5FBQB 2RARA 3D8HA 3MOIA 1Y48E 4OSEA 3W8EA 2W8BA 3TF5A 3HY3A 3OCZA 2O19A 1RBMA 3C6QA 1L5WA 2JZNA 4HJXA 3COSA 2QT9A 5LZ7A 1CNMA 1G41A 5DX0A 3PWTA 5FNVB 2X3FA 1PVDA 3LUAA 3TKLA 1ZBQA 3OZCA 5SZJA 3CVUA 1J9GA 2D0IA 2QTRA 1PLKA 3QXCA 5B58C 1DUVG 1PL7A 2QTFA 2P6MA 3ZWNA 4AMVA 1OKKA 2QG4A 1KMHA 2X3UA 4O4IA 2O8VA 2BFEB 1U2DC 4ZOEA 2LP4Y 3I2KA 4ZHQF 5CA0F 5HF6A 2A4KA 1PWEA 2BPOA 3ENWA 2QL6A 4C30A 4HH4A 4RVUA 1CIPA 2BEUA 4FFRA 4WD3A 1GTMA 2XB9A 2GEVA 2IHNA 3C14C 4ARSA 5BV2P 3ZGOA 3M49A 2JIZD 5ARDA 2N1BA 1LBSA 4X8OA 1Z3IX 3MSCA 4TWAA 5EP2A 3ZLTA 1DMRA 4HZIA 4UDOA 1Z2OX 2A0UA 3FB1A 2G63A 5L3ZA 4MW6A 1Z6TA 2WG0A 2I6XA 3M6FA 4KC0A 4RHTA 1W25A 2NU9A 3NEJA 2BFBA 2QUHA 4G5SA 1ZNQO 4KB5A 3AHIA 2WVGA 3VZBA 3KV1A 4HNUA 1UBTS 2RAFA 3EIFA 3FPAA 1CW2B 4PLHA 4XWTA 3DP9A 1TAUA 5LLSA 3FHLA 3MQ2A 3IA2A 1YULA 3SSOA 5TQ2B 2QW0X 3GJZA 5K6AA 1N2HA 4PWZA 3WGJA 5JJLA 3HHPA 3I01M 1W93A 4UAVA 5HQTA 4B3DA 1IQUA 1I24A 4RM3A 4XWWA 4D6YA 2XMQA 3KX2A 2C3YA 5EWLB 5HILA 1WXQA 3ITNA 4I50B 2W7TA 3RIYA 2CDBA 4ID3A 1TF5A 2GK7A 1LQUA 2ON6A 4MCIA 3E9EA 2XCOA 1KOLA 3FOWA 3ITEA 4BFSA 3MMNA 5LOVF 4QHYA 5E2BA 1VKHA 2XCRB 3F78A 3T5CA 3TG2A 5C9ZA 2QX9A 4ZC1A 2IS1A 1G16A 4M7WA 2HBYA 4W9NC 5ICSA 2JBHA 3WBJA 1L7MA 1BQEA 3OM9A 1T36B 1G5IA 1IJKA 4P3YA 5LDHA 4P0TA 2ZIXB 3R24A 4MQMA 4PS1A 2CV1A 5LYJB 5FQNA 4PCUA 4I55B 2ZRMA 3MW8A 1JAHA 5EEGA 2V7TA 4GPEA 3SVLA 3FZEA 3M0EA 3DOOA 3H5IA 1AB5A 4LRTB 5LYJF 4LA4A 2WT8A 3ORFA 3KR9A 1SCKA 1YR1A 2DFPA 1VLMA 5BSMA 3L4BC 1OLUB 4AM8A 4AROA 1QOZA 1ZKDA 3PKZA 1DEOA 1I94B 2PBFA 4DJDC 3CU5A 2X8JB 5HR5A 4BX2A 4O59O 4ZQBA 2AJDA 1L1EA 5C1OA 2QZ9A 1H0RA 4K05A 2N3ZA 1W96A 1HFJA 3X2FA 2HWUA 3OTIA 3SKYA 4HGNA 4ZQHA 1UKVY 4L76A 1BIFA 3KETA 1EDOA 3UJ7A 4O4LB 2BTOA 2RI6A 3FCXA 4MI9A 2TSYB 1XNQB 1E5XA 1GXSA 2NO6A 3LBYA 2JLAA 3D7SA 4P2BA 2R97A 3OBBA 3UVEA 1VCIA 1L5HA 2OBNA 2WAAA 1W2WB 4HWSA 4MR7B 5C5DA 5K99A 4W9MC 5FOUA 4UOEA 4XDGA 2AOWA 1S9DA 1HFKA 4HWTA 1H22A 1IHUA 1JI0A 1TYZA 3BCHA 1P7CA 3FOCA 4LHYA 5IBQA 1ZAYA 4PYMA 4L9AA 3OKCA 1BE0A 4F91B 5D85A 3STVA 2WJGA 4BB9A 2FRDC 1NY5A 3OU2A 2JIQA 1IN5A 1PFGA 2J09A 3HL4A 3G82C 3R1IA 3TB6A 1HT2E 1Z4PX 3MTAA 4KVZA 3CFYA 1NVFA 4N0QA 4NY1A 1BKSB 3O4RA 5HM6A 4BKQA 5KINB 1FMCA 5KTSA 3DBLA 4WXYB 3AG5A 4XR4A 4G0PA 2QP3A 4EFNA 2HJRA 4ZT7A 1RJ9B 4D9IA 3JQDA 3IR5A 5HGXA 3DHVA 2W6NA 3I05A 1YZYA 5HKAA 4XZ3A 4B47A 4B8WA 4FINA 2HSWA 4Z9FA 1QIFA 1AA6A 2DFDA 2F2TA 1ODJA 2ZSAA 5IT4A 1U8CB 2EGUA 3QF4A 3GZNA 1X15A 3KHTA 3TQIA 4ZJYA 3KHSA 3O5AA 1NQOA 3SHWA 4ASUD 2MSWA 1ZK4A 2C78A 3AFMA 3FTQA 3OPYB 4YBZA 3WYEA 4BMDA 3COVA 3NKLA 3A3NA 1CUVA 3VDRA 1IULA 1A9QA 1O6GA 2WKPA 1FP6A 2VXOA 2WD7A 3OLCX 5E6SB 4CM4B 5ESDA 2TECE 3L7KA 3LCCA 2HCRA 2QRKA 3PDHA 4JCCA 2ZRJA 5JSQA 3AUFA 4BDSA 1LLUA 2VJNA 2ZULA 4PG5A 3HO1A 4MVCA 3NTQA 1EPUA 4WACA 2Q1TA 8LDHA 1JJIA 2CYBA 2O7SA 4GOKA 1K68A 1CV2A 4KHPB 3OJ0A 4EP1A 4X00A 1DCTA 1P9NA 4HQLA 1XMSA 1H23A 2ODAA 1M2VB 2CNNA 2QNIA 3K0HA 4G65A 1R64A 1K5DA 2IPMA 5LB2A 2H9YA 2X7XA 1DBRA 3QK7A 4CCYA 1ZVKA 1BNCA 4AJOA 3UIEA 1WKBA 4GMHA 2KYRA 2XGJA 1FYWA 1TW2A 1SZCA 1QGOA 2HAEA 2PZFA 2C82A 4JHXA 2HEGA 4L22A 4RD1A 1EE9A 1HLFA 1TYBE 2OCLA 3JQAD 2I2XB 2DCUA 5IUNC 