2GN0A

Crystal structure of dimeric biodegradative threonine deaminase (tdcb) from salmonella typhimurium at 1.7 a resolution (triclinic form with one complete subunit built in alternate conformation)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
327
structure length
326
Chain Sequence
MASHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords Threonine dehydratase catabolic
total genus 123
structure length 326
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn0A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn0A02
2Q3DA 5B1HA 5J43A 2RHGB 1A5SB 1RQXA 2PQMA 3IAUA 3VSDA 4D99A 5IWCA 4QYSA 2ECQA 5C3UA 5CVCA 4HPXB 5D87A 1TZKA 4AECA 1J0EA 4PCUA 1KFBB 4F4FA 5J5VA 3ZEIA 4L0DA 4D9KA 4D8TA 2D1FA 1K8XB 2RKBA 1KFKB 2TYSB 1P5JA 1TZMA 1V8ZA 4NEGA 4IL5A 1A50B 1TDJA 5B55A 5DBEX 1TZJA 5B53A 2J9ZB 1JBQA 5I7AA 3SS7X 4D8WA 1KFCB 3PC2A 3RR2A 4D9MA 1C29B 4JBNA 1J0DA 1UIMA 3DKIA 4D9NA 3PC3A 3BM5A 1VB3A 2WSYB 2CLFB 1QOQB 3SS9X 1UINA 1F2DA 2ZPUA 4JBLA 1VE5A 5DVZA 2ZSJA 1J0AA 2ZR8A 5IW8A 4AIRA 3X44A 1A5BB 2CLMB 2Q3BA 5D86A 3VBEA 1BEUB 1K8YB 5B36A 5KZMB 1TZ2A 3L6CA 4HPJB 2TRSB 4OFXA 4D9GA 1Z7YA 5DBHX 1Y7LA 3FCAA 1VE1A 3R0XA 1PWEA 1Z7WA 2CLLB 5B1IA 4D8UA 1K3UB 2RH9B 1WKVA 1O58A 2GN1A 5JJCA 2ECOA 4D97A 4NU8X 5D84A 1CW2B 2C2BA 3R0ZA 1X1QA 3DWIA 5I7WA 4HO1X 4KKXB 4D9IA 1J0CA 2Q3CA 5I7HA 3IQHX 2CLEB 4ZU1X 4L3VA 5I6DA 2DH5A 4LI3X 5EY5B 1OASA 1QOPB 3AEXA 1PWHA 2CLIB 2JC3A 4D9CA 1D6SA 4H27A 4HT3B 1FUYB 5CGQB 5JISA 4D96A 2EFYA 1C8VB 5I7OA 5KINB 3L6RA 1FCJA 3AEYA 4D9EA 1TJPB 2EGUA 1C9DB 2TSYB 5B3AA 4D9BA 1K8ZB 1KFJB 4ZQCB 3PR2B 4ZU6X 2ISQA 2J9YB 3VSAA 1TTPB 1V71A 5DW0A 3T4PA 2BHTA 3VC3A 1UBSB 1M54A 2CLKB 3DWGA 3TBHA 3L6BA 5BW6B 1WTCA 2GN2A 4I1YA 1K7FB 1J0BA 5HBGA 3VSCA 5DW3A 5IXJA 2BHSA 3SPXA 5I7RA 1BKSB 5T6MA 2GN0A 2O2JA 5D85A 2J9XB 3IQIX 2C2GA 1WBJB 2O2EA 4D92A 3X43A 2DH6A 4L27A 4L28A 3IQGX 2V03A 1WDWB 4WX2B 4LMBA 4LMAA 3PC4A 4D9FA 1KL7A 2CLHB 1E5XA 1TYZA 4XUGB 3HMKA 3V7NA 2CLOB 4OREX 1K7XB 1A5AB 1TTQB 4COOA 4HN4B 3FGPA 1V7CA 3CEPB 5E0KB 4Y6GB 1K7EB 1KFEB 1CX9B
chains in the Genus database with same CATH superfamily
1NDQA 1VPLA 2LRHA 2MMGA 1KJWA 1RR6A 2Q3HA 2WABA 3IUBA 3ONWA 4HR7A 4JA2A 4LVCA 4OHMA 5B2EA 5IWCA 1EUYA 5K51A 3FROA 3OPVA 4R1LA 2B3TA 5LMNB 1P8AA 2A6PA 5HS6A 2GPYA 1G98A 3M49A 1GUYA 3OIYA 3QX7A 3PX2A 2RGNC 3KJHA 4FI3F 4CI9A 1QV6A 5KOJB 2WWGA 3Q11A 3CLSD 3SHWA 1SR8A 2OAGA 3H11B 4BLSA 2WJVA 1IEQA 2R6CA 5KREA 4M8NE 2B92A 2YIDA 4UPVA 4FMCB 4CMIA 1SXQA 1NVBA 1E9SA 2MR5A 2X6QA 3NPAA 3RM3A 3RR2A 3P2JA 3ST7A 3LBHA 3WBBA 4WBNF 3TECE 2IEYA 1W85A 1YRQA 3BIJA 1H0HA 1ZI8A 3FDJA 2BGKA 3NWJA 3DVRX 3PXDA 1PR9A 4MKIA 4KXFB 3WA6A 6ABPA 1IBLB 3CKMA 1US8A 2WJZB 1SUWA 4BP9A 4GX5A 4Z6KA 3UVEA 4PNPA 4ZT7A 1E0DA 2Q9BA 2H2GA 2WHQA 5IVIA 3EXG2 1PUJA 3TBFA 1NG1A 2Q3BA 2QVGA 4JCOA 2O3QA 4RVCA 2NN3C 2D8AA 1JKFA 3PUVA 3EE6A 4L76A 5D7NA 2G7MC 1TEXA 5J5CA 5AOAA 4ZK2A 3C3KA 3HR4A 4JEMA 1W4ZA 3AV3A 4O59O 4P3PA 1Y7LA 1RYHA 3PEFA 5F73A 4DRYA 5KWSA 1H1LB 1LFAA 2DWQA 2QRGA 2BFFA 3A6JA 3G2NA 4K7JA 2FZGA 2Z08A 3LP6A 4BKOA 1M2KA 4GPAA 1UJ5A 3WQBA 3F73A 5C8DA 2WHRA 4DLNA 4MROA 1GAEO 1EG7A 1SZCA 3E6AA 3Q8MA 1NP7A 1HKUA 1NMZA 5G0TA 1BWQA 2C3YA 1J0CA 1RWNA 2ZSEA 1HOTA 2W2LD 4JITA 4BU0A 3JVEA 2AV6A 1VI5A 4GLLA 1Q17A 3PLRA 4KEAA 3BXGA 1ZH2A 3CF0A 3V32A 1NBMA 1U6IA 4ARBA 2RCNA 3B2NA 4Z4GA 4CKWB 4X3CA 2QS9A 2VDQB 2V9PA 1JFRA 3MFYA 4LKRA 2DFPA 3H8VA 5DT9A 3DV0B 3VR4D 4DR1B 3CEMA 3GYBA 5F3DA 2I55A 3DAFA 5FH9A 1ULHA 1JX6A 3KT3A 3ORYA 1RWQA 4OXIA 4XJVA 1F1BA 1S3FA 3O03A 4UPDA 3ZCSA 1FMFA 3AXTA 4RSGA 2XUOA 3DA8A 3HS3A 1WUTA 1RM3A 1TUGA 3I64A 2OLEA 1U65A 1OXTA 4YAGA 2QVYX 3SLKA 3L1VA 3VKWA 1TIPA 4GXNA 4IFIA 3MT7A 1HLPA 3P4UA 3K3PA 5AK0A 5LQKA 2JG3A 2I65A 4QOGA 5IK2A 4PGMA 1SPBS 3RC3A 2OMEA 2GZAA 4Y9RA 3B2QA 4H7KA 2QPLA 3AI2A 1CZUA 4EY7A 3AR3A 1MU0A 3NT2A 1FQWA 5C4IA 1VFPA 2HHAA 3F9CA 3GRYA 4XFKA 4GRIA 4HSGA 1ES9A 5AYVA 1TAHA 2H63A 4LHSA 5D51S 1XBTA 3FZEA 2FMKA 4OYHA 4W8OA 4Q6WA 2YUTA 4GZ3A 3SQDA 2FRXA 1BU5A 1EA7A 5KU1A 1VSVA 4N6OA 1SBCA 4NBVA 1D09A 4UOZA 3WYAA 3IAHA 3DB1A 4Y6GB 3C3BA 1KAHA 1RQXA 1W4AA 1WZCA 2AHRA 3EY4A 4UUQA 3ESAA 3ZI7A 1FUKA 3JQ8B 1VG1A 1J8VA 1JE1A 1S01A 2AB0A 1ZMOA 5C37A 3R0IA 3ZWMA 3CIOA 2ZSAA 3VR2D 4RHEA 4EM6A 4B5KA 5JSUA 2E4ZA 5NLLA 1NLMA 2GM4A 2P27A 3MTEA 1CQIB 1E6LA 5DCWA 1Q0ZA 1WP4A 2FPXA 5IT5A 1BXRB 1OAAA 4MEBA 2QLFA 4Y2JA 3I6YA 3OSZA 5L6MB 1Q1GA 3OICA 3I9NA 2ZEJA 4OLAA 2HKIA 4MCAA 1IZ9A 4U6QA 2ZT8A 3M4NA 3I23A 3WLJA 4F93B 4ZAFA 3PNPA 3EH2A 4B40A 4DV7B 1N2EA 1CJTC 2C54A 2ZWOA 4QU0A 5ALSA 2WKQA 3RYFB 3WXMA 1YBVA 3TZKA 3TJZA 4U63A 2DRIA 3EGEA 5FLKA 5K01A 1XPJA 1GDHA 1MIOA 3OI7A 3PUHA 1CUWA 2HRBA 4EK9A 5EWLB 4KO8A 1KYZA 2WHXA 4MYSA 3SJUA 5IBRA 2BEWA 3M1LA 1ZH6A 3DLCA 1NURA 4N5IX 3MXOA 4QTXA 1VMIA 2VHCA 1Z5WA 2P9JA 3MMNA 1CUUA 4I4CA 1NMYA 1RI4A 4OSOA 1YIAA 4RCZA 4DMMA 4IPTA 4BPBA 1ZGHA 1CUEA 2PSEA 1CR6A 3HJRA 4JJ4A 4MW2A 1GTSA 1XNRB 1LH0A 3DJFA 1MX9A 1LTKA 2H5JA 4ZRNA 2O7SA 3R3WA 3NBQA 1AO3A 2JANA 2ZXUA 4CLDA 3P9ZA 4GAEA 3EZ2A 1B76A 2I7XA 4P0TA 4RXUA 4BMCA 1GXSA 