2GK4A

The crystal structure of the dna/pantothenate metabolism flavoprotein from streptococcus pneumoniae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
229
Chain Sequence
AMKILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGYEVCLITTKRALKPEPHPNLSIREITNTKDLLIEMQERVQDYQVLIHSMAVSDYTPVYMTGLEEVQASSNLKEFLSKQNHQAKISSTDEVQVLFLKKTPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKNQLQTVQTKEEIAELLLEKIQAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title The Crystal Structure of the DNA/Pantothenate Metabolism Flavoprotein from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 71
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 2gk4A00
2GK4A 1U7UA 1U7WA 1U80A 4QJIA 1P9OA 5INTA 1U7ZA
chains in the Genus database with same CATH superfamily
4G0MA 5KINB 3IKVA 4RK7A 2CMHA 3KOXA 5CLLA 1KMQA 1KVQA 1M0TA 3C3EA 5FJIA 2H5JA 3PNLA 4XLLA 2EZ9A 1U1CA 1V1MA 2JGKA 4FU0A 4OXXA 1E3TA 1EEXB 1YFJA 2AR7A 2IYPA 4GOMD 1T3SA 2CL5A 1DAHA 2HHAA 3G0IA 3QVKA 4C0WA 4QNMA 2ZROA 1BYIA 2YZGA 1TA9A 5JW6A 5KWJA 1NVVQ 2VHVA 3AU9A 2WPNA 4AYXA 4XIJA 3MRTA 3KAJA 4KZPA 2LD4A 3EXHA 2JGDB 1VE7A 5EHZA 5IAJA 1IY9A 3EFBA 4HFNA 1C0EA 4MKGA 1ACMA 4KRXA 2X15A 1M1NB 5ALRA 4M83A 3HPRA 5T3YA 2QX4A 3FTDA 3FWZA 3KUCA 5FWXA 3AONB 1GAXA 3K8QA 1UXGA 4MIEA 1YZKA 5ELLA 2G8LA 6AT1A 5JV5A 2AK2A 3H4MA 2B94A 2OB1A 3D0RA 4MVJD 1OT5A 2PZJA 1M0WA 4UNSA 4N0DA 2R7KA 4ZC1A 3GAZA 3PRYA 1JFLA 1IYZA 5AUQA 5A6SB 3ADBA 1V37A 2V97A 3HGQA 5ALWA 3U4CA 2ZJZA 4NXMB 4DCNA 1XRPA 2VDMB 2VDWA 1QONA 3KSMA 2Z98A 1OPXA 3GJ5A 1E99A 4PAWA 4F46A 2C2MA 4B87A 4TQGA 5DI3A 3YASA 4URFA 5JRDS 1Y8ZA 3PJRA 5JNLA 4TSKA 2E9SA 4GC9A 3AP2A 4MUAA 4FD3A 2IODA 1P5ZB 3C3BA 3VR2A 1Z2AA 2Q1WA 4ALLA 4NF2A 5FHQA 1AA9A 3MQFA 1M2HA 1RVV1 2IGBA 1RWVA 2P9FA 3HRKA 1MXFA 1XTPA 3EOZA 5TQ0A 2PG3A 1IZZA 1U4OA 3H7IA 3OCVA 3UB4A 4ZVPA 2BZ1A 2JFGA 5AK3A 4CIDA 2FW9A 3V3KA 3NR2A 1YGPA 4MA4A 3V1LA 1U2TA 1YQGA 3HI4A 1QPGA 4GSYA 1U7OA 4Q1VA 3RJTA 4ZCTA 1FB5A 4XGQA 1UIMA 3G49A 1BJKA 1KIFA 2E3JA 4FEGA 5CVEA 4AY4A 1M83A 3HYLA 3VA7A 4BPRA 3O8NA 5BRNA 1GQFA 4NC9A 2R8PA 1S3IA 1T8RA 1K8YB 3HLKA 4W1SA 2H31A 4HAUA 4OMFG 4UU7A 4UASA 4N01A 3V33A 2DFKB 2VDOB 3DXFA 3NDRA 3P20A 1QZZA 1U2DC 2H4YA 3DO6A 1BE1A 3ETHA 1WUJS 3JRWA 3PDCA 4GOND 4RFSA 4TUYA 1SHLA 4B8WA 1MP0A 2OFWA 5IJWA 1LBIA 3OMXA 3PR3A 4DZRA 1ZOOA 2OCGA 3ITKA 2XYVA 3ZS8A 3V7NA 3SQLA 3EUWA 1TU0A 2B8WA 5B2EA 1KI3A 1BCSA 1EX1A 1XMJA 2AG0A 4F4CA 5KSZA 4GPAA 1CLEA 2BMWA 3L0SA 3TLMA 4II3A 4WBNB 4EGSA 1TKRA 2R60A 2ZIVB 3RSLA 4MS3A 2AZTA 1NAIA 1O03A 2E6KA 3R5FA 4O33A 4YB8A 2CC2A 3IERA 4UEJA 3V8MA 1CEEA 3L6UA 3KEMA 1PYOA 5ARBA 5DT9A 2SNIE 4PY2A 1TO2E 1IN6A 4KWHA 1PG5A 1FRNA 3DMGA 4R1UA 2VA9A 4JWTA 1K0FA 2BEJA 1RRVA 2DPHA 5LZ5A 3JQGA 1GZDA 4HQKA 4O4IB 2IV3A 3FDZB 5CG1A 4LW8A 1QF7A 3ABQB 1CT9A 1V1RB 2A78A 4D8UA 4DIBA 1ISMA 4BJ1A 2WG0A 3DGEC 3I9V1 4GMGA 4WSOA 2HNKA 1FS4A 2CKMA 1BD4A 2Q4DA 1F1BA 2V7TA 3VH3A 3VTFA 4BKOA 4E46A 5KMGB 1NZFA 1VXRA 2F8LA 2QE7D 4FFVA 4NIMA 1EG2A 1NJ5A 4WI1A 1VDZA 3UIEA 1ZESA 3BIJA 4JI3B 4I55A 1CHDA 3BPSA 3IHKA 5D6NA 4YRNA 3ENNA 3GBSA 2OK7A 3ORFA 2NZWA 2ZPTX 3HV2A 3M6IA 4P58A 2DUJA 3BQ9A 5E3JA 4R4JA 1Z6PA 3ZW8A 5A02A 4W5TA 1Z22A 1ZK4A 4D4MA 2ODTX 3JD2A 2LV8A 1Q7CA 1YAHA 2JNWA 4PC2A 2GEJA 4EELA 4S1VA 4C7OA 3DM5A 3C7DB 1O58A 2XOEA 1XDDA 3OTHA 4UHCA 1YDFA 1ZNYA 3LXMA 3PLRA 3R24A 4JJZA 3D4BA 2B7CA 4GSLA 1JU9A 3PCTA 4QOIA 1Q12A 1YS7A 1WNTA 4TM8A 4HRYA 2YC4C 1A2BA 3GRCA 1EXVA 2NPIA 4G5QA 1IPEA 1GUZA 3PUWA 3THWB 1I33A 1XF1A 1KVRA 4N6GA 5DWVA 1CG6A 3LAWA 4HXGA 4CDRA 2V3WA 3UV7A 3OQJA 1G9XA 5A71A 3T3GA 1TADA 4I14A 1EA5A 1RYZA 2HU7A 3GJ7A 5AVKA 4BB9A 3MT9A 3ZD6A 1U8ZA 3NP9A 2DMRA 4HGRA 4ZCRA 4G8BA 2IXBA 1PT8A 3TZHA 1N9GA 2C42A 1SKYE 4LQ4A 4PS0A 1ZD1A 2NUTB 1NBWB 1YQEA 2B5VA 2W2TA 4O4LF 1Q19A 2J5KA 2QP9X 5EXTA 3M5DA 1SHTX 3PX2A 5CITA 1F5SA 5CYGA 1O94A 1XCPA 2HRCA 1CQZA 1JI0A 3LVFO 3PXDA 2ETXA 1K2WA 1IN1A 3NP7A 1H0KA 2FSHA 4WW0A 5B1YA 3ELUA 3PPWA 2PRKA 1NNI1 1RD4A 2J6BA 2X1HA 3T3IA 1ZL2A 5A3QA 3WIVA 3NIDB 4QUEA 2Y68A 1E7WA 1SC1A 1E6LA 4NICA 5A4MS 3FJOA 4BN0A 4EKYA 5DLQC 5KWEA 5BYBA 1U6KA 2XE6A 3INTA 2PXXA 4KFCA 3M5PA 2PFGA 2VK2A 4BP8A 1HM5A 1VP3A 1YXMA 2X41A 2VJKA 3KXLA 3G82C 4HSEA 3CVVA 1HTWA 4YMLA 4ABTA 2NSLA 3SDZA 1P9OA 4DL9A 1W93A 3Q8MA 3MMSA 4N0QA 2X40A 4Z0NA 4N41A 3WK5A 1E79A 2WIDA 1LLUA 1QH1A 3C3YA 5AW3A 2K7ZA 4B3HA 1NR1A 4K9RA 1CWUA 1G5TA 2RHRA 3FYUB 4Q3NA 4DT1A 4JB8A 1R6XA 1Y5LA 4FR0A 4XGRA 2X1MA 4TLDA 4BQNA 5AVUA 2H48A 1AUQA 1J5EB 4Y9UA 2IYSA 4PIVA 2RD2A 4DXDA 1UJMA 3V7UA 2HADA 1E9DA 3OIWA 4PHCA 1C81A 4I1UA 5EINA 3D4IA 2GSWA 3VJLA 4DSOA 3RK4A 4P31A 4NZYA 2Z9BA 4PYJA 2GJKA 2Z1DA 2Y1CA 1X2BA 3NHLA 1X0VA 4H59A 4MB2A 4L7QA 4V38A 1NOIA 5LP6C 2OQVA 4B3FX 4K8OA 3D2LA 2NSJA 2J48A 4HNUA 1SCJA 2JARA 1IBCA 1MB0A 1OWPA 1PZMA 1UXHA 2QUHA 2VYVA 2WTEA 2ZXFA 3LX6A 1SIBE 2WVAA 4J76A 4OLFA 2PFSA 4PC1A 4YRTA 4IX1A 3LHIA 3ZC3A 2JF0A 1Z06A 1OFGA 1C1DB 4ECAA 3KPVA 1U5BB 2X9LA 1DJLA 3EGOA 1KWGA 1PRYA 4LK3A 1FS5A 4E12A 1UPFA 3E35A 3ZX4A 3TIIA 1NVWQ 1Z29A 5EEHA 4EGFA 1ZWLA 3GAAA 1O6FA 4R1OA 3L8GA 5FPQA 2PGJA 4RTRA 