2GN0A

Crystal structure of dimeric biodegradative threonine deaminase (tdcb) from salmonella typhimurium at 1.7 a resolution (triclinic form with one complete subunit built in alternate conformation)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
327
structure length
326
Chain Sequence
MASHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords Threonine dehydratase catabolic
total genus 123
structure length 326
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn0A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn0A02
4D9NA 3SS9X 3RR2A 2Q3BA 2TSYB 3DKIA 1QOQB 3VSCA 2CLIB 1QOPB 3L6RA 3VSAA 3BM5A 4ZQCB 2TYSB 2DH6A 2Q3CA 2CLHB 2GN2A 1C9DB 5DW0A 5T6MA 2ZR8A 4D9GA 1OASA 1D6SA 1E5XA 1A5BB 4L27A 4AIRA 3R0XA 2EGUA 4I1YA 4LMAA 5B53A 1VE5A 2J9YB 4L28A 1Y7LA 5I7WA 1UINA 5KINB 1TZKA 1J0AA 3T4PA 1CW2B 1Z7YA 1C29B 4OREX 3PC4A 5D84A 5CGQB 3FGPA 5B1HA 1TZJA 5D85A 1A5SB 1UIMA 5IW8A 3SS7X 3AEXA 1VE1A 4LI3X 3SPXA 5JISA 4NEGA 1J0EA 1TTQB 2TRSB 4Y6GB 5DW3A 3IQHX 2C2GA 4D99A 1PWEA 1V71A 1KFKB 4H27A 3VBEA 4D92A 4D9BA 5I7AA 5DBEX 3L6CA 3HMKA 1J0CA 2J9XB 4NU8X 2O2JA 1PWHA 5I7OA 5JJCA 4D8WA 4D97A 5I6DA 2GN1A 5KZMB 1BEUB 4D9FA 1CX9B 1C8VB 1RQXA 1KL7A 4XUGB 1BKSB 1P5JA 2GN0A 5B36A 5D86A 4D9MA 1KFEB 1FUYB 3ZEIA 3DWGA 3X44A 3CEPB 5I7RA 1F2DA 1Z7WA 2RKBA 2ZPUA 4PCUA 1V8ZA 1WKVA 2ISQA 2CLMB 2RH9B 1M54A 1WBJB 1TTPB 4HO1X 5CVCA 4D9KA 4D9IA 2BHSA 5J43A 4OFXA 2CLOB 3PC2A 2ZSJA 1KFJB 4JBLA 1FCJA 2CLLB 5B1IA 3L6BA 5DVZA 4HT3B 1TYZA 2ECOA 3IQIX 3VC3A 3IQGX 1X1QA 1K8ZB 5IWCA 2J9ZB 4LMBA 1V7CA 4HN4B 5IXJA 3DWIA 1K7XB 5D87A 5J5VA 4D9EA 1WTCA 2RHGB 2Q3DA 1K8XB 3X43A 5B55A 2CLKB 1TZ2A 3AEYA 1K8YB 3PR2B 4F4FA 4QYSA 3IAUA 4ZU1X 2C2BA 3VSDA 4HPJB 1TJPB 2D1FA 3R0ZA 1TDJA 4KKXB 4IL5A 4JBNA 2BHTA 5DBHX 3TBHA 1WDWB 4AECA 4L0DA 4D8TA 5C3UA 5BW6B 1TZMA 4D96A 1O58A 5HBGA 5E0KB 4D8UA 1J0BA 1VB3A 1UBSB 5I7HA 2JC3A 4D9CA 4ZU6X 3FCAA 4L3VA 1K7EB 1A50B 3V7NA 1J0DA 1A5AB 2O2EA 4HPXB 1K3UB 2ECQA 2CLFB 1JBQA 2CLEB 1KFBB 2EFYA 3PC3A 1KFCB 2V03A 2PQMA 2WSYB 5B3AA 4COOA 1K7FB 4WX2B 2DH5A 5EY5B
chains in the Genus database with same CATH superfamily
621PA 2R6R1 4JB2A 2ANCA 3BVPA 2QW8A 4UCQA 4Y6RA 1TKCA 4NAUA 1Q6YA 4CM8A 1P7WA 4YJ2B 1G6OA 3RUPA 1SHTX 4HS4A 3G9XA 3P20A 4WCFB 1J07A 5J5CA 3UGQA 4C7MA 2AVNA 3QKSB 3A6PC 1R0YA 1G9TA 2ACKA 2E0IA 3LP5A 1USVA 4Q00A 3C8DA 4I3FA 1NVVQ 4LJKA 2AJBA 1D1QA 4YCAA 4PAWA 4RDHA 2ZXUA 3RNOA 4QQFA 1U1IA 3GJ7A 1UWLA 2L18A 3NBQA 2WJ4A 4OHVA 2PN1A 2JIDA 3O91A 3E1GA 3RAFC 1CW2B 1YB1A 4DPKA 4RYLA 3VC1A 3E9EA 4GMKA 4BO6A 4GRAA 1IEVA 3DMTC 2WWVD 3QPVA 5IC5A 4YT5A 3ZIDA 1GZHB 3P71T 5BYAA 4YJHB 5EZYB 2QP4A 1ACMA 4N9WA 4E2WA 4AG5A 5IFKA 4O0LA 2C2GA 3ES9A 7ABPA 1XAHA 4ZKEA 3TZHA 2WIGA 4MUYA 4MWCA 1ESZA 1TMYA 1YS6A 3N7AA 4US1R 4Y2PA 3KQHA 2B20A 2XJ9A 1Y6FA 2R1VB 3N5CA 5B7GA 4X65B 4TMTA 1CF4A 2HQOA 1II9A 2KLBA 1SWWA 4JSYA 2OFFA 3T1TA 4CJXA 1UBJS 4PYMA 3QLTA 1E6MA 2VL7A 1BMFA 1PLJA 1W581 5DGTA 3ANSA 4YONB 3ZZ0A 2P9JA 4EKNB 1LVUA 2QWXA 2J9FB 1IQPA 2LDXA 1THMA 3F6PA 1U02A 5KQPA 1CX9B 1ZSYA 2L19A 2PJUA 1KY2A 1FVHA 2ZAOA 2AZ4A 4HMOA 3HMQA 3H97A 1SVNA 5CJPA 5I8PA 2XV1A 4AKEA 2VP5A 4EDHA 3IB3A 4JCOA 4UD2A 3W4IA 4A6XA 1E3MA 1Y63A 1ZUD1 4P7KA 4K3VA 4DADA 3MUFA 3TOXA 5DSTA 4YRKA 4L73A 4M7RA 4G5HA 1XYVA 1JLRA 3A2NA 2ACEA 3KKQA 1YA8A 5DH9A 4CCYA 5FX2A 1BTOA 3JQCA 2QRUA 3B1WA 4FWBA 3W8FA 4CF6A 5MN4A 2BD0A 3OOYA 5DOZA 5L6LB 4CR6A 1IAVA 1RI4A 1N3YA 1HBJA 4MUHA 4H16A 4BKPA 4CMEA 4HTFB 3WRYC 1IRIA 3WS7A 1LPSA 1EWKA 1P0PA 1ZJ5A 4QBIA 5AUPB 2X40A 5DM2A 3TB6A 1M9NA 4G0YA 3JQFA 2WQ6A 2QAIA 1UC5B 4QICA 5IDQA 1ADFA 3QEKA 3IMEA 3L4SO 1Q7EA 4JBXA 1SUEA 1KZYC 1ZM4A 4PLYA 2UZAA 3W8DA 1HQCA 4EPTA 5K0TA 5JHGB 2W48A 4B6FA 1MAWA 3HNOA 2I99A 4IO0A 3ZHOA 3GLIB 3JARB 1YNSA 3WIOA 3EMKA 4L15A 1GGHA 3AF0A 3MSCA 4GW3A 2JFQA 4DIDA 3BXGA 5JH7A 3T7KA 3IERA 2DE0X 1YR7A 4BVJA 4IAOA 1GUYA 4RSMA 1XWWA 3F47A 3SR3A 1CRLA 5CFNA 4BGEA 1J6UA 4FCWA 1L7XA 5I9BA 2HBRA 3C85A 4HAIA 5J5AA 2P1RA 1WQ1R 3A4NA 3MMXA 1NXPA 4JJEA 4YDSA 3UB4A 3WGQA 4HXFB 2EFJA 5FB3A 1B6SA 2GQ0A 4C20A 3TTVA 4ZVKA 2VWPA 4QOSA 2FUG6 2JK1A 4FNGA 3ZWWA 4D3FA 4EHAA 5GMOA 5JS1A 2WI8A 1E3QA 1SOWA 1UAGA 2R751 4WJKB 5TQJA 4GBGA 4LDNA 1Z06A 5JOQA 1CUXA 1DHTA 3IXQA 3NRBA 4MKXA 1DO0A 3UPDA 1RTKA 3K0FB 3ONDA 3M5CA 1THTA 5D8DA 3DDHA 2YIJA 1WPXA 2QRGA 1YRAA 2IIVA 4MVYA 3QYAA 2EX1A 2QL6A 1H4QA 1PS0A 1ZN9A 5ALIA 3QNMA 3BMOA 2IKSA 2HHLA 3NWEA 3GDWA 4YK7A 5KVAA 3I37X 4KR6A 1BDMA 1WE2A 3NW9A 3VZDA 1EEXB 5JXJA 5F7ZA 3JQPA 1JSZA 1L1EA 4J1NA 4NFSA 3QSYA 3CY6A 4HGQA 4G1VA 3NBZC 5TS2A 5FO0A 2B5VA 2CXSA 3DHYA 3OEED 4F6RB 5CVTA 2GLTA 4OHOA 5F1OA 4P4TA 3PJEA 3BB1A 3JRXA 4NEGA 1E7MA 3I1JA 4PX3A 4UZSA 1JFVA 1P3Y1 1W5AA 2JBAB 3VDXA 1C7IA 1YAHA 4QD3A 1YBHA 1TU4A 3NTQA 4HSGA 2I76A 4PG7A 2C4NA 4BBJA 6GPBA 9LDBA 3Q9UA 1MTOA 1E92A 3DKKA 1W85A 3GH1A 5FBZA 3QX8A 2CW5A 2ZUCA 1NUUA 2FDCA 2AR9A 3UAWA 3JASB 5H68A 5IU6A 1KBOA 2GHQA 1ZNXA 3OFND 4ALNA 2QPAA 3JYNA 3V34A 3C0KA 2O3SA 1E2NA 1ESDA 3LLCA 3OQBA 4WFJA 5FJIA 2NO1A 4P22A 3NKVA 4CR8A 4MITA 2WINI 3E7WA 1DLJA 1REQA 3FNBA 4HUJA 