2GK4A

The crystal structure of the dna/pantothenate metabolism flavoprotein from streptococcus pneumoniae
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
229
structure length
229
Chain Sequence
AMKILVTSGGTSEAIDSVRSITNHSTGHLGKIITETLLSAGYEVCLITTKRALKPEPHPNLSIREITNTKDLLIEMQERVQDYQVLIHSMAVSDYTPVYMTGLEEVQASSNLKEFLSKQNHQAKISSTDEVQVLFLKKTPKIISLVKEWNPTIHLIGFKLLVDVTEDHLVDIARKSLIKNQADLIIANDLTQISADQHRAIFVEKNQLQTVQTKEEIAELLLEKIQAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title The Crystal Structure of the DNA/Pantothenate Metabolism Flavoprotein from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 71
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 2gk4A00
1P9OA 1U7ZA 1U80A 1U7WA 4QJIA 5INTA 1U7UA 2GK4A
chains in the Genus database with same CATH superfamily
3NYQA 4OB6A 3NGXA 1GAWA 4MV4A 3KWJA 1W93A 5LDGA 4MX8A 3AR9A 3IUBA 1LI5A 1SUAA 1W2GA 1CRWG 1F51E 3BQNB 1RQLA 2FF7A 3V4OA 2FSSA 2MIIA 4MIOA 2XB8A 4NECA 4ZV7A 1H5QA 2OXRA 3E81A 3NTUA 3O9MA 1D2MA 4BFUA 3ASVA 4F1WA 5JAUA 3KOYA 3STTA 3ZVRA 3SXUA 1O94C 4MW6A 2P2YA 3IIJA 3B89A 2DJIA 1N8KA 1URPA 1TECE 2C0QA 5B58T 4TX1A 4XIYA 2FK7A 4RVNA 1JU9A 3HUFA 4EBBA 5AKIA 2EYUA 1CUDA 1U4SA 2CYAA 2ODTX 3SIWA 1SQFA 4XYLA 1TZBA 1Z75A 4PVCA 4AIRA 3M6IA 3W3AH 2GJ8A 3NHWA 1CR1A 2XWJI 4OHFA 3QSYA 2BGJA 5G2OA 10MHA 3EFBA 4MINA 5A6SA 2P8JA 3L46A 3QXSA 1FTWA 2I7TA 2O8NA 4Q3NA 2QL7A 3GIDA 2IWHA 1H5NA 3OPMA 2E5FA 1A9YA 3ZXIA 1SQ6A 4LF5B 4MCAA 2EKZA 1DRKA 2Y92A 4MQLA 3ZE7A 2F48A 2FPWA 4IWNA 1U2GC 3L0OA 3P9NA 4D3YA 5LPNA 1LPPA 2C9ZA 3IJRA 5FWAA 1GCUA 4XE5A 3UKJA 2QLBA 1Z33A 3ONDA 4U2CA 3RFFA 3EVBA 1BFUA 2VJMB 3IDAA 3GBSA 4A16A 2E4WA 1XZMA 3A6LA 5CGQB 1FFXA 1C9EA 4FT4A 3GDOA 1X1EA 3E7FA 2BM0A 2RGNA 3EC1A 3A2NA 3DGEC 5J3JA 2GCOA 3UK0A 5TQ2A 4KXLA 1E2NA 1UM8A 3VH2A 3D7MA 1L9XA 4PHCA 4X3CA 1TIKA 5IUKC 1V1MB 3VTAA 5AHWA 5H70A 5C7YA 1MB2A 1VJDA 2J0VA 3LQRA 4HB2A 2VI5A 1O5IA 3CO5A 3ICVA 3K16A 5IABA 5A9TA 1Q57A 1UP6A 2VPYA 4BNJA 3AV0B 1U0TA 4Q4HA 4BP9A 4PHGA 2W2MA 2QU7A 4UD2A 4ZU3A 3VXKA 2B1IA 2MDTA 1NUPA 3MM4A 4TMXA 3SQXA 3IPRA 1Z26A 2R8XA 1Y9DA 2VDNB 3FPEA 3PIDA 3LBIA 4YRGA 3GFBA 3C97A 3EIUA 4KAXA 5JBIA 1BMTA 1E5XA 1TJ4A 1QB7A 5FRDA 1YASA 4E31A 3VR4H 4WLVA 2JFWA 1B7GO 1PJCA 1TYEB 1VXOA 3AUJB 4ND4A 4EZBA 1HG1A 3PKIA 1G2IA 3S68A 1KHTA 4FMDF 2F6RA 1BRMA 5A5VA 1DC3A 1JKFA 1S8NA 4J29A 3QEMA 2C2BA 1F8UA 2AKEA 1GAXA 4Z3KA 2PO7A 3OAAA 1V43A 2WHXA 1KJWA 2H2GA 3PXDA 1H2WA 2NUPA 4LV5B 5DTJA 4FMCB 1PK9A 4Z5XA 1W85A 4WN9B 4WWHA 2QP4A 5LWHA 4JLOA 5C3UA 2OCBA 3EDMA 2GBLA 3RSLA 2EFJA 2FK8A 3HKCB 1WP9A 3EH1A 4YAWA 3OKPA 4GI3A 2BYTA 3I62A 1IC6A 3FCEA 2BBTA 3KQTA 2LPMA 5BNFA 1M7BA 4FOTA 3UICA 1ECGA 1LQ2A 1P73A 1QIJA 5L3ZA 1X2BA 2JAHA 1OLXB 4UPDA 5ALLA 1JS1X 1SU8A 3CZAA 1X74A 2MSLA 3KB6A 2R1VB 2VJBA 4U3JA 5FPQA 5KAMA 4WXMA 5JBQA 2FUKA 4NCKA 1RIFA 4BFTA 1NTRA 2I3GA 2VRBA 3JATA 4NS1A 4M1MA 1D8AA 5T3UA 4IJ5A 4HNHA 1L8XA 3O7WA 3AESA 4N0PA 1DAHA 1ZIDA 4QSMA 4HADA 1FOEB 3O9ZA 3R0QA 3LT5A 3WL3A 5AD1A 1DIHA 4RSMA 2GNPA 4H77A 5JPIA 4FIZA 4UBJA 3DL4A 4IM7A 4R69A 1KI6A 2AEEA 4AI6A 2WA1A 3G8BA 1UZNA 3GH1A 5ICMA 5J1TB 4DLXA 2AKYA 4CEJA 2AC4A 1HLPA 1W49A 3MGGA 4JDPA 4B40A 1WVGA 4YAGA 4KVGA 3EUFA 2QVLA 2G09A 2WUWE 2XTAA 4WBNB 4ZVNA 3W1EA 5B6JA 5K99A 4GMDA 3K71B 1C1DB 1R0ZA 1JLLA 1Y9ZA 2EZ8A 3D3KA 3EUAA 4LGVA 4A8JC 1QIDA 4YMVA 3G2QA 3DOOA 4GKAA 5KVQA 3ZU2A 3DMTA 4K1LA 1DX9A 3U3KA 2PH1A 1J56A 3E53A 2CXRA 2DH6A 2XNHA 4LC1A 4QTTB 2JFQA 1O7JA 2F67A 4UAVA 4O8ZA 2RH5A 3OVMA 4HH0A 4UBNA 3REFA 4Q4AB 1EFUA 3LH5A 1E60A 4EL0A 2ZUDA 5F3RA 1RKQA 3KSAC 2IF2A 3EPLA 4MWBA 1Z2DA 2Q2OA 4ZXPA 3BYZA 4E5DA 3QYFA 2OO5C 3VBCA 1SVOA 3PF9A 4YRDA 5KTNA 2BGIA 2QGZA 1C81A 2PTHA 1LI4A 2XBLA 1W1UA 2H4HA 3S99A 5C9ZA 5LQNA 2C5BA 2VBGA 4UQLA 2IUFA 1KARA 3MLEA 1KK1A 1MOQA 4NICA 1F5SA 3VX4A 3MJTA 1EP3B 1OBVA 4TYQA 5BQFA 1E2FA 1X7ZA 3WKEA 3EISA 2QKYA 1RRPA 2X42A 2ZGVA 3GO4A 1XEXB 1NNUA 4XI9A 3UTCA 4EQZA 1LRKA 4DMLA 1Z63A 4A8TA 2PT9A 2X76A 4TL7A 2A0KA 3DVSX 1TT7A 4BQIA 4LWPA 3V00A 2VHEA 1ZMXA 2WIJA 3FMFA 4KXQA 1LS6A 3EG5A 3KTDA 1N3LA 1PJLA 1UBTS 2OG2A 4LDAA 5E6UB 1TUBB 2E4VA 3VM6A 4F8JA 1Z4QA 4NH4A 4YR9A 5CG2A 3DOJA 4ZCRA 2IXAA 4E7PA 4EARA 2YWHA 1PEYA 2ZG6A 3IJPA 1HDCA 3EE6A 3AEZA 3B1XA 2PVPA 4HVAA 1TVEA 3TUIC 1IRIA 4GMKA 1H0KA 2AHOA 4IILA 3SICE 3R0XA 1OSNA 5CEEA 4AXBA 1R0YA 4Q7KA 4TVBA 3LK6A 4COKA 3TI7A 5BUZA 2NZUG 3A8TA 3NHKA 4Y6QA 4QASA 5K0CA 5CDFA 3GNLA 5LYJF 2QL6A 1RXWA 3R09A 2Q07A 3GT0A 1SEVA 2CW5A 3SX4A 3TSYA 4UVDA 3ZZTA 4CF6A 4J9UE 1RLUA 3PQ8A 2R6FA 2MMGA 2VNKA 3BPSA 1ZH8A 3P4UA 2EFYA 2QB5A 1IY1A 4HZUA 1SKAA 4UXIA 5ENZA 1GZ7A 1FUIA 1QV9A 2ZPUA 2I2FA 3QJGA 3ROMA 2ZSIA 5JI2E 5CDTA 5H02A 2FEWB 2ZRAA 3FPGA 4HN4B 4TS3A 3UPTA 4RD0A 3HB1A 4BNWA 3SSMA 1JT2A 4MQ6A 2RGDA 4TKVA 2HUPA 3AHJA 1SCDA 1W5FA 2WHYA 3F6PA 2KI5A 3KB1A 3MRXA 4KU4A 1FDIA 1Y3HA 4D1YA 3MWDB 3B9BA 4LVUA 4RF4A 2FPUA 4AP6A 1L8LA 5L7YA 1D2CA 2H7XA 1CR2A 4ZVUA 5K6AA 2BFOA 3H9QA 1E32A 3ON5A 3A2MA 4OBBA 4UU0A 5B1DA 1DIBA 1BE8A 1E3IA 1VFPA 2C8VA 4PLWA 3C3AA 4D6PA 9ABPA 1ST2A 2GM3A 3H9CA 4H4CA 1YR9A 3AEUB 2A78A 2XTNA 2H1LA 1UBGA 