3OZGA

Crystal structure of plasmodium falciparum hypoxanthine-guanine-xanthine phosphoribosyltransferase in complex with s-serme-immh phosphonate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
227
structure length
227
Chain Sequence
PIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine-xanthine phosphoribosyltransferase
publication title Acyclic Immucillin Phosphonates: Second-Generation Inhibitors of Plasmodium falciparum Hypoxanthine- Guanine-Xanthine Phosphoribosyltransferase.
pubmed doi rcsb
source organism Plasmodium falciparum fcr-3/gambia
total genus 74
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.22: Xanthine phosphoribosyltransferase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozgA00
2JKZA 4IJQA 1ECGA 1A4XA 1IBSA 3ACDA 5EUCA 1DKRA 1OROA 1QB7A 4RABA 5E38A 2PRYA 5KAMA 1A95A 3OZFA 3HVUA 1ECFA 1STOA 1P18A 3OHPA 5BQPA 5KAPA 1QK5A 2DY0A 1U9YA 1HGXA 1G9SA 4RACA 1XZ8A 2EHJA 1DQPA 5BRNA 5BSKA 4M0KA 3N2LA 1V9SA 1Z7GA 1WD5A 4P3KA 1QK4A 1ZN9A 4RHTA 3DEZA 3OZGA 1MZVA 3G6WA 1J7JA 1BD4A 1ZN8A 4RADA 1GPH1 1QCDA 4LZOA 5HKLA 1NULA 2E55A 1D6NA 4P83A 4P81A 4M0PA 3KB8A 1L1QA 3NAGA 3O7MA 1L1RA 1XTUA 1VCHA 3DMPA 3H83A 4FYMA 5IPFA 1A98A 1TC1A 1UPFA 4RQAA 4PFQA 4F8EA 4ZFNA 4P84A 4TWBA 1O57A 1JLRA 3DAHA 1BZYA 1XTTA 1NONA 4JLSA 1I14A 1G2QA 1AO0A 5JSQA 1CJBA 4P82A 2YZKA 3QW4B 4MB6A 5K51A 1UPUA 1ZN7A 1G2PA 1W30A 5ESWA 3GGJA 2HCRA 1JLSA 1LH0A 4Z1OA 4M0UA 5JV5A 1I0IA 3GGCA 4X44A 1DBRA 1I0LA 2JBHA 4WMLA 1YFZA 2JI4A 1I5EA 1OPRA 1FSGA 4QYIB 1P19A 4RAOA 1QB8A 3LPNA 2VFAA 4QYIA 2H08A 2PRZA 1TC2A 4RANA 3M3HA 1R3UA 1A96A 3MBIA 4P86A 1QK3A 4LYYA 2H07A 3ACCA 1A97A 5ESXA 4LZNA 1ECBA 1I13A 4OHCA 4LZAA 2P1ZA 1DQNA 4RHXA 3LRTA 2PS1A 4WN3A 3GEPA 4RV4A 1A3CA 4PAWA 3EFHA 1OREA 1PZMA 2GEBA 3ACBA 2IGBA 5BQOA 1O5OA 3S5JA 2WNSA 1Y0BA 4P80A 2C4KA 4QRIA 1VDMA 1G9TA 4KN6A 4RAQA 3MJDA 1UFRA 1DKUA 1GRVA 1XTVA 2JKYA 1U9ZA 2H06A 4RQBA 5IAOA 4RHUA 1XZNA 4S2UA 1BD3A 1ECCA 1P17A 4LYGA 4RHYA 2AEEA 1QCCA 2FXVA 4X45A 1VSTA 1ECJA 1P4AA 4JITA 5HIAA 1HMPA 2XBUA
chains in the Genus database with same CATH superfamily
3C41J 4X7BA 3WB9A 2PZ8A 2JFZA 3WLTA 2QE7D 1YVRA 3F5DA 3HH8A 5HS4A 3BWDD 4LDJA 4ID9A 4MV9A 3OOEA 4AO8A 2CMGA 2PZMA 2QEQA 3RTDA 4HLCA 3V8VA 4TL6A 1RVV1 1X0VA 2YS7A 3AKZA 1AN9A 3AUUA 1DNPA 4FYWA 4NV0A 6REQB 3LBHA 1E99A 4H31A 3NHJA 3ASYA 3K96A 1K89A 1WCIA 2NOAA 1CKEA 3HB1A 5CIWA 3HFGA 3JYOA 3UXMA 2F64A 4EQ6B 4L4YA 5KTRA 3UVEA 1TCCA 1YS1X 5BMVF 3IL2A 4EELA 5HZGA 2W2QA 3QQPA 4LJYA 4CL0A 4GBJA 2WHRA 4NCKA 5TMBA 5DBIA 4X6LA 5ITVA 3K5HA 2C4MA 3THYA 3H2JA 1EA7A 2C4VA 4WD3A 4NOKA 1QUEA 1H2BA 4YT2A 5ALVA 1Q15A 3UMFA 3I5UA 3R77A 4WBNB 3QSGA 2C5SA 3ORYA 2Q49A 1N7IA 3S2YA 2A7XA 3T34A 5HP4A 1YQDA 2IEGA 2AH5A 2GUWA 5ITZA 4EGFA 5LP6F 4QUJA 3D2CA 1TD1A 4E51A 4MOWA 2ZBQA 3VFDA 5G1PA 3G0BA 4R2XA 1SPXA 4KQ1A 5C8XA 1U99A 1I5OA 2PMWB 3QKSA 4LXGA 3KUUA 3OAAD 3ISTA 1U4OA 1XKXA 3RUEA 3I6ZA 3VA7A 5LDDC 2VQEB 3MM4A 5BOVA 1QQBA 4AJHA 4EG3A 4EVSA 5H02A 2GN2A 3OP1A 4HWSA 5B6IA 3Q7EA 2IYQA 1UADA 4JZKA 4DQXA 2WIGA 4KHZA 5KJEA 2VYND 1U9IA 2OHXA 1NUTA 5KHAA 1SNYA 2ZM6B 2J3LA 2ZIFA 1X1TA 5AOVA 4Y6SA 2CFOA 2VUHB 3D0OA 4BP3A 1C1XB 2DKNA 4PM4A 3L6RA 2IT1A 2QM8A 1QTRA 3F6YA 1GEGA 1PEAA 1GZVA 1F5SA 2D59A 2W90A 3LYLA 3OSUA 3JATA 5ITSA 1FQOA 3B51X 4ZVQA 3VR5A 4O1MA 3V1KA 1ZU4A 5A03A 1XRSB 1FMTA 4A1FA 2WG1A 4TQ9A 2PEZA 5FD8A 4JXXA 5BV8A 4R8MA 5KDOA 2C8JA 1F2UB 1XR3A 4D0RA 2XNDA 4JCOA 3KEOA 3RS0A 1LPAB 2IZZA 1TUBA 3TNLA 4Z3KA 2JARA 3NRCA 4HPXB 4OOEA 3I2KA 4QOHA 1W1UA 3U09A 2GHTA 3ZI7A 1BHSA 3UUEA 4JUDX 1WF3A 4K9RA 4YPOA 2BP7A 4OMFG 3GT0A 3KLMX 1VDMA 5CJPA 2QTBA 2H9YA 5BNWA 2ERXA 1F60A 1RI1A 2QIOA 3TM4A 3E3NA 2AHRA 3IP1A 2ZIUB 3LS2A 2PT7A 3NONA 2CXXA 4G84A 1HRDA 4PVCA 1Z5NA 4L8GA 3FN4A 2WLTA 3MAJA 1NYTA 4IQGA 3SKYA 3WKDA 1U8CB 4JITA 1ENYA 4WZZA 5ISMA 2J0QA 4DLPA 1GPDG 4REQB 1N1DA 1H1LA 1NR5A 4KPFC 4AK9A 1UK8A 3MAGA 4ZHQB 4JB8A 2B5VA 1AZTA 3KQTA 3ZDRA 3CO0S 3FR8A 1WW8A 3CPSA 2PBFA 1RLTA 3SN6A 4Z7JA 1VA5A 1VLLA 3PUIA 2BFDA 3PD1A 3OPMA 4RVGA 3VHLB 3UPUA 4MYTA 3GJ8A 3OKAA 2HRBA 4JEMA 3SLRA 4H1WA 1ITZA 3N2EA 4MTLA 4EMBA 1IVSA 1G5TA 1MPXA 1RZRA 2Y76A 3I2HA 4HDQB 3V32A 1DLIA 4ALMA 3W5CA 3KAPA 4HJRA 4JELA 3A3NA 3PT5A 4NKRA 5EMHA 3ZYCA 1N6RA 4DT1B 2CD7A 2DF8A 3EIFA 2Q1TA 4FYKA 3RSLA 2E5WA 3EC2A 3HLYA 4QFMA 5AUPB 5B55A 1YIAA 3B2NA 4DXDA 4CM7A 4RTQA 4UEQA 4FC7A 1P1IA 4JIGA 1VJGA 4EJ6A 1SXHA 3BFPA 3OOJA 3QIVA 1PQWA 2C9CA 4ZIRA 5CM2Z 5K0BA 4LK3A 4C4ZA 4XASA 1M5UA 2DT8A 4Z86A 4WZAB 5KMGA 1FU8A 2G4VA 4D82A 3H2BA 3KZOA 4JUAA 3AESB 4M0PA 5DH9A 4CCSA 4CMBA 2QRQA 2BM1A 3EC7A 1JR3E 3OZRA 4WFQA 2CDNA 2X1HA 3ZGOA 2ST1A 3FLEA 3DAGA 4DJFC 3EMDA 4MWZA 1TT7A 4OXIA 3W2GA 4D0GA 2GCPA 3DTVA 2FSUA 4J0GA 4TVKA 5CNMA 3RM3A 4S12A 3O9VA 1G64A 5EE1A 4B8WA 1B74A 4GL2A 3DZ8A 1K7CA 1WD7A 1GY8A 2HTEA 4IJ6A 4UM8B 5AXCA 2VRWA 4LOIA 1HYQA 2B6HA 3AY0A 5IVPA 1OUMA 2C00A 2X76A 4ZAVA 1QU2A 3I04M 3ONDA 1NXVA 4PCVA 4R54A 3T35A 4F21A 4EG6A 1NV9A 1FDVA 1QH1B 1QF7A 2NSJA 3M4NA 4WKBA 1PQ4A 1XJWA 5A6SA 4TKUB 4WMLA 3L43A 1ZUD1 2YZNA 1L4NA 3IOBA 3S40A 1OPRA 2HMAA 