2GN0A

Crystal structure of dimeric biodegradative threonine deaminase (tdcb) from salmonella typhimurium at 1.7 a resolution (triclinic form with one complete subunit built in alternate conformation)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
327
structure length
326
Chain Sequence
MASHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonine dehydratase catabolic
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 123
structure length 326
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn0A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn0A02
1K8YB 3DWIA 1TZKA 5E0KB 2D1FA 3VSDA 2Q3DA 4HO1X 2O2EA 4HT3B 1E5XA 2BHTA 3HMKA 1X1QA 1A5SB 4F4FA 1UIMA 1TTPB 3VSCA 2WSYB 1UINA 2ZR8A 4ZU1X 5HBGA 5B3AA 1TYZA 2CLEB 2JC3A 4LI3X 4HN4B 5I6DA 1JBQA 4COOA 4D9MA 5I7RA 3PC3A 4JBLA 4HPXB 4LMBA 3IQGX 3TBHA 1WTCA 1O58A 3X44A 5JISA 1UBSB 4D9EA 4QYSA 4JBNA 5BW6B 5DBHX 1Z7YA 1K8XB 4KKXB 4D99A 4L27A 1V8ZA 3IAUA 2Q3CA 1F2DA 5I7OA 4L0DA 3VC3A 3X43A 2ECOA 4Y6GB 2CLOB 3RR2A 5JJCA 2C2GA 4D9BA 5D85A 1V7CA 1K3UB 1QOQB 1TJPB 4D9FA 1BKSB 3R0ZA 1TDJA 2TYSB 1TZMA 5D87A 4IL5A 5I7WA 2CLIB 2EFYA 4D9IA 4AECA 3L6RA 3BM5A 5KINB 1PWEA 3AEYA 3L6CA 2J9YB 2GN2A 2EGUA 2J9ZB 2J9XB 2ZSJA 2CLLB 1K7FB 2DH5A 4I1YA 4L3VA 5B53A 4OFXA 1C8VB 2TRSB 2O2JA 4LMAA 5J5VA 4D9NA 4D9GA 3PC2A 1C9DB 2C2BA 2ISQA 5EY5B 4WX2B 3PC4A 2V03A 1OASA 5I7AA 5C3UA 1A50B 1Z7WA 1KL7A 2CLMB 3IQIX 4D92A 1J0DA 5DW0A 4D96A 5DVZA 1KFBB 1KFJB 3CEPB 2DH6A 5CGQB 3V7NA 5B36A 1VE5A 4L28A 2Q3BA 2RH9B 3R0XA 1V71A 2CLKB 2PQMA 4HPJB 4NU8X 4XUGB 3T4PA 5IWCA 1TZJA 4D8UA 5J43A 4PCUA 5DW3A 3DKIA 4D9CA 3DWGA 2BHSA 3IQHX 1RQXA 1KFKB 3SS7X 1J0CA 1K7XB 3VBEA 1FCJA 1A5AB 1FUYB 2CLHB 1PWHA 2CLFB 2GN0A 4D8TA 1Y7LA 1M54A 4ZQCB 3SPXA 3PR2B 1K8ZB 1VB3A 5T6MA 3VSAA 3L6BA 5D84A 1KFEB 1J0BA 4ZU6X 1CX9B 1CW2B 2GN1A 1TZ2A 4H27A 1J0EA 1VE1A 1K7EB 5B1IA 3FCAA 5CVCA 5B1HA 1WKVA 5D86A 4AIRA 4OREX 2TSYB 1WBJB 5KZMB 5DBEX 2RKBA 2ECQA 3FGPA 2RHGB 1D6SA 1BEUB 1J0AA 1TTQB 1KFCB 1C29B 4NEGA 4D97A 5IXJA 3AEXA 4D8WA 1QOPB 3SS9X 2ZPUA 5B55A 5IW8A 1P5JA 1WDWB 5I7HA 3ZEIA 1A5BB 4D9KA
chains in the Genus database with same CATH superfamily
1ZRNA 5CB4F 4CTJA 1EUCA 4YRRA 1EEHA 1N4DA 1PJ8A 4EO4A 1FYVA 3SU8A 1N8NA 4QAQA 1ZKMA 4UBMA 3R0VA 1X6VA 4AJKA 4N6NA 1U0TA 3EEOA 2Z6AA 4RENA 4TVKA 1BMFD 3IEMA 3HWSA 2CJFA 4KO1S 2C9OA 4QWMA 2AFVA 4OXKA 3I37X 5L3ZA 1DDIA 3BCRA 3HDHA 3IBCA 2HDOA 4NAHA 4S1VA 3MJTA 1O58A 1XRLA 2JL1A 1T36B 1ESCA 4HYQA 3SX0A 1YWGO 5FV4A 5K6AA 1SUIA 4KR0A 2QLBA 1DKRA 3A7EA 5HUJA 2A0KA 2EJUA 1PP4A 1GGKA 2BE7A 2AWNA 3G5UA 1SNYA 3UENA 3VO8A 2IBTA 3IOMA 2XV1A 3FCCA 2XPCA 5CP8A 4CT4B 1IB0A 3I6QA 1BCSB 4RZQA 2FR0A 3F3SA 5FA5A 2YZKA 2VHQA 2ZJ4A 2P30A 2RH4A 4X85A 4Y1EA 4L0DA 4O6VA 1I3NA 3B70A 2GRJA 3CRZA 4LZPA 4D3SA 1J9EA 4M0MA 4TMYA 4RETA 4XWYA 3JWJA 5A5DA 5B1YA 4AJJA 1CZOA 3D4OA 3HBAA 1KEUA 5IT9A 3TL3A 4CM7A 4CETA 5HCNA 4P3KA 2YXNA 1SXJA 4BTEA 1G5TA 4LRQA 5FI3A 5CTAA 4WINA 5AM3A 4Q9AA 3KQKA 3CUKA 3THWB 2EGUA 3I1FA 4PLWA 2WTAA 2XUHA 1PKEA 3LQKA 2CVPA 4ZANA 3LC0A 4TLEA 2QL5A 3R7BA 4OYHA 1I6MA 1U94A 2FPIA 3CEAA 1I13A 3A6HA 2ISQA 2WR8A 3L6DA 1T91A 1T0JB 3MTJA 3JZMA 4JP8A 4EB6B 2V6GA 3INTA 4KUEA 4IJQA 2HKIA 2OCLA 1XNRB 2WJVA 5GOZA 2IEIA 2VAMA 3LPNA 3GLUA 3RYIB 2BMDA 2H57A 6REQA 3WWYA 3ENNA 4NU0A 1I8TA 4AJ2A 3JAWA 4I9HA 3EDOA 2XZOA 3MT8A 1SG9A 2CJXA 3D6AA 5DIZA 3WXMA 3HNRA 3CO0S 3IBGA 1GVHA 1BJTA 3AVXA 3GZNB 4RSGA 1PG0A 4JJEA 3A1UA 3IQZA 3GLIB 3A1DA 3R74A 4D8XA 4OGGA 3RABA 3WLMA 2PGDA 3EIEA 4C5CA 4YPOA 3ICEA 2AG6A 1CEEA 3COSA 4FFWA 4GBJA 1J0CA 2QX7A 5BSVA 1F2UA 3ZVKA 3AR9A 4K6MA 1H66A 3NH9A 4MWSA 3ZHOA 5BV0A 3O6VA 1YR2A 1RAAA 2GBLA 3AI3A 2VWPA 3OMXA 4HXFB 4RK5A 3TJRA 4CG0A 3VSAA 4NPHA 2O6LA 2NV6A 4RKYA 5SICE 1QLHA 1M1YE 3JPWA 4MROA 4X61A 4BMYA 2X1VA 5FH9A 1GGJA 4GPEA 4PANA 5G53C 4KODA 4KQWA 5L3QB 3QLUA 1OVGA 2QPTA 3RYHA 1LUAA 2FJ0A 3MCVA 4XCQA 1R00A 2XNKA 2HMSA 1ZOIA 3EXAA 4DC0A 4MUKA 2FUG1 4QLOA 2H2GA 2VQSA 1ORRA 1EXMA 2VJPA 3AF0A 3CRMA 3OTHA 3RS8A 4YXWD 2VCYA 4REQB 4N18A 1ND5A 2ZI4A 5C37A 1E2DA 1IM2A 4L5AA 2Y71A 1PL7A 1GLNA 3Q9UA 2AOXA 3GDFA 1BIFA 1K5HA 2GPTA 3CO5A 1FDVA 3V46A 2VNJA 1ISPA 2ODQA 4M36A 4P58A 5JQGB 5DKFA 3GT7A 4PQYA 2WUGA 2A9QA 2WIJA 1FBTA 1R0ZA 3K0BA 1ZBDA 3GPIA 1DC3A 3IIKA 3JWPA 1UKAA 4GIBA 3ZKWB 2DHQA 4C3UA 2ZWPA 3DNMA 3GJYA 3N5KA 1K0UA 3PFGA 3TZHA 5LDDC 1O0CA 2HK9A 1D1PA 4OQZA 4URUR 5JWRA 1KE1A 5KOHB 1BXZA 3E35A 3K0CA 4JGIA 4YRGA 1I0ZA 1TM7E 4TLCA 1FZTA 2Z95A 1C3VA 3LC7O 2NTYC 4IOMA 2C94A 1F2TA 4OKSA 2C4HA 2GCOA 3AJ8A 3AMVA 3INGA 2GJSA 3L7BA 4OCZA 2JKZA 3U7QA 1QNLA 2GDJA 2DKNA 2X2EA 4JHLA 4K9RA 3FPKA 4RYLA 1PE0A 1RKQA 2R2GA 3AL2A 1X9IA 2A9KA 1N3YA 3DAPA 4QOHA 3DXFA 3GA5A 4Z9FA 5G1NA 4I50B 4B6PA 4YPVA 4LF7B 1NY6A 3N59A 1JTFA 2F1IA 4IDQA 4Q4CA 3FNRA 3H0EA 3OIDA 4G63A 1Q0PA 4D9BA 3IH5A 1JAHA 1KZ7B 1T0BA 2WU1A 5IEBA 3RQSA 3TJMA 1P74A 4ZTBA 2PZLA 4Q3CA 1GYRA 3I0NA 4ENPA 1I3OA 2WLSA 1ZIYA 3SD7A 3SQMA 2ZB8A 2OFFA 3EWIA 3S8MA 2G77B 2IOFA 1F14A 3O74A 4HH1A 3C3YA 3FWKA 1IMJA 4KNWA 3RSZA 3UJ8A 1EDBA 3Q2OA 3EGXB 3SDZA 1XCPA 2OLEA 