1SKAA

Crystallographic snapshots of aspergillus fumigatus phytase revealing its enzymatic dynamics
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
435
structure length
435
Chain Sequence
CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 3-phytase A
publication title Crystallographic Snapshots of Aspergillus fumigatus Phytase, Revealing Its Enzymatic Dynamics
pubmed doi rcsb
source organism Aspergillus fumigatus
total genus 154
structure length 435
sequence length 435
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2004-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1skaA01
5HTKA 4TSRA 1RIIA 4FDUA 4EMBA 1UJBA 4MA4A 3FDZA 2OWDA 5CU7A 3QPVA 3IT0A 1SK9A 2AXNA 3EZNA 1V7QA 3LG2A 4PGMA 3IT3A 4ARSA 5AJWA 3KKKA 3FJYA 1V37A 2YN0A 1ND5A 3D8HA 3E9CA 3NFYA 3OI7A 4JOCA 2P79A 1EBBA 1E59A 1DKPA 1BIFA 2P30A 1DKLA 5AK0A 2PA0A 4PZ9A 1IHPA 4IJ5A 1DKNA 4AROA 4IJ6A 5AJYA 2YN2A 1K6MA 5HR5A 1BQ4A 2WU0A 1H2EA 2DWOA 3DB1A 2P6MA 2QNIA 3F2IA 3R7AA 5AJZA 4D4MA 2P77A 1T8PA 2A6PA 4ARVA 1XQ9A 4JOBA 4FDTA 3QPUA 2BIFA 2H4ZA 1QFXA 4PZAA 4GPZA 1C81A 2GFIA 1E58A 2H0QA 2F90A 3K4QA 3EOZA 1DKOA 5AJVB 3BIFA 2P9ZA 3GW8A 3LL4A 1YFKA 4JODA 3IT1A 3NTLA 3O0TA 2A9JA 3GP3A 2ENWA 1DKMA 2RFLA 2P2ZA 2DWPA 3D4IA 3FDZB 2P9YA 1QWOA 3E9EA 3QPWA 2WNIA 5AJXA 4QIHA 4D4LA 2ENUA 1NT4A 4ODIA 3E9DA 2H52A 2EKZA 1ND6A 1YJXA 1C7ZA 4GPIB 4D4JA 3ZHCA 1H2FA 3GP5A 1DKQA 1BQ3A 5CDHA 2OWEA 1UJCA 3IT2A 4ARUA 2H4XA 3MBKA 2EOAA 2P78A 1FBTA 3MXOA 2I1VB 1FZTA 1CVIA 4D4KA 3C7TA 2P2YA 2IKQA 1SKAA 3F3KA 3LNTA 1QHFA 1RPTA 3D6AA 1TIPA 1RPAA 2P75A 2EKBA 4E3WA 4HBZA 3PGMA 5PGMA 2HIAA 2P6OA 3DCYA 1C80A 1SKBA 2P9FA 2HPAA 2WNHA 4EO9A 3K4PA 3HJGA 1SK8A 5CX4A 2HHJA
chains in the Genus database with same CATH superfamily
2QTCA 1K8YB 4D9IA 4ZHSA 2XJ9A 1JU3A 4ZU3A 3D43A 4GOLD 5CVJA 3W1VA 3MD0A 3QF4B 3GUYA 1QDLB 2OMEA 3D5EA 3PHLA 5JI3E 3U7JA 1C41A 5LMZA 2G17A 4UXIA 5K09A 1NMEA 3D4OA 1JDUA 5F2KA 4EA8A 3LG2A 2B61A 4CKCB 1KEPA 3GPDG 1S2OA 1SCAA 1AUQA 2PLNA 3WS7A 3ITKA 4LBVA 2XKJE 1V47A 1PL7A 2YTZA 1Z5PA 2C00A 4QU0A 3RK1A 1EX6A 3AWIA 3ZGVA 3BA6A 3MCWA 4UHEA 2ZSDA 4GDFA 1DT3A 1BC5A 5C53B 2BJVA 1KJWA 4PC2A 2Q0HA 3FPCA 4PX9A 5EP2A 1UJMA 3ZWKA 2EFHB 1VLZA 3IR5A 2ACVA 4DLNA 5IC4A 5I9SA 3MRSA 4V3BA 4NABA 5FV7A 1OFUA 4BZXA 1XIVA 2UUOA 1EVLA 3PXUA 1M0SA 2R7KA 3G0DA 1WL8A 2BF7A 4YUAA 4IDFA 4KUGA 1ZUNB 5DSZA 3OZ7A 4Y6SA 3SJBA 2J5QA 3AG5A 5F2NA 3OZEA 3ZWVA 3AR2A 3CLHA 2EZ4A 1LPSA 2ADOA 4A8JB 4RMJA 1DRUA 1GQYA 2P9CA 3CVXA 4GYWA 2VSNA 3RLFA 5LQJA 2X5XA 4RGYA 1DBRA 2OBLA 1XD9A 3NV9A 1S9DA 4CG1A 4B3RB 4Z49A 1J56A 1EJ0A 4JEUA 4NZMA 3PLAE 3AR6A 1P1JA 1QOZA 1ZBQA 5DM4A 1N9KA 4AZSA 4F5DA 4F72A 1SBTA 3LC1O 2A59A 1PZMA 3KZVA 4HLUA 5HM8A 1WUYA 2NPFA 2O7SA 4CE6A 3H0CA 5C5EA 2BEVA 1KI1A 3ZN2A 2V7TA 2WHPB 4HQLA 4KDCA 5DVZA 4A27A 5ADWA 3FOFC 1ESEA 3RUIA 2XUZA 3KSUA 5GZ3A 2IELA 4AQ7A 5FKJA 3ZUPA 2HCTA 1K6EA 2OCIA 4JKYA 2N1MA 3JVIA 3M6UA 3GNLA 4Y7CA 3VAYA 4E7PA 4S1WA 3ED5A 1A1SA 3PSHA 4WNYA 2ZI3A 1N6OA 2BEUB 5FLEX 4EITA 4S24A 1D2CA 1K66A 5HEKA 3TTTA 3E7PA 1G8GA 2KPOA 4CMIA 5GY7A 1US8B 2FUG6 1S02A 4H9GA 1J0XO 3U0VA 3NX4A 3TQIA 4KR7A 3PQ4A 2JL1A 3PQ8A 1W1WA 1OX5A 4DV5B 4RD0A 2OYRA 3GN1A 3P19A 1EUYA 2JHFA 3AM5A 1SBHA 3E23A 2H1IA 1I2AA 1YGPA 4Q19A 2ANCA 1PFYA 5J5AA 2BKEA 2LE0A 5TY0A 2D1TA 1E7WA 2ZI7A 3FUXA 1QHFA 4OHOA 3RVNA 3IBFA 2HQ1A 2PX2A 4QX6A 4ER0A 1KH3A 1Z4QA 2EKBA 5HJ5A 3G2MA 4UOZA 1VG1A 4EFNA 4EW1A 1SWVA 4JIGA 2CZCA 3ECAA 5EZ5A 3WLSA 4NCNA 3FTQA 1TYDE 1RBMA 4H1TA 3H3FA 1BHSA 2O9JA 4A7PA 3UK0A 5BR7A 2JAXA 2DWUA 3FNEA 2H16A 3IP8A 3R20A 3LYUA 4RX1A 1IAQA 1UJBA 3Q7RA 4KRYA 4RIGA 3K6RA 2Q7OE 4MA4A 1PFKA 4B45A 4E30A 1XQWA 1H2ZA 3HKCA 1Y5NA 4KHZA 2GNAA 1JBKA 1U8EA 1TEVA 2W00A 3OJWA 4YRLA 3KE8A 3UAGA 1VOTA 3BWBA 4YPVA 1KJ8A 2KWIA 3ESQA 3FCSB 2D2IA 3DF9A 1PX0A 521PA 3E5MA 1SVMA 1V48A 3R3VA 1U2QA 4V0SA 2OXIA 4DMCA 1TADA 4AJ9A 1X9GA 4LW8A 4PQGA 1Y6JA 3D7SA 3SF0A 2ZJOA 3ZCUA 4CTNA 1J97A 3NM4A 2B6NA 2VUUA 3JQ8A 1RNLA 1YDGA 2OT3B 3UUGA 1G1AA 1WP4A 2WWTA 2JDID 4D0RA 2G3YA 2DJIA 2OP1A 3NEAA 1HA3A 2Y8EA 2P1RA 1DLJA 4HWPA 2XY4A 2A0UA 1DCMA 4LJ6A 4WXYB 3U3ZA 4P98A 4KO8A 2HSDA 3SIWA 3X1DA 4FP9A 1I6MA 1VGVA 1KOFA 5L4SA 1U63A 2CDCA 4M60A 1GJRA 2A33A 4KMMA 3F5MA 2IX9A 4RPJA 4XLLA 1XA4A 3EODA 4DLBA 4FT4A 3QX3A 4O5AA 2QRHA 2EL9A 2AZTA 2CLDX 4QVKA 1EDZA 1T4BA 1VGRA 2JGDA 2NQTA 2LXNA 1IZ9A 1QHSA 1GITA 1HE8B 1HDOA 1QCYA 2NV2B 2WSIA 4GPZA 3TLJA 5C7IO 3GLGA 2XWSA 3M5PA 4MQFB 3W5JA 5CVTA 1DINA 2XB8A 1J1IA 1L5LA 3LBIA 4B35A 4WN9A 2FH5B 4ZGBA 2CVHA 4I1UA 1WDLA 4O3FA 3GW8A 5J2TA 4XASA 5AVYA 1CUWA 1RC1A 3NXKA 1RLOA 1EE1A 2IIQA 1Q7GA 2AXQA 4OXYA 5F1OA 5I45A 5U4QA 3W1EA 1RPJA 2IIPA 2ZBVA 3BEDA 1KDZA 3MOSA 2GF2A 1NXXA 1ZI6A 2HDWA 4X1YA 5FPPA 2YFYA 4XQ9A 5I4KA 1VBFA 3KZCA 3DVQX 4WLVA 4MIOA 5AM1A 1NN1A 3CURA 4CKWB 2XADA 4PICA 1XCLA 3ST7A 4O2BB 5FHQA 1KPGA 2FP4A 4NE9A 1PL0A 4UASA 5FLKA 3FWZA 4BO8A 1T3ZA 3JQ7B 3EW7A 1LPBB 1I51A 4PHGA 4KQEA 1BU8A 3IEXA 3NT4A 2HT1A 2DF8A 1BD3A 2KB0A 2OGUA 4WCFB 4A6XA 2EGHA 3V55A 3WRXA 3RWBA 5TMDA 2FA9A 4HVTA 1CZNA 2ZG6A 3D3JA 3STXA 2WYWA 4C3OB 3IL2A 