5EXXA 1WO8A 1TOAA 4KHPB 2CF5A 3GUVA 1KQPA 1AV7A 3OIFA 4NE7A 4I8DA 2OK8A 1F2VA 2VRCD 1JSCA 1QNLA 4OY3A 1IIBA 5D8DA 4NRDA 4CMHA 5CGZA 2B2CA 4HLNA 1KDZA 1T13A 2FWMX 4RIHA 3K0EA 1R4ZA 1XEFA 3LFUA 2CN1A 5G4KB 3MXTA 3FSJX 1WDWB 4QECA 4BFCA 1KK2A 3ZCXA 2QSUA 3FOZA 1OQAA 5DEOA 3OPQA 2QMOA 3R7WB 1MPTA 3WWDA 4CHGA 5IKMA 5A05A 1KKUA 4EYQA 5DN6D 2UXBB 1MLDA 1XZQA 2R11A 5ELMA 3RVNA 3L5OA 2PNJA 1Z35A 3T5BA 2AMVA 1ZK1A 1PFVA 3C3WA 5M2QA 4N3NA 3E22B 5JSZA 3CISA 3WV4A 3JVIA 1HDGO 2Z4SA 3KAQA 5HR5A 1NG9A 4DR7B 1L4UA 2NU9B 4PN3A 4BGDA 1BSVA 1PW5A 1NJSA 4YRRA 3CSSA 4JFAA 3IRUA 3BAZA 1YI8A 2ZRPA 3G8YA 4GLOA 1T9CA 2AE2A 4KK4A 5EQDA 3DDSA 1WMSA 3OMWA 1R37A 2Y0CA 5HKKD 2ZRIA 1N5IA 4ZJPA 1R6DA 3TXYA 3CINA 3JQFC 3RUIA 4EGJA 2JB9A 3WLSA 1L8OA 2J9GA 1JXOA 3EK2A 3EGWA 4G5OA 3U7JA 5DHUA 4AECA 4OQPA 2HFJA 2WJ4A 3SN6A 4NH4A 4H3HB 2CV0A 2IITA 4TV9B 4W5HA 4GKBA 1BE8A 3RVQA 3AESB 2WUWE 1R0CA 2BJVA 2G4LA 4EIWA 1VJDA 2B69A 4QVGA 4JXZA 4DDUA 2YYAA 4EFKA 1Y9ZA 4MCAA 3A3KA 4LNAA 1DWQA 3CX3A 2NZXA 3ZWCA 3X1WA 2QVGA 3OM9A 1YZTA 3FWNA 4KR9A 4S24A 2FLKA 3TTWA 1Y3DE 2AF4C 3D8BA 4EKIA 1KK3A 5C5CA 1V6CA 3EGVA 3H05A 1M75A 3UMGA 4TZTA 1YB6A 2VP3A 4J3NA 4M0LA 2OSBA 5CAEA 2G82A 2J9XB 5KNCH 4HKTA 5CPFA 2HSJA 4YRQA 1WXEA 4R0MA 2EWVA 3AW8A 1CUDA 4Y6GB 3RS8A 2ODBA 1XTRA 2YNMD 3QRWA 4P4NA 1AGYA 3IAHA 2W6MA 4X20B 5JXHA 1GG5A 2BBSA 1J0BA 4E33A 1YMQA 2UU9B 4RDXA 1LSJA 2H5EA 2IU6A 3GLTA 3OCUA 2R62A 2QW0X 1E64A 2DQSA 2I54A 3IBGA 5BUCA 1CSEE 3T1TA 4GEGA 1C0IA 3PXEA 3WFIA 3QFHA 3ZU5A 1PIWA 3OCZA 1XHEA 1TMOA 2GJ4A 4LRQA 4V1CB 1DFIA 3RQSA 3TFWA 2OORC 1BEZA 5E2BA 4XGNA 3X43A 1NUTA 3G1TA 2P1DA 3W6PA 4FB5A 3O03A 4DV3B 1E5XA 1F8XA 1HEUA 1G5FA 2NXCA 3A6JA 3HKDB 3U09A 4TS4A 1DAGA 5HW0A 3OZWA 4YMSA 4NZOA 1MOZA 3LCUA 4B33A 1FZTA 3SX4A 4RTPA 1XCBA 1FFBA 3H5AA 4B3TB 3WHLA 1Z3CA 5CXXA 2J9FB 1R64A 4YCMA 3HB5X 1R5OA 3NBQA 3QU7A 3RYIB 2BGTA 4OAQA 1U2PA 3NORA 1B2LA 1FJ2A 2JDIA 3LX4A 3Q0EA 1ZBQA 2MSEB 5A9SA 3FPKA 3D0QA 1T3LA 2J59A 3GLRA 2JH8A 2NVWA 3A1TA 3KFXA 3PI7A 3WGQA 4H17A 5BN4B 1DAKA 1KMNA 2GZRA 4RAQA 1XV5A 1JNYA 2FWBA 1IHYA 2WF5A 5JDCA 2VBFA 3Q12A 1ZMOA 4O29A 1WSDA 4NE2A 3HK2A 4Q15A 1AXGA 1GP2A 3PQFA 2ZAOA 4TKVA 1UK7A 4D6YA 1IM8A 1YKGA 3RJMA 4CKBA 4ZFNA 1Z25A 3WYGA 3MWJA 4KQXA 3U3DA 2A0YA 4HK4A 4AI6A 2EFHB 4MO9A 4J9VA 2JCXA 1QCYA 5FOWA 5AUOB 3P7MA 1IJFA 3EMDA 1ORVA 2OCPA 1BO6A 1JKJA 4K86A 3TLZA 4NPHA 1QANA 2RMKA 3ND5A 2M32A 1Z0ZA 3BA6A 4YJ2B 1K06A 4RY2A 1TUGA 1ZWKA 1KF0A 1PR5A 4KVZA 2OBLA 2OG2A 1RI2A 3OX1A 1CJSA 4HNHA 4POAA 5AOVA 2Y77A 3IQDB 1TE2A 3LO5A 5THXA 4MLDA 2X5KO 1PVOA 5IHXA 4PXYA 4PNZA 5F2EA 4TN5A 5HRUA 5EP1A 2WSSA 4EB8A 4U0KA 1Z5UA 3EGIA 3GLFA 3ZU4A 1FMJA 1NP3A 2DPMA 3E9QA 1O6BA 4YT4A 3BRWD 1FFXA 4QQNA 4NESA 2RHTA 1V41E 4F2WA 1XZDA 2RGNC 4P3PA 1I4LD 4IINA 4UZSA 3TKAA 1U7HA 3QLUC 4BQQA 1OAKA 2QVZX 2ZUWA 4UEQA 5A5FA 2GPSA 4Q4CA 2QP3A 3VYSB 2OG1A 2Q1TA 1KSHA 4OQMA 1Y6QA 3QZUA 1Z0KA 4G0VA 2QL9A 4P3NA 3HA3A 3MOSA 3WL8A 5F5XA 2G28A 1F3OA 1SPBS 1O5IA 2KE5A 4R8MA 2HIGA 2V7QA 4LSZA 2GN1A 1U3VA 2WT9A 1ZJYA 2ZU0C 4TT3A 4F5YA 1YBVA 5A5EA 2I2AA 1JL3A 3OE5A 3ZY4A 1XCGB 4B4DA 3V46A 2P5TB 5NLLA 3ICWA 4MEJA 5EG5A 1LY1A 1WXHA 13PKA 2IYQA 2QL6A 3P9KA 4E7PA 4A73A 1GTL1 4DSNA 5CB6A 1T36B 1PFWA 1W29A 3CG4A 3DZFA 5IT9A 4B6RA 3EQ6A 4F2GA 4EJSC 4M38A 3A3PA 4FFLA 1FNCA 5JCPA 1PZGA 4GMDA 5AKEA 2IQ5A 3HXQA 5AHRA 3I6ZA 1ORDA 4MTCA 5K3FB 3WYFA 3A4IA 2QW1A 2FDRA 1SCBA 1DI0A 2Q6TA 1NF2A 4MQBA 3O92A 1RJGA 3CF0A 3NBAA 5DWQA 1W25A 3IOYA 5YASA 2BOVA 4XQ9A 2FR8C 1WUYA 2GRJA 2ECKA 2P9CA 4HL6A 4UVEA 4DCVA 1TJPB 1TB4A 3U4HA 3A1EA 2GILA 1DBRA 1KORA 1NBIA 1ST2A 5DTRA 1O9BA 4ZEXA 3ROXA 4YRGA 1LQUA 5HOEA 4I5DA 5F9FA 2ZTSA 4D02A 1MH9A 1WWKA 2AC7A 2DUMA 4FYPA 4GVPA 4BNGA 1EX6A 2HA3A 3F9IA 3FCSB 3C8UA 2RGBA 3SG0A 4DZTA 4NBWA 2XXBA 3LW7A 1SZDA 5MF6A 5I9MA 1SM4A 2CFCA 3VU8A 4W1PA 4DY4A 3Q7EA 4FMCF 1NBMD 3VQTA 4DBZA 8ABPA 3F8SA 3BMQB 4BNYA 1E63A 2OL4A 2VZ0A 2RG7A 4B48A 2JHAA 1XZNA 2Q3BA 3ELWA 2ADFA 1SKQA 4FWTA 4ILEA 5CGQB 3O4GA 3WRWA 2GK3A 3A05A 4U7HA 4D0GA 1KZYC 1BOOA 4FCVA 2VTBB 2X6TA 3GBPA 4PRKA 2E5LB 2F3QA 4G1MB 1KRWA 1NW5A 1OX6A 5J59A 2H18A 5AW8A 3WWCA 2PMEA 3N74A 3R76A 2VEDA 2YHIA 3VNQA 1T6BY 4IHJF 3WK7A 1T2VA 1XMIA 3M6UA 2XGMA 3HKEB 4UTOA 4PHGA 2ZT7A 2GEBA 4OTZA 1JG1A 5B37A 3FD8A 1ATZA 1PGJA 3OKFA 2Z4TA 4AF7A 3ZQ6A 2YDXA 3DBVO 1IWPB 3OFNA 1P80A 2J32A 4H7PA 3EX7C 2AN4A 2I91A 1PAUA 3KZVA 1P81A 3EBLA 5E4JA 5EKSA 5AJZA 1H5NA 5JJ5A 1EM8B 2DEUA 1SQGA 1RI3A 1JHDA 3HVKA 3ITNA 1HT3A 5KAPA 3HJNA 3WYEA 4J16A 3SJUA 5IM4F 5EIOA 2F67A 1X70A 3M4JA 4OSOA 5GGYA 2SBTA 2JLAA 2QORA 5J5AA 4CM9A 4NBNA 5EERA 4WN9A 1YQWA 4DLAA 1X1EA 3EF1A 1T29A 1OHHA 2YINC 5AKGA 3D6UA 4PG8A 1SCUB 3CEHA 4JKYA 5HF6A 4ZQCB 1E92A 2DB3A 3SVTA 1EM6A 3B9RA 4MULA 4HWTA 3O31A 2ZSBA 3PTLA 3DHNA 4I9NA 1AB5A 4C4ZA 4LF8B 3QEAZ 5TXGA 3FB4A 4ZC8A 1L5KA 4N4AA 2B4TO 1K88A 1XZIA 2OXRA 2WEKA 1BWRA 3ZWQA 4WEOA 5TS3A 4HNGA 4JWKA 2RK4A 4A1OA 2XCSB 3HDTA 1GVNB 3QWFA 1OXTA 3LYAA 4JGGA 2ARKA 4B7CA 4REOA 3B6KA 3ABRB 2G7MC 2C29D 1ODTC 4GBGA 6ABPA 1ZCJA 4LJYA 2ZUFA 2AJTA 4R69A 1KPHA 1ZMRA 1QGUA 1XKLA 2F17A 3DC7A 