1CV2A 1N2BA 1ZR4A 3D54D 2H8KA 3T7EA 3ETHA 3SXPA 2YKGA 3FGZA 2FDCA 4EUHA 3I04A 4B48A 3WQRA 4GE3A 1ZISA 2DCUA 3I2YX 2XRYA 4H3VA 5FWXA 4UE6A 3UCXA 3V8BA 1SBHA 4IKEA 2P3OA 4K03A 1PJAA 3JAKA 4RIEA 5H3CA 3UHJA 3W3AA 3MPOA 4XQ0A 4QJBA 2RG7A 2E6UX 1I4OA 3ZCUA 2IS4A 4L28A 5B12A 1M83A 5HQ3A 4WIAA 1STOA 4FDUA 1U8FO 4JUAA 2J4CA 3RH0A 2DG2A 3T7JA 4B6OA 4ASUD 2A9PA 1G8JA 2YHBA 2PX8A 3N76A 1A7UA 1GP2A 2W2OA 3PUZA 4QTZA 5E8JA 3WWZA 2GXAA 4K6GA 2DBYA 3VBEA 2IYUA 1FUEA 4O4JB 1XJCA 2GZAA 2VYVD 4B6QA 3IIJA 4PX3A 3TI7A 4UUOA 3VPCA 5GONF 3DV0A 2P2GA 4QUDA 1TJYA 3MNFA 2VPYA 4FLMA 1AF7A 3DZJA 3RRBA 5A02A 2YOGA 2G6TA 5AVTA 2WRZA 1S2IA 2DWUA 3F5DA 4NX2A 5FP0A 1JEYA 2QMYA 5AI6A 1AQLA 4MUXA 3T4EA 4DE5A 4ZOQI 4KSBA 2VDWA 1I9GA 3ENVA 2MU1A 1KZGB 4CQNA 1NVVQ 4YCBA 2EX4A 2QJWA 3VI3B 4G2TA 4L4ZA 1J97A 1BW9B 3GVCA 2VR1A 5AJZA 3OLVA 5ALDA 2ZXFA 1S1MA 3U80A 2XCUA 1BS2A 2P0EA 3MCUA 1ZUIA 3IDZA 3WQQA 3CG4A 4WN9A 2LP4Y 5CYOA 1G8PA 2XJ9A 5BQXA 2FQWA 1T5TA 3RTDA 3STWA 1XA3A 4GUDA 4D4JA 2XUDA 4A0HA 3ONVA 4YFYA 5F4ZA 4LVOA 1X3SA 1GTZA 1VLJA 2PRJA 2W6ZA 3OFVA 3WIVA 4CKYA 2O2EA 3T3MB 4JYAB 3A4IA 3O8CA 2JH9A 3VV2A 1ZNYA 5FUMA 3OQMA 2R1ZA 4BFZA 2ZS9A 3TEJA 1XT6A 3TZQA 4CQLA 3DULA 2WU3A 5KQMA 4S1NA 3TNYA 5DHUA 3HXKA 4Q15A 2B4TO 3KSDO 5DE3A 4HPWA 3ECSA 2XECA 1PR6A 5DIFA 4GICA 5D6NA 2W4IA 4HQNA 1ICEA 1M3SA 2G1UA 3GUZA 4PLPA 4RJJA 2GERA 2IKSA 2X5JO 3H2IA 3OZTA 3BFJA 3CUVA 1JJIA 1PR9A 2W6CX 2MHCA 3DE6X 3IIEA 3MJSA 1UBOS 3R3JA 2H5EA 2HRDA 2O2IA 1ENZA 3PFKA 3RJ9A 3CLHA 2GK6A 3K96A 1NJ6A 1R9GA 2AC4A 4TKVB 4L16A 3WO0A 3K09A 1Y8ZA 2GLUA 4H4CA 2O2XA 2A1TR 3E9RA 1XMIA 4HYYA 4G8BA 5DM1A 1PYDA 5G1PA 3W4KA 2P75A 3D7LA 1ZU4A 3GDWA 4MMZB 4TM8A 4C7VA 3B36A 4RNCA 1VLHA 5GZ3A 4E4YA 2ZIFA 1YQQA 1CR4A 1TM5E 1B2RA 1S8OA 4Y2XA 1ZVVA 2I6SA 1ZSNA 2VP6A 2YWJA 4H17A 3VR1A 3L8DA 2UYOA 2QPLA 3W6NA 1LK0A 5CU7A 1SEVA 2H1HA 1L4BA 1S9DA 3CKMA 4NU5A 2R47A 1KAEA 4XUCA 4YJ3F 2J6HA 3DFZA 5H81A 4A8TA 4FUTA 3VR4H 2ZYVX 3L5KA 4AYTA 1L5VA 1NYQA 3OP4A 4R1OA 3B1XA 2QZ9A 4HD8A 4KFSA 2GN2A 2QT1A 3FNGA 5EXEA 5BW5A 5GIOE 3AXSA 3WV4A 4X6LA 4H0CA 4GKJB 3M5PA 2V7UA 2F8TA 4DLWA 2HTEA 3HVIA 1R4NA 2QDXA 2WQ6A 1SA0B 1CKEA 2W6PA 1ECCA 4C4YA 2P0AA 4K9SA 1FLVA 3KTAB 4BLSA 4N0MA 4DV3B 2HX1A 1EBBA 2X5XA 2UZ3A 4IIJB 1NY5A 3OZAA 5KO2A 4P92A 1EDEA 2QIPA 1CUEA 2QROA 4X3OA 1OBOA 5BRNA 3MN1A 3T1TA 1DS6A 3NANA 1EDDA 4RC9A 2A5GA 1KERA 4POAA 2YRFA 1FFCA 2Q5FA 1QHFA 4WLFA 3MLAA 1ZGBA 3LNCA 2FOIA 1OPXA 3HWX1 3MMZA 4HNAA 2H06A 4AKTA 1Y5LA 3C5HA 3ML1A 4I5DA 3QWIA 4UBIA 1XZMA 3UK0A 4CM1A 5CDGA 5KCZA 1I4DD 1DX9A 1YVEI 4MGHA 4QTYA 4ZQCB 1JRLA 3SPXA 1E2KA 2ID7A 3EVZA 3ZDDA 1DLJA 1PZMA 1J2EA 3B8EA 4TTTS 2P5UA 5JYEA 5DYYA 2PBZA 1TF2A 5FUVA 1LQUA 5EMNA 2X9LA 4GAEA 3A4VA 4UQLA 5KWSA 4Y2UA 3S28A 2QU7A 3PK0A 1OI2A 3B2NA 5CNMA 4ZKEA 1CNEA 2OHJA 4K9NA 4RVDA 2C3MA 1SB9A 5KJEA 1KPIA 1JHYA 2X5KO 1PZHA 3PZRA 4G1UC 2IS1A 3W7VA 4GZ5A 3M9WA 3HFRA 3JQGB 1Q1QA 2ZSFA 4HTFA 4ARSA 1HXHA 5EWLB 4BNVA 3PGJA 1HWYA 3R0JA 3BGDA 1W9MA 3ANXA 4JLNA 4QO8A 3ZUPA 3EXG1 2MIIA 3G0IA 1BYIA 2YV2A 3ND5A 4KI0A 5IW8A 2ZYRA 1H4VB 3AESB 2X3UA 2AW3A 4GX2A 4O59O 1YJ5A 3IUEA 1GZVA 1Q57A 5EHZA 2Q2OA 4MRPA 5KU1A 4ER5A 4MW2A 1QZ3A 3OF2A 2HLDD 3OQVA 1YBHA 2EP7A 1YQEA 4JMLA 4UDXX 4CMHA 3RUIA 5BWNA 1EJBA 1EB8A 2OFOA 1KZ1A 2O2CA 3IB6A 5TE9A 2R00A 3TD9A 1JNXX 3AR7A 1L5LA 2Q3MA 2XUPA 5I7RA 2R1TB 5KKAA 2BKAA 4KMRA 1G7RA 1T2UA 4QFBA 3COYA 1D04A 3KUUA 4ND8A 3EG9B 1QHSA 3F5QA 2QW1A 2QN8A 3B9RA 1D1QA 3QVJA 4GWLA 1QRUA 4R0VA 1RQNA 3JYNA 3NHKA 3ZE8A 3ZU5A 1JHVA 5JECA 3PEEA 3SQNA 3SR3A 1Q1NA 2ZYWX 4Y0VA 1JFLA 4QUIA 2IWHA 5F7OA 1GZ6A 1C4XA 4BVEA 2C57A 1RPJA 3P9QA 1VQ1A 1TKAA 3H7IA 2WQZA 1UJ5A 2H7VA 4OXXA 3MBOA 5JJCA 4KK3A 2H4YA 1OXBB 3A9SA 2PD3A 3CPHA 2OM2A 2WV9A 5HDBB 5M5BA 3G2KA 4V0QA 4BFUA 4EHNA 2IDJA 1ORIA 1MHTA 3SQXA 1C4WA 1NBWB 5ERXA 3DLHA 1E96A 1XK7A 3FSGA 3O21A 5BORA 1VCNA 5FA6A 1MP0A 3HKDB 5FUQA 3K6KA 1US8B 4WKGA 3OM0A 5CLIA 3TTSA 1C30A 3DGEC 4YP5A 4L3VA 5FJIA 3W3ZB 5E2AA 1B6TA 1LNSA 2B61A 4POOA 1TVEA 4B3JA 4TVSA 1IQPA 2GYYA 1OXTA 2GVNA 4TLBA 4YXFA 2AFHE 1BMTA 4NFSA 4PRZA 2VKQA 3CVOA 5TMPA 4TXHA 3MTDA 2PSJA 2REQB 2QUKA 3O2NA 2COKA 1EFVA 1OZAA 2IIPA 2LBPA 4MUNA 4YR7A 3OPQA 1P6XA 2I3BA 3IVGA 3PEYA 3FZQA 2PGNA 4C1NA 1EWKA 1J0DA 1PN3A 2Q41A 1YAHA 4HZUA 3RFVA 4NMWA 1FMLA 4Z51A 1XCOA 4Y6RA 3WL4A 2B2CA 4WDQA 5ELLA 5C1PA 4MUFA 3KPJA 5C5EA 4XUGB 5IAGA 4D6XA 4UJ5A 3NJ4A 1GCIA 4BNUA 2P2YA 5KCMA 5CEJA 3HVRA 1YQTA 1UT6A 2FKAA 4LXTA 2GXSA 4CMCA 4J7AA 3LH5A 3LUFA 1S2LA 2Q6VA 1PW7A 5DP2A 4FFBB 1M2HA 4HDSB 2JK1A 3ZH9B 1LVHA 1E2UA 2X14A 4LRYA 1VL8A 2FEKA 1TUGA 4PAWA 5A71A 1SBZA 2L18A 3P0EA 4EJSB 2IYVA 4BN0A 1F5SA 4I1PA 2QSZA 4WFKA 1U7UA 3BB3A 5AKLA 4IDAA 5HZKA 1J8YF 2QORA 5KNBH 1J0XO 4JI8B 2C2KA 2KQUA 1T6XA 4RH3A 3S4YA 2GN1A 5A9SA 2M98A 3E58A 4EY5A 2JG3A 2P77A 5E3JA 1VLVA 4DYHA 1RE0A 4Y6QA 4FWTA 3CVJA 5SZJA 1MO3A 4XIYA 4KQIA 1ECLA 1SKAA 3CMCO 4ZQBA 2A9VA 3WRXA 4ADSG 4S1WA 2IZ7A 5FO1A 3U44B 1SURA 2QNIA 4CMKA 5KTOA 5DWQA 2FR8C 3FVTA 3MWGA 5EZYF 1OH6A 1YZNA 3T9FA 3UWMA 2P5SA 4OJMX 1GM5A 2H2WA 2A94A 3QTLA 4Z2AA 2Z8YA 3UB3A 