1I3LA 1QQ5A 2XAAA 2IYTA 4ERNA 4DOMA 1Y1KE 3P0EA 4BKPA 5C51B 1FUIA 2WJ3A 2PD3A 4IF6A 1N75A 1V8OA 3KWMA 4PAWA 5FEUA 3QNWA 3L6RA 2EF1A 4EPVA 2BGGA 4CDNA 4LJRA 1CPYA 3GLRA 4Q7QA 1VRVA 1NAHA 3OPYI 1KKMA 4GQIA 1Q6YA 4MINA 2GTIA 5KOYA 1KGSA 4KLRA 1M7BA 4HNRA 4K86A 2ZSIA 4RPKA 2QTHA 4KRGA 1FVXA 5HZHA 1T35A 3TL2A 4UU7A 5BQ5A 1NFRA 4UTXA 1WUKS 1JXMA 2DFLA 4EPXA 1RIIA 3KT3A 3EDQA 1A4IA 2ADFA 3DYIA 5EI5A 1P1CA 3MMNA 2RGAA 2FMUA 4TUYB 4UREA 3BFXA 1CNFA 2I2XB 1BKYA 3M5CA 4DW8A 4R3WA 1VMEA 3OE4A 2XECA 4RH1A 3MWEA 5IAKA 2JHCA 3FW1A 5F64A 3K6SB 1NYQA 1ZK4A 1OBHA 5D1NA 4ERXA 3N0WA 2ZVPX 5DYTA 2VJMA 1FTYA 1T8TA 2PZBA 3FMVA 4G23A 5GONA 3GLHE 1BS1A 1G5QA 2WF9A 3F8TA 3TK1A 4HUTA 4RSHA 1H2BA 3UZUA 2WT8A 1J06A 1TUBB 5D00A 1ZVVA 2PGAA 4AG3A 2C92A 1XF1A 3M1LA 4ARZB 4C0XA 4DR4B 1U7XA 3CE9A 1BWSA 1SHJA 2XQJA 2JFNA 3WSTA 3NYRA 3LUDA 4M37A 2JIOA 4EI9A 4QWWA 4ROTA 2C7OA 1WM1A 4FDMA 2QNIA 5CNJA 4AO8A 4D9BA 3BFVA 5KJEA 4EGSA 2IOHA 3ZCSA 3GJ8A 3HHPA 5H16A 3LLVA 2CNWA 4DNOA 4K6OA 1EJBA 2ZYSA 3F2VA 4FDTA 1L5KA 2IHNA 5F3RA 1HDEA 2WC1A 3QU4A 4EHDA 3EEQA 4OHRA 1OHHD 4MKXA 4BY9E 3F46A 4B3JA 2MSEB 1O94D 5EXXA 1RKVA 1J99A 1ODLA 2QN3A 4IIVA 1KDPA 3TRJA 3I30X 4J3FA 3TPFA 4C05A 2WHYA 5DASA 4LF5B 3KKZA 3ELWA 2QN9A 4I1PA 3NHFA 3GAZA 1U8TA 2PUEA 3NAQA 2BFAA 3DAFA 2HQRA 2X40A 3KTAA 1X87A 1YZHA 1D6SA 4OHFA 1Y48E 1B74A 4MVJG 3UMRA 2M1XA 2VYNA 3OFNA 4REQB 3VXKA 4BKQA 4KN6A 5H68A 2OBMA 5IF9A 5LDHA 1ZOSA 3O8RA 2XMRA 3WL8A 2F3TA 4S0XA 4DMKA 3IKLA 8ADHA 3LHSA 1ZQ1A 4M6WB 3TM5A 1M2EA 5DHTA 4EY8A 3K09C 1U7DA 3T38A 3GMIA 3NTQA 4B33A 3LO5A 3ESBA 4O1HA 3T7RA 2OV2A 3PX7A 5B1EA 1RWWA 5ALLA 2JK1A 2PR2A 3EVNA 2AKYA 3JAKB 4FWBA 5KTRA 5H83A 3SEFA 3WJ1A 2H8GA 5IS2A 5IH3A 3CLSD 4XB1A 1M2OB 2XMDA 3VZQA 3ZIDA 5SY4A 3FPHA 4YIKA 2EQAA 2CNLA 2V7QD 2XDQB 3DHVA 3JU3A 4Y98A 1QTNA 1EX9A 2PGXA 4EFKA 4F3TA 3FVQA 1UWLA 1BYUA 4KH0A 4X93A 3B1JA 2Q0QA 2VDWB 2YJGA 3GFSA 2ZRDA 3AB3A 4TMKA 3TLEA 4AKGA 2OESA 2AN1A 1GU0A 2C4MA 1ZCFA 3SEZA 2HFJA 1SVIA 3EC1A 4LDQA 3CH5A 2PUJA 3ISTA 3VU1A 1G21B 4JH0A 2CVQA 4R2MA 3H9JA 5I9TA 2AQIA 5JTUA 1SH7A 2GI4A 4MYHA 5DM1A 1QIJA 3VZDA 4QVIA 3NS7A 5FWNA 3FWNA 1R6VA 2W71A 3PR1A 1IY2A 3ZUGA 1BCSA 1JQ3A 3HUEA 4HWOA 3URMA 2DZDA 1Q0QA 4UDOA 4NESA 1BHO1 3WB2A 1X0XA 2WTUA 4KIJA 1K5PA 4W8HA 2Q99A 5HDQA 1U6JA 3C8HA 4U6SA 4HPJB 2EX0A 1KI6A 2WIAA 2PYIA 5FUQA 2JIQA 1TYCA 3LRTA 3WRXC 4BS9A 1ADGA 1ZJJA 4P4LA 4CIVA 4M49A 1GTRA 3U49A 5SZIA 4M4SA 3O75A 2P30A 5U1PA 3RRFA 2RKOA 1EBFA 1W7AA 3I34X 3G2QA 3A6EA 3CKLA 3F73A 1DKNA 3BFKA 2C2ZA 1TQ8A 3O84A 1LW6E 2EFDB 5F4ZA 2EJVA 2GTHA 2G1PA 3S2GA 4DQ0A 3QW4B 1IHXA 3UWOA 2JLVA 4I1IA 1G8PA 2GERA 4LZAA 4D5EA 4DIBA 2VP4A 2PX5A 1O6ZA 1J09A 3PX3A 5A6SA 3MWLA 3QEKA 2CHFA 4B76A 2AQKA 2JCGA 5CFQA 4FHZA 3OEYA 3GOHA 3IUYA 3OLXA 3C3AA 3MTDA 2QW0X 3U39A 3HYRA 1A5AB 3V2HA 3C8MA 4YAFA 1K7XB 3U44B 2D2FA 4BFLA 1ZL2A 2TYSB 3CQ9A 2XCQA 4JBLA 3FXAA 3NT5A 3WP0A 2L82A 2AVDA 2H11A 2B9VA 3KXKA 2X7HA 1NXVA 3CG4A 4Q3CA 1TPYA 5G1NA 2B5VA 3EIWA 4OU5A 5EIWA 1NSYA 2YOHA 4LJ5A 3CH6A 1I32A 3G85A 4KWCA 4J16A 4JI7B 3DP9A 1KERA 2C77A 4MWOA 4KIWA 3UFBA 4PN7A 3LRPA 5BN3A 1PFQA 5TMBA 5BPFA 4G1CA 4N5HX 5FV4A 5ALGA 5IT4A 3QWBA 1PIWA 5HNKA 1TVKB 1RM5A 1T5DX 3Q8XB 2QY6A 1XLTC 5CFMA 2FLVA 1PR2A 1S4QA 1SD2A 3NWJA 4M98A 5AKJA 5CDFE 5IFLA 1PDOA 1Z5WA 3R3SA 1YUMA 2GAJA 4HK4A 2YY7A 2Z9BA 3LLMA 5IDXA 1PFGA 3EC7A 4ZZ2A 1YGYA 2FWRA 2I1WA 1YTLA 4RHUA 3OECA 4KI0A 1YR6A 4BNWA 3BOSA 5M7EA 1LDEA 3GFTA 3IOEA 3MRXA 1S1CA 5FUXA 2CXPA 3KALA 3BKXA 3TZKA 3B60A 3W8RA 3W6UA 2ZZMA 2OOKA 1ZVQA 4OAQA 3QE9Y 5EY5B 4HVCA 1FNSA 4YQFA 5HG0A 1FUUA 2W0SA 4QC2A 1KI8A 1E7MA 1YZTA 4FLFA 4YMGA 2ZYIA 5D7NA 2JAWA 3Q7EA 1OYYA 2REOA 3GAAA 1CRQA 3KB6A 1Y42X 3UA4A 3NVKI 4WZBA 4GMFA 6REQB 1AUXA 5D3MB 5DYNA 3U4QA 4GXRA 2X0IA 1LRJA 3NWBA 2QZPA 2CKMA 5K3FB 4DYHA 1C80A 3HB9A 1WMSA 1MH9A 3G8YA 2VJCA 3LDAA 3O4HA 4GI2A 2J3JA 1TUIA 2IX3A 4HGQA 1Q57A 4D3YA 4DIUA 4DREA 4KDRA 4J4HA 4TTRA 5F1YA 3W2HA 5IJZA 1VTKA 1YR2A 2ZRCA 1XMPA 4DAOA 2P0EA 5M2QA 3SOZA 2YY6A 1Z0AA 3LTEA 3L6CA 4RORA 3R75A 3UHAA 3TZQA 3D2AA 4BNIA 2Z4RA 3EXEB 4MYUA 3VO8A 4WGGA 3INYA 1KOGA 3UUEA 5IEJA 1X19A 2AK3A 1MABA 4UMFA 2DHRA 1T9ZA 4D7AA 2WW8A 3QWAA 3H1FA 3L7KA 2I7XA 2YXNA 1GUFA 1F0PA 2GEUA 1UMDA 4M0KA 5JEEA 2WZDA 1W2HA 1GUZA 4HR7A 4OQDA 1CXZA 3FKSA 3KC2A 1U1CA 4G5GA 1PWXA 1MC1A 2Q2NA 1N7JA 2I62A 4DLVA 2Z9DA 1AXEA 1FFXA 3D2CA 3BRWD 1DKLA 2VBFA 1MTOA 3HFRA 3ODPA 4EJFA 3CBQA 3MCTA 4PX2A 4YCNA 1HF3A 4L22A 3A04A 3CNNA 4DLZA 3DZDA 2W48A 2IOYA 4JR1A 1CQIA 1KJ9A 3GUHA 3WL4A 3RGWS 4PSVA 2FEMA 2I7VA 1GDTA 1VBMA 3C43A 3KOXA 1Q1EA 2BTQB 3FNBA 4QT4A 2A58A 1K2VN 3DDOA 1VB5A 3N2EA 1GQ2A 4KYUA 4NBKA 4AZVA 2ZTHA 4QNMA 4RO0A 2PKQO 1P9RA 2PS3A 3T3PB 5CYGA 3S8EA 1I94B 1UQTA 5JCJA 3OEHA 2O4CA 3EVDA 5EYPA 5DGDA 1Z2PX 2FRVA 3NAGA 1TMGE 2P68A 3RHZA 3AVVA 3F6PA 1EFVA 1L1EA 1XTZA 2R9VA 3O7WA 1P5FA 2BFFA 3QHAA 5AW9A 1EU1A 3KKMA 1NIJA 3H0KA 3P9QA 4R7GA 4FIZA 1XZGA 1E4EA 1IPHA 2W22A 1JE1A 2ZQZA 3D3WB 2OORA 3KQMA 4LTDA 1YBMA 4YQEA 3LZDA 1H2YA 1HKHA 2WUGA 5ANRB 1OZGA 4YP9A 4AY6A 3MLBA 4BO5A 4DM4A 1P0IA 2J46A 1J5PA 3A6GA 1ZKMA 3C7KA 