2IF2A 2O50A 4JIMA 3I58A 4UDNA 1Q2XA 3ULKA 5LP1A 3BTSA 3FZEA 2IWHA 1W96A 4YASA 1NBAA 1W52X 2C5GA 3EISA 4ZV9A 4MB0A 1NKVA 4B3XA 2CZQA 4JL6A 5CCEA 3DLHA 2XYGA 2FW0A 2AJTA 2YXEA 3K09A 3SQLA 5HGJA 1SU4A 3SCZA 4W1PA 5ALHA 2HNKA 2BFBA 3A6JA 3HN6A 4BFWA 5KIAA 5AM2A 1U5AA 3VUEA 4X92A 2HK6A 3JQAB 1QLHA 2FRDC 4MCHA 3AB8A 3ZZTA 1YH3A 4IJKA 1JMVA 1YVDA 4TV8B 3U7GA 3DVLA 1QP8A 1QVVA 1Q1EA 3HWRA 3PFHA 2UXDB 4CXMA 3WB0A 1SUCA 2Q1SA 5COBA 4I50B 3FIUA 4TSFD 3NM5A 3R7SA 3NIBA 2N42A 4JJ7A 4IV5A 1E1CA 1TPYA 3EB9A 2V9PA 3QXGA 4CDNA 4OIMA 3DFIA 3QG5A 5EQJB 3D6AA 3H1GA 3M9LA 3SS9X 3EDRA 3AFOA 3MPOA 3FHCB 3VISA 1II8B 1KO4A 3DDUA 3SG0A 1I5RA 4IUYA 2RHDA 4MQLA 4B7CA 1ZPDA 1BXRA 4RK7A 3GO4A 2G9VA 2RHBA 2FZWA 1DIRA 2PV7A 3QU7A 4BFLA 4GX5A 1G8YA 3DXXA 4IUCS 5CPBA 1FDTA 2WOJA 3NC4A 4J94A 3RJZA 5CXXA 5J4KA 3IKLA 3HO1A 5IMSA 2FMXA 3E9YA 4KU4A 1FDOA 4OI0A 1Y8AA 1AC5A 2E3JA 3R0XA 4ZO7A 2H1WA 4QBGB 4AZWA 4M9UA 1UDXA 2YWHA 1UEJA 5ALJA 5JYDA 3A1UA 4M0LA 4W1QA 3R9XA 1AURA 2Y1OA 4DHWA 1RS0A 2CXRA 4KWCA 1CUIA 4PNHA 1G6OA 1MOPA 1Q7GA 3TS1A 5SYNA 5IX8A 4WVLA 1XZCA 1TVKA 3GHHA 1TPZA 4YLGA 1PFGA 3BJEA 5E1OA 5K6AC 1ZJ6A 4ZOBA 1LSUA 3ZLUA 1KXJA 5JD4A 3L0SA 2QMQA 4LWPA 3D6MA 1HBJA 2QI9F 2X19A 1PW7A 1G5RA 1YRQA 2A1TR 3CR8A 4P34A 4LJ7A 3P9RA 4PAOA 3SF8A 1W25A 3DEIA 2JFGA 5IVKA 1IQ0A 2PMKA 3A04A 1QRTA 2AFIB 1LNZA 2ZVQX 4UXHA 2HCFA 4G1UC 4CKWB 4PPYA 3A2MA 5D7NA 2GJSA 5IHPA 4FZVA 3GV0A 2FRXA 4I5IA 3VU9A 4D9IA 4K81B 1Z12A 2BFEA 4E3WA 3SJBA 1C3JA 2EBFX 2E48A 2R6FA 3DO8A 1T4CA 3AI7A 3SX2A 1NXOA 3AVOA 4NR0A 3W7VA 4ZCTA 1GPWB 4GOKA 4F0JA 5JOQA 1JB1A 3O1LA 4NHOA 5IPFA 4MV3A 1EFRA 5JS7A 3OX1A 3KM0A 2R84A 3ET5A 4QPCA 4EUFA 1BHJA 2EJWA 1W9HA 3NALA 5ITWA 2R48A 3QX8A 1JIIA 3TOSA 4XFJA 1JU3A 1XUOA 4M7RA 1GZSA 2ZSFA 1PWHA 1Z07A 4GP7A 3VH3A 1IXYA 5FFFA 1MW9X 3P45A 1JAZA 2YY5A 3SJAA 3RFVA 2N0SA 2GEUA 4YAGA 1OXBB 1U0EA 4IQ0A 2EW2A 3IDSA 4MUKA 4F3YA 5HOEA 3DKPA 2R00A 1O94C 2QQ0A 2AF4C 1M33A 4MYHA 1IPFA 2AI3A 3QU2A 4OUDB 2IZ0A 4Q3AA 5CK5A 5CX1B 3GZ4A 4BHTA 5DNUA 2C82A 4OQ4A 5AVYA 2GKSA 1CQIA 1VJ0A 4QPPA 3R5HA 5FUWA 1KBQA 3ZCSA 4GL4A 1M75A 2H54A 4AF6A 5BUCA 1CRLA 2H08A 3REQB 3KDPA 1H22A 3AGPA 1DX9A 2A1IA 3NBMA 1RE1A 3ECAA 4KO2S 4TVSA 4ZGWA 16PKA 3MJFA 1SN7A 4AMGA 4DC1A 1TQ2A 3ER6A 3WGJA 2HU2A 2YVLA 1GJRA 4REMA 3UG7A 4UNQA 1CJVC 3NHFA 3WFZA 3ZV4A 4BWVA 1MOQA 2OAGA 3U7IA 4BRSA 1NI5A 4F46A 2QG9A 1DTWA 3Q8MA 1OWPA 2LRHA 3RGGA 3VNSA 5DCUA 4JLJA 2GEBA 1MJHA 4O2BB 4D4GA 3AXSA 3N76A 4R1OA 5JSFA 4COOA 5BSGA 1F8FA 2PUBA 4WOCA 1RKBA 2OQIA 3O92A 4TLDA 1E1QA 1FYFA 2XDYA 2I6GA 4ILKA 1J6UA 4AZVA 1K3UB 2DR3A 2H1IA 1WHSA 1SOWA 2HWYA 3UK7A 1K4MA 1D3AA 1V1JA 4GWLA 4PQRA 1Y98A 3O4FA 2BF4A 4CNQA 2A5YB 5EIFA 1R37A 5HCUA 5BSWA 5LWHA 1BXZA 1DAIA 5ILGA 3NWJA 2D0DA 5I3ZA 4KIFA 1THGA 1A2QA 5F78A 3N2GA 1KE1A 2CJWB 4A0RA 4CMEC 2QPAA 2K4MA 4OLHA 3TEJA 1M34B 1UM9A 3DLTA 5AKIA 3IALA 1JJ7A 5L45A 3ITKA 4BNKA 5FTNA 4JR1A 2PGNA 5F2KA 2EWMA 1CYDA 3KQUA 3F4KA 4TLLB 1J56A 2UZIR 3D5TA 2OV3A 2FEWB 2QV0A 4NYJR 3JU3A 1SCDA 1YCHA 3HCCA 5F3DA 5K8IA 1IY0A 2PH3A 5KOIA 1PZGA 5CH8A 3WKBA 4FMBB 4IGFA 3CUYA 1XB2A 2X0FA 4N65A 5EJ6A 2A9PA 3X1JA 4DZTA 1H85A 5A5EA 1V71A 3QE2A 3KVVA 3JD0A 2R5NA 4NZOA 1O77A 1R6XA 3A9UA 3COVA 4WCVA 3T5DA 5DMXA 1QONA 1ST2A 2PYDA 5JS6A 2ZYAA 3NEPX 1G8AA 2BELA 3P2OA 3U5ZB 5H82A 1HG1A 3OBBA 2D3WA 1CF4A 2O07A 3H16A 3PEYA 3PB3A 5FL7A 2QUAA 2OXTA 2BUBA 5BNIA 5HKOA 3QKTA 2IYRA 5T4FA 3PXBA 4OQMA 1XZDA 3VPAA 3GOQA 3V4ZA 3N0VA 4NU6A 3L8MA 5K0SA 3AI3A 3SY8A 4A16A 1XQ1A 1YDMA 4JOQA 3DMFA 3C39A 1XZAA 5CXUA 3UJPA 2VWQA 4KLZA 2F1JA 3R9IA 1ZSNA 4LRTB 1F0NA 5JNVA 1COZA 2NUTA 5CT9A 2V7VA 1G2QA 2ZZKA 2V0CA 5EHNA 1A9QA 1CNMA 1G5FA 2FEOA 3BWCA 3H5IA 3OT4A 3DKVA 5L7TA 3QOWA 2NUBA 2GD6A 2PJZA 5B4VA 1CUJA 1TGVA 1X1EA 1Y1QA 5AJUA 4AXXA 4B83A 4BV2A 2G5PA 1ONBA 1TFRA 3G0CA 2JFYA 2Z5LA 3DHNA 2CC2A 1OWLA 3R5JA 1AKNA 3DDNA 4N1AA 2OC4A 5HZMA 1EDEA 3EF1A 2BYTA 4PLPA 1P3DA 2QRVA 1MDBA 1EK0A 4LDZA 1FS5A 1QCZA 2AGVA 3ZKAA 3A1DA 3VX3A 3T3PB 1N9GA 2A9JA 3FBWA 3KJHA 2XR1A 4D80A 4F2HA 3SJUA 2ZB8A 3UXEA 1QYXA 2I7CA 2PH5A 2BZSA 1NE2A 2WHQA 3C45A 3F4BA 1ND6A 1Q3TA 1Y5LA 5F4ZA 5I9TA 1H8EA 4NEHB 3B2EA 2F00A 5BRJA 5BWNA 1VMIA 2WZBA 3HJTA 4HX2A 2DCUA 1H42A 4JNKA 3ZU6A 3QVVA 4EVIA 3MK31 2EFDB 3GJQA 2B25A 5IH3A 3EA0A 2BSQA 3S5JA 1V96A 3IXLA 4P7FA 5JNLA 5F98A 1GZ3A 2QGZA 3DVRX 4AKIA 2WSBA 1DXQA 3COSA 4MA5A 4PZPA 4PNZA 3ZY6A 1TUEA 4G5XA 4YEDA 5AQEA 5G0TA 2G63A 2VR1A 1IWBB 3OFNA 3WQHA 4G63A 3HDVA 1GOTA 1ENOA 4DMGA 3SQDA 3WYAA 3COJA 4QTZA 5HZHA 1UKYA 4WJKB 4QKQA 2ZJ4A 3TD6A 2NT4A 5T7BA 1HL3A 1KH3A 1PJRA 2H2WA 1AM4D 4KO4S 1RI5A 4P9NA 4A8TA 1U2ZA 3HVKA 1N2SA 1EFHA 2NZ8A 3D2LA 2VN8A 7REQA 1FFAA 3BJRA 3DYIA 1U0LA 3SEAA 2FPLA 5SY6A 1QP7A 3QVLA 4Q4JB 1UKZA 2NXCA 1NXXA 1O5IA 2OK8A 4NZNA 4RHFA 3VO9A 1NNLA 3SYRA 3U3JA 3IUMA 5FWXB 3IQGX 2RGCA 4WPGA 3QVJA 3SC6A 3LM8A 4L1KA 2UUPA 3SZRA 1BMQA 1G8JA 1F17A 1K4KA 2AXQA 4X6XA 1O58A 1E18A 1K06A 1M1UA 1ZFNA 4YHBA 4ZAYA 4DLSA 2ZBFA 5ADHA 3I83A 4F5YA 4NESA 4TMTA 1NX6A 4WFKA 1SVNA 1G5PA 1L6RA 2HQ1A 4MQEB 5DO9A 3HDJA 4G5YA 3RS5A 4JD5A 3GA5A 2A1UB 2GVZC 3C4VA 4Q01A 2WF9A 