5CA1B 4CNQA 1JEJA 2H9AA 5CLJA 2ERCA 3S4YA 5KQRA 2RGBA 1SK9A 1FUKA 1OYYA 1XMXA 1TTPB 3JQ9A 3PUKA 5HIMA 4D9KA 5HCUA 3IESA 5JDCC 3A04A 3WKEA 4UPEA 5AXAA 5NLLA 3NORA 1E7QA 5I9IA 4ITUA 1E2KA 2IDJA 4HLUC 4E6EA 2V4UA 5JAMA 1G5QA 2W58A 3JU3A 5FWAA 3B3QA 3E3LA 5FPYA 3ZDCA 4R51A 4QOGA 4TUYF 2AZTA 1K8ZB 4HZUA 5IANA 2JFWA 2GBPA 3PEVA 4P4SA 2NM0A 4AXBA 1EP2B 2RIPA 5G1PA 3RS2A 4D9EA 2ISCA 1KJIA 3A2LA 2FFRA 2YASA 3H2KA 4QBFA 4RS4A 5CBPB 5K6AC 2NTEA 3AUSA 2Z56A 4OAPA 2RHTA 1E4EB 4EK9A 3A05A 3GIDA 3KVNA 4O4LB 2PCJA 4MDHA 2FK8A 4MIYA 4JLKA 1GA6A 5SY6A 3ZDEA 1P77A 5C18A 4CM3A 3AUKA 2RK4A 2H7CA 4TTTS 3WKDA 5DGIA 1M6NA 2WU4A 3RT9A 2UUBB 1XK7A 4DB2A 2HBZA 2PGAA 2ZAIA 3CGGA 5C3UA 1X3SA 1CIPA 4DSNA 3QYJA 1U0OC 2X0JA 2ERXA 3WAGA 1JWBB 5EXPA 4LXYA 5BT9A 2WIDA 3AF5A 3KSRA 2V9PA 5AFSA 3C8MA 1JEQA 1GZ5A 5FRDA 2ZVPX 1H2AS 3JWHA 3ILVA 5J63A 1HQKA 1V0JA 1SG6A 1QM5A 3EVBA 3MFYA 2XSZD 4LJ8A 4Q9DA 2G06A 2QLTA 3HN6A 4EMUA 2CUZA 2ZBQA 4ZP1A 3DEIA 3N0TA 2CE2X 1JJFA 3RLIA 2CNKA 4RV9A 4B3FX 4CCSA 3U3JA 3SIWA 3RYIA 2I55A 4QAQA 1B6TA 1BS9A 2CFRA 3FCCA 4WD3A 4XKJA 3V4FA 4GKVA 5AOBA 2I9PA 2WUWE 2OXIA 5KNCH 2VRBA 4LJYA 2CXRA 4Z1MD 3L05A 1FNMA 1NRWA 3KUKA 5CK4A 1EVIA 4EW3A 5AKIA 5C81A 2NSDA 4UATA 4D82A 1W8DA 4ZYWA 5DHRA 4QVGA 3KZNA 1G6HA 1SQ6A 1Z0FA 5KKAA 3PUVA 3GLIA 3L8DA 3WYBA 1RZVA 4XLTA 2G8LA 2P5SA 3C3PA 3EGOA 5LIRA 1MX9A 1ODCA 5AM4A 4BJ5A 5LMNB 2XMBA 5CGQB 1W4LA 5E3JA 1UBGA 4IFTA 1FXUA 3O7MA 3RIMA 4DMCA 4HAWA 1MRNA 4GX2A 1U31A 1KPGA 1J49A 1SWVA 2WMOB 3LHKA 2I8CA 2HWYA 4KXUA 1WV0A 1VE6A 4AJ1A 4DEYA 1C9MA 3PC6A 3WK8A 1TGYA 2OZEA 2NO6A 1NJ5A 2FR8C 2R6FA 3OKPA 2OCDA 4L4YA 4M37A 2JVKA 5CM8B 5E7JA 4IQ0A 4WK6A 4AM8A 4XI9A 3TK1A 1A7UA 2FWBA 2JI4A 2ZJ3A 4MYHA 4TKVA 5JUWA 3HWX1 2VDNB 5KWJA 2ZRMA 1JU4A 1N75A 1I80A 1C3LA 1DEOA 2XCLA 2O50A 4OB6A 3VHXA 3WGUA 4MLZA 4I4CA 1E7YA 3HB7A 4NE7A 4YXFA 2OV2A 3ER6A 4TLDA 1L4HA 3EIHA 3PHCA 4JBYA 4MLPA 2YN2A 2NZYA 5FBHA 4Y7DA 3MS2A 1IRXA 1ZM3A 2IZZA 4LZAA 3VR6A 5BSEA 4F91B 5L4SA 3GZJA 3OOHA 2XYQA 4C21A 1RWMA 2QUZA 2HRZA 1KFEB 1KP9A 5EGNA 3A11A 1NVAA 5F5XA 1CQPA 2FA9A 3OQOA 2A7XA 3AOGA 4CFZA 1K5HA 3RTGA 1L8XA 2BONA 1RQRA 1A2BA 2PH7A 4ZRMA 4MDFA 4MW9A 2TMGA 2IHKA 4X1KB 5JXGA 1KKMA 4DVJA 1JT2A 3OX1A 3LUDA 1NT2A 3IR5A 1H4VB 3NIGB 1UEXC 4NBRA 4FKMA 4PZ0A 2ET6A 3SQNA 3VKVA 1KJNA 2Q0HA 2XB9A 3PD7A 4PY2A 3NAMA 1IZYA 1BMDA 1O8CA 1TTHA 5FOXA 3RVLA 1NBAA 4Y2JA 2VDMB 1YUNA 3RJZA 2JIOA 1O6FA 4KNVA 3T5DA 4EG0A 4IUDS 3EQ8A 1NUQA 2VK1A 4FDTA 2HF2A 4AURA 1KC3A 3IAFA 4TKMA 3A6EA 5FUWA 2YC2C 1DOAA 1NFQA 1JLLB 2JJ2A 3VR2D 4LC0A 3AL3A 2I3AA 2YL2A 2DPMA 4RQBA 4W99A 2XWQA 4QODA 4UMEA 1QPBA 1Z2AA 4WNAA 3CJQA 4ARVA 5FXMA 5KYKA 2NW6A 5JCZA 3R8XA 2RB4A 5DASA 1NC3A 4LGYA 5JCJA 5IUJC 3KT3A 3RYHA 2EBWA 3U0VA 5AVUA 1K6XA 5EKSA 1MGPA 2I6XA 4BIIA 4D74A 4CM8B 1T43A 1IDOA 4B3CA 3KQLA 4MDYA 5KSPA 4B40A 1EU1A 4UFNA 5AVJA 4JI2B 4JY7A 4OY3A 3FOBA 3T9AA 2JFOA 5E1MA 4JI1B 4JH0A 2CLEB 5LZ9A 4BO9A 2E5FA 2CGEA 1G8YA 3QXGA 1N1GA 1RBYA 2VHVA 3QXXA 3T0FA 4JUAA 2IVZA 4FZVA 3CVXA 1JV2B 3O4VA 1VMIA 1AUVA 3ADKA 3RS0A 5KYYA 3IPRA 2CMHA 3AEKA 3B2QA 3ETGA 3LX8A 4FFSA 1ZNYA 2CLDX 4JBGA 5AUOB 3HBNA 1E89A 5C5EA 3I2JA 3QMWA 1T36B 4D46A 3FFTA 4V0LA 3KB8A 1ULTA 1GXSA 3IDOA 4PTLA 4X7PA 4KMSA 3LYUA 2HIHA 4PZLA 2VH1A 4FCCA 3W34A 2J3JA 3K1JA 4HQRA 3E84A 2B2CA 1S2MA 4RSHA 4CTNA 3QF4A 2ONZA 3SFTA 2GKSA 1U94A 5AYVA 1X7WB 1EINA 1SN7A 2WUVA 2H1LA 3DLAA 4YI5A 4D9HA 4BFTA 2RGNC 1T1SA 4ZIRB 2B4RO 1OAKA 1FNCA 2BI8A 2H07A 3DZFA 3KXKA 1EE2A 3FF1A 3WDKA 3H4MA 3QBVA 5DE3A 2ZWMA 1COZA 2BHLA 1PNQA 4V39A 5AVYA 3CUTA 3DDNA 4JOSA 3OU6A 4ETWA 5KQSA 1C7JA 1O87A 4MUJA 4PZ9A 3HBFA 5FLEX 4C5CA 2ODBA 2EBFX 1VGRA 2OGWA 4KFSA 3DW3X 2D06A 4PYIA 5F2OA 2JGNA 2EZ8A 3TZQA 3DAGA 4QGFA 3BPSA 1Z3IX 2ORIA 4DXDA 1E94E 4J4TA 2WJIA 2OG1A 3O4IA 2VA8A 1JVBA 4BLWA 2EKLA 3MVEA 3SJBA 3Q4GA 1YIAA 1QHEA 3JALB 3RSZA 4P80A 4AZTA 5ADHA 5FPKA 4X45A 2YVUA 3Q3HA 1D7AA 2V4MA 1KL7A 5AJWA 2FWNA 1S4QA 3IURA 3A7EA 3E05A 1CRQA 5E6UA 4GZ3A 5J4KA 4TZ0A 1G3UA 1N5JA 2I34A 1W4BA 1ZD3A 1NQUA 1C0KA 1DELA 1E6WA 2GZDA 2XTMA 4Z53A 3PC8C 2OBNA 3RS3A 2X8JB 5GZ3A 2WABA 5A1TA 3UJDA 3L0OA 3H84A 3UMRA 1UWCA 5DM60 3V2HA 1NG9A 5JBNA 2QG9A 4LI0A 3FTDA 2W2KA 1RWWA 2PY6A 3UXYA 3KKNA 4HRYA 3HYRA 1AHPA 5K3DA 1AS3A 1H5NA 4CMGA 5KOHA 4LXUA 5ESWA 2IA5A 1WKBA 3DLHA 3FYDA 4TYYA 2XT9A 1F17A 3GK3A 2H5JA 3I6YA 4YCMA 1GZVA 4P1ZA 3K96A 1WD5A 3IP3A 2BVNA 1OX4B 5IWAB 3N8GA 4P7GA 4GZ5A 5ESDA 2I7TA 2P2DA 1BN6A 3I76A 1G20E 4RHUA 1DQSA 3OSUA 2RGWA 3MQFA 3AILA 3D8HA 4JJIA 4UHHA 3DMYA 1JB1A 4L0DA 1M5TA 3FUUA 1FNNA 3CSDA 1RAHA 5BW6B 5J58A 1PQYA 2UV8A 4K2HA 4ZREA 2AE1A 3BE5A 1T15A 4D9CA 5A9SA 1RHUA 2WFMA 3BMCB 1AKWA 4X63A 2PKRA 4YRDA 3UT0A 3FPBA 3LGAA 1JB9A 1OZHA 3EYWA 1PIWA 4G86A 2Q3FA 5HKLA 3FVRA 5BVGA 2R6JA 3W5VA 1TD1A 5C4MA 2OGSA 5I7VA 3CZ9A 4DCGA 4PGHA 5J9FA 3CRNA 1TK2A 3TLGB 4L8YA 1ZK1A 5J3JA 1GLNA 4Z0HO 2C7OA 1KC1A 1YR1A 1M1ZA 2P3QA 3TLCA 1JDZA 4R6XA 4IILA 4LYFA 1ZOSA 5JYDA 1A4RA 2AVDA 4BX3A 3N28A 1X7HA 2C54A 1UP7A 2JFFA 3G2PA 2G1JA 1ADBA 3AVQA 5IP5A 3VZCA 4YR9A 3H0EA 3D4OA 4D8VA 2EARA 2C5GA 