4JXKA 5HSGA 4HBGA 4BNYA 5B55A 3H9QA 2ERYA 4CI9A 3KZ1E 5A2QA 1OXTA 1E4OA 4LOLA 4KE8A 3V1TC 4TMVA 2OV8A 1X14A 4C0QC 1LK5A 1Q0PA 2H2GA 1W1IA 1G18A 3H5IA 4IDGA 4GYKA 2XQKA 4FYJA 1E79D 1YVUA 4ANFA 4F2HA 5LA6A 2G0NA 3WK8A 3NNNA 2WY2D 1XQVA 3B6IA 4PSKA 1OH6A 4QKQA 1ZYUA 2XHZA 3DE6X 4RD4A 1N2EA 3PI7A 4X92A 3TR6A 3GH1A 3HNRA 1UBCA 2I6TA 1SQ5A 3KT0A 2RHWA 5FTJA 4QJ4A 3C6QA 3QMMA 3H3JA 4LISA 4MYDA 1HMPA 4JB0A 4MZXA 4ZOEA 3ICOA 2W0MA 2A1UB 2VCYA 4RHYA 1ZS9A 2WHXA 1AMOA 2IPAB 4BFXA 1XTVA 3KOOA 2EJBA 2GAAA 4Q4HA 1EP9A 3LC7O 2DULA 2CMHA 2YWHA 1V3TA 5TPWA 1NYRA 3W77A 4MW4A 1DG3A 1AV6A 2R8YA 5HQ3B 5KNDA 5G0VA 3NIFB 4TYQA 1BOFA 5DCWA 2HJSA 3AUKA 4H27A 4K9KA 4AJ4A 2JRCA 2YMLA 1KHHA 3F71A 5FF9A 5AW1A 4W9NC 1RRCA 3OTGA 4L5AA 1X7HA 4M1QA 1T25A 1X3SA 3GJQA 2JGKA 4J16C 1J9GA 1SVLA 2CL0X 3AR3A 3HBMA 2WU1A 1VL2A 1IN8A 4IDBA 3Q3IA 1ZMOA 3HN7A 2DE0X 4X8HA 4EEXA 2IH4A 4F4DA 1ZD4A 5KU1A 3RSFA 2C0CA 2F9FA 2IEBA 1N5LA 1DQYA 2J0VA 2WAMA 4TRNA 5JY1A 1DBWA 1DAMA 2HC9A 1SUFA 4QGAA 4RMHA 3A4YA 3CZPA 1ND5A 4JELA 4YQZA 3VR3A 1VBNA 3MCZA 2WU3A 3QKSA 5DNYB 2XGJA 2NO5A 1CS4C 4J0CA 5GPBA 1WB6A 3OAAD 3PEUA 5G2OA 2IS6A 2PJDA 4TLCA 1U6IA 4OGWA 3K0KA 2Y9MB 3P4UA 3UB4A 4YAKA 3THWA 1X3LA 4LWPA 1KS9A 1PN3A 5HPYB 2WYOA 4DA0A 2NUTA 1AE1A 2W11A 1PR9A 3QFHA 4YJGA 1FFYA 1F2UA 3RGGA 3I9OA 4IILA 2I7DA 4QELA 1KORA 1C50A 4DILA 4TVBA 3U13A 1Z5ZA 3LSYA 1U4SA 3WRWA 3FFXA 3IVCA 4IINA 3W0LB 5KC9A 2V6JA 3ICVA 3IIKA 3KB8A 1CY6A 2I5PO 1YCFA 2WDPA 2X1VA 3ZQUA 2H4HA 3ZDYB 3AEUB 3IV6A 4QUEA 2FOIA 4YJ3B 1CF4A 3H1PA 3KVVA 3JZAA 3SNHA 4FFRA 5EKDA 4ID3A 2Q62A 2WWHA 3PFFA 2CXXA 4UPVA 1NW5A 4LBZA 3HVUA 3UMVA 5CG2A 1T34A 2NZVG 1IZZA 1MKYA 4P7JA 4RBNA 4EB6B 2X0NA 4QQKA 4CEHB 1OGYA 1Z33A 4LTMA 3SPXA 4JSYA 4UMEA 2XMQA 2EGUA 1GAWA 1I30A 2O2HA 2JLYA 1P80A 4Z99A 3SLGA 1Q14A 2DQSA 3IP7A 3TD9A 1OWNA 3DLPX 3F3MA 2NU9B 4EUEA 5K3DA 4Z4HA 1ABBA 1RHRA 5E8RA 1YOVA 2FR8A 3ZWOA 2NYRA 3O4GA 2CLKB 3OJFA 4Q1AA 4M9ZA 5K1ZA 1SA0B 3L02A 2PX6A 4TYPA 3Q11A 4OX9Y 4KV7A 3ZTTA 5G0TA 2YHAA 3FF1A 1ATZA 1E6LA 2OZEA 2RGUA 3DBRA 4NZNA 3TQHA 5AOAA 3KOZA 3QE4A 4AG5A 4TYMA 1A8PA 2B25A 2OPBA 3S4YA 4JYAB 3BQNB 4L9AA 1K6JA 4UE3S 1JHVA 3C6XA 3KR1A 3FCUB 4B75A 1ZOLA 5IU6A 5HOQA 3BMQA 5CCBA 2Q5HA 4G36A 1J39A 5FX2A 1H8ED 1FNDA 4EAQA 1XEXA 5KU7A 5DNAA 3T8YA 4CTKA 2DUWA 3CJTA 4H60A 3RIMA 3IBSA 4Z9FA 2P2SA 3C3YA 3JZDA 1ZZGA 4PVCA 3ZY5A 1FS5A 4TL8A 5CVEA 1L7PA 3ZHBA 5H5JA 1XLWA 2J6BA 2OEPA 5FPYA 1IH8A 3D5TA 1X8JA 1BXRB 1CUDA 2R8OA 1U3TA 5A9TA 5IARA 3T34A 3K1AB 1P4JA 4MR9B 4NEQA 2ISSD 2OHFA 4AMBA 5KX5A 1VG8A 2PR7A 5BYKA 1SHZA 2PT6A 3IH5A 2C7RA 1IPEA 2QX4A 1N77A 3I62A 4KMSA 2ZRJA 3O8LA 3WIBA 3ANXA 2IYSA 2PYDA 3AX6A 2AFVA 4XQEA 1YDMA 5J4HA 2QTAA 3EUFA 2WG2A 1XELA 2R79A 5KOJA 2PLFA 3LUAA 1U0SY 3D6FA 2QORA 1M0WA 4R69A 3HB0A 2XUFA 4RCZA 2XVAA 3L7NA 1IHDA 2RK6A 2EBWA 1V4VA 2ZROA 4RYLA 5AI4A 3SK0A 4EW6A 4I50A 1PJ8A 4KIFA 4NPAA 4TTQA 3BFJA 4X7PA 5CGZA 4MUIA 5K3OA 3HLKA 1P62B 2EZTA 5G41A 2BBWA 4TMZA 4NY1A 1JHDA 2POCA 4Q39A 3VNBA 4G2NA 4J4BA 1J0DA 2BMEA 3KHTA 5CDYA 2V1XA 2YN0A 1W4LA 4H3KB 1QHHA 3VYUB 2XXAA 2B7CA 4U2DA 5DNUA 3O0DA 1PF7E 1ZC4A 2FN3A 3N8GA 5CUQA 1P72A 3EH1A 1EVEA 1AKNA 2DCUA 4FFNA 4F7DA 1ZEJA 1JQKA 3EFOA 5K6AC 2IYNA 4ATNA 3D2LA 3EQ9A 5CM2Z 3OKPA 4B71A 3DP7A 4YJ2B 4YRDA 2CXTA 1LC3A 3RODA 3DC7A 3ET5A 1EAMA 3DAPA 3I45A 4OQZA 4X1KB 4DXDA 5HP4A 5FT9A 4MW7A 1XKQA 2O05A 3TTWA 3KEMA 4BO9A 3K9FC 3RK4A 4BB9A 5FNVF 1DIHA 1HUQA 2QG6A 3P27A 3WTCA 2A6PA 4FEAA 1F17A 1C8KA 3RYIB 4QPCA 3L46A 2H4ZA 1D0IA 3MGGA 4LYFA 2QI9C 4YS6A 1XOIA 4ZIRA 1Z75A 5H1YA 3SE7A 4NH4A 4V0NA 1PVDA 3T3OA 3II6X 3SBEA 4XYBA 2BI7A 1KAGA 3ZKAA 3H5VA 3QELA 1T0HB 4W5OA 1O8BA 1IZ8A 3AZPA 2Z98A 3BIFA 4XFJA 3RRZA 3TZEA 3UB3A 2QYHA 2NP7A 1KJNA 3L0IB 1MO3A 4FYKA 3RG2A 121PA 4V1CB 1PTJA 2IS1A 2AD1A 3G1UA 2AIRA 1IBLB 2GILA 2Q0SA 2ZE7A 2NYVA 1I0ZA 3IB6A 3DWFA 1FVFA 1NQOA 2G8NA 3CINA 3JVUA 3VX3A 3DMTA 1OI3A 2YIJA 1QZXA 4L5BA 1KMMA 5BOVA 4MS3A 2Z2KA 4OMUA 2FZWA 1H23A 2EX4A 3FROA 1AB6A 3LBNA 3NQ41 4ABTA 4B47A 2Y66A 1XK6A 3V1LA 4NOLA 5A9SB 3A9TA 3FAKA 1A9SA 2OBYA 3FD8A 1FY2A 1LI5A 3UOAB 3NEPX 1U0TA 2FPOA 5DHPA 4UC0A 4O4IA 4HS4A 4RZQA 2IV3A 5EQDA 4MEAA 3OT5A 2IHYA 2ZT8A 3MFYA 4H6VA 5CT5A 3TLAA 1D2GA 3QEOA 1FYVA 2GBPA 2MYPA 3CLVA 3EEFA 4U5QA 4Y2GA 5ER6A 1YC2A 5H59A 4D5GA 4KWEA 2GN6A 5DGIA 4IDCA 5EXTA 4Y0NA 5BXQC 1W0CA 2ZYTX 3GZTB 1P2VA 4L73A 2Q6TA 4Y2UA 4BU1A 1E61A 3OY7A 3Q7IA 5JQGB 4UVEA 2DBVO 1JFTA 1NT2A 1RWKA 2B30A 2PUGA 1YL6A 4CQNA 2GBIA 4NU8X 1QMPA 1P29A 2VK4A 5B30A 2HWYA 5FBVB 1L5GB 4KX3A 5EVCA 3LU1A 2IH5A 5HTKA 4ZI7A 1IOWA 1XV5A 1FUKA 4XYLA 4CMEA 3E61A 4KOAA 3BIJA 3EXHB 4NZZA 5AKEA 3V4PB 3OMWA 3L40A 1T10A 3M33A 2Z08A 2ZIUB 3L4SO 3UK1A 1Q2UA 2DGDA 3NIWA 4UOQA 1WB4A 3DD1A 1ODSA 2GA9A 1NWCA 4IBOA 2MDTA 4D3SA 1X7XA 4LSZA 2A67A 3UNXA 4OM8A 2B2CA 1BRMA 2EJWA 2AOUB 5TJHA 3BBLA 4MR8B 2A57A 3F6EX 4F6RA 5JZMA 4X54A 1F4PA 3R0IA 3CZ4A 5F3DA 2ZRNA 1CZUA 1ZQ9A 3FZEA 3QW2A 4KKXB 3CPSA 4ZVUA 3EYWA 4DWWA 2FZKA 2I7TA 4JAVC 4PZ9A 5ELLA 5TS3A 2LV8A 5TVKA 5T64A 1XQYA 3RTEA 4F8JA 5CCEA 1KTVA 2EDCA 4FEEA 5F5XA 3WBKA 4ZQFA 1JJ7A 4FNAA 2HZBA 