4P3NA 4RY2A 1N3LA 1Z7WA 1WXQA 1ZNWA 1ZNYA 2CBZA 4ARVA 4JH0A 2F1HA 4E1BA 3ZVKA 4IDFA 2GEVA 1L4GA 1SXJD 1GPH1 3NHBA 4B0PA 2PT9A 4YRBA 1J2EA 5TPZD 4GVXA 3RASA 2HPZA 2YJ4A 1H1DA 4P83A 2BMDA 4PC7A 4UC0A 2N9UA 2YNMA 3N0XA 3LC7O 1H2YA 3AEUB 2H0QA 4IZOA 2W6QA 4F5ZA 5EA2A 2Q5OA 4MR8B 1HDYA 2XUIA 3OEWA 4XWGA 2VZEA 5BVHA 1LS6A 5JARA 1ORRA 8OHMA 1W34A 1L5HA 3QV2A 4YP6A 5L3SB 3BCSA 1QX3A 1WIWA 3SM9A 3S2SA 2R65A 4MRPA 1JHDA 5THKA 5JAMA 2ZQ5A 3WGIA 3G2QA 4B74A 4G36A 3FDJA 2NZUG 2QJRA 5SZHB 1EDZA 3QKWA 4GMGA 3ZI4A 3NORA 2JIPA 1KY2A 2ZOSA 2HDOA 4XPIA 4HGQA 2YINC 5CLQA 2YMQA 3FMIA 3G17A 5TIIA 2H1VA 5HJ2A 3L0CA 3F96A 1VZ2A 5KTTA 4P1ZA 3ZE1B 3HFRA 5G0UA 4ZHSA 4FXPA 4ZQGA 5A02A 4OGKA 1WG8A 3HB4X 4TYPA 1MRSA 1MC5A 2YHUA 4OMCA 5EIBD 3ETEA 2GLXA 2IHUA 1W2WB 3G85A 4X6UA 2R7MA 2WWHA 3UKOA 2IC5A 1Q0QA 5KNBH 2D1QA 1QPBA 3RUPA 3LWDA 3SQXA 2V54A 2AK3A 4Y2TA 1JYFA 2NXWA 1NMXA 1A8QA 2Q0XA 4IKEA 4N3GA 3TSWA 2YBEA 1FXUA 2FSIA 5DIFA 4LZAA 4B45A 3HCNA 1Y9AA 1EZ1A 3FOAA 4BVJA 1PS8A 2CXNA 3T5CA 4AZ0B 5TVGA 3KRTA 3MGCA 2PSDA 1XBTA 3AOEA 2R86A 4BLOA 1OFIA 2IOYA 5A5VA 1JE1A 5CT6A 4PN7A 2G5GX 3LRXA 3R6DA 4KAXA 2PMFA 1T0PA 1W0JD 3SEQA 1H6BA 1ZNZA 2PSSA 1H9BA 1DKUA 1HTWA 5KYVA 4J3FA 2ZUSA 1T2UA 1PUJA 3DGEC 3MWGA 1L5WA 1JKJA 4OD0A 1L5QA 2CNWA 3GZNA 3URMA 5KNCA 3NZEA 2EIXA 3QJ5A 5H1YA 1W9MA 5T4HA 4FSHA 3A2LA 2XBUA 1RCUA 3CUSA 3ZJUA 1NJ1A 2EYUA 5KQRA 4QGGA 1E0SA 3PF9A 4WLVA 4JUFA 4GMFA 1JAYA 1OROA 1D7OA 1X7YB 4WZBE 3T54A 2IGTA 4EHLA 4U00A 3T3EA 3NGLA 4BJ1A 1EP9A 2O2JA 4MIEA 2JATA 1HMYA 3VPDA 5CM8B 4N5IX 1R0WA 4RF2A 1KO7A 2NTEA 2E9SA 2QP3A 2I03A 4EHKA 4LJ9A 3RU3A 5T3YA 2N47A 3GVCA 2ZTMA 4BO0A 1J23A 1RT9A 4K0KB 4X1OA 4Y6QA 3EXHA 1JZSA 4TX1A 1LD3A 1YASA 2PS0A 4KXVA 3O1IC 4QT0A 4QXAA 4QXMA 2RAFA 1U7XA 4XEUA 4Q4AB 3X0DA 1O3YA 2OGUA 4RE6A 3D6UA 2ZB7A 2D2VA 4UE2A 2RBEA 4BGUA 1T5SA 4ZV7A 5L40A 5HQ3A 1TA4A 2D7DA 2OBYA 3LOQA 2IUYA 5AVKA 3CRRA 1S89A 1QG2A 4U2EA 4OU5A 3PWKA 1A0OA 2BFAA 5HF5A 2A84A 1D2HA 5M34A 1JS1X 3U7FB 4NC9A 1GADO 3CURA 5K1ZA 2UU9B 2YWFA 4Q12A 1A76A 2ARKA 1LBHA 1PZXA 2OBLA 3OIWA 4BBZA 3E70C 3FZQA 4N6OA 4LSWA 1P45A 4PC6A 4ZFNA 2QSJA 3D7RA 1QG0A 3HPRA 4IQFA 5KTNA 1ISFA 4TUYF 3SHVA 1XTQA 1OSNA 2E7ZA 3B38A 5E1MA 3WDLA 1BE1A 2AW3A 2GEKA 3FB4A 2G6TA 3FCEA 1OVGA 4GPEA 4JEUA 4TQAA 1T2FA 2VDWB 3EZLA 1V3UA 1W93A 4UM5A 3O4VA 5ERGB 5BVGA 1G55A 1NFQA 4YUWA 4PCAA 1D5WA 4PLZA 2O9JA 3CZ9A 1AXRA 4NBLA 4FBGA 4FMDB 5DBGA 4ZC8A 3EUEA 2IPAB 3HEBA 3LZDA 2IPLA 1GPUA 1JR3A 3KSZO 5CMLA 3Q6IA 3FYHA 3TD2A 3PJGA 2BAGA 1NVTA 2WILA 3LWNA 4DBVO 5K0JA 4PQEA 2GBIA 4FX5A 3LGXA 5F2NA 4RTNA 3ASVA 3H17A 1BEEA 4TTVA 4S2EA 2VFAA 4G0UA 1HDZA 5JNTA 1CIJA 2K2WA 1N2ZA 1N5IA 2QMUA 3IJEB 5GV8A 2HO5A 5TQ2A 3RUIA 3U3OA 4V1CA 3L06A 1XI2A 1WPQA 3W9SA 3M3HA 1KYZA 3MBIA 5FFNA 5IANA 2IDJA 3C5EA 4C4AA 1FUEA 1XTSA 3MSXA 3GRCA 1OI7A 2XADA 1P73A 2EOAA 5L4NA 3R8FA 3L18A 1MDFA 1E61A 1Q77A 3EWNA 1WABA 1GV0A 3D7KA 5KQSA 5I4CA 1KFBB 3GQBB 4FIDA 1V8ZA 2FV8A 3LK7A 4LGMA 4AJEA 4DDMA 3BHMA 1VHLA 1ZOSA 3CJTA 3FKSD 4J91A 5DLEA 3N1UA 3TYXA 3MRTA 5LYJA 3UJBA 4B4KA 4EPTA 4QT4A 1JHOA 1SFRA 4RQBA 1E9RA 3FSJX 4KWHA 1VBNA 2P2YA 4OHYA 1RI4A 4LGVA 2ZJOA 1S8NA 4UATA 1C7RA 4P4SB 1RMYA 2FSVA 2GMWA 2L19A 5ENVA 3N2KB 4LAFA 3TPZA 5KPJA 2FSGA 3IUPA 3R3UA 1PGJA 3RC2A 1GTVA 3I01A 2RGWA 1NJFA 5CCBA 1M1YB 1OX5A 2OCBA 3M7IA 1YT5A 3CCCA 2Q8QA 3NUGA 3A6HA 2RI0A 4G23A 2P68A 5ALIA 3MT9A 3IILA 4DDTA 2EX1A 4M9QA 3Q5DA 3RRYA 1WOMA 1I3MA 3UHOA 2Z09A 1DELA 1O87A 3GRAA 4BEWA 3GGDA 4OBWA 5KWVA 3F1KA 2JLZA 3WLIA 2C88A 3LY9A 2XF2A 2ZZNA 4JLBA 4NOLA 4FEGA 2JRCA 4YMHA 1J8QA 2R1TA 4X24A 2R44A 5JR3A 1FFEA 3F98A 3PNKA 3H8SA 3VJLA 2AT1A 1YDHA 2NU6B 1DV2A 4F85A 1H2ZA 4P36A 1FFBA 3VDMA 2Q2QA 3GA0A 3QFSA 4B6SA 2FJUA 2OLEA 2QVCA 5JH7B 1IXRC 1WVIA 3F8WA 1R6TA 1LTQA 4KPUA 4B3FX 1VRVA 5FUXA 1IWOA 5GP1A 3OIUA 3AILA 5CG2A 3DE1X 1D2NA 4PRYA 4PV7A 4BFXA 2VT2A 3VR2D 3AU9A 1M8GA 3OQNA 3L46A 4D3DA 5JUWA 1AHNA 4GF5A 2I91A 4URXR 2B4TO 4KQ2A 4Y9DA 5E3JA 3SVZA 1VM6A 4C08A 4ZTZB 4RA9B 4YJHA 5K8UA 1E3JA 1U2GA 1CJCA 5KOJB 3NEJA 3HGQA 3REQA 3N6XA 1L7OA 3OQJA 5LU8A 3KKMA 2X7HA 3PUZA 1SULA 5DN6A 4AJ9A 1A9TA 3GZTB 3E1KA 1V16B 2VYVA 3MS4A 5TQVA 1B3BA 1QHNA 4ND2A 2G04A 3C74A 4HDSA 4HO1X 4KQIA 3DMNA 2I4LA 5AK4A 3RRZA 3HNPA 5EMLA 5AK3A 5J3JA 2A8YA 1FU7A 3OEEA 3DE4X 4W9MC 4ABTA 1JAHA 4DSZA 5KTKA 4YJFA 2BLNA 4TL7A 3ISJA 4HB4A 4Z4FA 1U3GA 3GROA 1RCFA 4HUTA 3EFEA 3EHDA 1MB4A 4JKOA 5LZ7A 3AO0B 4AUKA 4CU5A 3UCXA 4Z1OA 1VSBA 4RD0A 4AB1A 1T5LA 2ZRQA 3IAHA 4LDQA 3AUJB 4QXOA 1SO8A 1RPNA 4YRJA 2BTQB 3AYZB 3E0XA 3KSAC 2GJ4A 4KNWA 2YOGA 1OX6A 3IQXA 4EMSA 4NV3A 3ESXA 4BQQA 1OBFO 5JSHA 1DBVO 3K9FC 2HDHA 4MUFA 3ZW8A 1KSFX 4I3GA 1FP4A 1DZ3A 4G0OA 4NAUA 3UT6A 4IIEA 2B4KA 3CUVA 3AIMA 2XE7A 1SIWA 3G9UA 3KQWA 3IOMA 4INAA 2XZOA 1YR2A 4HEHA 1G20B 1W0KD 1CSEE 3KVRA 1DXOA 5JMWA 1Q1QA 1T1EA 2OBMA 4NYMQ 2IE0A 1E2NA 2ACEA 5IDYA 1XO1A 4UQPA 5EXSA 1UZNA 3EFHA 4M6WB 3JZDA 1KEEB 1LZKA 3Q72A 4XYBA 2AC4A 4DSAA 3QXCA 1BTOA 2PANA 1QRRA 5GOZA 2J0EA 5ALEA 3D6NB 4LXHA 2I4OA 2PKCA 3H2YA 3D8RA 1IN4A 4HAZA 2ORYA 2XKJE 4K6CA 4Q9DA 3EDCA 2NUPB 4WJZA 3ZIAD 4YJGB 