3TE6A 3LA6A 3U26A 5A9RA 5KTKA 1N77A 3KOUA 3STHA 3DOHA 3OPMA 2AGVA 1YR6A 1LF5A 1EE9A 2VDLB 3KZKA 2IH2A 5A3SA 3OPYB 3DONA 4DHWA 4TTIA 3P8ZA 3AI7A 3DQPA 3UAZA 1PT6A 4QPCA 3VYVA 1KMIY 1UFKA 4L5AA 5BWMA 1VIDA 2I6XA 4AN4A 3OTIA 1J2UA 3GP5A 1HNXB 1B7GO 4GYYA 1AN9A 5B2ZA 5IWCA 4DCCA 5F2KA 3GLKA 3G2HA 2WMYA 3TDNA 3AUKA 1XAIA 3ODGA 3DE2X 2HF2A 2W48A 2Q4OA 3GFRA 4E4YA 2CD7A 3PQDA 2SKCA 3H1BA 2I34A 2PKEA 3NGLA 3TB6A 1E7QA 3ABOB 1I5OA 4P3XA 2QGFA 3B52X 2UYHA 4RXMA 2OV4A 4CLHA 2OV2A 1J8VA 1HKUA 2X86A 4RELA 3COSA 4JI7B 4E1AA 2VTEA 1V8ZA 2P9GA 3PHCA 4LHWA 1D09A 4KXQA 1Y4AE 2WJGA 1GPAA 2WT4A 4UC0A 3OBBA 1LPAB 1TTHA 1XPRA 3FPLA 2TMYA 2YW9A 1MVNA 2MMGA 5IVIA 4OA8A 5AHKA 5K6AC 1J21A 3HU3A 4O63O 3W05A 4EA6A 3OT1A 2ZWOA 3RD5A 2YZNA 4RD6A 1WCYA 5DBHX 3BH0A 1OXKB 1UJNA 3M6MD 1P29A 1BE6A 3GEGA 3P4XA 1U1FA 3BXHA 5KOJB 1EUZA 1I36A 2FUEA 3L4JA 1VKHA 3MW8A 2ZRCA 4MX8A 4L5IA 3X0DA 2EGGA 2QRVB 2JA2A 1PNVA 4IRMA 4F5ZA 3E0XA 5FUVA 3AHGA 4LC0A 5KREA 3IODA 1SHZA 1P5HA 2C82A 1N2IA 4JJ4A 1XD9A 3GFBA 4QOJA 5IK2A 3A11A 3W2FA 5DGXA 1X1DA 4H1HA 4L0QA 2B5OA 2JGAA 4B6GA 3LRPA 1E58A 2J09A 3LC0A 4NU6A 2A1TR 2VDUE 4AP9A 1XT6A 3PKJA 4EMBA 3QEOA 5HQ3A 5LDDC 1H85A 1LNZA 1WB5A 1M8FA 3IQZA 1I2AA 3AWIA 1ZI8A 1ESEA 3NKFA 1CQWA 5GONB 5J2UB 3RS3A 4A3SA 2XMPA 3OX4A 5DFAA 1AQNA 2YKGA 4JI6B 1Y3FE 3W79A 4FLMA 4W6QA 2KBEA 3AOGA 3L84A 1I6LA 3E5MA 4FK8A 4B0PA 2FQXA 2AYYA 3HRHA 1OZAA 4OYRA 5TVGA 2A4KA 5NULA 1PLLA 3COJA 4ZT2A 4QDTA 5LQRA 2Y1GA 1PR1A 5GQSA 3VPFA 2ZJAA 4KYVA 3W6ZA 3CRZA 2QAJA 4CN9A 1YRBA 3QENA 5JRJA 1E98A 2JD1A 2A9OA 2RHBA 3N2NA 4BRWA 3P2JA 1U7WA 4MV5A 3F98A 2PJRA 4Q7QA 3Q15C 3HNOA 3MWYW 4JXXA 2PV0A 1MOQA 2HMUA 1A1VA 1J8QA 4IDFA 2R5NA 1HDZA 1EGQA 2GFHA 1KJ8A 3QITA 1PFQA 3E53A 5J5CA 1YJ5A 4KPYA 4IJQA 4PSAA 4MIOA 1DWUA 3NTQA 4UE6A 2Y0PA 4OBBA 4ZVUA 3KL4A 3DMTC 4E5UA 5JEEA 5M34A 1QCDA 1VLQA 1P2BA 3NX4A 4QTTB 1SY7A 3T9EA 1VYVA 1U2RA 2NO6A 3FF4A 3NTLA 1MABB 4MLZA 3GLVA 1DO2A 1TYCA 5COAA 3LI2A 5JYEA 1XHFA 3HY3A 1XBTA 1DV2A 3ILVA 3VHXA 4V3CA 3AOEC 4JSTA 4F9GA 1BA2A 3WWOA 5C8DA 3HUFA 7REQB 2RGCA 4M4SA 5JH7F 3SZUA 4CPDA 2XEXA 1Z8NA 3DHYA 2XBUA 3EEQA 1UBFA 3ZOKA 1J8DA 3N86A 3RYFA 3WX0A 2GHQA 4FFDA 1GDHA 5JZMA 1B3BA 4Y9SA 1ZEMA 2CUKA 4YGXB 3C5CA 2Q2WA 4Y2GA 3AJRA 4UXIA 1IHUA 3S70A 3C4VA 4JLDA 1QDEA 3C7AA 3EF3A 3MM4A 4QRHA 2I6GA 3KOYA 3ABZA 2VUIB 2P2LA 4LRSB 4EABA 4JQZA 3OHPA 5E8JA 5A2QA 1FX0A 2XT9A 3L92A 1HFEL 1RC0A 1U0JA 2NVBA 3CXUA 3ZVLA 4DWOA 1JWLA 3HXPA 4G8JA 4XSVA 3AR6A 3TUJC 3VBEA 4ETMA 2UAGA 2GFQA 1E2KA 2DHQA 2IZ1A 2O2JA 3DTYA 3EF0A 3PNOA 4P82A 4Q00A 3T35A 4DTCA 4B46A 2JC3A 3NUQA 3T5DA 2RKBA 5ESXA 1Z63A 2QTBA 3V48A 4NBVA 4A15A 3LT4A 4QWMA 2X7HA 2FPGA 1MOSA 3FOBA 2DVMA 1NMXA 1GITA 2Z2JA 3PFHA 3EPLA 3NYRA 1JTVA 4FYHA 2IC5A 2Y1KA 3NM5A 1LBTA 1FLNA 1LUAA 1P2GA 1WXGA 3KTAB 4QYMA 5E3HA 2CDNA 5KNCD 1PO7A 3ENQA 3I52A 1MF7A 4JB2A 5KNLA 2YIJA 2Z0MA 3BA1A 2JG3A 3LUDA 1U9CA 4YGYA 2R8YA 4QGSA 2VK1A 2CLEB 3QP9A 2WUEA 5KX5B 1SCDA 1IG0A 1TKCA 4F4JA 1FF9A 1XD2B 3WBJA 4EG0A 2O8CA 5AICA 2X0NA 1JHYA 1AGRA 4X71A 2QBYB 2ZSKA 3ZHRA 2PMWB 4KO2S 4AFNA 5CB4A 3QVJA 2XUIA 2HK8A 3BFPA 5DLDA 4M0PA 1KBOA 4RH1A 1YB1A 3STYA 4BAUA 1KY2A 3NATA 4D44A 1QQAA 5MN5A 5H16A 3FUTA 2AX3A 3EZFA 5K3AA 3EXHC 3QLEA 3PI6A 4QLOA 4MS4B 1N4DA 1ZA1A 4IDEA 1SK9A 1YUMA 5HOQA 1KNQA 1HGXA 1N8NA 4FNMA 2CJXA 4Q7EA 2I2BA 2REQA 4MGKR 4OHWA 4PVDA 4RJJA 3C6ZA 4Z4FA 1AUPA 1RXEA 4JXJA 1CUUA 3L2OB 3UHPA 4LGMA 2C20A 4CUZA 1NZDA 3IAUA 2AG8A 3AETA 5F1KA 1GRCA 3ML1A 1U0HC 1VBNA 4P80A 5AP9A 1THMA 4JC5A 5JVDF 4QE3A 4NDNE 2VF7A 4RLHA 5FXMA 1Z5NA 4OGGA 3HBAA 1M1UA 5E9JA 4TXHA 4GMXA 4HWRA 4NL4H 4RIGA 5CA1F 1L4KA 4NYMR 4UW9A 2O4CA 5FWAA 4RQUA 4YDRA 4KO8A 4OREX 3NUZA 2I9KA 1P2SA 1AC5A 2H7XA 2NYAA 3ITDA 1CTQA 4ZO9A 5KNBD 2OFXA 2OV6A 5FA5A 4IS2A 1YCDA 2UUCB 2A0XA 3DYBA 4YT8A 1JU3A 2AMFA 4KVGA 4ZD6A 4YFYA 1Y6FA 3HA2A 5UKDA 1HG0A 2AYXA 3F3YA 2ZRHA 1QHGA 2FX5A 1HTTA 5IJ0A 3ZHBA 3P2EA 4B1FA 3RU2A 1XDUA 2TMDA 1JN0A 3AY7A 3HDVA 3PQ3A 2V9CA 3RROA 3QFCA 1LFAA 3VAYA 3HUDA 2ET6A 3Q10A 2FSIA 2GNAA 1AE1A 2ZU6A 3IBYA 4V03A 3U13A 3OZXA 3Q4GA 3QPAA 4EBBA 3BMCB 1K9SA 5EFZA 3T99A 5JADA 1VPVA 2J4FA 5J2TB 1WVIA 3FWHA 3WHIA 5TF0A 1M2NA 5EWMB 2XGSA 1AKNA 2R7AA 4V0ME 5K2MA 3UWDA 3WDKA 3AUTA 4OJKA 4LQCA 1QHXA 1BZYA 2C04A 4D3ZA 2D2XA 2W4QA 1P2VA 3O7WA 3WLFA 2ZE8A 1LPPA 4MICA 1SXQA 4GR5A 1WUIS 5FTLA 1JA0A 1RAHA 2Q6LA 4Q24A 4A27A 4EPTA 3NOVA 1R9MA 4PZAA 4DSUA 5KJCA 2EFGA 2CL7X 2V45A 1QRUA 1GA4A 3L7MA 1TC1A 1TMYA 4YAOA 5FUYA 5A4IS 4P7BA 4WOJA 4JOQA 4UM8B 2B8TA 3U4QB 4F56A 5CW1A 2BI4A 4ZGBA 3OPYI 4KMOA 3UH1A 3HB4X 4Z4HA 4RK5A 4G0UA 1T0UA 4XVQA 1T0IA 3OZTA 3B3FA 4HDMB 1XVUA 3GN1A 4ROTA 4BAGA 1W44A 3OZAA 4G2TA 3UPUA 3CT4A 3RNOA 3B48A 2W6OA 3JARB 3QE4A 5FA8A 2C58A 4ER5A 4Z7OB 1G8AA 4H3KB 3W7AA 4UQOA 2FZLA 4U8GA 3D6TB 3QIVA 3WQRA 1D1PA 4LJ5A 2AE1A 4E21A 2RAVA 5BW6B 4OQDA 5IH7A 2HTFA 2P5UA 4C14A 3WVNA 3OO0A 3R7LA 9GPBA 1V5GA 1E7SA 3F6EX 1Z0SA 1WZCA 1QYCA 3FPEA 2O0HA 5JXWA 2Y27A 3G7SA 5EIHA 3WZMA 4B6EA 5K3DA 2XEDA 5HZHA 4KGDA 1A9PA 4LRTB 4PZYA 3HTXA 1VA4A 3A37A 3T3EA 3NTRA 2VO1A 4OGLA 2EJWA 1SWVA 3V7YA 4ACBA 