2V3WA 1E3JA 1XKLA 2FXIA 3P9YA 3ICQB 5I9BA 1YDWA 2ZIWB 3C3AA 4Q12A 4TN1A 1ISRA 1CLUA 4JOSA 2HCBA 5FPSA 3IEIA 5FTWA 4RXTA 2VJAA 2G1AA 4X1IB 4RV5A 3G5MA 5IARA 1NQVA 1Q0QA 1T9GR 5CD9A 1WKBA 2RC5A 5HKOA 1FRVA 2ZR8A 3W1WA 1VDZA 2FW7A 4QLAA 3JWEA 1W4LA 4L22A 3QE9Y 1U7HA 2NO5A 4N7MA 4EJ0A 3UKJA 3PCTA 1XTBA 2FUNB 4JBLA 1ODFA 3LWBA 2XXAB 3SBXA 4DS3A 1UXHA 1V8OA 3ZDEA 1QJ4A 1V8DA 4KPGA 1DINA 5E9QA 2A30A 1XYVA 4CLHA 2W22A 2PLFA 4PZUA 3WB0A 2JANA 2W2KB 4FR2A 4PE5B 2IKQA 4H7PA 2R65A 3FVVA 3K5IA 2E4ZA 3DZIA 4I6GA 4M1QA 3KSUA 1YDMA 1LSOA 2V3VA 2DLCX 3EDQA 3CISA 2VDNB 2B99A 2C1XA 2YXPX 1SQGA 3E9QA 3JU3A 3PX2A 4B6EA 1VKHA 2JGLA 3AOEA 1FXUA 3AR2A 1PQWA 3Q41A 2G5TA 4HH3C 4UHKA 1EX6A 1FBNA 1WDTA 1WB9A 3BK1A 1NW5A 2VN8A 2IWRA 1L7OA 4MQBA 4TGLA 3D8BA 4RAOA 3RRYA 3FHTA 2E1RA 4DR1B 5J5AA 1N9GB 3BMCB 1FFAA 2MSLA 4YCAA 1WE2A 5D3QA 3UTCA 1MH1A 4AIIA 5LZ4A 4YIKA 2R6HA 1YRLA 2XNDA 2ZWIA 3SR4A 4HDRB 3H1EA 3LUJA 4HB4A 4HC4A 3QHQA 4ARZB 1AHIA 1KEWA 1NT4A 3K73O 2VJDA 3IIMA 1L3BA 1O97D 3OWOA 4YRKA 3ZOZA 2NSLA 4IYRA 4Q05A 4OLHA 4LXYA 1JEQA 3OTOB 2R6CA 3L0IB 4HS4A 3IE1A 1U0BB 4HLUC 1ZSVA 3E7DA 3BXGA 4RVSA 5AVWA 1JEDA 3BPSA 1ZI9A 1NXWA 3TLBA 4R2MA 3WYBA 1ADYA 3DZDA 4X00A 2IDMA 3I9KA 2GS9A 3HL4A 1N1DA 2LW7A 4TS4A 4YAIA 2QD3A 4HQKA 3M89A 4LWPA 4YA6A 5KSYA 5D8DA 2UKDA 5EJ5A 3AJRA 2WJYA 4OSPA 4W5NA 3B6MA 1IOLA 3P52A 3SS7X 3SHQA 3HYSA 4L5BA 1NOIA 2BJHA 2KLHA 1G3RA 3R41A 3DWEX 2OHIA 3A37A 3NIGB 4TYYA 1A4UA 1AB5A 3RF7A 2Q4EA 3GD5A 3VX4A 3ETNA 4RK1A 2P69A 4F4UA 2GGSA 2QMHA 3IR7A 4RF5A 3KNZA 5ADWA 1GCUA 3D6UA 3VSEA 3R77A 4RTSA 4C2TA 3EPJA 1DTEA 3H2ZA 5CDFA 3I6IA 4H27A 1KKUA 1RWBA 4Q9JA 3E6AA 3EZ7A 1YTUA 2D59A 3VOTA 2FPSA 3D1VA 3GOQA 3LM8A 4HUJA 5B1EA 3KQLA 1FW6A 4L2IA 3UMMA 5F1KA 4RL6A 1YT5A 2FOXA 2WAYA 5F2OA 4GXTA 1XA4A 4K6CA 5K2OA 1UXOA 4ZYYA 4GD3Q 5E9JA 4QJ3A 1AQUA 3HMQA 2WD9A 2H9IA 4RTNA 2ZUEA 1LJ8A 5FHRA 1SXHA 1UH5A 3WL5A 4G0WA 3SJZA 4P81A 1J06A 4RNDB 1BS9A 2O50A 3M6AA 4KU4A 5MN4A 2IX3A 5DTEA 4X7PA 3M6UA 5GAJA 4DWJA 2OD7A 2ZB7A 1S3FA 2BONA 5DM70 4AY2A 1E8DA 3BHMA 2QYTA 4BUJA 2Y93A 4HY3A 4UCQA 2YWBA 2ZBUA 2KPOA 5HDQA 3M1AA 4D02A 1UKVY 1SU6A 4PSVA 2IF2A 2I1LA 1PNVA 2N3ZA 1JZTA 4MQLA 3ROFA 5BSHA 1C3OA 1Z36A 3LKZA 4IO1A 1LS1A 2HWWA 3RKUA 1QQ7A 2BPOA 4B3HA 2QP9X 1R4MB 3A6LA 4R16A 2VSYA 1I94B 3DOCA 1USGA 3WRVA 4Q01A 4EVQA 2CLSA 4HLDA 2AJDA 5ENDA 5CVTA 4BBZA 4JU9A 1SGWA 1K8XB 2L2QA 3MELA 4RXUA 3KIPA 3SEAA 3QYAA 1YA8A 2P8SA 3LDAA 4JLMA 1V5GA 2ZTUA 3EYWA 3BFKA 4J1NA 1OXUA 4DLNA 3LBHA 1U4SA 2XOEA 3HBFA 4D26A 3D7MA 4QBFA 5M34A 5B1SA 5IVDA 1B16A 1OBCA 5K45A 4PCVA 3F6EX 4LV6A 1XP8A 1OKKA 5D85A 1Z12A 3MJEA 1ZUNA 2I65A 4GOJA 4EJSC 2I78A 3SP1A 4K9LA 4K8OA 5LQRA 2DE0X 3UB2A 4MICA 4DRXA 1YB2A 1U7DA 5T3UA 3ASUA 2B5WA 5EJMA 2I71A 1Z39A 1XEWY 3W05A 2VXBA 1UF9A 4R2HA 5AKEA 3WISA 8ADHA 4GVXA 3VHRA 4R71A 1WCIA 3KYDB 5AI5A 2B8NA 2C4UA 1EIZA 1VLZA 4HMQA 4HAXA 1LPOA 3UC9A 3I34X 5JSQA 5K0BA 1DMSA 1ZM7A 2ZYGA 3HGQA 3LE8A 4TLAA 4XX1A 1QBKC 3Q6NA 1T4DA 4MGYR 3AVVA 5IKXA 3EDCA 4INPA 2CJPA 3HLYA 3MXOA 5G41A 1GNRA 3TKLA 1N7IA 1Z0UA 2PY6A 3G02A 4NKRA 3RAJA 1B0PA 3K72B 4TUYA 3TLGA 2Z1MA 3DAHA 2R8BA 5AXCA 1Z73A 2PXCA 2C2XA 3A3KA 4RGYA 4FEYA 2Z4RA 1N8KA 3PQ7A 1VCHA 4IZOA 4QXPA 3Q98A 2HCRA 2XSZD 3HJHA 4TYPA 4UBNA 2XWBF 1GL3A 1NR5A 4QL3A 1AO3A 4BMPB 3EHDA 1IXKA 2JFNA 3NVDA 2ZI6A 4R4JA 1VG9B 4KUGA 4EX6A 3D6HA 4KQ6A 4W9RA 3CBGA 3TPZA 5JALA 3HS3A 3NOXA 1JLLB 1LDBA 3S8YA 3AWIA 1E89A 2FPXA 2XJ4A 2XWQA 4B3BA 3JAMA 1XMQB 4CEJA 1Y9DA 2J3JA 2C2YA 4KTVE 4UHJA 4ZOAA 3DV2A 1GNLA 1RR6A 4GECA 4MYRA 1NVWQ 2BE9A 2QRLA 3LQYA 2EJBA 2X58A 3WYGA 1C0KA 3B6ZA 1P29A 2OGWA 1VPVA 1B2LA 3DHWC 5K4HA 2FSSA 2ZJOA 3R3SA 2F3UA 4X3PA 2BVNA 3RJ5A 3QJGA 3WIBA 1JXQA 1YUNA 4PW0A 4RDXA 1BHSA 2UZ1B 1XCBA 2R48A 3OJLA 5TIIA 2ZR7A 4BC1A 1EE9A 1E0DA 1QIJA 1SQ6A 4LOLA 3WSTA 2Z56A 4RJLA 4U7PB 5BVGA 5JSUA 4ZVVA 1U9IC 3S99A 3PLRA 3PQ3A 4K86A 4IEEA 4R7TA 3TR6A 5FOXA 2VS1A 5LJIA 4ZRDA 1V16B 2WSSA 4DCPA 4U6NA 5F5LA 3QJ5A 3RARA 5BYBA 1TVKA 3ELWA 4ZO8A 3IL2A 4ARCA 4O2RA 2JD0A 1T3LA 5LA6B 1WVMA 4OA8A 2AA3A 5AUNB 1TXGA 3UPDA 4I9FA 1BXGB 4ZZ1A 1IY8A 2CXUA 3OF5A 4MDHA 2FHSA 4Y6LA 2FN4A 2F9FA 3OQPA 5AVXA 2ZRQA 4EW1A 4TROA 5MF6A 1QV7A 3P9KA 4MW5A 3ZGYA 4DDKA 4FE3A 4B4VA 4EY7A 5F1OA 5IM5A 2SCUA 1XRQA 3BCUA 2PUGA 2A7QA 4CLRA 3CEMA 3HUEA 3A1VA 2RDMA 1CQIB 3H5AA 3I3OA 3CVUA 1KBZA 1PYGA 5K3EA 4YRNA 3Q3CA 5A3RA 5LZ2A 4QEZA 3IBSA 1Q7TA 4KXUA 1DAHA 4MKXA 4RZ2A 5JH7B 4O3MA 4KW7A 4MB2A 2VSFA 1Y81A 3K1JA 3L43A 3TUZC 3H8SA 1T8PA 1J2TA 2HR1A 2ZM5A 1RM3A 3OQIB 2K7FA 3LBNA 2BEWB 2BR5A 4I4LA 1IAQA 4X20B 1VP9A 3RREA 4C6TA 1XRSB 2IY8A 3BQNB 3HB9A 2B8JA 4MRVA 2VP2A 4O4HF 2FMHA 2GVDC 2IYFA 1IPFA 1Q3HA 4ZC8A 2VWQA 5HMMA 5K3DA 2WSBA 4FQ5A 4F45A 4F96A 1RXSA 5CBPB 3INNA 3PG5A 3WGTA 1IXSB 2BM9A 3V2GA 1MHPA 1UEJA 3RC1A 3VYSB 4TYNA 4ZN6A 3KWMA 1XRPA 2UUOA 1SOAA 5IU6A 3KTOA 1KMCA 3DVLA 4PY2A 3T9CA 1JDZA 1A71A 1GPYA 5E4YA 4PC2A 3SHOA 2D5LA 3WOVA 4PYNA 1E32A 3T1NA 4MVJF 1KI9A 1TK2A 3Q3HA 3V3KA 5IJZA 3DPUA 3W2EA 4FU0A 5BWBA 2EWMA 2QW8A 4WOPA 2W48A 1XCJA 4MV8A 3VU9B 3TW8A 2QQFA 5FEMA 4B4OA 