3MJHA 4I5EA 2ZZMA 1NRJB 1RR6A 3V1TC 1UM8A 1S96A 3QPVA 4ZVVA 4RMIA 1Q7BA 3ZI7A 2JATA 2PWZA 4BB6A 5LJLA 4BKMA 1BX3A 5H82A 5D86A 4S2EA 1YQEA 2XAAA 4UZFA 1V4NA 2DKOA 3KQUA 1P1FA 3S2EA 3H3JA 3O92A 4MR9B 5REQB 1HT1E 1L8QA 3GJTA 2GASA 3D1LA 3GP3A 3HS3A 1FLVA 4OQPA 4XYBA 2GBGA 1VIDA 4LJ5A 4RTRA 3EVAA 5AR1A 4JUBA 2WTBA 1D1QA 1QK3A 1YQWA 4M1YA 3OZXA 5DT2A 1A1VA 2QL7A 4KO8A 1KQ3A 2A5DA 2EGHA 4FFMA 1UJ6A 1G64A 1K8RA 2I7DA 2GDZA 1CZRA 3CPSA 5HIMA 1ESNA 1JQJC 3DS8A 2ZS7A 3HCRA 3VDQA 4CLRA 4EJSA 3EH1A 2AOTA 1LD3A 3Q5GA 4M76B 1NW5A 4M88A 5CJ2A 1T9GR 5AJUA 5HE8A 1M9NA 2B0JA 3BX1A 4JCOA 4F5YA 3HV2A 2BJVA 3L8EA 3T9EA 2O4CA 2IPNA 2OHXA 4AP9A 2WTXA 1DKUA 2O1SA 3N87A 3NAGA 4DDHA 5LL6P 1R6DA 1JB9A 1QFJA 2NXCA 5TPWA 3C7CB 4PZUA 5K51A 1ZI8A 2OZEA 4TZTA 1LDYA 1ORWA 4FXOA 4LNHA 4C22A 2XB6A 4CL3A 4F5EA 1GOTA 2VP6A 2BZ1A 5YASA 1AXEA 4LXYA 1KKMA 2IUFA 2L18A 2Z4SA 4RETA 2XKAA 1C9KA 1BHSA 1PG2A 5LQNA 4JI0B 1CY1A 2JFUA 4JJ7A 1FLDA 2EQAA 1LI4A 1Q77A 3U40A 1E92A 5L7WA 4J2OA 5JCOC 2X4LA 3V4ZA 2H92A 1IQRA 1SCUB 2AG6A 1ZQ9A 3IBSA 3V7UA 4B0PA 3T1YB 4MULA 1ISRA 5TQ0B 4OX9Y 3AWDA 3EGEA 3NBKA 4CF6A 5BXYA 3DKIA 2YYAA 5L4LA 1IATA 1ORRA 3I28A 3WISA 2B1IA 3LZDA 1Z0DA 4QPPA 2ZSKA 1I80A 1GU7A 2VPZA 3QXJA 4OHXA 4C0KA 1GA1A 4Z7JA 1Z47A 5AW3A 1UIRA 2FG7C 2IEBA 5ALNA 3UXEA 4R2JA 4TS4A 3FCAA 1DAMA 3UA3A 2O8EB 4UUQA 1Z7YA 5FUBA 2PT5A 5LKRA 1H2EA 2B4KA 5JAHA 1TUGA 2XB8A 4IM7A 1FQKA 5AXDA 1QP8A 3N70A 3PQ4A 3I9KA 2ST1A 3NONA 4OAOA 3ZU4A 1K5HA 3G0HA 3MS7A 4XWKA 3RHTA 2QXUA 3NHFA 3C3EA 4YRAA 5B3LA 1KARA 3CW8X 1PK8A 1CUFA 4PQGA 3QYPA 4MW7A 4DV1B 3ZN2A 2H4HA 3V6LA 1DIAA 5ECDA 3JQBA 2G0AA 2HQBA 3C6KA 2GCGA 2YNMA 1ECPA 2XBLA 1IEQA 4OAQA 4OJMX 4QYIA 4E7PA 1KKUA 2E85A 4KBFA 1XF9A 3UMFA 2ILTA 2WWFA 2ZRKA 5HSGA 4DMRA 3RYIA 1ZZEA 4CCAA 1L5NA 3M2PA 3L7IA 2QTMA 2HF7A 2FEKA 1CX9B 1NWCA 1U2TA 2YWXA 3TBHA 4E1AA 4EVRA 4JBLA 3E70C 3GFQA 3KLMX 2H4YA 2ZKLA 4XIJA 4F72A 4WDRA 2WNIA 4HYTA 1ZCJA 4EW1A 1CJVC 4WK0B 1D4OA 3SDZA 1E77A 4Q4HB 3TAHA 1QK5A 1REQA 2H4JA 3AV3A 3LI2A 1TMKA 221PA 2Q0HA 1KL7A 2DWCA 4ZV9A 4G84A 3RIGA 1A2QA 1TVKA 5CEJA 5ICEA 3R3HA 4NU6A 1XMVA 2FWPA 2ZATA 3CE9A 3LA8A 5EJ6A 4L4XA 4KBGA 3ZNNA 1E3QA 1MJHA 3NKFA 2JGLA 2Y4NA 4CR7A 1SG6A 1VB3A 3HU2A 3NG1A 2B8TA 3KUCA 1J0XO 3NETA 3Q40A 4UAUA 3W34A 1U98A 1U63A 5LM3A 3ZWPA 2PX4A 1HBJA 2FZ4A 4F3CA 5L6MB 3LDHA 5B6JA 1IVNA 1GTZA 2QRQA 4WOKA 1HR0B 1OH7A 1QDUA 4X20B 5UKDA 3NC1C 4ZTZB 3L9XA 2CLDX 3D8NA 4Q7JB 1YR6A 1PZMA 2XVYA 1QZUA 3CUWA 4IY1A 4MUKA 3PWKA 1YFJA 3HN7A 5F2NA 2X76A 5K0GA 3MYRA 1GSAA 1J20A 1XYGA 5D5PA 3THXA 4TXJA 2QN8A 2XW6A 4BQSA 1J0EA 1H3EA 3HUEA 4GVLA 3M6MD 4L74A 3IMCA 4CQLB 5DNAA 5JQGB 3NM5A 2HREA 5IULC 5JO0A 2WSYB 5LJIA 3FYSA 1YKSA 1X7XB 3RABA 1XR3A 1RRPA 4UE3S 1G5RA 3BHNA 4I1OA 2CXPA 4L4RA 1GQQA 1C1XA 1KBOA 5DGTA 2C1XA 2F43A 3N6XA 4ZPJA 3TZLA 4KLNA 2R7NA 3ZY4A 4N6GA 4O2BA 4XARA 4BV2A 2PL9A 3I6MA 1G60A 3U0VA 1AZLA 1RIIA 4K6OA 4HB0A 1G21A 1Z17A 1EQUA 2AN3A 2QW8A 2V7UA 4JK3A 4R1NA 2N0SA 2B83A 5T4BA 5ITVA 1AHPA 3A1SA 3F4LA 1Y63A 3RB8A 4TS3A 2Y0CA 2G1KA 5JJIA 1W581 2ZYUX 2DBQA 2WABA 4JP2A 2C83A 1GUFA 4E4RA 2HSEA 4JI1B 2PCLA 4R8VA 2QI9C 4WESB 1P2VA 4M8NE 1L1FA 1I13A 2DWPA 