3G7UA 5F5NA 5KTKA 1AT1A 2P6MA 3FRIA 3WQBA 2B4QA 1WXWA 3FPSA 4U7PB 4IFBA 5EFZA 3TJRA 1XLTC 3RUEA 5CT5A 1QYDA 1ZGAA 4JROA 1GTL1 1I8TA 1G7RA 3BJIC 4LYDA 1C3EA 1VJGA 4P0QB 1AS2A 2ZBQA 5UKDA 5HRAA 2HJWA 1HKUA 4A4DA 3UK6A 4IH1A 4V39A 2C97A 1BW9A 4OCZA 4BUCA 4YRFA 1Z3IX 3NDBB 3K0SA 5JY1A 3RV3A 3WTBA 3GEMA 4WI1A 1QFSA 1AKRA 4V2IA 3KALA 3T4XA 2J7PD 3TPCA 4ZHQF 1K7EB 4HDRB 3IA7A 5GV7A 3T9CA 2WAMA 3TTVA 1NWHA 1O9HA 1KFJB 1Q5PA 2NSHA 1J0BA 2D1SA 2GPSA 3OWOA 4KUGA 4MARA 4RCYA 2Q5JA 3AF6A 3A9VA 2JFPA 1JYSA 2VWHA 5TF4A 2FFRA 3ZE0B 2O8BA 2FWIA 4GBGA 5T8KC 5GVRA 1MF7A 2L82A 3VSAA 1QVWA 3EBOA 2RD2A 4JSRA 3E9QA 2D4AA 4R2IA 4PG4A 2ODNA 3RC2A 3SS9X 3LHFA 1RBZA 1TKCA 4DIDA 3COSA 4YCAA 2I6SA 1YZQA 4GXQA 5DNEA 3SJBA 2H54A 2H7YA 4HDMB 4IHKA 1Q2UA 1PHRA 3AI1A 2PBRA 3FWPA 4H17A 4P7JA 3JD1A 1II8B 2P9BA 3KPUA 5T6MA 4BBJA 1CY1A 3SY8A 5D3MA 3GA0A 3ULKA 3NXKA 3N2YA 1BWQA 1KMHB 1CCWA 1SU6A 3FYTA 2WM8A 5JS7A 1QGOA 4QXAA 2Q5FA 1U8XX 2JFYA 2TMGA 3K8YA 1Q16A 3R9KA 4AYTA 1T9CA 1Z0JA 1M6HA 2HU7A 3CNHA 4K9DA 2O5CA 1B42A 1LCIA 1TYAE 1QH8B 3G0OA 3C1OA 1H2ZA 4ZIRA 1C8LA 3OI7A 2R8ZA 4ZYVA 4FI3F 1KO7A 1D6JA 3L6BA 2RGGA 3A4NA 4JLSA 2O8EA 1NUUA 1SHTX 1USIA 2RBKA 3Q7TA 1V6SA 4JD5A 5C7IO 4JT9A 4IOLA 3SX2A 3T9AA 5KOYA 2C5HA 2G8NA 1K6XA 2QX8A 3KQVA 3N2GB 3V8RA 2H16A 3MINA 2W8BA 1A7KA 4BFXA 4EO9A 4XWAA 1KS9A 3IUYA 1ANKA 1TM4E 4I55F 1XQ1A 3MWKA 2V7TA 3ENZA 1DTSA 2XVAA 1UF9A 4QLOA 3L4EA 3FWZA 3A32A 4YCSA 3G1UA 4J0HA 4B8WA 5LQUA 3DHYA 2VSFA 2B2NA 4GKVA 4OJNA 3QVUA 1C4XA 4LBVA 4Y7CA 2C2HA 2YWXA 4BTVA 3WIDA 4E15A 3TLGA 4UBMA 4CG0A 2ATCA 2BRUA 3IIKA 5CYOA 2BZ1A 3GAFA 4PR3A 2ORED 5BYKA 5AVXA 1SC6A 2B61A 1BJTA 4ZO4A 4KQMA 2OQVA 2J85A 2P4UA 3U80A 4EBFA 3ZZ1A 1LDBA 2QLNA 4XYBA 3GT7A 2HV8A 3MSXA 4L78A 5CMLA 5LYJA 5JRZA 2OAEA 3PIIA 1OAKA 2DPLA 4PANA 4TVKA 5LA6B 3DQPA 3G2HA 2ZT6A 4U5QA 1KETA 3DEFA 3L8DA 5EIAA 3UQYS 2IS1A 3BDVA 1RJ9B 3IYLW 4FKBA 2H08A 1NBIA 4ALLA 4NBKA 1Q44A 5U4XA 3WE7A 4CM9A 1P6UA 3RNLA 1WTCA 1X9GA 3KIPA 1Y5NA 2VUTA 4N39A 3UOGA 4CM5A 4DA4A 2I29A 1OLUA 2EBUA 1TCBA 1MPXA 2IL1A 1E4EB 1UDAA 3EGWA 4G1UC 3AEQB 5CM9C 4ESVA 3NNSA 3OEED 1AA6A 1FMFA 4QDZA 4R54A 1D8TA 4ZDJA 4FYVA 4EZEA 3LOUA 2WJIA 5JQWA 4C01A 3M33A 2G76A 4WIAA 3VI3B 2JIMA 4ZAZA 1JFSA 3DOUA 4B8YA 2DX7A 2XF8A 3BGDA 3DP7A 3O82A 4I3GA 4BATA 4LFAB 1Z4PX 4ZT7A 4RD2A 5JJIA 4DMMA 1P9LA 4MW5A 3CBGA 3RLFA 3EJWA 1BXRB 1DJNA 3WJ1A 1FP4B 2IPXA 2I6GA 2R79A 2AFHE 3HVHA 3NHBA 5AM4A 1NN3A 4B0PA 3VPAA 2H4WA 5B1HA 4ZMSA 2BMJA 1BCSA 4MRVA 5C1BA 1F8XA 3LIIA 2V9ZA 5H4GA 4QTUB 2PXCA 4N0QA 1JPNA 4YRNA 2Q3LA 1UK9A 2ZYGA 4KDCA 3GRAA 4HVCA 5B55A 4V1CA 4X66B 4RTRA 2O5VA 4ZPXA 4MUNA 1W0JD 1KEPA 3UWPA 2PZAA 4A92A 4CNQA 1X7YA 4HH3C 4LJ7A 1JDSA 2C5AA 3GK3A 3ZZMA 5JR3A 3KQOA 3IP9A 1WB9A 4B4WA 3VNAA 3SDZA 3EA0A 2IELA 1OE0A 4AS3A 4ZHQA 3KZVA 4RMHA 1WXGA 3NDPA 3ORFA 3CLUD 4IVPA 4D25A 3GXOA 4QLBA 2G72A 2IYRA 2YJ6A 4X24A 4LJLA 4KE8A 3VH3A 3I9OA 4M98A 4NDNE 1P2SA 4LZAA 4UREA 3RC1A 1U28C 1G17A 2CVQA 3IP7A 4RIIA 3BAZA 3BIJA 1UJCA 1DCMA 2FPXA 3DBRA 4PAMA 4AN0A 1AC5A 4EFMA 1O97D 2VOEA 4R1OA 5H83A 4BU0A 4UVGA 3URKA 3I8XA 3HB9A 1TT5B 3GRUA 3E9NA 3Q7EA 2ZVQX 4QC2A 4RLSA 4TV9A 1A9XA 4YRJA 2PGOA 3AIMA 4Q7MB 2XIJA 4JP2A 4Q9HA 4HXGA 1CTQA 4FZ3A 4P82A 4LX8A 4AZWA 1VJ0A 2IFTA 2QM8A 4N3AA 4DM4A 4Z1OA 4ZZIA 5A5DA 2EG9A 4P81A 2AQIA 2BI8A 2VDKB 1Y42X 2YXBA 3FNGA 3PQ3A 4P1ZA 5DYNA 3STHA 3H11B 5KUTA 4Q6BA 2CYCA 4PCAA 4I1SA 3ZKAA 2WI8A 1AH2A 3MGAA 2OR3A 4K0RA 2EQ5A 2D1RA 3HZRA 4E4TA 2J6CA 1I6WA 3AF0A 5HPYB 5K0JA 4EPRA 2BTEA 3O38A 2B4YA 1KPHA 1DFGA 1CUEA 3LFHA 1TAUA 1LRJA 2UZ1B 4K6HA 3D6NB 3NHPA 4J2TA 3IT1A 1K7SN 2QD2A 4LHWA 4YJGB 3ZVNA 2OHVA 3GJTA 4M76B 1V37A 4MROA 2JZNA 4ND2A 4L8LA 2D62A 3LV8A 1PI3A 3OPXA 3I0MA 1BDHA 4GT1A 5DMXA 3W7BA 3NRJA 1JWBB 1ESMA 4OFBA 1H4TA 3QLVA 3L2OB 1M8PA 4GUDA 4C89A 3BXZA 4KYIB 3H04A 1F14A 5DB4A 4D0LB 3CLTC 2IZ5A 5AO9A 4RTLA 1NHGA 4HGQA 2ACEA 2VL7A 2CWWA 3KJIA 3RSOA 3GFOA 2NSJA 3L7BA 4I81A 4R31A 1YCDA 2YQ4A 5LBTA 2O2YA 3NUGA 5AJTA 3UA3A 3QX3A 2XDQA 3NC4A 1LV7A 3MB5A 3OQNA 4ITUA 3DZKA 1V6CA 4O5OA 1TUEA 3TMYA 4B0OA 3D0QA 4AJNA 1OJ7A 1YGPA 2P8SA 3CKYA 4I4LA 3F7MA 2J30A 4K6CA 3VR3D 1DI0A 2O2DA 3UWSA 4C07A 1BQEA 2QMOA 1IY8A 3FPCA 3ITNA 3SEZA 2R751 2YVAA 2Q50A 4A1FA 2HPAA 1LBQA 3LL4A 1B41A 2YZMA 4OL9A 4TXNA 5B2ZA 3QX7A 4ZOBA 1JKJA 1YU6A 4YEDA 3S8EA 4X95A 3A3KA 3BH7A 1KRXA 1Z7YA 4ZK2A 3R0ZA 1H8ED 4B74A 2V1XA 4G8JA 2H8KA 2Z95A 5L4LA 1M6YA 1AV7A 3KKQA 3H8WA 1NQWA 1Z4OA 2WF7A 4XSVA 4E5SA 3DLAA 3AP1A 1V16A 4M99A 3H9EO 1JFTA 2WJHA 3PP8A 1VPTA 1J8DA 4IOMA 4NMMA 4GDFA 3KE8A 2XRZA 4GL2A 1UC9A 4BVLA 1GLNA 1JE0A 3Q8XB 2YWDA 1MH1A 2CJWA 3O0TA 3C5VA 2QN1A 5KVVA 4YUVA 1Y6FA 2OT3B 3T38A 3BERA 3TTSA 4E5UA 1WL8A 3PR1A 4LEIA 1H3FA 2G1JA 5JCJD 4AKGA 3E9DA 3KD3A 1A72A 1GUAA 4P5EA 5AKZA 1EFRA 1BHQ1 4ZZ0A 4S1WA 4IHAA 3LVRE 3IMGA 1NJSA 3KG2A 2AJ8A 3M4JA 3GPIA 4LF8B 1BXGB 3MA0A 2DQZA 1LBEA 3G1WA 1C9NA 3WHPA 4EUNA 3I37X 4RA9B 4BKOA 4NQZA 1ETUA 3LQ1A 3AXSA 1L7XA 3IQDB 1GT6A 5IVKA 4RE6A 4QGBA 3LY7A 4P34A 2I03A 2YICA 3NRBA 2P65A 2I7DA 3CEJA 1BYIA 1BMFD 3JXEA 4EGQA 4E3WA 4RS3A 4DEVA 1JHQA 3UJCA 3ND6A 