2O3JA 2WILA 2R7MA 1E6MA 3DXZA 2VHEA 5CVUA 5JWHA 2QBYB 3TGPA 3NBXX 3F7TA 3ZGOA 3DAGA 6Q21A 3V00A 1ZHOA 2A7QA 2WF5A 4XWKA 3GQBB 3PVZA 3L7YA 2WQ7A 1P60A 1QOPB 1QM5A 3PT9A 2ZUWA 2DUNA 2AEEA 2IXBA 1EWTA 3NPAA 3OOWA 3SIXA 1SZDA 2NYUA 1QH8B 3ZI7A 2WF8A 5E7JA 5LLDA 5KYTA 2VZ8A 3ZWPA 5EHGA 4LXGA 1U2RA 5I7UA 1GPYA 1GTVA 2C8LA 4OVKA 1F14A 4Q7EA 3WLJA 4EVRA 2Z3WA 4US0R 1T5HX 4AJ2A 4E1AA 2AMLA 4FUTA 1Z6XA 2X4IA 1ZI9A 2Y0BA 3BS4A 5TJ9A 3U4MA 3ETLA 1L9KA 2NO9A 1IY0A 3HY3A 5K3EA 2COEA 1IY8A 1GP2A 4M9XA 1M1XB 1JHMA 1M1NA 2QAGA 3NW9A 1SXGA 2PH3A 3MUOA 3ABSB 2NXJA 3BGDA 2JVKA 3OFVA 3GRZA 4QHYA 4QPJC 2EXXA 3VBEA 4LE0A 3W7AA 4D82A 4DR7B 2VHZA 3EH2A 3NALA 2G5TA 3A3NA 5AKHA 4DY4A 1JWBB 1CS0B 4P81A 1THTA 2PXAA 1OAAA 2FW6A 2QV7A 1HMYA 1OT5A 3QITA 4GKVA 5DE3A 3TO5A 4D8XA 1GUBA 1X92A 3K5WA 4MCAA 5K3AA 2O07A 3I04M 4ZT7A 4E94A 5CD1A 3BULA 1FW8A 1TQ4A 3E3NA 4KG7A 2AR7A 1RLTA 3UJ9A 2RHHA 4MR7B 3WIDA 3W5BA 4HX2A 1HRKA 1CJUC 3MWYW 3ACCA 4DSZA 2H5LA 7REQA 1EUQA 4U6NA 4YBZA 3IJ5A 4HAYA 1WSAA 1V11A 4KFSA 2O8NA 3VR0A 1IOZA 3JAMA 2FNAA 1F06A 1NYTA 4GYYA 3UA3A 4KO4S 3VOAA 1S7GA 4TKMA 2FQXA 1QNLA 2F1OA 5EE3A 3A6ZA 5JBIA 4ID9A 3FOCA 5DNWA 1FMCA 2OLJA 2HNKA 3EA5A 1K92A 3BHJA 3U62A 3VFDA 3ZY6A 4AUMA 3DDSA 3QBDA 4OOEA 2ZTUA 4LMRA 5CNMA 3WYCA 3WKDA 4D4GA 4DMUB 1CT9A 2FZ5A 5CB4F 5I7SA 4DV1B 3OUUA 5CK4A 2NSHA 1VJ0A 3DDZX 3T9FA 1S2MA 2HBQA 1DRWA 4Z7JA 1FMFA 1PBTA 2IGTA 4BFSA 3TZLA 1E99A 4QJIA 5U4XA 1PWHA 2AHOA 4NDNE 1FP4B 1SU7A 5IJ0A 2YWJA 4DUGD 2QT0A 4UQOA 4KODA 1XRNA 3MSXA 4J1TA 4AF8A 1J0CA 1PQ4A 2PUWA 2XMPA 4GGPA 1C3EA 1GQSA 4HO1X 5DX8A 4HRYA 3TW0A 3V7FA 4UQLA 1MW9X 2O54A 1ODJA 2O8VA 3DHYA 2IYOA 4INAA 2JFPA 3PPIA 4QUKA 2CF5A 5DXAA 4ZYWA 5DI3A 2I4RA 3KCQA 4PZCA 2FFJA 3OPQA 2HMUA 4EI7A 1GEGA 4HAOA 4X63A 2LP4Y 1D4OA 5GM2A 1EUCB 4B3FX 4QUIA 1EZ1A 3GHHA 2VUIB 4DT1A 3JQQA 2GCIA 2MSCB 2R8RA 1DELA 5ALTA 2GM5A 5BP7A 1WB9A 2AVNA 2LIPA 3MCVA 1IPFA 4EJSA 1AGXA 2WJZB 3IKMB 1R0LA 1SOMA 1AN9A 5TMPA 1UBEA 5AP9A 5IWCA 3ZVKA 1CYEA 4LKRA 4RDCA 4NU6A 2W98A 4EVQA 2BSQA 2UZAA 3WGKA 4BJ1A 1KZ6A 2OXRA 3RRJA 2QE7D 5BSEA 3RWMB 5JD5A 1FP2A 1TO2E 1MT3A 3ZGNA 1GARA 3B5IA 4ZOBA 4I9HA 2P3LA 3QLEA 5EIXA 1PR4A 3NKLA 5HIKA 1DQRA 2XNDA 1ES9A 3VOBA 4OLJA 1RXUA 3THYB 1Z28A 2UYCA 1ACLA 1XF9A 3TZ6A 3ZS8A 2FSUA 1JHYA 1EE2A 3DOCA 5DHUA 3PGJA 4O4LF 4UDYX 4FJ2A 5IK2A 3JSAA 3BTOA 1E1YA 2DECA 2FWMX 3Q8MA 2HY7A 1KJYA 2NU6A 3EPRA 9GPBA 1KEKA 4PZPA 3C45A 3MWKA 2RHTA 2ZS8A 1G41A 3A6FA 3WGVA 1LJUA 4TYWA 1NOKA 2Q5FA 3W3AA 4Q9LA 3ZI4A 4RXUA 2C5LA 4ZN6A 5E6SB 1V5FA 2O2DA 1RZRA 1LPNA 3TL6A 1T2FA 1Z4IA 1HYHA 3WOVA 4D9GA 1PS0A 3W8DA 2XJ4A 3CJQA 1L7AA 3L6BA 4L51A 5K8UA 1G66A 1BXZA 1C7ZA 1QKJA 1BQ3A 4AN0A 1U04A 3GGJA 2JD0A 3CEHA 1TB4A 1HWYA 2NP6A 2ZBPA 2XTAA 1GPKA 3EXG2 1C7RA 4BU0A 1ISPA 3ADOA 3VR5A 3FI9A 3S5JA 2PSEA 3QLVC 2GCOA 3MUFA 3WMGA 1NW8A 3HDGA 1KNQA 2ERXA 1N2CE 1E8DA 1TA9A 3VSEA 2YY5A 1EK0A 4OBWA 3EF3A 3VSCA 1A8SA 4MI1A 4M8KA 1DOHA 2IZ6A 4TMFA 3COJA 2J5KA 3IQDB 3KZNA 4N18A 3JQ7A 1PWEA 3W5AA 3MOIA 3S44A 3WRYC 1F6WA 2ZYAA 5K0GA 4NENA 5EQFA 5JYBA 3EAFA 4XB6B 1PWZA 4EY7A 1IXRC 1JKJA 3DXXA 2P6OA 3DMNA 4PO9A 4TL7A 5AR1A 4YRRA 4IVQA 1U0OC 3RBZA 2P1ZA 3K2QA 3RUAA 3V8NA 4BN0A 2R62A 5SZHB 1W88A 1BKSB 2J4CA 3D7KA 4DLTA 1TTPB 4Y9DA 3A2NA 4A8JC 1OLUB 5A4KA 1SAYA 5LP6B 4S1OA 1ZJ4A 3EE6A 3SDZA 1SD1A 3VPAA 1X1DA 4K03A 4P3YA 2PJZA 3NGLA 5U9CA 2CXRA 5A3SA 5ILQA 3EZNA 2J9FA 2AUTA 2WJPA 4R98A 5AQ1A 5DM60 3OOSA 1KH1A 5CBKA 1KFEB 3QU5A 5D86A 3QMWA 2DPMA 3OICA 3DKIA 3F6SA 4BATA 1SQSA 3AR5A 3L8FA 4BX0A 3HSYA 4HDKB 1VKJA 2I4TA 2QRQA 4P54A 4ZTBA 2ZIAA 4KXFB 2VNKA 3O9VA 1QH1B 1ZCBA 1SBIA 2VR1A 2ZSFA 3KLPX 3MWJA 4B43A 4BX8A 1LRKA 2WIBA 2KX7A 3A3KA 3HJNA 1OH7A 2FW8A 3KHKA 4N39A 4GM0A 1R6DA 2NTNA 4HDQB 4DIMA 1N4DA 2EDAA 4E2WA 1G4UR 3EGXB 4M76B 4OH7A 1JUDA 5KJCA 1VZ2A 4GBED 1M1YB 5TPZA 3B36A 2DFKB 1NN0A 3T1QA 3U3MA 2PT7A 5KJ1A 1MZVA 2BGMA 2P5UA 4B7CA 3F6RA 3ONDA 2E82A 1NU8A 1NE7A 9LDBA 1Q0LA 1YZ3A 1N0VC 1K86A 4QTTB 4LJ9A 1QGDA 3I2GA 3HDTA 4ZAYA 1WVMA 3UVEA 2BGRA 1BGXT 5DGCA 1E2GA 1JLLB 2CXOA 1ZNQO 2HR1A 4Q47A 3VYRB 4BWYA 4ZV4A 5JXIA 1NDHA 1GXSB 1T4CB 3TCNA 3BD8A 1WR8A 5C46F 4X0EA 5GGYA 2JGFA 4TQ9A 3C3DA 3SBXA 3ZGZA 5GIOE 4OHKA 1Y5RA 4D3DA 2WE7A 1Z82A 4CN9A 1AZWA 1NVMB 4M99A 3OCVA 1UINA 3BXFA 1Y5MA 4P83A 5T3UA 2V7UA 1B2LA 3H5WA 1S3GA 1QGOA 5ALVA 2F17A 4OYYA 1QU3A 2YZ7A 1OMOA 1WB5A 3O74A 5DFAA 2W6ID 3COWA 2BISA 3SQDA 2HU2A 2LDXA 1QF9A 2P6PA 3HPQA 4LNAA 3I9KA 4PZUA 4DSUA 1LK0A 4EG7A 1Q1QA 2WPDA 5BW4A 1YS6A 1UOQA 5JANA 1PZNA 3LPMA 4UEOA 5LP1A 1ZSVA 2A9KA 2FZ4A 1MIOB 2P62A 1CIJA 2WD9A 3HXTA 3C74A 4LYJA 3SHFA 1MX3A 5KIAA 5LYJB 3A6HA 1U3FA 1OLXA 2I76A 3DLAA 4DS3A 2UUAB 3ESAA 2VOJA 3SKYA 3A1EA 5J2TF 1J8FA 5KNBH 2G5CA 2YYZA 3GEBA 2OBNA 4WL0A 3VU0A 3G5UA 2XTMA 4H77A 4IEEA 1CP2A 3VC1A 3FYUB 1RE1A 1RQ7A 2JAUA 1U1FA 3UJ6A 4EPRA 3WK6A 1ZA2A 3NEYA 4DIDA 1OU0A 1GKYA 2DX7A 2EQBA 2ZRBA 3SMVA 4BO6A 3CIOA 1EX7A 1AKRA 2FPGA 2JCYA 3DTVA 2WAYA 3DE0X 2VYCA 3D0RA 2HIAA 1ZXBA 5L7YA 3A2KA 2VPXA 4HH1A 3I72A 4OQLA 1H5UA 4V0MA 1EESA 4F9EA 2HB6A 3CUUA 1FX0B 2CXHA 3L7DA 3FVWA 3SX0A 3DO8A 3ESRA 