4HRVA 1QH9A 1WEKA 3LW8A 4HYEA 4CF6A 3VO9A 1J33A 3CZRA 1NXVA 1BVRA 3VPXA 1B8UA 1GG8A 1S1CA 2QMEA 1JDTA 2QTCA 3RSFA 5LC1A 5BMVA 2W2VA 3U09A 2BONA 3I8XA 3OLQA 5KSZA 1AV6A 1MAVA 2HYIC 3FVQA 3DVLA 1JIVA 4HI0E 4RVOA 4EPYA 5KVQA 4DMKA 1ZBDA 2YWDA 2JK0A 3UPUA 2Y1KA 4EVQA 1QKKA 3QX9A 1ACJA 3JV7A 4WN9B 4UUNA 1LTHR 3CINA 5FR1A 1K8ZB 3V8MA 1V96A 1ZRNA 1TGVA 3R3UA 4QBTA 2CHVA 4QNRA 3O82A 1PE0A 4CT4B 1ONBA 2AKEA 1PJSA 4MV8A 3VUFA 1X19A 4HBZA 3A6FA 1OFTA 1CF2O 3KPJA 5AVKA 1YS1X 5BN1A 3GLQA 3BRSA 3HBJA 1F12A 3KTDA 2B1GA 3Q6IA 3RVDA 1RP7A 2G08A 3NS7A 3LC1O 2G5GX 1DUSA 4IJKA 4C3VA 4ALKA 4INPA 4W63A 5E9JA 5KAMA 1I3NA 2R6AA 3MIIA 2CFRA 3ZTYA 2OB1A 5H1YA 3NTQA 3MS2A 4Z0HO 3A2MA 4TMVA 4EW6A 3IOCA 4NDAA 3LPAA 5HUQA 4YMSA 1AUQA 4N3CA 2CD9A 3H5LA 1T1SA 2O1WA 1OHHD 4C76A 4DEVA 3D2AA 3FPAA 4INJA 2GF2A 1ZYUA 2ZYTX 3WRVA 4DA8A 1M1YB 3UB4A 1B0UA 1UBKS 3HKEB 3AMVA 4DMCA 1W19A 1X1DA 3R9XA 4EJSB 2B4KA 1F0KA 2H1IA 1KXZA 4HV4A 3NHPA 5EWMB 4DZRA 1T3ZA 5FOQA 5C8XA 3Q10A 4MMZB 2PRSA 1SQ5A 3T38A 1NATA 1PN3A 4G0PA 2ZWIA 2XTMA 3KG2A 2CVZA 2ZI3A 4O4JB 4B6PA 1RP1A 2OCGA 3G9TA 3NNNA 2OFXA 1OV4A 2A30A 1BHJA 1I33A 1IEVA 1TMKA 2VWQA 1BU8A 1E1NA 1QBGA 1WDKA 4KQEA 4B46A 4CEHB 3IESA 2XCLA 4LCBA 7REQA 4NH0A 4GX1A 5B55A 5KPDA 3IFSA 3ZQ4A 1GZ7A 4KE7A 4H18A 3N59A 4TXHA 2CV0A 1J5PA 3AJDA 3DDUA 4IIXA 3PC3A 1G7SA 5EUMA 3F5FA 3HY4A 1Y4UA 3G68A 4GYKA 1UODA 4AX8A 2WFLA 4QRDA 1E6UA 4CKEB 2OHIA 4C2UA 3JAWB 1EHYA 2WZDA 2X5KO 2IYVA 3HVJA 4KFSA 3VVBA 1C8KA 3D3NA 5CTAA 3DNFA 4AIRA 3G0DA 3UJPA 3EDMA 3CFYA 4I55B 1X7DA 1ULSA 1ZN7A 2EJCA 3SVZA 5KZMB 2YWGA 1M2VB 1MC8A 1AKMA 4RVHA 5TS3A 2Q0QA 4YAJA 1PT7A 4D5GA 3NHUA 3GOQA 4M54A 4PLVA 5ALEA 5JJIA 3LWDA 2JIQA 2RGRA 3UKOA 4DTIA 3RIEA 1PJAA 4TTJA 5JFOA 5JZSA 1P2FA 2DC1A 4J0CA 5C0OE 3CRVA 1PS0A 5F7OA 1T5IA 1OVGA 4G26A 2HIMA 4GS5A 4Y0NA 2SCUB 1OXUA 2Z43A 1KEUA 4MUNA 1OZFA 2WRZA 4ZO4A 3ZCXA 4M0FA 1PJ2A 4J0GA 4N8SA 2ERYA 3NJ4A 1ORRA 4MDHA 3CR8A 4DZZA 2V7EA 2HDWA 3TGLA 3SICE 1ZO8A 1WCV1 2ECFA 4FS3A 2C7GA 2NO7A 4XFDA 3TX6A 1VLHA 3K5PA 4CL0A 2PYDA 5AJYA 1U2GC 4AP5A 3LHFA 4ALIA 5KTYA 1QHIA 2NYAA 1N7GA 3MFQA 3TZ6A 1M2OA 3DFKA 3WMWA 1MOQA 3QH4A 3GU3A 1W1UA 5BPHA 3DE7X 1FLAA 2LVBA 3I0ZA 4O4HB 3UV3A 3O1JC 1EYZA 1LPNA 4J16A 5LDDC 4FK8A 1EWYA 5TPZA 4DCMA 1MF7A 1Y5IA 5ANRB 4B84A 4F06A 1TZCA 1NUTA 1WDLA 4DCOA 5JADA 3THXA 1V71A 1WXXA 3K4HA 4NHOA 4OL0A 2OZLB 4UMFA 4CM4B 4N7MA 5COQA 1YGYA 4E30A 2PWYA 3DBIA 5DO9A 4LOLA 3H7IA 1MB2A 1JWAB 4A2QA 4ZV9A 3QF4B 4RPCA 3FDIA 3ZHYA 4BFWA 3VYSB 4Y18A 3ZX4A 1MQAA 3RSSA 5B3JC 4LC9A 3SPXA 5A4DA 4J4HA 3KHKA 2V6MA 4IF6A 1T5BA 1BCRB 3C1OA 5KVVA 5J2TF 3GFTA 4EJMA 4FYHA 4QQNA 3EXAA 4BIIA 4EJ2A 3AR6A 2X0JA 2X6RA 4RCVA 3A4VA 1WSBA 5DN6D 5GJWC 1GZ5A 1CEXA 2WSSD 5HBRA 1TLTA 5F77A 1J0XO 3EQ6A 3T3OA 1NMEA 4AUNA 3NRJA 3DW1X 4AZ3B 5DGDA 4G36A 2EV9A 4Z4CA 4HDNB 1L4BA 1XMJA 2HPZA 4MR9B 3S1AB 4Z4FA 2YVAA 4F3RA 4MRAA 2AYXA 1BD3A 2ZBFA 3VAAA 1TVEA 1X7ZA 2REQB 3LVRE 5EXSA 4F97A 3GUHA 4A8PA 2HF9A 1J2TA 3HZZA 3C6MA 4M7RA 4D0GA 1PVVA 1O6BA 3C8HA 2QN3A 1DX6A 2JLRA 4HDQB 3VR6A 4KITB 1IPHA 1ZG3A 2E7ZA 2JFGA 3BH7A 2ZT7A 3A6EA 1KFKB 1Z34A 2PL9A 4DA6A 3AM5A 4XARA 2XXJA 3ZJUA 4TWRA 4UTOA 3DLTA 4YLGA 3KALA 4LYAA 4CM6A 2AQ8A 3WMFA 1GQSA 1CS0A 2RH8A 1LKZA 4RE5A 5EJ7A 1YBAA 4YR9A 5AD1A 1NI3A 4OJNA 3TLXA 1E2JA 4FDTA 3O3NB 3GUVA 1L4EA 3OJEA 1KY3A 821PA 2Z6UA 1LPAB 1UJMA 2FSHA 3DEYX 3E4DA 1R8JA 2NU6A 3KHTA 3PT9A 4HYQA 4DYHA 1JVSA 3NHWA 3L7AA 2FZEA 1RKVA 2JATA 1JLMA 3ZDDA 5GGXA 5KC9A 2JGAA 5IFKA 1VYTA 3A6DA 4P35A 4N48A 2L18A 1SVMA 3UBMA 1ICIA 1Z5ZA 2ZSDA 4IFTA 4L22A 3DE1X 3JQEA 3BXOA 2ZBQA 1N1EA 3P9XA 3S2ZA 2X42A 5DV9A 3U6BA 2Y4NA 4WVFA 2JHCA 4A0SA 2JRCA 1VSQA 3CNEA 3KJEA 2R751 4H31A 4LX0A 3HV2A 4ZQEA 4RVSA 5BQPA 3VHRA 3ZY3A 4BFVA 3U5ZB 5CTJA 3KSAC 1E60A 1XYYA 4BLVA 4JKOA 3UXYA 5I7WA 2GD0A 1OFUX 3QE2A 4KLRA 1XQWA 1XNQB 1MBZA 1D07A 2JD1A 3AEXA 3T52A 1AKEA 3IMKA 3R6WA 5IJ9A 2I2FA 4KNYA 2R00A 1HYQA 2JI7A 2XKAA 5FRDA 3V48A 4WOKA 3PZBA 4CODB 2NO9A 3HDTA 5EE3A 2GH1A 4UTVA 3KR0A 4FTWA 4DMLA 4EG3A 5AUQA 1OKKD 1S3SA 5KHAA 5HJ5A 4G0VA 5PGMA 5DHPA 3THRA 1TEHA 4H7FA 4BXOB 3CZCA 4KQCA 3QJYA 1F0NA 4N0MA 5FUXA 3U7IA 4DM4A 4Z9XA 4K2HA 5EKUA 1UBGA 2UZIR 1K86A 2VH5R 2J3QA 1CUVA 4NE2A 2R6GA 2XUDA 3MYRA 4WKBA 1G3IA 3RQIA 3HCBA 4PBTA 1TLFA 1Z4PX 2P79A 2RCYA 4B31A 2VZ0A 2ISSD 3R6LA 1DFGA 2FR0A 4Q4HB 2BY4A 2G6TA 4BRWA 4JJFA 1RPTA 1XZ8A 1PKEA 4EAQA 5T57A 2L17A 2NV6A 3EMDA 3F6EX 2R6R1 1LK0A 4H1HA 3AH8A 5A6VA 3D6TB 6PFKA 1A8IA 3ZGYA 3D0OA 3B6EA 3KL2A 4Q3OA 4YAWA 5C7OO 2PKQO 1QIIA 2IY8A 1W4RA 3GJ5A 1HURA 4LZWA 2I80A 4WTOA 4A36A 3MW8A 1PJLA 5A9RA 1XEWY 3GPDG 2KHZA 2WSIA 1BHSA 3GFRA 4F5EA 5FPPA 1AGXA 2DQYA 1YONA 3VU9A 3TDNA 3K0BA 2XLBA 3HCDA 1C1DB 3I2KA 4R5MA 4ZRDA 4OJMX 4B8ZA 5BORA 2YW9A 2XOXA 3COPA 5TIIA 1B0PA 6REQB 1I36A 2Z1NA 1CDOA 1Z39A 3K2BA 3PFCA 5A4FS 3KX2A 2PRKA 3LH5A 4BN0A 4UBJA 3ND6A 2BCGY 1P0QA 2BFAA 3OEWA 3PQ6A 2LE0A 2P2CA 1AS0A 1Z07A 1W5SA 2HJ9A 2IP4A 2REOA 1EXVA 1EEHA 1F9EA 4K86A 3TG8A 2OO5C 1QQ7A 2WJ6A 4L0DA 2C99A 4BNTA 1K5HA 3E9ZA 4LOIA 5EWLA 3E2MA 3GN2A 1UZNA 3OPYA 3SIWA 3DDSA 