3IP8A 1RWKA 1K5DA 5LDHA 1Y9JA 1V8DA 1TA0A 2D1RA 2XQJA 3FRIA 5C8XA 1O4VA 2JGRA 4CV1A 3C16C 4KH1A 4O4LB 1JDUA 3O4RA 2O0MA 1GPMA 4C2TA 3RO7A 1LEHA 1OFHA 3I6QA 1ZIXA 3B6EA 3ZUPA 5CFQA 3EIHA 1C3OA 3UKOA 1PZNA 1R8JA 3TL6A 2DG2A 2FVXA 2IU4A 2QE7A 2B36A 3WA7A 2ZR9A 2YQZA 4M49A 3ZBUA 2HMWA 3IXLA 4DMUB 2JPDA 5HIKA 5HUJA 1RMTA 2PDAA 1Y0BA 2VWHA 4R0VA 4RD4A 3ZWDA 2ZVQX 3U3ZA 1KK1A 1UXJA 3VSCA 2W6NA 1E0DA 1GZ3A 1OAAA 1X38A 4RZ3A 4RTQA 4I2VA 1OXMA 4DOMA 1II8B 3CUUA 5LBTA 2ERCA 1ADYA 2YWDA 1A9XB 2B78A 2P67A 3BIOA 3RRXA 2CD9A 4EHFA 2ZYTX 1ZL0A 1ICIA 3LOQA 4EAQA 5C7LO 2N46A 5JLAA 1C1XA 1O4WA 1UMKA 2H0AA 3H86A 3OCYA 4EW2A 3PC4A 3K9HA 3LUKA 1H4SA 4B35A 1EFKA 3ZQ4A 2FWAA 1H0RA 3VKVA 5C8YB 5JMTA 3AGQA 3UGJA 3I34X 2DHRA 3PVSA 4B32A 1DP4A 2I7CA 1F4LA 3IT3A 1J7JA 2I4LA 1O94C 2ZBGA 1N2CE 1S0UA 1K1EA 2HPVA 4L8LA 3SOPA 5IEJA 4NFHA 5JMWA 1VYHA 4YRLA 4UTVA 3OG9A 1RJEA 4GRAA 4Z1MD 1E7YA 1LGYA 1AMUA 2RJ3A 3WA6A 4F9EA 1NVFA 4HB2A 3IAM1 2J85A 2QDXA 4M0UA 4HRVA 2B0JA 4EUHA 3A3NA 3ZWWA 1OYOA 3S81A 3K2EA 1V6AA 3IQXA 2D1FA 2NM0A 3NPAA 4IDCA 4WZAE 1BN7A 3SX2A 2ZCJA 1RPNA 4Q16A 1ESNA 4E2FA 4JT9A 3DEHA 4A16A 3ADKA 1ZD5A 2XV1A 2A9JA 4TSFD 5DGIA 3RR2A 4CV3A 4QDZA 1W94A 4MRMB 4JLNA 1JHAA 3ZDAA 2JJ8A 1KDOA 1VLZA 1BVYF 1NQAO 2H6EA 1J2RA 1H9CA 3DEKA 1U3FA 2YUIA 2Z1MA 2MYTA 2BZGA 2VSNA 2WAXA 3D3QA 3HNPA 4MUEA 2ETVA 3MTIA 4UKDA 1YR7A 3TNDA 1QQBA 2ZRDA 2WU1A 3R6WA 4IGKA 4Q3CA 1USGA 5KYVA 4WY8A 1JA9A 3PUVA 4ESVA 4NE9A 1REQB 4EHKA 1W36D 2HR1A 3EMBA 3VH2A 5C7OO 5CFPA 1DG1G 1M0SA 5C9ZA 5IYZB 2CEKA 2CJPA 3O5AA 4YMUA 4MUHA 4NZMA 2WF7A 5BNZA 3B8HA 3C6MA 4ND3A 5DM0A 2Y1WA 2ZR7A 2EW2A 5EWLA 1ORIA 4OJNA 1O9GA 3C3XA 4TKLA 1P2DA 2X0IA 4U4AA 2ZAIA 5SV2A 1ZK3A 3TOSA 1L4MA 4YCCA 2GCIA 2OZVA 4RLQA 2GN9A 4ITVA 4UOZA 4BVBA 5I45A 2OGUA 3EGXA 3PK0A 3WY9A 3EY4A 4JEUA 4EBFA 4LDJA 3FHTA 5JYBA 1YDMA 2AXQA 2HMTA 4BV2A 4IW3B 4JOCA 4WBSA 3QA3E 4P4SB 5T8KA 5LMZA 2C84A 3U1BA 1B74A 1MV5A 1T2EA 2X9VA 3P0IA 1CUFA 4O2AF 1WSAA 4BXOA 2OXCA 4DB2A 2QUAA 3N7AA 4WCFA 5TQ2B 5L4NA 1X8KA 1DCMA 2ID7A 2XYHA 1KEUA 2ZI7A 3GA5A 5TS2A 3T3HA 3OM1A 1H2ZA 3ZJVA 3T9CA 2DBQA 4G26A 4A1FA 5LZ9A 2WSBA 2YXDA 3I73A 1QRDA 1ZD4A 3OPXA 4FGWA 4MVJM 5KYWA 3AF2A 4J0DA 2Z04A 1JB1A 1T5HX 4MS1A 1N3BA 1V5WA 3JYNA 4OFZA 3E27A 1YK1A 1TLFA 2WAMA 3OLQA 4GOLD 3OKAA 3SXJA 4BGIA 4YT2A 2NNLD 4HZUB 1E5LA 3KQWA 3WHPA 2WIFA 3F5DA 2D1YA 2C99A 1UEIA 1GPH1 4KO4S 1GUDA 3JVUA 3UA4A 3AVWA 2DE0X 2XI4A 5JRZA 1JAYA 3L1JA 3CWQA 3ORSA 2F00A 4OYLA 1CUAA 3IE0A 1X77A 4J9UE 2VQ6A 5CVTA 1RWPA 1NZJA 3R3XA 5CLGA 1GA1A 1E1KA 4WX2B 4EW3A 5BN3B 3BXPA 1KZHA 4JKIA 1WF6A 3MTQA 4DV5B 4MUNA 4TVOA 2YFQA 2ZIXB 1X7ZB 4S1WA 1JI3A 3UYKA 4KX3A 1V4VA 1B4DA 1RP1A 4TXMA 3OIVA 2O23A 1QG2A 3WE7A 3V34A 5F7OA 3PCRB 4MW2A 1JHOA 3F5MA 4NCNA 3ETNA 3LK6A 1L4HA 2Q4EA 2P69A 3IMKA 2VJBA 3EEIA 4HXYA 1Y48E 1Z13A 4CDNA 2NP7A 2O3QA 2XKJE 3BSYA 4HWPA 1N8SA 2TSYB 2V7EA 4UATA 5BV0A 5JCXA 4Y8VA 1O95A 4FXPA 3S2UA 3QX8A 1IG3A 4J7XA 6NULA 4B47A 2GD2A 2BP7A 3ZDYB 3OBIA 5M29A 2FEXA 4ZALA 4I1VA 4DBLE 4CKBB 4C89A 2PS3A 1X0XA 1DJPA 1WCIB 2Q5IA 4CEIA 1I4WA 2EZ4A 4U2EA 5FPKA 4QDKA 3A6KA 1AG9A 2CK3D 2B4RO 3EDYA 5ADUS 5KYNA 3E9NA 1FVOA 3DD1A 3TD2A 3ZHZA 5JSUA 1PR6A 3EXIA 3SJAA 1W7AA 2GYWA 5TMDA 1WMEA 4ZVSA 4S1TA 5G3YA 1V35A 1JTFA 2CXUA 4BFTA 4BGVA 1JG6A 3R5XA 5LQKA 3QX3A 1VYUA 1F8FA 3DF9A 3NEJA 3RTCA 4L07A 3S55A 2JFUA 3WRVA 4BNNA 2FG5A 4D0LB 1J99A 4LMRA 1Q0LA 5L40A 1JQDA 2IH4A 1YKFA 4UBOA 2PGXA 4PRLA 5BNTA 5LP6B 2WHXA 4DV4B 1XPOA 4CLEA 3BFVA 2PT7A 1PJSA 3UT5A 1YMUA 3QKSA 2OEPA 4RHCA 7MDHA 4JJFA 1DTSA 4G84A 4CIYA 3JVDA 2QAGB 2HSEA 1IZ8A 1XZHA 2X3YA 3INRA 3DVLA 1GGEA 3NEYA 1I01A 2C95A 1H4TA 4BNFA 4EUKA 3NVAA 3IQHX 4OJQA 4BO4A 3WAKA 1B42A 2PV7A 3AM1A 1RHRA 2AHRA 4TWBA 1B0PA 1V71A 3BB4A 2NMVA 3H17A 3UKJA 3K9QO 1P0MA 1PZXA 2XCOA 3BGOS 2YNMA 4X66B 3IQWA 2Q6IA 2Z83A 1YBAA 3I5UA 3PGMA 1JIVA 4X63A 3C48A 3B1WA 2P6RA 1G20B 1NLFA 2V4MA 1YBMA 2FWRA 4GU5A 2WIJA 1VKNA 5D2CA 3R7BA 5CFNA 4L50A 1OU4A 1K6MA 3FHLA 3KBBA 4B9AA 2XWBF 4QOGA 1T5LA 1QZTA 2CW5A 3HO6A 2IS4A 5C46F 1YIOA 2JLQA 1SXGA 1IXSB 3ACCA 1RHUA 2VJMA 2VHTA 3L46A 4I5EA 3HKBB 4IFEA 4KB5A 4RXUA 3CCFA 4DA0A 5I7HA 4ZTUB 3T34A 1CR2A 1MO6A 1OX4B 2AD1A 2F43B 2J0VA 2OZLA 3KYJB 3LYUA 3I2YX 4LE0A 2WUGA 2I4RA 3M3HA 4N3AA 4NV0A 3F3KA 4YCSA 4N0MA 1KAHA 2C3PA 5JDCC 4MWZA 3WMXA 2YMMA 2HU8A 2C54A 4OV6B 2DERA 1BFDA 2CLDX 4HFMA 3OU7A 4RJLA 3FE2A 2ZUSA 1HG1A 4KFSA 3QBEA 2PZEA 2GSDA 4JP5A 2EX0A 1I5EA 1PJ4A 2VXOA 4GNKA 4IXTA 4UAGA 4WLEA 5E38A 1FP2A 2VWPA 1RE0A 3FXAA 3K0AA 3L01A 3NHKA 3DP9A 5BOVA 2HUNA 2ZZKA 3KPWA 3H0KA 1O0BA 1LBSA 5CH8A 4LECA 4EG7A 3BICA 4OPMA 2P8JA 4US1R 2R48A 5F2OA 1HMYA 1XLVA 2WAOA 3ESAA 3NT4A 4P7JA 1FMLA 3FVWA 4G0PA 4P53A 5A4AA 3TJRA 4DQUA 4FBGA 4Y0AA 1OA1A 2YQ5A 4WPGA 3N7UA 4IGEA 1RPJA 1RRCA 1SFRA 2RGYA 3N7TA 1XVTA 1XTZA 3KVOA 4CZ2A 2O14A 2COUA 1TUIA 1OBFO 1FOEB 3LD9A 4A03A 1Q0QA 4RTKA 1MB3A 1NMQA 3FUUA 3H3JA 4EAAA 3FFBA 1VQ1A 3OQHA 5F78A 2BYTA 4X00A 1FDWA 4G1CA 4HDQB 3GELA 2VNIA 1WP9A 1EI9A 2FEAA 4URHA 2VYQA 1F0PA 2C9CA 2W2KB 3RVRA 1T8SA 1PG2A 2H1FA 2ZRBA 1AT1A 3GQBB 4FE7A 1M9NA 2F9LA 3IKMB 