2Y3IA 4C01A 1J07A 4HNTA 3H1FA 5AI4A 1DAFA 1T1RA 2Y2VA 4EUNA 2JH8A 3MUEA 1CXZA 3FRJA 3GN2A 5FXMA 3TBFA 2ZDGA 3U7EB 1IPHA 1NGSA 1UK8A 3OAAD 1GV0A 4MMYB 4KH1A 1JAIA 2I2AA 2Q3DA 3HUDA 3RFXA 2SKEA 3WJAA 2VJPA 3M9LA 3QVXA 3KXIA 4KR3A 3NOOA 4CIDA 4L08A 1YKFA 2X8BA 1O2DA 3PICA 4BMNA 2QR3A 4UTXA 1KPHA 1JIUA 2B7BA 2JFOA 2UKDA 3NBZC 1XD2A 4IV0A 5TX7A 3I4CA 2AD1A 3UKDA 3I8OA 5BRJA 3AF2A 2OWDA 1F51E 4R51A 3CUUA 3ZZTA 2XCUA 1N92A 4E70A 4YP7A 4Q19A 1S7GA 2PSHA 4DCSA 5LC1A 3DMTA 4YCAA 4S1WA 4IIFA 4ALKA 1ZINA 3AKZA 2OENG 2XZDA 3DL0A 3THRA 3SC2B 2GZHA 3H1PA 3AM5A 3WGZA 1E8NA 4MKIA 2PTHA 5CAEA 2QDXA 3PJGA 1J2RA 1H5QA 3ICCA 2ONKA 5LP6B 1XA3A 2V7QD 1TJ5A 5IRCD 5KDLA 2EBUA 2B4QA 2CD7A 1RAHA 2D2IA 1RE1A 2J6CA 2JJYA 2ZSEA 5JROA 3L4KA 2PUAA 4X1YB 3TLAA 3FKJA 3B1FA 2LD4A 2EW8A 3C5CA 4YVFA 1IVYA 4Z1OA 2VNKA 1YRBA 3AL2A 4PHTA 3AU8A 1Z5UA 3SKVA 3D2AA 5AW1A 5LNK6 1P45A 2YZ7A 4H3KB 5BV8A 1JH9A 2P65A 3GCWA 1S2DA 3AF4A 4HC4A 3KZNA 4YUWA 3RV4A 4TTVA 1F0KA 1HWYA 1RBQA 1XDBA 2HIMA 3BC1A 4GH5A 4IDAA 3TCNA 1XSEA 2ZRDA 4MWCA 3ZE8A 4E2WA 6AT1A 3IVMA 3T3EA 1ZXLA 2JI4A 4ZGBA 5I01A 2FA9A 5IH7A 1L5ZA 1YA4A 4ZQCB 3AB8A 5C8YB 5JATA 2ZJYA 4DA6A 5LPNA 2QN6A 2E82A 1R5BA 1T4DA 1DRJA 3QFCA 5G0TA 3SMVA 2C8LA 1CR1A 2WINI 2ZUDA 5EP4A 1I2MA 1VMEA 5DVZA 1T8PA 3NB0A 5J4LA 1UKAA 1ZONA 1KDPA 1MEJA 5EUMA 2C9BA 5HW0A 1HGXA 2CVOA 2H1IA 2MSDB 1B8OA 1M2JA 2QYOA 5FOVA 3R7LA 5KYYA 1ODLA 1RAEA 5DP1A 2OXRA 3NV7A 1N1DA 1AUOA 3EZNA 5C52B 2CD9A 1QRDA 3N8KA 4WWHA 5K2OA 1PK7A 2H08A 2WIFA 3CV3A 4A6PA 1AO0A 1UKZA 2F48A 1I6MA 4ZCSA 5LMCA 3CVWA 3VC2A 1R4NB 3GPLA 1X86B 1SY7A 3BD8A 1ZG3A 4UVHA 2OTCA 4RKYA 4U2BA 1MNQA 1TX4B 4O4JF 4YCSA 4UHBA 1V8OA 1ULHA 3BD6A 4HAVA 2KX7A 3OCUA 5HKOA 2QT1A 4KQ1A 5I7OA 3U26A 1N8KA 1E7WA 4N9WA 4NLLA 1LJLA 3ZV5A 1FP4A 1U8FO 4BVFA 1HY3A 1E2LA 1THTA 1X0VA 4NZ9A 3FPBA 3OCYA 1US8B 4GUAA 1R0BA 1Q3KA 1N1GA 1NJ5A 5DLQC 3IILA 1PX0A 2HJ9A 4AZ3A 2HWWA 1N32B 3JQ6A 2VCHA 4HDRB 4WN9A 3USES 1ODFA 2NSLA 3FMVA 4FYPA 4JJIA 4HO1X 1MPTA 1RM3A 2Q4EA 2LWIA 2QN2A 3OQVA 2GQ0A 2ZAGA 4LHSA 3F90A 1IY0A 1N75A 1NR5A 3M1IA 4RX1A 2M6LA 5ICGA 5JCZA 3KOOA 4UM9D 3OJFA 3P5SA 2C59A 1LSOA 3R23A 4L5JA 1BROA 3DFFA 5CB0A 2I9KA 4V1CA 4RHCA 3DLTA 1PGOA 2QK4A 4F96A 3NFRA 1M6EX 3GJ0A 3K9HA 1O95C 3TZBA 5IVHA 1O9GA 4KR6A 1DPFA 2ZJBA 2G77B 4G5FA 5DYTA 4A3SA 1SCBA 4DNQA 3V48A 5THQA 4NCXA 3LVFO 4R2LA 1AQJA 4O1IA 4O63O 2ISQA 3FOEC 2IX9A 3ICOA 4F3KA 3CCBA 3LD9A 4BQNA 3G2PA 4Y0AA 9LDBA 3JQGA 4NYIQ 3VH4A 4KQIA 4J0QA 4D96A 1M76A 4G5YA 1AN0A 2FKNA 3OP1A 4NC9A 3PJDA 4LC9A 5JXHA 3PK0A 2DX7A 3PP8A 2HRQA 4YO7A 1QE3A 4HS4A 5EHIA 5GV7A 1CYEA 2GLTA 1HE8B 1NC3A 3HB5X 3R5KA 5HE9A 4WEOA 4OXYA 2VAWA 5K4HA 3BF7A 5G1NA 3W6OA 1HE2A 1KC3A 3BREA 2WV7A 4EIWA 1I36A 3TL3A 5BSEA 5IZCA 1BWRA 5KQMA 2JBAA 3KQLA 1D5WA 4PBRA 2DUWA 3SEAA 4F6CA 4YJ2A 1OA0A 1K3FA 1N4DA 2V9CA 1DWQA 1MDBA 3IP1A 3QU2A 1CWUA 3C8MA 1S02A 1A4IA 3E2MA 3KDSE 4QDXA 5I7WA 3WP1B 3KE8A 4O3FA 4QPJC 2WAXA 4KMMA 1YZNA 1JA9A 3PFCA 2FW9A 4ZTBA 3C43A 2PFKA 2YFKA 2GO7A 1R0XA 2MSEB 2VF5X 3I9V1 1DKLA 4BE7B 1WXWA 1A04A 1RCTE 1X94A 1XZAA 4WBNF 4LJSA 3AC0A 3SHQA 4C6SA 3HLYA 2PLNA 3GLQA 3RDPA 5ALEA 1P2SA 1DOAA 1CY6A 2GZAA 1JS1X 3LUCA 