4BXOB 1XKQA 3ETEA 4ICIA 3RCBA 5E9WA 2B7CA 2Q4DA 2PSEA 2OFPA 1QRTA 1OQAA 3B5JA 4CFYA 2H3EA 3IHWA 3LY9A 3KDSE 4AS1A 2BFCA 3PFHA 2HQRA 5DRYA 2FF5A 5A4KA 2G0NA 4JLNA 4A82A 3LZCA 4DAOA 3DV9A 4RLQA 4UUAA 3I04M 3LLMA 4D3DA 4XPIA 621PA 2RK6A 4E4YA 1EUZA 1LJ8A 1U8ZA 3ZD9A 5F2KA 5J23A 3PPIA 3KUUA 3SYTA 4MITA 3JQEA 4P38A 4J91A 5FPPA 1IQRA 3VNUA 5KVCA 1KZ6A 3G9XA 3IAEA 2HR1A 2OHIA 3M3DA 1N1MA 3P20A 3VC2A 1W44A 1JXOA 4BB6A 1NVUQ 4KVAA 3QWIA 1I5EA 4B7XA 5LBUA 3ZDDA 2Y1LA 2Q29A 2WUDA 1UAGA 4CTKA 4IKEA 2DPMA 1QCCA 1ZK0A 3HDGA 1E98A 2HRQA 3AT1A 3NPMA 1BKYA 2I7VA 3D02A 2FJ0A 4NCXA 1YK0A 5AUQA 3HSKA 4RNCA 2O2GA 4QQRA 1R5NA 3BZBA 1YQDA 3CF2A 4LY6A 5IKMA 2A9FA 3QUSA 4HX9A 3E9CA 5AW1A 1EVYA 2P9CA 2WSSD 3DDHA 4QJBA 4RL4A 2LDXA 4WCVA 5K3CA 5LZ7A 4B6OA 1KH2A 4F4HA 1F0NA 5EFOA 3TUZC 1DWUA 2GK4A 1WY7A 2DERA 1HX7A 2ZZNA 1COZA 2J32A 2Q7OE 5I9MA 1PYOA 3BXGA 4Z99A 3FJOA 5H3CA 1QC5A 1ZSNA 3DC7A 1Y4DE 1AM4D 2QX9A 1S1MA 3T7RA 1WSDA 4XVRA 4RYDA 3K1ZA 3GFRA 2VDWB 2IDKA 4MUGA 4HWTA 3JY6A 4XJSA 4IG9A 1OH6A 4KNYA 1VHDA 1OFHA 1W5TA 1P0MA 3PC8A 2ATVA 4CXMA 2ZRDA 4R2JA 1PD0A 3PUZA 1G19A 4LYJA 4WKNA 3FPAA 1ID1A 1YNOA 4LXGA 1QJ4A 3IOCA 4WVLA 3E8SA 3GG2A 3I6ZA 1HTBA 2GF0A 3JQPA 3SC4A 1XLVA 1W0KA 5DBFA 3VR1A 2CNKA 2PSDA 2ZIVB 3O0DA 2QORA 3GMIA 4WDQA 3FI9A 3G6WA 4RMNA 4ZVVA 3T7AA 4UJ3A 4Y2SA 4EL5A 2UZ3A 2JIOA 4HC4A 1OBCA 4KQHA 3D6MA 1F8GA 3K0FB 3KV3O 5CYFA 3GDFA 3IELA 4A6EA 3CZ4A 3WLIA 1EHIA 1B6SA 1HGXA 5E6SA 2VC2B 4G5OA 4DA7A 3FWNA 1V3QE 2IHZA 4KMRA 3TQOA 1N3BA 5EJ6A 2ZBGA 2GETA 1N5JA 4FW9A 1NVWQ 3AF4A 3PTLA 1SM4A 1Q1NA 2G67A 2PZFA 2P6RA 4K1XA 3IUQA 3LSYA 4IH9A 1JR3A 4UTOA 3GQBA 2VKTA 5DYYA 1R9JA 5F5LA 2FEPA 4NR0A 4RORA 1FNSA 1Z35A 4G26A 2XDWA 1S89A 4X6YA 1POXA 1R0BA 4CR8A 1DIRA 4JHLA 4PC2A 2IS6A 4M1KA 2EW8A 3GBPA 3IJEB 2IYLD 3OIYA 5E4YA 4Q3BA 3SBXA 1MGPA 2QE6A 1BX3A 3CJTA 4F21A 2ZAMA 2QN3A 1RAFA 2OP1A 3N0VA 4WCFA 5DO9A 2PV0A 1O6GA 3EEFA 1SXJC 4CUJA 1QHSA 1ECBA 3G2IA 4XGRA 3ORQA 4I1YA 2O3JA 1CJBA 1LK7A 2PUBA 5A04A 2XVYA 2F2TA 2GTHA 2IZ6A 1P8AA 1QYIA 4OSOA 5P21A 3IKTA 5IC6A 1R27A 5BRNA 1XVIA 2GM9A 4HDNB 4HPXB 4TZKA 5JYDA 1WPXA 4CUKA 1UBRS 3X2SA 1GSAA 4I9GA 1LC0A 3EDYA 1LJLA 5JSYA 4Q66C 4PU0A 4R8RA 3PD7A 3UMYA 3LUHA 4DDKA 3OC6A 3KQHA 4HQ6A 1OAOA 2B9EA 5EIXA 2XY4A 4TLBA 1R1DA 1ELOA 4H3SA 3D3WA 4LQLA 4QXRA 1ENYA 2GUGA 3DXYA 1C14A 1QU3A 2AJBA 3ZQKA 3GYBA 4C04A 5IBQA 1ZVKA 2PV7A 1C2YA 4B47A 3CEHA 4HPWA 3RIHA 4PRKA 4KC0A 2GMWA 3K32A 4Y1RB 3E2MA 4TVOA 4Q01A 1HDGO 3T3OA 3BB3A 2FN8A 1JQBA 2JFOA 1K8YB 1OXVA 2YV4A 3KQYA 4FCCA 5AP9A 3K6JA 2AYYA 3B6KA 1UJ6A 1XXHE 4QJ5A 5FH9A 3BS4A 4O25A 1KAOA 1AE1A 3BSYA 4WV3A 4MR8A 3U5ZB 1J21A 3V4VB 5HK9A 1SXGA 3OZGA 4XQ0A 7ADHA 1G3RA 2IODA 2Q3DA 3ZQUA 1OW3B 3SPXA 2BMWA 2GBGA 4Y2RA 2X2OA 1DJLA 1RYHA 2DPYA 2SHKA 1NBEA 3BXOA 3EDRA 2BDUA 3O3MB 4LOHA 4N49A 3UJ3X 5TQ0B 3EYWA 4HNTA 2GPTA 3AUUA 1R12A 3P9KA 2ZYAA 1B6RA 3R6LA 3D0RA 3RNOA 4PG8A 2QDXA 1I7QB 1VTKA 3DOCA 5CIQA 4BMDA 3LWBA 2IVZA 4AYWA 1YRHA 4K05A 3FFBA 4F91B 4F92B 4BB5A 1JYFA 1NI5A 2WU3A 5ENVA 4NCHA 4FNAA 2R97A 4Z1MA 1G66A 1QIMA 1SXJE 4TRNA 1H8HD 4GYYA 4DARA 5CB4B 3LHKA 3TOCA 1KVQA 3L43A 4B81A 1G55A 4C3OB 4D7AA 2OCDA 4O2BB 4Z4EA 1S3SA 2AOVA 3VOTA 3AJDA 5LJLA 3QVWA 1RP7A 2A9KA 3D1LA 5A3VA 2G5PA 1C7JA 5BYJA 3EMVA 5CFZA 2AOUB 4BNDB 5JADA 3KOOA 1Y1KE 1PG2A 1T5BA 1NN1A 1QTIA 3WFIA 2G82A 3F5SA 3NTRA 1G8FA 1T1RA 2GXQA 3MPOA 3SEQA 3PICA 5ADWA 3OY7A 2W6QA 3VA7A 1EXMA 3JALB 2M6RA 4W5OA 3PDHA 4ON9A 3FXAA 3VU3A 1G2PA 3UMVA 5K8VA 3Q1KA 4OLJA 3F6RA 3EOZA 2Z6AA 1V5IA 3W5DA 2GPJA 4G5RA 2ANBA 1QAMA 4DQ0A 1Z0UA 1C8VB 1CJTC 1M0WA 1OVMA 1YMVA 4MS4B 4P3YA 5E1BA 2QN7A 1JP7A 3AR7A 4AQDA 4R0MA 1LW7A 2IYVA 3D4OA 2G4LA 4G8CA 2DBRA 2ZPAA 3AL2A 4PF1A 4S2UA 5DOZA 4AQ7A 1SZCA 3AJRA 3AI7A 1KEEB 1J6UA 2D74A 3UT6A 4EHLA 2QOEA 1GHTA 5IVHA 1PEDA 2VSXA 4JI4B 2O3UA 4YRQA 2R7LA 4PYQA 1SBTA 2F8MA 1H6CA 4TRRA 2HF9A 5JSFA 5F9FA 2H1WA 2CLKB 2OY0A 2PR2A 2PUWA 4DIMA 4OB7A 4YJKA 3GCZA 4PO3X 4HDQB 4GQIA 4QATA 3E82A 4DQXA 1TW3A 4YS6A 4OYHA 4ERXA 4EKGA 1K4YA 3DE4X 2PFGA 5J5AA 3WYDA 4UKDA 3MGBA 3NOXA 3VV3A 5AVWA 5D5QA 2EZTA 1G60A 2R1TA 3ID6C 2GM4A 4LHSA 1M5RA 1XRPA 1KU6A 4UW9A 3COPA 3JU3A 1GSOA 2AIRA 4PTYA 2B7BA 1RKBA 1E3EA 1O89A 1P74A 1WX1A 2CD9A 3COWA 3EGDB 4JBLA 4XOIA 1CQIA 4OM8A 2KB0A 4A8PA 5BMVB 3OE7D 3IUJA 4O2AA 5DLYA 2FMUA 1TO1E 3EMDA 1KI2A 3EASA 3KQPA 3MUFA 3U60B 3N1UA 2Z5GA 1OPRA 3A1SA 3DOEA 2AFIA 2JVIA 3TH5A 4P9NA 1M1YA 3Q2IA 2CLDX 5C7OO 2LR0A 4CM8A 1SIUA 4E09A 2J0UB 5TQJA 1GN9A 3L05A 3VC3A 3V33A 1PEKE 3REQB 2AX3A 4NFYA 1G2OA 2Z5FA 1Q0HA 3PNMA 1J0CA 1MB3A 2W42A 4F5EA 1Q50A 2G40A 2BCJQ 3EBLA 5GM2A 2BGUA 3Q87B 3KJHA 4A8JB 4A2CA 5FDFA 821PA 1Q3TA 1BNCA 1WXEA 2ZYRA 3C0KA 4O33A 3OQPA 2AI1A 2CDNA 3W04A 1UT8A 3AFMA 3JVUA 2OBLA 4FBMA 5CM8B 3NDJA 1VP3A 4PAGA 1HEUA 2OFFA 1U7OA 1Q20A 3RT9A 1NXTA 3CLRD 2XCIA 1XA0A 3KKZA 4UMVA 1F12A 3CVYA 2WJ4A 3RFVA 1LY1A 4NATA 4URFA 1E1RD 2XYQA 4ZOEA 2J3EA 5EJ2A 1ZD8A 4EW3A 3E1SA 1EB9A 4NL4H 3U9TA 1FNCA 4XB1A 4DVGA 3BJEA 3EMKA 4OJMX 5IUNC 4YYZA 3QWFA 4L5YA 3SSOA 2XWSA 2C61A 3Q3VA 1Z08A 1Z68A 1LDMA 2ZEJA 3K1TA 4AUKA 2A5YB 4Z0TA 3EGCA 3RSHA 