1G4UR 4DA9A 5CPFA 3FDIA 3ZH2A 3WWEA 3D8BA 5HUQA 2XQGA 1ZP6A 4ISBA 4Y0AA 4Y9SA 2RC6A 2B98A 2WW8A 1RJEA 3ETHA 3VHXB 4B3SB 1IZYA 3A05A 4BLSA 3GVIA 1G6KA 3RKSA 3NPMA 3F6PA 1PGNA 2C58A 1E9FA 2JKZA 2YL2A 3LH5A 1QIGA 1DC6A 4TTPA 4ZRMA 1FX0A 2X2PA 5JWRA 1HTTA 4U2BA 3U1VA 4L75A 3TO5A 1HO3A 3GCXA 4E08A 4TKMA 3LBIA 3ZZUA 1A88A 2J7PD 2QVGA 4EKDA 2AYXA 1W94A 2BGJA 5JXJA 4PWYA 4CPDA 1HT1E 1YE3A 2OAP1 3LAWA 4E2YA 2GJ9A 1NUPA 2P7HA 2LZ0A 1Y89A 2FPMA 2YYSA 3FGNA 3TCKA 3KTDA 4QSHA 5SYMA 3WHLA 4LOKA 4J9UE 4BO6A 3ADPA 4KE6A 2CXTA 4YUZA 3DWIA 3CH4B 1PZFA 3Q41A 4IWXA 1QKJA 4LI3X 3A1EA 1JE0A 1X7WA 3LVRE 4R9UC 2PUCA 2B34A 3QMVA 2NIPA 2PFSA 3ZVLA 2R8ZA 3VNRA 3THXB 1NW4A 2F6RA 2V6IA 2BEVB 5JPCA 3W5IA 5K20A 3PS9A 5F12A 2B99A 3R3WA 3NR2A 4RDHA 1W2HA 2BUAA 2WWVD 1KFJB 2J59A 2NSDA 4G56A 4NMLA 3MF4A 4AMUA 1SIUA 5H9WA 4BXOA 4KKXB 2HDWA 4IVRA 4QAQA 2YIVX 4QU0A 4XCQA 1U3WA 2GN8A 3VBEA 4AJ4A 1RIIA 5HWSA 3G5AA 1XZFA 2ZR0A 1OTYA 3I05A 3TR6A 2ECOA 4XTRA 3ICQB 1E2HA 4A7PA 2WKQA 5LN1A 2O8EA 1Y3DE 3RTBA 4EEKA 4OKSA 2WHXA 1Z9BA 3V2UA 2FMHA 4JBIA 2H5IA 1C2YA 1JFFB 1ZVJA 2JLQA 2PLFA 4JB0A 1EBUA 1I4LD 4NPAA 3L4BC 3D4BA 1XN4A 3KWFA 3TL2A 1E2LA 1JA0A 2JGFA 3E5HA 3PIDA 3ICWA 5EAIA 1NXPA 1YR8A 2F43A 3SEFA 3UHJA 1ZA2A 2XJ4A 4JOSA 4NAHA 3IP9A 4GXTA 1UXKA 4PHFA 5EXXA 5TPWA 4GAEA 1OIXA 2GEFA 2NUAA 1JIXA 4B85A 3HRIA 3BWEA 4BQIA 4EMTA 4ER5A 1F1BA 1Y3AA 4RJTA 3Q7SA 5DTRA 1WUTA 5LB4A 3MUOA 2H1HA 4TLCA 4ENPA 1KY3A 1L7XA 3R20A 4J1QA 4NVRA 1MFPA 3LLCA 3VR3D 3WWDA 1I94B 3RVBA 1L6IA 4XD7D 4LMRA 1HNNA 3U1TA 2FP4A 5GINE 2ZYIA 3H9BA 4Y2HA 1SBIA 2H8GA 3EW7A 1K7FB 3IPXA 4CW7A 4RZQA 3PDCA 4CMIA 1E9SA 1G98A 2H07A 2GOYA 5C5IA 1PF7E 3DFUA 1XEFA 1OMOA 1IZ8A 3MLAA 5J5CA 2EKBA 5JSKA 2PKWA 3O0DA 3U60B 4O63O 4OX9B 3DUFA 1NUUA 4DDWA 5C1OA 5IJ0B 1RRMA 3IUQA 4O8ZA 4QECA 4C3UA 3IP3A 1A8UA 2R60A 2X5NA 4RPKA 5DYIA 2BCGY 1Y3BE 4JB3A 4MI6A 2VH5R 4HYYA 4MQ5A 5DB4A 4ZQBA 1ZI6A 4WJLA 1W85A 1QTIA 2DUMA 5IWCA 3DL0A 1XTVA 4J7AA 2QZ4A 5JG7A 4MMXB 4MKIA 2V96A 4IF6A 2RGAA 2DUNA 4X7MA 3DEAA 4K1LA 4B4WA 2A9OA 4AYXA 3I2GA 4AN1A 3U7EB 1MV5A 5LOVA 2AZ4A 1I33A 3LXXA 8LDHA 1C9NA 3TSAA 1T3ZA 1SQGA 2CVHA 3MOSA 3JQRA 3H9UA 3VRHA 4PVDA 4Y6GB 3FA2A 2ZE5A 3LSTA 2GESA 1ZH0A 4K2HA 4BS9A 2CNBA 2DBVO 1IBSA 4NONA 4TN5A 3LOUA 4FB4A 3ER8A 3LQQA 4GI5A 4L9WA 1OIVA 3G9QA 3BB3A 3F8TA 3HQ4O 1KIFA 3JWJA 4XLLA 3A31A 3HA2A 2Y6VA 3LMKA 1PR1A 5FULA 2CJYA 1TT5B 2BFCA 4EUNA 2OUKA 3UJ3X 4KNYA 3VBCA 3ZV6A 4E7PA 3JARA 3V4LA 3DOOA 3PGVA 2CVPA 2ADFA 1GZ5A 3RVSA 2JCBA 1RYDA 2JGLA 1RWWA 4FYIA 2C7OA 2OAQ1 3BMNB 3PCTA 4WQMA 2ZUTA 3ROXA 3UUWA 4ND3A 4IFEA 2GJ8A 3IEIA 4DPLA 1NP7A 1BOOA 5J2TB 1VLJA 2OZKA 1MCZA 4XGKA 3F9RA 3IQDB 2OKCA 5AESA 3D02A 3EEIA 2XKAA 4IW3B 2F3TA 1UR5A 5B6JA 4KN8A 1FFDA 1DKQA 1KI9A 1O89A 1QH8B 1VPVA 1TEXA 4F06A 5EQFA 4ZYTA 1ZQ9A 1UCFA 5A3VA 3TLBA 4NI5A 3WGVA 2HHJA 1MVNA 3H2GA 1RJGA 3O3OB 3OQ1A 3W1VA 2G8LA 3IODA 4IJ5A 1DUIA 1NXWA 1XTUA 2GERA 5FJIA 1VG9B 4ODIA 1K5HA 1NLYA 3UMYA 1DOHA 4P93A 4BZXA 1L1FA 2R1VB 1M8JA 3KQKA 1ZH8A 2XOKD 3LY5A 3VOAA 1CR6A 3KIPA 4TM8A 1YQXA 2UV8A 4AUNA 3RQIA 2INGX 1CYEA 2YZKA 2D1FA 2OPBA 3JQ9C 4QFBA 3NBAA 4MSUA 4MR7A 1ZMTA 3I12A 1CULC 1KJWA 3A4IA 3H9QA 4X9XA 5KYTA 3EXG1 5JJIA 3LHFA 5FLEX 1M9NA 3V55A 4B82A 3NAQA 3O4HA 2HYIC 2VHZA 2VT3A 3WR5A 3AR4A 2VUTA 1DBRA 3X3HA 3CM0A 2HNAA 3GJYA 3KUXA 4MWSA 1DQSA 4IOJA 2JGDB 4BNGA 4H18A 1H6AA 1XU4A 2QZZA 3V4PB 4QVGA 5REQA 1LK5A 1I32A 1ISHA 4M1YA 1SQSA 3DE5X 5KKAA 1P9OA 1EUDA 4BNDB 4ES6A 1XVLA 2XOXA 1UBEA 2H7VA 2O7RA 4GOOD 1CUZA 3BXXA 5ELLA 3ZHZA 4R0NA 5JFOA 4I1VA 1R0SA 1VHJA 3D6TB 2CHFA 1PT9A 2HRQA 2PK3A 1XALA 3CVWA 3ZVNA 1NHWA 1OGJA 1SOAA 4EG0A 3A1VA 1R0CA 4ASUD 1SUFA 1FK8A 2IYFA 4PSCA 4C3OB 4G0WA 1XF9A 4CIVA 2HREA 5A2GA 5BNZA 4Q4DA 1CZOA 3GEEA 3U17A 2B9VA 5FOQA 3IAM1 4F4CA 5IKEA 2CCJA 4QODA 3FE2A 3FYTA 3G8DA 4YMVA 5CFZA 1D5CA 1Z7EA 4ZPJA 3D0QA 3U80A 1Z4OA 2I6TA 2DHDA 1ECCA 3GJRA 1Q0LA 3LPMA 4ER3A 2AEMA 4S04A 3ZG6A 4JP2A 1RQGA 1RRCA 4JB2A 1FVHA 1NC3A 3K8OE 1GGKA 1RXIA 3ZH9B 3KOUA 5LZ2A 1JLMA 2EL9A 2I4NA 3IXQA 4J76A 3RC9A 1Z4QA 3LJKA 4YRRA 2H4HA 1XMIA 1N57A 1OZ0A 4YJ3A 3GVHA 2EDAA 2ZULA 3DNFA 2QTVA 4KE7A 5D3MB 3L4KA 2MDTA 1Y8QB 3C7AA 5EWLB 3BXOA 3VH4A 3WMFA 4NENB 4EFMA 5ICCA 4LFAB 5B1IA 1BX1A 4N0QA 3P9YA 4EQZA 5DX8A 1EFUA 1VCNA 5LYJF 5ALTA 3DMDA 1PDOA 3D6JA 2OORA 3H2SA 2IPNA 3OT1A 3Q0IA 4R3NA 3WX0A 3X44A 4BNHA 2CN1A 3NBFA 1Y6FA 1E2BA 2AQ8A 2PX0A 2CK3A 3NT5A 4KR7A 4ATNA 1UFOA 2QTZA 3QI7A 4NF2A 2EARA 2HU5A 2YOHA 3L8GA 1NJ2A 1V9SA 1VHDA 2HMTA 4MWBA 1PYDA 1Y1KE 2W2KA 3MJRA 5ARCA 1RR6A 3RC7A 3U3XA 2HRDA 1Q0RA 2F3PA 4R71A 4UAUA 2DPHA 2Y77A 2D5IA 1OB5A 2VF4X 2B3DA 2VKTA 5JCXA 4KNVA 3TCNA 4XM2A 1KMQA 2AOVA 1U6KA 2PQMA 5DM2A 4J2OA 3UOWA 4IMPA 3S70A 2HJ9A 2VT7A 4EY5A 4GC9A 1QIKA 5KYYA 2IIQA 2DP4E 4KIJA 1R88A 2REOA 4R83A 5AK0A 3GEBA 1E3DA 4NCXA 2G6BA 3H0CA 3MT8A 3C3KA 4GT1A 4I46A 1L3BA 4KJXA 4D44A 2WIJA 2B3TA 5FYQA 3K6SB 3B60A 1PFQA 1F48A 1QNLA 2V59A 5IUKC 3VYSB 3GHYA 3W9BA 2QN8A 3WHPA 3WSWA 3DVAA 3SVTA 2VTBB 1X7DA 5CT4A 3ZXUB 2A9FA 4XVHA 4TTJA 3ZLTA 2DYKA 3A6PC 2W2VA 2Q5FA 2FWRA 1W49A 3DD5A 1VOTA 3TH5A 5CYPA 1YIOA 