3WISA 3IQEA 2NV2B 1VHLA 1U8FO 3EBLA 3ELBA 4NFYA 1E3DA 1RHRA 2HK8A 4RANA 3QKUA 2CDBA 1GPBA 1EZ1A 3CA8A 5HHTA 1J2RA 1E2QA 1T0PA 1L7VC 4OXYA 1X1EA 3W8NA 3H19A 5FV7A 2A5JA 1H2ZA 1OLSB 1XQ1A 2X9QA 3AJ9A 5DRYA 3BSFA 1MZVA 1NVTA 1UXJA 2D1RA 4EPVA 5A7FA 3L01A 2QVZX 1NYTA 3DXZA 3CRZA 4WUVA 2IWRA 5K0JA 1IHXA 1A5BB 4MVCA 4LI0A 5D3ZA 3PQ7A 1GGVA 2FG7C 4IQFA 1UM8A 1U04A 3S29A 1INLA 3D8HA 3H3XA 3FMPB 3HCAA 3E4CA 3U26A 1Z6XA 3HN6A 5HOQA 1H4QA 4A82A 1XROA 1U4OA 2F9FA 3KJZA 1PWEA 3VR4H 4A1FA 1IZ7A 3TNYA 5E7QA 4Z7NB 1Z5PA 4HEJA 3UM9A 3Q6NA 4U4AA 1EINA 1DHRA 1KIFA 5D1NA 4ALNA 3UMVA 1I6LA 1HNZB 3PQ3A 2RK3A 2ATIA 1D7OA 4NNJA 1FP7A 3EBOA 3SQXA 3VNVA 4LE2A 3P71T 1GGJA 3FNBA 4W5HA 1MO5A 2WLSA 4CV0A 4R71A 5HW0A 2Q07A 4P84A 4ZJZA 4K9NA 3ADCA 3F74A 3S4YA 2VK1A 4AMVA 3UYLA 4X7PA 4DA4A 4OHVA 3PNLA 2FDRA 1JLRA 3EZXA 1XE3A 2D3WA 4Z7OB 3WB9A 1MXFA 1YBHA 2IPXA 3ICWA 3N3AC 1PLLA 1V7ZA 1XZLA 4IUCS 4RMGA 1KZ6A 4J3FA 3T99A 3PRKE 1VIVA 2G9RA 2M98A 5ESDA 2UUBB 1L4NA 2PCLA 4M6WB 4KPYA 4JXJA 2SECE 2NYUA 4JLKA 2Z8YM 4NCBA 4YMVA 3PDCA 4DCNA 1U2DC 5EKXA 2Q1YA 1GTZA 1UBOS 5F2KA 5AXAA 5JQWA 3ZLBA 3K1AB 2NYVA 1YR1A 4BMSA 1AMOA 1FNMA 5F1PA 4YUZA 3KR2A 2Y1DA 1DKRA 1N3BA 2QRMA 4R41A 5FUWA 3VVMA 1KEEB 3K6RA 3L9XA 2GNOA 5A6SA 1ZMRA 3JZDA 3INRA 3FCOA 4PYIA 3GGCA 1QS0A 1IQRA 2VL7A 1LBSA 4Q19A 4NF2A 3SJ7A 5C5IA 3MAGA 4LMAA 1XDDA 5H4GA 3IVGA 5EE0A 1C1YA 3TVDA 4JC8A 2JH8A 4FXOA 2A1UB 1M6VA 2JFYA 3DVQX 3GGPA 1GQYA 2FK7A 4MR8B 4BFTA 1LDBA 4X5OA 3FMFA 3IRUA 4EG8A 5FWXB 1OYYA 4YRNA 1CYDA 1B73A 1OTYA 1GZVA 2P0AA 1XRQA 5EJGA 1EFPB 1R4MA 1SUBA 4NONA 3EG5A 3Q15C 4EG4A 2FMTA 521PA 3CRRA 4XD7A 5JNSA 4OIFA 4IGAA 4QULA 2PZKA 2HDHA 4ZDJA 1EHIA 3KT8A 3O2SB 3W77A 2YVKA 4Q82A 4DCSA 4RC9A 4XCQA 5CFNA 3I05A 1QQAA 3QJGA 5FBHA 2C5HA 3O4IA 4MYUA 3GB9A 1V16B 2UVPA 5CIWA 5BUZA 2J9ZB 4AULA 3GJRA 4L0CA 3HU2A 1HQCA 1Z4LA 5E7JA 5KJFA 4TKMA 4TT3D 2FPGB 4LCEA 3EPLA 2WWYA 1AY0A 2BFCA 4TT8A 2IFTA 1ZOOA 2IYUA 3VOSA 2FW1A 2HLHA 1OX5A 1VLLA 3DOOA 2ZR8A 4KCGA 4UE6A 4D1YA 1XFDA 3OU7A 1U2GA 2DFTA 1RXVA 2AKYA 1GITA 4IW3B 1PQUA 2JEYA 3KWJA 2ZAIA 2H1CA 2XCSB 4Y2UA 2NQTA 4GSLA 4BAZA 3LWZA 3WKCA 3NG1A 2HW8A 2B98A 5FA6A 2CCGA 1WXGA 2HUNA 4LY0A 1CRQA 1R0ZA 2I3ZA 1NE2A 1PTJC 5IC5A 2BBOA 2NU8B 1EK5A 4I9NA 1KDYA 4LNUA 1M8GA 3FGNA 1K97A 3G89A 2DPLA 3L4BA 1YFZA 4MWBA 4OFWA 5AJUA 4IG4A 4MAFA 2CLIB 2XTAA 5DPMA 2W93A 1ZW6A 2JFFA 1SG6A 1QZTA 3QM1A 2HMVA 5JCPA 1C8VB 1BDIA 5BWLA 1LWNA 1F2TA 1T35A 2FTKE 2FRVA 2RHWA 5FOSA 2RHTA 5JC8A 3COVA 5C5CA 3IXLA 4MVJI 3ZK7A 5BT8A 2PL3A 4UUMA 4FMDF 1A2QA 2NT4A 3UWKA 3FF1A 1QBKC 4X3OA 4ASUA 3NP9A 1FFEA 3GNLA 4RZHA 3RVMA 1Z5VA 3EZGA 1XMVA 1Q3HA 4IRXA 4CUKA 1VDZA 5BQ3A 2DWCA 4XQ0A 4RADA 1AO0A 3E7WA 3OX3A 4OFBA 3QIAA 1CTQA 1L4UA 1A9PA 4M0MA 1U0FA 1EEXB 1NAHA 2WYUA 1T2VA 1YDHA 3EWNA 4REQB 3A05A 4E3ZA 4ZQHA 5TPWB 2A9VA 3OTQA 4ZEWA 3P0EA 5IAKA 3SYKA 4C89A 3KE8A 4LGVA 3KKEA 3IYLW 4CU2A 2OBBA 1PWXA 4MRSA 4BUJA 4PC1A 4LBZA 3N5KA 5CB0A 4Y1RB 1XCJA 2DTXA 4HDSB 4Y6OA 2JFVA 2NVOA 2VCEA 4ZOLF 3U31A 4LF6B 5T3UA 3GNQA 3K09A 2ZTUA 5JPCA 2WE7A 5CDHA 1EXNA 2Q2OA 3ZZMA 1OX6A 1QM5A 5E0KB 3QA3E 3L4KA 2BTEA 1RYDA 4MMXB 4OXKA 4I1RA 2J4FA 3O8QB 3BRCA 2D1SA 4NEHB 5I9SA 3QUBA 1EK0A 2CCKA 4ZZ1A 5JARA 4FOLA 2B78A 4PG4A 2X40A 3FB1A 3HUTA 3QVMA 3UYKA 4L6IA 2ZSBA 3SC6A 2EP7A 1CWUA 1ULUA 1VG8A 1DC4A 1V8ZA 2BSXA 3PICA 1A7UA 1H5UA 5HYVA 1J97A 1C3LA 4XYGA 4ZI7A 2HF2A 3JYLA 2X2FA 3KKLA 2EKDA 4PAMA 3SS7X 4JJGA 2IIPA 4QXPA 1KO1A 2WM2A 2GD6A 3FUVA 1LZLA 1UFKA 3WZ2A 1O54A 3L8ZA 4EEXA 3KYIB 2IVZA 3OOYA 1FA9A 4KPGA 2ZPUA 1H6BA 4R2XA 4R31A 4WXRA 2OBLA 3DKRA 2PVSA 4A92A 2AC4A 3R0QA 1BJRE 1RJGA 3WGMA 5DM70 4DADA 3TSOA 5JALA 3K0AB 4DLXA 1N6LA 5G0UA 4RIHA 1UAGA 3KK0A 3FIJA 5CPBA 1JHAA 1OA0A 1HYHA 1QGOA 3O93A 1O08A 2TMGA 3BQMB 4K88A 4YUXA 3AF6A 4B73A 5ERXA 4QC2A 2YV5A 1SVOA 1TRKA 1V43A 4RBNA 3PPWA 2XF8A 3ZGVA 3C6KA 3D6HA 4GI1A 1OROA 3AR8A 4ZEMA 4YFVA 4AB1A 4P93A 1RCFA 5KNCA 1X7YA 1DAGA 1DMRA 4RQUA 4TUYA 2VA9A 2N0SA 2E85A 4H35A 3WR5A 2EL7A 1VE6A 3S40A 4R7ZA 4BV8A 3C7CB 4XQCA 2G9NA 3UA3A 4YUWA 4P32A 3Q8LA 2Y71A 1JDJA 5B2ZA 2QA5A 4PGGA 1IWOA 2X1MA 2NG1A 2X5OA 1CE8A 2CZGA 5I7EA 3KYBA 5KYXA 1S5PA 3MTBA 4HDRB 4JZKA 4N8DA 1SKMA 3ECSA 1PV2A 3EIUA 3I0MA 2AW3A 2HWXA 3Q1KA 3TLCA 1DO0A 3V2GA 4EB0A 2VCHA 3R7AA 4ND8A 4JT4A 1JKXA 4DEXA 5IF3A 1ONNA 2C2HA 1MOPA 4Q4JB 2KS6A 1GTL1 2WFZA 3PT5A 4FFWA 2PO7A 3LT5A 1GCUA 2BMAA 4OP2A 2QR3A 3RSGA 1N6HA 3I73A 1SIWA 3QVXA 5ALUA 3T4PA 5B6IA 4DLZA 1SO8A 4N3AA 2CLKB 4CIDA 2FXIA 4B09A 1H8ED 1AC5A 4Q1CA 1ID8A 3E8MA 3QKSB 2CW5A 3OCXA 1FDWA 2QD2A 1PQ4A 1WMDA 2NZJA 4MI3A 3TZEA 3UJBA 3WNCA 1EXMA 4DUZB 1WMFA 2J9GA 3FXAA 4UQLA 3CNLA 4DDUA 5I9TA 3KM0A 1Y9JA 3EULA 6REQA 2Q1UA 2W6MA 1WULS 4I4NA 2OPBA 4L8FA 1MAUA 3WYCA 3HCEA 4DNFA 421PA 3DTTA 4TSFD 4YO8A 5HM8A 4HADA 1OXBB 2YUIA 3JAKB 3LECA 1YL7A 4WFKA 4QDZA 4HNUA 1P3DA 5DHTA 4JMPA 4HGQA 5DHRA 4F2GA 1S2GA 2CHGA 2AR7A 3D1VA 4RESA 3DV9A 1B42A 1M6EX 1DO2A 1SUCA 5HEKA 3RS7A 3STTA 3UGQA 2L82A 2ZYHA 3OEHA 3BX1A 5DIFA 1VSUA 3M5PA 3TL2A 5BWBA 3TK1A 1G17A 1JQDA 2BKVA 2Y1XA 1NF9A 2Q1WA 4HX5A 3OT5A 