1CF2O 1D2CA 1DAOA 1CU1A 1Y3FE 2E2WA 5FV7A 3QUCA 3CUYA 4UZSA 4J6EA 1QK4A 3IV7A 5H80A 5LL6P 1DCFA 1FUYB 3AVUA 3DGFC 3SVTA 1HA3A 2WF7A 3OT4A 3ADOA 4HDNA 4NH0A 1RMQA 4BNDA 3R9KA 1U8CB 1AZSC 3Q3EA 4MS3A 3QVOA 4CF6A 2NZWA 3L7LA 4RLHA 4LOJA 4UU7A 4WZBB 5CJPA 3TRKA 3S1SA 3RFXA 3MT7A 3UB4A 1P7WA 4PU0A 3ZHVA 4BQPA 4C7BA 1QFMA 3EXG2 2FYTA 3IQEA 4YRPA 3E7PA 3RIYA 3TDKA 5DBIA 1RC1A 4DMUB 3H4IA 1TL7C 3TOCA 1C5KA 2PMEA 3SXUA 4TT8A 2WFLB 5LU8A 1TZCA 1XDBA 2VQDA 4TKUB 4YT5A 2CHGA 3GBVA 1C7FA 5H9WA 3RGGA 4KQ9A 3VKHA 2I87A 3FYSA 1GGEA 2Q5CA 3HEAA 2D0PB 4WL0A 3LW8A 1KK3A 1EE1A 1KMHB 5TC4A 3R5KA 2GBPA 3FBGA 2R8YA 4G56A 4WHMA 1I14A 1LSSA 4PR3A 2CFIA 1Y1SA 1P73A 3HADA 4BWGA 4EKGA 3V1KA 4GKBA 5CIQA 1ZH0A 3D5QA 5JZVA 1S2MA 2HXSA 3W4IA 4O4LA 3GX1A 3VZQA 2EP8A 3WY9A 2FF7A 2VEDA 3RIGA 5A0VA 4FUQA 5KAPA 4CM9D 3R20A 1GZUA 1ZJ6A 2NSYA 5KNDH 3VPDA 2WDZA 2GYVA 2HIGA 1T2NA 1T2CA 2JBHA 3LSYA 2H1IA 2H31A 2BEUA 4KXYA 3PEWA 2PE5A 4RVGA 1Y7TA 2AOUB 4BYGA 2W6OA 3EMDA 3VKFA 5A3QA 1R9NA 5CMLA 4MUEA 3RM3A 1IY2A 4MYDA 3DVAB 1Z2NX 1ADJA 1ZSYA 5ERYA 4DKXA 5KX5A 1E9FA 1CZUA 1SUEA 4FNAA 1VLQA 2VBGA 3I6YA 3PP8A 4N7BA 1SXJE 4N49A 5LQSA 1AKEA 4RTKA 1ULHA 1ESMA 3LK6A 1DOAA 1BKSB 1MGOA 4Y2SA 1E3QA 2NP7A 4KWIA 3GNTA 4CCYA 3HA3A 4FHDA 3R3UA 4DDWA 4GYKA 2XUGA 1OFUA 3IA7A 1EDZA 2DY1A 4LJSA 2PVCA 5SYNA 5T67A 5GZ6A 5KINB 2I8CA 4W7HA 4RZHA 2A5DA 3EPRA 3QOXA 4Q9KA 1CIVA 1RKUA 1T15A 2DH5A 4AN0A 1MB9A 2UUCB 4UXJA 4C87A 3NRBA 3OZBA 4OK6A 2AOTA 3C3WA 3L7OA 2A6PA 2B0JA 1V39A 1C9DB 5JVDF 1NMYA 1J24A 4IJMA 4Z1MD 2QVZX 3DUFB 1NLYA 2PYIA 2ATCA 3OPNA 1Q0SA 2GLTA 1H9BA 5C8YB 3A6EA 4ZCLA 5BT8A 4X8HA 2O8BB 621PA 2G9UA 5AICA 1MQSA 4OYLA 3HM9A 3G1WA 2J3QA 2CLKB 3AZQA 2DJ5A 4CMIB 4AJIA 4DG9A 4BUZA 3K32A 5D01A 4FYIA 4P3PA 2Y77A 5J1SB 4NCBA 1XNQB 1EUZA 1MRZA 1ZN7A 1RQXA 5CX1A 3SE7A 2FPKA 4OHOA 1GNPA 1N6PA 221PA 5E7IA 1FA9A 1JEEA 1L7VC 3RT1A 4A8HA 1IMOA 1AQ6A 1RWMA 3NEAA 4Q4HA 4X1YA 4CKCA 3P2OA 4GKVA 3Q7QA 3F7TA 3ROXA 3GMTA 2GHIA 3R6LA 3K1ZA 2R68A 4P3XA 1GQOA 1F12A 1OLSB 2OCYC 2HFJA 2PMCA 3NASA 2QM3A 3BHJA 1GPAA 2X8AA 5BQ5A 3E9CA 3MTBA 5EIHA 4DBVO 4ZYVA 4KCGA 1D5WA 1NJ1A 1YH3A 4HEHA 5AJVB 4IRMA 2A9OA 4X7BA 3ICCA 1U2DC 1XK6A 1OFIA 3IESA 4OXQA 4DG5A 3FM9A 3S0JA 2CBZA 3QFCA 4B83A 4R9RA 1B0UA 3K0AB 5MGBA 3FSJX 4GMFA 4ZT7A 3I1IA 3NWBA 3ZQ4A 1T4MA 4B4KA 1EVJA 2TMGA 1N6HA 2DUUA 2YV5A 2Z2XA 1TA4A 4F2PA 2IU0A 5JXWA 5TMBA 2W2LA 4I5EA 3SC6A 1MIOA 5K1ZA 4PFQA 4A3SA 4QFCA 2ODEA 5FTNA 2YMLA 2WB4A 3ZCVA 4CUZA 2Y1LA 2H52A 1IUOA 4IH9A 1FL9A 1JDJA 4M1WA 4YVFA 1W96A 3AHCA 4JFRA 4XOUA 1K98A 1YC5A 3KB1A 2Q5HA 1X8JA 1XEXA 3O3CA 4YC7A 3P97A 5TQJA 4ALMA 2UZ4A 2OBBA 3IT3A 3TI9A 1QR6A 2QLTA 5AW1A 3PNSA 2BJVA 1GTL1 2V5AA 1X9HA 4XJTA 3J80A 4Q3OA 5IYZB 4N48A 1J2RA 1PVOA 3PRJA 2FCRA 3C8DA 4D0RA 2JIPA 4XWTA 1T1IA 3ZZ1A 5IXYA 4F92B 5KJ1A 1N2CA 1T0IA 1H05A 2RHMA 3HA2A 5LP6B 4QFMA 1DQZA 2Q49A 4G5YA 3TGPA 4UMVA 4F1JA 1RXVA 5IAAA 3KVRA 3V2UA 1C2YA 1T6BY 5T64A 5IN5A 4MITA 3UHPA 5IM4A 4GLJA 4P3NA 2ECOA 3DFFA 4EHAA 4Z1OA 1A27A 5JAQA 2XITA 4XDGA 4XB2A 4YCDA 4N5NA 2XEXA 5ALMA 1Z4OA 3O95A 1QYXA 3OQJA 1P5FA 3QI2A 4GYWA 1T9KA 4WOBA 3GRCA 1N2GA 1LLDA 1NPTO 2W8BA 4HNHA 3TKAA 1R12A 3TXYA 4EB0A 5TEVA 3U19A 4LMRA 4H18A 3C6YA 4C4XA 1W85A 1K3FA 1NVMB 2ODTX 4FC7A 2V4UA 4L5YA 1Q92A 3AY6A 3SYRA 5CAEB 1DJPA 3THSA 3TYXA 3ROTA 1H8ED 1Z6TA 2HXYA 2V59A 1NOKA 3ACCA 3FFTA 3K9QO 3KQSA 5KDLA 4BP8A 1AZTA 2HHHB 4YAUA 4EZEA 2C2BA 4HAWA 3U3XA 4MVJH 4BC0A 4EG5A 3CNOA 3I0MA 4FIDA 4W4TA 4N3BA 4WCFB 5EEHA 3WBBA 5DEIA 4YRBA 1J33A 3OKCA 1G6HA 1I5OA 1JQAA 2ZETA 4IIYA 4JCOA 5G40A 4KMMA 1X1BA 2AG1A 4MKFA 1H2HA 3GQBB 1GPDG 2QUZA 3UMSA 3QVSA 1EVYA 2BFOA 2C7OA 4ARIA 4BIMA 3TDNA 1F8XA 3L18A 3OU6A 1H2FA 3INRA 1QPBA 4ZVUA 2RHWA 1RYDA 2VO1A 3E8SA 1NF8A 3JCZA 3CH6A 4MW0A 3V8MA 4DA9A 2HA4A 3ESAA 1W19A 3KZMA 3OZVA 4XYEA 1H6BA 4OTZA 4E08A 3EX7C 1DX4A 1SK9A 1W0JD 1VTKA 1UZAA 4L51A 1CRLA 3VH4A 3IBTA 1A5AB 3K0FB 4Y2GA 1KHTA 1YR7A 5AVUA 2IHNA 3MWKA 4AKIA 3F7MA 2PYDA 4MUMA 3P2KA 4NIMA 4WTOA 4ZCQA 1THMA 4CMAA 3NBXX 1XCMA 1WZEA 2IXBA 2IYWA 2CK3A 2ZE8A 4OMCA 2GMWA 1MA3A 1CW2B 3EZ2A 3AB7A 1ICIA 1QAQA 5F9MA 2Z6UA 1D0VA 5EMKA 4JI3B 2PG3A 3ZG6A 2QTCA 4G1MB 3I12A 5GJWC 2EL7A 4FQ7A 4DA6A 3ZIAD 1T5DX 4BO3A 1YV9A 3QBEA 1R66A 2KBEA 2I6UA 4IOLA 4XPIB 2B7BA 5EUMA 5HILA 4W8HA 3RU9A 1YB6A 4JSTA 5JCJD 1Y89A 3NHUA 1QQAA 4PG6A 1T4BA 1XQ1A 5DRYA 3ME5A 1Y4SA 3KQNA 4C7OB 4DDTA 5DNCA 1RC0A 1TT7A 2HF7A 1TZKA 3EZXA 2A1TS 3HZHA 4FQ8A 2O48X 4CTNA 4BVBA 1TRKA 1VE7A 2J4DA 2P3LA 3GZNA 2XVAA 4L9RA 2O8FB 3GLIA 2BKEA 3CX6A 1N8SA 1TTPB 3OCJA 3T5AA 1TM2A 2W2XA 3OZ7A 1JT9A 4OPMA 3A6JA 1EGVB 4N9QA 3UV3A 1AGYA 1TAGA 4LHXA 2C4VA 2FSIA 2P6UA 3ESBA 1OE0A 1U31A 1QVZA 1CE8B 1ZMRA 3D3NA 4CKXA 2YWFA 3GLGA 1G2OA 2HRRA 3C6ZA 4X7MA 4G89A 4UBOA 3MAJA 3ILVA 1CZKA 1INLA 3E5HA 4PIMA 1Y8QB 1CQZA 3CB2A 3HU2A 3JD2A 4LHSA 3HSYA 1NW6A 2BSXA 2J8ZA 2VHUA 2NLOA 3KXDA 4CM4A 5CCXA 2Q5OA 4R7ZA 1NDHA 4KKXB 4JXJA 1OWOA 4BX8A 1DIHA 4ZRNA 1NUAA 1ZGGA 2WMOB 2F43A 5ILGA 5JZOA 4DUYB 3BXPA 1XQ6A 3M5CA 3SYNA 4C4OA 1X7ZB 3QIVA 4RELA 4XARA 5CXXA 3DE4X 5KHOC 3O73A 2FSVC 