2JASA 2WK1A 4OMUA 3VR4D 1D09A 2GLUA 3WGGA 2ZRIA 3UTDA 4TV9B 4OBBA 3HCWA 1TJNA 1CX9B 1FSGA 2AZTA 4DLLA 1C7FA 1OHHA 1ZM9A 2E1RA 1NVVQ 2YZMA 1JZQA 2R6JA 3LPNA 4L0DA 3WZMA 2WSMA 4Y6LA 1ESZA 3LUPA 5DHPA 1J97A 2DKFA 1OU4A 1R0XA 2HJSA 3RRMA 4B4VA 1IHPA 1WZNA 3I5XA 4XYGA 1ZSYA 1LA2A 1E6UA 2E4XA 4JGBA 4W7IA 1LKZA 2ENUA 2ZWVA 5T4BA 1N7HA 1SR8A 3JYNA 2ADMA 4B6GA 1VL6A 4L4XA 2O1WA 1ZRMA 4NBVA 1QGED 5JPIA 5IM5A 1M2NA 1TIPA 1HEYA 1Y9ZA 1KAGA 1YB7A 1A3CA 4FOSA 4ML3A 4NNJA 4UTZA 4I8IA 5K4AA 3AL2A 4AWXA 4EZBA 3H3FA 4MQFA 1NQTA 2ES4A 1XDBA 2GF2A 3G3EA 1TKBA 1L7MA 1PHPA 2P4SA 1ILEA 4HZGA 4X3PA 1K7YA 3STXA 2DG2A 3WP0A 4GLBA 4BQSA 2ET6A 2C77A 2P78A 5C5EA 2JS7A 4QULA 1F0KA 3GLSA 1I8TA 4WNAB 5BMVB 1W73A 1XGKA 4M0DA 4R2WA 2V5AA 2Q2OA 1LJLA 1V9CA 3R6WA 3OFKA 4KEAA 3UAVA 4Q1FA 2HOQA 3VC7A 4XGQA 1JIKA 4ZO8A 1N36B 3QE3A 3MXOA 1CUFA 1D2CA 4M0EA 5E4TA 4CTJA 2A0KA 3WLAA 4B2IA 2GPJA 4JT2A 1CBUA 3EPLA 2PE5A 3RJ5A 1W581 3H65A 5IUNC 1KVSA 2R2AA 2GTHA 3FVTA 5D6NA 2IEZA 3WGOA 2XW6A 1NURA 3FVVA 1G7TA 4Q9HA 3T4PA 3UJ9A 3KELA 4QPJC 2YICA 3R3JA 2C1XA 2FE1A 5LP6B 1OH5A 3ZK7A 2P9CA 4TT3A 5DNDA 2I3BA 4FW8A 4IRMA 5L3QA 1U11A 5G0VA 1QLJA 1JXAA 2DU8A 3ANSA 1HDXA 1G2OA 1OZAA 2O2YA 1RBQA 3H75A 4IWYA 4RU1A 1J2RA 2O1EA 3ZQUA 5JJ5A 1HNZB 1P4HA 1BXGA 2A9VA 3PUYA 5DX0A 2PO7A 4ZAGA 1Z4JA 3T3IA 4R0MA 4L15A 3ZXYA 3KEGA 1G7CA 4QC2A 1BXKA 1MAUA 3KYJB 2VDMB 4MWOA 3S44A 3ZGLA 2HT1A 2ODPA 1UXIA 4IJUA 4XX0B 3T99A 2ZJAA 4XGRA 5CFLA 3BSSA 3EVGA 4H60A 2P4HX 1Y4ZA 1QFYA 2BC9A 3EFOA 1BJRE 1N92A 4G65A 4B84A 5LQRA 1FOEB 2FDXA 1IDOA 5JCPA 3TTVA 2G77B 1PG0A 3QYJA 2OV8A 4S05A 5EZ5A 1NW9B 4L6CA 4NBSA 2C0QA 1KPIA 3GXOA 4AY4A 4FPXA 5DXFA 5CURA 3NHYA 1DAGA 3JS5A 1JHVA 3NRJA 1DB3A 3I2JA 3CKMA 3GH1A 5C46F 3EY9A 1RXEA 5DKFA 2PM8A 1J4AA 3IJRA 2GPBA 2VDOB 3GU3A 3RYIB 1RYEA 3AONB 5AXDA 4ENVA 3MHPA 3AW8A 3MT7A 1JIUA 1ZMXA 2HQSA 3L1IA 2Z9BA 4FIZA 4B5KA 1GYQA 3C7CB 3CTMA 3HSSA 3EVBA 4QO8A 3MOIA 5D3KA 3W4KA 2QE6A 3K0BA 1DXYA 1EFPB 3PKJA 2D00A 3ZHYA 2H1FA 2Q1XA 3K15A 4JQZA 1G7SA 1SVUA 1WLSA 2ZR9A 1AKRA 1NJ5A 2QT0A 1T0IA 1MRNA 1YULA 4UHDA 5AW3A 2HUPA 1L7BA 3DJYA 2FGJA 2GD2A 5EOVA 3DZCA 5L7WA 1M10A 4DJJA 5LZ8A 1SVWA 2BD0A 1IJKA 3UUFA 4KVGA 4RZUA 5EPOA 4MW7A 3RCBA 4MGYR 5KWJA 5EJGA 1KJ9A 2WQ7A 3OO1A 1GPNA 4MH0R 1XNRB 3CTPA 1T4BA 1TIKA 1GO2A 3GAMA 1XVIA 3PXDA 1FNNA 1ISJA 1RM3A 1DIHA 3L8DA 1M1XB 3ZWBA 4DXAA 4HDRB 4Y8VA 2A7QA 2LR0A 1Y4UA 2N1BA 4BUZA 1CD5A 4BKUA 4QXRA 4ND4A 2D74A 4UREA 5AO9A 5K09A 2VSOA 2M6RA 3ZHOA 4JHXA 4Q93A 4WFJA 2AG8A 1X42A 2CNNA 2FCRA 2GN4A 4IHJB 3DTVD 4YV0A 1Z38A 2OCKA 1GLNA 1PYGA 4WZAE 4RY0A 2Q5EA 3HCBA 1SCJA 4U7GA 2ZSIA 2F8LA 2OKGA 2UVPB 3NG1A 1X1BA 3VR1A 4PZLA 1K9SA 1SWWA 1ZKMA 2J46A 2XODA 4TOIA 3MJHA 4YO8A 4ZDKA 5K0CA 1XRLA 1GNPA 3O2SB 1NN1A 2KMLA 2YV3A 4E7OA 3U6KA 2W6IA 5FQNA 4TXHA 3RUHA 3U49A 3WIBA 4E6PA 4GX1A 2V7XA 1FUKA 4M9CA 4E4RA 3RWOA 3FPAA 4H17A 2QJWA 5DHSA 1OLSA 1SU6A 1I2MA 3SICE 4UTPA 3QPCA 4BUJA 2QVYX 1AU9A 3I8OA 1OFVA 4HTFA 1FP7A 4FFNA 3JZMA 3H87A 4NBKA 1ZS9A 4QYSA 2WAAA 1OQAA 2LCIA 4MUYA 5BWMA 5AKYA 5LUBA 4ZVRA 2HR1A 4C7OA 5ALKA 3GJSA 5IFKA 1OGIA 2PUEA 3RSFA 1HE1C 4MKZA 3I73A 5GJCA 5KJCA 2IITA 2JIDA 1GHTA 4HX9A 4OP2A 1CDDA 1JPJA 3O1JC 5C35A 3OCUA 3AXTA 4BQFA 3HKBA 3WK4A 5JRJA 2WJJA 3A37A 4HDMA 1ZIYA 2ORVA 4WOPA 3RANA 5F1KA 2G40A 5JC1A 3K4HA 4N5MA 3RHZA 4G01B 3W77A 4OY3A 4JROA 2ACWA 3BMQA 1RW4A 1ID8A 3AIOA 2E4ZA 3FUWA 3IH5A 4HBZA 3UXHA 3LIIA 4ARBA 4DY4A 3WAGA 1Q6YA 5P8WA 1D4AA 1VPEA 5KNDA 3RJMA 4Y1EA 4BRUA 1YQWA 3I1JA 3UQZA 3OA0A 3G23A 3RNOA 4NJMA 3ZWXA 4EI9A 1GCUA 3CPJB 5EL0A 3MFYA 3AF1A 2R7LA 1NDHA 4UVHA 3K4PA 1QWSA 3WK5A 2FPXA 3GY0A 4Q3OA 5AYVA 4ZD6A 3NKFA 4TLBA 5A9TA 4DMHA 3T5MA 3AP1A 3MOGA 4XJVA 3AEYA 1UOPA 4LTNA 3WFIA 4G1BA 1UZMA 3AKEA 4IEFB 2W2OA 4N48A 1CCWA 3S28A 3MMNA 1RQNA 3BGWA 3ZQ4A 3BORA 2J3JA 3JSAA 4OFBA 4OHKA 4EI8A 3VNUA 1QXSA 3WGHA 3WXBA 1YXMA 2VYFA 3STYA 3FYUB 4EJSC 4H7PA 1BE6A 2UVQA 1IHDA 3DXYA 3TQSA 1RKQA 2FPIB 1A27A 1HYBA 2H2FA 3LDUA 2QLJA 1QDUA 3LP8A 3EMKA 5DGXA 3TNDA 3UTCA 3H9EO 1I7DA 2F2TA 1J22A 2XRFA 1F9EA 2ZRAA 3ACCA 1ONNA 4I3HA 4A2QA 5A5GA 2ZUEA 4AI6A 3QF7A 4DS3A 1CEEA 2REQA 3QHAA 2AA3A 2HM7A 4HDOB 3UGJA 3OT5A 1GXSB 1LS1A 2FUG1 3FHJA 4MIKA 2R6CA 1P2TA 4M0MA 4OK3A 2BDUA 1F0YA 4IP0A 3ZWNA 1W36B 1KFEB 4IH9A 2WYVA 3ONNA 4LNUA 1XCOA 3PNPA 4PIVA 4QWMA 2YXNA 4QUAA 4U0KA 2EP8A 1AQYA 2GYYA 3ODGA 4IV8A 2C9YA 4UBOA 1M2WA 5LU9A 2BR3A 2ZIXA 3WGYA 2AFIE 1K5PA 3B1JA 5AVTA 1P81A 1NOIA 2DUUA 3B6JA 5FI3A 1F0PA 1Z82A 1PBNA 1US8B 1XYGA 2PCJA 2PZLA 2Y67A 4Y1FA 3RHSA 1RXVA 4LTDA 4MS3B 3T1VA 2O5EA 2WUGA 1WR8A 1TUIA 2P2CA 3ROFA 3DLPX 1GQOA 2DLNA 1TD9A 1XXHB 2OSBA 1V3VA 1LWNA 2CV2A 1Y8ZA 1KO8A 2GFQA 4HVCA 2IYAA 2Y2UA 3FTQA 3MWEA 5I9MA 4J1TC 1Z7YA 1DJQA 3CY6A 3LUKA 1TYZA 1K5DA 2OK7A 4FKMA 3RR2A 2WAMA 3HM2A 1B23P 1II9A 1ZHHA 4MB2A 4XWKA 3BIXA 5FPYA 1VFPA 4MHSA 2CNKA 4KYVA 3IBGA 4B0OA 1AN0A 1XRMA 5EWJA 5BMOA 2C8KA 1YDFA 3U44A 1F7UA 3DHEA 1GTZA 1RAHA 1VB5A 1K68A 1KRWA 1F8YA 5TQ0A 1O8BA 1T4DA 1EFCA 4ZALA 1X94A 2CE7A 1ESMA 1PG2A 3SFZA 2UXBB 1Z6PA 2I6SA 5EIWA 1YR1A 5LL6P 2QK4A 2V6MA 1JX6A 1QHEA 3A9WA 4YJ3F 