3JASA 4L9WA 2WQ7A 3WKAA 3ZV5A 3DFZA 3WG9A 1EUCA 3E7DA 1PR4A 5JAQA 1HNWB 2ATEA 3VR4D 1LRLA 1N25A 3ZE9A 1DQSA 1K3FA 3LGSA 4DS3A 1UZMA 1ENPA 1XRRA 1EQUA 5JI3E 1J09A 4IDHA 4J0GA 3I2IA 3F4LA 4EYEA 1KQFA 1JVNA 4MI6A 2AFHB 1RI4A 4Z2YA 2AQ8A 5IUKC 3N0WA 1PS9A 2C3YA 1GRVA 1YA4A 4S2UA 1K97A 3GROA 4IIJA 4P6VF 3CM0A 1IJKA 2H06A 2IZZA 3QWHA 3GRRA 3BRWA 4X6XA 3OQBA 3IIIA 1ZCZA 1WP4A 5EC8A 4FYJA 1W4ZA 3TXXA 2F55A 2OKCA 3ZU6A 3EOBI 5KC9A 4Y7CA 1P7PA 3AFHA 4MQFB 4NCAA 1KFJB 5CVCA 2GTPA 2OXEA 3LYHA 3TGWA 3K1AA 1KO8A 1W8DA 4YMTA 4W63A 1TZKA 1MX9A 3OUUA 2OILA 3W2GA 1KO4A 3QE2A 4BMOB 4C1NA 1U65A 4E11A 3ET5A 4EZIA 5A4KA 2H2AA 2PA0A 3CIOA 5H3LA 1X39A 3ZIDA 3GCXA 4HS4A 4E22A 1LS6A 1Z0IA 5EJAA 2IHJA 3IVMA 3V8PA 4DRXB 4ZOCA 2PO5A 4H1UA 5LP1A 1F06A 4RVFA 4ZMRA 2MSWA 1N6NA 1Z8DA 2XB8A 3H18A 4HYEA 5GP1A 3AIKA 1ORWA 3AXSA 3PQ8A 4NHOA 3SSMA 1L5GB 4PYQA 2Y0BA 1YI1A 4GMHA 1N6OA 1U81A 2JI6A 2QLMA 3H3XA 3HBFA 3I8SA 3LP6A 3MWKA 5JSFA 5IT0A 4NXNB 5DDIP 4JS0A 3A04A 2FPIB 1QG4A 3AERA 4YY3B 4P33A 4UNPA 4GZMA 4LJ6A 4MUIA 4MV1A 3GJRA 2FV8A 1EH5A 2CNWD 1XA0A 3M1AA 3PIRA 1DAOA 3ZIUA 1EMDA 3UHFA 4NBRA 5TE9A 1PFKA 3F9CA 2B1IA 2RB4A 3EXFA 1IJBA 3MUNA 1ULBA 3DW1X 5AM2A 3PIDA 1CCWA 4K9QA 4LOKA 3LA8A 1YU9A 3IUMA 4A8TA 2UZ4A 1JA1A 4JOSA 5D6OA 5FPPA 5DWDA 2D3TA 2BF7A 4LDRA 2C7RA 2TS1A 1OBOA 2G63A 2IQIA 2Q5HA 3QLVA 3E61A 1Z38A 3HQ4O 1OR8A 2XQGA 3SSNA 3K31A 4MHTA 1JHPA 4N12A 5C80A 1GTMA 1QYDA 3ENWA 1QGED 3ZUGA 3MRXA 1DMSA 1FVFA 3QIAA 2PAAA 3R6TA 4E08A 3O0TA 4P32A 3ROFA 1NBMA 4X7PA 3EUAA 3AM3A 1XCLA 4N03A 4NCHA 3M49A 1EPUA 4KFTA 5F51A 4NU8X 4MVCA 5H7XA 4DMHA 3GF4A 1QIDA 5KSOA 2BFEB 5LVAA 1TMGE 1ENZA 1L4EA 2M6SA 3CV3A 4HX2A 4RH0A 1K89A 3PRHA 5DMXA 2DR2A 1E2JA 1NFQA 3T5AA 1TKAA 1S8OA 1YQQA 1I10A 1SVMA 2QRLA 3KK0A 3X44A 5H4GA 1KH2A 4TWAA 1UPCA 1XZBA 2V9ZA 4IYJA 5DZSA 2AN1A 1SUIA 2HK7A 1K4KA 4LA4A 1EFPA 3GCDA 2ZCVA 3CZAA 1ZH6A 1ZY2A 2YRXA 3EZGA 3G02A 3SDBA 1ODFA 3AVUA 1V6SA 1X9IA 1N5KA 3BGWA 3NUGA 3OC6A 1A8IA 2OD2A 4J16C 1KYVA 3A1UA 1E59A 1WPXA 3FCUB 4ZOBA 2X42A 2D4AA 3ANSA 4W5NA 5HJEA 1CUGA 1E9FA 2CT8A 1R4MB 2GEVA 2LIPA 3MLEA 5IF3A 2XA9A 4AWAA 1XEAA 3CX4A 4DC0A 3W90A 1LF0A 1EWKA 2R1TA 2XB2A 4DCGA 4G5RA 1KO7A 2O5EA 1YRHA 4KDCA 3W1EA 1O3YA 2DLDA 4CCYB 1JFSA 1DOZA 4Y6PA 2X0JA 1IM2A 4NMXB 2ZRAA 4RKEA 1QGZA 2XIJA 1C41A 3QQPA 2ZT5A 1NSFA 3G8CA 1E9SA 4E6PA 3HYNA 1NULA 4EB6A 3ZDCA 3ISJA 2QGZA 1AUVA 3HA7A 3ZHXA 2B92A 3R0IA 1UXOA 3KWJA 5AJTA 4LE1A 3THYB 1GD1O 3CZCA 1VI2A 2IZ0A 4XCQA 4C3ZA 4BLRA 4AK9A 2KLBA 2MU1A 4C30A 4A0SA 1HI9A 2VAPA 4DEYA 2TMKA 4MQ4A 2NTYC 5E6RA 3K2QA 1Y8RB 5IAAA 5AKZA 3WGHA 4RORA 2JJQA 2VFAA 2ZJ8A 4BNZA 1XU4A 4Q5IA 3TW8B 4IIHA 2P9JA 1I80A 4Q3EA 4X1IB 4RJTA 4NJMA 2P75A 5HIAA 3H5LA 4QBGB 4CKWA 5D5QA 4M0FA 5WRFA 3TXAA 2EHJA 1WQ3A 2QJOA 2O8EA 3D0KA 1DAIA 1M76A 4LMBA 4RAOA 1M67A 2QTGA 4GX0A 1JBQA 4CJXA 4EUFA 4HN4B 4BFXA 3VI4B 2CDBA 3HZHA 1RPAA 4P5EA 3GFFA 5G0VA 2Z9DA 3FMGA 4MWEA 3U1VA 1HYHA 2BEVB 3ZLVA 3E9MA 5KTRA 3Q3EA 2A2ZA 3FGOA 1QK4A 5AKHA 3S27A 3JD3A 3UUWA 3WIUA 5E7QA 2RI1A 1UH5A 4DNQA 5JECA 4B3GA 1SVOA 4MR8A 1QPBA 2WZCA 2XY4A 1XWFA 4LXHA 3ROQA 1JIIA 4ND8A 5DGDA 2PGDA 1NT2A 3IHLA 4QU9A 4TYYA 2JH3A 2WZQA 3F6PA 2EKQA 4H0NA 5B5SA 3EQZA 3JSAA 3DL7A 4P86A 2C98A 5GM2A 2IV7A 4ES6A 2ZYRA 4HNSA 2HA0A 2J08A 3AFIA 3PSHA 4FYMA 4Y1GA 1FE8A 2ZP1A 5CVUA 3AIMA 5CDHA 2OP0A 3ZHCA 2WFLB 4FDUA 4M0EA 4UU8A 3SFZA 2C07A 5EJ8A 2DH5A 3KHSA 1VL6A 2DBVO 2XMZA 4P83A 4Q6BA 4X9XA 2EJBA 3IH5A 1FQWA 2IIBA 3N39C 3OOEA 5BORA 1Q1AA 2X4GA 1JHXA 4D26A 3O4IA 2X4DA 3PEUA 2IXTA 4M53A 2PUVA 3V2IA 1YU6A 2P1ZA 3GT4A 4HDSA 3IVAA 3RU9A 1DJQA 4H0CA 1OFUX 4IP0A 5BW4A 4LWZA 4YP1A 1BCRB 2CXTA 3I83A 1E3WB 5EZ5A 5A5VA 4MPPA 4BVJA 1HH4A 5IKPA 3SXUB 2XUHA 4O0LA 3SE7A 3RYHB 2HBZA 2H1IA 1NPYA 4YAWA 5K3BA 2ACKA 3EISA 3EJWA 3JV7A 4IICA 4UPVA 3LQKA 1RC1A 1TGVA 3BQMB 1ZISA 3EOAI 3PDWA 1Y6ZA 3ZY5A 4OP2A 2WJJA 2UZ3A 5HTKA 2I4OA 3HE3A 3IP5A 2BGLA 3PEEA 4O4HB 4C4PA 1G21A 1SIUA 1T34A 3COVA 3L4BA 3U5ZB 1ZJ5A 1CY8A 1NIJA 2HSWA 2BFDB 2OQ2A 4K05A 2CMGA 4BMCA 1IEXA 2NU8A 4QHTA 4RM2A 5D7BA 1G7RA 3FNGA 4BEBA 1Q0PA 1KVTA 2FMIA 3ZWPA 4BMYA 4DKXA 1Q14A 2XNDA 1TJ5A 3L8EA 1USWA 4D97A 4X7BA 1KP3A 2WZDA 5BUQA 1EG7A 2R7NA 3QBVA 2PT9A 4P93A 2AQKA 1Y1KE 5H4HA 1QQ5A 1DRJA 1GAEO 3MK31 2A9QA 5E6SA 5DU2A 4M1ZA 1OROA 1G8FA 2BJHA 1HSOA 5JATA 3GQVA 2ZTLA 5H59A 1MJGM 4PQFA 2NTEA 4XH9B 1LS1A 3K7EA 4B6FA 1NRIA 1CFZA 2IGTA 3J81k 2PUEA 1OC2A 4EUSA 5ADHA 3NHJA 4OJTA 3JTEA 4PG7A 3ZY6A 1EFRD 4DRYA 3C3JA 3BMOB 1LDMA 2GASA 3TQHA 3HU1A 4C78A 3WP1B 5D5HA 3HLYA 2JFFA 5C5DA 3HR4A 1JMVA 1LK0A 3M1LA 1ICEA 1ZG3A 2G0TA 4R51A 1A0OA 1KIMA 1DIBA 3EARA 2RARA 3DUFB 3IKTA 1HT0A 4L0MA 1WG8A 4EHBA 1OREA 3EUFA 4JP8A 4LCBA 1NSTA 3O26A 4XJVA 1C9DB 4G25A 4FKBA 2EIHA 4B2PA 1FBNA 1AQYA 1SVLA 3OX3A 2QY9A 2D0PB 2Z5VA 3BERA 3LGXA 3K71B 2RGDA 2YMPA 5HCUA 1RQXA 4A0GA 1ZOSA 2F8MA 2W2LA 1ADJA 4ISCA 2O2YA 2RI0A 4OKSA 2GN0A 3CUWA 3DZKA 2OPBA 5K0NA 4UEKA 3VSEA 3A9VA 3CWZA 1US8B 2ZXUA 3JX9A 3EZYA 3ONNA 4Q4HB 3UJDA 5CG2A 2Z3VA 3ANLA 3V4PB 2JFNA 3B1FA 5JZBA 4F4HA 2HI0A 3L05A 5KQPA 2QQEA 1FJXA 4LBVA 2Y67A 3D2AA 4XX1A 2XNKA 