3NWEA 1S2IA 3I09A 1MO3A 2O1EA 5D00A 4RL4A 4PNPA 9LDTA 3SC3A 2JLUA 3ODPA 2QRVA 4QLAA 3SVZA 3E0XA 1WSWA 1A72A 2RIPA 1I0IA 4H16A 3RS5A 1JDBB 1Q7TA 2N75A 1DAIA 5CTAA 3EN0A 3O8RA 3JATA 1TZMA 4JJGA 4KUHA 3ZZUA 4E7OA 4JYZA 1H4SA 3G7UA 5BPHA 2HCBA 2I6QA 1DCFA 1HE4A 3QYAA 1PJ8A 2EYQA 4NMXB 3PNSA 3JD2A 4F2HA 1CP3A 3OT1A 4RGQA 3AOEC 3CH4B 1IEXA 5JDCC 5TPZA 1P77A 3WL4A 2ZRFA 2BUBA 5FQOA 3ROKA 3VU8A 2O52A 5BRAA 4DOMA 4HNVA 2WTMA 1KYVA 4CEHB 3N74A 1Y6ZA 2CFSA 3GDOA 3K4HA 4H27A 2OR3A 4ZQFA 2OPHA 3SR4A 3W06A 3HM9A 2C2KA 4OO3A 1ZD9A 7AT1A 1U1EA 3CEJA 4MUAA 1J06A 3VNQA 1QX4A 3T7IA 4C4XA 1WKCA 3A4TA 4FVTA 3ZHCA 3HY4A 4B81A 4HDKA 5K3FB 4E07A 1FFDA 1ENYA 1P9LA 4WKBA 1H6BA 2YDXA 1H42A 2Z5GA 2OKCA 2OM2A 4LK3A 4LZLA 3C3MA 3RTAA 2DECA 3V7YA 5I4IA 4OXRA 3KEQA 5A3QA 5L3SA 4X7MA 1WXGA 1P8AA 2FW8A 3ZGYA 1BJTA 1XMOB 2XUDA 4OATA 3L6RA 5K0EA 2V3CC 3KOXA 1H65A 4CE6A 1ZC3A 2ANBA 5KJFA 1LPAB 3AUJB 1SD5A 1OVMA 3C8UA 3ABQB 1XZNA 4LJKA 3E15A 3KJQA 5DGDA 1QR6A 5AKZA 3O95A 2ZR7A 4DMCA 3I83A 3KKEA 4CIAA 4BFUA 1UQUA 3KZOA 2F59A 4URWR 4ATNA 4LI0A 2X15A 4EPXA 2AT1A 4POOA 1CRLA 1CCWA 5EXXA 4PVCA 4WGFA 2AB0A 4CL0A 1GILA 2CHUA 2FZ5A 4B9EA 1EWYA 3ZDXB 2HHCA 2P4QA 1SB8A 3H2SA 2ODBA 1DPGA 3IIMA 5LD2B 2NAFA 3IE2A 2XA9A 4RA6A 4AAYA 2VH2A 2QA5A 5KTTA 1A50B 2RFLA 3PF9A 1XO1A 3CSUA 3UYLA 3VPAA 1NG9A 2CXNA 4ISBA 1QOPB 3WNCA 3H2ZA 3WMWA 1G9TA 1CZKA 3GRZA 2E7ZA 1XYYA 3PNOA 2EEZA 2XX3A 2B99A 3AP1A 2Q0QA 4K87A 2WG1A 3T54A 4AJNA 4HRAA 5FP0A 4ZI7B 1MP0A 2IYVA 1FC0A 8ADHA 1ZA1A 1JN0A 4X95A 1H5NA 3L77A 3O2SB 5ALXA 1ADFA 4M1WA 3T7AA 5LZ9A 2YCBA 4RIGA 2O2CA 4UNQA 1IZ7A 3JXEA 1ND6A 5KU1A 1TZJA 5EEHA 3WYCA 1PJSA 1IZ0A 3BK2A 2CXTA 3KVOA 1Y4ZA 4ILKA 2EFHB 2JI6A 1PJLA 4DWWA 1IEWA 3JVEA 4GGPA 1K27A 4GRAA 5HX7A 2WKWA 3N8IA 3IXQA 1KY2A 3HBJA 4ICIA 3OI7A 3GUUA 1FYEA 2P5TB 1I0ZA 2PRJA 2FCAA 1TE2A 3PC2A 4DLZA 4DT1A 2X2EA 1QHGA 3H99A 1K4KA 3LTEA 4NECA 1TT5A 3HADA 1X9IA 1YSCA 4ZOLB 2HK9A 3WRYA 2IEGA 5I9SA 1OV6A 4R2HA 5KUTA 3BH0A 5HZHA 3AF1A 3QFRA 1CY4A 5EHQA 4OBWA 3S1SA 3FOZA 4TTIA 1D2HA 1YNOA 2I4TA 2QF7A 2XXAB 2V1UA 3P4XA 4UBKA 2LDBA 5T4EA 3TECE 5JD6A 1COWA 4TYPA 3HTXA 1QK4A 3QP9A 1G0OA 4DNOA 2J3MA 3GY0A 3OPNA 4NSNA 2G5CA 4W7IA 3ROEA 3RQIA 2C4WA 4F38A 3LP6A 1XHEA 4NU0A 2QM8A 3RS3A 2VDKB 1W1WA 3OQIA 4KQFA 4N4AA 5I9MA 4D1YA 5IP5A 2Y77A 3ZWKA 2OUKA 1RXVA 3RNOA 1CP2A 4AURA 2IIQA 2QD5A 2B25A 3GEEA 4M8SA 1XQ1A 4BRWA 1NUPA 1UCFA 2PU7A 3R8XA 1XXHE 2ERXA 2VF7A 4IXTA 4R2MA 1RC8A 1O0BA 1K8YB 2HCTA 2UZ1B 4TLBA 3CXRA 5M7EA 4JEMA 3PITA 4D4JA 8ATCA 3SZOA 2POQX 2W2KA 5LWHA 1MO5A 3T06B 1OMOA 2ZI9A 4ZZ2A 2R6DA 4Y2QA 3A2KA 1I7DA 4BVGA 3F9RA 3WXMA 1PT5A 4DHWA 2KW5A 1WQ3A 4FFDA 1HDZA 1UL1X 3AR2A 3UG7A 2XCTB 3KCQA 5EIXA 2XE7A 5CT9A 5DHRA 2OYCA 4C04A 1U90A 4M53A 1CEQA 5CHYA 5BMVB 5C34B 1EK6A 4LPSA 3RRNA 4X66B 2FFHA 3DM9B 1B93A 3SM3A 3I5XA 821PA 4JBYA 2GD0A 4GFDA 2CJWA 2VHTA 5CFNA 4DV5B 1TXGA 3ETJA 5E1MA 5U9CA 1P75A 4ZP1A 4NICA 1ONOA 3CSSA 5JY6A 3HR7A 2E5LB 4K9QA 1F9AA 3S2GA 4COOA 1BYUA 3D6MA 4JEIA 5DMHA 4M86A 4CG0A 4YXWD 2FMFA 1N2XA 4U2GA 4A5SA 2W22A 1SBYA 1WABA 1GGMA 3E5MA 2Z2XA 1N0HA 3RTDA 1EFVB 2JAQA 3FSGA 5K5EA 2IWHA 5F9FA 2WUVA 4FX5A 1XDZA 2AMLA 1Y5NA 