2D5CA 3OY7A 4HX5A 4WL0A 1VXRA 3KZVA 2XYRA 1H2FA 1OYVA 2P7IA 4LS3A 2RMKA 5E4FA 1X2EA 1UINA 3CH7A 3HUUA 4MKRA 4MWTA 5GWXA 5LSAA 4DR6B 2PSFA 2X1HA 5BNIA 5BUQA 2CDRA 1H4TA 4AG6A 1WXGA 3K1TA 4MRSA 3AIMA 4U4AA 1KYQA 1MLDA 4B3DA 2IW3A 4CWAA 4ZT5A 1LKZA 1AF7A 3Q8XB 2C5AA 1N2CB 3HUEA 4WUTA 4AMZA 2IFTA 1VKZA 1NMSA 3QWHA 4Q34A 4R3UC 2AHOA 4NIMA 1ZJ6A 5FAXA 1DHRA 2B1GA 5K2MA 3UJHA 4PSAA 3KQUA 1XGKA 3GDHA 4EGJA 1NG1A 2DHEA 2PL9A 3WJAA 3G5LA 4YACA 2BGTA 5CURA 1TLTA 4FWIB 1JTEA 5AXBA 1SCIA 3BC1A 2R44A 2R8YA 4TMWA 5D51S 3GEGA 1EAMA 1MABB 1FRQA 1SUIA 1TI7A 3A0RB 3EQZA 3HCOA 3HVKA 1DSSG 2TECE 3D4BA 3UIEA 1BS1A 1NUTA 1R9JA 4TTIA 3D5TA 3SICE 2B5OA 2OHHA 4EFNA 4CL2A 3HLTA 4CHTA 1PZFA 2A5YB 3UWOA 1PZNA 2ATCA 1EG7A 1TAGA 4DZZA 3U4QA 3KDAA 1DDGA 1V5EA 2FCAA 3LKDA 5K99A 2B4YA 5KNBA 4DR2B 1BJKA 3M82A 1WB9A 1Y4SA 1T6ZA 2AXNA 3V32A 5AKKA 3SAJA 4N7BA 1V5FA 2BSAA 3PCTA 3T5PA 2HA0A 1D07A 4PF1A 3ZCUA 3PNMA 4FEYA 4FIZA 3U6BA 1IATA 1KK0A 3ZWDA 3F7NA 1EQUA 1KAMA 1XWFA 3EC2A 3R3VA 2YMPA 1Z0ZA 1ZM9A 4DT1B 2VUUA 1DRUA 1G5PA 1SUBA 3L6BA 4LC1A 2HMSA 3OIFA 3AI7A 4FW8A 1M8GA 5DTJA 5K51A 3KE8A 2NSHA 4N0DA 2EJCA 5GY7A 5REQB 5TMDA 4BGVA 5J2TB 2DEUA 1DC3A 2YZGA 1U6KA 3MJRA 4O2LA 1MVLA 4HEQA 3I6MA 3AKEA 3GAAA 3GCXA 2ZJ6A 4JZYA 1X9IA 3OIGA 3MT9A 4R05A 4PS1A 3GMTA 3AKCA 5ARCA 1KSGA 3OP4A 4K8OA 1NX6A 2QUHA 3SZUA 2C2WA 3WGZA 1R6XA 3WMWA 4FEEA 5C7IO 2IPNA 5BUZA 2XNJA 5LUAA 2I62A 1YC5A 4IXDA 4KIFA 1E2HA 4LNHA 4B71A 1N9ZA 1PG2A 3I9OA 1FQJA 3JATA 1UJ2A 4R2HA 4BEJA 2QUIA 4KYTA 3TS1A 2AQKA 3QPDA 5HK8A 1OSNA 3D4NA 2I3DA 3ESAA 4ER0A 2QN6A 3JQ7A 2ZYAA 2P75A 5DSZA 1ZQ1A 521PA 3VU1A 1Z2EA 4EDFA 3B1XA 2X5JO 3PUZA 1GFSA 1B6RA 1M2GA 1Y3DE 1PNVA 3KJZA 4H7DA 1IOZA 1TT7A 4HB4A 1V8FA 4DR4B 4L6AA 2Z30A 1R2QA 1M8FA 2PXXA 3FBGA 2V98A 2H51A 1IJFA 2V3VA 5E9JA 4ICIA 5BMOA 2P9GA 5HWSA 3T95A 2PT6A 3KLBA 1QC5A 1ZOPA 3OU2A 4TRJA 3U39A 1R4NA 1U7WA 4CL3A 5A4AA 2IQ5A 2B7CA 4HAZA 1MNAA 2WTAA 3OT5A 1YCDA 2XTAA 3ZXSA 3EDCA 5E4TA 1G1AA 1K7SN 4FGZA 1Z26A 4TLMB 3GRUA 2V97A 2W2LD 3P2EA 2DT8A 2VXOA 5LD2B 3ORYA 5JIBA 3WWPA 4Y6LA 3KZCA 4HAXA 3GD5A 4EAQA 2RHLA 4KJZA 1SG0A 2LCFA 3CTPA 3AONB 4I5EA 1J9ZA 1A8HA 1HC7A 3L8HA 4NRDA 3DBVO 4AP6A 3SYRA 2G5CA 1Q7TA 3EIFA 1NQTA 3QLJA 4L51A 5DNDA 3S1AB 1PX0A 2X9NA 3RK1A 4KR0A 1JAXA 3VMFA 1JHMA 3R3XA 3WLIA 1M75A 1W5EA 1U98A 1IN5A 1LBQA 2PUAA 3HBJA 3TSAA 2X5KO 2DR3A 2ZAMA 1OT3A 1VE1A 5E9WA 2WG2A 1XI2A 4KN6A 2OZLB 2B4QA 2PZMA 4NU0A 1O57A 3S2IA 3FUTA 4J16C 4L5IA 5F77A 3UJCA 3ZQJA 3I3OA 4D8XA 2BHNA 5TEVA 5HZGA 4XD7A 2AK2A 2WWGA 1A7KA 3GLKA 5E9QA 4Q93A 1G4HA 1UBOS 2V96A 1YS1X 4AYXA 2NSYA 3GJ6A 2OD7A 4DGSA 1D04A 5LLDA 4W7IA 4JJZA 5ADUS 4XGKA 5MGNA 3IEXA 2XKJE 3PEUA 3SJUA 3RRXA 1QFMA 4K0RA 1QRUA 1UZUA 3FNFA 4Q15A 4HF7A 4WCDA 2CHVA 2PMDA 3U1VA 3UT6A 4A2QA 4E22A 3L9XA 4Z2AA 1RLJA 1EFTA 1SCAA 4RJLA 4Q3AA 4FCVA 1ZI6A 4H4CA 1MT3A 4U5QA 2VRWA 1GYQA 1IIRA 4UHJA 4PIVA 2Q29A 1GL6A 1ODTC 3QTBA 2VJNA 3GPIA 1CDEA 2BEUA 2C0QA 2P2LA 3NBFA 3QZUA 4KYVA 1A77A 4TN1A 3GDGA 4LZOA 1PEDA 1XZAA 4RK7A 1ZXBA 3T8YA 3C6YA 3HU2A 1XA3A 1Y82A 2ETXA 1L8LA 4A6DA 4OM8A 4ZVTA 4C0XA 2Q4EA 3BXHA 3C3MA 2QTHA 2C3YA 4Q4JB 4UDXX 4MHTA 1RVV1 5G2OA 3L7OA 2G4VA 3LBYA 2WU0A 4HG2A 4LX0A 5TNXA 4A73A 4C0JA 4WBNB 5FTWA 2FZCA 1IN6A 3KVYA 3W5BA 1GITA 1PT7A 1K7XB 4EAAA 1VJDA 2Q3DA 2YXBA 1HV8A 1ECLA 2Y1XA 1PTJA 3NOVA 3TQRA 4FWTA 2Z2YA 4EI2A 5C34B 3PX7A 2YMQA 4GI7A 2ZE5A 1SO8A 2VEDA 2C2ZA 3G49A 3RQSA 2ZQYA 2XADA 4XWAA 4O02B 5EP2A 5A3VA 2C99A 1QFJA 1OPRA 3IV6A 1WMDA 1Y1TA 3C43A 2ECPA 1PYOA 4HTAA 4PFJA 1V1RA 4EO7A 3U60B 1PBTA 3M2TA 1JQKA 4CXMA 5C7YA 1MF7A 2FJ0A 4J1SA 5LIPA 4XDHA 3A4LA 1S9HA 2VWGA 1HT2E 2BIFA 2PWAA 2H00A 3MMNA 4M86A 4AMVA 1K7EB 3AESB 4WCFA 3F46A 1UPFA 3DNMA 1I2AA 3KALA 3JAWB 2QQ5A 3VJLA 2F8TA 2VTEA 1XDUA 2NV0A 3FMFA 3EDRA 1M0SA 2ZRNA 3H2BA 5ECWA 2I2WA 4EB8A 3I42A 2FNAA 2JLUA 1LVHA 4HC4A 4IHJF 3NQ41 4GEKA 3ED1A 3WRVA 1G2IA 5FWYA 4DWWA 3EODA 3ASUA 5B3JC 5BOSB 3L3BA 2EFHB 2IP4A 1KTIA 4MGHA 5GJBA 1T2AA 3VSAA 5AJYA 2GM4A 3BREA 2ONKA 3VZSA 5AVQA 1N9GA 5DNEA 5KJ1A 1RADA 3K9WA 4LXHA 1RZ3A 5CB6A 4PLGA 3U7JA 2HSEA 4TV8F 2WHXA 2RGCA 3A9TA 4RTSA 4GP7A 3MZ0A 5JY1A 1E58A 3P9YA 2ZCJA 2BEKA 1FTSA 2FQYA 4QAJA 3AR6A 2LZ0A 1JSLA 1VPVA 3HG7A 3NG1A 2AWOA 2XBLA 3AUXA 5G0VA 3B3FA 1PKXA 2AV6A 2C94A 3RARA 3PV0A 3R9KA 1RWOA 3DXXA 4MUXA 4QDXA 1U65A 3MWFA 4C2BA 1N77A 3U1BA 3DVAA 4PLFA 1GUFA 3K7EA 4HYYA 4BQQA 4DLWA 5ICGA 1C0EA 2X5NA 4KODA 3M1YA 4OV6B 1G21A 4UCWA 5JWHA 3UJ7A 1FSZA 1A04A 4KQHA 4FD2A 1Z18A 4OHUA 5DX1A 4MICA 4IZ6A 1AKEA 2OP1A 3HA3A 3I8XA 3L7YA 4Q3KA 3CZ4A 4EA6A 2EJUA 4LZJA 4MWEA 4UNPA 2DPLA 1B42A 2I80A 4J0FA 5DBIA 4EQ6A 4O29A 3KNZA 3WL4A 1C7ZA 1P0FA 4GS5A 4ZEMA 4ES6A 4D4GA 4RDCA 1T6NA 2IKQA 2XUGA 1JFFB 2F1HA 2KS6A 4Y3UA 1D2CA 3KJFA 5ALPA 4TOIA 1GDDA 1NL3A 3WXBA 3ROFA 3WFZA 1WLSA 4J3JA 4PHFA 2ZBFA 2ZATA 2H59A 2HO4A 5TQVA 4DDUA 1CUAA 3DJYA 4JL8A 3ZGVA 4LQCA 4CQLB 1WKCA 5L95A 3ZVMA 2IXBA 2WJJA 1QJCA 3BGVA 2Y76A 2RJNA 3CMCO 3ML1A 4RS3A 1ORWA 4ZOCA 3OU7A 1ZCJA 3AF3A 1H2YA 4XCXA 4RTLA 1Q7BA 2C59A 5B7PA 2BUAA 4GDFA 1MH9A 3O8BA 3QOFA 2WSMA 4EQ6B 