3QEOA 2GK3A 2H1IA 2VR1A 2WG2A 4Y2TA 1Y6GA 2XBUA 2XWBF 3I45A 3ABQB 2W7TA 1V5GA 3LCRA 3WRXA 1PR1A 5A3SA 1FXSA 2VT6A 3SXJA 3RBZA 4QYIA 2X7HA 1G6Q1 1NRWA 1WSWA 3FTCA 3QKIA 4JIGA 5BV2P 1OWPA 1KFBB 4M0UA 1JSRA 1M66A 5FFNA 4I9NA 3CXRA 2FEMA 3MWEA 5AJHA 3ANXA 5GONB 1GGVA 4NABA 1Q3KA 2RGNC 1ZL0A 1ORTA 1HE5A 3HA2A 3L1UA 3NHSA 3Q6MA 3LA6A 3S44A 2Y1EA 1V9LA 4OX9Y 2V0CA 4RY2A 4WL0A 4FBGA 3SLRA 2ODQA 3SHWA 2ZIGA 3U3XA 3IT0A 1AMUA 2WYVA 3DAFA 2QPLA 4S35A 2XZLA 1M1NA 3E05A 1TL7C 4WE3A 4X20A 3MNFA 3A6DA 4MJ7A 1YFJA 3KYIB 4HQOA 1GQFA 3CY6A 5J5CA 5FWYA 1MXFA 2HCRA 2OL4A 3QW2A 1GXSA 5BV7A 2OBMA 4FWIB 5A4FS 1U1DA 3KYCA 3I1IA 3KVRA 5BSFA 5KQLA 1TTQB 2FPIB 5J2UF 3BHMA 2IGBA 5AI8A 5KYYA 2B0CA 2RHCA 2ON6A 3ICOA 4KO2S 1C0EA 2IV2X 2IF0A 4OMFG 4V0LA 1VPDA 4LRXA 4M38A 4Q19A 1I2AA 3WG9A 1G9SA 1P7CA 4EG8A 4V24A 1YRWA 2LKCA 1FYVA 3RUDA 3DCIA 2DHQA 3BB1A 4M1OA 1XDWA 2LCIA 1U31A 2NXJA 3O5AA 3PJGA 4KO8A 5EWJB 2OXIA 3WWDA 5JANA 3NR2A 3S3TA 1QFJA 2C9OA 4TMZA 3S40A 4ZCSA 3VPCA 2Z98A 2ZS8A 3LXMA 4U2FA 1T2CA 3M2TA 4E6PA 5G3YA 1GRRA 2GBLC 1NFRA 1YA4A 2D13A 2GKOA 1FBNA 1WG8A 4IUDS 3CX8A 2VCEA 2CWDA 4F4JA 1QX4A 2GILA 3IB3A 1SY7A 4JGIA 2GB4A 4FD2A 4TSFD 1N2EA 2GZAA 2QL9A 1QBKC 1VE1A 3HUEA 3TI9A 5TC4A 5MGBA 1GQRA 1LSUA 3H2HA 1UKZA 4Z8XA 4B3JA 3L7DA 3KAPA 4D8WA 1NVVR 2FDRA 4FNOA 3RVJA 1XZCA 2D7CA 3GFSA 3W6OA 5EERA 3S81A 3V9AA 1P62B 2CCKA 3EJ6A 4YDHB 4EITA 2BGGA 3MWYW 5TY0A 3ITKA 1GA4A 2WKPA 5F9HA 3B52X 3MAGA 4X91A 1NVGA 2ZB4A 4PBRA 3KFLA 3Q6NA 1W4LA 4KCGA 4AJKA 1S2IA 3G8AA 6AT1A 2VTDA 4W4TA 3IX7A 3GMTA 5SY4A 4K9OA 3H3FA 1LFAA 1LDYA 1RXSA 2BP7B 2I9PA 2PRZA 5DGDA 3HDYA 3V32A 3VPGA 1V4VA 1NR5A 3BDIA 1PSWA 4I6JA 1KP9A 3V4RA 5IWCA 1U7XA 3IL2A 3PUWA 4RVOA 3QYJA 4F6RA 4IIDA 3TE6A 4DR7B 3L7JA 2VAPA 1U0RA 3DA8A 4J75A 1YZTA 5ALUA 4WOJA 1O08A 1HORA 1MAVA 1THZA 2HF2A 4OHXA 3DMTC 5IKPA 3I2HA 2GZ2A 4HNQA 3QVGB 5FBVB 1O9GA 2ZTLA 1F3OA 1C7FA 4TL6A 4XWKA 2H5LA 4B3BA 5LM3A 3MILA 4IF6A 2FFQA 1E79A 5AM0A 4PZUA 5HJ7A 2HTEA 1KXZA 4KQEA 4AF7A 2IYNA 2REQA 3CZCA 2CDAA 1D1SA 2FN7A 1V7PC 2ILTA 2JGDA 2XT0A 5JH7B 2PAAA 1ZA2A 1YHNA 4FFNA 4B09A 1TAQA 5DULA 4ZGBA 1UIMA 2QRVB 3TGPA 4MK4A 1JL3A 3HEAA 3QU2A 1K89A 1CX9B 2NSYA 3IBGA 2YQ5A 1XRJA 3GZJA 2YVLA 3EVTA 1K4KA 2G28A 4K86A 3V4SA 2Z58A 2C2ZA 2QUAA 4JLJA 4MRMB 1L1FA 3SGLA 3TB4A 5JD5A 2OLKA 5THXA 4F9FA 2JIZD 2BY4A 4X1IA 1GGJA 1KIMA 3ESZA 3UAVA 2FZKA 1GLGA 3O26A 1CD5A 1VL8A 4DR3B 4JITA 1Y9AA 4KIUA 1AQNA 1P45A 2V3VA 4EY7A 1GPBA 2B99A 4MQEA 2BEVA 2C9CA 1UMDB 1TF5A 1P2BA 1I7NA 4WKPA 5T4EA 5FBRB 3GDHA 2B36A 4XIJA 4H6XA 2EHJA 1GU0A 2QY9A 2IXDA 5COAA 1PV1A 4QBTA 8GPBA 5KNCD 1UKVY 2CVHA 2QIOA 2XMPA 5KNDD 5EE1A 2JVJA 2JRCA 1TAHA 3OQ1A 3ZY2A 4KACA 2GDZA 4D02A 4K6GA 1FLNA 3RRFA 4H59A 1HT1E 2H11A 3L41A 3LT0A 3O8OB 1J23A 2Z3ZA 4IL5A 1ICEA 3MBOA 2RHWA 1QH9A 5FHQA 2Q3MA 3DH0A 1W34A 3EXG2 5HS4A 2DEUA 1M7HA 2OSBA 4YVFA 3U26A 3KXLA 5GM1A 3CRRA 3AGPA 1X14A 1W4ZA 3E70C 2DWPA 3DV0B 5IXYA 1UZMA 3CIOA 4IAOA 1ZOOA 4JT8A 1SVIA 1XI2A 3CWCA 3U4QB 4A2PA 1CDDA 5KSOA 3D5EA 3JASB 1REQB 3ACDA 3THWB 4LTDA 4Q9NA 4XWOA 5HWSA 1A4IA 1B3BA 3DYVA 4MW4A 3OQVA 3QYPA 4RHCA 2D0DA 1VKHA 1GKIA 2G83A 4ZVOA 3AEXA 2LTAA 4X93A 2HN9A 2WZDA 2YOGA 3A70A 1GKLA 3C6KA 4F45A 5JXGA 2WFLA 1O95D 2JIPA 2IUSA 1FFBA 1PT5A 2J5QA 1P7YA 1YK1A 2ZE7A 1DAEA 1J90A 2ZFUA 3E8MA 3LYHA 1TEHA 2XXJA 4I14A 4P5DA 1ML4A 3LO5A 2PD3A 4JC4A 2GA9A 1YULA 3ZIAD 5K6AC 4YC7A 1K86A 4DE5A 4KR6A 1QVVA 4OY3A 2WD7B 1H3NA 2VAMA 3E9YA 1IN6A 1HE4A 3KB8A 3DHEA 2WOJA 3DP9A 3P0HA 4I9HA 4CJXA 5J40A 2VHZA 2D2EA 2JJ1A 3JAKB 1NXXA 3BHJA 2W48A 1XTSA 4MVJD 1HUQA 3AB3A 4WGGA 1NNLA 4Z2YA 4J43A 3TW4A 7GPBA 4GZ3A 2HFKA 3M4XA 2A9QA 2VBIA 4OP1A 1IOLA 4Q3KA 5DSXA 1FRNA 3D0KA 4HDKB 4PPGA 1ISPA 4OIFA 3ZEAA 5IARA 5AK0A 5ICFA 3CPJB 3TZEA 3PWTA 4FOPA 4HMQA 4BKMA 3T1TA 2BGKA 4OP3A 5G3ZA 3KE9A 2W4IA 1OPXA 1YVEI 3R20A 3KR1A 4AF6A 1UFVA 2RI6A 3EZ7A 1XEWX 1Q21A 3MUEA 4M9ZA 4OHCA 2EX4A 1EWTA 1TYZA 1DADA 3Q7QA 1XZNA 3GG9A 4FFBA 3L5KA 5GJCA 2Z56A 3ORRA 1LBTA 1VBFA 1JG6A 1ZGGA 3DT8A 1PDVA 4QYTA 1T1SA 3W1VA 1QIEA 4WBXC 4I2VA 3KTOA 2XGMA 2VCYA 3ESRA 1HTTA 2HSZA 3MERA 3C3KA 2FMHA 2A5JA 3RTEA 4KB5A 1DBQA 4KSYA 2X0EA 4B80A 4Z4FA 4BX3A 1IBKB 3LW8A 1XJCA 1AG9A 5AYVA 2ZWMA 1JG1A 4YX9A 1NUSA 3FNFA 4BBZA 5CDFE 1H66A 4XCVA 2ZI4A 3HVRA 1L4GA 4B3FX 2Q6OA 1F0YA 4N7MA 3D2LA 2WAYA 3RVRA 1VI6A 3PD1A 3K5PA 4HT3B 2OCYC 3AF1A 3PGLA 4Z7JA 3H2KA 1P5FA 3B6EA 1IHPA 2DLDA 3G8CA 2XECA 2HB6A 4P58A 3ZY4A 3RYFB 4V02A 4NDZA 4KBGA 5CAEA 1GGMA 2G77B 5KKNB 5C8XA 2R2GA 4IIHA 4BRZA 3OJCA 5BSGA 3CLHA 1U1GA 2GLUA 3RFCA 5JROA 2QUKA 4FKZA 3S1LA 3B3JA 3H1EA 5B6IA 1UAYA 2QRQA 3BJZA 3FB1A 5B1EA 2J9FA 3A9SA 2IPOA 1TKBA 2BJHA 1N0UA 1SUIA 2VF4X 4MKIA 3LWNA 2RGXA 2ZSHA 3FGZA 3GLIE 4QUJA 3WY9A 4YP9A 1GPKA 3FF4A 4BX9A 3C1UA 4U00A 3AZOA 3SJAA 1UZUA 3CRZA 2FEOA 1Y1QA 3QVTA 4YJFA 2J7PA 3L0DA 2R96A 4FONA 5KU1A 3THYB 5KTMA 3UMBA 5DNVA 2F4VB 1H2YA 2DUWA 4JOQA 3RTGA 4HGNA 1XBTA 5EPEA 3UJ8A 2F9MA 2ZB7A 4MR9B 1KNQA 3AYXB 5DN6D 4MYDA 5AVVA 2CD7A 3CUVA 1EBUA 2PUVA 3KFXA 4IGFA 1VMKA 2PKQP 3PFNA 2VDLB 3D1VA 1HZJA 3QFTA 3JVDA 1T34A 2NYRA 5HQJA 4O1MA 2P9GA 