3DL4A 1YB5A 3B6ZA 5CLGA 3TBFA 2E4WA 3AF1A 3GLUA 1WXEA 1HL7A 2V7BA 3RJZA 9LDTA 1DTWB 3FKSD 3FCEA 4RIFA 5T57A 4KXMA 5BSTA 4LV5B 4UD6A 1W94A 1JAXA 1PK7A 5FWYB 1CETA 3SQNA 5F76A 3UBTA 2JZNA 3MWGA 4YAEA 3OM9A 3ZCQA 1B0AA 4INOA 2O2XA 3JY6A 4B74A 5KSPA 1ZD3A 5AI8A 3LZ6A 2IJGX 1MN6A 4F12A 3AKDA 1LBQA 2O8DA 2AF3C 3KM0A 4JOCA 3BXZA 1VBKA 1X1EA 2PUTA 2QR2A 1Y8QB 1R6UA 4FCVA 2Q9UA 3BUSA 3PA6A 5A3JA 2RB5A 5DBIA 4F8YA 2NZ8A 4DYDA 2O48X 3SZRA 4F6CA 1T8RA 3GJ5A 2MJLA 4HLCA 4GMGA 3VJKA 1OJLA 1RYMA 3OEHD 4EA6A 5JCJD 3ND6A 2WU0A 1DC3A 3J81k 2DOKA 3PT5A 3OZSA 1JEQB 4L07A 5ULLA 2AH5A 3E58A 4UUOA 2DFVA 3PIRA 3G5AA 4ZXPA 4QGFA 4WCFC 1MPTA 5JJIA 3D6MA 1WXWA 1M0EA 1N32B 4R2JA 2V54A 1I3MA 1R8JA 2NU7A 1CRZA 3CIFA 1OXUA 2K2WA 2XOXA 1C0KA 1XJWA 4BBAA 1VA4A 4OFBA 4ES6A 4MJLA 4ZPJA 1F60A 2WU8A 1WABA 3IAFA 3LVRE 1NRWA 1JT2A 3DH0A 2Y76A 3RFTA 1RVV1 4KR3A 4Z53A 5C0OE 4M8NE 3RHFA 4MEBA 1DKOA 2KJQA 2XIJA 1YO6A 3C5WP 4J03A 4L15A 1L5FA 2CB0A 1QV9A 1DAPA 3CE6A 3M1YA 1G3IA 2GRAA 2HV9A 3JARA 2I87A 3KU1A 5DW3A 3GP3A 3A06A 1KKUA 4QYWA 1UF9A 2XF2A 4D3FA 3OZXA 3Q3CA 5A05A 3TW8B 2YIVX 2C7GA 1I7PA 3FDZB 4K2AA 3H05A 4GMDA 1YA4A 3NLLA 1OBFO 1HFWA 1P0CA 3LCVB 1ZGGA 2Q5JA 5J40A 3ZJ5A 3BGVA 4XIYA 3FRIA 4GC9A 4GOND 3U44A 2AQHA 2X9LA 3BZWA 1KVRA 3DW1X 3ORYA 5HK8A 3R4VA 4BLOA 5C4MA 1RABA 2JI7A 1ZCJA 4MS1A 3SYTA 5JJBA 2HM7A 1Y3DE 1TU0A 1ZBDA 1KR2A 3PYXA 3GLFE 1ULHA 4M9SA 1BKDR 4LZNA 1G98A 5EXDA 2FR1A 2ZCUA 1BMFD 2X22A 5MN6A 3F5SA 2GAIA 2ZITA 3DLIA 3CU5A 5AM4A 4Y1GA 4ZVQA 1JDVA 2PQMA 1Z26A 2VDVE 1R1DA 2O7RA 3HBNA 4MMYB 1CUAA 1LLDA 4BDSA 4EQ6B 1E66A 2C03A 5KNDD 3USCS 4IMPA 5BR1A 1RYNA 3M6IA 4JFRA 3IQHX 1SELA 4F9FA 1RLIA 2RKWA 2PYZA 3MAAC 4A92A 2FEXA 3H2SA 4OQ4A 4G5RA 3AESA 4D8UA 2WKSA 3I42A 5LZ9A 3IUSA 4A8TA 1K0FA 3QLJA 3EULA 1R4ZA 1EXWA 2HRCA 3OQJA 4JS0A 1RQXA 3JX9A 3CY6A 3JD3A 4LHXA 4RAOA 5ADHA 1ODIA 1H05A 1SKUA 2YFHA 3ELDA 4RVUA 3D54D 2AJLI 1W0KA 3HUTA 4JYPA 2WNHA 3KAJA 3Q9NA 4BBPA 2VJKA 3N75A 4J0KA 4UM8B 5HR5A 4RL6A 2MSLA 2W8BA 1X42A 2ZPUA 4JLKA 4TX1A 3WLEA 1HORA 2Y92A 1K08A 1MENA 3E8XA 4MLPA 3VR3D 4B82A 1UJ5A 1G6KA 2FWIA 8MHTA 1QHNA 1CUIA 1L7RA 2YBEA 4L2IB 4PEVA 1WLYA 3GBVA 5ALNA 2WYIA 1WZNA 5IF3A 1ZSNA 1QZZA 1FRZA 2ATVA 3FJYA 1TA4A 3LDFA 5TR9A 4U7DA 3GDFA 4FGLA 1ESCA 2QLNA 5AKLA 1F3LA 1O6GA 4M83A 1PG2A 4IEFB 4AMUA 2HIGA 3A1SA 1HETA 4HQOA 4IJMA 4MGZR 2V8BA 1YU6A 2ZGVA 3P0JA 5F33A 1UPCA 2QROA 3BE5A 3T5PA 2JJMA 1PFUA 1EHCA 1K7SN 2BV3A 5K3CA 4LN1A 1XDUA 1H9CA 2V3VA 4C0AC 1XMIA 4BJ5A 3ZWXA 3GLSA 5FUMA 1BROA 2R7AA 3IP5A 4R01A 5IBPA 1K7EB 3MWDA 3NC4A 3FNGA 1FQKA 1NKVA 2PL9A 3IBTA 4I55A 4OHVA 5H82A 4DRZA 2VKTA 2XEXA 3CKKA 3KVYA 1HT3A 4YUVA 4B2PA 4Z2AA 5JNLA 5DHAA 2H1LA 3V80A 2LKCA 2C0QA 4ND8B 3PX2A 4J43A 3WJ2A 4RQUA 2YFQA 4RXMA 3LW8A 1I2BA 1R7RA 5DYIA 4HNVA 4N82A 2NUPB 5T4EA 4C1NA 1YRLA 2WWWA 3F3YA 1QP7A 1BFUA 1BN7A 1HDCA 2HA3A 2FPMA 2PMDA 1Z17A 2O0HA 1HDRA 5KYUB 4C7OA 4XVCA 1W19A 3OP1A 4H1UA 4LF8B 3I2IA 3RS4A 1SURA 3QKIA 2PUAA 2XVYA 4X7RA 4KFTA 4N49A 4RTOA 2REQA 2Z6UA 1Z5VA 1TC1A 1KZ9A 3G2PA 3ZGLA 2NO7A 4EUHA 3DBLB 2B2NA 4OUDA 1RRGA 5C4IA 1G60A 1GGEA 3T52A 1DCFA 1E3IA 1UP6A 2PSJA 4O1IA 4Q9JA 3PNVA 4E12A 2Q29A 3DBIA 1O5IA 2CYAA 1AH2A 4JNKA 2V1UA 4PONA 4MIEA 2QVYX 2Y3IA 4UCQA 4EFLA 1FFCA 3GUCA 4BLPA 1K7CA 3DM9B 4MQEB 4B1FA 3DVAB 4AUEA 4NNJA 4A1FA 2E4YA 2O1XA 1E94E 2R86A 4BVAA 3WNBA 4E7OA 2R8EA 1IY9A 5L6MB 4AKIA 4Q9KA 2PL3A 2VUTA 2Z1DA 3DCIA 1SCUA 3IEPA 3IMGA 4TV9A 5EP4A 2J3DA 2AZXA 1I4OA 2C42A 2WTMA 4UCWA 3LPDA 2I1LA 4BIIA 2BP7A 2H2IA 1EZZA 4IIGA 5CTAA 5CB8A 1E0AA 2E89A 1V45E 4ZDIA 1GPDG 2GXSA 2C04A 2GZAA 3QWIA 5EZYA 3TCXB 4KR6A 3K2BA 4HH3C 1J0EA 1E63A 1FNMA 4WX2B 1MQ8B 5HOEA 1UC9A 4QRDA 5FYQA 2BGWA 4MUMA 4WTOA 4RM2A 2PBZA 3DLBA 4BQRA 5K2MA 4FYPA 2H1WA 4YIHA 5LDDC 2PAAA 3H19A 2ZB7A 2ZDQA 2EATA 3MT0A 2D1SA 4RCYA 5IVPA 1R0YA 5K0FA 2GKGA 4YAJA 1OFVA 1U7HA 3NP7A 4B9AA 1CU1A 2NSJA 3A0UA 1NMXA 4MW2A 3ICCA 3PNSA 2WR8A 4PRKA 3UJ8A 1DI0A 1XRMA 2BWJA 2N46A 4IOJA 4MQUA 5KTTA 1C1DA 2F8SA 1ID8A 2XITA 1NVEA 3AEQB 4AWAA 1JEOA 4A10A 3ZHQA 2GJ4A 3LE8A 2X4DA 4D92A 1SQFA 4AECA 3ZX5A 5HQ3A 2R0QC 1J4AA 4L0MA 1K4YA 4QM6A 1E0DA 3MIIA 4CDMA 4YA6A 1O6BA 1M6NA 3UXYA 1RQGA 2HLDD 4PG6A 3P9XA 1AQLA 3HSKA 2WG1A 4XSGA 4C4AA 3X3HA 4D26A 1XTRA 1HM5A 2FRXA 2MINA 2PQ6A 5INTA 4LRUA 3D0KA 3W2FA 1M1ZA 5MDHA 3OFKA 5CCDA 3R3ZA 3IODA 4R1UA 2RJNA 2GN2A 3OM1A 4ZC8A 3WISA 2K7FA 1S7CA 1AQ6A 1QS0A 3CRW1 3NBKA 3D4NA 2JAHA 1PJ4A 3T1TA 3ILHA 2R47A 2B35A 2WD8A 1KQOA 4DIFA 4EY5A 3PE3A 4NECA 1T36B 4YJFA 3A6KA 1SEPA 2IOFK 4H4DA 2ZYDA 4LXIA 4HUJA 4L8YA 5BRAA 1NBWB 3L6OO 1A3CA 3N53A 3K70D 4NG5A 2CBXA 3UC9A 3K32A 4E4RA 5LFAA 3A2LA 5AICA 3T3MB 4G81A 1L4MA 1BVYF 2XIQA 3VNQA 2EC5A 4BKMA 4ONEA 4DIEA 4RKWA 4JJ6A 4L0CA 4M1KA 1Q1ZA 3RSSA 4LNUA 1P77A 4Q1VA 4CJXA 1GKKA 2E6UX 4MHOA 1ZICA 5JYCA 5IPFA 4Q1BA 4OLFA 1MGPA 1QIKA 3V48A 4DJFC 3NHLA 1K8QA 3DVLA 1XZJA 4I9NA 2I65A 4LDZA 4RA6A 2PKXA 4YH1A 2C4KA 2HGZA 4YT2A 4URUR 2HJ9A 2F4VB 3IDFA 3RRYA 3SZGA 4AJIA 4F5EA 2VT7A 1YC5A 5DWVA 3UTCA 2XB6A 5B53A 1G6Q1 3OJXA 4DTIA 1ONNA 2AW5A 1C7QA 1U99A 5LSAA 3QTBA 3LM8A 1X39A 4RFLA 2ODTX 