4ZOLF 2WM3A 1A1VA 1F0NA 3W05A 5J47A 4BV3A 1NXWA 3PJRA 3N8HA 2CV0A 2EJBA 2ZKIA 2Q46A 5HIKA 4ISBA 3DM9B 3OPNA 4G1FA 3M6VA 3HACA 4WK0B 2XAUA 3QBTA 4MHOA 4PXAA 3IBYA 3UPTA 3NHKA 2HRBA 4TTJA 4UAVA 4BVLA 3HO1A 3M4ZA 4Z3DA 4DJJA 4DDWA 3U17A 4RZUA 1JG1A 1Z0UA 2RHWA 1OA1A 1GDTA 2AZMA 3RGWS 5THKA 4FGJA 4Q1AA 1JHOA 2P5TB 1YB7A 4DLTA 1VL6A 2WD8A 3QUCA 3S6JA 2XOEA 4BHTA 1R8JA 4QXMA 1GRNA 5C7OO 4JGIA 4CNBA 2QK4A 4J3NA 1ZH6A 5L8VA 4YO7A 3LYHA 3SEAA 2VYQA 3ZS8A 1FP4A 4WY2A 2FEMA 2Q5JA 1XK6A 2OORA 3DXFA 1P9WA 2CJYA 3H1FA 3HJUA 3HLKA 4JC8A 3AR7A 3VOBA 5DHSA 2G76A 1NLYA 2QUAA 3A1DA 1U3DA 3EVZA 4HVAA 3V8RA 4FUQA 2ASVA 2YJ4A 2P6NA 5DHUA 3ZDRA 3ETCA 4QHTA 1JRLA 1P1IA 1QGYA 1YGYA 3ICPA 3CVYA 3EZ7A 4A2PA 3M70A 4E5YA 5K8CA 3G23A 1UEJA 3G3EA 1VJ0A 3Q6MA 1TX4B 3OWHA 4UBOA 3W5JA 1KBZA 2QE7D 4EJFA 3VNUA 4XARA 2PZ8A 1GPUA 5CG1A 1NSTA 1QZTA 4YRNA 1PP4A 1KU6A 2IPLA 2V7EA 2WSBA 3B6IA 3KHSA 3LUBA 4JKOA 4S0ZA 3TD9A 2WC1A 1MRZA 2JLCA 4I8XA 4B45A 4JKIA 3MS4A 4UTXA 2G0AA 4PXSA 4KPUB 4X9XA 4YFYA 1W35A 5LOVF 4M9UA 1N2ZA 3EAQA 3MYYA 2I3GA 1BJRE 2ZE6A 3E6AA 4GBMA 4UEKA 3PQCA 4BNMA 3HKDA 2NTYC 2Z1DA 3DA8A 2WV9A 4D0GA 5CD1A 2OBMA 5AIAA 3G8DA 4XQ9A 3LDFA 4B43A 1NONA 2C9CA 2CN1A 2RKWA 3DCYA 3SKVA 2IEBA 2V5UA 5CT8A 4RD6A 4NV3A 3T4PA 4CCWA 4UW9A 1P4GA 1GTJ1 5ITSA 2FSVC 3EH2A 5AM1A 2GYYA 4K7JA 3NDJA 3NUZA 4E5KA 1DQNA 3C6BA 2VHCA 1FQWA 3FZGA 3QX9A 4FTWA 4L95C 4HY3A 4MQ5A 3ZZNA 3IKJA 2H9YA 3K9QO 3GUUA 4LI3X 1US8B 1SD2A 2ILTA 1NW9B 2HNKA 4GP9A 3CG0A 3DL4A 2BTOA 1YT5A 4MV7A 1TO1E 3CLSD 3L2OB 3VTFA 3WLTA 1Q83A 3OZAA 3DL2A 4DLNA 4B79A 1WAMA 3RFFA 2AI1A 2ZIGA 1RWPA 4RY2A 2A0YA 2X1VA 4MQFA 5GINE 4CN9A 3T7IA 4NCAA 1H66A 1S2LA 3WYAA 5LL6P 1SRRA 2XWSA 2BFOA 4RKFA 3STHA 5ES4B 5LMZA 4FZ5A 1NC1A 3IP9A 4UNSA 1F1BA 3FTQA 4UE3S 2QPTA 3OESA 4MV4A 4KAXA 2NU6B 1ODLA 2IEZA 3KKLA 1LU9A 3NP9A 3O73A 1MXHA 2EW1A 1RHJA 2ZCUA 4TS3A 5AW9A 2AC7A 3ABRB 4U6SA 1EFAA 3Q3VA 3U9TA 3QHQA 2F8LA 3ETHA 3OBIA 4Z0TA 5J59A 1GPLA 2E4AA 1TZBA 2I65A 1DJQA 1QYCA 1XZLA 2W2LA 4UE6A 5EJMA 2ZRQA 4DA9A 1NNLA 5AK6A 1E7RA 1HFWA 1EFDN 4ESOA 1A9XB 4E33A 1DB3A 4CZ2A 3KUUA 1TAQA 4ZYVA 3RVBA 2WE7A 4IRUB 2GD6A 2PAAA 3WNDA 3QLVC 1U1FA 3EY9A 1SCJA 1R0SA 2OOKA 3JAKB 2YMMA 1GG2A 2W37A 4NBWA 3L7JA 1VZ2A 4OLHA 1C8BA 1PRYA 2Z1MA 2ZIWB 4I5FA 4L5AA 4IOLA 5EJ8A 2GEUA 4GKAA 1UK9A 3IT1A 4U1RA 2GM9A 2WU3A 4K9PA 3HU3A 4RE6A 5CLHA 1T1JA 2D1FA 5A2GA 1R9NA 4CKYA 1UBEA 1W29A 1WF3A 2RHBA 3NPAA 4I8DA 1GEGA 5M34A 3DL7A 4NYIR 5BQ3A 3B1YA 3ACBA 1K66A 3AB8A 5C8XA 2EQBA 1QKKA 4OUDB 4PX5A 2J7PD 2EEPA 3D8SA 3P0IA 3VC2A 5JEEA 1HE1C 1OD6A 5JFGA 4U3JA 3WQBA 2HMVA 2CHGA 4YAUA 1OXUA 1XVUA 4FU0A 2B6HA 2Q5HA 3TFOA 3VU9A 2Q27A 4AICA 1Z07A 4LCBA 3PGA1 5HE9A 1NXSA 1K3UB 3CR3C 4G1EB 2ECQA 1N2CE 2IXTA 3L0IB 4LEIA 5KTSA 1W76A 3ACDA 3L7AA 2JFXA 5K0JA 1W4AA 3ZV4A 2J3LA 1YTLA 2C5HA 1O7JA 2WVGA 4FX5A 1OW3B 3P19A 4H7IA 1M6WA 1TMKA 4F1JA 1X94A 1IXRC 1H8HA 4URWR 4GXQA 2JGFA 2J9RA 3KB2A 2P4SA 3KR0A 5DW0A 1JHRA 2YVAA 4WZAA 5EN4A 1QDUA 3EZXA 3ONNA 5JCOA 3BWXA 3LBAA 2WJ6A 2IOFK 2CXNA 5JI3E 5A6SA 1ZK2A 1GLGA 3LWNA 4OMCA 1Z47A 2R6ZA 3GGJA 4MS4B 3C1OA 2BMWA 2IYRA 3WDMA 5KINB 4MW5A 3HKCB 4NICA 3LUKA 4G1BA 4O8CA 4XYMA 2EFCB 5G53C 2DU8A 5C52B 3B6EA 3IVXA 5SYNA 4YAIA 2X2OA 3FSRA 1SQSA 5IH7A 5EINA 1DP4A 3E23A 3ILXA 4U8GA 4H7FA 3R7FA 3SS7X 2VHQA 4MLCA 1QLJA 3CUYA 4F9EA 3U3OA 1R5OA 4LCEA 2G7ZA 1E1DA 3SSAA 2HMWA 4QGSA 4ZTBA 2JD1A 3KSDO 4URVR 4LOIA 4H27A 1E20A 4DL9A 3Q98A 5I7AA 2NPFA 3KQNA 3IAAA 3DAYA 3ICWA 1J0CA 1UBNA 5CW1A 3BRSA 4JNKA 3V4PB 4UOQA 5F1YA 4DWOA 2XUDA 4WAUA 2GAIA 4HLCA 4ONEA 1MFPA 4GOLD 3D0OA 4EHBA 3LUJA 4EG5A 1L8QA 2ZIZA 2ADMA 3ANTA 3HB9A 2DCMA 4W5HA 1FJGB 3WVNA 1G6Q1 1M6HA 4HQFA 4NBLA 3SDBA 1L7BA 1LEHA 3I2KA 4ZAFA 4U7JA 1UXJA 4ZN6A 2FMXA 5AW5A 1YVUA 4E94A 3BAZA 5HQ3B 5I4BA 2AQHA 4CKWA 1Z5PA 2RH8A 4TV9B 4BMYA 4LZWA 4QPJC 4HH4A 3UKOA 3UYKA 3EFOB 1VCMA 4ZTZB 1XHFA 2EIXA 3AJRA 4GPTA 2ZULA 2IHVA 4EGAA 1FCJA 4WZZA 4KX5A 4TVOA 5ICFA 4J49A 1TJ4A 1NUSA 2GERA 1E3IA 3VR5D 2R79A 1GSAA 4EJSB 3MOGA 3EPLA 3EGDB 3CXUA 4F71A 3ISTA 1Y3BE 2LDBA 1LS1A 3VO8A 3KQTA 4FQ8A 1I4TD 2CBXA 2BHRA 4N5LA 4PPQA 4PZDA 1JXQA 3RK0A 1H4SA 1DFIA 1JA1A 1RWXA 2J6IA 3PQ7A 5ECYA 2OSBA 3K4QA 3VAZA 1GPNA 4IVRA 2FE1A 4MP8A 3RJ9A 2E9SA 1EFPB 4X90A 4MGYR 3AINA 3E2MA 3QG5A 1DKNA 1JG2A 2DSNA 2JLBA 2PX0A 2GAAA 4JJ7A 4JLUA 3LCUA 4BATA 4CQMB 5EHNA 4BLPA 3FKSA 1Z6XA 4Y1RB 4E0BA 4XVQA 3A3OA 1C9EA 2NU6A 3PI7A 4M1SA 4RESA 4EGCB 4ON9A 2QUKA 3OE7A 4RZ2A 2HTFA 5FULA 3TRDA 5P8WA 2QGNA 3K5IA 4KMMA 2RBKA 3CV3A 3PXEA 4L8VA 4PONA 5JANA 4QRIA 3FR8A 3IAS6 4H3SA 4S1OA 5B37A 4KO1S 3DB1A 4LNAA 3I05A 3KU1A 5FPTA 5BR1A 4O2AF 5TF0A 2FB9A 3VKGA 4AX4A 4IIHA 4FZ3A 4HH0A 4TS1A 4E88A 2YZMA 1S89A 1CY7A 5ITZA 3DQQA 2GM5A 1BW9B 3FTCA 1XTSA 1H42A 1WVMA 4FJ0A 3OHMA 4EUKA 3FF4A 1OWNA 3MQ2A 1LPNA 1X8KA 4LGCA 1BN7A 3LG2A 3R4VA 1CUZA 1E9BA 3QU2A 3BF8A 3FWKA 2X86A 3P2YA 3QVTA 1TKRA 2BSQA 1Z34A 1BHJA 3SN6A 1KZ4A 4OQMA 4EJ0A 1P5ZB 2R7LA 3H05A 3KXIA 3TTTA 2GPSA 4ILKA 5K03A 3T4XA 1LA2A 4MV1A 2BH2A 3GLFB 1ZD5A 1CTQA 4CV2A 3LVQE 3CLHA 4MGKR 1NSYA 2P1ZA 1RJ9A 2QVYX 