1KAMA 4AYTA 5IFKA 4LN1A 1N36B 1CB7A 4POOA 4RA6B 3PNMA 2O1SA 4P5PA 3DZHA 3SYRA 5CX1B 4EM6A 4Z4EA 3ZZMA 1P77A 4LDNA 4GIBA 1A27A 4FP9A 3COPA 2M2IA 1M7GA 4INPA 4XCXA 3RADC 4YH1A 4N18A 1DQZA 3LXXA 2B4YA 1P6UA 2OR3A 3D8RA 1BMFA 1XQWA 4JC4A 1OGIA 3A4YA 4LNHA 3SOZA 1RW4A 2HSZA 2UZ1B 3T8YA 4MZDA 5DHPA 2P4UA 1NDHA 1ULTA 2EF0A 1EINA 2MCFA 4YPOA 1FNMA 421PA 3P2IA 3T1HB 1PYDA 3WGLA 1Q7EA 2ILVA 1T4GA 1T9ZA 5E1BA 3KEOA 2VKQA 4B82A 5CFMA 4R84A 3DVAB 3F8TA 3EDRA 5DSXA 4DIOA 1Z5GA 4TS9A 3KNZA 4O4IA 4EPXA 3BWEA 1LB1B 3DBHB 3F6RA 1Y7TA 3GGCA 3LUJA 2IELA 3PL1A 1G3QA 1CYDA 1NBEA 5JVDB 3UGQA 5KMGA 4U7JA 3MCWA 1JWAB 5IKXA 3A58B 1KI6A 3FZEA 4JJ6A 4TRRA 5ICMA 4W9MC 4KLRA 4S12A 1FRZA 5CK5A 2XOKD 3ONDA 4DARA 1JR3E 5T7BA 4RS3A 3OZSA 4X62B 5F9HA 1KKLA 4QXMA 4AU1A 1KQNA 3L7IA 4BNUA 4FC7A 4BLWA 3EG9B 4GWLA 4LXXA 4OOEA 5L6MB 1QMPA 3GEBA 1NW8A 2BHNA 4BNLA 2QI9C 5EZYF 4ZK2A 3NHZA 1T8TA 2DC1A 2JIBA 5GZ6A 1UINA 1R0SA 2CMKA 2J5BA 2J9ZB 4TL6A 2YJ3A 3I4FA 2CHGA 2DXIA 1PJTA 4W9RA 1BXRB 2R1VB 5BUSA 5JISA 4WNYA 1R3DA 5EMKA 3AEUA 3EC7A 1RPTA 2E7ZA 4Q1DA 3SHFA 2OO7A 4D3SA 3UCFA 1NYQA 2BFOA 4O4JB 4WZBE 4I50F 2IP4A 2Q28A 3LLSA 3ZWYA 4I4TF 3MHTA 3BWDD 4J2HA 2PVSA 1CS0B 1I51A 1QE0A 4KHZA 1AKYA 5LKRA 3JVEA 2GPBA 1VMIA 1ZLYA 1B43A 2AW3A 1M74A 3DDUA 3LLCA 4XLZA 4DC9A 4DLRA 1AK2A 1WVMA 2YXEA 4X92A 1IB6A 3GVHA 1P73A 3DEZA 4RSRA 1YFKA 3KB2A 3PX7A 3DTTA 5TEVA 5C37A 2V6IA 2ATIA 1T4DA 4X84A 4H31A 1LRKA 1L5HB 3BREA 5IBRA 4TTRA 2JIPA 3WLHA 2JLVA 2HXGA 4UUAA 5IC5A 1VBFA 2DBRA 2W70A 3T4UA 2DU8A 3IPYA 4GOOD 4V0RA 3W3ZB 2HDOA 4JLKA 1DO0A 1LDGA 3IDOA 1SOAA 3KT6A 4IOJA 4F8EA 2YWCA 1J2EA 2W2XA 3RVMA 1I7QB 1E4EB 1FNDA 1CX9B 1N2EA 4FNGA 3H9QA 4IIEA 1I3MA 2Y05A 4EJMA 4FB4A 4OL9A 2POQX 2Y99A 4N6NA 2C8KA 3MJHA 1IQPA 4QARA 5HE8A 4RZQA 5AI4A 2GJ8A 3C7CB 3RVSA 3KYCB 4UJ3A 1SA0B 3JAKB 1JKXA 1KR5A 1DUIA 3D2CA 4GZ5A 2E2WA 1V9CA 4FN5A 2UVQA 2BHTA 2I8LA 3LVQE 3PG5A 4WJZA 3D4OA 3TZCA 4V2IA 3C97A 1UKYA 5LXTF 1GGKA 4YDSA 2IU0A 4KC0A 1BJTA 1PR2A 4Z9FA 3EWNA 3FOCA 1Y4SA 2HQOA 3ETLA 3UFXA 1UAYA 1YRQA 1M5UA 1E5DA 4R41A 1A71A 2IKSA 4IOMA 3SEZA 3KZ1E 3L7DA 4LJ9A 4BJHB 4C03A 3TN7A 4FGZA 3HL0A 5HDQA 1DIHA 3A9CA 1HDIA 3FAZA 3VZPA 3HYTA 4PG4A 3GC6A 1IVNA 1TCAA 1GUBA 2RHOA 3TW4A 4ZEVA 2CE7A 3LIPA 2ANCA 4DCSA 3SICE 1M8KA 2DCMA 3ORQA 3KV1A 1QIKA 4MRAA 4PNEA 1C9MA 1L3IA 2NXEA 4F04A 2ZZNA 4L73A 1DOHA 4ZT7A 3T4EA 2GUWA 4UNQA 1B6RA 2OOSA 3A10A 4BLSA 1CRWG 1XXHE 2BTQA 3PS9A 3FTNA 4QRIA 3TAXA 1M1YE 4J29A 2Z6AA 3ZKWA 2VF5X 4DSAA 5G53C 3CTMA 1U1DA 3FYTA 3BTVA 4K87A 1HTBA 1JP7A 2XVAA 2K5UA 3JAWA 1ZD8A 4L4ZA 1YNSA 4S1PA 1SG0A 4GMFA 2OAP1 4M8LA 1QZXA 4MPDA 4D4HA 4D6XA 5EMNA 4Q9HA 1OH5A 2CXQA 2QJFA 3QHAA 1IOWA 1ISPA 3RUDA 1P7VA 3AVVA 1YQTA 1E9RA 5F52A 1OD6A 1CS4C 4H3VA 3EXHB 5LBUA 3NRBA 1WBDA 2NXNA 4MRNA 3S68A 4EYKA 1XSEA 1XA3A 2JCVA 3KV3O 5JS7A 1UKBA 5JQGA 2PKCA 1VE3A 4S0XA 4XDGA 4CG2A 1U5BA 2H3EA 8OHMA 5FWXB 2JGJA 1VIAA 3G8DA 1QC5A 1H0HA 1TCBA 2QTRA 3SZOA 4PLGA 2X9NA 4A0QA 1C7JA 1TTQB 2DP4E 2XZTA 1HE1C 4N49A 4AICA 4F4DA 2OHIA 1PX0A 2NX2A 1TVKA 1MJNA 2PRYA 3CHYA 1KJWA 4KE6A 3CH4B 3WC4A 3Q3HA 5KTOA 1YF3A 3TB4A 3Q3VA 2VDWB 2HOQA 5JHGB 1N7JA 3GRUA 2ZCUA 5JD3A 4DC1A 4HH4A 5G41A 3INGA 5CX4A 5G4KA 4ZYVA 5LIPA 4QUJA 1RCUA 4OIMA 4ZO8A 4D4IA 3RIXA 1ZDMA 3R7WA 4NG4A 2I87A 2AT1A 4U2DA 1HFKA 3N1UA 4RQTA 3U19A 4HMPA 1TLTA 4A5OA 1W30A 1MAVA 2GRUA 2WFZA 2E85A 1EUQA 1Y82A 1Y7IA 1G6OA 3AFOA 1ZUWA 3GVIA 4WERA 1ZRNA 5EKUA 4ARZA 1NNSA 4D8XA 1JIQA 4BVKA 4OLJA 4HFJA 2FOLA 1JILA 5TQ0B 4I5IA 1GPYA 4DJFC 1YZYA 1KZ6A 4NNJA 3FETA 3EWAA 4XM1A 5HQJA 5J47A 5FCDA 5FOSA 1B0ZA 1EBFA 1NMZA 1Z18A 2FA9A 1WKCA 2JRCA 2WKPA 3GPCA 4LX8A 4PCVA 1W0CA 3H6GA 3OWHA 3RGGA 2V7XA 2A6PA 1Q0RA 4CQMD 1U3GA 4YHHB 1R6VA 1NP6A 3OZIA 4RDHA 9ATCA 4MDFA 3R5HA 4UHDA 1JQ3A 1R0RE 2XCLA 1VCOA 1Z0UA 3VPAA 4JEMA 4RFSB 1PEDA 1SEPA 4JL6A 2B82A 2Y1DA 2PUHA 4TUYB 2GD0A 4TV9A 4XUGB 4YXWA 4Y2JA 4HV4A 1R1DA 4MVJF 1WCXA 2IPLA 4AKHA 5FLEX 3IPXA 3P9RA 1X1QA 2WD9A 4WLOA 2G08A 4NPAA 2FG6C 4QGGA 1COWA 3HN6A 3PUXA 1BCSB 3RSSA 3TLAA 1PK8A 1PT7A 1HETA 3HKCA 4ODIA 3TTYA 4M7WA 2BE9A 2XHEA 4L6IA 3N2ZB 3DMFA 4O02B 2PLNA 3ACDA 4IL5A 1PFGA 4MS3B 2EWMA 1KAOA 2GD1O 5ALUA 4TYPA 3HFJA 3NPMA 1EGMB 4EEZA 4MKZA 1PJ8A 4UULA 5DBEX 5LOVA 5JAOA 2VWGA 3ZJUA 3H5OA 2CYCA 2H00A 3EH1A 3JD4A 3FM9A 1X7XA 2V4UA 4HEA6 4IF6A 4LS3A 2FTKE 3CX6A 4FHEA 1UZNA 3JQGB 2XT6A 3HEAA 3DEFA 3WP0A 3H04A 3TBFA 4IZ6A 5KNDH 1K66A 1AZTA 3IT2A 4UBJA 2CFOA 5CA0A 1CULC 4HOYA 4MZXA 5MN4A 1WEHA 2FPUA 1CV2A 2B6HA 2I3AA 2WYIA 5JBQA 3LHKA 1QAOA 2GM5A 3HCAA 1Q16A 3NBUA 1U8YA 1VA5A 1TPYA 1AVTA 2PIAA 1PCXA 3MPUA 2QKYA 3DZ8A 4EVQA 4V1CA 3K9NA 1SU4A 1FDIA 4BB0A 4I55B 3RTAA 3T9AA 3E3LA 4NYJQ 3TE7A 5LMUB 3KXKA 2WKQA 2I8AA 1USUA 4F1JA 5K8UA 1XTVA 2PZGA 3H2YA 3TOZA 4R2WA 2HA7A 3DZDA 3WWZA 2O2DA 4G81A 4GM0A 3F9RA 2OT3B 2WJZB 5FOXA 3U9LA 3NG1A 5T8KC 2VAWA 4I6JA 4KPUA 2HPAA 3B3AA 4FZRA 4TV8F 4L6CA 3BKXA 1HZZA 3LJKA 3BTUA 2HZ7A 1YT5A 2DWPA 1A5BB 4WCFC 1D6MA 4JJIA 1YDWA 3ZIAA 3BXZA 4AY3A 4LZJA 5C4MA 2WNSA 2EGHA 1NMSA 3QOYA 4OHKA 4G5YA 3BBLA 4QU8A 3B38A 3I1JA 4F92B 2F8TA 3TQOA 3NDJA 3OM0A 