2PGDA 3QE3A 4CLOA 5K0CA 3NOVA 1OXSC 4JFAA 3ZJ4A 3ZKWB 4MZXA 5FOTA 1FTQA 4OG2A 3WDMA 1NT2A 3ST7A 1YE8A 3GQVA 1ZXXA 5DM2A 4FEGA 5BUZA 4HX2A 3I3OA 2ZGVA 1U7HA 2FEXA 2R4TA 4FYIA 1ETHA 4P33A 1GUBA 1YS9A 3FBWA 5LBUA 4BGEA 3RUAA 1LDMA 3W78A 4AY4A 3A05A 2ZAMA 2XYQA 5ALKA 5HYVA 2WYUA 1ONBA 4KWIA 2H8KA 2NQ2C 3BMQA 4I5FA 1P1RA 5B6PA 3MBKA 2GSWA 1E3WA 3BZUA 3H7AA 1K92A 4YRLA 1AKNA 1NVEA 4QM7A 1EAMA 1EJ6A 1HURA 4LXGA 1K66A 4OXKA 1FOEB 2I6GA 4RFSA 3U31A 5CHEA 1P7ZA 4B2IA 2RKWA 4R0NA 3OM1A 2O9JA 4IZIA 3NHLA 3RIHA 4O4HB 1J9ZA 3AJ9A 3D0RA 4L5BA 1U3VA 4YPVA 2NX2A 5EQFA 1W88B 1W2HA 2E4ZA 3SE7A 1KFBB 4ITVA 1R6BX 1ZI6A 2ZQZA 2DP4E 1GPAA 3VR3A 3L01A 1RADA 1YUBA 4HH0A 1PT7A 3WGLA 4KN9S 2X1MA 4IDOA 4L6IA 2A92A 3AVYA 2J33A 1IQPA 1B6RA 3SQDA 1F2TA 5FWDA 5BQXA 1V3UA 2YWBA 4LMPA 2A0KA 4UHEA 1W0JA 1B6GA 4JVLA 4IWXA 4F4DA 2D2FA 4ALNA 5K6AC 3BRSA 2J67A 3DUFB 1N5LA 3NYWA 3OZEA 3PR3A 4NFLA 4Q4DA 4QEZA 3L5OA 2IBMA 3MWLA 4IIHA 1W4CA 3N2EA 5BSWA 1JZQA 1O97C 4RELA 2EWWA 2HLHA 1USKA 2GK3A 4KE7A 5J1TB 1G4AE 3DV0B 1GLVA 4Q7QA 3EC1A 3HUUA 1JG7A 4DJTA 3AETA 4I1PA 3DDNA 4R81A 1N5OX 1Y3FE 1Y0BA 4OU5A 2WZBA 5LDDC 5FV7A 2IS4A 4Y0NA 3C48A 2JKVA 3RK4A 3ZBPA 2J0QA 4B35A 2NUPA 2P2ZA 3QMVA 4RSHA 1SUWA 3KV3O 1O6FA 3WKAA 5FUMA 4EHAA 1VKNA 4B46A 3TLKA 1SOWA 3ZHOA 4LXQA 1GAQA 3IQIX 3IT1A 3AF0A 4OXXA 5BR4A 1BEUB 1MV8A 2WRZA 4DCPA 1V26A 4MQ5A 3ZQ4A 2PRIA 3UGJA 2VDOB 2CXUA 3KPUA 4IJ5A 3O3OB 3PUWA 4E94A 4FIZA 1VHLA 4WASA 2FFQA 4MRMA 5JS7A 4BLTA 1SVKA 5HRUA 5KNDD 3OICA 5DBHX 4EENA 1QGYA 5H16A 5IAEA 2NVUB 3OZAA 4MS3A 1UR5A 1VHDA 4RUKA 1M3SA 4KIGA 2HRZA 3LPLA 1IOVA 4FDMA 1PR5A 4LYJA 4C76A 2O20A 2Z4TA 2W70A 3U17A 2CL5A 3ZXSA 3G88A 4AY3A 3JQ8B 3HCOA 3R6LA 4TL8A 3QEJA 1T2FA 2MCFA 5KPDA 2X2FA 1J8FA 2AD5A 5G40A 1NSTA 2PR2A 2EU8A 2FR1A 1ODSA 5M5BA 3V1LA 5JALA 2XMSA 1MO2A 4M9ZA 3SS9X 1E9RA 4UTVA 1BFUA 3JZIA 4YT5A 2XRZA 3R0QA 2J0UB 4D79A 3ZCQA 2UVPB 1KERA 3NBFA 1WW2A 1ZUWA 1RHUA 4ACBA 5IMSA 1R0WA 1S7CA 4I66A 1ZM9A 2HZ7A 5ALFA 2PM8A 1TKCA 3RU3A 4M2LA 2WVJA 1UOEA 1XHFA 4QU8A 4JQSA 4RV9A 2LXNA 5KPJA 1JG3A 4JLKA 3RSGA 4DKJA 3ZGZA 2V4ZA 2JJ2A 3EULA 4N8SA 4FCVA 1F2UB 1DQRA 2Q5OA 3LYLA 4UW9A 4WW0A 1C30A 4TT3A 3OIVA 3DP7A 3M1LA 4MV4A 5C4GB 3UCEA 3WZLA 1QF7A 1VSBA 2TMGA 2YWFA 1JIXA 2NXJA 5JAPA 4LOJA 1AKMA 3PX3A 3UM9A 4M1TA 3W9UA 1BU8A 2UU9B 2ZE5A 2YY7A 5IF9A 1DUSA 1KJYA 4CKZA 3GLGE 3EVBA 2HKIA 4MMZB 4NBKA 1MJNA 3KWJA 1T0UA 3MBIA 2IYUA 4MLPA 4PGFA 3ZWVA 1PAUA 3HDHA 1BFDA 1DELA 1LBTA 2XMGA 2XJ9A 1XEXB 2W98A 5LUBA 3V2UA 3GJ4A 1M2EA 2VNSA 4KW7A 4Q4LA 1GFSA 1IFXA 3S6JA 2G7MC 2P9ZA 4MRRA 4AI6A 3TSAA 5EMJA 5BWNA 5MFPA 3ZIAA 2YC4C 3NVKI 1B8NA 4UM7A 2A2ZA 1WM1A 3WRVA 4YHHB 1W52X 2DPGA 2K6GA 4P4TA 1MB2A 9MHTA 3PHBE 1UP4A 2I3GA 4BNIA 1QWOA 5KQSA 4GWGA 2P9CA 2R86A 3QTBA 4HX9A 4X6UA 3FPSA 3TRIA 2Y8EA 3JQ7A 3M5PA 2BLLA 4HJRA 3K09A 3LKZA 4CLHA 5DNCA 4RIHA 4L78A 1Q91A 1T3TA 5E1BA 1RQPA 3FFTA 2PS1A 4AC9A 1HO3A 2XVMA 3FJ1A 3VR5H 3HWX1 3IAM1 3MZ0A 5ETJA 4GPTA 1I51A 1O94A 1UZAA 2YXPX 5DOVA 1ODIA 2E4AA 3GGCA 1WLSA 4RE6A 3H2JA 4TMZA 4QTYA 4RVFA 3BAFA 1AHNA 4CHGA 2JFWA 2YUIA 2XADA 3OT5A 1YJ5A 1L6IA 3VC3A 2OSBA 4I81A 4AK9A 1Q17A 1J7JA 4PM4A 3S5UA 3HYRA 3A27A 