2FE4A 3PQ5A 2C82A 4JBHA 4C7OA 2ZDQA 1P8JA 2PWZA 3NATA 3PYLA 4FIDA 3W9YA 1NHWA 3EPJA 4P34A 3GNSA 3SKYA 2O8DB 4O0LA 1L4KA 1L7MA 1G20B 1NT4A 3ODGA 2Q5OA 4AZSA 4FM9A 2OQ2A 2B1QA 2QZJA 4JN6B 3CVJA 1A50B 1N3YA 4HTFA 5JNUA 3P26A 4R9SA 1RABA 2J7PD 3PGJA 4L3WA 4UASA 1E8MA 4KBYA 4NESA 4NCKA 1FYDA 4XD2A 4EY4A 5F7XA 1Y3AA 3M6XA 4IM7A 4BMPB 1NXOA 2GZSA 1VJ5A 3GFPA 1L8LA 4UCXA 3RI3A 3SXPA 2ZFUA 2XT0A 4QLOA 1U8AA 3A27A 1ZI9A 4Q05A 5AJTA 4AN1A 2ZSKA 2A8YA 4L74A 3OQJA 621PA 1UMCB 2PXHA 5T3YA 3NT5A 2BGTA 3BJMA 4MB0A 1KOJA 3T0IA 3M4XA 1RQRA 3GAFA 1JG7A 1SKYE 4MKXA 4UVIA 5SV2A 2GCPA 3EPHA 5HIKA 1XD2A 1LD3A 2OGWA 5KYWB 1RLJA 2UKDA 1CQPA 3ENVA 2GN1A 4F11A 1PG2A 1H23A 2YNMD 1E0AA 4F38A 2CUKA 3KV1A 4DG9A 4BGDA 1IG3A 1KO4A 4MUGA 3E9EA 3IUEA 1ZJ6A 2AHOA 5I6DA 2CSXA 3DVSX 4Z3DA 6GPBA 3HJNA 2WNIA 3GF4A 3BOSA 4ENWA 4WGFA 2VTKA 1JS1X 1IXKA 3HSYA 2ZYAA 4UEJA 3UMGA 4Q9NA 4HNHA 3D81A 4BNGA 3O9VA 4PZYA 2EL9A 2GJ9A 4LZNA 1U8EA 2GLXA 4B7ZA 4KVFA 2VXCA 3RTGA 1HQYE 4DG5A 1YQXA 2GK6A 2O4UX 4ISCA 1B1AA 4CLHA 3E22B 3FWPA 3O8CA 1L7XA 3UCFA 5CW2A 3EASA 4I4IA 1DG1G 1FFSA 2VWPA 1JMKC 2PY6A 1PNQA 3AOEC 1AQUA 3NJRA 1O57A 4G5XA 3T9DA 1TNDA 3H2YA 3OX2A 3V6LA 3DLHA 2FPKA 5B5SA 1NW8A 2GLUA 1A2OA 4U7TB 2ANCA 3W90A 4W1QA 1GQRA 1I8TA 4TRNA 3WOVA 3KTAB 3RU3A 1DARA 1C7ZA 3AM4A 5FJIA 3SU8A 2WZBA 1S89A 4R1PA 3ZE2B 2C7BA 3ZG6A 3AIKA 3B8HA 3F6BX 1B23P 2O2HA 2X14A 3Q8WA 1GAXA 5KU7A 4BNHA 4AWXA 3GT3A 5E38A 1U0HC 5EZ6B 4PXAA 5LD2C 1D5CA 2MIIA 4JB3A 4XVRA 2X9VA 4Z86A 1IY9A 1Z8FA 1UC4B 1JVNA 1DAKA 2YJNA 2JBHA 1YTUA 2I5PO 4Y6SA 1N1MA 2V7WA 3H5VA 3NBYC 1Z13A 1KVTA 2TMYA 1QH0A 3DE6X 1J09A 5AH0A 5KQGA 2X0DA 3T1HB 4HN4B 3TTWA 4LSGA 4LWPA 4ND8B 4JSRA 3OLCX 3RUDA 1R88A 2W4MA 4YRKA 5CEEA 2QN2A 3HHPA 1R6DA 1KJ9A 2GCOA 3KSDO 3BSSA 1H1DA 1T9HA 1UZAA 1ADYA 2R7NA 3VNBA 9ABPA 2EARA 4HWSA 3MWYW 16PKA 5ECWA 4DR3B 3G2IA 2VWGA 4N9WA 2DM6A 4BEBA 3RC8A 1L3BA 1A9YA 4E6EA 2RHCA 3SYRA 3I5XA 1S4QA 1ML3A 3A31A 5AESA 2OV8A 2CT8A 2I1VB 4N54A 1L7EA 3DKPA 2GCNA 3ICPA 4Z54A 4ZYUA 2WJJA 3EOZA 4MWSA 4DKXA 1W35A 2MJLA 1OGIA 1QFMA 5MF6A 2CXSA 1MH1A 1B3BA 3DCIA 4FD3A 1IMJA 3U1BA 2WWRA 4TV9F 2E21A 3QE0A 3X2EA 3QPWA 4IVPA 3CX3A 4WFIA 2X4IA 3SS9X 4E2ZA 1Q77A 3UT6A 4MZXA 3B1JA 2Q2NA 2Q5CA 4Z1MD 3ICVA 3LCCA 4LAFA 3D3EA 3ZHTA 3X44A 5DNYB 4PINA 4MRNA 1IOLA 2YMQA 2YJGA 3CB2A 1XZGA 3YASA 1KS2A 3OKCA 1YBFA 2HMUA 5TVKA 5A5FA 4F45A 2PG3A 3JZMA 1COZA 3K8YA 3ZU4A 1N9GB 2WTAA 5DBHX 2QE6A 4AS1A 3R0XA 2H2AA 1AK2A 4CV1A 5KVAA 4FDMA 3STUA 4NV0A 1M6VB 1P62B 4MR8A 2P2DA 4K9OA 2ECOA 2ORED 4WE3A 4AF7A 2OXRA 2Z9BA 4XKJA 2HOQA 1I14A 3BWCA 3QVSA 3MWDB 2A0FA 4B0OA 2NSHA 4CDNA 5E7MA 3WL6A 2QIPA 3MTDA 3HJTA 3QSGA 2WAXA 5FLYA 4IQ8A 4LOAA 2R8ZA 1KY2A 3GCDA 3JYQA 1FYFA 4F6LA 4EZBA 4JXZA 3EIHA 1AUPA 3D59A 1QH1B 2ZW9A 3D3WB 3KO8A 3MMZA 5JPIA 1LBHA 3WRYA 4JIMA 1RBMA 4X45A 1CUJA 1W4BA 1OC4A 1QC5B 4IYJA 1XZHA 5IJAA 3G88A 4JVNA 1PG0A 4AG3A 1ZONA 1JAHA 3Q5DA 4ZOAA 3D0QA 3OIVA 4RNCA 5KQRA 2F9LA 4J4BA 3H8SA 1PWYE 5E95A 1ENPA 1N6PA 4JBIA 3ZE1B 4MKZA 4B3HA 2AZDA 2IHUA 1P72A 2A88A 1ATZA 1G20E 3QE3A 4FYMA 5F78A 1XG5A 3G2QA 1JECA 5BNIA 1QG0A 3LY7A 2O0LA 4WLUA 5E4JA 4BBZA 3CLTC 2FQWA 5ER9A 1PAUA 2NPIA 3Q3CA 4HRAA 4ZTBA 5KCZA 5KNCH 4F1KA 1QVAA 1ZLXA 2PGAA 4ZIRA 1FNDA 1KPHA 1VRWA 2MWMA 2IS1A 5JTUA 3OZDA 4TLDA 1EP3B 1J7JA 4YEDA 1OW3B 1T91A 5FL7A 3KOZA 1V5EA 1TM1E 4NCAA 3QEMB 4HEHA 3QQ5A 2PM8A 3PQ8A 4E31A 2A33A 2A5YB 1XRPA 2ZIXA 3ROMA 1ZSVA 1SQSA 1DXQA 2FFQA 2PKCA 3OAAA 4FWIB 2A9OA 2ZM6B 4FN5A 3WLFA 3AESA 1I5EA 1Z4MA 1WD5A 1MDBA 1QFZA 2O05A 4IDFA 3I83A 1MIHA 2WR8A 4XYMA 1BDBA 1AMUA 1QIKA 3B6JA 1CDZA 3SBOA 1XJ5A 1Y37A 1SIBE 1F20A 2X5NA 2ZDGA 2R25B 2RH4A 4JLBA 1CJSA 3L04A 2VRCA 2AJLI 2OAQ1 4ZI7B 1W4CA 3DLIA 3MEQA 3PQEA 4NS1A 2NSLA 5B64A 5CXUA 2HJVA 5BT9A 5C7YA 2E87A 3NIDB 4QPNA 1HK7A 2OO5A 2RGUA 1K9VF 2XY4A 3E9QA 3RC2A 2J45A 3WLRA 1P6QA 2QRLA 4CV3A 2BGWA 4A0RA 4C0BA 1IWBB 2HJHA 3V4PB 5AI5A 4D0SA 2N46A 3HKDB 2QDXA 1I6WA 3N39C 1AA6A 1CS0B 1TZMA 3OZVA 2XODA 1ECLA 3CJRA 4UEKA 4XYEA 1UR5A 5DLQC 3U3KA 5IF9A 3HDGA 3N7UA 4D98A 1YVUA 1TJ5A 3GELA 1Y6ZA 2XE8A 2XQVA 3ZCTA 1OOEA 3L7JA 3KFLA 3P9RA 4XLZA 4P3XA 5AOBA 2CXXA 2PYIA 3L4BC 1NFRA 2Y6UA 3TOZA 4D26A 4CT5A 3LIIA 3HWRA 3FUXA 1FQKA 2H5EA 5DTQA 4RSRA 5HQ3B 4GO1A 1UM9B 4YJFA 3U39A 2AFRA 2G82A 2IF0A 1OAOC 2WWWA 4ARVA 3VPGA 1A9TA 2XYHA 5AMXA 3B85A 3VR5D 1RCUA 1WHSB 1WWKA 3VXKA 3T7TA 3BMXA 3K0FA 4EHFA 5IBCA 1ZZGA 1QGDA 1XAIA 2ZZMA 2WVGA 5ER6A 4BO7A 1NBIA 3VKHA 3A0UA 1KE1A 2V8BA 2RC5A 5SY9A 3TG2A 4BO8A 4QJIA 5MN4A 3QQPA 1RYYA 4KB5A 5JVDB 1Q0TA 5B30A 1O5TA 1KEVA 2ZROA 5IHXA 1GWNA 1V0JA 2QNIA 4GX0A 4OK3A 2JW5A 3EQ8A 4ZD6A 5IDYA 4QXOA 1OSNA 2R8RA 2OC9A 2WP8J 4L95C 4OGLA 3DMHA 3HDYA 2OEPA 2C1EA 3FUTA 2QBYA 2M9MA 3T5CA 4RWEA 2FWRA 2VR1A 3BBPA 3OEED 4RKRA 2XMRA 5AKXA 5DYIA 5A0TA 3OOEA 1KK3A 3V8PA 2FAXA 1LDEA 4IDQA 5JISA 1NONA 2SHKA 1QCCA 4MOWA 1ZD9A 3AB7A 3L7OA 1AS3A 3FFTA 4B4KA 3O8BA 1U8TA 4CM8A 4DCTA 3CO5A 4OGWA 2H2HA 3TQSA 5UKDA 4FYJA 1U63A 2E5LB 4INOA 5A1JA 3TNFA 4GGPA 2ASVA 3I9MA 2ADOA 3EIXA 3L2OB 3PYXA 4GD3Q 1UPXA 3NEJA 4R9VA 4JUFA 3BYZA 