2X23A 2YWCA 4L50A 5IULC 2FZKA 2Y1LA 3FG9A 5I5GA 4XLLA 2H7YA 3UWSA 4LKRA 4FHGA 1X1BA 3FYUA 3KFLA 4PPFA 1X1RA 2MIIA 1PE0A 1YE8A 2E85A 3L7IA 4Y0AA 5LA6A 4C4SA 4QG3A 3E48A 4G0ZA 1AXRA 5CEFA 1Y6JA 2COKA 3FBWA 1ZZGA 1EXWA 1RP7A 2FFBA 1PWHA 2YQZA 2ZVJA 1JYSA 1QCZA 1XZMA 4YJ3A 5J40A 4F8EA 5CBKA 4PHGA 1W75A 3FAKA 1YZTA 3VYVA 5K0FA 2BP7B 3H8SA 3RAPR 2L42A 1AZLA 1JNXX 2ISSD 4D9FA 1KRHA 3QK7A 3TSOA 2D00A 3W90A 4FGSA 4G5QA 4P5PA 4BFYA 4JYZA 2EFGA 3PUHA 2MCFA 2A88A 2AYYA 4O4IF 4L75A 5C1BA 4R8VA 3ZIAA 1T2VA 1HUQA 3V1MA 1IQUA 1O97C 4BVBA 2QS9A 4PWZA 1C41A 1YK0A 4GZMA 3B3GA 1EB9A 1Z8NA 1IBMB 3W5UA 4GKBA 1AO0A 4J3FA 3MEQA 1M76A 1QO7A 1DO8A 5A5GA 1OX4A 1WMSA 1XTQA 1ETHA 1NATA 1Q0PA 1KDRA 4Y1EA 1NI4B 5IJAA 4QG7A 2VAVA 3LIIA 3GXBA 3WL3A 5CXUA 2XTJA 2X8WA 4OGKA 4B5LA 1U28C 3RC9A 4PYJA 5KJ6A 1EI9A 2F3TA 1NQVA 1YU9A 4K9OA 4PRLA 4GSLA 1ADGA 2GRUA 1G21E 1QONA 1ULZA 4IF6A 4IZHA 1LDBA 4QQ8A 4M88A 3DTVB 4XXHA 1G20A 1OPXA 1KSFX 4QJ3A 2EJWA 1NZFA 2JS7A 3BMCA 3BZUA 1DIAA 4A9AA 2VXBA 2PIDA 2I6SA 4I99A 3J80A 2W6PA 3T52A 1NLZA 2C9DA 3MT8A 2BELA 4OJYA 1UJ6A 2VHUA 4NV1A 1KU0A 2XQGA 3O8QA 3F73A 3R6GA 1GAQA 4FMPA 1G7TA 2G1AA 3PFHA 3U37A 4HDSB 2YWFA 2QD3A 1IZ9A 4HK4A 4HL6A 2QNRA 3WLPA 5IHPA 3FY4A 1FNSA 2GYWA 1X1SA 2OHVA 4G5OA 2Q21A 3DZKA 3VR2A 1KI7A 5EJ9A 2XWBF 1S02A 3DTVA 1G20B 1QP7A 3U44A 3IT3A 3U19A 2R5WA 2V03A 2SKDA 3LW8A 3SSMA 3TL3A 3LZ6A 4D0LB 1BMTA 1CIVA 3QU5A 4KK3A 3OQIA 3Q88A 3TX6A 3QVJA 1M2HA 3DE3X 2H5LA 4BU0A 3DAOA 4R8KA 3NHAA 2JL1A 4Y9RA 3ZGOA 1BXRB 4KVZA 5T4BA 5CCXA 1XPUA 1R4MB 4MLDA 1QTNA 1XTIA 5HJ2A 2CLHB 1FFWA 3A9VA 4GT1A 1OB2A 2FPMA 4MINA 3QWBA 1I3NA 3S70A 4B5KA 3ZY2A 2V55B 3MJFA 2XKKA 4YMLA 1PK8A 3F8WA 4HLQB 1GL3A 1TMGE 5JTTA 1ZLXA 4O2AA 1DARA 3KEGA 2PJZA 4LRWA 5BO5A 4BP3A 3U7HB 5KCMA 4LKOA 3BFXA 4C78A 1CPYA 4DV5B 4U63A 2R48A 4RHYA 4UEQA 4D79A 4TWAA 5KPJA 5FQOA 2ZJFA 5BV8A 4E5DA 1OE0A 4LMPA 3K8ZA 2IYNA 2J67A 2V0CA 1NBIA 1VFNA 4WPGA 1R0KA 1CCWA 1SBNE 3L7CA 5D00A 1RIIA 2NXNA 1BXKA 2AHRA 2VJMA 1R6UA 1WDTA 2NP7A 4M83A 2IIBA 4KIUA 5JD6A 4BN0A 1P1HA 1XZKA 4P93A 3IAM1 2A1UA 4XA8A 5JMTA 3HM2A 4F93B 5CX1A 4XFKA 5B1YA 4P81A 1Z29A 5F4ZA 4RH0A 2DFKB 5K4AA 2HSDA 3PQ8A 3NOOA 5AW7A 4IKPA 2VQFB 1N5LA 4M55A 2R25B 5EHXA 5HUJA 1HFKA 4F86A 3HY4A 4X0EA 3IODA 4WW0A 5TY0A 4QPPA 1L4FA 5JDIA 1SCUB 2QSYA 2ID4A 1R6BX 1JAHA 1UKAA 1WSBA 2XCOA 2OXEA 2HPAA 4JLNA 2BDUA 4U0KA 4JXZA 4I55A 2XNCA 1LW6E 4OL9A 1A72A 1SK8A 4NTZA 5DIZA 2IYQA 1HGXA 1SKBA 1OTYA 1Y4AE 3Q8WA 1MW8X 1T6BY 4R68A 4X60A 3G9TA 4YJ2A 1EHCA 2AIRA 2AXEA 2J0VA 4NECA 2H8GA 3BQNB 3L7LA 4EF6A 4CR7A 2HA2A 3RPEA 3QLUA 4MW1A 2FZWA 2NVOA 2O5VA 3BDAA 5AI8A 1BXZA 1ID1A 3TQIA 1DAFA 4PIMA 3MUEA 2G9NA 2R7AA 2HU7A 1V4BA 1IEWA 4UEWA 4YP9A 3Q7SA 4LYJA 4H6XA 1G3IA 1NZDA 4C0AC 3BZWA 3P2KA 1QIDA 1SCUA 3EF0A 1Y3CE 3KTAA 2XE7A 3W9SA 1DFHA 1LV7A 5DXFA 4DQUA 2JLQA 2OV6A 1E0KA 2ZAYA 1ZGZA 1N4DA 2ZJ0A 2ZSIA 3I2FA 4NYJR 3UC9A 1KI9A 4CPDA 3T9BA 2G3YA 4OUDA 2D2IA 3T9FA 3CZAA 4UM7A 1QV9A 2WJZB 5TVKA 2VF5X 1XEFA 1KY5A 5IZ4A 2XVAA 2AFRA 4JUFA 5EJEA 4KQ6A 3L41A 1MJFA 3W5DA 2WUGA 2RGUA 2JHGA 5F9MA 3NALA 3DE4X 1OLUA 4LBWA 5EXDA 2R1VA 3KHTA 1OC2A 2QZ4A 4YIKA 4BO8A 3GRYA 3CE9A 2VQSA 4D8TA 3O1IC 1Z8HA 3P9XA 4PYOA 1TZMA 4D96A 2UVPB 3H42B 4NABA 1O58A 1UFVA 1V25A 2NWQA 2R6CA 3ELYA 3WGHA 3CRVA 3FYHA 2D2XA 2FUNB 3QEMB 2PV7A 4K3UA 3H1BA 3A1FA 4E5UA 2GDZA 1LLUA 1HLPA 1Y1SA 2AEMA 3B5JA 4OXKA 3DD1A 3MD9A 3REFA 3BXZA 2O8CA 4LNUA 5ALOA 1P91A 4ATNA 2H1WA 2HA6A 3IAM6 3N2GB 1PWZA 3LA6A 3WL7A 4ZC8A 3NV7A 3RG2A 1RPZA 3D8RA 3FLEA 1W93A 1R00A 2V7TA 2VS1A 1JMVA 3D5QA 1P73A 2X4LA 1YL7A 1B4DA 1G6KA 2TYSB 3DDOA 3P0JA 1DC7A 1MC1A 2GN2A 4NULA 3RBVA 3VOTA 3MGAA 2ZYVX 1PEKE 2FZ5A 4O1IA 4BWYA 2UYGA 3UJBA 3PX2A 4GUAA 4H31A 4ZRNA 2P30A 4K40A 1V5GA 1VRVA 1YOVA 2VBFA 1TEZA 1I0IA 2OZLA 3PEEA 4BCDA 3JWJA 1PFVA 4GQBA 1P7CA 4LZPA 3T9EA 3V8VA 2XODA 4ZC1A 1YZYA 4Z1MA 3E9MA 1USGA 4NAHA 1I51A 3E7FA 2P9QA 3I09A 3CPJB 2DFLA 1RAIA 4W1RA 1V2GA 1AH2A 2EWMA 4PSKA 3FNEA 3VR4H 1BU5A 3EVCA 1WULS 4A3SA 1ZG3A 3E5NA 3MRXA 3QFFA 3OUUA 4F5EA 2W8ZA 3ZV3A 3A70A 5DU2A 2BFCA 3IQHX 2R85A 4FSDA 1F8YA 5FTKA 4EYGA 4KHZA 3HXPA 2B98A 4OYHA 1UJBA 3UAXA 1E77A 3LKBA 3AU8A 2A57A 5CIYA 5IKEA 4LVCA 4QREA 1MOZA 4KUHA 1GAXA 2WHEA 4UVEA 2VAXA 2EW2A 1KJ9A 3VUEA 4CV0A 3EVNA 4E09A 1X1EA 1WUTA 1RCTE 3A6JA 3NBMA 2GWHA 3FVWA 4JJ8A 4PC1A 5D1HA 3S2EA 4C6TA 5BWCA 3U5ZB 1F7VA 2ZIXB 3EVFA 4I4IA 1FS6A 4CHGA 1JDSA 3PX3A 4FMCF 1Z2DA 2NYVA 3ANXA 3O0TA 3BMQB 4ZOLB 1UUFA 4UOEA 4IWYA 5LM3A 4O2AB 3MD0A 3DHNA 1BX1A 1U0EA 3PNYA 1YB4A 1VKHA 3M81A 4R3NA 1N36B 3K94A 4DWJA 2VDOB 1EUCA 1R8SA 3WLOA 3BJZA 1XX6A 5DM4A 5AJXA 1N6OA 1P8JA 4IKOA 5KYWB 1K7CA 4PNPA 3HCFA 4G5FA 1Z16A 1KKUA 3V9PA 1X1QA 2VXCA 3MRVA 1F7UA 1U9IA 1N0HA 1GQ2A 1UDAA 2BJVA 1HM5A 2ZIXA 3AOEA 3JRWA 2VZ8A 4KDFA 3ENNA 3IPYA 3TOSA 3VPSA 4C01A 4OP3A 1E1MA 1L5QA 4FGKA 1V96A 4AJ4A 4LK3A 2PVCA 1WQ3A 3GEIA 2JLWA 1NP7A 2YMLA 4GNKA 1QH8A 2ADFA 5F52A 3KL4A 2QJOA 4JC5A 5FOVA 1B8UA 1X8JA 2VO1A 3AY6A 1JDUA 4GVXA 3CJRA 1ISFA 3C24A 3OFNA 3KT8A 3GEPA 5BOVA 1IXKA 4OHCA 3CEJA 1Q1AA 3IVRA 3HQ4O 5EG5A 