3PE4A 4BMPB 1R0SA 5KX5A 5BSKA 3IUQA 5AT1A 3FGOA 1JFRA 3QVSA 4DYHA 5A6VA 4HAYA 4UQPA 2NWQA 1ZOLA 2KB0A 4WY5A 4URVR 1V8DA 1ZMXA 3BH7A 3DWEX 2RHGB 3AXTA 1JQEA 2V54A 3G0OA 1MLDA 2F4NA 2QRGA 2P2LA 2XVZA 3DEIA 3PENA 4NOLA 2C98A 3SNKA 3VYTB 1HPLA 3A3KA 1M8JA 3PBKA 3E22A 3G9UA 1F8XA 4IEFB 1ZW1A 4TL9A 3ZOZA 1XRRA 2X86A 5KWVA 3BE5A 3KZXA 1GFZA 1WX1A 2Y1XA 2BGRA 5MN6A 2Y1WA 3GRYA 1KO7A 3OC6A 2DULA 1OAOA 4NESA 1NV8A 1UBMS 1NFQA 3HQ4O 1GZVA 2D4HA 1KOFA 3L0CA 3NHUA 3VAYA 5FTNA 3OIGA 3KSRA 3SS7X 5HQJA 3RAFC 1QHYA 2N47A 3VR6D 1VXOA 4EJSC 2VDPB 5L3RA 1TK3A 1Q3HA 4FT4A 3KOMA 3P19A 4D46A 1VJ0A 4K8OA 3WYBA 3F67A 4BZZA 1V96A 1XZPA 2DBZA 4NKRA 3GRPA 5AJYA 3VVMA 5K6TA 5KQPA 1E62A 4R9SA 3B6IA 3TM5A 5C1BA 1XJ5A 2CNKA 3L41A 2HA2A 3KJXA 4WGGA 1LSJA 1U8UA 2BFNA 1TTHA 2J4FA 3FUXA 4HWRA 4DRYA 4N54A 4B85A 1AM4D 4A5OA 4BNXA 7ADHA 1JHXA 4MVJE 3ANLA 3AGPA 3KFXA 4MJ3A 4PZ9A 3O84A 1XLWA 2FN3A 2HWKA 2ZW9A 2Q8PA 3BEOA 4NOMA 3ZCUA 4JGGA 5KVSA 2HF2A 1X80A 1VCNA 1EHCA 4PGMA 2VHZA 5FI0B 1NVGA 4LZPA 4B5KA 2GMWA 3O0TA 3T3HA 1ONSA 3WSVA 1W48A 2B1JA 4RPHA 1M2HA 1FUIA 3QTTA 4US1R 1R8SA 4TV8A 1L4BA 1MEEA 1BCSB 4HEA1 1RQ2A 1LTKA 1SKBA 2D0OB 5FR2A 5KI6A 1K1EA 2B21A 4RK7A 3QW4B 2VUTA 4A6DA 4HDQB 1CBUA 2JD0A 3DAPA 4M46A 1JKIA 4Z4GA 3N2KB 4YHBA 4C0QC 2WPNA 2J9RA 1QJ4A 4RY9A 4JJ4A 1PKXA 2HJHA 1Z4KA 3HGMA 5J9FA 5BXQC 3NX4A 3U5TA 2J4DA 2Y99A 3NDBB 3GZ4A 5DNWA 5TNXA 4REMA 1CUGA 1O96A 4AX8A 4YRRA 4C4SA 4D3DA 1LXCA 3A6FA 4WEQA 4Q5IA 4ZCIA 4AN0A 3PHHA 4EHJA 2CHFA 3V1KA 2QBYA 3P7MA 2GI4A 2IEIA 1LF0A 4IMIB 5BN4B 4Z0PA 5KVVA 2H4FA 4R8LA 1KKLA 5CB4A 3N2LA 2I1QA 3JZDA 3P26A 4MV7A 1IY9A 2AR0A 5FNZA 3UV3A 5G4KA 2VDVE 2H00A 3JQBC 4GC5A 5F52A 3RF6A 4A23A 4YT8A 1UWLA 2YNMC 2E5WA 4PNHA 1GGHA 3M4YA 2CNWD 3UJHA 4EPTA 1ESCA 2G76A 1ZM7A 2DMRA 4CG1A 2GM4A 4MKRA 1NNEA 1S8OA 5TF4A 4EATA 4EF6A 1EUZA 1JMKC 2A9FA 1PZHA 1WF3A 4LX0A 3GNQA 4J07A 4W5OA 1WMDA 1KK2A 2CUZA 2YCLA 5C5EA 4TXHA 1P2GA 2X8LA 4HTFB 4KZKA 3TNFA 1N7GA 3ZWYA 2JLYA 1F5NA 3EXFB 1JG4A 3ZW7A 2GN1A 2ECPA 2YY6A 5DW3A 1GL7A 3HV0A 3PC8A 4L5IA 1JX6A 5JBQA 3EMVA 4Y8VA 3OJLA 3U1TA 3EA4A 1JHAA 4FU0A 2FPUA 4M7PA 4O0LA 4UNPA 1QRUA 1HT0A 1UINA 2YW9A 1UZNA 3ZE0B 3JTEA 1JA0A 3AR5A 4GI7A 4EJFA 1UBSB 2ZAYA 2PKQO 3QHPA 4LSWA 3V5NA 1IU9A 4UU8A 1HI9A 2W6PA 5FFMA 1FU4A 1NI4A 4AYTA 1H85A 1Y1LA 3DR3A 4ZO4A 2B8JA 3HM2A 1U8YA 5JU6A 2OFFA 4DMKA 1M6YA 1SBNE 2DPMA 1Z26A 5DM70 4ER6A 1O6CA 2FXIA 5BOSA 1WMBA 3LBHA 3VPHA 1PJBA 4EYEA 3VKHA 1KFJB 1PJ2A 1RYDA 3NDIA 4BNDA 5K8LA 3FTNA 5FNVF 5HMLA 2EL7A 2XRMA 4KN6A 5DIZA 4UULA 5C3MA 4RJ2A 1P80A 4ZIRB 4U6NA 4RVCA 5IT0A 5CEEA 1GPLA 1M10A 3OETA 1E9CA 4NQRA 1MVOA 1ZRSA 3AERA 3H86A 4OX9B 2AG5A 3DZHA 4Q1BA 5IAGA 4QXOA 3QMMA 1EVQA 3QI2A 3M4JA 3LW7A 4JEHA 4AIIA 1SH7A 2G40A 4QBFA 5JC1A 4IVQA 4G0MA 1V1MA 5C5CA 1PFVA 1N2IA 1CS0B 2R9VA 3C3AA 1KS2A 5IAKA 4UBIA 1AUQA 2PAAA 2YHUA 3C3BA 4FT2A 1BO6A 1FBTA 4JJFA 2X4GA 3L82B 5LA6A 1GCAA 2JIRA 3EBLA 4WJZA 5DGCA 3X2EA 4YAUA 2IYZA 2NN3C 1NUAA 1V4VA 5F21A 5H3HA 4BQFA 2NZYA 4CV1A 3DWFA 1Q0HA 3DHYA 1YQTA 1M2KA 5IVKA 2MR5A 4ER7A 4YMGA 2J46A 1AK1A 1QG2A 3QFFA 3V33A 3U44A 5K3CA 5LQRA 2D4AA 4MCHA 5AJHA 2P9YA 1Z7BA 2G07A 3LQKA 4I14A 4TN1A 