1V1RB 4INZA 4DW8A 1JIUA 3VKWA 5I7HA 3MGCA 1X15A 1FJHA 2J9RA 3GJ6A 5EQJB 5JBNA 3AVWA 4HB4A 1G4UR 4C08A 4DLWA 1R8YA 1J0DA 1YB6A 1P7VA 3IDQA 5BNWA 5AUOB 3SMQA 2RJNA 3KT6A 1E7WA 1OTXA 1PHPA 2BRUC 1IHYA 2VDOB 3NTVA 3AKCA 3INRA 4FCVA 4UE6A 4UVIA 2PSHA 4C7OA 3D7SA 5FJJA 4FE3A 4ABYA 2HRRA 1ZFNA 4TLCA 3FX2A 5IZCA 4LCJA 1NOJA 1TO6A 1MO5A 2QJOA 2XNJA 4I3FA 4K3VA 5HFJA 3RM3A 4BJ1A 4C0AC 5MN5A 1H6AA 3TW8A 2R86A 2FZ4A 5EXXA 1KRHA 3OLZA 1L7BA 3M6AA 1RAEA 4CKEB 4NG4A 1JHUA 1B14A 1C7RA 2O7QA 5DRTA 4P86A 5FPYA 4EG0A 5KWJA 1B15A 1YHZA 1OBOA 1G6HA 2VZ8A 4JA0A 5E3HA 5KJEA 4P0TA 5AJVB 1W88B 5H80A 3DAGA 3C39A 2PN1A 4O4JA 1W36C 2W6JD 1SVKA 4OSPA 5SZJA 1YNSA 3ZWPA 3HWRA 3OJEA 4G1BA 4HEA6 5ILQA 1UXHA 4HVLA 2OBYA 1EA7A 3U81A 3A0RB 3WL7A 1Z2OX 4ITVA 3TSOA 3UM9A 3EH2A 1JDZA 5BR8B 1XL0A 1MNAA 1E2IA 2O5RA 3NIBA 3TTUA 1L4NA 1VYTA 2FZVA 3TXYA 1SUWA 2X22A 2PX6A 1ILEA 3NI2A 4GX1A 3CUTA 4K2HA 4AWBA 4DBZA 4ZYTA 1RAAA 3F1LA 4LXTA 1A8IA 2HOQA 4W5RA 1E9CA 4A73A 1B8VA 1JUDA 5EE3A 3ROFA 1QE0A 1Z6TA 2EKDA 5JCZA 3LGAA 5IVPA 2JFNA 3QLEA 4K88A 3T94A 3IBSA 4DA8A 4XD2A 1RI4A 3PQFA 3W05A 2QAGA 4DCJA 1BVRA 1W2HA 2RHMA 3I2KA 4I50B 2BFBA 2XMCA 6ABPA 4YRKA 3DHNA 4A9AA 2VS1A 2ZI6A 5K3SA 1GCIA 2F1OA 3T5MA 4F4CA 2FVYA 3HCWA 2OD7A 5D1HA 5EZYB 1QGUA 3SOPA 3MSCA 4JDUA 1NU8A 3EY4A 4UE3S 2HDOA 4CMHA 1VXRA 1I0ZA 1E1LA 3ICPA 2VJCA 1X2EA 3H8SA 3EWNA 3M70A 1B00A 1WUHS 4M4SA 1AXGA 3UCEA 4CTOA 5JZBA 4OQNA 3A6FA 4QECA 3N59A 1V8OA 2KSQA 3CWQA 2PGNA 4PYMA 4QAQA 4JB2A 1Z2AA 3QLUC 5FI1B 2QF7A 2ZSFA 2P2SA 1JDPA 4PX3A 4V3CA 2J5RA 4XM0A 4QGSA 3TOXA 5K8LA 4BFWA 3U7JA 5LCXA 3RK1A 3FMIA 3UV3A 1ZJ5A 2B1GA 3MUNA 1PBNA 3TZKA 2XCQA 2B8NA 1GILA 3L0CA 3PR3A 3R3ZA 4QEZA 4ZAWA 3W7AA 3NH9A 4EKEA 1L4MA 4UASA 4CKCA 2H1OA 1OIVA 3QPUA 5B6PA 2OBBA 2FN4A 3S1AB 4PGGA 5KNBD 1A50B 1FF9A 3K5HA 3U4CA 3T7IA 1WB5A 3N6VA 2GPBA 3PNYA 2QBYA 4IDEA 4N3NA 5JNSA 4AB1A 2CXSA 3EGEA 3NTXA 1MHTA 1MIHA 4HUJA 1M0SA 3L7AA 4BO9A 2DTXA 2NLOA 4WFKA 1ZI9A 2YS7A 3G9TA 4NFHA 2SKDA 1JAYA 1E1NA 3U4HA 2GXAA 3GDGA 1W0JA 4POAA 4TT3A 2XX3A 1WOYA 4RAQA 1NUQA 5C1OA 4NAVA 2GR9A 1FRVA 1C7QA 2HSWA 4URXR 3ELYA 5BWOA 5I01A 4UMEA 1KIAA 5COBA 3BUSA 5BOSB 3ETJA 1ENPA 1VG9B 2WF9A 4B3GA 4CQMD 3ONWA 1IXKA 4PSVA 1GV0A 3ZG6A 4RV5A 3SVLA 3JZMA 1LQTA 3GHYA 3WLEA 1K75A 1PD1A 4X54A 1GAJA 4B85A 1WJGA 1MABB 1XD2A 1I80A 4D99A 4MRPA 1E5TA 4D41A 3QLVC 1IM2A 4NKRA 4Q4DA 3EWIA 3SQNA 2L69A 5G1PA 4DDWA 4A5SA 3H5VA 1C50A 1M1ZA 3AOGA 4MJXA 4JUBA 1LA2A 2HYDA 4FE4A 3OHMA 1UBHS 3NOOA 2JI9A 4S1VA 2P79A 4RQAA 1HQKA 5LC1A 4N54A 3UXMA 2PH5A 2PMBA 3BCSA 4U7WA 2GKSA 4WOCA 5T4HA 5B2EA 5DFAA 1QH1A 2IHVA 2IZOA 4TXLA 4MWTA 2XE4A 1X87A 1NQOA 3EC2A 4K26A 3SJ7A 5FLEX 3X1KA 1SIWA 1UMCA 1MC4A 3EPJA 3L7OA 1CU1A 1CVIA 4ZU1X 3TQCA 4G0QA 1H9CA 1YUNA 3ZHSA 4HAXA 3O74A 4UHKA 3LNCA 4GE0A 5I7SA 2R7NA 4U63A 1KR5A 3AHCA 4WECA 2C31A 1F2TB 4D45A 3NOQA 4YROA 2IY9A 1BX0A 4ZYXA 1QHIA 2CLIB 2ZIXB 3RU9A 3TZCA 1WS6A 2NPOA 1WMDA 3WIUA 4EGJA 1G9XA 1RWMA 1JDVA 2LIVA 1GGHA 1EG2A 3EZXA 4PHFA 3RC8A 3Q11A 4NCAA 4Y7DA 5FYDA 3NALA 1Q6ZA 1R9GA 2YHSA 5HHTA 2WUEA 3QHPA 3BE5A 3VVMA 4JQCA 2R4TA 1WXFA 3M9WA 1OZ0A 3HJHA 3GEPA 3U4IA 5BXQC 2QG4A 3B3QA 1U7ZA 5F2EA 5FV4A 3A7DA 2O3RA 2RCYA 3PEFA 2FJPA 3FCSB 4N9QA 3RWBA 1XDZA 1OFVA 1TDJA 1TOAA 2L19A 1JMKC 2NT4A 2ZBRA 4HJRA 1AUXA 2OYCA 1Z15A 2P7IA 3FIJA 2ZKIA 4EJSA 3VR3A 2UDPA 4MKGA 5I9BA 4BKUA 4LPSA 1X3LA 2ZSBA 4Q1EA 1O94D 3KZKA 4GZMA 4PC6A 2BR5A 4TZ0A 2FPLA 2QG6A 3NV7A 1L2TA 3R6GA 5E1MA 1H2FA 4N48A 2Y93A 1P31A 2YHIB 4GECA 2AOXA 3OPYI 3A6PC 1IDOA 1OH5A 1DAMA 1U9JA 3VV2A 2B30A 3EFOB 1OB5A 4UOQA 4ZCQA 1H8EA 1RWKA 2FPOA 3KTFA 2RFLA 4TTQA 4BECA 3PTZA 1LTKA 3H5TA 1FFDA 4GU5A 3FTQA 4D81A 3U5TA 3I05A 4Y2VA 2C20A 1IBRA 3VPFA 4KWTA 2GPWA 1QPGA 1ABEA 4GPTA 4PXSA 5L53A 2C58A 2XR1A 4OQDA 3VNQA 4GOLD 2GUWA 5TEVA 4RSRA 3SZGA 5KOHA 3QOWA 1Y8QB 2G17A 5DLEA 2C4TA 1XQ9A 2GXSA 5JCJA 3VMFA 4FJ1A 2B8JA 3I2JA 4OXYA 4G4GA 4RGYA 4WFQA 4XD7D 5KYXA 4J6FA 1RYFA 2LNDA 2WICA 3SX0A 4D9IA 2VK8A 2WFMA 4FOOA 4M1EA 4C4ZA 1Y6RA 4HWPA 4KSBA 3UIEA 3ESXA 3GCDA 1IWOA 3A1CA 3C3JA 2P6OA 3LUFA 4ENWA 3MMZA 4LV6A 1LBHA 3G23A 5A2GA 3VUFA 1Z2PX 1EEHA 4IX9A 2C04A 1SIOA 1I1QB 1HEIA 4QFCA 4EYOA 1KS2A 1C9YA 2EP8A 3HUUA 1KJYA 2EDAA 1GG2A 2YFKA 4LE1A 4MWZA 3OBIA 4RPHA 3UUGA 2BIFA 1ATZA 4RAOA 2BFAA 1ZC3A 2ZWIA 4QTZA 1EXVA 3FR8A 1ZXLA 3LL7A 1BMFA 4K9MA 1SOUA 4AKTA 1BXKA 1YR3A 1UPFA 2IOQA 1Y3IA 4ALKA 1L4EA 4AN4A 4ZCMA 5JALA 2CHQA 3TM4A 2WNSA 2OMEA 3K9QO 1BIFA 1FX1A 1EX1A 1ZW6A 3FTNA 3PA6A 3I83A 1XDSA 4DC9A 3C4QA 5BUSA 3CR3C 3LUPA 3OM9A 1G4AE 5GQSA 3EK2A 4QBGB 4Q3EA 5FQNA 4HAYA 4O3FA 5EINA 3PC8C 1MUUA 1P4HA 3L84A 2EQAA 2FUG1 3KSRA 4JVLA 2W70A 3C1AA 4JBWA 2W2OA 2PKCA 1M2OA 4BAUA 5LMCA 221PA 2JAXA 1Y3AA 2I5PO 2NADA 1AKYA 4JYBA 4P4LA 3O31A 4YV7A 1WUTA 2NN3C 1GNQA 1B73A 1G5RA 2BOVA 4BLOA 3HBAA 4FQ7A 5SY9A 2X5JO 2FHPA 1KWKA 1CE8A 1RADA 4YXWA 3OIVA 4DV1B 1WD5A 2NZ2A 2PLWA 4BEVA 4CMCA 4W5TA 2X0RA 3E03A 1B74A 3HUTA 5BN4A 2O8CB 4HXFB 1QPZA 4TTIA 1NRIA 4H15A 4BQOA 5BRJA 1V39A 4OXNA 2PUEA 4QX6A 3JYLA 4KXYA 1EB8A 2WSSA 2BFEA 2DUJA 4PC1A 2O3TA 2WEKA 3WGNA 4QDUA 1UFOA 2O8FB 