3A1NA 3L84A 4JEIA 1ZH8A 2IE0A 1HT2E 3IIMA 1KOJA 4OA5A 2GEKA 4I1YA 1QRRA 4KXQA 2H2HA 3S5UA 1JLSA 2Q9BA 3DD5A 1XHEA 3X1KA 4DLKA 8LDHA 2D4AA 3HVJA 1Q74A 2E5FA 4YDSA 2BBOA 4J8PA 1IB6A 1T8WA 1ZM7A 1FS6A 2GDZA 2LPMA 3GRKA 3NBQA 4JD5A 3DFMA 5CLFA 4QLBA 1A1VA 4RLFA 4BAZA 5IKEA 1W2GA 1W48A 1XCGB 2Y1KA 4EHNA 4OM7A 1A2QA 2Z4TA 1C1YA 2FCAA 3K8YA 5AJHA 4C2AA 1U2ZA 2LRHA 1CCWA 1ICEA 4RD3A 3PUYA 2BDTA 5HFNA 3F3KA 3MW8A 3SDBA 3WHPA 5IUNC 4S2EA 3KPJA 3OM0A 3RARA 4YAUA 1I4LD 1UXGA 2C8VA 2CJWB 2IUFA 2WAAA 3HVKA 4RSMA 5EJIA 3TQRA 4PXSA 5K01A 3U7FB 4QDUA 4YECA 1CULC 1CDEA 4M2LA 3RSOA 5KNLA 3OJ0A 1Z37A 3WYNA 3L41A 4ZAZA 3KKLA 2IYVA 3HJUA 3UYLA 3U7IA 4BZZA 3F78A 3TZHA 1G6HA 3ITDA 4DMHA 5GMOA 5H3CA 4YY3B 4S1NA 1CD5A 3K9QO 3OY2A 4C4YA 1VYHA 2O5RA 1O0BA 4C6TA 3ZCRA 2I8CA 3GGGA 4I4TB 1H9BA 3OX4A 3VTZA 2UYQA 1X7YB 4PNZA 1RHJA 4UATA 5SICE 1BU5A 1FLNA 4CR7A 1BWRA 3TUZC 2PNFA 3F6BX 1PLJA 4F3YA 4M22A 1N3YA 4WY8A 3PQFA 1KY2A 2H2AA 2H1FA 2WHEA 2X4LA 5AD1A 3FYDA 1WCIA 3G1TA 4TSKA 3M81A 3ZDBA 1ESNA 2AWOA 1CNMA 1IE3A 3IHLA 3ZHOA 5ADUS 3OD5A 1P6UA 4KPFC 5AJYA 1PWYE 1R12A 1XZHA 2VL7A 3AJDA 4HB4A 1D2MA 1USGA 4K9MA 4Q1CA 3RNOA 3USZA 5BQ3A 3U61B 1PNQA 4LHEA 1AIPA 4TXJA 5EC8A 1OFUX 4OJNA 1XX6A 3DA8A 4YCSA 4LV8B 1QXSA 5I9LA 1UXHA 1SPBS 1FVHA 4BQSA 2Z3VA 5D3QA 1J25A 4YYZA 2H8KA 4ZCIA 1QBGA 1ICIA 3HWSA 4CM5A 3I61A 2IODA 1E6WA 1NUQA 4DSTA 4ZEMA 4LGVA 3TSAA 1SB8A 3LHFA 3BAZA 4EGAA 5KWEA 1EJ6A 5F9FA 1AQJA 4MROA 1U0RA 2J87A 3P9ZA 4NBSA 1P1BA 4Z0PA 3SZMA 3CNLA 3KJNA 2WSSD 5ALPA 3WRVA 4N76A 4RS3A 4B7XA 5E6RA 1TVCA 4X1KA 4CCAA 1V25A 2DMRA 4E5UA 1TGYA 4HNHA 4WZ6A 4OLHA 3UQYS 4COKA 4TS3A 4ER7A 1C29B 4GR5A 5JV5A 5T5QA 1XFDA 2JRLA 2DQKA 4HNQA 3D4IA 2ZI5A 3AT1A 2R4QA 4J0JA 2V5UA 1NL3A 3DHEA 5JFGA 4F4JA 4UU0A 5AVKA 3PENA 5GWXA 1BQEA 3EWAA 3LS2A 1C3XA 2JASA 3G5MA 2O8FA 5P8WA 1R4NA 1UBGA 5CXSA 5JE8A 1Y8RA 2HCBA 3C3PA 4R8SA 1CR0A 2C20A 4W7SA 4CKXA 4E5YA 3GT4A 3U3DA 1XJ0A 2ZVQX 5AHKA 3LCJA 4MGIR 3GEMA 3TRDA 2ZJBA 4B8ZA 5B3KA 2ZIXB 3ELBA 4MUJA 3DMYA 3LHKA 2OXTA 2C2WA 1ZA1A 3G2KA 5AVVA 5TQ2B 1ZAYA 1MDFA 1WEKA 5ETJA 1GPMA 5SYAA 2O50A 2FSPA 4P86A 4K6CA 2YWBA 5LZ2A 4JA2A 2PGDA 3TSYA 3HU2A 7MHTA 1H42A 4AVYA 3L4BC 4L4XA 5ESWA 1FTGA 4ZMRA 4CIXA 3RS3A 2Y99A 3ES9A 4U9UA 3R5XA 3H2JA 2FQWA 5E9QA 1SXJD 4ZTZB 1XRRA 3S28A 1EVZA 2FW1A 3MGKA 3UJCA 1R8QA 1ZNXA 3LWDA 1MZPA 3I01A 4M86A 2FHSA 3DR5A 4TSFA 5DLEA 1CR2A 1AKVA 3IDSA 1EDOA 4OP3A 4BNDA 4UFPA 5HKAA 1UDWA 1BH6A 2VTBB 1X80A 2C0PA 4H08A 2QNBA 1X7DA 4IOMA 4P1ZA 4HWSA 1MJNA 3UXHA 1QGZA 3B6EA 1WSDA 2ZE6A 3BHMA 5ALXA 3OPVA 2QP9X 1KRWA 3GGSA 2WLSA 5BMVA 3F9IA 5EUQB 1QPZA 1VHJA 1IQRA 4NQZA 1DE0A 1A04A 1P4GA 1VYUA 4GQAA 4EJ6A 1LWOA 1R5NA 3S1LA 4US2R 2VDLB 2FX2A 2R4TA 3ORHA 2VP3A 1JHZA 2XA9A 3AJEA 1IZYA 3LBYA 1E3SA 1F8YA 3SM3A 4B44A 4PW0A 4U39A 2YWFA 4X41A 2C59A 1PSZA 4LCBA 1EP1B 3GCGA 5KAPA 1X86B 1DS6A 3R77A 3F7NA 4DJDC 5I7FA 1E3MA 2Y67A 1WX1A 2IXFA 2WU4A 2JA1A 4V0KA 2UZ4A 4JK3A 5KC8A 1JILA 3QBVA 1C30A 2GPJA 3QLTA 2B3TA 3FVTA 1K8ZB 2RD2A 4IIEA 2CDNA 2W4MA 1L1FA 1J5XA 1GV0A 3NONA 1MVOA 1H2RS 1UL1X 1WMFA 4YTEA 3WV5A 2HPVA 4J6FA 3ZZ0A 4LXXA 1Z47A 2UVQA 5AXBA 1XYVA 1GYPA 1YE8A 4I50F 1IMOA 3QQ5A 3BMCA 5FPKA 3ORRA 4MR8A 4W7HA 2X2OA 4AJHA 4L3OA 6GPBA 4YXWA 1FCJA 5IK2D 4FW8A 5FBWB 1LFAA 1RACA 2YV2A 5H7XA 4KE6A 1J70A 1GN8A 1YKSA 2RAFA 4ZVKA 1S01A 1WD5A 2PZKA 2O57A 2VJLA 1JAYA 1U2EA 1QAQA 1PGJA 3L0BA 4KKVA 5JNWA 3QEMA 1JDTA 5KMGA 1F2TB 3IIIA 3HBLA 3W3AD 3OF2A 2QAIA 5TQJA 2CDBA 1OXXK 1SC3A 2ZVDA 3FY4A 3K0EA 3M49A 5JCOC 4YCJA 1GKUB 5B1IA 3GEEA 1UT8A 1U3GA 4PVDA 1YQQA 3K96A 2TSYB 2DTDA 3I9NA 4Q24A 4GP6A 1AKMA 1PGQA 4YHHB 1A71A 1H65A 2H17A 4HSGA 2YKGA 2ZEJA 4N4AA 1VKNA 3DXYA 3GYBA 3PKZA 2O2YA 5FUWA 5JVDA 5B3JA 3VKFA 1FFBA 1Z63A 4Z8XA 2PL1A 5CAEB 3HB4X 3K1YA 2MTBA 4MNTA 3RFUA 3JWGA 3VR5D 4BQNA 3G88A 4BTEA 5A5FA 3SVTA 4OATA 4LPKA 4YI5A 3ZLVA 2R66A 3SZ3A 2C4WA 2FJPA 3ICQB 2YHUA 3PV0A 2X6TA 4IS3A 2ZJ4A 1R3DA 5F5NA 3IOBA 3EVBA 4MVXA 4C29A 5LJLA 5FDFA 1O1YA 5FPHA 5J4LA 5B7QA 1QKIA 3BXEA 5SY9A 3I28A 5BQPA 3W2EA 5CLJA 4XVRA 3K15A 4GYJA 3NHUA 1HZZA 4KH1A 3OEEA 4J7UA 3TRHA 4KE9A 1JMVA 1H9AA 2O2CA 5CX1A 3KB1A 3LXMA 5DMHA 4E1BA 1FU7A 4UTPA 4JYZA 1XN4A 2GEBA 1OIWA 1VPEA 2QLLA 1U7ZA 2YRXA 3LUCA 4NFYA 5MN4A 4CLOA 4DV3B 1FTQA 1EK2A 4TOIA 4RZ3A 1ZI8A 1VIDA 4BYMA 3D3KA 3UIEA 5L3SB 4ZKDA 2QQ5A 3SF8A 5HF9A 1T2NA 1L4BA 1TVMA 2CVZA 2REBA 2Z5GA 3SZLA 4YJKA 2BGTA 2DY0A 4GKAA 5C8XA 1XZNA 2EV9A 1VDZA 2EL7A 3B6JA 4H7HA 1NQUA 3WL6A 2GDJA 2ZREA 1S6YA 1PJTA 3L8DA 4FDLA 3OTOB 1ULTA 2HJVA 1G7SA 2OV4A 2QJRA 1UIMA 5AFSA 1GY8A 3HWRA 4M1ZA 2GEFA 4ZVNA 3NHSA 4PQFA 3WIVA 5DCUA 1SCJA 4DZRA 1USUA 1XZ8A 3EG5A 3S1SA 5AXAA 1EG2A 1ECFA 2UVPA 4UPDA 2QMHA 3P2OA 2ZAIA 5IT9A 2Z2JA 3HE3A 2CL5A 3AI1A 4X24A 1V26A 3T5TA 5K0BA 3BWEA 4XPZA 5MF6A 1QP8A 1V3UA 3BWCA 3PI6A 4LGMA 4MQMA 4PAMA 1NQAO 3ZNNA 3D6VA 3GVHA 2BFCB 4WIAA 2H07A 4WUVA 5JD6A 4WLOA 4JT9A 5DT2A 3S8YA 1VHDA 1UUFA 4LMPA 4DB2A 3DFKA 5FXMA 1RZUA 4HLDA 1UMCB 3BIXA 2V4ZA 3LLUA 1MXFA 3LKVA 4IAOA 4ZT5A 3FTCA 3N6XA 3T1OA 4KQHA 5FA6A 4WJZA 4X97A 4C3ZA 3U26A 4H0FA 1YB1A 1AQIA 4XYGA 3FLBA 2QSZA 