4HH0A 1RAAA 2BI4A 1RIFA 2ZYGA 3DFFA 3LWBA 4PZZA 2O5CA 4RD4A 3KVYA 4O29A 3FWYA 1JXMA 4M22A 3Q3JB 2GA9A 3EIEA 1O6GA 4ZQFA 1KDVA 4HQ6A 3ZV7A 4M8NE 4MKRA 4MI3A 5BQ3A 2XWJI 5IXJA 5K3OA 3OE5A 1MOSA 2H18A 3NJ4A 5K3FB 1VPLA 5TGDA 2Q99A 4JR2A 4UDYX 3L40A 1YL7A 4EG1A 2WM8A 2ETXA 3QBTA 4U6SA 1C4KA 1S0UA 1W5AA 1JXOA 1F12A 1CJBA 1T26A 1J00A 1EUCB 1RXSA 2H3EA 3I62A 3HR8A 3OTWA 4YRTA 1BVUA 3JWEA 4J0IA 4B6QA 1AQLA 4AICA 4LKRA 3Q12A 3SWWA 4EB3A 2GGSA 3V7NA 4L72A 4OHWA 5JRZA 2JLYA 2YJTD 4FQ5A 3RRXA 3A6DA 5KC8A 4A03A 1LQUA 1RJ9A 2B7LA 2FWJA 2V7PA 1I0IA 4E09A 4EY3A 4BQRA 2I2WA 2CFCA 4JC4A 3E15A 3TECE 2X1LA 4HLUC 1MJ5A 5M04A 3LY7A 3Q5EA 4FDUA 2XXBA 2QD1A 3N6RA 5HIJA 4RKWA 2V65A 5DP2A 2PBZA 4CKXA 5B5SA 3CKKA 1Q12A 2DPYA 2B1QA 4R1QA 3IO5A 3N59A 4DPKA 2CL6X 3SQMA 4INZA 5JALA 1XD8A 4GDMA 2ZGVA 2R5FA 1JIQA 4MVJE 4G0XA 2ZZMA 3GT3A 4CG0A 4AWAA 1B43A 4RLHA 3FPCA 3IB3A 1CIVA 3A6EA 3NBZC 3LSYA 2YWJA 1E7YA 3HVIA 1E2FA 5MN5A 3OPVA 4PAWA 1S9DA 4PC2A 3K0FB 3N53A 3EDQA 4XEHA 2ZXFA 3U19A 3PL5A 3NH6A 3EVFA 3CLKA 2B8TA 3QYPA 4WX2B 5TEWA 4K9QA 1B8PA 4NATA 3IMKA 4CR8A 3DH0A 1VHQA 2HYDA 3CMMA 1XQWA 3C4JA 3OLWA 4PFJA 4PYIA 4Y2YA 4YDHB 5JU6A 3WJ2A 3BCRA 3PC2A 3ZGZA 4S2UA 4WXHA 5K3SA 4OFXA 2FSPA 2HSDA 2WD8A 2Q3HA 3AU8A 3N8HA 3PYMA 3BH7A 2HRCA 1WSBA 4QIHA 4IJQA 4L0MA 4LZZA 4TMKA 1SC1A 4TXNA 3IEVA 1L4FA 1ZGZA 4JLAA 1C4WA 1CQPA 2PL1A 3R7FA 4Z9YA 1UJ5A 2QRNA 5DYGA 1Y9JA 2NU8A 3FOWA 1KZ4A 1X7XA 3EGCA 1J2JA 2SKCA 3SQWA 1FYWA 2RG7A 4PZDA 4HNHA 1RRKA 3L92A 2JLUA 5E9AA 5SYAA 4FK8A 4P08A 1Q6ZA 1XELA 4F3KA 2CDCA 1WCIB 4XW2A 1P33A 3EZ2A 5B58C 2PIAA 1YC2A 1DBWA 2ZEJA 1OBHA 3EX7C 2P5YA 1OXUA 1SUEA 3CVYA 3Q7IA 2OBBA 1E6EA 1XDUA 3WTBA 1UMCA 3HBMA 3PBKA 1OI3A 1ZJ5A 1HLFA 2QG6A 1C0IA 1DPFA 4HDKA 4I3FA 1CUGA 5HK8A 1FE8A 3PIIA 4LXYA 4EX6A 4HVAA 2ZDHA 3V46A 3HWX1 4WV3A 4C30A 1AKVA 3E35A 3MIZA 1AV6A 1A2OA 5IXSA 4L4UA 4INJA 4WI1A 3ZQKA 4MA0A 5A4IS 2SHKA 3AK4A 3JWGA 1J2TA 9LDBA 6LDHA 4DUZB 3TVTA 2ZJBA 3FSRA 3BIJA 3E2MA 4GZMA 4I6JA 4RCYA 2QDXA 4HWGA 5AMXA 1QRAA 2DC1A 3NQ41 3G2HA 4ZU6X 3RHFA 1HT3A 3VNBA 1Q20A 4DIEA 1TYBE 1ZOIA 2O1XA 4X41A 2SICE 1FYVA 2Q9CA 4BGEA 4BU1A 4Q1VA 3RE1A 3VDRA 1PU2A 2G1JA 1QHXA 2QUKA 1IRIA 3IHKA 1LDMA 3E1SA 3MVEA 4TVBA 3V8EA 4F7WA 1P0PA 2AWNA 1ZK0A 2R8OA 4EGSA 5CFNA 4EARA 2PMDA 3IV9A 2ZU0C 3K20A 1KZ1A 1CC1S 3MLEA 1DCMA 1XKQA 3QWFA 4FR0A 1Z8HA 4UJ3A 5E6UB 3T4XA 1NVKA 3A14A 3V4VB 1NQ5A 4P3PA 1V6AA 1C8KA 4DA6A 4DJDC 1Y1PA 1E2EA 3W5HA 5EJ9A 3H11A 2EYQA 3CISA 2QYSA 4QPDA 2ZSDA 3T3HA 2PRIA 3JATB 4BCCA 4DG8A 1C7JA 2WUEA 1HLDA 1TQ8A 3ZU4A 2JH8A 4TRNA 4XFKA 2MTBA 1F8XA 4AP5A 4O25A 4QBTA 4XOIA 3SE0A 1Q1NA 4YCDA 3WADA 4B80A 3GPBA 2GCOB 3KXPA 4OVKA 4R8RA 2ZRNA 3R2JA 2FGKA 1BFUA 3TIGA 2AC7A 4NK4A 4BX3A 3EPHA 2OBNA 5LIRA 2RK3A 2XWBF 3D6VA 3D3EA 4D2IA 1WMFA 5DHFA 2Q2VA 5IBPA 4CHGA 3B9QA 2UUOA 2GJKA 5TLSA 4H7FA 3MJ4A 2AMFA 1SD5A 4P80A 5L8VA 3F71A 1QPZA 2TRSB 2QT1A 2H0AA 3DC2A 2JCXA 4K88A 3R0ZA 1XP8A 2ZIEA 1AUOA 4QOEA 3U16A 2JD1A 3PG5A 1DP4A 1SKYE 3IEKA 3FRJA 5JXHA 6REQA 2JGRA 1V4BA 1UPAA 1KAOA 1IY2A 1J24A 1MG5A 1N3IA 1GIAA 4C29A 3QV1A 4EQ6A 4O02B 4RH1A 4N76A 3OM8A 3IUEA 2HJRA 2RMKA 4J3JA 3RSSA 4DMLA 4KXFB 3NIDB 3EK2A 1RWMA 1U1FA 2RH8A 2V8OA 4KVAA 4ONEA 5F77A 1X6VA 2I22A 4H3SA 3KXIA 7GPBA 1LBQA 2JL1A 1TEZA 4UULA 2BZ1A 2FPUA 2ZJFA 1I1HA 1R5JA 1SXGA 1UBNA 2BFDB 3D3QA 4HEQA 4DSTA 5BN4A 3QHPA 1B6TA 4G1MB 2PNJA 4JBHA 5HCNA 4KB5A 1KFCB 3U4HA 3PYLA 3PXCX 2P3OA 4OL0A 4A2CA 2AMJA 1DDGA 1SKAA 3H0EA 2C2WA 2JW5A 4TKVB 5TJHA 4OQXA 5WRFA 1VIDA 1Y6ZA 4LQLA 1O0CA 3VYVA 2FG5A 1USGA 4WOBA 5I6DA 3CLSD 5C1BA 5JCOC 1JDZA 3MSCA 2ZS8A 2O7VA 3TZBA 1R6AA 3FPLA 4OYYA 4CLDA 3I3OA 1JQAA 1UQRA 3AV3A 4ZU1X 1YGYA 1WCYA 4YLEA 1O8CA 3VYTB 2WNIA 3AQ4A 3SR3A 4RGVA 5KMGB 3FRIA 2IXGA 1XCJA 1VFNA 4DW8A 1P8AA 1U2SA 2QYOA 3H6HA 4IGKA 1LC0A 4FMCB 2AS0A 1S2MA 4LDNA 3AF3A 4CGZA 3E7DA 4ZANA 3ELBA 2IODA 1JDTA 3RLFA 4B8ZA 3BERA 1OAOA 3RH0A 5H4GA 1YRWA 1ILWA 1UFQA 2DQKA 1FZTA 1ZCAA 1P0FA 3I23A 1LBIA 1SKBA 2X3YA 4KE8A 5F9HA 1U7PA 1CJKC 1ADYA 2XT9A 1VPTA 1EDDA 1ODTC 2OCIA 3Q9NA 1Z0IA 3TFWA 4JYMA 2G07A 1YK1A 5DEOA 2ZBRA 5ALMA 4DUGA 1SMKA 3ROGA 5B4UA 2H5JA 4HTAA 1UQTA 3AH8A 4U0JA 5BSHA 5A2QA 1HZZC 3KQSA 5I48A 3UFXA 1BCSB 3AB3A 1S4QA 2QVZX 2FR8C 1U7OA 2CF6A 2JJ2A 2WMYA 4FHZA 4KQHA 5A6SB 3G2IA 2Y0PA 1UF9A 3LVBA 4R7ZA 3QUBA 3IPAA 3CH6A 1ZH4A 4LPSA 2UZ1B 1A1SA 5KJ6A 1GAJA 3Q3HA 3K5PA 2A14A 4X00A 1GM5A 4G5HA 4RCZA 1P1FA 3FSEA 3ZS8A 1J90A 3R5FA 2QJOA 5BNTA 3G6KA 2FFBA 3A2NA 3TG2A 3ZD9A 2G82A 1FLNA 3WK9A 3QEJA 1C1DB 1QIHA 1RQPA 4CETA 1ZGHA 4FFVA 3MWDB 5HA5A 3BSWA 1EB9A 2WT8A 5JWHA 3N7UA 3UMBA 2XB6A 3BK7A 4H4CA 1HEIA 1PVOA 2JGKA 2RCYA 1AA9A 3KPYA 4JYBA 2MSDB 3DBRA 1FRFS 1TTHA 5JDCC 3VVLA 2EGGA 4EB6B 1V3TA 5K0FA 1THMA 2HA2A 3BMCB 2ZRGA 2NO0A 3MJCA 4REQA 2Q9AA 2H57A 2PUTA 3QLUA 4RV4A 4CL3A 4GG1A 4ZHQA 1KARA 4P8RA 3ESRA 5DWDA 521PA 1SA0A 4GNKA 4MUJA 5D85A 1E7SA 1FSZA 2Q7XA 3ENWA 3ILVA 1V8FA 2RGYA 3M6IA 3QWBA 2CUZA 4AC9A 1NFRA 5B57C 1U1CA 2JKYA 2JAUA 3SHTA 1U9ZA 2Q46A 1VKOA 2VJYA 1X8KA 2E87A 4ZJYA 3AHCA 1IUPA 1T8WA 2I2BA 2A0YA 2Y9PB 1Q0PA 3T94A 3NYIA 4DT1A 1KP9A 1BAPA 2FPOA 