1JWAB 4G0PA 1KJNA 2I34A 3ZDAA 3HC7A 3UN1A 1IIRA 1RCUA 1SU7A 5ALPA 4F12A 1EGQA 1NJ2A 5K3OA 1B1CA 1JXQA 1TVKA 4G4SO 2IOFK 3DMFA 4Y3UA 1IEXA 5M29A 3VOSA 4H1TA 1MQAA 3AG5A 1C0IA 1XTZA 4DCSA 2IBTA 1VJRA 3E9RA 5BR7A 4FU0A 1CB0A 3L0YA 3MCAA 4KXXA 4N5DA 2INGX 1YKFA 2WWFA 3CVVA 1WLYA 3E7XA 4IJQA 2CLEB 3K0EA 2HIAA 4GOJA 5KQSA 2BSQA 1WV0A 3HPQA 1CUYA 4PS1A 1Y1LA 2VOJA 3FLBA 3U17A 3KSMA 4U7HA 4QVKA 1JPJA 2HREA 1HYEA 2GESA 4WCFC 2R68A 1M34B 1OXXK 3PNPA 3Q0IA 3RI3A 4BV9A 4RKFA 4BNZA 4S04A 1SCJA 5F3WB 2IS4A 4UDYX 3HCBA 2FDXA 3DGFC 2ZJ1A 3TXAA 4DCNA 5DHPA 3NIGB 5TE9A 3U7QB 4EMTA 2BTQB 2PL3A 2IX9A 4RVDA 1N2IA 3CG4A 1EUDB 4W7IA 4NBNA 4U6SA 1NX9A 1FDTA 3RRXA 1SOVA 2R7AA 1F4LA 1R4NA 2XYPA 3IKLA 4B32A 1OD6A 2QZ4A 5C7LO 3GVCA 5GJBA 2JLYA 4US2R 3OQBA 1UJBA 1H94A 3CSSA 4LJ9A 5EJIA 1OAOC 4X7MA 5JNWA 4KXFB 5FI0B 3PFWO 2XW6A 4RYLA 5KOIA 1V1JA 2I8LA 4UZSA 4QFDA 4P3NA 2OQRA 2C4MA 3ZOZA 3SXUB 1RPTA 1SB8A 3N8NA 3OESA 4Q4JA 1OY1A 1TLLA 1BCRA 1TADA 3DB2A 3P52A 4D3ZA 1RE1A 1GCGA 5KMGB 5KOJB 3X1ZA 2FZEA 3GEDA 1GZHB 3OOHA 4K81B 1C9JA 1EA5A 3EWSA 4E2WA 1PS0A 1V5FA 3M6FA 2VJYA 2P4HX 4DR6B 1N9GA 2ZK7A 4CV0A 4OREX 3NBQA 2XZOA 1NV9A 4BTLA 3TLAA 3VR5D 1FTSA 4KQ6A 5EMHA 2QGNA 2HMAA 3SN6A 3NASA 3AYZB 3NHFA 3ROPA 2E5LB 3Q3HA 4TLLB 5A6SB 3ZD7A 5BVGB 2Z1NA 4FXPA 1G2QA 1SHLA 2O7NA 3EEIA 3RYHA 2WMYA 1JR3E 3BWMA 4BWVA 2DWQA 5CX4A 2FW7A 4QODA 5EHGA 4C22A 3P94A 2MTBA 5B12A 4B3RB 4LMBA 4YLGA 1WCYA 2BEJA 2CEAA 5J63A 2A3NA 4PEVA 2Z9BA 5EKXA 2YIJA 1QGZA 3S5JA 3TZBA 4OK3A 2Q7DA 4CDNA 3UJBA 4ISBA 1FFXB 4P6VF 1JHMA 4D79A 1UDWA 4QDOA 4GMGA 4BMOB 5AT1A 4MUBA 5KCMA 3TRFA 4QJ4A 5EWLA 3VQTA 2GCOB 2F3QA 1P61B 1YCHA 1ZWLA 1QYRA 1R6TA 5TQ2B 5KDOA 3O4FA 1X7XA 3R6DA 1DIOB 4EZIA 3ZY3A 5A9SA 4C06A 1U5BA 4QGGA 3I6QA 2VYFA 1STOA 1UXIA 1PJTA 1SWVA 2P3SA 1N92A 3OUTA 1JKXA 1L4LA 3D8UA 3WYCA 5M3BA 2C54A 4RGQA 1OTHA 5I51A 1JDUA 3CSDA 1JQLB 1ZGJA 3B5IA 4ZI3A 2V9CA 4Y8VA 1KQGA 1NNSA 1EVLA 1VZ3A 1UOPA 2W98A 2X4GA 2ZT5A 3O75A 1TTTA 4FEAA 5HGJA 2QW8A 4ZRMA 4KNWA 4LECA 3QKUA 4AURA 2V6IA 1BHJA 1QFYA 2IXBA 3B53X 3DFMA 1XU9A 3OKCA 4H4EA 4KN9S 1I32A 4P31A 3V1NA 3W2IA 3SD7A 3JAWB 3T34A 3V1TC 3F8WA 3N2NA 4UFNA 3LCMA 4ENPA 1WZIA 3JQ9A 3QBJA 3I9V6 2GN6A 2ZRBA 4ND8A 1HOXA 1AO0A 3HDJA 1W581 3EEOA 4IZIA 1WB4A 1W85B 4NESA 4Q9IA 4KI7A 2ZAIA 4JB0A 4V0QA 4ARIA 2AZXA 4KIWA 3DYIA 3DAOA 3OURA 4JLVA 9LDBA 4RE5A 4PAWA 4G0YA 2FWAA 4HI0E 4KBFA 1H8HA 1V3TA 2N1MA 3BD8A 4RCVA 1ONPA 3QTBA 1QFXA 3UC9A 4EKDA 3OMLA 4JA2A 2OKCA 4X1KA 3U3RA 2PUGA 2Y2VA 2BZGA 2PWBA 3UHFA 1AKNA 1MMFB 2HU5A 1NI4B 1KE2A 3QPDA 1JAZA 2P27A 1Y5LA 3TVTA 4Q7LA 2CT8A 1JJFA 1SCQA 5AOVA 3D3NA 4BB9A 1JHRA 5I7FA 1E0JA 2H0RA 4KV7A 1Z5UA 2ZBUA 3ZWKA 3K6SA 2RONA 3I2FA 4L08A 4C0LA 1AURA 3D8RA 2O0KA 1KO8A 3GNQA 3O8LA 3STUA 4C7BA 2Z8YA 4PHHA 4XW2A 5JAMA 2ZU6A 5FO1A 3AESB 4HD8A 1W5BA 2JGIA 2Z5LA 4LYYA 2BCGY 2XMDA 1K8XB 2SCUA 4LSZA 1E6KA 2E82A 1WE2A 2X6TA 3C6ZA 2OZLA 3K73O 5L8VA 1DXHA 4OGLA 2MSNA 3U4MA 4EO4A 3UWMA 3AWDA 3NYIA 1TQ6A 2ZIAA 2HQOA 1LSOA 5JW6A 2HKIA 2NXWA 3FYDA 3GPCA 2JI7A 3PQDA 2P1RA 4G41A 4TWBA 4OHPA 4XZ3A 3ZHVA 1WD7A 3U3DA 2CE7A 1MO2A 3ZUPA 4HQNA 1QE5A 4NXNB 3ISVA 4L6AA 2P2GA 2JGLA 3L06A 4PZCA 4F3TA 2O57A 4MGZR 5CNJA 3A6GA 5FUBA 3REOA 4B2YA 4YAUA 2G04A 4ND3A 1LX7A 3UPDA 5M5BA 1BX1A 1MRSA 1M2WA 1QQBA 1DWOA 1XZHA 3HYCA 2F59A 4TLAA 4WZZA 4X6XA 2OWEA 3CE9A 1FNDA 1FP7A 1LLQA 2HFJA 4IDQA 3KQUA 4NXMB 1J39A 3KZNA 3I5YA 1N57A 1H9BA 4NRDA 2WTUA 2PRYA 1T6YA 1RLJA 4GPEA 4BNMA 2EF1A 3ER6A 2VZEA 1JQ5A 1N0VC 4E1BA 1N5LA 4XQCA 5J4VA 1ZR4A 1RWBA 1Z7GA 3NFRA 4H6VA 3SDSA 5AUPB 3BSSA 4QWMA 2WAXA 1LPAB 1YJAA 2P41A 3OE7A 5KAPA 1GGNA 4URHA 2N46A 1NY6A 5FBHA 1JNXX 1T15A 2YXLA 3A28A 1O0SA 1C1YA 1JG7A 3RIMA 1X7ZB 1EDDA 3W90A 1FTQA 4N7JA 5KQPA 1LLFA 1TXGA 4WZBB 4A36A 1WVMA 3WRXC 2QX6A 4A3SA 1Z7BA 3U09A 3DR5A 2JBAA 2FZ5A 3I72A 4QUHA 3ZCXA 5JMPA 4LFCB 1VGQA 2PMCA 4Q1CA 1OX4B 3OIUA 4R5HA 1Z0ZA 2HCTA 2DT5A 3D6JA 4R2KA 2X8LA 5HR5A 3FOZA 2V4MA 2AK2A 1AY0A 1T1GA 3HVKA 4TLDA 3C41J 3TNFA 4MGYR 3VZBA 4H31A 1EUYA 3RU3A 2VSNA 5D86A 2FSGA 3UMFA 3ER8A 2XE6A 4EA7A 1CRZA 4OO3A 2OAGA 2EKBA 2JAUA 3MAAC 2AFIE 3OHPA 3GLFE 4MV7A 1M1YE 2ZQYA 4QZVA 3FZNA 5G0VA 1XF9A 1E1RA 3ZKWA 1CLEA 1TFRA 3I4CA 1KNXA 5JSZB 2O9JA 3HYNA 3SOZA 2Q45A 1J7JA 1T5TA 3JRXA 1T5IA 3HTXA 2IOYA 2PH3A 3LPMA 3R5FA 2ES4A 4KV9A 3GGDA 1L0BA 3A06A 2F90A 3R9XA 4CQLA 4HZUB 1SZDA 1B16A 2OHGA 1OU4A 2I2CA 3D7KA 3DZHA 3M1YA 4KQ2A 3HXTA 5DLQC 5FWDA 3EQ8A 4ZVQA 2UUAB 3CNLA 3T5BA 2HC9A 2ZJ5A 3AEKA 4MS3A 3BGIA 4C88A 2X7XA 4QARA 1PL7A 1USUA 3NHMA 4DTCA 5EUQB 4N40A 4HL6A 2B34A 3FRJA 4M1QA 1OZHA 5DYIA 4MV5A 5CLHA 3GZ4A 5ARDA 3DTYA 2RBGA 1II0A 1QXSA 3KHUA 1QDUA 1OYVA 2QE7D 3HE3A 3IAAA 3V4PB 1ZAYA 2DBZA 1ZKMA 5IT4A 4MCHA 3U56A 5L9AA 2C96A 2GPAA 1YZ3A 3BA6A 4Q15A 3MCTA 3VDXA 3AERA 3GELA 1SZJG 3NCHA 5I4BA 4DB4A 2Q1YA 2RK3A 3X0DA 1CQJA 1EHYA 3B13B 3TAUA 4ZVTA 1SXHA 3IE1A 1CS0A 2WQ6A 3D0OA 4P4NA 3VNSA 1CVRA 4LA4A 5KDDA 1L7NA 2FUCA 4NY1A 1L9KA 4JB3A 3FCAA 3QBTA 1PX0A 3E18A 4YGXB 1PTJA 1MJHA 4JN6B 3IXLA 4LTNA 1S2OA 3WISA 3T1OA 5BSTA 1SVMA 3OFJA 4F1JA 5U1PA 4DWVA 4JBHA 2WKSA 3QPAA 1CR6A 