4D8UA 5LZ4A 5B4VA 2XNDA 2JZCA 1KA9H 3PF8A 3NJ4A 5BVGB 5EQFA 1OWPA 3FRIA 1E3EA 4Q02A 1M8PA 3LY5A 3X1DA 3I4FA 4F5WA 3C3AA 4PQYA 4RGQA 3PA6A 3K15A 1Y48E 1X86B 1X7GA 3GVHA 5E7QA 1DEHA 1H5UA 4IOJA 5H59A 5LP6F 3CZCA 3P9CA 5DCLA 4RGVA 4P3YA 3UK1A 1TQ2A 2JFZA 1YTUA 3IO5A 2EU8A 3N3AC 5LDHA 4B3RB 2F2TA 2PX6A 2B8WA 3FIUA 4MKHA 4P0TA 4C5AA 2OAGA 3OJLA 2ZRFA 3EDOA 1V1MA 3FHOA 4L27A 4ARBA 7GPBA 5HX7A 2XUFA 5BT8A 2UUAB 3LAWA 3T7SA 1ICEA 4P7FA 4QUAA 4M9XA 2EYQA 1XXHE 4MVJD 2NX2A 1SVWA 2V65A 1A9QA 3BBLA 3WGGA 3DMHA 2I2FA 4KFTA 1DG1G 1P9LA 1Z28A 4BY9E 4RZHA 2OENG 2D54A 3BQMB 2B2NA 1DFGA 3OZVA 3UXMA 5MFPA 2XUKA 3WQHA 5K7SA 3OF2A 4KR2A 2YRXA 4RMNA 4CT5A 3TGLA 1FOEB 1XCOA 3C6QA 1E8NA 1ZK0A 2HC9A 3G8AA 4YJ3B 3OURA 3P0HA 3UJ9A 1H3FA 4PCAA 3QH4A 4YAOA 2UZIR 4XQEA 5HTKA 2VJPA 4XJSA 1XWIA 1QV6A 4D92A 4S1WA 3WWDA 1JGTA 3K9HA 5GGYA 2GPYA 5KX5F 5EJ5A 4ZCTA 4KYIB 4EY6A 3G0GA 5KNDH 2AC4A 2W6ZA 2SKCA 3CYFA 1KS2A 4OXXA 4QM6A 3STUA 2QVZX 1RW4A 1ZIXA 4X97A 3WLJA 4OXRA 3P27A 3QEOA 2D0DA 1QCDA 4X62B 4Z9FA 1E1RA 4NYMR 1JLSA 5PNTA 3KOUA 4PQRA 5CJ2A 2KHZA 1OR8A 3JVIA 4GM1A 3E4CA 3UAZA 2VP0A 1Z38A 5EC8A 5JCPA 4ZYYA 1JQEA 3SI7A 4NZ9A 3CEPB 1PD1A 2XB4A 4NOMA 2NPIA 2OHIA 4X3CA 4ALJA 3CIFA 1ZS9A 2G40A 3K1YA 1UMBB 1UODA 4E32A 5KWEA 2B37A 4RLSA 3MHTA 2EHDA 3AM1A 1SHUX 4QDJA 1VPWA 4BV2A 4BBPA 3LOUA 4GQAA 5AT1A 4I14A 3T3HA 1A8PA 4F2PA 4ZMSA 1ZXLA 2QMOA 2O0LA 1Z82A 1KJWA 4O63O 2VSXA 1VSTA 3RU2A 1A9RA 1R8YA 4BQFA 2VAWA 3ZXYA 5DRTA 3DWIA 3EYAA 3ILSA 3KKPA 3ZBQA 5KNBH 2QTZA 3WV4A 3T7CA 2IOYA 1LK7A 1QH0A 1X15A 3WADA 4MV8A 4MCAA 2G08A 2C2BA 2W2KB 4B7AA 5JU6A 3A3KA 4BO5A 3PC8A 3QPCA 3LHIA 3QKTA 3HUDA 4TQUS 1G3RA 4G0MA 1JIXA 4MQLA 4HBGA 4R7TA 4ALIA 4FSXA 1K8QA 4OU5A 4YLGA 5G0UA 3GPLA 2YJ6A 3N05A 3UHPA 2JAXA 4X7BA 2OO5A 4HXGA 2C3UA 3GHYA 1SHJA 1XHEA 3NEYA 3RW9A 4C7KA 1YASA 1Z45A 1DEXA 1GILA 4I81A 1HOTA 5BNTA 2DZDA 3OJCA 1NHWA 4IUBS 3TLBA 1XD9A 2XMGA 1IBKB 3AZPA 1XELA 5A9TA 3H5NA 5K4GA 2AS0A 1LWOA 4X1IB 1ZKDA 4EZEA 5CVUA 2IXAA 2QN2A 3F5DA 3INGA 4GBED 4ECAA 5LC1A 3FCSB 4QJ5A 5F7XA 2FMIA 4NCJA 4OB8A 3GRPA 2BEUB 3L8GA 3O4GA 2QMZA 5JAQA 1T9GS 4WQMA 2C5FA 4KH0A 4GXTA 1M0TA 2A67A 3ITEA 4J75A 5CK5A 2WPDD 2XUOA 2I4IA 1XZCA 3O0DA 1QQ6A 4Y2RA 3TUJC 4EUHA 4C4AA 2O0KA 1NKVA 2CDBA 3K0BA 1NVUQ 2A9PA 3JPYA 1GPKA 1PHRA 2G72A 2GF9A 1DPFA 1UXIA 1K88A 1PFUA 1YIOA 2VSYA 3VR3A 3F5MA 1TLLA 3Q72A 5B1DA 4KKVA 1GA4A 5CAEA 1AVTA 2G83A 2AG5A 3NNNA 2FHPA 1DZ3A 2ZJ2A 3M83A 3KCNA 3NBXX 5TXGA 2A5LA 4MS1A 3DTNA 4B4UA 3EDQA 3T54A 2WP0A 2Q2NA 1A9OA 3KUDA 4OOEA 2AMJA 3UENA 3QOWA 4DXHA 4W5TA 5FLKA 5F64A 4Q1VA 1ND5A 2FWMX 2I78A 4OQPA 1M8JA 1FYXA 1CQIA 4UZFA 5JMWA 3FPSA 4AZWA 1ZR4A 2V0GA 5JDIC 4GRDA 5F3WB 2IEGA 3VNVA 2XQVA 3BMNA 3NX4A 3ISJA 3K53A 5JLAA 3T5TA 2C4TA 2GPWA 4DZTA 4X85A 3QE2A 5MN6A 4LSZA 4ZWNA 1CZNA 2D5AA 4FHFA 4YRLA 4NXNB 2HEGA 2A2ZA 3ZNNA 2C82A 2PS1A 1WNFA 2O3UA 3ZEAA 1ZM2A 4I55F 1DBIA 3WYFA 1BW9A 2WHPB 1FB5A 3B53X 4QUIA 4K0KB 1X7ZA 5TMBA 2HDNB 1FUYB 2FOIA 4FI3C 4NHOA 4BLUA 5I7RA 4JASB 3SIPA 1VCIA 2OZPA 5IJ0A 3TJZA 1K4KA 2W8BA 4UTOA 3F3YA 1DWPA 4P2GA 3QQPA 2V0NA 1T4CB 3X1MA 4DQ0A 4B8ZA 1YRQA 1QHFA 1X1CA 1T91A 1RJ9B 1MD9A 1MO5A 3BUSA 4KQMA 4N8DA 4DS3A 1YS9A 3D2LA 2PWBA 5EWLA 1VPLA 5HF6A 5IVIA 2F1RA 2CHUA 3F2VA 4OVKA 1WHTB 4WESB 1UFKA 2VIIA 2CNLA 4L9WA 4I9GA 3SQMA 4IFIA 4GVPA 2X0DA 1SCQA 4ABYA 1GOTA 2FPRA 3RC7A 2QPLA 1USIA 3R7NA 4EOGA 3ROKA 1CFJA 2GRAA 4HLNA 1IM2A 2QRKA 1MCZA 1C0LA 1GQQA 3A1NA 1V1RB 3WHLA 3UOWA 1O1YA 1TQ4A 2PU5A 3AT1A 2WJAA 1OI3A 3LYAA 3GVCA 2PTHA 3G0IA 4KJXA 2Q4BA 1ISSA 1O8BA 2WM2A 3AR5A 4DYDA 2CVHA 1GPH1 1WW3A 4B4OA 4TZ6A 4TTQA 3BQ9A 3M8KA 3D3KA 4MCIA 1APBA 5KTTA 2A35A 2EX4A 1JJBA 2A92A 2BTEA 3FJ1A 2AJTA 3AWIA 1JHVA 1FEZA 1QJ4A 3HL0A 4CDRA 1Q1EA 3E82A 4KQFA 1A9PA 3FNHA 4BO3A 3GPDG 4IDOA 2AX4A 3X1YA 1S8AA 2H8KA 4J90A 2QMUA 3PDUA 4G01B 1E2JA 1AZSC 2J59A 3ZK9A 2VTBA 1JEQB 3PPIA 3R6WA 1E0SA 1UMCA 4DG9A 3Q6NA 1DQRA 1TE2A 2UVPA 1DV2A 1GNQA 4FFMA 4C0BA 4RD2A 3C3DA 4BJ6A 4QYIA 1TPYA 1QPGA 3DOOA 3GQBA 3A26A 1T0BA 4K86A 5JSFA 1QC5B 3OEHD 4JL6A 2ZJ5A 4YHHB 4Z4IA 2WB4A 4RA9B 2C9BA 1YKSA 3HJFA 1GNLA 4RCYA 1T9HA 1XDGA 1LDEA 2UYHA 1G5FA 4AS1A 2E48A 1KY3A 4LJ5A 1GAEO 2G04A 2AX3A 4MNTA 4JJGA 4IZIA 3C41J 4AUKA 2FZEA 1KVTA 1YBAA 3SVLA 1N8NA 5SYAA 4XM1A 4LF8B 4YJGA 2D0PB 2JLXA 2QLFA 2XNKA 3PR3A 3S2ZA 1Z25A 3LWBA 3B1ZA 1A1SA 2X7HA 2P9YA 3CONA 2GBLA 2J7PA 5JJIA 4ABTA 2C4VA 1YR8A 1I36A 4EHIA 3EEFA 5HQTA 3NHWA 1XF9A 2FEKA 4RA9A 3SJAA 2ONCA 2HPHA 4OLJA 1MB3A 4J94A 1OZ0A 4UHBA 4OU4A 4LFBB 3SEQA 3OQ1A 4PE5B 2W7TA 1DBWA 3KZOA 3JZIA 3NHMA 3RU3A 5I7EA 4HWPA 1ISRA 3EN0A 3O4FA 1WXQA 1I4LD 3IEKA 2WTMA 3A1EA 3QFCA 1N5OX 2G6TA 3JR7A 3PE3A 1EK2A 1F2UB 4MRRA 3MBOA 3OOWA 1XAGA 2DETA 1E6CA 4ID9A 1ZITA 4MR8B 3C48A 2ZUTA 4UUBA 3RKSA 2GPNA 1YRLA 4PLZA 5ALFA 5EIBD 1DRVA 3UHFA 4F38A 2J33A 4P32A 3IBFA 3TVTA 4CLXA 2EZ4A 5B7QA 4B4KA 3EXIB 3PTAA 1LK0A 2QDKA 3LUAA 1XZHA 5HBRA 1F4LA 1XCJA 1P0CA 1Q7GA 4XVUA 1E2DA 1TT5B 4AJEA 1RBMA 3O8DA 1VG9B 2VJMB 3ZR4B 3U40A 2YDXA 3HSSA 3COJA 4LOJA 2ZR9A 4V3BA 1L6RA 3O9ZA 1KIAA 2ZS7A 3AXSA 1E6UA 1RM0A 