3DMTC 3FCEA 3UHOA 1MR3F 3OJFA 1WDMA 2B4TO 5KKCA 2V6JA 8MHTA 1F17A 2QD1A 3EIWA 5IT9A 4A9AA 2WMNB 3VX4A 4YMTA 4AI6A 1D2MA 3BD6A 3F6RA 4L78A 3LUCA 4HLQB 3H1FA 5BURA 3F7OA 1RE1A 4YMHA 2B3DA 2IYAA 3SC2A 1FZTA 1MJ5A 2AJBA 4PC7A 5B6PA 2PLNA 4CMEA 4XUEA 4AJJA 4KW7A 3W5SA 2P9QA 3E1GA 4FXPA 2ZB7A 4R81A 1TQ6A 1Y5MA 5EA2A 3VU1A 3WMEA 4K1LA 3LUKA 1HE4A 3ZVMA 3JVVA 1BYIA 1IL0A 2YJ6A 3ZC3A 3OCYA 5FUVA 4B7AA 4D02A 1E69A 3FF4A 3TL3A 2Z3VA 1J2UA 1DBWA 1J25A 2VHQA 2CFCA 3IBTA 5DN6A 3OETA 2Q4OA 3RV3A 3KC2A 4HMPA 4IDAA 4AAYA 5K3EA 1ODCA 3ID6C 4K28A 5EJIA 5H3HA 1PK7A 4TYWA 2P5UA 1V4BA 1G3RA 3PDIB 4KSYA 3U7GA 5BV2P 4MWDA 3W3AD 3IR5A 1JU9A 1N92A 3R7NA 4R0VA 3MQ4A 2DE0X 1DINA 2GYWA 3MJVA 1BEZA 3FCSB 3FDFA 3PR3A 4GPEA 4HPXB 1HDIA 5AW9A 1OTXA 5BMVB 4A0HA 3EK2A 3QELB 4MRVA 3OUUA 2XVMA 4XIGS 4V0MA 1PGJA 1SIOA 4CMEC 2OCYC 4HWRA 5F4ZA 4WK2B 3RS4A 4YJHB 1KKMA 4HVAA 4B9EA 3S7TA 5K0LA 3QU5A 4Z4QA 3AYXB 1CUFA 1Y5RA 4IUBS 4RZIA 4JC4A 5AUNB 2QAGA 2J59A 3FBTA 3EARA 2QRJA 2QUIA 2NO4A 2GYVA 2V97A 3C6BA 4KG7A 3VV2A 1BG6A 1MUUA 1QTIA 1BN7A 1Y8QA 2A57A 4DANA 5LP1A 3UMSA 5B58C 2X0EA 4P4SA 1G55A 1IH8A 3MMSA 1Q6YA 2HB6A 1JQKA 3NM4A 3L02A 5IM4F 2PUBA 4MINA 2BFEA 2P7HA 3FJYA 4OM7A 3H0EA 3S99A 2QZSA 5IJ0B 2ZKLA 2WWXA 2CNOA 2DWOA 4PSKA 2YJ3A 3AUJB 3SX4A 1GGNA 1R9JA 3HCWA 4UZFA 1ZAKA 4JOQA 3VR0A 4KL8S 4A73A 4U6SA 2DCUA 5AKGA 2AI1A 1RRFA 3H4VA 4QXQA 1I1QB 4BFXA 1T6ZA 2FEKA 1JQJC 1A7KA 1FS4A 2QD5A 2ZIWB 3MK31 4HDNA 2GA8A 4KWCA 1AKQA 3LP8A 3EB9A 3RB8A 3I62A 4FYXA 3CNNA 1IONA 3JQAA 3GRAA 1NIPA 4JVLA 5IAGA 2QRNA 3A9UA 4LGYA 3FH0A 4ZVLA 1XMSA 4H1TA 4JYZA 5MDHA 4CMHA 2R79A 1D2CA 1P61B 5PNTA 3QG5A 2ZAMA 4TKLA 4AJ4A 3DOUA 3GDHA 1ZGZA 3UH1A 2W37A 5DBGA 3LBFA 4DARA 5HQTA 1NR1A 2WD8A 2OYCA 4C0SA 1G21E 1GPUA 3IDQA 1RJFA 1S2OA 1MTZA 2J46A 1G8YA 3G2JA 3FWHA 3JWJA 3LPDA 3NP7A 4M1YA 3RRJA 5JPDA 1Q7RA 4P3YA 5KNBA 2IH5A 1EDBA 4WXMA 1T4DA 3HFSA 3VJLA 5AM2A 3DVAA 4FGKA 3HJFA 4R5HA 1HYBA 1Z3CA 1NQOA 3QWHA 2GCEA 4PYQA 2QV0A 4MQFB 2VATA 1GUZA 1J23A 3GLKA 1P0PA 4GSYA 4I1UA 4L85A 3DAYA 1WUJS 3G8BA 2IZOA 2J5XA 1IN6A 2XI4A 5JSQA 1SXGA 2J32A 1HLGA 4HF7A 1UK6A 3KKKA 4L9WA 1K92A 2QW8A 5F2EA 5FTKA 1PRYA 5LZ7A 1QF7A 2E37A 4V1CB 1ZJWA 2QY9A 4CI0B 4HX9A 4D46A 4JWTA 5ALPA 3L93A 5IEJA 1K88A 1HDOA 2ZU0C 1MLDA 2A1IA 3GPBA 4NPCA 1YRHA 4JVSB 1KH2A 1H9BA 1ABFA 3KB2A 3PDHA 1Y4DE 4L28A 4WEOA 1NJ5A 4KI0A 2W0MA 4CFZA 1I5RA 3RDPA 1TYEB 3GRUA 1M34E 4LX8A 4WH0A 2ODPA 2I4OA 4S0XA 4G5FA 4B3JA 2FXVA 1U1CA 4NOLA 3RS2A 4E5NA 1Y9AA 5I4CA 3PUJA 4ZWNA 1NL3A 2WYOA 1TEZA 3AF5A 1GL7A 1A3CA 2PZMA 3QK7A 1QGUA 2W58A 5F5XA 5TMBA 5FTJA 1FRNA 3DEZA 2UYGA 1SXJA 4ND7A 4NCIA 5CCXA 1HG0A 3NHBA 1D1PA 1X7HA 2B35A 5H81A 3G0HA 3OZTA 2G8LA 4I2VA 2ZETA 5E8RA 2VDUE 4EF6A 4F4DA 1VHJA 2Y2UA 5E6UA 3FMGA 4RIEA 4EX7A 1JRLA 4L8WB 5DTRA 5ADVA 3HJCA 2R1ZA 1KRXA 1E89A 2PLRA 4TTVA 4MLZA 5ALMA 4WN3A 4JB8A 3NKVA 3PWTA 3WKAA 3KFXA 1TYAE 3KUKA 4HB0A 2R2GA 4XX0B 3ZWDA 3QU9A 2C31A 4KXNA 4WINA 4JI7B 1VQ1A 3MMPA 5G53C 4XB2A 1C29B 4K9RA 1F38A 1ZA1A 4LTMA 4ZTUB 2EQ5A 4JOSA 1VL1A 4IMRA 4UBIA 4ONEA 3BGDA 3DFZA 1XRNA 1R6UA 4BVKA 1QAMA 1AXEA 2HTEA 2GESA 2PEYA 3QHAA 3EA5A 3PCRB 3QF4A 1CS4C 2HRQA 4ZAXA 5F2OA 2WHEA 4JROA 4OU4A 5EE1A 5HE9A 3EYAA 3SQWA 1BROA 1OI4A 2OBMA 2JLCA 3ISJA 4DDVA 3EZ6A 5LD2B 1TF5A 5GPBA 3SWWA 4WESA 1R0YA 4X00A 5JZOA 4RVDA 5FWNA 1IQ0A 1CVLA 2K7ZA 1RWKA 3E15A 3D3KA 3DGEC 4TMKA 1GTVA 4WY5A 5L7YA 3PXCX 3DLPX 1Y6JA 2V65A 1JG3A 1Q0PA 1UC9A 4MO2A 5FAKA 2P6UA 1Y82A 3JATA 3DMTA 1MG0A 3CZ9A 2QLJA 4GE0A 4P7JA 4BS9A 4CNQA 1U7TA 1WXQA 4CRWB 2IH4A 4CKCA 4V0LA 5DULA 4FLEA 5DBOA 4ND3A 1X74A 2GPTA 1G1MA 2NUTB 3EEOA 4HLCA 3ABSB 1RYEA 4WHMA 1ESEA 3CT4A 3VC1A 3AETB 4GRDA 2V7TA 1JR6A 4HWTA 2HIAA 5HIMA 1RRGA 3AKZA 1W8DA 1H2AS 2QM3A 1V1JA 1T4CB 4O4IF 5TARA 3UUEA 2ZATA 3TLYA 2PT7A 1ISGA 4HQNA 3NBXX 5ES4B 3UJNA 3N2GB 1FY2A 3VHXB 4D25A 4DL9A 2GZ2A 2WOOA 5JO9A 4WZ6A 1U1EA 1T9KA 2YDYA 3TE7A 3WNDA 3ZU2A 4C7JA 2OCKA 1ZC4A 2IDZA 3WBFA 5B1SA 2BKEA 2HFKA 4OJYA 4XSGA 4ZEVA 1AGRA 3KLBA 5CHYA 4F3NA 2B8TA 1DL5A 3G0BA 2XA2A 3N8IA 1E7MA 2FI1A 2VH1A 1YR6A 3OE4A 3UW3A 3RBXA 1PVOA 4DNOA 3A58B 3OY7A 1V6SA 1ZK1A 4J7CA 5DZSA 1EZZA 1XB2A 4F8YA 3UO8B 3QF7A 2HT1A 3UT5A 3HEBA 1V2HE 5FTWA 2NADA 2WY2D 4TYPA 5ETJA 5CA1B 3VISA 4IWXA 3BERA 4KLNA 1YH3A 4QL3A 2P4SA 1AHHA 1V1RA 3GIDA 3B89A 3LBAA 4F4UA 1K75A 4PF1A 1WJGA 5LQAA 4PLZA 5H8WA 4LSWA 4E03A 4DDMA 4F3CA 4ZDIA 4UUAA 3B3GA 4YVFA 2A0KA 1KU0A 1O8CA 2CFSA 3A1WA 4NL4H 5AUPB 3KSBC 4D3FA 5AJXA 4Q7EA 4B17A 2FDCA 2HA7A 3D8UA 4C04A 1N2CB 3E8XA 2O7NA 3HP1A 3PNBA 4G1FA 5LB2A 4CMBA 4RL6A 1EWVA 3VR6H 3L4EA 2RHMA 3IXQA 5L8VA 1A9ZA 4WADA 2ZBVA 1GNPA 3BZWA 4LISA 3WWCA 3I9LA 1HE5A 1UOOA 4S0ZA 2D2FA 3K1AA 1PV4A 4O2AF 4I1SA 5CVVA 4JV5B 3A8TA 3OBIA 4XEUA 1K7SN 4LWZA 5IEBA 3NASA 4MTCA 1JZTA 4DAOA 3IIIA 1IAQA 1XFAA 4HQ6A 2P2NA 4DFDA 1Y42X 3WV5A 3LDFA 3DMYA 3U80A 3VYWA 1P81A 5HS4A 1SHUX 2OV6A 1H2RS 3BMCA 1ORWA 1W4LA 1XLUA 2AG8A 3O47A 3OE7A 2BBWA 3FYUA 3NAGA 4OHFA 1ISIA 1G7RA 5TGTA 4MI1A 1DKLA 2W6OA 4CFYA 3FFBA 4PZDA 1T0JB 3AWIA 1ZJJA 2WU3A 4Y2RA 1TB4A 1Z8NA 1Z7WA 4RK6A 1XMOB 