4N0PA 3KOMA 5ECDA 5G41A 1ORTA 4HC4A 4YP9A 3S1LA 3HU3A 4KDFA 1OKKA 4X1KA 2Y0BA 4P31A 1QYVA 4Y30A 3HZOA 1J39A 2OM6A 1U31A 1GILA 1DS6A 5U4QA 3SYMA 4EY6A 2YTZA 2YYAA 3TD9A 4LOAA 4W1RA 2EJCA 3RC1A 4RY9A 1FRQA 1JQDA 2PRYA 4RPHA 1P5FA 4MV5A 5J2UB 2JLXA 4WZAA 1CU1A 1Y7IA 4QXQA 2BE7A 5BO5A 3UWMA 3BC1A 3W2HA 5TNXA 3AESA 5IHXA 5HKAA 4NBNA 2X5OA 1R9JA 1BMTA 2W4IA 1PQYA 2FNAA 2JPDA 2DPGA 3N74A 3B6ZA 5FP0A 4QHTA 2XUPA 1WOYA 4NU8X 4UHFA 1BS2A 2XMQA 1Y5IA 3QBDA 3SF8B 3MINB 3SI7A 4H3KB 1BYUA 1JHAA 1ULZA 1NATA 4CM9A 2CHGA 1HURA 2FX5A 3LBFA 4Y2GA 3TTWA 1NIPA 4FFBA 5HW0A 2PJDA 4PYMA 4DCNA 1KDZA 1SZCA 4KV7A 2X3FA 2BFEB 3HBJA 3OP4A 2PHZA 5BYBA 3T5BA 1R8QA 1QH1A 3A36A 5EP4A 1T4CB 1VGQA 5DISB 5E8JA 1OH8A 1QZZA 4WVFA 2EF0A 2C97A 2YJZA 3TSCA 1H2EA 5EIOA 1J8YF 1E3IA 1TDJA 1MXFA 1E1MA 1ZD5A 4D0SA 5C5DA 1IN7A 1FMFA 3UZUA 1SXJC 4EHIA 3EVZA 4I1PA 1KEKA 2BEWA 4LF8B 4YRAA 6NULA 3GRFA 2IRWA 3OLYA 4LRSB 3PL1A 3AV0B 3FROA 4MTCA 5FNVF 3NRBA 4FHGA 1WZ2A 5L3VA 1Q0UA 4V24A 4CN9A 1C0LA 1TQ6A 3LT0A 5LQSA 3VO2A 4O3FA 3ABIA 5LM3A 2R6R1 2C2OA 2AV6A 3EG5A 1D0SA 3JY6A 3WK7A 2YV2A 4L5IA 1T9AA 4WWHA 2E82A 4TV8A 1CS0A 1NVFA 2VF7A 1CQIB 3FY4A 2EKPA 3ABSB 4IEEA 3ZCTA 2VHCA 1LDGA 1XZEA 2ZJ8A 3VU1A 2PL5A 4HDAA 1IUOA 3F7OA 1PZNA 1C9KA 3I72A 1YDEA 4MPRA 1ZX1A 5C3UA 4AG3A 4CV1A 5AOAA 4BJ6A 1II8A 2CY0A 4H1VA 4UMEA 3U4GA 2DAPA 1G8PA 1NNI1 4GRAA 4L6AA 1A9ZA 1CB0A 2E21A 5EIBC 1DTWB 3GEMA 3TLGB 2O2CA 1CUDA 3EIQA 3QK7A 1S6YA 2RAPA 4XUGB 3ZU3A 2YZ2A 3IVXA 1W48A 1L3IA 1XJ0A 2C95A 2WM9B 3NHUA 2G7ZA 4NLLA 4BLUA 1D2AA 1CUYA 1D1TA 3KFXA 4R1PA 4RFSA 1KEVA 3GIWA 2IYLD 4CE6A 3RKUA 4CMJA 3MLBA 4EYQA 3RUFA 1HQYE 4JKYA 1R18A 3G82C 1OTXA 4U39A 3TZKA 3E5RA 3NLLA 3GT7A 3JYQA 2C3MA 1YI0A 1LZLA 1QCYA 1NVXQ 1W5EA 3OEED 4PX5A 1BJTA 1SUDA 3W8DA 4M1TA 2G9NA 3OA2A 3ZHRA 3HUEA 4KR3A 4IO0A 3IA7A 1Z0UA 2UUBB 1P5ZB 3DMTC 1XEXB 4B87A 2B1GA 4J0EA 3RV3A 1OYOA 4ENUA 4MEAA 1CFJA 4WNIA 2W42A 5AIBA 1DRUA 1CZHA 3ZTWA 3Q3CA 5D3QA 1IG0A 1QIDA 1Y80A 1WRBA 3EAGA 4FKBA 4JYPA 4NY1A 2AFIA 4BAZA 2B8WA 2I99A 4JLOA 1JKXA 4LVCA 4U6QA 4CG3A 4CKWA 1UBLS 3M34A 4QEZA 4S1WA 3DZDA 1B8UA 2C5HA 2C83A 3FPKA 2ILTA 2A9KA 4V39A 3RV4A 5AW6A 1QVZA 3SX4A 5K4GA 5T8KC 4YPVA 3U62A 1UKVY 4YT8A 2AFVA 1IPEA 3TRFA 3ZYZA 3CZ5A 4GXNA 2W2NA 1YNSA 3AKDA 3L9WA 5AM4A 5HXAA 4PU0A 3VYRB 1P7PA 3FCCA 4WKNA 2HQRA 1U0FA 2W6CX 4FD2A 2A67A 1NQUA 1LV8A 4J4BA 2CLOB 3OJFA 4RMJA 4NS4A 1YI8A 3ONVA 4DIOA 3TLCA 2RJ3A 4ZODA 1V9LA 3RT9A 1JBQA 4HNAB 2JGMA 3K2EA 2GRJA 2OOKA 3K8YA 2ACVA 4G5OA 1N9ZA 4JBYA 2D5AA 2ZQZA 1EHCA 1IAVA 4I4TB 5KWIA 1TECE 1XK7A 3EQZA 3R6TA 4MHTA 1ZJZA 1I36A 1YB4A 4ZYUA 1G20E 3C6KA 3QPUA 4LE0A 1PRYA 3B78A 4K6HA 3KB8A 2R8BA 5DMHA 1F3LA 1SVOA 3LHIA 2ZIAA 1ZUNA 4F5WA 2HK9A 2DQYA 3LTNC 3EGOA 3W3AA 2IEBA 4BJHB 3FW1A 3P9IA 3H04A 3HP7A 3OUUA 4BJ3A 5KU1A 1ORWA 2RGGA 2WJVA 1I2ZA 3SMVA 3CU5A 3LFUA 5EMJA 1FL9A 1CP2A 4TWJA 3V80A 4GMDA 2M1ZA 3ST7A 5KQLA 3WDMA 3CB2A 5DHRA 4AZ3B 2ZKIA 1E79A 4HWTA 3CVOA 5THQA 3RYTC 3SS7X 3VOSA 1H9CA 2I5PO 3NJ8A 5DI9A 4HT3B 5LKRA 3TDNA 1HNWB 4ZK2A 1GT6A 3FNEA 3NYRA 3O2QB 3AR5A 4YP0A 2PD4A 4DA0A 4Z2AA 4GZ3A 3AG6A 3DUWA 2XYRA 4M0UA 2QRVB 3I9OA 4QNNA 4RTMA 4CUZA 1CVRA 3WYGA 1KVTA 4HH4A 1JMYA 1WXFA 4GSLA 4AULA 1HETA 4BC1A 2O8DA 3CH5A 4C78A 2DPMA 2YQ4A 4L8LA 1WDMA 2IH4A 1I2CA 1UDRA 3C0KA 2QD5A 1NG1A 3N3AC 1PBTA 5CW1A 1Q7TA 3SKXA 4RKQA 1T43A 3IAUA 4QM7A 4IINA 1FVXA 3PRHA 1PE0A 5EXPA 4S24A 5J5VA 5LLTA 4RMNA 3PFBA 1EESA 2NW6A 3G5MA 4I1YA 2XNCA 2GXUA 5KNBA 2X13A 1W7AA 4JI7B 4EGCB 1N8TA 3NUZA 4OL9A 1AS3A 3HMQA 1O0SA 3A26A 1D7AA 3EVDA 2PS1A 3QG1A 2JJ1D 4QQFA 4XLZA 3TOXA 1JTVA 2ZFUA 4MIYA 3TGWA 4RD6A 3LKZA 3PCXA 1CRPA 2ZROA 2PCLA 2P0EA 2IYZA 4K9PA 2IHZA 1E3QA 3OJXA 4L9AA 1ZOLA 2OCGA 4OQQA 3LPLA 2Z4TA 4UM9B 2JAWA 4HNTA 4YUXA 4PBTA 1J09A 1WPGA 1VL0A 4S1VA 3RS2A 2WB4A 2WTXA 5BN1A 5C53B 2JFNA 3MJDA 1R8SA 4V38A 4DMUB 2A0FA 2XMGA 4N8SA 1X15A 3M6FA 4PPGA 2FZGA 1BX3A 3OLCX 3IUJA 2EKLA 4MVJA 4MDEA 3C16C 5I4BA 5KVCA 2NT3A 3EQ9A 2A30A 2FXVA 3Q10A 3ND9A 4KWIA 4BB9A 4BTLA 3KJEA 3G7SA 1EFTA 4X65B 1DRWA 3K1YA 1EI9A 3QFTA 4K5QA 4POAA 1LVGA 5KSYA 4PQYA 1KMCA 4JQYA 3TBFA 3TI9A 3VI4B 4CV2A 4Q3DA 4Q3BA 4YQZA 4EABA 2MIIA 1PD0A 2WBLC 1IEXA 3WHKA 3AHHA 3IHWA 3K9GA 1XA3A 3E18A 3FG9A 4JJGA 4OXNA 3M3DA 4C06A 1YBMA 2ZR7A 1H5UA 1OXTA 3I0NA 2N75A 5I51A 2ZUUA 4KHPB 5G4LA 1TL7C 5IZCC 3FWNA 3JPYA 4IJWA 5FKJA 2O19A 4TMVA 3NXKA 2FKNA 1PSWA 3IDQA 2L18A 4JT9A 3BWYA 4X8MA 4RGYA 4CT0A 3ADCA 4YWHA 3PFNA 1BW9A 4D45A 2E4YA 3GPLA 1NKSA 4FLEA 4F2DA 4QHYA 1OYVA 2BJHA 1Q0HA 1R4AA 3RIYA 1E62A 1RAFA 3NFYA 4DDUA 4GDFA 3RS8A 4JJFA 1P2FA 3H42B 3VZRA 3ZWPA 1UKCA 2PU5A 2ZWMA 2XRMA 4PXYA 1EEXB 4B76A 2R87A 1PJ3A 4FD3A 3LQFA 1I3CA 1LF0A 4PQFA 1U81A 4N5DA 3FHTA 4V02A 4EUEA 2Q62A 2PXHA 2ZYSA 2ZS9A 3T15A 1YR7A 4FDTA 5BVHB 5KJFA 1L5HB 2RAVA 1XQ6A 3IP8A 3QEOA 3EUFA 5EXTA 2R8PA 2FX3A 2GCNA 1XD2A 2XDAA 3WIOA 8GPBA 5JBIA 2BCEA 3F47A 4JP8A 1QOPB 1PCXA 3G0GA 4QOFA 1KAQA 1HC7A 4UD6A 2ZYHA 4W5OA 4TMWA 4MLZA 4ZCIA 4TQUS 5EESA 4Z9XA 2R8YA 3OEHA 2VQ6A 4QYMA 4TZTA 2H31A 2ZBUA 1BU8A 3DNMA 4OV6B 2OZEA 4WW0A 3JQEA 4XPIB 4H35A 1PNOA 4HMPA 1Q14A 