1JA0A 2GR9A 1JSXA 4B40A 3T5GA 1YDHA 3OQPA 4BL5A 5JNTA 1KVTA 3D0OA 2OFXA 2VJAA 1P31A 3IVXA 1LI7A 1GQRA 2DBZA 4JJ4A 4TM8A 4EGFA 3GVXA 2QX8A 2H7CA 1B0ZA 4P2GA 3JQBA 4EDFA 3ZV6A 4RJKA 3IYLW 3GV0A 1OKKA 4RTMA 2HYDA 5FOTA 3GOQA 4FYYA 1J07A 2ECQA 5E95A 3SLRA 4MS4B 3SC2A 2ZSBA 3A28A 4IH1A 5H3LA 2YHBA 1U80A 1KO4A 3SCZA 1UCFA 4O08A 4K3UA 4DSOA 3MGBA 5EIFA 1S5PA 3CH4B 4OOFA 2XNHA 3NBUA 4PO3X 5DCLA 4BO2A 4F3CA 1ZW6A 1XTPA 2WPDD 1FIUA 1KDRA 3K5IA 3C3CA 3SVZA 3COVA 3KJGA 2HDOA 2A1IA 4OHZA 2YNMA 1Q12A 3QPCA 1U5BB 1JMYA 1NRIA 4V1CI 3PFKA 3F74A 4EABA 4EEKA 3EXHC 1EFAA 4OP1A 4X61A 2PJRA 4GRAA 2XYHA 4L16A 4RH3A 1CHNA 1JDPA 2R5WA 4K26A 2QVCA 2A92A 4B6FA 1S2IA 1SXQA 5JDIA 2NUBA 4YV1A 5JZ9A 2D54A 3TI9A 4DQVA 5K0NA 1JHRA 1LLQA 4QA9A 3ADCA 1UJCA 1RRVA 2WJGA 2NACA 3B70A 2I1VB 4LI0A 5ES3A 4EZBA 1ORWA 3DTVD 3FOEC 3T1NA 2EBHX 4OG2A 4PO8A 1GZ6A 5F9MA 3OUZA 4ENSA 1IXYA 3PRYA 2VDMB 4UHDA 3H11B 1SC1A 1T3LA 2GF0A 3A1FA 3WIEA 2QL9A 4LBWA 1NVBA 4A73A 3LXRA 3U16A 2P65A 2GCGA 2O1SA 2Y27A 1NW4A 5CDUA 2P9GA 2JFUA 3HB1A 3I0MA 3PWZA 1FLVA 1UDXA 1NVGA 1RWBA 4I4LA 5IEBA 3WK7A 2OZPA 4HWTA 2ZTLA 4RY2A 1WOMA 2O0LA 3IOMA 4PQEA 3MJDA 4EMTA 1PHRA 1I9CA 2P9FA 5BT8A 4X00A 1XVAA 4Q82A 5HE9A 3ZHRA 1I6KA 4D0GA 4QWMA 5IYZF 2TMKA 4C43A 1IYZA 2GNOA 1U8CB 1RI1A 4FR5A 5DBEX 2C7QA 4TL6A 1PL6A 1EH5A 1KMNA 4QAQA 4RIHA 4BE4A 1PR3A 5CD9A 1OC4A 6ABPA 4Y18A 2UYHA 1JIIA 3ITEA 4IEIA 4NCHA 4MUNA 1PUIA 2P4EA 3O90A 2CSUA 2QP3A 2SKCA 3TLYA 1EDBA 1NP7A 3NP9A 1CUYA 3B1WA 4FD2A 2JW5A 2WUVA 4INJA 2LIVA 2AT1A 3GQVA 1UK9A 1R9JA 4WXMA 3DBOB 5EJGA 4ZO8A 1EGAA 2X23A 1E3LA 4Y9SA 3KKOA 5DLPA 3THOA 2IIVA 4KN8A 2ZWAA 4HZUB 4PINA 2P8SA 3B51X 3QI2A 3RC9A 3IQZA 4JNCA 1I0LA 3IPXA 1XCJA 3RKUA 5I9NA 1UH5A 2B4QA 3ZVLA 4TZ0A 3GZNB 1DBIA 3E7DA 4U3JB 3W9YA 2QL5A 1I8TA 1H4QA 3HNPA 5KB3A 1OX4B 1TCAA 2M6SA 3ZV7A 3PJDA 3RO7A 1Q19A 2BCJQ 2D8MA 2OKGA 3NGXA 4YRSA 1K6MA 3PNKA 3DL7A 2EFGA 3JYPA 2XF8A 3KFLA 4MIYA 4GGMX 4ER6A 3NDPA 1RJFA 2NNWB 2G71A 4RWEA 1YS2X 4M9QA 2OSVA 4NMWA 4HDKA 1KR5A 3NHZA 3ER9A 1YULA 3TPZA 3NTUA 2JI6A 1N5OX 4WZAA 1J1ZA 2P9TA 3UO8B 4NICA 2BGKA 3PICA 3FGOA 2R6ZA 4NFSA 2IH2A 2YQZA 4O2AA 3SYKA 4EZIA 4F7WA 5CJPA 2OM2A 2A3RA 2Z83A 4O0MA 2W6JA 2OFPA 1J9EA 2B0JA 4DSAA 1NU6A 2NTVA 5C1BA 5C37A 1YR3A 1KFJB 3WNDA 3PCXA 3WY9A 3FBGA 4JDUA 4JP8A 3LKBA 5JECA 1U2SA 1WZUA 1BO6A 2X5KO 5KQLA 4Z0HO 3ZW7A 5J47A 2FGJA 1VM6A 2P2ZA 4CT0A 4UCFA 1DDIA 4QFDA 1GDDA 2HSJA 3NHKA 2OG2A 1G63A 3LPLA 4JP3A 4QATA 5ERGB 4PWZA 3J7AC 4EF6A 2AR0A 1T15A 2JIPA 2VBCA 3AK4A 3EVEA 3DFZA 4GZLA 4IG9A 4B8WA 4TROA 2TMGA 2WJ6A 3RTGA 1IIBA 2WIDA 2POQX 3VJMA 4EPWA 1XU4A 4GRDA 4WV3A 4GLLA 4HJXA 3OCUA 1A4RA 4A2QA 3IA2A 3C5VA 2VNJA 1XYGA 3EZ9A 1I0IA 4JA0A 4E13A 3KQTA 1NY5A 4PZDA 1RXCA 3AFHA 2PH7A 1TFRA 1SQ6A 3P2IA 5FUVA 4CM4B 5HK9A 2VQSA 4Q05A 2BFBA 3WXBA 3UV3A 2GD1O 2PZAA 3K9CA 1QF7A 3TRFA 2FI1A 3NRCA 1OH5A 4LGCA 3KQUA 3LYHA 3HN2A 3ZQ6A 4CR6A 1G9XA 1YCDA 1CY7A 2C2KA 2IKQA 1NI4A 3MJCA 1JJBA 3G7SA 3LUHA 2NPOA 1ZOPA 2BGLA 2FP3A 1O96B 3CHYA 3DUFA 3JQBC 3KT6A 3PGXA 2OMKA 4ND4A 4W5TA 2Y9PB 1XPOA 3SHVA 2G0AA 2ISQA 1W29A 1Z7BA 3TTVA 1R66A 3REOA 2AE1A 3TLGB 1JALA 1VXOA 4BUZA 1V43A 4BV9A 3DV0B 1ONBA 2XODA 4MICA 1BHJA 4I8XA 4NXNB 2F8TA 2PM8A 3T7TA 5CDSA 1KQ3A 2YR0A 2G7MC 4PXAA 3FNFA 1IG3A 1LQUA 3I39X 4LNHA 5D84A 2OK8A 3AP3A 4AS3A 3ZD7A 2BYTA 5JYDA 3KQSA 2RIPA 1ZMTA 2X58A 2VSOA 4WY2A 3KP1A 3RC7A 2IYXA 2OCDA 4WOJA 5IP5A 5FPSA 1O95A 4CPDA 3FPFA 3LQRA 4N8DA 3O8BA 4RC9A 1EXVA 1ZM2A 2Q1YA 1Z0KA 3K31A 3D3NA 1UXOA 3CM0A 4ARSA 5D6OA 2X77A 1JR4A 1QSGA 5BW6B 1CVRA 3RAEC 3VKHA 3R8CA 2UU9B 2HDHA 4QSMA 5HGJA 3AEKB 3G2IA 4MOWA 1E3QA 1B8PA 1ZD1A 3B1XA 3GFBA 3PDIA 2DR0A 2GCPA 1TGVA 4C2UA 4IVPA 1ECBA 5JATA 3L49A 3BJIC 1L4YA 3B8HA 5DK4A 1H85A 3VPCA 3VQTA 5I48A 5I6DA 4RZSA 3SR0A 3MM4A 4HRVA 4YLGA 2JAPA 2QJTA 2RG7A 3A4NA 2YWCA 2D06A 5FFNA 2ZBUA 1JHOA 5BYBA 5KYXA 3RF6A 2M6KA 3WFJA 1NFFA 3GJTA 1AQNA 4MVJA 1U7TA 1I1QB 1G17A 2ZK7A 4FMCF 4PR3A 2E9SA 5LMCA 2OKCA 1JFFA 5B37A 2OFFA 5ICCA 3LHIA 2W2NA 3JWHA 3QUCA 5EWLB 5BVGB 2FZCA 4HDNA 4IQ8A 5SZJA 2QRGA 5CFRA 3RVJA 2GFHA 4EAAA 3ZOZA 3MPOA 3EEBA 1MJFA 2FRDA 5EWJA 4I1OA 1CF2O 2FVYA 1ZN8A 2G9VA 4Q1DA 3RNLA 3I5XA 3Q88A 3KQLA 4F2DA 3GLGB 2V8OA 2BJHA 3HCFA 5JOQA 1OASA 1NF8A 2PMWB 3Q41A 2C5SA 3DE7X 5ILOA 4INPA 3RANA 4P0PB 3HDYA 3ZWMA 4CLRB 4Q7JB 1BVUA 1JH9A 4LKOA 1U1GA 2PANA 4A91A 2YICA 1Q83A 1XBTA 2IBSA 5KOIA 1LDGA 1FQWA 1BJTA 2UUPA 4NPHA 1SZCA 4WUTA 4P2BA 4GVLA 3ILSA 4XX1A 5I9MA 1G19A 1N0IA 1XAJA 4V38A 1VL6A 1YRYE 1TKCA 5LP6C 1WSBA 3RF7A 5FOQA 3N86A 1F0NA 1NT4A 3RT1A 4B09A 2A4MA 1S2LA 3O21A 3WGHA 4G89A 1JR3D 1TF2A 2DPYA 1ECLA 2OAGA 2R6JA 3UT5A 3OE7A 2HBYA 2O06A 1Z6ZA 1N2SA 1E1QA 2OTCA 3K1ZA 4RHTA 1G3MA 3H5OA 1AUOA 4XQ0A 5EERA 3VPBA 3EXAA 1XPRA 3ZJVA 3PTLA 2QQEA 2NOAA 2BPOA 5JROA 3BHIA 3FFTA 2VPTA 4ON9A 3CW9A 3AERA 3KOUA 4R1PA 4TMWA 1X2BA 3TAXA 2B1IA 2B98A 3FUTA 2PIAA 3JSXA 5KVQA 1Y3IA 5GGXA 2AZMA 3EXFA 3L93A 3OSUA 4M0EA 4TKUA 2EW2A 4D6XA 4CKWA 4Z3OA 1GILA 3W5UA 1XGKA 2P4QA 3C48A 3JQRA 1EHIA 1DEXA 4HNAB 5IKPA 1QO0D 4UTZA 1A97A 4UUNA 3SC3A 4F84A 3WJ7A 1N8NA 2RE8A 5HJ7A 5LQNA 