2CLLB 3QFSA 2B83A 2FUNB 1E18A 1WKVA 3D7KA 4NYMQ 4IIJA 4AS3A 2AEFA 2YXDA 4DF3A 2JVIA 5LU8A 4D8VA 3COWA 5F9MA 2P9GA 3O8OA 3TRFA 4L4XA 1TAGA 4HO1X 2LXNA 3ER6A 4NBLA 3NHRA 2J7PA 1W5FA 1BQ4A 7GPBA 4ZAZA 2JLQA 5BY2A 5HWSA 3A9SA 4R9RA 2QRQA 4O4HA 5A3SA 2EYUA 3AUSA 2HA2A 2PAFA 3HN2A 4M9CA 4IXTA 5H4HA 4IIJF 3OFNA 4TM8A 3KHUA 3PVZA 1L9KA 5CMLA 5IM5A 2JLSA 2R97A 3EEYA 3W8DA 1MH9A 3ESZA 1NV8A 5AK4A 5LDGA 3KKNA 1MNAA 2J6BA 3RANA 3Q88A 3ZR4B 2I6QA 1GKYA 3MSCA 3ZLJA 1NASA 1UJ2A 3DM5A 1TYDE 4CLEA 1GLVA 1YULA 2KBEA 3WA7A 1PT8A 4QM6A 3CW9A 4U2FA 4JDUA 3ET4A 1HX7A 4K6KA 4QGFA 2WF6A 4PGAA 2BMEA 3T3MB 1PVDA 1XTQA 4EG0A 6AT1A 2UYOA 3W6OA 2IYWA 4BNYA 4O2RA 4DIDA 3BTSA 4J1NA 4EPTA 1QCYA 3GVCA 3JYHA 5I5EA 1W49A 4WZAE 3K0FB 5KJEA 4PYLA 3A9TA 3ZDFA 2R7AA 3GFVA 4F6CA 5IN5A 1G60A 1DTEA 1Y33E 4OMDA 1QPZA 2ZZKA 1E3JA 4X66B 1JHDA 2K6GA 3GVHA 5INTA 4L07A 3CRW1 3KB8A 2AR0A 2PMCA 1PSZA 1LQ2A 5KMGA 5BOSB 1JFLA 3IDSA 4RXTA 3AETA 2YX1A 1J21A 2LBPA 5DYWA 1EUDA 1LRKA 5KYUA 2UXBB 2FWAA 3F6CA 3W5JA 4YCNA 2PZAA 4AS2A 3F4LA 3EGDA 4O4IA 3WB0A 1K5DA 2OCLA 1LPPA 1N6IA 4JT9A 3PEVA 4L3OA 2GAOA 3EEQA 4DM3A 5E6RA 5EJ5A 1HE2A 4LDPA 4P9NA 2EEPA 4QATA 4G8BA 2PGNA 5HKKD 1L5OA 1E62A 3QPVA 1HT1E 3G5LA 3JWHA 4JJ7A 3UHAA 4CHGA 2FZKA 3P2IA 4G63A 4TYQA 2IBSA 1C3EA 1G5RA 1ZOSA 3TRDA 4YGXB 1R4NB 2XKJE 3IAAA 4G0XA 3SZGA 4Q03A 2VF2A 3AXSA 4P4SB 2W2KB 4DLVA 1C0PA 4KUHA 4F2PA 2DFLA 3LD9A 4KOAA 5EIBC 1TM5E 4CBVA 1FNCA 2XLCA 5HF6A 2PBFA 1OT3A 1C1XA 4C2AA 3IAXA 5H59A 1PDVA 2XRMA 4LF5B 4BB0A 1USUA 2J41A 1JNYA 3LSYA 4IHAA 1DADA 4UZEA 3WL8A 2HH9A 2FWJA 2UUPA 2ZSJA 3H1PA 4BWGA 1U0BB 2G72A 4BNMA 2RDMA 4TTAA 5CUQA 1N33B 1R7RA 3A1SA 4Z51A 5JDIC 1S96A 3BICA 3LM8A 4OJQA 4MCJA 1YJCA 3K20A 1FF9A 1GNQA 2AOTB 3Q85A 4JLOA 1EG2A 1Q0RA 3ILYA 1GZ6A 2HREA 1DCTA 2Y93A 3JASA 1HKHA 2WJGA 2XB9A 4JQSA 4Y2SA 2OZPA 4XVHA 5DKFA 4RM2A 5EXPA 3LMKA 1U2ZA 3SJAA 4OH1A 1XZEA 2GBLA 2Z4RA 3IBSA 1E59A 1P7PA 1G5IA 2ZXEA 1TCVA 4IRUB 3CX7A 3DZCA 3O8QA 3PYMA 1CUYA 1D4AA 1FNSA 2OHHA 4MUXA 4QXAA 5LPNA 3C6XA 1U2EA 2C5LA 4FC6A 1BE6A 4FSDA 2WSBA 2QVBA 2X1LA 5AKEA 4AJOA 3GEGA 3E7XA 1QTQA 4LGMA 3WIUA 1GTJ1 2P4QA 3MJHA 3DUWA 2PDAA 4PGHA 2G07A 3WYBA 1FNNA 3FMOB 1Q92A 4R2KA 2BFNA 3VR3A 1KHTA 2WG2A 1Q2UA 3JALB 4UHCA 5B3AA 1DC8A 4V1CI 3SOPA 1P73A 2DHRA 2V3CC 1UBHS 2CEKA 4O4LB 1H8EA 4RPJA 1FVHA 5BNZA 2CHFA 5ELMA 2VXYA 1AIPA 2ZCVA 5KTKA 4K9LA 2Y0EA 1IQUA 4FLMA 4CG2A 1IULA 1EWRA 3UWSA 2JD2A 3FDXA 3HY6A 4OXXA 2OFFA 4OOFA 5IH7A 4CKXA 2JARA 3IMCA 3KEOA 4DWVA 1YRBA 1Z37A 2HBQA 5BP7A 3P2YA 1FTNA 3BGIA 3NC1C 4DVJA 5JRJA 3R8FA 4NQRA 3KTOA 3QHPA 4AZVA 2JZOA 2GO1A 2PA0A 2ZUUA 3FYDA 3QOXA 2C5BA 4U3JB 4NXNB 2PUWA 4AY5A 2QQGA 1RZUA 2RJNA 3U3ZA 3MTQA 4DHWA 2RARA 1CNMA 1Q91A 1WDWB 1KVRA 3AL2A 3IT3A 1T3LA 4PSDA 4YROA 3RVRA 4ZXFA 4E08A 1SD2A 5TMDA 3WFIA 2EHDA 3LHDA 1TKCA 4MCHA 3F8WA 3GVXA 4G9BA 4MWOA 4NK5A 3MCZA 4WNAA 4XUGB 3ZHRA 1GPWB 3H8JA 5DIZA 3ESXA 4EUNA 1ISSA 2YQZA 3VZDA 4BQRA 5ENVA 3BCHA 1L4FA 1J70A 1FZQA 4MQEB 4XRGA 4EEKA 2G5TA 3CZPA 1KFEB 1KK0A 3HWSA 4LRUA 3EX7C 3GJSA 3AVTA 2NO1A 3C0KA 1ZUNA 3LF2A 4NZYA 1CQJB 2AIRA 4C0WA 4KQWA 2PTHA 2CL5A 1QAQA 1O03A 3PIRA 4K5QA 4KQHA 4BNFA 1IG0A 1L7QA 4JQZA 1DEXA 3M33A 1R18A 4TRMA 5JSKA 4IIBA 2QOEA 3OA2A 3WLTA 4A8JB 3M3PA 1K8XB 4ECAA 5C80A 3LUDA 3LLCA 3VDQA 2FPIB 1F8FA 2BHNA 5T4FA 4GVPA 1BMTA 2J9RA 3NC4A 1JFFA 1KYXA 2GEDA 1YVDA 1TZJA 3G49A 5DBEX 1YRWA 5AVSA 1UJ4A 1EAMA 4OI4A 1VL6A 2X58A 3O2QB 2VHVA 3RYHB 4EW2A 2H65A 3HB1A 2PJDA 2XVZA 3FNGA 4PU0A 4AUMA 4BFUA 4E2YA 3U60B 2G71A 5DOVA 4HCJA 1THZA 2UXDB 2Y99A 2G0AA 5LVAA 2JRLA 4DRZA 1LRJA 4FGUA 4A6PA 5T7BA 3TZBA 1XQ6A 1YCDA 2XQIA 3ZJYA 4RKQA 1TKBA 4J16C 4XSVA 2H07A 1OB2A 1K8YB 3KUDA 3PENA 5JE8A 1U02A 2VDMB 2N42A 3GC6A 3SVLA 3D6UA 2XA1A 3D4LA 3MUNA 1Z15A 5FPQA 4OFXA 5A3JA 4FEGA 1QK3A 1CRWG 3PJEA 2XUKA 1YCHA 1PIWA 2R48A 2FMHA 4FI3C 3Q3VA 4D8UA 3OIDA 5SICE 3ZBQA 3KELA 2CC2A 4ME6A 1RJ9A 2IYPA 3UXEA 3WLPA 4YRRA 1R0XA 4K6MA 5EGNA 4BGIA 4QKQA 4BJ3A 4N40A 1E6CA 1IB0A 4CF7A 1VP9A 1C3JA 1GCGA 2DQSA 5E9QA 1K5PA 2JCSA 5JJ5A 2J4CA 3FPFA 4IDCA 2J3IA 4CHTA 3BTOA 4KKVA 1E32A 1RI5A 3LIPA 4K8OA 3UAVA 1IN1A 4HH0A 3G8CA 1KZHA 4D4MA 2W8ZA 4GUDA 2VHZA 5YASA 3UMJA 3O73A 2R1UA 1MJFA 4CCWA 1QYIA 2MSWA 4EB3A 1AH2A 1FXWF 1Y1PA 3FZNA 4N18A 2RBKA 1OILA 1ZUHA 2O2CA 2J1LA 1E1LA 1UBRS 1E6EA 2B8NA 3DYVA 3TLAA 1CD5A 4E5PA 1WUYA 3T3GA 1G21A 1CP3A 4FINA 3TLZA 3EVDA 3PPXA 2XUHA 4IV8A 4QX6A 2CZCA 3GLGE 3OJ0A 3DCNA 5A6SB 4WZBB 3M9WA 1H1TA 4YP0A 3EZNA 4NZZA 5CX1B 2AOWA 4HFNA 1KQ3A 3DDNA 4RXMA 1XCMA 4HEA6 3W0LB 5EIWA 4EHIA 4L08A 5A02A 2HRRA 3QBTA 1W5BA 3SNKA 4B7CA 1BX0A 2IT1A 2P5SA 1IY2A 3A9CA 3G0OA 1KSHA 4ZOEA 4CM8B 4EFDA 3AHGA 4YQZA 4WBNB 3P9KA 3RHTA 4M4SA 4TV8F 4D3DA 4PC6A 4Q5IA 4RGVA 2GRUA 1XZJA 4UBOA 2VPXA 4CN8A 2REXB 2C4KA 4HGPA 4RD3A 1G8JA 4PZEA 4QNMA 5K99A 1IM8A 2Y1FA 3O3CA 1G5TA 1OLOA 2V7PA 3LYAA 2G70A 4OHKA 5AVXA 2RI6A 3PF8A 4TMFA 1PW7A 1RAGA 2Q5EA 4OHUA 4CMIB 3OLYA 3CBGA 1UKZA 4EF4A 2E0IA 3KYJB 2IHYA 1HDZA 2IVFA 2OV2A 4L72A 5GVSA 3FLBA 2C8VA 4JOCA 3I30X 3ZWBA 4H4CA 1ZK2A 1L5WA 1KFBB 4OTZA 1DWPA 3RK0A 