2BRUC 2ECFA 1JYEA 3OSZA 4IPTA 4JJIA 4UBJA 4DE5A 3AF6A 3WB2A 1TAQA 1EFLA 3P0RA 1KC1A 1EHYA 3KDAA 4DHEA 1LW7A 2VUIB 4M9XA 1ZUHA 4MKXA 4C20A 5EY5B 1WMSA 2O52A 3RFTA 4ZI7B 1U04A 1UXHA 3SNHA 4UTNA 1K98A 4ZMSA 4C0HA 4EGJA 2GPWA 1U0BB 4EOGA 4YAKA 2JLVA 5A0TA 1ZK2A 3LTEA 5KU7A 1OU0A 4UCWA 4DA4A 1TW3A 2A5DA 4X64B 1T3GA 4IZ6A 5AI6A 3P9SA 1VTKA 3ZWKA 3A6FA 2Q0QA 2SKEA 3OF5A 3D4IA 1IUKA 1GQ2A 4P7KA 3GP3A 5DRYA 4YCNA 3PGXA 5I7AA 3KBOA 4NZPA 3WVNA 2A4KA 1LK0A 2PJUA 3OHMA 4Q4JA 4E70A 4B7UA 1P5JA 4UXIA 5FJJA 3WS7A 1L4HA 1U3CA 5FWXA 1XPJA 3DM9B 4RORA 2ZRBA 1R0RE 3RGWS 4Z53A 5JFGA 3CLTD 3VPGA 4Z3OA 3EOBI 3FCXA 3A25A 2P11A 3MCTA 4IHKA 2G83A 4X61A 4I4IA 1RQ2A 3AFHA 2FN8A 2VNKA 3IRUA 1N1GA 2QXTA 5BW4A 3OEYA 4IXTA 4RCVA 1ZRNA 3A3KA 3NEAA 5BWLA 4YYZA 1TZMA 1JN0A 1TB4A 1ZHFA 5TDHA 1ZAKA 2N1MA 2A1UA 3H4MA 4TQGA 4MGHA 3U48A 5IF9A 3DP7A 1UWCA 3HYLA 4RVUA 2W6NA 4GOMD 5CBPA 3GAZA 1HDIA 2WMOB 4ZHQF 3O1HB 4LSZA 3H2HA 1XMJA 1S2OA 3UK0A 2CDRA 2RK6A 3M4XA 3AJRA 1WUYA 4FHEA 3IJPA 3PFIA 3DCYA 3NM6B 2ZIVB 4J0QA 1WTCA 3PPVA 4OP1A 5G53C 4ZICA 3OZEA 3CNEA 5C7LO 3EXHB 1IIBA 2FOIA 1NZFA 3AEUA 3RYFA 2QU8A 2PUGA 1JU4A 1FTQA 2O14A 4OI2A 4MR8A 1M8PA 2BH9A 3IAS1 3QVUA 4O5OA 1KQ3A 5KSPA 5L3SA 4Y9TA 1CLUA 4TRRA 3ZCPA 4X97A 2Z08A 1DAOA 5ERYA 1S2IA 2WSYB 3Q9UA 5FTLA 3AY6A 2IUTA 2ZBEA 3G6WA 3REFA 3C3AA 2DJIA 3OZAA 3K70B 2YY6A 4FLMA 3QY9A 3DL7A 4WESB 1ZWKA 3RFFA 3VTAA 2FOXA 5KO2A 3OZUA 3PPWA 4NPCA 3BIWA 4Q00A 4YA6A 3TPCA 5CB6A 2IZ7A 3C48A 3OU7A 1SCIA 5ALYA 4QSMA 1P0CA 4AY5A 3HTXA 1SVLA 2J07A 2CHVA 1VCHA 3ZV5A 2VZ8A 4OYLA 4PZCA 3KT6A 1H2FA 1VPDA 5EHQA 3F7MA 3KR1A 3UAOA 2NXEA 4X5OA 1C80A 1AKYA 3EWSA 2FRDA 4CQNA 3LGSA 1QIEA 2VJQA 4JJ4A 4UHBA 5LFAA 3U3ZA 1ECLA 1NY6A 2B4AA 2D2EA 2O2XA 4WXMA 4BEVA 1XQVA 3K6RA 4FDLA 4RVFA 1DEAA 1QV6A 3PNSA 4JDPA 2BJVA 4RO0A 1G16A 2W71A 1Y1TA 2ATXA 3GEDA 3LYHA 4GP9A 3VO8A 1RFGE 4LW8A 3X1ZA 4A8JC 4EGQA 4D8YA 1ZM7A 4EFDA 3EXFB 2A92A 4EYSA 4JASB 4PO8A 2HPHA 5KTSA 2FWBA 2EQBA 2ODNA 3DEHA 1VKJA 1YR3A 1RJDA 3CQ9A 3PICA 5A0FA 5B2FA 2PAAA 1Y81A 3SX0A 4FFSA 1SM4A 4OF4A 3R1IA 1VJCA 4IFTA 4IOLA 3KHKA 1P1CA 1BYIA 1QOQB 2AOWA 4EP1A 1AUVA 3GJXC 3DPIA 4XDYA 1VE6A 3DG9A 4RWEA 2X8JA 2NO7A 1P1BA 2A5FA 4IDEA 4R1LA 2HIAA 3V5NA 4C3ZA 1Y9DA 3L8YA 4Q3KA 4AD8A 4ZYWA 5FBKA 4YROA 1PJ8A 3OPYA 3K0EA 5KX5B 3QENA 4JBNA 5ARDA 1T0JB 4J4TA 1W4BA 5LYJB 1VKNA 1B8NA 4TTTS 4TV8F 2IH2A 3RSQA 5K6AA 1AUQA 1LFDB 2YC4C 2PDAA 1S3SA 3CSSA 2OOSA 3HL0A 4Q9NA 3V7YA 3VMFA 3FPSA 1E5XA 3KKEA 4I50F 4U9IS 2ZVDA 1JEAA 3QRWA 3T7DA 3A6ZA 5AI8A 4EVRA 1PVVA 2GM4A 1NLFA 4BYGA 5EFZA 1V8PA 1FDIA 4ANFA 1EZZA 2LIVA 4IJMA 4DV6B 4L0QA 5FOUA 1SXPA 2IQIA 1ECJA 5IT5A 2Q8NA 2RHHA 4Q4AA 4XFDA 5TVKA 4K6OA 3EC1A 1QYDA 5ED4A 2E18A 4YTEA 3O8RA 2OAEA 4RIFA 5ECYA 3B1XA 3NOOA 3R7LA 2H2GA 2ZB3A 3K35A 3M3PA 1X80A 4FOPA 3TXAA 2DY1A 3AMVA 3FR7A 4E13A 2ID8A 3JTMA 3C3WA 3T0IA 3TLMA 4P5DA 2X0EA 1VECA 2VXYA 4XSVA 4ZOQI 3D4LA 3HVUA 1L5OA 2R1TB 2OZLA 4Q7KA 4DUPA 2ID4A 1PJQA 2JCSA 3JVUA 5CVTA 2COEA 3IIEA 4IS3A 5D3ZA 3O5AA 1FSFA 1GITA 3RS4A 1ZN2A 4NZYA 5E9JA 4H4EA 2I4RA 2OENG 4UTRA 2ISSD 5TV2A 1VJDA 5BSKA 4HH1A 2CSXA 1M6WA 2Z3VA 4KPUB 4Y6RA 3WNQA 1EFAA 2IU4A 5D7BA 5ED0A 2QL6A 1O94A 1PZEA 1B6SA 2EXXA 2QTFA 4GZ5A 4B6JA 1GFWA 2VDWA 2BKVA 3PQ4A 4E5NA 1G8HA 3AI2A 5ALZA 1B1AA 2R2GA 2J0UB 1PR4A 4YJHB 1W76A 4WBXC 1T9CA 3CXRA 4MXDA 3CV3A 2ATEA 2MMGA 2ZU6A 3AEXA 5KB3A 4Z0PA 3ER9A 3IE2A 4WZ6A 1RWVA 4Y98A 5BW5A 5LYYA 4KO3S 5EEHA 3TRJA 2XCIA 4TS3A 1YL5A 3RF7A 1Z22A 3HCRA 4HDSB 2X4DA 4PPNA 5LD2B 3B1FA 1OWOA 4OHXA 3CKLA 3M9XA 4BIMA 5EINA 2QA5A 1D1PA 2DTDA 4ZCMA 2DR2A 3C8ZA 4YJFB 4DF3A 1S4MA 2H85A 1BDHA 2XHEA 2B8EA 1DMRA 1YRHA 3G7UA 2NO1A 1ZN7A 1E1NA 4W9RA 2VJKA 4H6XA 2AZXA 2BFFB 4HP8A 3M6MD 5K3BA 1T9GS 2EJVA 4IG9A 3TR0A 1ZR2A 4MV4A 3UICA 4ABYA 3QJGA 1AGYA 4BVLA 2I4IA 4D9FA 1FTGA 1MENA 3DD1A 1TLLA 3PQEA 4J49A 2G25A 1MB0A 2QUHA 3SYTA 1E4EA 4X20B 5IJWA 3QLTA 4LEIA 2I1WA 3ZJ5A 1Y48E 1OZGA 5GZ1A 4I1UA 4CMEA 1YQGA 4YNBA 2ZIGA 1YU6A 3NV9A 1COWA 5BR1A 4UEJA 4KOAA 2BGUA 5E6RB 1WY5A 5B30A 3N2KA 4H08A 2LDBA 4MRRA 5FR2A 1T6XA 4Z49A 3HMKA 1LC3A 1Q1BA 2IP4A 4P4UA 1DJMA 5IK2D 3K92A 4MNTA 2JCGA 1C7EA 4JLMA 4M4SA 1FDRA 1HKUA 1TYCA 2PA0A 5DP1A 4O2BF 4N7BA 1PDWA 1CETA 3A1WA 5LDHA 3I9NA 1PWXA 3AR3A 3DDSA 1KL7A 1RPZA 4XDZA 2Q3EA 1GUDA 2OECA 4X8LA 3EWAA 4RKEA 3FDXA 5F7JA 2P6NA 1B42A 3AUAA 2MYTA 2YHBA 2WAOA 1FW6A 3TBKA 2J33A 1MJGM 2DVMA 4KWEA 4MQ4A 3TGPA 4YY3B 2QB5A 2EV9A 2YWGA 4N9QA 2R79A 3WKEA 1XZMA 1A9PA 3OLQA 2YFYA 1YVPA 1U2PA 1E20A 1BA3A 1KOFA 3A8TA 5IW8A 2G9UA 3QXJA 5H3CA 1ICEA 1BN7A 2ZIWB 1SHKA 4N5HX 2FZ4A 2GI4A 1ZVVA 3THWA 1WHTB 2NXJA 3HCOA 4OIFA 5CAEB 3T7AA 1IULA 4ZYYA 2PKXA 1L7DA 2X23A 1U8EA 5G2OA 3GLGE 1N2CE 1CRWG 1HE5A 2Q3MA 1UM8A 2QTNA 2PVSA 4MVWA 2WKRA 1K1EA 1YWGO 1SZJG 1SBZA 1K9VF 2GFIA 3E3AA 3M2TA 3WLLA 5HUJA 1DQYA 4FSDA 5H70A 2YRWA 4MVJF 1J06A 3KQHA 4FGSA 2IPMA 4FKZA 3WDSA 3AB7A 3H9GA 1YS2X 3I9JA 3NI2A 4XRRA 3U9TA 3KQPA 3W4IA 4AKHA 4BXOB 1NT4A 1EKXA 1WDWB 2OD2A 5H0IA 2F59A 2GBCA 5HX7A 1JBKA 2D8AA 3HU5A 3OZ7A 3TTXA 5LZ4A 2CEAA 3SLKA 1TYEB 3FAZA 3JTEA 4H7JA 4HBGA 1VXRA 3M1LA 1KJNA 5E7I