2GFQA 3BFKA 3HDQA 4UCXA 1N0UA 4IV0A 5IZCC 2QRPA 3GEEA 4QUHA 4ZU1X 3AOEC 3PFKA 3STYA 1SVSA 2LD4A 3U7RA 4HNQA 4LECA 1DJPA 4TKUA 4RTQA 3ZLJA 3JQRA 2VNAA 5DSXA 5AW1A 3NETA 1XMPA 3C6XA 2OHGA 3HABA 5HMLA 1ZNZA 4NK5A 4YRJA 1VLLA 3URMA 3DP9A 2B4KA 2YHBA 2H54A 5D5PA 5IDXA 3W8NA 4CRWB 3DNFA 5DFAA 1W36B 1GTG1 4UUOA 2C3MA 1X7ZB 4LVOA 1Y8QA 1A8IA 1AGNA 4MA0A 1E3TA 4QJIA 2F1KA 3ZZUA 4OB7A 5EIAA 2O2EA 3I58A 3K73O 4GPBA 3KB6A 4ODIA 1OQAA 4RZQA 1PTJC 5B4TA 4C08A 1P4AA 4M87A 3KWMA 5IJ9B 1V26A 3Q3GE 4QA9A 3O3OB 3SCZA 4MEJA 4DNQA 1ENPA 2AF3C 1L4YA 3DKIA 3JPWA 5A4JA 4H15A 5C8DA 4D25A 4KLCA 4FVTA 2JDID 4W8OA 2W22A 2AFHE 5FPSA 5T41A 1PX2A 2JJ8A 3CVJA 2HZBA 2DT5A 2PGIA 3DEFA 4QJBA 4PHCA 1TW2A 2IXDA 1JZSA 1IY2A 1U0FA 3DFMA 3GUYA 3IHKA 4HAOA 3VBCA 4B74A 2Z6UA 1JPNA 3OQNA 4DPMA 1HYGA 1ST2A 2PTGA 3PNPA 5IDVA 1PR6A 1FP6A 1VKJA 2CVQA 1UZLA 1XFDA 2Z43A 3PITA 3SY8A 1WXHA 4ACBA 5JJ5A 1AY0A 3UW3A 2AR0A 1JDBC 4RTPA 4YRTA 4BBZA 2WWXA 2LCIA 1ZMRA 4I4TA 4MYCA 5F51A 4KREA 4JLAA 4AFNA 3MINA 4DCJA 2GTIA 2IHUA 1A5TA 1J7KA 1HKHA 1ICIA 3KX2A 1MN6A 2O7VA 3IR6A 4O4LF 4X6UA 2XDQA 5AJTA 1LDYA 3QNUA 1ULAA 4Y9DA 4YJFB 2FCRA 3HUTA 1C8KA 1XJCA 5EFOA 4BO4A 1PL7A 4BZQA 4CMBA 3W3AH 5IPFA 4TKLA 2QVLA 2JGJA 2WJWA 3A32A 3AI2A 2RAPA 4ALMA 1NMQA 4GXRA 3VR6H 1A2QA 1E2QA 3RSQA 1NNI1 4JMPA 2Q9BA 4A8JA 3L7MA 5F2NA 1UDBA 1WW2A 4GQIA 1G21B 4B8YA 2DFPA 3CUWA 4KQKA 3SNHA 2RK3A 1KWKA 1M7GA 3GB9A 3X2EA 4TXLA 1S7CA 4KBGA 3BGWA 2DPHA 4XOUA 5GPBA 4FK8A 3AY3A 1AURA 2IS6A 1ITZA 1JKJA 1DT3A 1NW7A 1E8DA 2NTJA 4R84A 2XWPA 4C7BA 3AR2A 3DUFB 1Z7WA 5C1IA 4EWLA 1F2VA 3HZZA 4GEGA 2YFYA 2HRCA 1P2DA 1PGOA 4LX8A 3WSVA 3GBPA 5IXSA 1PAUA 5IF3A 1ES9A 4S3MA 2J4DA 2WICA 5FA5A 2O59A 3WGVA 2IH2A 1XZEA 2BKAA 3KXLA 1ADJA 4NBUA 1WCYA 1CDDA 4ISCA 4R54A 4IFEA 4D3YA 3EQ6A 3RS8A 4D7AA 1NR5A 1GR0A 1MJ5A 3ASZA 3IQGX 5AI6A 1D4FA 1M2FA 1SURA 1SXJD 1TCBA 2JGAA 4RQTA 4ZI7A 2R6DA 4M46A 1Q0TA 2JLYA 2JFVA 2GBCA 1QTQA 4L4ZA 4XPZA 1J7JA 3I92A 2CL6X 3AK4A 4S04A 3V1UA 2WAMA 1PFKA 2XRYA 2YCBA 3QF4B 2CUKA 2V4ZA 5FWNA 4N3GA 4Q48A 4ZZ0A 1C3JA 4P54A 3L77A 2OCAA 3S8YA 1NBOA 5IKMA 4B2LA 4CCYB 3NHUA 2YXDA 1PYDA 2X8LA 2OA0A 5B7NA 5JCXA 2D2EA 5AKJA 1YHNA 1E1CA 4QO8A 4IHJB 1OI7A 3GLSA 2B78A 1GG8A 3C1TA 3MC1A 1SQ0A 4LYGA 3TH5A 4DA0A 1ORIA 5FUVA 4B34A 2WPNA 4UFOA 2WEKA 1XQ6A 3E15A 2XR1A 3K0EA 3MWDB 1WA5A 4FHDA 2D2FA 5KYNA 1YF3A 2AMLA 2WSYB 4CMCA 2O2HA 3M89A 3PQEA 3DJFA 2H4ZA 4B3JA 3QIVA 2HDHA 2HLDA 4OGWA 5ILGA 1Z2CA 5CFPA 1DCTA 4GPZA 2NU9A 3MB8A 4UU7A 3T94A 3RD5A 1TMOA 4DUGD 1M2OB 1RLOA 2D59A 3RFCA 3X1WA 1JEDA 2HD4A 1UPUA 1S96A 2J0UB 2GLUA 3CU5A 4XWGA 2A9RA 3SHQA 3KEQA 2H65A 4CLDA 5JSQA 1PVDA 1BH6A 2FLKA 1UJ5A 1QNLA 4DDVA 4AZ3B 3F6RA 1X87A 3AO0B 4MR9B 1L4GA 1PK7A 2ENUA 3FWYA 5FFNA 2PLAA 3HUFA 4B8WA 3IILA 3QBJA 4BNJA 4QUDA 3AVUA 1QIIA 2RHCA 4RPIA 4YYEA 1Z7YA 1S2NA 4BEVA 4ZJZA 4TZKA 3HSYA 3W1EA 3AUFA 4BNDA 1WCIB 5EKXA 4AD8A 2OKCA 1RWNA 2JGRA 3DLPX 2WIBA 3I6QA 4HTFA 2VP4A 2X9GA 1FX0A 2KX7A 2HCRA 2ZJ7A 3F67A 3DW1X 3OIYA 3HKEA 1N6NA 1XU4A 3HJRA 4UKDA 5CPBA 2E6UX 5EKUA 5JISA 5JR3A 4F1KA 2WOOA 4V1CA 4C43A 5KTRA 1KJQA 1D8TA 4RH3A 5FYDA 1GM5A 4CN8A 2HHAA 1RM5A 1PQPA 3PRKE 1RM4A 3JSXA 1QF7A 1RRCA 2BCEA 2RBGA 2CDAA 2W2XA 4V0RA 1O3YA 2C9MA 2FP3A 3IUQA 3ROXA 3I9LA 3VKFA 4BZZA 2QQFA 2F9FA 2HWXA 2OFOA 3NRJA 4W7HA 5HG0A 4RZXA 3RFVA 5I6DA 1U7ZA 2QLLA 4O25A 3U5TA 1CETA 2OXCA 2MSCB 2P4HX 1QS0A 3K0CA 3BIWA 4MKZA 5E3IA 5HDBB 4TYNA 5GV7A 3I45A 5EIOA 1YFJA 2IDKA 3IRVA 3MB5A 3KJXA 3LX6A 3KV3O 1GP2A 1E1YA 1G8KA 3MPUA 4TQGA 4TLLB 4NONA 2IZ0A 2ZPTX 4IDHA 4L5CA 4CG3A 2OYSA 2WNHA 1E2GA 1EWTA 2R97A 3SR4A 2JHFA 5EMHA 4C0KA 2X6TA 1WDMA 1QRAA 3L06A 1N4AA 5LYJB 4LYHA 3UG7A 5CIQA 3AIOA 2GXAA 3DZBA 4YRSA 4H1WA 3H65A 2Q7XA 2VNKA 4D3ZA 1DTWB 1MQ8B 2FQ1A 3KP1A 4U2KA 2DTEA 4A92A 4DLSA 4IEEA 4E07A 5JT1A 1Q1NA 3L8FA 1OZFA 3DPSA 1XBTA 1M2VA 4LHEA 4ZAGA 3ZWQA 1D9XA 4QNRA 2M1ZA 5DVZA 3ZGYA 2ZSHA 4HH1A 5FV7A 1JG7A 1J70A 3RSLA 1SZCA 3T06B 1K27A 1XZNA 4FFVA 2AW3A 1E4VA 2IYPA 1YVRA 3G8YA 5H3HA 4WMLA 1LNQA 1E2MA 1C0PA 3L1UA 1OU0A 3NT5A 2VP9A 3BK7A 3TDNA 4FLFA 3RV3A 8ATCA 1TM7E 4WBSA 3ND5A 4EKYA 1P0IA 1L7EA 3LGSA 4K03A 3OIDA 4G0NA 1V48A 2GH1A 4TYPA 1X38A 1PV4A 5DHAA 3I62A 2LTAA 4OHKA 1AUPA 4WZBE 4JUCA 4M0UA 4YP6A 2PVSA 5KTPA 1GU1A 4FYKA 4JI8B 4BMNA 4NC9A 4RHEA 2PT5A 3VO2A 3OKAA 4ACAA 4PN7A 3OOJA 4TRMA 1IVSA 5FNVB 1LXCA 5F7OA 4N48A 1TVCA 2FW6A 4D80A 3P2JA 4BECA 1NLUA 3KR9A 3TRIA 4D26A 4XIGS 3D6FA 4EW1A 1BKSB 1T6XA 1VJRA 1NXOA 4ZEOA 4HGZA 2C7GA 2R7MA 1D4ZA 1FTNA 2IHBA 3BK2A 1HMPA 3KLNA 4G63A 4LWPA 5KHOC 2CHQA 1V41E 2DJIA 1DWOA 1PDOA 1BWPA 1UAYA 1D03A 2OBFA 1PJLA 1MB2A 2Y67A 3R7DA 4II7A 3DVLA 2GUWA 3UZUA 4RV4A 3RCBA 3UV3A 1SQ5A 1GRRA 5CT6A 3BRWD 1CERA 2C9ZA 2HU8A 3C2QA 2CBGA 1G5TA 1VQ1A 3NATA 4H17A 2FSFA 2J9YB 2QIPA 4TV8B 2Q07A 2F9LA 1G9SA 2XYPA 3F5SA 3P9KA 3PUIA 2Q7OE 2HM7A 2O2ZA 4KXYA 3AF6A 3GLHA 2A5DA 4LQDA 5SZKB 1RQGA 8LDHA 5IEJA 3SNKA 3PC4A 5D84A 1XB2A 2K7FA 2KBFA 3K32A 3A4IA 3KSZO 1L1FA 2OD9A 3RRMA 3UB2A 1TO2E 3GC6A 3WDLA 1DX6A 5JJBA 3SKXA 3SE7A 4LV6A 1V6SA 4Q4AB 3TZEA 1Z0JA 1MIOA 3QX7A 4DFDA 