2EF0A 1VYUA 2A2ZA 3THRA 4UNIA 4FFOA 2OV2A 5TQVA 3HH8A 3TW6A 2HF7A 4JWKA 4OA8A 1E94E 3DKRA 3TKLA 1CUWA 1TA4A 2QA5A 4INPA 2WQ7A 1W52X 4GF5A 4IEIA 4BTEA 1M83A 2MSWA 2HM7A 5B7NA 1ADCA 2BFFB 2R6CA 3BF8A 1P9NA 2PBFA 2WJVA 3ENNA 4ZVMA 2AN9A 3D64A 3H2ZA 2W37A 2HAEA 4S1TA 2YIVX 1L8OA 5SZKB 4CMIB 1OI2A 3EG9A 1KYQA 2ODBA 3OD1A 1EX6A 5KYUA 2GZ1A 4N65A 4CU2A 4IV0A 3VSDA 2VNAA 1AHNA 1Q1QA 1YA6A 3TZHA 4DGQA 2N9UA 1WSAA 1ZQ9A 1ZMOA 4JZYA 2FQXA 1V0JA 2DFPA 2WE8A 1NBAA 1QWSA 1WQ3A 2M9MA 4JU8A 1FXWA 2NTNA 4J4BA 5CNIA 5MFZA 5EJGA 3G5MA 3SHFA 1KU0A 5A5FA 1CIJA 3PGVA 4ZA2A 1XU4A 1YQTA 3K05A 2V4UA 2RGEA 3TOZA 4JELA 5FTWA 3WNCA 4CIWA 4ARVA 4B8ZA 4IRUB 4FHFA 1E0KA 5BWBA 2H2AA 2V6MA 2VK1A 4RVUA 4Y2HA 3BQ9A 1J9GA 2XCTB 3OSZA 2DMRA 5JS1A 3OZCA 1T4BA 2Q62A 3BL5A 5KX5F 3VYWA 2ZUVA 1VMAA 1V47A 3H2GA 1CR4A 2GZHA 3OWHA 3CLTD 3USCS 1S8AA 4LZWA 5CDYA 3HQ4O 5CVVA 1A8PA 4JJ4A 1UDCA 4DNXA 1U2PA 1HMPA 4DR2B 4HDSA 3W79A 2W83A 2W8BB 4FK8A 3HLTA 3PT9A 2QRMA 3KL4A 4HEJA 1Z8HA 3EEQA 4K9KA 4G1EB 4YP7A 2B21A 2P3QA 4NDAA 1Q0SA 4H1HA 5HKKA 1JQJC 2ZRKA 3I32A 3R75A 4OL0A 4KFTA 4YMSA 1GNRA 4R9RA 4C14A 3GJQA 4O4IF 2XUOA 1KJ9A 4IVRA 4N9WA 4EVQA 3UY4A 1E6CA 2QSJA 3ILSA 1DTEA 1NPYA 2H06A 1DQRA 3LPLA 4H0NA 4L4SA 3TLGB 3TEJA 5MN6A 3DOIA 3OT1B 4NZZA 4WLUA 3P9QA 3KRTA 1FP6A 5JIBA 1DKOA 2P5SA 5FTNA 1NM5A 5K8JB 1KMQA 2B78A 1KDTA 4JKOA 4DMUB 1I94B 1EUCA 4JT2A 4JJAA 4B3HA 3FBWA 1FTNA 1PR2A 4ZQHA 5JJLA 4IHJF 2Y0BA 1HZZA 5FADA 2BF7A 3U1VA 1L5QA 5J2TF 3LBHA 2WYHA 3RF6A 3H7AA 1IY0A 2JIZA 4K9NA 1OLUB 1EFKA 1PWYE 2PJZA 3HKBA 4P80A 5IAEA 3K0AB 1ZD2P 4H1VA 3D9QX 5JQGB 3GA5A 4M53A 1KBQA 4A0SA 2MSDB 2XCRB 4G63A 1D4AA 1KI4A 1ZIOA 2SKCA 1NU6A 1SC9A 4UM9D 3LS2A 3Q9UA 4RFSA 4YMIA 1FJXA 4JKYA 3LDUA 3WKBA 1EQAA 4NCBA 4YPOA 1HA3A 3BTSA 3GP5A 3ZEIA 3BE8A 5KNCA 3BXPA 3FFWA 4KNVA 1NVBA 3NQ41 5ERXA 3VU1A 1LLUA 2PUJA 3EZLA 4UUBA 2NOAA 4C76A 1BAPA 4MKZA 2YHUA 1AN0A 3FKQA 3DM9B 2FQWA 3QG5A 1MB9A 2QNBA 1NX6A 3UUFA 3RV4A 1F5NA 1PYGA 2AA3A 5T67A 1CY4A 1XZBA 2QT1A 3WWEA 4A2QA 4UHHA 1UKAA 4B6EA 1BCSB 3E5MA 1O96B 2DJ5A 2RJ3A 3AQIA 3VJMA 4OYYA 1QDEA 5EE9A 4AJLA 1EFVA 4RDIA 5B53A 2ONYA 3IEIA 4WY5A 2D0PB 4V1CB 1IZ8A 1XMVA 3LRTA 4RS4A 1I3KA 1WF6A 6ADHA 3PDIB 2QUZA 4IF4A 1Z73A 1ZIXA 5K0ZA 4DDUA 1J8FA 4LJSA 5C4IA 2JDID 1ZUHA 2VQSA 4AP9A 3E84A 1FLDA 4EDHA 5DNWA 5SYAA 4BYGA 4ZU6X 3RS9A 2JJYA 1GFZA 3I0ZA 4WEOA 3GAZA 1LDEA 2XSZA 4HS4A 5CVDA 1TCUA 4MR7B 4W8HA 1E6MA 4MVXA 2XQFA 3AV3A 1ORVA 1AZTA 1J4AA 1BD4A 1K7FB 2YZNA 3COZA 3SLGA 2PXXA 4HZIA 1KJZA 4I8DA 4E08A 1QLHA 3GFVA 4AXXA 1CY2A 4NV3A 4ZO9A 4NU5A 5K0BA 1E1DA 2Y0PA 1TYDE 3PXGA 3ZBUA 4LXHA 1BZYA 4IV8A 1I1HA 1COWD 3CE6A 1ZH0A 4KLZA 3M6VA 4DJTA 1A2QA 4TV9B 3UMRA 2JVKA 5EVJA 3ZV4A 4EENA 4IKPA 4BMXA 1C0PA 2EIHA 4Q7EA 3U3MA 3S4YA 4CCYB 3ZE9A 4ZODA 3P5SA 1LZKA 5FUYA 4OHOA 1PR3A 3BRWD 4JUDX 3AVYA 5CX1A 3M3HA 4O5AA 4S0XA 4CMEA 4HAWA 3SZOA 1LSSA 1DAKA 2WHPB 3FLEA 3ZS9A 2D8AA 4W9MC 3RIGA 1WXHA 3FNEA 3VKUA 5ALQA 5AM1A 2CNBA 3W3ZB 4JBIA 4Z3OA 2IEGA 3P71T 3HI4A 1WV1A 4QDJA 2G1KA 3JARA 5CGZA 3ST7A 3UYLA 3Q7SA 4KDRA 5KX5A 1C9KA 3TBHA 4MPDA 4U0KA 4AZ0A 5KNLA 3DUFB 4LWQA 1YJCA 2I7CA 2GTPA 1R9NA 2JI4A 1OKKA 1OYOA 4FX2A 2I2AA 5ABPA 1TZCA 4EGAA 3AU9A 3R7WB 1R8JA 4DYDA 2IU3A 4EI2A 2Q8NA 3DMGA 1WCIB 3ZBTA 5HBGA 4DEXA 4TQGA 3FGOA 4LSWA 1RI3A 1T35A 2RHHA 3BSFA 2JGNA 2WIGA 5HUQA 2NGRA 3S2IA 4FPXA 3D7LA 1Z36A 1ZLXA 1Q1EA 4ESEA 4QDTA 4Z4HA 1FU8A 4J3NA 5P8WA 3R3YA 5JG7A 4JR0A 2C7GA 3EX7C 5EEGA 1TRHA 3OU2A 5BORA 1HT2E 2HA5A 4C0SA 1T8SA 2YY5A 2R8OA 5FUQA 3UNXA 1WBBA 1XAIA 4KXUA 1E2KA 1FLAA 1GPDG 4CGZA 3QFCA 5ADUS 2WPDA 1T9BA 5IFLA 3FDZA 4L15A 2WILA 1R4AA 5HKLA 4BNNA 5HIMA 4IHJA 1AKUA 2QSYA 4E30A 1DRWA 3PNBA 3AR6A 5ILGA 2DBYA 2PH7A 3FDXA 1G18A 3ZYCA 1FDVA 4ZDIA 1KZ1A 4R2WA 5GTDA 2H6EA 4GNKA 3AVUA 1AB5A 1NLMA 4B1FA 4AW9A 4YALA 1YHYA 4OGWA 5ALDA 1JLMA 1HYBA 1P7WA 4V0NA 2G8LA 5DN6A 1GUZA 1SXJD 1TQ8A 2HADA 1ARZA 1V41E 2CLLB 4IDBA 1JHVA 4LYGA 1B93A 4Q7JB 1Z9BA 4RY9A 4EM6A 5HKBA 3IUMA 4I4TF 5ALIA 1J1UA 3REGA 5F78A 2CXOA 1HYHA 3DO5A 1VCIA 5AOAA 3FIUA 3T1HB 1XAGA 4BQEA 1NSTA 2VRNA 3PUHA 1N34B 1AS3A 5FYQA 1QYCA 1YDGA 1L4BA 2ZRGA 1DWPA 3V34A 4ZEWA 1W1WA 1UFQA 4REQA 2CXPA 1XJ5A 5TLSA 3PUKA 1ZI6A 4FCTA 3LD9A 3SKXA 1E3SA 1HLFA 1OMOA 3FPHA 4NTZA 4QYXA 4TMWA 3RU7A 3WDKA 5JARA 1G9TA 4JC5A 4PYLA 2VP2A 1D07A 1WP4A 2C2WA 2QRNA 5DP1A 4GR5A 3WJ2A 4ZN6A 2GHQA 2IU0A 4DIOA 4Z9AA 3T95A 3JR3A 4NHOA 3IEUA 2DY1A 2QAGC 4HNGA 5IXSA 1NBMA 3WLQA 1CF2O 1SAYA 3F1KA 4FBLA 2YRFA 1N2ZA 1YZGA 2Y1OA 3ZLJA 1DJPA 3DMRA 2G06A 4YECA 4YTEA 4ER7A 4N3CA 3EIWA 2C5LA 4I1RA 4BFCA 4DXAA 4WK6A 1R4MB 1E6UA 1GPJA 1T1JA 2V8OA 4WA8A 5FPKA 5DM70 2II6A 1RCTE 3MJVA 4YBRA 1RD4A 3M81A 3EYAA 4M8NE 4PAOA 1MAWA 3TOSA 4IFEA 3WSWA 2ECKA 4DCGA 1F2UA 4HKTA 3LCUA 5TNXA 4YAJA 4MTCA 2ICAA 2HA6A 1N5IA 1DELA 1RYEA 2QQEA 3MMPA 4D8XA 2OOKA 1P1HA 5LU8A 2XEXA 4UNRA 5DCWA 3F46A 3DXXA 1LPOA 2B6NA 4TVSA 3KJGA 5AXAA 3HU2A 3RODA 1X13A 3QF4A 1LZLA 3ZGNA 5C52B 1VMEA 4X45A 4QO7A 2FP3A 4B79A 2WM9B 3OTHA 5I8WA 1PS9A 2RH4A 2A58A 3CTMA 3MTEA 3HCFA 3VU0A 4MMXB 1VECA 5H9VA 4GYKA 5DP2A 4DA6A 1VOTA 4R6WA 3NKVA 1TI7A 