1F38A 1QYRA 4KNWA 4MP8A 1HEUA 3KOYA 5L53A 1VJTA 4FPXA 3NANA 1EI9A 4DDHA 5LZ4A 3ETDA 3B13B 1JEYB 3VU9B 2FMTA 4JGIA 5AUNB 2F1KA 4BC0A 4HFMA 3EDYA 4XJTA 1KVSA 3NWPA 4LTNA 3ZCTA 4NBWA 4Y6OA 1E2MA 3TYXA 3P71T 2BTEA 1PJZA 4RPIA 3G5LA 4GBMA 4OHXA 1ABFA 3QA3E 1VMKA 4Z0NA 3ZWAA 4RKQA 5JSQA 1L5VA 1L7VC 3TIIA 4GX1A 1Y1PA 2A3NA 1DTSA 3O83A 5LL6P 4U9IS 1B6SA 4EVSA 3D59A 5CPBA 2O1EA 2O0JA 4F86A 4S3MA 3RYCB 2F6RA 3TE7A 5FA8A 3K3PA 1UWVA 2BEWA 3C6KA 1U8YA 1PJAA 1QC5A 1XAGA 2ZVJA 4URFA 3H2YA 4C6SA 3OQOA 1ZL0A 2A9RA 4YI3A 5BSUA 1AHNA 4N7MA 3MINB 3S99A 5KNBD 1NJ8A 2HCRA 2WLTA 4LRSB 1IUKA 3WYBA 2H31A 4L9SA 2RBKA 5DMXA 3TS1A 1N7HA 3PB3A 4DE5A 2LWIA 2PKRA 4ZQEA 3LC2O 4YV0A 4DV7B 4ZICA 2Q8NA 4DCMA 4MW9A 1HDXA 4XEUA 2P2LA 3RVSA 4ZYZA 1KJJA 3AILA 2YUIA 1Y4DE 4BLSA 3H9CA 4CCYA 1U90A 1UODA 1BAPA 1Q7BA 3W3ZB 4EHHA 3I73A 5AVTA 1A9OA 1GYQA 3EXIB 4RV9A 3CNHA 3H8SA 4DG9A 4FONA 5HZGA 1SRRA 3JQDA 1F3OA 5C1IA 3LX5A 1RT9A 2F55A 4IJQA 3FYUC 3K0AA 3QKWA 4PAQA 4RMIA 3QLUA 5AKXA 1POWA 2VPWA 4NYJR 1PU2A 1N36B 1O54A 1HQDA 3G89A 5YASA 1CJCA 1PP4A 4QDKA 4TKLA 5HVNA 1MFPA 1BMTA 2NUPA 4Z9XA 1NNI1 2QWXA 3OT1B 3H99A 3WGTA 1Q20A 4G1EB 2IW3A 1R4MA 3V9AA 4RNCA 3FUVA 3FMFA 1XNQB 2I2AA 3V7NA 1GLGA 3RSCA 3RU3A 1HNXB 1RXVA 1W6RA 4Z9BA 2HA6A 5B6PA 3KUCA 5FFFA 3LLCA 1V2GA 1KYZA 1P5ZB 2CXUA 1NF3A 4BCDA 2DR3A 4I66A 4JV5B 4OLAA 1YR1A 3UT6A 3A36A 5CLIA 3KYJB 2PFSA 4QOHA 4ZDJA 2FPRA 2YWGA 1DBPA 1Z73A 3HKEA 4JR0A 4NK5A 4Y9TA 2P78A 2RIRA 2NZUG 1EINA 4C5CA 2VPPA 1MC8A 1D7AA 2C5GA 5EXSA 3GLKA 3UXMA 3G2OA 4QJ5A 3W04A 2VRNA 1FUYB 1SUBA 2Q1TA 3WGMA 2YUTA 2YVQA 3RKRA 2WKPA 2IHZA 1E9FA 4W5JA 3GLIA 5GJWC 2HU5A 4R3NA 3V4RA 1LLUA 3UUWA 3UHJA 3E1KA 3H2ZA 4OGFA 4D98A 1QYXA 2EIHA 5FAXA 4KWTA 3ZHXA 4F5WA 2AKEA 1ZSYA 3Q6NA 4JQOA 2PV0A 3E8MA 4MDEA 3BDVA 3UMFA 3WBJA 1VC2A 3P32A 1F4LA 1HT0A 1U9JA 4RY0A 3CZ5A 2H1CA 3QM1A 3CCBA 3D64A 4RANA 5CW1A 4D97A 2WFZA 4Z4CA 3WLFA 4G2TA 4D0LB 2BL4A 4D0NA 3B3QA 4RHCA 1M6VB 1X15A 1GZ4A 1HLGA 1EDDA 3H8JA 1JFLA 3NKFA 3AIIA 4LRTB 2HU7A 2YW2A 4I4IA 3FR8A 5DCYA 1B2RA 1ZJYA 3EVFA 5FB3A 2JH8A 4EYOA 3QYFA 1H8HA 3DZFA 3FCOA 2XTJA 3IUJA 3NFYA 5A0FA 5J58A 4S05A 4I9GA 4LHWA 3VNUA 5E1OA 4YR7A 1RHMA 4CQMB 1E59A 2OZLA 3I9MA 3CPHA 3KSMA 3DEAA 1JYFA 4EYSA 3OHMA 1GL9B 1VLQA 3C70A 4OAPA 3VZBA 4JOSA 2DAPA 4MO2A 5CB4B 4HWRA 2B37A 1Q0SA 2D3TA 3VDXA 2R7LA 1C7JA 4BEBA 2EJTA 4BNLA 1Z5NA 5CTJA 1B93A 2SECE 1SRQA 3KXPA 3N07A 3R6WA 4TQAA 4RDIA 2NXCA 5JIBA 3T7IA 1PI3A 2Y2VA 1TM1E 4NATA 1T2VA 3WKAA 1KL7A 1W5BA 1WJGA 1ZGBA 1VLLA 3FSGA 1MVLA 1P2TA 1ZGZA 2RHRA 3ED1A 3HL4A 3KX2A 4RZXA 3RRMA 3H0EA 4FOTA 1V1MA 1RYZA 1QV6A 2SICE 3SR4A 3U37A 1S3SA 3P96A 5IAOA 4B3HA 2Q5EA 3A10A 1Y98A 1TKRA 5TXGA 1DIRA 4GLBA 5B2ZA 3ABIA 1UM9A 3SYMA 2Y1OA 3D2BA 5B3LA 3HRHA 4EKGA 1Y9ZA 1GR0A 4NJMB 5C5IA 1NXQA 1QWSA 3D7LA 3HP1A 3M4YA 2CUKA 3LL4A 4UMVA 4EBFA 1WZ2A 1GQOA 4MVWA 2H0AA 3N76A 4C87A 2PFKA 1WPQA 4RACA 2EJUA 3FKJA 3HJAA 4PCVA 4UEQA 4ZODA 3AF6A 4DB4A 3OQMA 3CMCO 4I55F 3VPXA 3P20A 2YMMA 3RI3A 1SKYB 3CKMA 3NUGA 2DSNA 4E03A 3H8VA 4JI2B 1P0FA 1AS3A 3H7AA 3ZBQA 3ZWWA 4B7ZA 1T0PA 3EX7C 1UBFA 3OIVA 5KO2A 4GKBA 1BD4A 1UKCA 4ZCPA 1OFIA 1TA0A 4PC6A 3PU6A 2BFWA 4XEHA 3CF6R 1TEZA 2Z04A 3BRQA 3VPSA 3OFSA 6CHYA 3N70A 3W1WA 3SWWA 4RMNA 1JSLA 1XWIA 1AO0A 1MRSA 3GRFA 2I3GA 2O3UA 1XD2A 4R83A 3H87A 4EKDA 6LDHA 3TGLA 4JKIA 3MHTA 1U1DA 2WTAA 2QM0A 3H9GA 4RKRA 5FCDA 4HX5A 1J49A 3OQ1A 5F2EA 4IDQA 3LKDA 1PFVA 1JWLA 1Z4JA 3BH7A 4HYEA 4E5MA 1GNRA 1VIMA 1DXHA 4KDFA 3LP5A 1U28A 4DVJA 4J2TA 4MQBA 1GD1O 1XDWA 4MLZA 2GBLC 4QDJA 4DJEC 2G09A 3B82A 4F4HA 5BYJA 3CISA 3WGGA 5H4GA 2RGYA 2XZPA 4LC9A 1ETHA 2VT6A 4YCCA 4Q6BA 1KU6A 3ZNPA 3H17A 3F98A 1NDUA 1U2DA 3QXGA 4ZVTA 3ZE8A 1JI0A 3PE4A 1L6RA 5KJFA 3QOYA 1QYIA 4WECA 3PVCA 1MW8X 2P40A 3EQZA 3QMVA 3JVEA 4JX8A 2C5EA 4ZARA 4BBZA 1DIBA 1XRQA 2I6GA 1FW6A 1OGIA 2H9YA 1JV2B 5FO0A 4Q1EA 4U8GA 3I8XA 1P9OA 3P45A 4NAVA 3N0TA 1EFLA 4P82A 3M3DA 5AWFC 5CA1A 2OVFA 4UNQA 1VSTA 2CFRA 4LHVA 4JL5A 3L92A 1II8A 4UFNA 4WNIA 5DBHX 2CJWA 4NMLA 2BEVB 5DEOA 1YDEA 3LT4A 4QBIA 4JJFA 2AJ8A 1H0KA 1AGNA 2P9JA 1OV4A 4ZQGA 5CHYA 1QFZA 3RJTA 4AF7A 1FVOA 3NTXA 1VCOA 1BRTA 4Z3KA 2F9MA 2BUAA 2AG6A 3CF0A 3N0RA 1AGYA 1CSEE 2DFPA 3JVDA 2HWKA 3GNTA 3QE2A 1B26A 1JKXA 3C15C 3GEDA 3DE5X 4ND3A 4X44A 3HBJA 4BFVA 3ROFA 1YONA 1Z2DA 2AEMA 3PKIA 4Q3NA 5ALZA 4A3SA 4BMPB 5LQKA 3FPJA 3AZOA 3DTYA 4PNHA 1G55A 2EQ5A 4MB2A 2PBLA 3OE5A 4CMIB 1XZAA 5TGZA 4GD3Q 4N5LA 4IJVA 1GGJA 4CTMA 1A9YA 1R10A 1D03A 1Z22A 3AOEA 4CFYA 4IOKA 2H48A 4TLLB 1L5QA 2F9LA 2I2WA 4RSGA 4HT3B 5KTSA 4IGAA 3T0IA 1Y9DA 2I4MA 3KJZA 3LD9A 2PH1A 3RW9A 3IBGA 4MSUA 4RUKA 5JALA 2JI4A 3H97A 4EKEA 1EK5A 1GRCA 4LY6A 1CLEA 4O2RA 4CM7A 3MA0A 5K3SA 1QNFA 1V96A 2OOSA 3RVDA 5AW3A 1HNWB 1UXKA 3IS3A 4DBZA 1KC1A 3EIUA 2JFFA 4MWCA 1BDIA 3THRA 2HHAA 1G20B 2FQYA 2A5FA 1ZUD1 2BR3A 2QHXA 3MTJA 4C01A 4OF4A 2HA4A 3K0BA 2Y1CA 3TMYA 4AO6A 3NTLA 1Z2AA 3LBAA 3FDJA 1AU9A 1SVSA 4GSYA 1SXIA 4CM9D 2PCJA 4Y0AA 4CNBA 3PL1A 2AFHB 2PIDA 4GVXA 2VDKB 4GS5A 4EO7A 2EARA 2OK7A 1EB9A 3I05A 4RK0A 1BG6A 2LCFA 2H9IA 3HKCB 4Q3BA 3HCNA 3F67A 4ZHQA 2J7PA 3GRRA 3U60B