2FPRA 1V11B 2MT9A 1J56A 3SWWA 4MGIR 3Q11A 4HEJA 4WIAA 1O97D 1HORA 1OFIA 3HO8A 5BN4A 1CRPA 2WU4A 1R6UA 3I0MA 4DUGA 2VDKB 3FKJA 2ZJ6A 2ZAMA 5CNIA 3IJPA 3L06A 4E15A 1TTTA 2PWAA 3BH6A 4AZSA 2KB0A 1MVOA 1N9GB 4AY6A 5IMSA 3NFRA 1N57A 5EIXA 1ZD3A 4ZZ1A 5JSQA 1WPRA 4NOMA 1JHUA 4QJ5A 3GGJA 4X3CA 4AKTA 4KAXA 4BEJA 4EI8A 3JTMA 1C7RA 3F3SA 3CQ9A 3WWPA 3NVMB 2YWHA 5IS2A 3RBXA 1ZW1A 4BLUA 3T5TA 4YMGA 1LW7A 3VJRA 1J24A 2FN4A 1QVVA 3DPUA 3HI6A 3KR9A 4RENA 3PC6A 4JAVC 3HXOA 1WMDA 2VSYA 4LV6A 4YJ3F 1E1CA 1LC3A 1KS2A 1P1RA 2PCJA 2H8GA 2DH6A 3KLOA 2EL9A 4X44A 3W9SA 4BP1A 3RC7A 5T41A 5E3IA 4Y2UA 2ATCA 1E7RA 2G1KA 3N59A 5ESDA 4F5WA 1RTTA 1M1XB 1KTVA 3IESA 3H16A 2PFKA 1JR6A 2PH7A 5HNKA 1P4GA 4CT0A 1U7DA 1O95C 4U7FA 1HR0B 3D54D 4UTRA 1EK5A 2J9YB 3RASA 3GPBA 4E5PA 3DFFA 2EW1A 4A6XA 3FCCA 3PP8A 2QTFA 3HCFA 3W5VA 1QH1B 4FSXA 4XIFA 4AT1A 1E5QA 4G67A 1KZ4A 4PXSA 1JDSA 3B7GA 2A92A 1U7XA 3E6AA 2DR3A 1YJ8A 3U0BA 4GX1A 3VC7A 2JBHA 4ILKA 3UF0A 1G8HA 1PJBA 1W5SA 4TTVA 3G5MA 5M04A 5AJWA 5JE8A 3AR3A 1K3UB 3NDIA 3CLUC 4G37A 3OP4A 2A8YA 2I4MA 1UFQA 2ZVPX 5EJ5A 1X8JA 4MUGA 4BMVA 3C74A 1CIJA 1ZI9A 3P5BA 4F6RA 1A1SA 1PEKE 2HCFA 4QUHA 5DNAA 3ZTTA 2PKYX 2WJ6A 3HJBA 5K8IA 2CK3A 5HHTA 1E61A 2Q4BA 4BQEA 1SVNA 1FUEA 2BEUA 3O9MA 1R74A 4FIDA 4FR5A 4WXMA 3ZWMA 4CM8B 3PFKA 3U40A 2VNKA 2XMCA 4YEDA 4ERXA 1BRTA 3WV5A 1M2FA 3CNLA 2QPLA 4HQ6A 2Z6QA 5KS2A 3WJ7A 2YZ2A 1I3CA 1EFUA 4WH0A 4EO9A 4JUIA 1TQDA 1Q50A 3RG8A 1II9A 3IURA 5FBKA 1XE3A 2YZ7A 3WRYA 5AVVA 3KKMA 4GI2A 3JXEA 2GDZA 2QTAA 1CERA 1EFLA 1ECLA 1GSHA 4H6PA 4L8VA 5D5PA 4DIEA 4EY8A 5TLSA 4L75A 2FQWA 2NSHA 1S8FA 4WOKA 1WMAA 2IEZA 4LXYA 1I4OA 5C0OE 3OETA 3WB2A 3L6EA 4JU8A 2YFYA 2B9EA 1R8XA 2R5FA 1DWOA 1MGPA 2D0DA 4UVDA 4ZYWA 4IIGA 1R0XA 1NQUA 3L7KA 1TT5A 1O9HA 1UFOA 5GAJA 4FHFA 5AM3A 3IPLA 3BMQA 2QL5A 3H6KA 1EZ4A 4ALMA 3BZUA 5L4LA 1QVRA 1CZOA 5A1JA 1WB9A 3R09A 4EJ0A 4DMLA 2CLOB 1YIAA 5JSZB 1NNEA 1JPJA 2C4KA 1DELA 3JQ6A 3KXIA 4BP9A 5AHOA 3VZSA 4A8PA 4Q4JB 4HAWA 1V25A 2VTBA 3QXJA 1MO2A 3VV2A 2QL7A 2X8WA 1E2LA 3ABSB 2BFFA 3PJGA 4GICA 4IUYA 5IBPA 4C1BA 4X6UA 3V1NA 4AURA 5BVGB 4ZOAA 4LCEA 1WDTA 2B20A 1P60A 1BMQA 2HHCA 2GZ1A 3C70A 3HFRA 1ECCA 2QG9A 1CRLA 3CLKA 4UUBA 3WLLA 3AVYA 4UHFA 1IUOA 3M6XA 1ETUA 3R8XA 3EPKA 1BDJA 1FP4A 1MFZA 1P4JA 5IAEA 4UFNA 3U4DA 1ZMXA 3HYSA 4M46A 5SICE 1DEAA 3V9AA 3EODA 5KPDA 2XNHA 3UTCA 2Z9CA 2XZPA 4TMVA 5KAMA 5K3EA 3OLVA 2AOUB 3X2EA 1NV8A 1SB9A 2DPYA 2VHQA 2FNAA 1C1YA 4ERNA 1Y6GA 4NLLA 1ELOA 5KBYA 2OQRA 1JUDA 1Z82A 2ZBEA 4PGGA 2H08A 5GGXA 1Y6RA 3ZJYA 1DZ3A 5E1MA 3BT7A 3LT1A 4UUQA 4W5QA 4QEDA 1L6RA 2WP0A 2G9RA 4FCTA 4C29A 1KDTA 3WIDA 4E03A 5ERYA 1QK3A 2GK7A 5LMNB 1LCIA 4N39A 5FI0B 4MVXA 4BVFA 8LDHA 3IV6A 4XB1A 4XD7D 1GLNA 1ZHFA 3BHIA 4P9NA 4L5YA 3H2SA 1SKBA 4MDEA 1AHNA 3AV3A 4BC0A 4KN9S 2YDYA 1AKUA 3ICQB 4IXDA 2DKFA 4WUVA 1Z0FA 1OW3B 1KU0A 1SIOA 1PP4A 2HRRA 2J3HA 1S1CA 4PTZA 2VHXA 5JDIA 1NPDA 1QG0A 3JALB 4HDOB 4NDZA 5G1NA 2ZIGA 1N6KA 3X1JA 2HWUA 3G5LA 3UVEA 3ZCUA 1FFYA 6REQA 1BKDR 2AN5A 2WU3A 4L15A 1VG0B 4L7VA 3IE1A 4JJKA 4KPEC 2XNCA 3PHIA 3PQCA 4Z86A 2XIQA 2A9KA 1PI3A 1WHSA 2BE7A 1HFJA 1ILEA 2RH5A 4FZJA 1O0SA 1S9DA 1VKJA 3FPFA 1UAGA 3Q1LA 3O8CA 4U2KA 4E51A 3AHFA 4IGAA 3CKLA 2H1WA 2DKOA 4Q47A 2XCTB 3R0ZA 1U0EA 1FRFS 5LB2A 2D7JA 2JA1A 4BLTA 4OLHA 1TQ2A 2Q8PA 2XAAA 2Y9MB 1DJOA 3WTBA 1PR9A 4YA6A 3LO8A 1RMQA 2B8EA 2PJUA 3ZCRA 1V47A 2HHJA 3B85A 3TD9A 4H16A 1IUNA 1G8PA 1EFHA 3KKNA 5A9SB 3BGSA 5AW1A 2HL6A 4TWIA 4Y6RA 5LSAA 1G63A 4HQNA 1DFGA 1GLVA 1N5RA 2O57A 2Q1XA 2W6ZA 1W4AA 5B58T 4EG4A 4KWIA 1GYQA 4N5MA 1BHO1 2YOFA 1J8MF 1U11A 4BQOA 3NH9A 2RDMA 4ENWA 3PLAE 1N5MA 3NNSA 3ORYA 4HQLA 1F12A 1YASA 4FW8A 1EU1A 2XYGA 3GRVA 4UTXA 2FEKA 4Y2TA 4TKVB 1LNQA 3S7ZA 1RLJA 2LWIA 1KC3A 4ESEA 1KMCA 1BXKA 1OWNA 3C3KA 3I9NA 3SDSA 3UAXA 4ARSA 5TT1A 3AU8A 5ESRA 2YFHA 5K4HA 3HM9A 1FLVA 2JL1A 4I7EA 3LXUX 1LV8A 4H6VA 2FAXA 3WQHA 3QLVC 1JKJB 2WICA 2Y0EA 3QH4A 5L3ZA 4BNDA 4EZEA 2VPZA 5FI3A 3L0ZA 3T9DA 1WOMA 4NOLA 5B1EA 2IOFK 3EHEA 3AUYA 4ZDKA 2HLDA 2EJTA 2VTDA 3SKXA 2W42A 1FDTA 2CNWA 4GZ3A 4HXEB 3CRQA 4DJDC 4U00A 3PRKE 4KSBA 3ND8A 4A5SA 5DV9A 4YUWA 4KXNA 2VF4X 2H5LA 1ECGA 2BF4A 2L2QA 1N1DA 1ZNWA 2X2PA 3GAMA 1NP7A 2AKEA 3IOBA 1DBQA 3LT2A 5IAOA 2WIKA 3H5TA 2PYZA 1E5TA 4FWIB 5D84A 1K63A 1S2DA 5ALGA 3SY8A 3GLFB 1XX6A 2X76A 2V5VA 1SQ6A 2IHNA 4BVHA 3VX4A 1QUFA 4MKIA 1UPUA 3OEYA 4LZPA 1RYNA 4OOFA 4QNNA 2QRZA 2P35A 4UHEA 3Q98A 4OXYA 1YVDA 3B82A 1XC7A 3E2IA 4IMRA 2FGKA 1PG0A 4IPTA 4URUR 3NOOA 3OQOA 4TS1A 4XR9A 3KQKA 3WBFA 4EKGA 1N2OA 4ZVTA 2IYFA 3L4SO 5SZIA 3TQFA 3T1YB 5DCUA 4MV8A 2XVMA 2IVFA 3DTVD 1DT5A 1OV6A 1JJIA 3VR3A 2G76A 2NUPA 2V59A 5EUCA 2DPGA 1Z4MA 1SUBA 4CGZA 1DAFA 3DNMA 4MV3A 4ETNA 3LPMA 4CNBA 3K0FA 2BHRA 1YQ9A 3EAGA 3NIBA 3VMMA 4WBXC 4EPWA 4QG3A 3MT0A 1UM9A 4OU5A 5JZSA 5IT4A 4FM9A 5INTA 2IEDA 5TC4A 4NNPA 1PL0A 1RHJA 1YRWA 2EQAA 4FYIA 1EBBA 3BGIA 4RNDB 2KQUA 3CZ9A 2HJ9A 3MTDA 3V2UA 5KC8A 3IMFA 2XTAA 3GJYA 4P84A 4ECEA 4G24A 5G0SA 3FFWA 4O2BA 3IELA 1M6VA 4GS5A 4RZUA 1EA7A 2H1VA 2QX8A 2BMAA 1GZ7A 4RGQA 2IOYA 1L7BA 3GCGA 3CC8A 4ICIA 3L7NA 4NJOA 3WLAA 3PUYA 3Q9LA 