3TPCA 4ARSA 2PGOA 3O8NA 3L6UA 3MINA 2VN8A 1NF2A 1TX4B 3SVTA 1RVV1 2ORIA 1PR6A 3J81A 3ZNOA 4KIUA 3BMNB 3BKXA 4FT4A 2F90A 5DTIA 1M2FA 1PJ3A 1SCUA 2DHDA 1XZFA 2PA3A 4LBWA 4Q34A 4YO7A 1OFHA 4B45A 3QFCA 1MW9X 1GFIA 2Y0BA 3C1UA 1J0DA 2Q7XA 5HDQA 1W93A 4K3VA 1G4AE 4G5RA 4PPGA 4CM5A 2G1JA 1GG9A 1KBZA 5EJMA 1JHZA 1ECJA 3HLTA 1GZHB 1LBIA 1CJCA 3G9QA 1VSTA 4JP5A 4YXWD 1E4VA 3K8QA 5SYMA 1SA0B 5K3SA 1N0HA 2IGTA 3BWBA 2XIJA 1OWLA 4CIWA 3B78A 1AB6A 2J5BA 1XIVA 3Q0EA 5H9WA 1YSCA 2GD1O 4C3UA 2NX2A 3BXZA 3IELA 3LGSA 4EJSC 13PKA 2PU7A 3KPWA 2JKVA 2EKBA 2NU9A 3MCTA 4H3KB 4YJGB 4J6FA 5H16A 2HXYA 5GP1A 1PL0A 3AUTA 5JHHB 5TQVA 2WP0A 4TMYA 3AFOA 3E53A 5EQTA 4DDWA 4KO2S 1KYTA 2FYTA 3OJWA 5JEEA 1SNYA 2OECA 3SAJA 5J2TB 3MBKA 3JTEA 1ORDA 3LPNA 3C5EA 2BFBB 4B71A 4MPDA 3TCXB 5LU9A 2CLEB 4FC7A 3S8EA 3PHGA 4B3MB 4DUGA 4RAQA 1QGAA 2C5EA 1AGYA 2VC2B 1AK9A 3NOOA 3SR3A 4DGSA 1FXSA 4HAWA 4A26A 1UOPA 4OF4A 4KO3S 1FBTA 1FLDA 1NQWA 2YMPA 1F3OA 1HFKA 1YB7A 4H0NA 1H4VB 1JG6A 1XCLA 4AJKA 3V8QA 2H3HA 2FW0A 3AY7A 1VHQA 1F48A 2Q41A 4GXQA 5CXXA 4DA7A 5K8VA 1KI3A 1U9YA 2H2DA 5H7XA 1PZXA 2PBZA 1ZN2A 2Z5VA 4ND4A 5DI3B 3PXEA 2PS3A 1X87A 3ET5A 1TTPB 2ORVA 4U39A 4URFA 4KWTA 1VKNA 1XTRA 4MJXA 2PKEA 3QJ5A 1E1KA 4IV0A 5HILA 4CM9A 1NMSA 2QQ5A 4NR0A 5DGXA 2X1HA 1I51A 2EZUA 2GN2A 3V1TC 1EX6A 3DMDA 4CLRA 5KQMA 5LFAA 2LP4Y 3B1ZA 4ZT2A 4IY1A 4DR4B 3VSCA 5JH7A 1XAJA 5G1OA 2UXCB 5IJZA 2P9EA 4F84A 3D2BA 2WU8A 2V6BA 5I8WA 1SXHA 1RTKA 1CULC 2QT9A 2XCIA 5K0GA 1OLSA 4J1SA 3AF0A 4H7DA 2P40A 2NT3A 3QFHA 3PQ4A 1K06A 2A78A 2G0NA 3DJYA 2QTVB 3EUFA 2X0RA 3OJXA 4H1VA 4AN0A 1MAWA 2HV9A 2CLSA 4R05A 5J47A 4TYYA 3RHFA 4ZZ0A 3DZFA 3LZ6A 2WM9B 3G8AA 4NE9A 3V97A 4MV7A 4CDMA 2PS1A 2I2DA 3PR1A 2X0FA 1AF7A 4HZGA 3IAM1 3Q3GE 4CLOB 3C3DA 1K6XA 1Z06A 1RLOA 1XJ0A 4GQAA 1KMIY 1BXRA 4V0QA 3IOMA 1JYEA 1L1FA 4D3SA 1EAYA 3I09A 2BZSA 5LYJF 4LYJA 5KTTA 3FN4A 2W00A 4ER0A 5L3ZA 4DNXA 2VJAA 2Z8XA 1K6MA 1QH8A 4Y9SA 3SFVA 5CBPA 1CETA 4TKZA 1H6DA 2W2NA 3OQ1A 3UZUA 3SM9A 5ABPA 3V4SA 2W71A 2YIJA 2PUCA 1KOGA 5AQEA 2I4TA 2EJUA 3KXIA 3NYRA 1AQLA 5EAIA 5TQ0A 2V96A 4J2OA 3RBVA 4EGCB 1OWOA 1T6XA 1SXJE 2Z58A 3MJTA 3AF3A 3HUDA 5CNJA 3ROPA 2YMLA 2J31A 5KYTA 1EX1A 3T4EA 4Q01A 3RAFC 5JD6A 2IL1A 2NPOA 4RTKA 2VTBB 2B36A 3B36A 5JD5A 5KOYA 3M3HA 3OEEA 1HTTA 4HY3A 2GEBA 3HVUA 3PX7A 3AEKA 1Z5NA 1TK9A 1DIBA 2BFMA 3LKZA 3Q5EA 4I50F 5E6SB 3RVQA 3RVJA 3VKVA 4BE9A 4RMHA 4U9UA 4N03A 1WLSA 2CZQA 2RB4A 1V48A 2YNMC 4MV9A 1NYRA 4Q37A 5KAPA 5HKBA 1TKAA 1I13A 4YMWA 3SZ3A 1YI1A 1VIYA 3E9NA 3O84A 4ZI7F 1CLUA 5A4IS 3HVHA 1O96A 5KTNA 2ZIGA 3ZWYA 5TEVA 5FWAA 5GJBA 4D45A 1MABB 3FPKA 4ASUD 4F1WA 2RGEA 3I8SA 4KQIA 2YV1A 2R7LA 4PZZA 1JQ3A 2E82A 4PNZA 4YT5A 2EJVA 3T5DA 1U2DA 1E8NA 1GIAA 2G83A 4PANA 2I3BA 3QWBA 2P0EA 1R6TA 3C8UA 3K0EA 3L8HA 1SC6A 3LOQA 2IQIA 4TXMA 4WA8A 5JLAA 2QMZA 4O4IB 1E1CA 3QA9A 4DJTA 3OJOA 3EZYA 4GI5A 4UHBA 4LSMA 2ILTA 3FCCA 4R84A 5F33A 3CUVA 3RYCA 2VHEA 1MJHA 2FMIA 2H1RA 3CIFA 1LF5A 2QM0A 4XM0A 4H27A 5HGJA 4CIXA 1REQB 3HR8A 3G1TA 2IYLD 2QN8A 2NUBA 2XB6A 3ICCA 2ZDHA 1DG3A 4Y2TA 4ZQBA 3WO1A 1LLCA 1NAIA 2BWJA 2CJXA 3HUFA 3SR0A 1TJYA 4C0QC 5BWMA 2ODWA 4XGIA 4QE3A 1LVUA 5DDIP 3VDXA 4ZVRA 3U3DA 1VJCA 2GRJA 3FOAA 3OC0A 4E5SA 2GVNA 2EKPA 3IR6A 4LIPD 3GLGA 5JS1A 2OHXA 2O0HA 3NORA 5JSYA 2NIPA 2FVXA 3H0KA 5CA0A 1H2EA 1SC1A 4MDFA 2P4UA 3UV7A 1SXPA 1XR3A 1VCMA 4ZVOA 4MRMA 3G2MA 4EJFA 1H9CA 5FTLA 4F21A 1YDWA 4QZVA 8ABPA 1KP9A 1RYFA 1LDYA 1ZM4A 4CCAA 1FJXA 3KQOA 3SQMA 4XOIA 1KBOA 3WGKA 4YAUA 3TW6A 2CHEA 4BKPA 5AHWA 1NI5A 2XITA 2ZRFA 3BREA 3I6MA 1TK3A 1H5NA 4C7BA 2ZJ0A 1CFZA 2BF4A 4UDXX 2Q1SA 3GJ6A 1QFYA 2IEBA 1CF4A 2IYOA 4GMGA 3BRWA 1NIJA 2JJ1A 4ARZA 1NULA 2LD4A 3LQ1A 4EA7A 1A8PA 1NW5A 1X0XA 5EC8A 1Y0BA 2QENA 5A2QA 4CG1A 1C0EA 2DXIA 1YZUA 2ODNA 1T8UA 3ES9A 2FFRA 2HSZA 4PO9A 5AJWA 4JA0A 3C87A 3PC4A 3EFOA 4YFYA 2NUAB 1J8DA 4PG7A 1T9GS 1AG9A 2G0TA 4CEIA 4BO9A 3N2YA 2BISA 4R2MA 1UKAA 4CIVA 4UM8B 3D0KA 2G8NA 1D0VA 1YQGA 4UC0A 1UKBA 5IASA 5IMSA 5KJ1A 3U4QB 5IC6A 2XMCA 3B8EA 3GLHB 4MIYA 2PQMA 3HB9A 4NABA 3SF0A 1E94E 4TKVA 4CXMA 4OKIA 2ZIUB 2WK1A 2OXEA 3GLFE 1O89A 2QAIA 1U5BA 1PR1A 3ITKA 1FP4B 1BQEA 3AHEA 4MP6A 4H7JA 4KXVA 2QLMA 3NKFA 2M32A 1L5RA 4JDPA 4S2UA 1TUBB 2DQKA 3JALA 2YW2A 4REOA 1L5YA 3O95A 3T7EA 4D9KA 1UBFA 5IFLA 3WJ2A 2P6RA 3WE7A 4OSPA 1E2FA 4G1UC 4RKEA 3T61A 10MHA 4NWIA 2HXSA 4M3NA 4WAUA 1MGPA 3INTA 3O4FA 4D4GA 4YHHB 3OZWA 3E23A 3CWCA 2CKMA 4FE3A 4QPZA 2HI0A 1XJQA 3GUZA 4LV6A 3DMNA 1NVAA 3NKLA 5HCIA 3TR6A 4EBFA 3GBPA 3GA0A 1RHJA 3DKIA 1Z73A 3HNOA 3DE2X 1GCOA 1Z7EA 3LCVB 1KAGA 2EWVA 3C6QA 2NZ8A 4KAFA 3I04M 4EO7A 1ACMA 4XH9B 4PX9A 4QFDA 1VRVA 2PXCA 4RUKA 3AOGA 3KKZA 4PYOA 2AOVA 5DRTA 1DO8A 5EINA 5EMMA 4ZCPA 2Q7OE 3ZOZA 4EI7A 4DV2B 2IUUA 2DY0A 1Y8RB 2JIMA 3KJNA 4UHKA 3RIYA 1E6MA 3TIVA 3COSA 4ZA2A 1KJNA 2ILVA 2RFLA 3MB5A 3WGVA 4KVZA 1RQPA 5SZJA 3VVCA 3NANA 1HSOA 2AN3A 3FI9A 4PLPA 3THWA 1EBBA 5KTSA 1MHTA 1BH2A 1KDPA 4X1YA 1Z56C 1II9A 4J1TC 1XC7A 4K03A 5DCLA 5F21A 3SKXA 3L1HA 5K6TA 2AG6A 2LIVA 1SCNE 4QYIA 5JS2A 1VXRA 3I6ZA 4IUYA 1FS5A 5DFAA 4UTXA 1CZHA 4DC9A 