3WLRA 1SCUA 2VHUA 3CRMA 3QBVA 1RWWA 3G2KA 3TLKA 1Q0UA 2XGOA 4Q1VA 4IQ4A 2P77A 2KS6A 4XUCA 3W8NA 2Y0EA 3LGSA 1Q83A 3OE5A 1MAHA 1NHWA 1ISGA 2FCRA 2BBOA 1H4QA 4TKMA 1ZD3A 3Q7PA 5DHFA 4ZOLA 4FFVA 5FR1A 1EK2A 3CLUC 3W5HA 4PO8A 5GINE 2QWXA 3AUAA 4S2EA 4YJHB 4Y9UA 1WCXA 1IXRC 2R8RA 3VPDA 4ZC1A 3GRCA 2VJAA 2BMVA 3GEIA 2NU8B 1BDMA 2G70A 3ADBA 1Y34E 3L7CA 3WGLA 3QJ5A 2GYWA 1VHLA 1WNFA 4LI3X 4X44A 5LSAA 4NOJA 4EFKA 5KS2A 4F72A 1G7CA 4PINA 4L2IA 3IPXA 1CG6A 1IK4A 2NQTA 2PKRA 1OREA 2QRZA 4TS9A 5C37A 5KNBA 3P2EA 4EYKA 2CFCA 2ZP1A 3KM0A 3QHQA 1V8DA 3B38A 4XDGA 4DANA 1TC1A 2VKQA 4PW0A 2Y0CA 3MJDA 1BO6A 1USGA 2GF2A 4TROA 4O2RA 3LQYA 3C8HA 5EXSA 3UFXA 1KDOA 1VKRA 4EMSA 3CHYA 4P3KA 3U2QA 4LCEA 4RENA 4ECEA 4QUEA 3C8DA 3LPCA 3C15C 1C8KA 2XOKD 3BMNB 3ONFA 2HMUA 4OHZA 1C3LA 4QOEA 4A0GA 4RTPA 3IIEA 2RJOA 4Q48A 3AG6A 4JJZA 3QVOA 3LVFO 3MHTA 4KRFA 5JSHA 3CR8A 1AF7A 4JMPA 3H13A 4K87A 4UNSA 1P8JA 3JWIA 3H4VA 4I4NA 1QKKA 4U9HS 1E63A 3RRYA 4BS9A 5C4MA 4XWTA 3HYLA 2F9LA 3GIWA 3ZC3A 1J7KA 5JMOA 4LGCA 3UHJA 5IVIA 3VHLB 3ENWA 4I4TA 5GVSA 4IIUA 2VPIA 3KDAA 1Q1BA 4LHYA 3RIYA 4QHYA 5LQKA 3EW7A 2BE7A 3HK2A 4MP3A 6REQA 2NZJA 4L9SA 3NRCA 9LDTA 1DPGA 5TS2A 5FBWB 2Q4BA 1Y4ZA 3L49A 4G89A 5FAXA 3WRYA 1RPZA 1A82A 3W2FA 1RT9A 1YCGA 4WCFB 1U8UA 2ZRPA 3T7TA 2CFTA 3TEMA 3L0BA 4QPNA 2XZPA 2XNSA 3GZNA 1E2EA 2JAWA 3IR6A 2I2XB 2HLPA 3PQCA 4DA0A 5E9JA 2PZ8A 1YV9A 2PCLA 4EJSC 3MCWA 1UMBA 2PSFA 5LU9A 5CU7A 2AEJA 4LJRA 3K6KA 5E0KB 1Z83A 2HA7A 3BH6A 3KQWA 4TUYB 4UUMA 1M2EA 4PNHA 2C7BA 4E5MA 1L5OA 4HXEB 4CIXA 3P9CA 4JR1A 3DBIA 5GPBA 1KQNA 2O6HA 4P08A 3TE7A 3P2KA 1XJ0A 2SECE 1MXHA 3PWZA 5G0UA 1AA9A 5EKUA 3Q8MA 2B3TA 1GGFA 3INYA 4ZQEA 3G0DA 3WHKA 3TAHA 2YYAA 2GJ9A 1T0PA 1KBZA 2A1TS 3D3WB 4PYKA 4Q3CA 2ZI9A 2I3BA 5H59A 5F77A 5A05A 3B51X 4AWXA 3ZCVA 4C1NA 1RYMA 4EQ6A 3F5MA 5IYZA 2O8DA 5B4TA 4J6EA 1C41A 1X19A 4UARA 2YR0A 5ECWA 3O3CA 4ZXFA 4XR9A 1U65A 3HY6A 2FLKA 3GGCA 4ZT4A 4QA9A 2XHEA 4KGVA 2Z43A 2ZJ4A 3AHEA 3IILA 3RGGA 1LK5A 3K0HA 5LNK1 3BJRA 1XZ8A 4NENA 3O8QA 4NJMA 3UHOA 4IDGA 3E4DA 5T6BA 3I6BA 1ZRNA 1T8RA 4HPJB 3GRYA 4MR8B 4QU9A 4RC9A 1WDWB 4IQGA 4GOXA 3MT7A 1YB4A 2W6NA 2LCQA 1KH1A 3GV0A 4JX8A 5ELMA 3RUAA 2P5TB 2PGXA 4MB6A 1DMSA 1YT5A 3AETA 4Y18A 1Y4AE 2BEWA 3TLCA 3UAGA 3IVAA 4BKPA 2VTBA 3C7DB 1E2JA 4LY3A 4YRCA 4QBKA 1N2CB 5E4TA 4ARCA 3DE3X 3TTTA 3HJCA 1EWKA 1EZZA 2PUTA 2OZPA 1CNMA 3QKRB 1CUFA 4MA4A 3SDBA 1BU8A 4AJ9A 3NBKA 4MYSA 4PGMA 3SEFA 4Z7NB 5AVRA 2KMLA 5F52A 2CXUA 2VWQA 3SKYA 2ZXFA 3QE4A 5B7QA 3ROXA 1OBHA 1KYWA 1G7TA 1L5GB 3G89A 4CLRA 3OTOB 2VZ9A 5CEJA 2R8EA 4BNYA 1LTHR 3ANSA 1SR8A 1KZGB 5JAOA 1OF1A 3LKVA 5FPSA 2PRJA 4OQFA 1SOAA 5TPWA 4RPGA 2V7VA 2J0EA 4MQ4A 3KKMA 2O2JA 5KREA 2CMFA 3OAAD 4YFVA 4B4UA 4UZFA 2I2DA 3LT4A 2ZJAA 4PFQA 4Q12A 4RZQA 5BT8A 3EB9A 2ASEA 3JR7A 4L5AA 3V97A 1XDBA 1T2VA 4UM5A 1A04A 4LZOA 2QUBA 1IEVA 3CF4A 1WZNA 3WIVA 3ZWAA 4R8SA 3M5DA 3W9UA 4PZZA 4GBJA 3RIXA 4HTFB 2EJBA 1HSZA 1KBOA 2Y05A 1XIVA 3A1DA 3O84A 1RXYA 4G81A 1TA0A 3GUHA 1V2GA 4AG6A 1ZK4A 1PR4A 4FWBA 2OP0A 3GLHA 4NYMR 1TZMA 3UUEA 3G79A 5DV9A 1UPXA 1NBOA 1ZXBA 3HA3A 2WM3A 1OFUX 4ERNA 3S1SA 4YAOA 4JYAB 4BQPA 2NX2A 3ESYA 5ED0A 1IQUA 3UKOA 2UVPB 3N0XA 3UW1A 1L6IA 1E3MA 1JG3A 2C1XA 2IIVA 2C5GA 4LBWA 5BNIA 1NOIA 4EB6A 1S3IA 1QG0A 4Q3LA 2FLVA 1IHDA 3WRWA 2HV9A 1TZJA 3JX9A 5LZ2A 2R1TB 3FSGD 4NBWA 1QMGA 2R9VA 3W06A 2CJYA 2IYSA 2X4LA 4EHHA 4LW8A 3FUVA 3P19A 4HWGA 3DVQX 3KKEA 4AK9A 3WL8A 4DG8A 5ITZB 1FFSA 2DAPA 2VPPA 1OLSB 4TKUA 4LY0A 1CQIB 1MO4A 2JLCA 4LXYA 5ESWA 1T5LA 3KR0A 3NBFA 1DS6A 3SVTA 3TW0A 1I9CA 1Y89A 5J2TB 5FEMA 2CY0A 3FYUA 4ZI7A 3JQ8B 1A9TA 2FMXA 3DO6A 2WJ3A 3RWOA 5J4KA 4FKMA 2H1FA 5L3VA 3KZXA 2Y4NA 3B36A 1M1YB 2REXB 4KQWA 4UCXA 3OH8A 2XAAA 3JQGA 3WGMA 3I5XA 1P72A 4CM8B 1LF5A 1C3OA 1W96A 2H1CA 1EM6A 3GRZA 3V3KA 3WYGA 2H5JA 5CW2A 1II9A 5DTMA 3L1VA 2GZRA 5LD2B 1XYYA 2CL7X 1E1CB 2DFTA 3FKSA 3W9BA 4EI7A 4MLPA 1QCDA 1EWQA 1BWRA 1F1BA 1I0LA 3FBGA 4G84A 1MT3A 2BMFA 2OM6A 2QTRA 3NJ4A 4TT8A 1P2FA 1M6VA 3KXPA 3L04A 5BN1A 1N7GA 2NSLA 1Y4UA 4ZEMA 3BWDD 3PLAE 1NW4A 1ZPDA 2X1HA 1EEXB 3TNJA 4EHAA 4FB5A 2PPVA 4KBYA 4Y6OA 3STWA 5I8ZA 4GPAA 2J3JA 1NL3A 1CKEA 1QP8A 1W46A 4R16A 1GSHA 3S7TA 4LKRA 3U9SA 3J80A 3K8ZA 3WK8A 1D1PA 1Z4MA 3CRW1 4GSYA 3VU9A 2FZWA 4H3KB 2E3JA 4Z51A 4RDXA 1P1BA 4J9VA 5KI6A 2C8JA 2LUOA 5AIBA 1NV8A 1U0EA 3K9LA 3DC2A 4LRWA 1GSIA 4KL8S 4TZTA 2EP7A 1G5QA 2A5FA 4JU9A 1YSCA 3H5RA 1GFWA 2FZGA 3EN0A 2DVMA 1YS1X 1QVZA 2K5UA 4LWOA 3HWX1 2PKXA 4YUXA 2IYWA 3UMCA 4D3XA 2XGJA 2QMHA 4JY7A 5FKJA 4CKBB 1R0LA 1O0BA 1ZICA 3K0BA 4C4OA 4QYIB 4JI6B 2BKEA 1VCHA 1Y3CE 1ZC4A 1Q22A 2FW6A 1KPIA 3MWEB 1D1QA 4M7OA 5DGIA 3T7SA 4J3FA 1XFAA 1Z16A 3DVLA 1XDGA 1H9AA 1CSEE 1XMXA 3PUXA 4GRIA 4XX0A 3GJ0A 1V11A 3UOWA 1WSBA 3FVTA 4ETNA 1E3LA 1KHHA 3L8HA 1H1LB 1WEKA 3LSTA 1BMDA 1L4UA 4E32A 2WP0A 2ADOA 2E4AA 4OMCA 2UXBB 3RRNA 1U1FA 2BTOA 3FVQA 4DMRA 1TPYA 4X20B 3WIBA 5LBIA 2HWKA 3V8EA 3TQQA 2FW9A 5JVDA 3EAQA 3PLRA 4Z9BA 5BYAA 3TQTA 1F0PA 1IOVA 3KQNA 1KZYC 4MKHA 4RTOA 2AJDA 2V54A 2AMYA 1JJAA 4HN2A 2NU6A 4HNRA 3R7BA 2FN9A 3OPYA 4LDQA 3WL5A 4DMKA 2C95A 2X86A 3I2GA