5PNTA 2NO1A 2ZBFA 1E2BA 5JSYA 5A5GA 2H3HA 4I50F 3MA0A 5EJMA 1S2LA 5IJWA 4AZ0B 2QMYA 3EIHA 3KJFA 1MOSA 4F9TA 1M34B 4U2FA 4WCFA 5HS6A 1AB6A 1LPOA 1A2OA 1ZUIA 2M98A 4OHOA 4D9NA 2GJAA 2D1RA 1XD8A 2RHRA 4YMLA 3NUZA 3PUZA 2JIDA 1PVVA 2GBFA 4WJLA 4C7KA 2WTNA 4RY2A 1D2MA 5LQKA 2VDUE 3NT4A 1DJLA 2ZB8A 2QSUA 3D6VA 3SXPA 3VR2D 2BW0A 3BL8A 1DBWA 5E8RA 3JYOA 4YGYA 4PLPA 2P35A 3IP8A 2J9YB 4L7QA 1JT9A 3MT7A 1CY8A 4Q3NA 5DJ5A 5BR7A 3AIOA 3QPBA 2ZIUB 3CLTD 1FQWA 2J08A 4F9GA 3F3MA 3OOSA 4Y2UA 1PJCA 4HXYA 5FO1A 1ZISA 3RRXA 4RF2A 3D3JA 1R6AA 4TKLA 1RE0A 3B9QA 1UOOA 4DV6B 2HJGA 1ARZA 1P0IA 4KITB 4WINA 2YFQA 2FK8A 4JH0A 4CMAA 4C3UA 3M4NA 3QE0A 4F12A 2R1ZA 4UMFA 5CVJA 3FJYA 3HUFA 3HJBA 1HSZA 4NS4A 3OFND 1TO1E 2ZCVA 3E9CA 1ATIA 1V5FA 2XJ4A 4RKFA 4GOMD 4AG6A 4BBJA 1JKJA 1PQUA 4V39A 1J97A 3OE5A 5F5NA 3GCXA 1TFRA 4O4LF 5G0SA 2QTHA 1OAKA 3FFXA 2WP0A 1C8KA 2JFPA 3QKSA 1JDSA 4XQ9A 1Z4IA 2BGKA 4J0IA 4JIGA 1FRQA 2Z95A 2CLIB 2AC4A 4RVSA 2D6FA 3CF2A 3DO6A 1Y7PA 3M6LA 3O9ZA 3RM3A 3ZV4A 2OHIA 3L8DA 4MQFB 3RPEA 3F73A 1IPEA 4HY3A 4KIUA 2KJQA 1VPLA 3QE2A 1RACA 4D9FA 4M22A 3AINA 3AQ4A 5J2UB 2WZQA 3BA1A 3AKDA 4S0XA 4BZQA 3HA3A 1SZPA 1KEWA 3JX9A 4E32A 1QE0A 4YCMA 7GPBA 3OSZA 5TGTA 2ONZA 2KPOA 4ND6A 1EGAA 3DQZA 2Y68A 3HRHA 3O90A 3QUSA 1A88A 2EFEB 1XEWX 1OSNA 2WSSA 1HDIA 3DEAA 3FNFA 1IHPA 4JLJA 1U0FA 4BVHA 4X84A 2P9JA 2HMYB 2UZ0A 3AESA 3PGMA 1RT9A 1K75A 1Z08A 3EGDA 3GMIA 3DEYX 3KZ1E 3PDWA 3QTLA 1HE3A 4XLLA 1DO8A 1NQ5A 4XUGB 1B73A 5BT8A 4XVCA 1NMZA 4RADA 4U8GA 4BJHB 5K7SA 1VL1A 1Y34E 2GWRA 3EEFA 1ZIYA 1VSVA 2OVFA 4NRDA 4ML3A 4Z1MA 4JR0A 4OHVA 4R3WA 4CYMA 1DG9A 3WIBA 3RS8A 3ZGVA 1YGYA 4DLVA 2ERCA 3Q8KA 3KZCA 4RGYA 2CLKB 4MIEA 4U7HA 4KV7A 3DLIA 4PU0A 3WHKA 2VTBA 1HMPA 5HZGA 4N7MA 4CZ2A 3LE8A 2BEVB 4L2IA 1YVUA 1R9NA 4HB3A 4KQEA 2VL7A 4KRGA 2CBZA 2GXUA 5D7NA 2ZB2A 3H5RA 1M2OB 4ZYWA 4CJXA 3V1YA 1R8XA 3AFIA 1FXUA 4L50A 4EEKA 3R5JA 3WMXA 2YYYA 1AO3A 1VSUA 2QUIA 2WAMA 3FFBA 4JYPA 3UHOA 3RYTC 2ZSUA 3IERA 4JEUA 3LCMA 2VYCA 4U39A 2GM9A 3D3EA 2PBLA 3HU1A 4PRYA 4LZJA 5AJTA 3LT4A 3LY5A 2CY0A 1G291 2OKGA 4FMPA 2I4RA 1LJ8A 4MS4A 3REFA 1W6RA 4WBSA 2GHTA 2EW1A 2IPOA 5KNCD 3E9MA 4KMOA 2BY4A 3GBVA 3LVRE 3O4FA 1BN6A 3BSWA 3K2EA 4OQEA 1XKQA 1SBIA 1B8PA 4ITUA 2Q27A 1BWQA 1RPJA 4C0XA 5JQWA 1B8VA 1EVZA 5A9TA 4AXXA 2HR1A 3EARA 3QNUA 4RD4A 2PTGA 1E4YA 1VMDA 2Y66A 4NPAA 3TNJA 4CI0B 2DOKA 3A32A 2FK7A 2YXLA 3BRWD 1QUFA 1SKUA 2WAYA 4I4IA 3F6PA 4U1RA 4LTMA 4FFOA 2CVHA 2LKCA 4PXSA 2G70A 3O26A 4YRKA 4ZN6A 3FNIA 3OQ6A 3ETDA 2AC2A 4LYEA 5DHTA 3TBKA 5KNCH 2VJCA 5IZCC 1D3AA 1BWPA 2ZWPA 1BG6A 3F6SA 4IYRA 4K40A 3INRA 5BSTA 4QDTA 2FUEA 5HIAA 3C5VA 3LG2A 3KT6A 1AY0A 4A82A 2CZCA 3ZBTA 3K2IA 4QICA 4W4TA 3RODA 5KQLA 5AW2A 1HMYA 3K9CA 1GKKA 3NM4A 3C0KA 2ZTVA 4ND2A 2BFPA 3H6KA 1T15A 4FHGA 3U1BA 2QTLA 1PLLA 2M1ZA 2H2GA 5CH5A 5ALLA 2R3SA 3IUPA 3LH5A 5FOXA 3GK3A 4MIOA 5ALZA 4HI0E 2NUBA 2FV8A 2IXEA 4M9QA 4C6RA 3BYZA 2KS6A 3ZDQA 1XE3A 1YS7A 1NF9A 4G2TA 1KYZA 4NBLA 4QNRA 5FBZA 3HEAA 4R01A 1JGTA 1U99A 4I1RA 3Q1KA 2BMWA 3RK0A 4HAIA 5JE8A 2Q6LA 3KLOA 3ZY6A 3TUZC 1GFWA 3E81A 1VJDA 1QWSA 3H8WA 3EUFA 1KQOA 4QOGA 5JAIA 6CHYA 5DX8A 4ZYLA 4BX8A 4WZAA 4ZARA 3BTUA 3M6UA 