4CG2A 4DPKA 4PZPA 5EUQB 4DJJA 4DNXA 5JS8A 3RUCA 5JSZA 1TJPB 4A26A 4PXYA 3VOAA 2O8EB 2Z4SA 1U99A 3L4BC 3L93A 3QUTA 4QC2A 1RE1A 3ZQKA 4AP5A 4BIIA 3NBKA 2HLHA 3DOUA 3SG0A 3QMMA 2ZT7A 3JQRA 4UHCA 1Y4DE 2DTDA 4EZIA 4G97A 2HFKA 3RRFA 4E7PA 5JEDA 2WKQA 4NYJQ 3WK9A 2BBOA 3U9TA 1NVBA 5ALFA 2VT2A 3N53A 4ENQA 3CS3A 1S4MA 2OAQ1 3A06A 4E5MA 4GSYA 5EUCA 2IHYA 4EJ2A 2QN7A 1EFUA 4EW6A 4ISCA 5C1IA 4BJ6A 1SXGA 2X0FA 2O2SA 3LLCA 3WK8A 3DAGA 4YP6A 4NNJA 4PLTA 4NG5A 4KYTA 1UOQA 3B60A 4OK3A 4JS0A 3PUKA 4D80A 1U9JA 4CDGA 3AUKA 1FSSA 4H31A 2MCFA 5DN6D 1M6YA 5E4JA 5IAKA 5BSEA 2YDYA 1FYXA 4KQKA 1JX6A 4I50A 5L3SB 2MR5A 3I2FA 4PPFA 4Z6KA 1FXWF 4AROA 3ON5A 1D1TA 3I72A 4KJZA 4AD8A 2MT9A 3TB6A 4FB4A 3T7AA 1Y4ZA 2PO5A 1BE8A 4HMOA 4IO0A 4LOHA 3OIFA 1HT3A 3JQ9A 5DPMA 3RYFB 5EE0A 4XVCA 4MKIA 4LNUA 2BFCA 2DERA 5D3MB 1QMPA 1KZYC 1O97C 3NZEA 2Q3EA 4OG2A 1CC1S 1USKA 1MC1A 4MS1B 3RT9A 2Q29A 5KOJB 1ONNA 1F0PA 1THGA 2FEXA 2CXTA 2WWXA 2QENA 1PHRA 3ES9A 3KWLA 4HFJA 4MYHA 3RSHA 1DBIA 4PYIA 1L5GB 2J9FA 4C05A 3FN4A 1MBZA 3F9RA 3KDAA 5JWOA 2GHTA 4QG7A 4L4RA 2I1VB 5I9MA 2E4UA 4F71A 3SFTA 4N0DA 3FOBA 4G65A 2OD2A 4B35A 1G66A 2GR9A 4MRMA 4YHHB 3QUQA 3PITA 3DXXA 4YX9A 2P9ZA 3K9FC 2WM2A 4DSUA 1FFXA 1RXUA 3LA6A 4YUXA 5FRDA 4BRWA 2E3JA 4UAGA 3GVHA 2VTBB 3BFPA 1KJIA 3GLRA 4LXUA 1FEZA 3NBMA 4ISBA 2Q9AA 3U0VA 2CJWB 4JQOA 3AUAA 3H2SA 4H7FA 2D5CA 4I4CA 2I3DA 1D7AA 5H70A 2O7SA 2VBIA 4I55B 2E55A 5TRTA 3OEEA 2FZGA 2EBHX 1EVEA 2EEZA 3A8TA 1R50A 4PQFA 4E13A 1YSCA 5HW0A 1TJ4A 4GLOA 3W90A 4MNTA 2BBWA 4WCFC 5J47A 4LF5B 2G80A 1WO8A 2NACA 5HF8A 3D2LA 2V7QD 5K0EA 4JI6B 4EVRA 1T2EA 1UPTA 1Z7YA 3VC7A 4PN3A 1YFLA 4JBGA 3ECAA 1HQYE 1XXHE 3DZKA 2IE8A 1K75A 4E6EA 4D99A 3C6BA 4HNVA 1QANA 1SELA 2UYQA 3BSFA 4ZEVA 1QWOA 1O0BA 3R3WA 2HBRA 2Q3CA 2XVYA 1A9SA 1XPJA 1SMKA 2CVQA 2Y0BA 3NC1C 4YO7A 3A3PA 3ZHBA 3VKGA 4FHEA 1PR5A 4LX0A 2JLQA 1Y3IA 3RE1A 4YMIA 5BWMA 4CT0A 3H2HA 3G8DA 1KH1A 4NECA 2XE6A 3ZV5A 4NMXB 4ZREA 5KEIA 3UFXB 3RNLA 3SS8A 5JDIC 4E46A 5DCUA 1JYSA 4QPZA 1OY1A 3O9MA 2B1IA 4QRHA 2ZCUA 3WKCA 4K6OA 3FNFA 5AM2A 2DR0A 2WU8A 3IELA 4G5RA 1SVNA 4B0PA 2CF5A 1TT5B 4HRVA 4R1PA 3SE0A 5L95A 1MU0A 3K15A 3L1HA 1KAHA 3TAUA 4D4LA 1SCAA 1W47A 1K1EA 4L8LA 1CQPA 2NO0A 2VRWA 3A4MA 2ZBRA 3JRWA 1GUYA 3NTQA 4GYYA 5J2TF 1KDYA 4C3OB 3CNQS 4DBLE 1JDPA 5AKZA 4DAEA 4DCMA 4QLBA 4BV2A 3ESRA 4R81A 4YNBA 2ZZMA 1SCBA 3HB1A 1MGPA 2AS0A 3P20A 1UJNA 1SO8A 2OL4A 3PPYA 4RACA 3STVA 3ZN2A 1VE9A 5F9FA 4WOKA 1N5KA 1TMYA 3SC2A 2GCNA 4G01B 4TKVA 4AW9A 3BZUA 5DGTA 5IWCA 3RRNA 5TPZD 5G2OA 2BFFB 2FQQA 2I99A 3KPUA 1E0AA 2WV7A 2Z30A 3I0ZA 1C41A 5LQAA 1MRNA 1KFKB 4AUMA 1YI8A 2A1UB 2GOYA 1DKOA 1LPMA 3GJZA 3PUIA 3S44A 4DFDA 4DT1A 3RYCA 3HLKA 1HETA 3M49A 1Y9EA 1DTWA 1GKUB 1HRDA 4LKOA 4BQOA 2QTAA 2GAFA 1SXIA 1OIVA 1V3VA 4JITA 3K6SA 2C5GA 4Z0HO 1T9GS 3PGLA 1U1GA 1DQRA 2BFPA 1QKIA 4IIXA 4Q4AB 3JTEA 3UJAA 1XZJA 1L5RA 5AW3A 2CNWD 3BE5A 4D4IA 1Q1BA 3IODA 3WHKA 4UULA 2HSZA 4RVHA 2JZOA 3KJIA 2QE7D 4G1CA 3AGPA 1QLJA 1SA0A 1IHYA 1U3DA 2YFYA 3PNOA 1JTVA 2D1TA 3GA0A 4B7CA 2H1LA 4OHCA 4PCAA 1T24A 5IF3A 3LUDA 1DRWA 3B13B 4US1R 3MCAA 3Q0EA 4AXXA 1G5IA 3B1FA 4ECAA 1P0FA 5L7YA 4EYQA 1HORA 1JA0A 3ZY3A 3CW9A 5E0KB 4KQGA 2KM1A 3PFIA 1YRAA 4UD6A 5E8RA 1E3WA 2ZU6A 4DV2B 2R44A 2L82A 1Z13A 3U61B 2NZUG 2G1PA 4G36A 3TZKA 1NBHA 4WZAE 1R3DA 4QGBA 4Y9RA 1S89A 4PEVA 3A10A 3QWFA 4JL6A 1X7XB 1YCFA 1KU6A 3PICA 5JCZA 5FLEX 1ZNWA 3USZA 4OQMA 3Q40A 1BVRA 1DZIA 1C3JA 1VFPA 5GZ1A 4Z4FA 2KX7A 5LDHA 4W5TA 3DP7A 3QLTA 5E7QA 5EXXA 1U11A 2B35A 4D45A 1VL6A 2OZKA 1MO6A 2CZGA 1MKYA 2WUDA 2MINA 1PGJA 5BQPA 1Q16A 4JLDA 1XDZA 2WHXA 4B5KA 4QUEA 1DTSA 2ZJYA 2C4KA 3N9IA 2W0SA 3ORSA 1MOPA 1U7TA 2RHLA 2Q3FA 2G9ZA 4O4IB 4Y6PA 4HWTA 1H0KA 4P4SB 4E0BA 1XTTA 1D4OA 2G83A 2WTNA 3EMVA 2XKKA 1JECA 1QGDA 2PZAA 4NJOA 1RLTA 1D2AA 1W46A 4C1BA 1G21E 3SIRA 3ER9A 2DPHA 2V6FA 2HU8A 4ND6A 3G6KA 2OENG 3AESA 5C5IA 2COUA 5KYYB 1E1KA 4OA5A 3NLLA 2EJVA 1NYLA 2B3TA 3HXPA 4LQLA 2GEDA 5FIUA 4Z3KA 1NMQA 3CJQA 3UJHA 4K8RB 1W49A 3NP9A 1XEWX 1FJ2A 1M7HA 4KBGA 3AEYA 1QYVA 4EG3A 4PFSA 3AZOA 1H6AA 1ODKA 2D8AA 2GPSA 2HC9A 1SCUA 3HB0A 2FZKA 1HE4A 4BWFB 1IN6A 1XLWA 2D7DA 3TMYA 1I36A 3ET5A 3KUCA 4CM5A 2YWXA 1Q1GA 1BO6A 2J45A 3W5DA 3EB9A 1R18A 3GFBA 1NZDA 3V4OA 4MLCA 5TDHA 3Q5EA 4RZSA 3UTDA 2FPPA 3EQZA 3P0JA 5HNKA 2WTUA 1CUFA 4TTAA 5TMEA 4DUGA 1UDAA 1P2FA 4DR7B 3GW8A 1YB5A 1XAHA 4L57A 4QAJA 4R9UC 1R0CA 3ISJA 5EXSA 4HDOB 2W8ZA 3CZQA 2XWJI 1LSUA 1I9CA 2XUQA 3C7KA 4FEAA 3KQUA 1EESA 2HHJA 2ZB3A 1UJCA 3S2EA 5CDFE 3ZY4A 1V1JA 4BCDA 5KYNA 3BCSA 4PZZA 3B78A 1JV2B 4BVJA 1M10A 4ZOEA 3OTGA 3U3DA 4YWHA 1CJSA 3LKVA 4EB3A 2PV7A 4FFLA 3VVLA 4GL2A 3HKDA 2A5YB 3GWGA 3IAM6 4X44A 3SQDA 4MXDA 2HF8A 3TX6A 1M2WA 2H2DA 1WKVA 2Q1XA 4R0MA 3FYDA 1JSXA 5C8DA 1T25A 1VECA 4HJXA 1JR6A 3LNTA 3LI2A 2ZATA 5E4TA 3RK0A 1OXKB 5KQLA 1FMFA 1E2IA 2AD1A 3BRWA 3D0RA 3PPWA 5F1PA 1YJAA 1IBSA 3BSWA 3P7MA 2NYAA 2BEVB 5MFPA 1XQWA 4QYIB 3Q3VA 3NT2A 2FZCA 1YB1A 2R751 1X92A 2ALJA 2ZUSA 1NUQA 4Y9TA 2XZPA 1D6NA 1CQJB 4NAVA 4M1SA 1XU4A 4RWZA 3T7KA 3WJ1A 5M29A 1M6WA 3FF4A 3VJKA 3B7GA 5JT1A 3A36A 