4Z3KA 2GO7A 3AR4A 3CPHA 1R9GA 4D9IA 4ZO8A 2R6JA 3I9JA 3V00A 3BK7A 4DSOA 3Q7RA 3I58A 3QXGA 1WE2A 2ZZNA 1LW7A 4JUCA 1N1DA 4HFRA 3MB8A 4DHEA 5KIAA 4OXQA 3ZNNA 3VMMA 4L51A 4M0PA 2YS7A 4XIYA 2OXCA 4Q3EA 4AFNA 3WWYA 1I6MA 4RWZA 3R75A 2QVXX 1YCFA 3PNVA 1J9ZA 2CKDA 2HCRA 1L4MA 1MTOA 5DNCA 2HWUA 3OX4A 1EDZA 2XA9A 4IIYA 3E9CA 3U13A 3DWEX 3U6KA 3VC3A 2Q0SA 1N5RA 4E7OA 3NT4A 1QF6A 4DC0A 1E5DA 3SX0A 3ZV7A 1CK4A 1CY2A 1NFFA 3BJIC 4NYMR 1Q12A 3U44A 2WILA 3ZUPA 1PNVA 3EXIA 1V41E 3KOMA 5DBFA 1P2UA 2GVDC 3RAGA 4KR9A 2W4QA 3A4MA 2KYRA 5D85A 2C7PA 2C8JA 4P4UA 3NTUA 4AVYA 1U80A 1J99A 3W9BA 3B38A 4LDAA 3WK6A 4Q66C 3U62A 2XMQA 3W34A 2YY5A 2FN3A 1C9EA 4OQPA 1GPMA 1R8YA 1DQYA 2SKCA 4QGSA 2XPCA 3ZCVA 2O23A 1Z0JA 1P45A 3RTAA 3BSYA 2FK8A 2ZUBA 3JQFC 1C4XA 2HNBA 2D7JA 1GZ3A 2MYPA 4KGVA 1H2FA 5KHOC 3T0GA 4R2IA 4MVJF 4WV3A 3G5MA 2G63A 1X94A 1WXEA 4FX2A 1JEOA 2I3AA 3GMTA 3LQQA 4TSKA 3V2HA 4YR7A 2BZGA 1BMFD 1YZLA 3FLEA 3GFBA 4LGCA 3LRXA 3PKZA 3T3NA 1FYXA 2ERCA 4LF9B 3KD2A 3H83A 1T5OA 3GRCA 3P4XA 3QPUA 1A9OA 1DXYA 4G86A 2ZRNA 3NHKA 4KSBA 5G3ZA 2H18A 3EWSA 4J2TA 5DISB 4MVJE 2ODTX 2D1FA 1WPGA 1E3SA 1DELA 4MJ7A 1B6SA 4XA8A 5CLHA 1JALA 4Q18A 2PZBA 3L0OA 2VPPA 2JLWA 3QFFA 1W0CA 3AVXA 4PM4A 5IAOA 4MV5A 5JRDS 2DPMA 4CEJA 4F6RA 5IUJC 1N2BA 3ELDA 5IG2A 2GM3A 3DC7A 5DX8A 5KSOA 1CUGA 3FHLA 3GMSA 3P9PA 2A9KA 1RJDA 1P5HA 1XSEA 1E96A 4IIEA 1BD4A 3S7ZA 4YRSA 2W6PA 3D7NA 5L53A 1T4BA 5FBVB 1TIBA 3CZQA 4JU8A 3TUIC 2ZM5A 3CH4B 2O2DA 4NENB 4JGGA 3MCUA 1MC5A 2HEGA 3BRQA 3P5BA 3OLVA 2B5VA 2P91A 4ZYVA 3QFTA 3BL8A 3C4VA 4RH0A 1VE1A 1BOOA 1EFPA 1R4MB 1T8TA 1VKOA 3QTBA 1ND6A 3T35A 1OGJA 1JNXX 2HHJA 3OLXA 4R8SA 4AXXA 1R15A 3P7MA 1BVUA 5F1YA 4BKRA 3EVGA 5LP6A 5E9AA 2PAAA 5D3MB 1QFXA 4YJKA 1X1QA 3ETLA 1OD6A 5E9WA 3KIPA 3X1KA 1Y4ZA 3FFWA 3G0CA 1ISFA 1SK8A 3HZRA 3PC7A 4FKMA 1D2HA 4M8LA 1RADA 4RYLA 3ZD7A 3HDQA 3QKRB 1RRCA 1E79A 4B3GA 1M67A 1ZVVA 4FW8A 3B6KA 4AJEA 3STVA 1A9XB 1BQ3A 2H06A 1CR2A 2D5IA 4F2DA 5ICEA 4B3RB 3REGA 3IAEA 4ENSA 4JEHA 2EKZA 4C2BA 3V8RA 3N86A 3N3BC 1TJNA 3I1FA 4D9EA 2Q8QA 3CEHA 1RZRA 3GVIA 5BOSA 2H0QA 1NU6A 4IIHA 1ULBA 4CTKA 1X3LA 4FOPA 1QE0A 3RFFA 5IVPA 1QIMA 5G1PA 5G0WA 1U0JA 2GDJA 1QUFA 3H5AA 3L05A 3NNDA 3K6JA 3VR5H 1ARZA 4L0MA 5CYFA 2AF4C 4YAIA 2YOGA 1XI2A 4RGQA 1E5LA 3RWMB 1G20A 2H2FA 5K0SA 1E3TA 4MZDA 4EAAA 4HJRA 3ABZA 3AZOA 2I4NA 3DD5A 4LDZA 2WA1A 2NSYA 2CMHA 1KSJA 3A3NA 1QANA 4GKVA 1UPFA 1TT5B 3Q3EA 4I4TB 4PONA 1UBEA 2WHYA 1NV9A 1KAMA 4I6JA 3RK4A 5T5QA 4EZIA 1T2AA 5KEIA 4AJHA 4PLWA 1R50A 3OZRA 5IKOA 1JDVA 2XOKA 3EFBA 1SUAA 1X8KA 2GAAA 4NP6A 4KPUB 4B2IA 4MQ5A 5TE9A 3CF4A 3WOHA 3WICA 3T1YB 3OQ6A 3EOAI 3V1YA 2DR0A 3R7DA 1ZR4A 1E4OA 1T9CA 1IHOA 3AUYA 3GEEA 3FJOA 3HUEA 4B32A 2X7HA 1UK7A 2B7BA 2HA0A 5J23A 2OO3A 1A4XA 1U98A 3DBLB 3T7SA 4CKBA 1VKZA 3KXKA 2D1QA 4JT2A 5FBZA 4BQNA 5IM4A 3E81A 3U7FB 3HRIA 3ZN2A 1EB9A 1FK8A 4BVBA 2ZUWA 4D81A 3CEPB 3C85A 1WVIA 3G2LA 2H1HA 2C9BA 4G3XA 2I76A 1C4KA 3H9BA 3OE7D 3PFWO 4KH0A 3BTUA 3P2OA 4A16A 3EVFA 3FPSA 4AMZA 4UTRA 3WK8A 5IZCC 3NETA 4HDSA 5L4NA 3U61B 3BULA 1PGPA 3II6X 2NPFA 5J4HA 1P0MA 2A9QA 5EFZA 2D2XA 4GXRA 5LYJB 2CMFA 1RXSA 2AFHE 2ZJ8A 1G2IA 3IP1A 3M7IA 1W2GA 4O2BF 2HMSA 3RYIB 3WBKA 1KOFA 4LRYA 3GHHA 2DAPA 3JVDA 4QSMA 5FOTA 4FEYA 4S1OA 4IFBA 5TPWA 2PKQP 3RHZA 4AZ3A 1T0IA 2YHIB 1ZDMA 1PZMA 4FHGA 5B53A 3KLOA 3N8HA 1E2BA 3H65A 1B4DA 3CHYA 3FMVA 1WQ3A 4JJIA 1H2XA 2QGNA 2BM8A 4KREA 5FNVA 5HK8A 2Z8YA 2IZ1A 2D1TA 5AR1A 3VH3A 3E2PA 1VE5A 4F96A 2VJOA 1NFQA 3EDQA 2RIPA 3U16A 3D4IA 2IZ0A 1KYIA 3O7MA 5ULLA 3U9TA 1P5ZB 3PA6A 4HGZA 5A3VA 3ZIDA 3NLLA 5LXTB 3G9UA 4JSYA 5BQ5A 4JUBA 3NWBA 1GFWA 4PO3X 3GH1A 3QY9A 4J8PA 3KPVA 5L51A 2H92A 1K0UA 4GZ6A 4X3PA 1M83A 5CNKA 4OGFA 3RVKA 3FYUC 2V3VA 4BQFA 5LQRA 4RZUA 5CLQA 3MRTA 4YCBA 5H02A 5LUAA 4QBIA 4DMHA 2PV7A 3E3OA 1M72A 3MWKA 5DM0A 5LLDA 1DOHA 5A4MS 2RGXA 4OH7A 3IP6A 3JSXA 4AKTA 3FWNA 3CKYA 1QR6A 4EO4A 2FQQA 4G24A 4D3YA 4F9GA 3LXRA 1HOXA 2AFVA 2XVYA 3W9UA 5B2FA 4MK4A 5KOJA 1DTWA 1FJ2A 4Y1GA 4FKBA 1K2VN 1VCNA 3N1UA 2KB0A 3G8YA 4M86A 3O4JA 4DT1B 3PV0A 3A6ZA 2BTQB 1T1GA 4IH4A 5KJ6A 4M2LA 5DBIA 4DXHA 3COZA 1DEHA 1MXHA 2RGWA 2XB8A 4BGVA 1R4ZA 1B6RA 3SEQA 4EOGA 5FHRA 2Q6VA 1YZVA 5F51A 4HNSA 3Q9UA 4OXRA 1J06A 2VDPB 3K94A 3PGXA 2OQVA 4F46A 3CNHA 3AVYA 4UM9D 5EXDA 1P7YA 4JU9A 2B8WA 1EGMB 3MIZA 4UPEA 1P0CA 1EX7A 2HJSA 2CNKA 2B0CA 2Q1XA 4J1QA 1YE3A 4A0GA 4F85A 1DAOA 1SG0A 3L6BA 5E0OA 5BW6B 3DDZX 2P2SA 4TROA 2WSSA 3NGMA 1OE0A 3QLUC 2JIRA 4RK5A 2WAYA 3PI6A 4KQ9A 4Q1DA 4BO0A 4CETA 3KEMA 1MABA 4L8YA 3GROA 3G8DA 4E5DA 4XW2A 3HV0A 4KQ1A 2ADMA 4RKYA 4XDYA 3UGTA 4DV1B 1JVBA 5IBQA 5BUQA 4X60A 2DH6A 2C2KA 4YQFA 3IBGA 2IOQA 4Q21A 4BO3A 1H8HD 1FUUA 3MELA 4GOND 3LVQE 3N2NA 4NLLA 4N41A 1EP9A 5ICFA 1TPYA 2A59A 4IR7A 1IJFA 4N0EA 3HYNA 4MA5A 3OU6A 3R9XB 1N9GA 1QHSA 1ZM7A 3ORFA 4JLSA 1O6ZA 3FGPA 4ITUA 5KYGA 3H9CA 4G4SP 4Q93A 2ZS9A 5D1HA 1YJ5A 2HV8A 4B35A 2C88A 3M6AA 1QHEA 1XD9A 4MUBA 2AG1A 2W8BA 3OJLA 3OU2A 1U5CA 3IUPA 5BSMA 3TWOA 1FEZA 1G9TA 1GAQA 3QNMA 4FFOA 4ZVPA 5G4KA 1SVLA 4LMRA 1M73E 2V8OA 2QE7A 1E6KA 2CMKA 3WAKA 4D8TA