1X7DA 3KFXA 2VDUE 3FD8A 2ZP1A 1IY8A 1UEIA 2Z4RA 3TTYA 4G2TA 2DLDA 3C7AA 4I1IA 1M7BA 1BVRA 1LPMA 4D4HA 1GQFA 4PO1A 1Z68A 1E61A 2AOUB 3GJ0A 4YALA 1TOAA 5DNCA 4AJIA 1E7WA 4N6GA 4RNCA 2BDEA 4C14A 1TJ3A 2DYKA 1SXGA 2Y9MB 3GLHB 3W2EA 5JW6A 4BMZA 1J2EA 5DYWA 2G1UA 3BGSA 1VBNA 3RRJA 4A23A 3UBTA 2QVXX 2GCIA 2OL4A 3AEZA 5DV9A 4C3UA 2XUIA 4R16A 5FOSA 2FK7A 1RI5A 4TWRA 5CXXA 3JQAB 1U8CB 4RY9A 4E4YA 3COYA 2J85A 2B21A 4J29A 4YCCA 1XSEA 5CB0A 3H9GA 1U7PA 5H4HA 2ZBDA 5EIFA 3L82B 1JHUA 1HETA 2BGNA 4LSWA 5HKAA 2BFMA 4WXMA 2WMNB 1NR7A 3F1KA 3KJEA 6LDHA 1ZHFA 1HXHA 3HPRA 3PC7A 4QGGA 3TTXA 5IYZB 4XGNA 1QQBA 1PJRA 1PGQA 4UPVA 4V2IA 1YMQA 1KXJA 2VSFA 1D0VA 1TIBA 3L1JA 1A2KC 2AMVA 4UUMA 4M36A 1KH1A 1X14A 1K6JA 2V5AA 2O7QA 2WJ3A 3RYIB 2PKQP 3VPFA 4R6WA 3PFBA 3EUAA 4RPJA 5TE9A 3UAGA 4V1CB 3JQAA 3KK0A 4EQZA 2B1RA 5CYGA 1C9NA 1T3LA 3UB3A 2J0SA 4IUYA 3CCFA 3ZVLA 1L8AA 1QHSA 4WY5A 1WXXA 1JU3A 2AZDA 2PRZA 4FNMA 4OF4A 3KKZA 3WLNA 2Y05A 3PGJA 4NZOA 3H2YA 3II6X 1EM8A 3R23A 4LG1A 3LE8A 4PZUA 3KJNA 4AT1A 4PSVA 1YO6A 1YDHA 1NLFA 5BSRA 3V8BA 1GTRA 4B3SB 2QD5A 2AI3A 1V5IA 3ZOZA 5LXTA 2MTBA 2UYQA 3ZHRA 3P45A 2Z6QA 4J07A 2FW9A 3R44A 2XRFA 4IJQA 3M4NA 3DV0A 5FI1B 3SYKA 3RABA 5IJ0B 4DV3B 3DO8A 2XF2A 3DC7A 2X4DA 5D2CA 4HVCA 1H2ZA 4Z54A 3IMFA 2I7CA 4R1QA 3TTUA 1DTWA 2C5SA 2HCFA 2ZS9A 1QRDA 4XIYA 1G4AE 1GA1A 1GRQA 3FRHA 4Q3CA 3SC2A 2FTKE 3SXJA 2XMPA 5EJ6A 4I08A 4NR0A 5JS6A 4AY4A 2J0QA 3R5HA 4H3VA 4LTMA 4L4RA 2VCYA 1UWKA 1ZN8A 3PQ3A 2ST1A 3LLMA 2BFNA 2N9UA 5AK3A 3W79A 1U3UA 1ZN2A 1HSOA 1MXFA 2PSSA 3AB3A 3SHTA 3EXEB 3ID6C 4L76A 4BVHA 3E7DA 5IT4A 4LMAA 2ZYRA 4E1BA 3UNXA 1IXZA 3DXYA 4YRGA 2X9QA 3D8BA 5EKTA 1OH7A 1EIZA 4IEIA 1NJ2A 2BEVA 4KI7A 3SM3A 5JNTA 3HCWA 1S6YA 5DN6D 3K4HA 4ARZA 4EY3A 3KVOA 2QZSA 1M1UA 4ND8A 1KGSA 3VNQA 2ZZMA 1H2EA 1IUOA 1WUKS 4MVJI 2DB3A 1P2VA 2A9QA 1E69A 3OTGA 3RVNA 2P62A 4L74A 3TW6A 2QTCA 1XZJA 2EGGA 3KUCA 1SC1A 4TKZA 1ZI9A 1VMAA 2VLBA 4ZQBA 2VDKB 4RMJA 4XQGA 5HCIA 1ATZA 1ETUA 2JGIA 3LQ1A 2EP8A 3TNLA 4BX2A 2QRQA 1U0SY 1RAGA 2YYZA 4NYJQ 4UMDA 1X9GA 3RASA 4YASA 1QVAA 1I1OA 3C4QA 3D9QX 5CVEA 2QNBA 4N65A 3WO1A 4EUFA 4Z4QA 3BMXA 5A05A 3QW4B 4N0QA 2QV0A 1P74A 3GAZA 3ZHUA 2BEWA 3CX6A 4MSUA 3FNGA 3GJYA 3QOYA 2H85A 2IEAA 4ND2A 5IM5A 1AUQA 1EWRA 5AW6A 2ETVA 3ORFA 4K6CA 4PS0A 3SS8A 3WLSA 4AW9A 4QXQA 1C9KA 5JAUA 2WWYA 4XSGA 4C9BA 3LUHA 4OSEA 3ZE1B 4K88A 5F2KA 1WKVA 2ZSUA 3ZQ6A 1B1CA 3C5WP 4F2GA 2VWHA 4H7KA 4AZ0A 3ZYZA 3X1ZA 3B70A 2GPAA 3EPKA 3OCWA 1K7YA 2PUFA 1GTZA 4HFJA 3STXA 1N3LA 1A82A 2IW1A 5CNIA 4OXIA 3LA8A 1JJAA 4QBGB 3PFFA 4C1BA 1L4BA 4FOTA 1EVEA 5FL3A 5CFZA 1S8NA 1F06A 1TQ8A 5HDQA 5L3RA 4RL4A 1KJJA 3FOZA 3HCRA 4P0PB 1DXYA 1L1QA 3CNQS 4BCBA 4YMIA 5JC8A 1X1AA 3N2LA 2PX8A 5HYVA 2H0RA 1E1CB 2YOGA 1PJ3A 4Q6BA 4F7WA 4EA9A 2C61A 1K2WA 4Q3LA 5HGXA 5E6UB 4II2A 1UDWA 2YBEA 5KAMA 2CEKA 1H8HD 1W19A 2G9ZA 2YHIB 3JYQA 3GBVA 1PQUA 1V37A 3OAAA 4QYMA 1Y98A 4X6LA 2ZUEA 3OZGA 2B7LA 3MWDA 4MGEA 2WTUA 2BHTA 4GE3A 3KQVA 4KUEA 2J8ZA 1A4IA 1IQ0A 4FDAA 1NOJA 2ZRLA 3C15C 4KGXA 1Z13A 1JE0A 1ZMXA 4QLAA 4Y2TA 2VDLB 1QANA 1A71A 3KS9A 4Q4HB 1UBSB 5I7HA 5AKGA 1UXOA 3DB2A 2OO3A 4GLBA 1UP6A 2BUCA 3JSAA 2SECE 3FCAA 3OFSA 1N0VC 1X80A 2QXYA 3ZIUA 3RVQA 1FSSA 2WFZA 1IYZA 4JXKA 3QTTA 2BKUA 2PX5A 4BLTA 5A4FS 2C2XA 4ME6A 7REQB 3EPRA 3ITKA 2GKOA 1BE8A 1UJNA 1CJKC 3CB4A 2QI9F 1U7HA 1WJGA 2WDZA 3TOVA 3UMYA 3SEFA 4GC9A 1QMGA 3ZQUA 2BJHA 3L93A 1KYTA 3ZD8A 5I7FA 1RLTA 3LDAA 1H93A 5KYUB 3UGKA 3BIFA 1SUDA 4MB6A 3OZDA 2QZZA 1PEYA 3WRYA 4GLFA 2CMDA 2HK9A 3DULA 3G5MA 1T5TA 2EXXA 5BV7A 1U9ZA 2UYYA 3IEPA 4X8LA 5G1OA 3HXKA 2JCSA 1YK1A 4YAWA 2ZRJA 4TL8A 5E2BA 1LSJA 3D2CA 5B6PA 3FWHA 1J0AA 3K2EA 2VHTA 2IZ6A 4ZCPA 3OJXA 4HEHA 3RVMA 2PLWA 4EPWA 1V4NA 3IALA 1ZEMA 1MP0A 3FWPA 3O82A 4P0QB 3L1IA 3ROEA 4YRAA 4GL2A 2C5LA 3UGJA 1BRMA 5LNK1 2R8PA 3NONA 1II0A 2P11A 4MEAA 1FBNA 5TPZD 3OZRA 1QQ5A 3K70C 4MVJA 4WTOA 3FB4A 3BXPA 5LA6F 4OMFG 1PR9A 3HN7A 2VSQA 3MTJA 4MUMA 4UHEA 1DJOA 4BS9A 3MF4A 3BCUA 3QPBA 3ETNA 3UATA 4BLSA 1C4WA 3MMPA 2VUSA 1L3CA 1V8PA 3L92A 1FFSA 2SHKA 3AJ8A 5CT9A 2C96A 4L6CA 5HM8A 5HRAA 5JJCA 3BIXA 1Y34E 3MOSA 1DEKA 1ZOIA 1Z17A 3C6KA 5KYYB 4G0PA 4B3IA 1OC4A 4JLPA 2ONYA 2HK8A 2AFIE 4N54A 1E66A 3TNDA 1T4CA 1VKRA 3ZU3A 1OTXA 2A59A 4G9EA 3WK4A 2JLSA 2QTFA 2LE0A 2X77A 4LXQA 3IO3A 2DPGA 3ZE7A 4XDGA 2GF2A 2BFAA 3BTUA 3ELBA 1MNQA 4CLEA 2CZGA 1H85A 3D4PA 3UH0A 1IFXA 3P5BA 4G84A 1HO3A 5G4KA 4ZYTA 5LKRA 4BGUA 4G4JA 1S4MA 3ZE6A 4CM4A 4YPVA 2RSLA 3K3PA 3GWGA 3KQWA 4JWTA 1KMIY 2A84A 3WR5A 4JP2A 1KTVA 1L4UA 3BL5A 2E3JA 4KSYA 4HT3B 5LP6A 4ZAWA 2XZDA 4RQAA 4CLHA 3I39X 1PHPA 3PNBA 4NFHA 4J7AA 2GDJA 3NC4A 4QGHA 5IASA 3IKVA 3HTXA 1C80A 3BULA 1EX6A 1Z56C 1HRKA 3PPYA 3WB2A 4GZLA 5ICMA 1YDWA 5BUCA 4LHVA 3MWGA 2FF7A 4M9CA 5K3FA 3T1VA 3C1UA 4PSUA 4QDUA 3BBPA 1TIPA 3KJHA 4WKOA 1EIWA 1EWQA 1X77A 4FDLA 3PLRA 2XCQA 2BMFA 4NJEB 4P84A 1O5TA 3OQPA 1N33B 3FKQA 4KGVA 3ZU6A 4MWDA 1IZ7A 2FPWA 4WDRA 5THQA 2PPVA 2EQ5A 4IWNA 5E0KB 1VMDA 3P96A 4R98A 5ER9A 1J5XA 3FCUB 4CLRB 5KKCA 3AF1A 2YYSA 1P60A 3K9NA 5AHOA 3ZWNA 5LP1A 1J9EA 3GRFA 3L02A 2IODA