1BMQA 2ZB2A 5DHSA 4AS1A 3QEAZ 3RROA 1IXYA 4ZVKA 4M0DA 4HN4B 2NIPA 4JL8A 2RGRA 3LV8A 4D9MA 2Z2KA 5GTDA 4PXSA 3DL2A 4HQFA 1ZEMA 2ZCVA 2OKGA 2R1UA 2RFLA 4Q1AA 1QRRA 3MRTA 2HWUA 3BXHA 5GJBA 1VMEA 1ULTA 3FTQA 2XBMA 2PKQO 2CXHA 3QSYA 3NUGA 1ETHA 1FYWA 5FTJA 1IDN1 3EN0A 3PL1A 4IG9A 4TMTA 3H9UA 4C89A 4CM8B 1JHZA 1N2JA 3LQFA 3ABRB 1NW9B 4LFCB 5JTTA 3UT5A 4ZHQF 1ZJWA 4DUPA 2PTGA 2W11A 4N7RA 5KMGB 1I7SB 2RHDA 2CFCA 2FWAA 4UM7A 5AKIA 3EGDA 4WRRA 4ZU3A 4FMCB 3WB1A 1AVTA 2JAXA 2JIDA 4HAIA 3PQ2A 2EX0A 3DOEA 4AZ3B 4DHWA 5KVVA 3TGWA 3VH2A 3BGVA 3ZYZA 1GPMA 3EVEA 3PDHA 2OY0A 2W6QA 3GFPA 3WRWA 1T3HA 1QHHB 1AUXA 2J9YB 1EA7A 3MA0A 5CVUA 4YP0A 3WLRA 1E7YA 1ZM4A 2PGOA 1U1IA 5JY1A 2ZTHA 2EKBA 2AQIA 2YHIB 3LPAA 4G9EA 4LN1A 3SZMA 3UW3A 1Z2EA 2PWAA 1PTJA 1T29A 3KAQA 2YDXA 1V1MA 2P9GA 5K7SA 1ETUA 3HCAA 5FR1A 4NJMB 5LMNB 3QIAA 2JHAA 4TSFD 3TTVA 3OJCA 1QFYA 2W2VA 3U81A 1M1NB 2MMCA 2BBTA 2W90A 2ZZKA 3CSDA 4P5EA 2IE0A 1AKQA 2EFEB 1HC7A 1GVNB 4O2BB 3EFBA 4D92A 2GT1A 4EF5A 3O94A 3NM5A 1GQYA 3VZSA 4CI9A 1G8HA 1ZMXA 2SKDA 4KMOA 3T7IA 4EUSA 2W2KA 5BUQA 1BDIA 2H6EA 1LXCA 1U2EA 2GPWA 4QEDA 3FZNA 1POXA 3RF6A 1EFKA 3ZJYA 3ZCTA 3F8TA 1UBTS 3R7AA 5KTSA 5CA1F 1PCXA 1M6VA 2UUBB 4ZT3A 1ZD5A 4KQFA 5B57C 2JW5A 4YRSA 1MJHA 1Y80A 2HOQA 2VSQA 2J5QA 3AR8A 3DDUA 3IGFA 4A2CA 3HJGA 5F5XA 5LQNA 3OZUA 5DNVA 2C03A 4ZVQA 2PAFA 2BHRA 4IVNA 4M0EA 1X8KA 3K0HA 4EENA 2ZP1A 1M33A 5LFAA 2Z5VA 3U39A 1CUCA 2ZRJA 1VPTA 2VPWA 5IABA 4BNLA 2QTFA 1MQ8B 4LY6A 4OBBA 5FPQA 4ARZA 2HQOA 2XT9A 1DWQA 3C5WP 3TSAA 3REQA 1W88B 4B6RA 5DBEX 3A9UA 4Q3KA 3A58B 1DIOB 3QTTA 3ROMA 2Q1YA 3E8MA 3TRJA 3W6OA 5EP4A 2C7QA 2VDQB 3M6IA 3M6FA 2I03A 2P9BA 2XB6A 4QDTA 3VYUB 1IVNA 2VRNA 3I9OA 4UNIA 4EL0A 1EUQA 1Y9JA 3PNYA 1J20A 3R9XB 3IKTA 3EC2A 3UVEA 1K8YB 3U7IA 2I3GA 3WDSA 2E82A 3VNQA 1J8DA 1E0KA 2HHAA 2WWRA 3RS5A 3VHLB 1ZK4A 2O1WA 2GXQA 3H2YA 4EG6A 2GF2A 1OJ7A 2JLXA 1UFRA 4GOND 2H0QA 3JATB 4O08A 3FMPB 1SB8A 2HMVA 3H3XA 3VDXA 3ZWVA 4B85A 1M2OB 1ENOA 4NYMR 1XKQA 2ZQ5A 3QBTA 2QL6A 4KE6A 2CCGA 3RVOA 3VPXA 4PSAA 1HDIA 2J1LA 3H18A 3VISA 1N0UA 1Z07A 2O4CA 4ZMBA 4R8RA 3ZTTA 1HE8B 2H18A 3UANA 4E1AA 3ZNQA 3QKIA 2Z1NA 4DANA 2OAP1 3ESYA 3G1UA 4WJLA 5GPBA 5CG1A 1DEXA 1OXSC 2Q6OA 2I33A 1PJ3A 5EIFA 3ZDQA 1JG7A 3SKYA 3NJRA 3PA8A 3TVTA 3PQ5A 3W8DA 3I58A 1QC5B 2QVLA 5CXUA 2DT5A 5LLDA 2B7LA 1XYGA 2OK7A 4NESA 3WAGA 4UXHA 5LB2A 2F7SA 1WXEA 3CJRA 4EZBA 3IULA 5HMLA 4LG1A 3TAHA 1MEJA 1QGUA 3RHZA 3VM6A 3STUA 6GPBA 3L4SO 3X1KA 4J9UE 4M1KA 3C41J 4K40A 4WNIA 4C4SA 3IT2A 1JIJA 2CUNA 3CXRA 3VUEA 2X7XA 3HN2A 3OOHA 3PE4A 3NHSA 2YHAA 1A9PA 3HRHA 1RWXA 3P8ZA 3R75A 5KNCA 2I9KA 3T1HB 3P0RA 3E70C 3NX4A 4ARBA 4IUCS 3T3IA 2P1RA 2WJZB 4Q1DA 4A03A 1LBHA 1SC9A 3C3KA 3N0RA 2WP0A 3R4CA 1FTWA 1QH8B 1YZQA 4DLPA 3O1HB 4OI4A 1U8AA 4AJNA 4DQDA 1WAMA 5GV8A 5FR2A 1NX9A 1G3IA 3RSOA 2ZTMA 4WD3A 3FPSA 3VNBA 1M66A 3MCTA 1L7BA 2VNKA 3PRHA 1Q7CA 1NG9A 3V7WA 3I5MA 3PNLA 4WEQA 1Z7WA 3FR8A 3MVEA 1KIFA 4AJLA 3QPWA 5L53A 3SHTA 5DEOA 2H59A 1B3RA 1FXSA 3KFVA 5KJCA 4FS3A 1PSZA 1J4AA 4GDMA 2O8CA 5BSGA 1QAMA 4A15A 3TNDA 5EP2A 1B0ZA 3L7KA 4JFAA 1NBMD 2XADA 1EXNA 1QDLB 2WIKA 4G4SP 1FUUA 4TTQA 4WK2B 4KR2A 3WYFA 1A98A 1OZGA 1CYEA 3L7AA 1E5QA 2R7AA 1V41E 3HJUA 2ORWA 3ND7A 1HURA 1QH0A 1VL2A 2D8MA 2HF9A 2WG2A 2HUNA 2HWXA 1SD5A 3KOUA 1G20B 4RIGA 5LBIA 5CB4B 1S1CA 3BIFA 3GG9A 3S40A 1XC7A 2HIHA 4D8TA 3K2QA 1DXHA 3ID6C 1VP3A 3ZY2A 1SD2A 4QUKA 5JASA 2H3HA 1U81A 3SZOA 1JJVA 4XWKA 5IUKC 2MOKA 4EO9A 1LPSA 3AHHA 3GLFB 2JAHA 4OHRA 4XVRA 5KOYA 4Q4LA 1DI0A 2QB5A 3LUKA 3Q9SA 3HDGA 4CV3A 4P0QB 2OXEA 4D97A 2R0QC 4JR1A 1JFVA 5IXJA 2E49A 1PL8A 2FOLA 4BVHA 5LLSA 4DQLA 3FX2A 3W6ZA 3HJAA 4IFIA 1NLZA 1CK4A 2ZW9A 3LYHA 4RK6A 1CJUC 2F8LA 5JJLA 1U2SA 3ACDA 1KDOA 1V95A 4BEJA 4FZRA 5DLQC 5JQGF 1KI4A 3ANLA 1E5XA 2OGUA 2V0NA 3HMKA 1MR3F 4ZI7B 3WJAA 3KSAC 1ESZA 4OJNA 4B3RB 5ALSA 2QBYA 4L72A 1EFRA 3ZGOA 2V74B 2WTXA 5T57A 5SZHB 2NSJA 2IYEA 2AQ8A 4B80A 1F4VA 4BKQA 3MLBA 3QXJA 4GPBA 3TLYA 2V54A 2V4MA 2H16A 1I3LA 4MVJI 4MYUA 2W6ID 1LK7A 4FYPA 4CDMA 3EODA 3HLTA 4A36A 3TOSA 3NHLA 3CM0A 3TPFA 2BMAA 4UQPA 3S5UA 4P4TA 3X1MA 4JLJA 1TYAE 2GBIA 2Q5LA 1LZKA 2QR2A 2CCKA 3BMNB 4UPVA 1T3ZA 5IHXA 5T7BA 1LW6E 4P1ZA 4UM5A 3IAUA 4E2ZA 1UBNA 4ZEOA 2IEDA 2H4ZA 2VFAA 1NR1A 1FVFA 4CUJA 2ZK7A 1P61B 1Z2CA 3EZNA 2JNWA 3OIGA 4TV8A 2CF6A 3W78A 4DDMA 4XSVA 4F3YA 4UTPA 1A8PA 2J0VA 4IEIA 3JYLA 1OXXK 1QP8A 4ZAYA 4OUDB 1JFFB 1I2ZA 2Q9BA 2XVZA 4O8CA 3TIFA 4KX3A 4HVCA 4LRWA 4DCTA 1XNGA 2P4UA 4QFDA 1M5TA 3IP8A 3H1BA 1ZNXA 5KYWA 3QELA 5JJ5A 2P91A 3ZHCA 5DTJA 1XAJA 3WNVA 4FCCA 3KKPA 3V8VA 2ET6A 2JFGA 1CUWA 1IJKA 2YN0A 3TLZA 2CNLA 3KKNA 3GP8A 2DFTA 1XZDA 2CVOA 4CR8A 4O2LA 4CXMA 1JP7A 4J2HA 5GINE 3QOFA 5IDYA 1Z5WA 2XUJA 1G60A 1XNJA 3IQIX 3MT0A 3B20A 5LYJA 1WU7A 1BQEA 4Z4QA 1P1RA 3GP3A 4L07A 4NS4A 3BWBA 1H2AS 3H3JA 1B8UA 4NFYA 3U1VA 3G17A 1ZM9A 1MA0A 1BVUA 1PT9A 5L3RA 2C83A 3IMKA 3QX3A 1CQIA 4I8XA 4A0FA 5ED0A 3BWMA 3OECA 3WMGA 2CB9A 1OX4A 1YCGA 3LL7A 3UA4A 4ZOBA 5A6SB 3GOHA 3AH8A 3A1TA 1LB1B 3IMFA 2XQIA 3NGXA 5HIJA 4E5KA 1PUXA 2VAWA 3DL0A 3MINA 2FQ1A 3I64A 4B84A 