3ER8A 1L5LA 2I71A 3OKCA 3UJ7A 3P4UA 3H0CA 1V8OA 1YA8A 2E4YA 3KKPA 3CVOA 3OEWA 1NMEA 2EXXA 3Q3JB 2C61A 3OE7A 3PGXA 3DKRA 4M8SA 3LBAA 5L95A 1H4QA 2ONYA 3K9GA 4GLBA 4CT4B 1T4CB 1LLCA 1BX0A 2AEJA 2YXPX 3IPRA 3QELA 4BQRA 1F6WA 4CKZA 4ARCA 3EYAA 2Q7DA 3G9ZA 2VHEA 4PONA 2QGNA 3ZK7A 3G8BA 1K7SN 1ZCAA 5CFZA 4XA8A 2EDCA 1PTJA 1R88A 3WB0A 2VOJA 3QOWA 1FPQA 3WGMA 5K6RA 1RZRD 1JYEA 1JIKA 5T6MA 1MB2A 4MW7A 3CA8A 3FDIA 3JATA 4KLZA 4OI2A 1XCJA 2I7VA 3MIIA 2GN2A 4F9TA 3AGPA 4OQLA 4EUNA 2AXEA 4R9RA 4B9EA 2VHJA 4EFMA 1EXDA 2D7CA 3E4DA 2UYYA 2CFIA 3QM1A 4BZQA 2YCBA 4BFSA 1UPBA 4L08A 3UK7A 4TRJA 2OCAA 1JPVA 2FZ4A 3D7LA 3N53A 1QYXA 3REOA 2YHIB 2ZVJA 3W6UA 4AC9A 5BN1A 2V8BA 1KO1A 3AF0A 2ERYA 5IBQA 3I32A 4NK5A 3IUPA 3DH0A 3KVYA 4HPXB 4RNCA 5IDWA 2RKOA 3IX7A 4BO9A 2OUKA 1IQUA 2HRDA 3K20A 2R6R1 3KYDB 2P77A 1T5BA 5KYTA 3R77A 4WA8A 3L77A 1ZGHA 4INJA 4IO0A 5TQVA 4D96A 4ETWA 2EIXA 1IAQA 4R71A 5KNDD 5HPYB 1RYBA 4MGHA 1IN5A 1C50A 5FOTA 4I1YA 3C14C 4MP8A 2RGGA 4Y2RA 3PYXA 1B23P 4R1QA 4MGEA 3MINA 1T9GS 1VB5A 3MJEA 1V5FA 4P92A 3VX3A 2ONKA 1NW4A 4G4IA 1IJEA 1ODIA 4WN9B 5B4VA 2XBLA 3AEKB 2FJ0A 3PR1A 1NQXA 1YDGA 5A9TA 2EZ8A 2FPPA 1QE3A 1XZEA 3WKBA 2YHUA 3PQ7A 3HEBA 1E1RD 3GLGE 4HLCA 5JJBA 3L4BC 3SVZA 1CYEA 4ZKDA 1TYDE 3LK7A 2M6KA 1XLWA 5JCOA 4MAAA 4NCIA 4PBRA 1OI3A 5C1DA 1NT4A 1VJRA 3TZBA 1XN1A 2QEQA 3HXTA 3V4FA 1IN4A 1USKA 1YS1X 3ICCA 1CFJA 1QYRA 5AXDA 4DM3A 4P7KA 3JZDA 1B0UA 2BDEA 4IVPA 3DBRB 1L5FA 2IE0A 1QGUB 1Z83A 2OD9A 3O6VA 3N0TA 1SXJA 4C4OA 2EBWA 3CRW1 2YWGA 1KRXA 1AKQA 3DD5A 5TPZA 4C0JA 2V1XA 3A6GA 2QMYA 3OTWA 2M1ZA 4CM4A 4PICA 4MVJE 5EIEA 5A04A 3ZWNA 4OI0A 3MJ4A 3EPPA 1G6HA 4N3BA 1DSSG 1JDZA 1LI4A 1W5FA 2DFDA 4YN3A 1UEXC 1MG5A 5CJ2A 4OB8A 1ZJ4A 4XASA 4RVCA 4E4TA 2VJCA 3D6NB 1IRIA 5DXFA 2ODNA 4RWEA 3CUYA 4UVHA 2QPOA 1WCWA 4BTLA 1NOJA 2J3EA 3K3PA 1XNRB 3TDKA 4B80A 3P26A 1E1LA 2I80A 1OGYA 2EU8A 2WB4A 2FQQA 3OLXA 5EJ2A 5H5JA 1EFRA 3AVQA 3DUWA 2YIMA 3RFCA 5KTMA 4HC4A 3BMCA 2RAUA 4WOCA 1U80A 2AUNA 1Y89A 1ZM7A 2I2WA 4QJIA 1RXVA 2MR5A 4Q0MA 2MYPA 5EWMA 4UU0A 2V98A 3HABA 3DAHA 1CUCA 3B5EA 1LK7A 4MA0A 3IAEA 2VJQA 1AGPA 1PEAA 2Q45A 5FEMA 5BSUA 3UY4A 5IU6A 1N1MA 4QLBA 3JWIA 3BS4A 3T0GA 2ADMA 2BM0A 3ZGZA 1I2DA 3CNEA 3K92A 3DE6X 5JD5A 7ADHA 3NT2A 1DCKA 1Q44A 3BZWA 1H4VB 4JCCA 3SS9X 4L1KA 4MWBA 2A0KA 1Z56C 1A77A 1E3EA 2D1QA 3GFVA 3RBVA 4GKVA 5FTNA 5JBIA 2HQRA 5EZYB 4PC3A 5AMXA 4Q37A 2ECFA 5MGNA 1ISGA 1VJTA 4KIJA 5L45A 1D8TA 2GN4A 4N0PA 3JARA 4WLUA 5FNVA 4MO2A 4EF4A 4C21A 1NVAA 2W6JA 3UQZA 1O96A 3WYNA 1L7RA 4KMSA 5LLSA 4UD2A 3IQFA 1I4EB 3GRKA 2FEOA 3KCNA 4I50B 1Z5PA 4I4TB 5HQ3B 3W3AD 1MJFA 3H1PA 3L0BA 3RHZA 1ND5A 4RSGA 5K1ZA 2A58A 5IABA 1WPQA 2BMEA 2OAQ1 2XUGA 3CO5A 4I08A 3W4JA 4CF4A 4JB3A 5J4LA 1UAAA 4JQYA 3M2PA 4GVLA 1TZJA 1DHRA 2W2QA 1LSUA 3D02A 3OLYA 1YCHA 5CK4A 2LDXA 1YJXA 2JFVA 1IRXA 3OFKA 2VT2A 4Z2AA 3BN3A 1S01A 1W19A 1FP1D 3F73A 3OQVA 1L2TA 2XRFA 3BWXA 3TNYA 1EUYA 2P2NA 4HAOA 3H1EA 4O4LA 4PF1A 1B6TA 3SR3A 1AS0A 5EA2A 5ED0A 4D41A 3FZNA 1CD5A 1T6XA 3Q85A 4JLAA 4MCJA 1NF9A 1JDNA 2GLXA 2QM3A 2WM9B 3OZFA 4OI1A 2DFTA 1NHWA 3OSUA 4GP9A 3A6PC 4PNHA 1CY6A 3CUSA 5D85A 1GPNA 1KJNA 3Q5EA 5EVCA 1A95A 1ZGGA 1GLGA 2QMUA 3C3CA 2C1ZA 3I42A 5HS6A 4C22A 5DOZA 4ENTA 4NENA 4PSDA 1IPHA 3M6LA 3C4JA 5CJPA 2CMFA 1NN0A 3G85A 4KJZA 3V4OA 3IHWA 5FUMA 8ATCA 3T7AA 1KHTA 5A5GA 2OHOA 3FFAA 1XEWY 2RK3A 1OH8A 2XOXA 4ON9A 5B1DA 3QG1A 2ADOA 2CVZA 3KZNA 4E5MA 2WRZA 5C34B 4RVOA 1V2GA 2HREA 4QYTA 5K0ZA 1W0JD 2GF0A 4U7WA 3KEFA 1JFFA 1C30A 3ICPA 3IAS1 5C2JB 3MGAA 4WVLA 5B6PA 5AHXA 1EJ2A 3P1JA 3MMPA 4YCBA 3VHXB 4ZA2A 4GH5A 4BJ3A 1QV7A 4M76B 1P0QA 1H2EA 4CFSA 1FA9A 5E2IA 2A7QA 1K86A 2QRUA 3UMCA 4ASUA 1HL3A 2B5WA 5KYYA 3U60B 3X1DA 3ZXYA 1VJ1A 4UAVA 1M54A 4LZWA 2OWEA 2O6LA 1CF9A 3RYFB 2XMGA 3S2YA 3WTCA 4BATA 4RTNA 1BRMA 3NJRA 2W4IA 3R3YA 4D9BA 2C0QA 4QODA 2ZDHA 2I6TA 4C08A 2E37A 3GWZA 1GR0A 4MXDA 1GYRA 5BP7A 4DQVA 2HT1A 1X92A 4PS1A 5A7GA 1E1DA 3K1ZA 3GDGA 1EAMA 1HE3A 1PDOA 3I1YA 3IILA 1FX0B 1M2JA 1VLLA 4JI1B 1I9GA 3DULA 4E4RA 1YCGA 2AUMA 1VOTA 2ID8A 3VR6H 1C9NA 1CNMA 2PLWA 4OJMX 4U9UA 1F9EA 2RK6A 5DX8A 2G80A 2HWXA 3DO5A 2WU8A 4WMLA 5HILA 4HPJB 4HLQB 1FSFA 5AQ1A 2DGDA 4FYVA 2VATA 4PGMA 4R81A 2HDHA 5FUXA 4MR9B 3MOGA 3QPWA 3ROTA 2XGOA 4OQEA 5ESWA 3OFSA 3PHBE 1QLHA 4GW3A 3V4RA 2WMOB 2P9YA 3GBVA 2HWWA 3RJ9A 3HZRA 2FPGB 5DCWA 3RTGA 3VPBA 4DMFA 3PXCX 2BGGA 1REQA 1ZMBA 2UZIR 3FVRA 5EN4A 5LA6F 1UPTA 4KOAA 1QS0A 1YZ3A 1W0KA 4LYGA 2CLHB 4Y30A 4BOYA 4E88A 4GRIA 2BONA 2JAWA 3SM9A 4D9MA 4UMVA 2R9VA 1J90A 4IYRA 1Q3TA 2Q9AA 3DMNA 1NUSA 1GIAA 1N5DA 1QWOA 3H8WA 1B8OA 3WMEA 4QHSA 3VSDA 2AC4A 1VIVA 3GR6A 3AY0A 1M6YA 1TZBA 4XIYA 4BIMA 5I9LA 2O8CB 4Y2VA 1Y3CE 1M8PA 1QTIA 3EASA 4YP5A 5CB4B 3DAOA 1ITZA 3AH8A 4LYHA 3TKYA 3T3NA 1F2UA 3ISVA 1T6NA 2ASEA 4OQYA 2Z5LA 4LWPA 1K9VF 3O8OA 2WIBA 3A2NA 4WACA 2C2KA 5F76A 1G4AE 1SUAA 4YT5A 1Y1SA 4ZVRA 3UK6A 4K6GA 1V2HE 2ZPAA 4OQXA 3HUUA 4BIIA 3KZMA 3ZOZA 1UWLA 1P2UA 2HJRA 1SC3A 2R6CA 4JFRA 2REQB 4RLSA 5F98A 2R66A 2BDUA 3FTQA 2N1BA 2FN7A 3E3NA 1ZMTA 3PXGA 4EDHA 1TW3A 4K2AA 1N6IA 1U8CB 1XNGA 4YV7A 1V9LA 3AETB 4BFWA