1K8QA 1QQTA 5EFZA 2WWXA 5HRAA 4XIYA 1XKTA 3CE6A 2BONA 1UOQA 1R7RA 2WOOA 3AEUB 5ECYA 1L4KA 1Q12A 2ZBGA 2WNHA 3AY3A 4TMFA 4R71A 2JAHA 5DP2A 3OCVA 1KS9A 4UNRA 4P86A 5HF8A 2CSXA 1K8XB 1SIOA 3WWPA 1DEXA 2PT6A 4RQBA 2V9PA 4OFZA 1NC1A 3FDZB 3JARA 2GX6A 3LYAA 1DIHA 3X2SA 4C4PA 4MTCA 3AONB 2X7JA 3E6AA 1CE8A 3K53A 5A3VA 3ZNPA 3MXOA 4QJ3A 2HJWA 1ZNXA 3H9GA 5I7SA 4YAJA 3OQPA 2R00C 3ASUA 3DBRA 1Y9EA 2VHCA 2QJTA 4Y9RA 2SICE 1C4WA 2PRYA 3BB4A 4Q7KA 3UK6A 4XFKA 4C5CA 3FOAA 4LY6A 2NXNA 1U1GA 1ULAA 1PYGA 3LFUA 2B37A 2QR5A 3QVGB 4KFSA 4MDYA 2FYTA 1G7TA 3E8XA 1WDWB 3Q6IA 5ENDA 1DVRA 3DZJA 3AVWA 3K6SA 1KQPA 4B80A 1WR8A 3UWSA 2ZXUA 5JS1A 3UJCA 5FJJA 1BMTA 1PZNA 4DWJA 3ZDDA 1JPJA 1RCUA 2PX2A 3ULKA 4X45A 1L8LA 1YZVA 2BGJA 2GB4A 3CH5A 4EK9A 4PLGA 3VSDA 2BVNA 2GH1A 5EERA 3M4XA 2Z09A 3PC6A 4B0OA 1K63A 1LVHA 1XEWY 4Z0HO 3U4QB 1OYYA 2XUKA 3C24A 4Z3KA 1J8VA 4ND3A 1DC6A 4ZT5A 4DGQA 2WQ7A 1P5JA 4X90A 1SUBA 2D2VA 1I3MA 1FDIA 3TI9A 3TQSA 2XNKA 3WYNA 1IUPA 5ALOA 3V4RA 3BKXA 1XMXA 4CDRA 1PJRA 2PVSA 1S6YA 4YV2A 4ETWA 4RHEA 3WK5A 1MVLA 5LQJA 3E9YA 3PUKA 4GEGA 4D3SA 2VPIA 2R6GA 4KNWA 1KEEB 4N41A 5KKNB 1GEGA 5JCJD 4XQCA 5TVKA 5IVIA 5ERYA 1J1UA 4L8GA 2A88A 1WY5A 2QSYA 1P7WA 4S1TA 4M0PA 1Z16A 3EQZA 3N8GA 1KVSA 3ZEIA 3OX4A 2ADMA 5A4IS 1Z6ZA 1W34A 2O2XA 1NJ2A 4G0XA 1OJ7A 2DUNA 3SM9A 5LXTB 1TPYA 4NWIA 4TWZA 1BEEA 4LYHA 4CMEA 4H1VA 3EVTA 3U7JA 5JARA 4L51A 4X0EA 1P1KA 1UDRA 2ZWAA 4NJMB 5LWQA 2FHSA 1S1CA 3BE8A 3E5RA 1V5EA 3ROMA 3TUJC 4P7KA 2WE7A 2RJ3A 4F3RA 1N34B 1AC5A 2A1TR 1ORIA 2C7BA 2JGJA 3AL3A 3EXEA 2FQWA 4QJ4A 2YXBA 3HN6A 4URXR 1ACLA 1ZVMA 2CK3D 2PX8A 3E7WA 4U9HS 5J3JA 1BDBA 1J8YF 3EX7C 4QOHA 3S28A 5CG2A 1KC1A 2EOAA 4ZQIA 4BRSA 2XCIA 3V46A 3AVUA 1BOOA 1O4VA 1Q92A 4MV1A 5DTMA 3LK7A 3ROPA 5KU7A 5JXWA 1QC5B 3NJ8A 3DFZA 5K6RA 1QJCA 3L8HA 2PYDA 2QY6A 4LJ9A 5ALUA 4BL5A 3FNQA 3BWEA 1AK2A 2W2OA 4HYYA 3ZD7A 1XA0A 2P67A 3GR6A 3Q6MA 1NA5A 3KOYA 3P97A 4IUYA 4S3MA 3T5DA 4BNGA 1Z5NA 2C2YA 5HKKD 4C78A 2ZEJA 3C97A 4C0JA 2C96A 2W2NA 2BV3A 4ZT2A 4GGOA 1FMLA 1K2VN 2UUPA 1U0NA 3VU0A 3ZCTA 2EKZA 1MIHA 3CO5A 4LHZA 1AS3A 5EPEA 1MJ5A 5A4FS 5KQRA 5LP6F 3UJNA 3L43A 1H2HA 3ABIA 3FHJA 1U2ZA 1VYUA 5IJ0B 5IU6A 1BDHA 4MP8A 4QU0A 3BIXA 1OH6A 4EGFA 4BO3A 1ICEA 3K6KA 4EZIA 4FDVA 2XE8A 2C88A 4WBXC 5BR8B 1JLLB 4D02A 4EY4A 1CQIB 4O2AA 1F0PA 4WQMA 4LJ4A 5FLXA 3SU8A 3QOYA 3CRZA 3F5SA 2BEWA 3GNSA 3IP7A 1J24A 1HC7A 2UYYA 3LP5A 3CY6A 3MCUA 3UANA 3DEHA 5D3MA 3JRWA 4CMBA 4KP7A 3WBKA 5GM2A 4KQHA 4EGAA 4EMUA 1QO9A 3SXUA 2GF0A 4KQJA 1E1QA 1CHDA 4KCGA 3L7MA 1MDFA 3DSRA 2WF9A 3ZE1B 2JHCA 2NZ8A 3TEJA 2ZFUA 1FTGA 2PGNA 4IVPA 2WWYA 1GCIA 4PEVA 5CT4A 3NBAA 1KHHA 1Z6QA 1FVFA 5I6DA 4HZUB 1MX1A 1MAHA 4OM7A 3OLZA 3IQHX 1XZEA 3DBIA 1AQIA 2Q2QA 2RGDA 1HF3A 2PUWA 3NV9A 1EGMB 2WIBA 4HATA 4YASA 2NUTA 1YTUA 3TSCA 4DCUA 2QJFA 5E3HA 4BECA 1KAMA 4Q3LA 2ZRQA 2ZYDA 4RPGA 3FTEA 2CHEA 2V1XA 1E5DA 3AVVA 3GRRA 3M34A 5DWQA 1IXRC 1U0LA 2VJMA 1EWQA 1E2IA 1JUDA 3EODA 1VI2A 1Z38A 1E8MA 2HDNB 3QLJA 2FN4A 2A94A 2H06A 2C3MA 2BFCA 3EG9B 5ALYA 3CX6A 1RI5A 3PNBA 3TQRA 2QP9X 1TA9A 1EWTA 2OCGA 4MWBA 1D0VA 2A5YB 2B34A 4XLTA 4Z8XA 4F4IA 2OBBA 1JXQA 4PZDA 2PYIA 4MK4A 1H2FA 2BM1A 2O3JA