4RSHA 2V0CA 5BMVB 1ISHA 1NP3A 2HSEA 1FDIA 4P22A 4Q19A 4LS3A 1BG6A 2BMJA 2JIQA 3DEKA 3V2HA 1Y33E 4MAFA 1W93A 1UM8A 2G5PA 4NCIA 3MM4A 5EYPB 1KKMA 2HEGA 3W2HA 4JASB 5CA0B 2VH1A 1PX2A 3RUEA 3I30X 1NDUA 1J90A 4Y1RB 4RXMA 4XKJA 5DCLA 5AM1A 3M5WA 3AF3A 4RCYA 5E9AA 1UCFA 3B7PA 4KO8A 2PCJA 1OXVA 1ST2A 2O8DB 3FD8A 2VAXA 3NT5A 1BD3A 3PUJA 2X23A 4J76A 2YRWA 4ND2A 5FT9A 3X1ZA 1R10A 3DBRA 1LK5A 4D8WA 1G64A 1F8YA 2J07A 4ZVTA 3WL8A 2JGFA 4L6AA 4OHXA 5CXQA 3G85A 3D9QX 4TRMA 2FEWB 2GBCA 4YDHB 4H6VA 2IUEA 4ETIA 1ZXXA 1ZIOA 2FP3A 3WE7A 4TTRA 5FYQA 1FP7A 2QN9A 3V4SA 1C0PA 1CPYA 4JB2A 3RTEA 1V26A 5B7QA 1DRKA 1PJRA 1RYFA 2XB8A 1LFDB 1W2WB 2Q1WA 1AO0A 3NJ8A 4MWCA 5KUTA 4EHIA 4RVFA 1RLJA 4A2WA 1GPKA 3KEQA 1E1NA 1DEKA 4OJYA 1Q0ZA 2IVFA 4TTSA 3GG2A 9MHTA 1UC4B 4QTTB 3AV0B 5CK5A 2Q5JA 4S2EA 1G41A 4JY7A 1U0EA 2AFIA 1T5SA 3CSSA 4LXXA 1PFGA 4LOAA 5F7XA 3VYWA 1XPRA 4HZGA 2II6A 5JHHB 2CMKA 1W34A 2JHCA 4FN4A 5EKUA 3DYBA 4YDQA 1B1CA 1RXCA 1X0XA 2O2HA 1CDOA 2VIIA 3FBWA 3T5TA 1PNOA 3CINA 4DA0A 3MB5A 5FL3A 4CLOA 1F2DA 2IYSA 3KWJA 1VBMA 4AQYB 2I22A 2RGXA 4FMDF 3RKSA 4ES6A 1E62A 1I3CA 3UATA 1Y8AA 4AM8A 5JZ9A 1MC4A 2P67A 2OYCA 1QO0A 2FPGA 4KQMA 2TYSB 1PVDA 3GLVA 4LK2A 3RO7A 1IQUA 2LV8A 3N8NA 1NXSA 5FI0B 1EKXA 4B87A 2YW2A 3AG5A 4PYLA 2ZM6B 4NJEA 5A1TA 3AF1A 1WXXA 3LPMA 5FPPA 1C1XA 5AMXA 3NAGA 1CEXA 3SF8A 1SIUA 2VYCA 2X8BA 1XZLA 2OBXA 4IDDA 1AKRA 3KB6A 2N42A 4IIEA 4LRSB 4Q82A 1Y5IA 1SU4A 1SVLA 5G0WA 1NWHA 1MUUA 1NXOA 3GEPA 5BSWA 1IG0A 1NNEA 2HMYB 3OY2A 1NVTA 4B2IA 2RMKA 4AY5A 3F5MA 3A6FA 1WXDA 2FLVA 3P2JA 4IIJF 2FH5B 4A5SA 3E1SA 2IC5A 3QENA 4HXEB 5B36A 3NCHA 4X1KA 3PUHA 3M4NA 1E6WA 2V7WA 2WPDA 4F6RB 1KSJA 2MYUA 2N75A 1QG2A 3CC8A 4TMXA 3OZSA 2QR3A 4D3YA 3PEVA 1K2VN 2XVMA 4BKMA 1ACLA 3H84A 4J16A 3STTA 3WKAA 1N3BA 2J5KA 4RD6A 3A6ZA 4BGIA 5CFOA 3DEIA 1ORHA 2C5AA 2WU4A 4PS0A 5E0OA 4AUKA 2PUCA 5IBQA 2PMFA 2JH3A 1D4ZA 4OM7A 4TYQA 1P7PA 3ZWYA 3E9MA 1AOXA 2LPMA 1NBEA 3EF0A 2CVHA 3GJ7A 3ILHA 4FZ5A 3STYA 4F5EA 4YY3B 3A9RA 4QTXA 2HK6A 2JJ1D 4MQ4A 2H3EA 3WSWA 1L7NA 2XDQB 4GI7A 4E1VA 3MWFA 3CR7A 2Q7XA 2ZDHA 4Z99A 3N0TA 2AMFA 4IYJA 5AW2A 2GEKA 1V8BA 1KVSA 3WHIA 1ONSA 4QOGA 4UBKA 4YLEA 4GYJA 2AQHA 4G2NA 1LU9A 1PZGA 2P1ZA 4LXIA 4E07A 2W2MA 1Z17A 3W8FA 2FB9A 1HFEL 4TZKA 1NURA 1UC5B 3GLIE 2J4FA 2QD2A 4L85A 5ALYA 2CEAA 3HBMA 3F7OA 3JQ8A 4D4GA 3ZE7A 5JZBA 3AVOA 3DTVD 1YHNA 1HDGO 2I7TA 3ZZ0A 2QJRA 5C3MA 1NE2A 1FMCA 1GFZA 2O0HA 4MRNA 2BR3A 3R6WA 1WNTA 3T5BA 4OU5A 1FPMA 3H17A 4P4UA 3UICA 5B64A 3BGSA 2EAUA 4GP6A 4ZK6A 1RJGA 1O4VA 3PGXA 4XWAA 5HBGA 3ZZTA 3PU6A 1MLDA 3DDWA 1ORVA 1RBQA 4KLZA 4DIFA 1ZITA 3P45A 4YJ3B 1PLKA 3PXEA 2O7QA 5WRFA 2QHXA 1DJMA 3DS8A 1WXFA 4S1PA 2P2CA 4AS2A 5T4EA 3KKMA 2OOSA 1E2QA 1NUPA 2ZUDA 1YIDA 2ZBFA 3EMBA 4OB6A 2RAUA 2J3DA 4ZYZA 4KNVA 2JAOA 1E92A 2F3SA 2NU7B 2Q5QA 3GYBA 5E1MA 4BX3A 1TIBA 2CHQA 2FUCA 1A4IA 2N0SA 6NULA 1GGMA 2QTZA 1X2EA 2RI0A 3OPYB 1CS4C 3DTTA 4FONA 4N5IX 4PGAA 5JNSA 4PAGA 1VCMA 2A88A 3F46A 1VBNA 2PVPA 4YACA 2GESA 5AM4A 2ORVA 4GOMD 5HFAA 4DDUA 2P3QA 3ISVA 4OB8A 5H8WA 2EU8A 1W1UA 1XSEA 4UCFA 1CZHA 5F73A 3QM1A 2D3TA 2PS3A 1N34B 1Q0LA 2GZRA 2R3SA 1L4GA 1R8SA 1RW4A 3LSTA 1TIPA 4KIJA 4MS4B 3KRTA 1W48A 3JARB 4QYXA 4JJZA 3JQCA 4TXLA 3WSVA 3ZWAA 4PGGA 3EZFA 3HVHA 3RBXA 5CLFA 4XQEA 4QX6A 1LRLA 3WLHA 3RS3A 4KH0A 4QNMA 5JC8A 3AUYA 1OVMA 1ESEA 3BHNA 1IOZA 1F6BA 5ER6A 2FF5A 4AZSA 1W76A 2BSAA 1IH8A 2C3PA 1L1EA 2NVWA 3C7TA 5TQVA 2XD4A 1IZ7A 2E4AA 3HR8A 1ENPA 3GPDG 3O9ZA 1N32B 1ZIXA 2PZEA 4TV9A 2C9CA 1BXRB 1XD2A 4YJDA 3VR3D 1LX6A 2RHCA 1PVVA 4QUJA 3THXA 2QM7A 4PPYA 1OTXA 1XMVA 3IJRA 1ZXLA 1SUBA 2JLYA 3M3HA 1XZAA 2X7JA 1LD3A 3ZV4A 1U1DA 1NJSA 1RFGE 5C53B 4JLVA 3ULKA 5TLSA 2W6JD 4X97A 2YNMD 3TZEA 3CNLA 1VHQA 2IY9A 4P93A 4I9GA 4XQCA 4TSRA 5BMOA 3A9WA 3IOCA 3MSXA 1HYBA 2ZULA 2OORA 4LE0A 1Q19A 1M6HA 1II0A 1P9LA 5TNXA 2Q28A 4S04A 2YMMA 2OZLB 4U7HA 4WJZA 3PYLA 4LXHA 3WDMA 4NONA 3R23A 5KS2A 2BUCA 3LF1A 2DGDA 4OQPA 4X45A 2HTFA 5I5GA 1IHDA 2VTKA 1E5LA 2GKSA 5DCWA 4WBXC 4HAVA 4HZIA 4AJOA 5B55A 3RK1A 5KWEA 3F4KA 3DBIA 1TX4B 3GQBA 1HM5A 2CHEA 1ND6A 2CNNA 3QA9A 3LO5A 4EG0A 1I2CA 1M2EA 2GASA 3CR3C 4M9XA 4GM4A 1KQNA 3TSCA 2P40A 5JAIA 1ZA2A 3FFBA 4YAOA 1UZMA 1S4QA 1EGQA 4CPDA 4HOYA 1DPGA 3TNFA 2D6FA 3F5SA 4LF4B 4KQ1A 2NAFA 1V8PA 4AX4A 5KTYA 3A2NA 3CUTA 1NL3A 4M0PA 4XJSA 3SDSA 2C31A 4RSRA 1E1QD 3O7WA 1JFRA 3E22A 3ETGA 3K7EA 3I1YA 3CCFA 3II6X 4FFDA 1X42A 4CU5A 3FMIA 1NKTA 4OP3A 3WQSB 1P0MA 2VI5A 3AEUB 2AW5A 3N7AA 4FIZA 1KQ3A 4IIHA 4U02A 3LXMA 4GR5A 4QVIA 3DL4A 3GVIA 2BF4A 4YMLA 5D51S 4D46A 4I8IA 3N6XA 3IEKA 4DCUA 4WNCA 3G7NA 4ND4A 2Q07A 1LEHA 4JOCA 4RLSA 3SIPA 1OU4A 3P9XA 4EYOA 4LHZA 5FNVA 1RS0A 3F7NA 4UTNA 5KYVA 4MVJM 3TTTA 5AW5A 1P2UA 2YTZA 2ZAOA 3OMLA 2GBGA 2FFHA 4YYZA 4EFKA 1L7DA 2PJZA 3NWJA 4DKJA 1BGWA 1NATA 3JY6A 4V0LA 2G0AA 3AVPA 3F74A 3N6RA 3BAZA 4EITA 4C7OA 1ZESA 4BGVA 1S8NA 3DL7A 3PE6A 3GUYA 1EWRA 3QWBA 4QHSA 2E37A 4F56A 4NBVA 4TTVA 5ENZA 4WBNA 2ODBA 1ZFNA 1KDPA 3EEIA 5B7GA 4LAFA 4G24A 4MHTA 1ESNA 1E2JA 1XF9A 2F9MA 3HCPA 3AVTA 2DBVO 2Y6VA 4IXTA 2ATXA 1A7JA 3OLYA 2H65A 3VHXB 2P4SA 4JUFA 1WEKA 3AC0A 3IC5A 4RF2A 1JMKC 2V8BA 1QP7A 2Z2IA 2IXGA 1N6RA 4CF3A 1Z25A 4B2LA 2EKLA 4UVEA 2EWVA 3AR5A 5ELMA 3FPFA 4H1TA 1PTKA 4D1YA 3BD8A 3NC0C 4CLEA 4E1BA 5FTLA 3KJGA 4JWTA 1SCIA 3UO8B 5JNRA 1AMUA 4DDVA 4FW9A 3AUFA 1RZUA 4RE5A 4K9PA 5L7TA 5CYPA 1Z5ZA 4CR7A 5EZYB 3DAFA 3RJTA 2GCIA 3DM5A 2AMYA 4ZC1A 2GRUA 1PJSA 4JC0A 3M1IA 1JAYA 3E3NA 4KXFB 5A05A 3W9UA 2XMPA 5T8KA 1CY4A 1OFVA 1VIMA 3G5TA 2HMTA 3U5ZB 2XMSA 3OICA 2OFPA 3A2KA 4B3SB 4K3VA 2AZDA 3L7IA 2CDNA 2BP7B 4EQ6B 5ICGA 2GEFA 1JYEA 4PCLA 3UN1A 1UMBA 4UPEA 4EKEA 1TU0A 3I62A 4J3FA 4RA9A 5LXTA 1Y6QA 2QYSA 1PZFA 1X39A 1GNQA 4ZODA 1N33B 2EG9A 2NUAA 3D4IA 3U0BA 5EWJA 2A3NA 2F8SA 2YFHA 1QRDA 3A9VA 3ZTWA 2XUKA 2E89A 4UNPA 5IJ9B 3PT5A 4R8MA 2BM1A 4IHQA 1P75A 3DKPA 1O5OA 2ICAA 1E20A 3LD9A 3L06A 3QZUA 3NTLA 5AR1A 1NSYA 5HX7A 3NM6B 3W06A 1U8EA 1UPXA 3DF7A 4FMBB 4INAA 1BMDA 4L95C 1HFKA 2VXYA 3H9CA 4KN6A 5BNTA 1PZXA 4Z49A 7ABPA 2FN8A 3QVGB 1T2DA 4HATA 3ZHZA 1Y3DE 1YONA 1SHZA 2V8OA 3O0TA 1DIGA 3GLKA 1G8AA 1XROA 1RKXA 1L5MA 3T12A 1YVPA 3UQYS 5HS6A 5JMWA 5L4LA 1R8YA 3V9AA 4TLLB 5BR4A 5EVCA 4WUTA 5BRAA 3M70A 1Y9AA 2AL7A 3OOJA 1EI9A 4WDRA 3T0GA 1KO8A 3G2IA 4OY3A 1H6CA 3WLPA 4C6SA 3CZRA 3BWCA 1W5FA 3GAAA 5E6UB 5IMSA 1EK1A 4BX9A 3DE2X 1EK5A 4FC6A 2EYUA 2PZJA 1ODJA 2X4IA 3V1MA 1SVUA 1VHJA 4LZWA 3OT1B 1UKZA 4HX2A 3TCNA 1QWSA 1DG9A 1ZG3A 1SC4A 2YN4A 4UZFA 4DRZA 2IJGX 3ZDXB 2GILA 2PUHA 4PSCA 2LKCA 2FN9A 2FG5A 3EVDA 4FFPA 2HPZA 1S8AA 2QLFA 2RK6A 3VR6H 4DCNA 4EDFA 1NM5A 3TAXA 3RC7A 2XTNA 1YR9A 1CTQA 2IVZA 2JJQA 3BWDD 1V11B 1UPUA 4LI0A 3ZQ6A 1PR0A 1K7FB 3WOHA 4IFTA 1NVUQ 3LKDA 2K4MA 1G8FA 4IOKA 4Q7LA 2PBRA 2G72A 1R9JA 1PL6A 2VHXA 4X62B 3THYB 3ED1A 3NALA 2M1XA 5A6VA 3QVVA 3OD1A 2GEBA 2FWRA 4MVJG 4GKAA 3LTNC 1TUBB 3FCYA 4LYHA 1HLDA 2ZUUA 3QOWA 4WCVA 4UNQA 4YJFB 4GMXA 1ONOA 4QHTA 3WGUA 4H0NA 1J2UA 1Q22A 1ZKDA 3JALB 4Q7MB 5BYKA 4MEJA 2FPWA 2HJ9A 5AW8A 1AHNA 3BTUA 2OV8A 3TF5A 4ERXA 1A2QA 1JHQA 1PBNA 2EBWA 4I8DA 4RIHA 5IBPA 1L5HA 3C85A 2AR9A 5C4MA 3JRNA 2WTEA 3L79A 4BO5A 1OZFA 5EIXA 2HM7A 1AE1A 5D1NA 1CWUA 1OSNA 1QFXA 3CNNA 3N2EA 2ACVA 2WJJA 4QDZA 4BNKA 2YMPA 3PLNA 3W3AH 4YEDA 3LO8A 4BQFA 3M5DA 4IXWA 3KT3A 3OU7A 8LDHA 1U7WA 4ZZIA 5JROA 1AN0A 1N3IA 5JU6A 3AEKA 1VXRA 3TLAA 3QX8A 1J25A 4ZJPA 1D0IA 1SKYB 2AXQA 3PR2B 4M7RA 4AY3A 5D84A 1P9NA 3QE0A 3CPEA 4RADA 2VYND 3FYUA 3R24A 4CNQA 1B6RA 3B3QA 1Z0JA 2ZRIA 2HF2A 4IMJB 4PQEA 4XD2A 4E5PA 3A6KA 3EXFA 4TXMA 2ZIXB 4BMDA 1L5OA 1F0KA 4OP2A 2QY9A 3S7ZA 2V7PA 1V9CA 3ADDA 4ZEXA 3F2VA 3KOYA 4QATA 1MIHA 1SOMA 3CUUA 2BV3A 5COQA 3H5TA 1OAOC 2JVIA 5C81A 1AMOA 2BGRA 3ZV6A 4Q1VA 4FEEA 3PFBA 4RFSA 1ZVJA 2IYNA 2V7TA 3MC1A 1QH9A 1VJTA 1KY2A 3FUWA 4HSGA 1XALA 2RSLA 5HF5A 9LDBA 4PZDA 4AZTA 3U3ZA 4FR5A 3CTMA 5B6IA 2XTAA 2BFFA 4YT8A 1RM4A 4WKPA 4FM9A 3EVBA 1CDDA 1AKWA 2NU6B 3F3KA 1GNVA 4GMKA 5DXAA 4BHTA 1TF5A 1NPDA 4MR7B 1LDEA 2A1UA 2YOHA 4IUDS 4MV1A 1E59A 1GRNA 2R2AA 4XJXA 1V3TA 2B9EA 4I1IA 1DT3A 4CUKA 3EXHA 2P9EA 4DGSA 3G82C 1CZNA 2VF5X 3MT9A 5A4JA 3SZGA 5KWIA 3HB4X 4W8GA 5TGDA 3R6TA 1MQAA 3VGPA 1TAUA 1ST3A 1KRWA 1V47A 2A92A 3DD5A 1KI1A 2B1RA 3ABSB 4BMCA 5DBHX 5E38A 4C78A 3D4BA 3FUVA 3GWZA 1A04A 1P9RA 2DFLA 2YV4A 3L8EA 3GN2A 2JFHA 4ICIA 5HTOA 3D8SA 3I2KA 3PHGA 3BDVA 2NO4A 1FS4A 4UAJA 1F0YA 4UKDA 4F11A 4KPFC 4ZAWA 4QBGB 3L92A 4DMHA 1W0KD 2NO6A 4EABA 1JAXA 4BX0A 5JH7F 3BN3A 3U9SA 5ESXA 1U0HC 3WWDA 1C3EA 5KQPA 2VUUA 4GNRA 3VSBA 5BSUA 1TAHA 2C00A 3JYPA 1FX0A 4RE6A 3K2IA 4U3JB 5B3JA 4BVLA 2BGTA 3GB9A 3I52A 2GH1A 4LV5B 2QMZA 1Q44A 1QS0A 3WIUA 1H0RA 1PEDA 1S2OA 4HLQB 3X2FA 1U7ZA 4GR9A 4P9NA 1AQNA 3BJIC 1UPBA 4TQGA 1HE2A 2YXDA 3DBHB 3VAZA 2DR2A 2FSGA 3EMKA 3OUZA 1O08A 4YAFA 4D9NA 4NQRA 3QXCA 3WYNA 2R6R1 3G2LA 5A5VA 3CG0A 3CHYA 4O1MA 4GLFA 4MVJP 4KO3S 4M2LA 4PHTA 2ILVA 2IU4A 1RJ9B 2PA3A 1DSSG 1WIWA 4NBLA 5J4YA 2C3YA 1R2QA 1RI3A 3CF2A 4G41A 3H9EO 4KC0A 4DY6A 4Z1MA 5TS2A 2ZT5A 3O8QA 4TL7A 1CT9A 9GPBA 2ABWA 2XNSA 1JJFA 2JGKA 4GLLA 4LCBA 2FRVA 4XA8A 1A5ZA 2F48A 3N2IA 5BR1A 1YU6A 3B5JA 3PX7A 2GAJA 3DTVB 4HDMA 1KA9H 1TECE 4W7SA 2OB1A 2Q4DA 1K7XB 3DQQA 2GX6A 3UMFA 3TMAA 3B3GA 3INYA 4P4GA 4RKRA 2LKDA 3HI4A 2GN0A 4KRFA 1EFHA 1UWCA 2O7NA 1WCWA 2NNLD 1K08A 4KITB 4YJHB 2J30A 5BOSA 2YICA 1QVWA 1RFLA 1CF4A 4XAQA 2C9BA 4U7GA 1TAQA 1V25A 1BCRB 1KYYA 2HA5A 3NO4A 1Y6ZA 4R2JA 2CFTA 2KYRA 4EMUA 4LJRA 3C6MA 2GZHA 3H9BA 3OCVA 2OZEA 2ZXEA 4UUMA 2GARA 5CPBA 4CT5A 3IJ5A 1SVKA 3QNWA 5U4QA 2Y1OA 2PPLA 4XLTA 4Z8YA 2HK8A 3ZEAA 3FZYA 1XDUA 2W43A 1HE3A 1O9HA 2C4NA 4DV1B 2FFBA 1U90A 2WK1A 2X8WA 3HA5A 1QOPB 5COAA 3C39A 4HRAA 5AKHA 5DHQA 2YY6A 3P9CA 4BQIA 4MTCA 3DHEA 2FP4B 2QTVB 3ZWBA 1NVVR 4RTQA 4QQNA 1A5BB 4R8SA 5KHAA 3FDFA 1IB6A 2RGNA 3LOUA 2TMKA 2YZ2A 2LCIA 3R4VA 2X0RA 3TFWA 4B8ZA 1KEZA 3LX5A 4IDBA 3PIIA 2WF8A 5JPCA 3KLNA 1P62B 2PD4A 3EFOB 4UMFA 4H3HB 4C76A 3CLVA 2GTIA 3KLMX 3E0XA 4MUIA 1SQ0A 3AYXB 2AN3A 5EZQA 4BNHA 2DX7A 3PJRA 3WBJA 1UP7A 2YJ3A 1MX3A 2GO7A 3GCXA 3ELDA 2YCBA 4P7FA 2BGJA 3AUTA 2GD1O 1GXSB 1O6CA 4V0ME 1JA9A 5DF1A 3LUGA 3UWSA 5FWNA 4TTPA 3TB4A 3TFOA 3T99A 4KKVA 4JI7B 1I3MA 3O2SB 3PKZA 1AN9A 1KMMA 4OHPA 1WSDA