3FZQA

Crystal structure of putative haloacid dehalogenase-like hydrolase (yp_001086940.1) from clostridium difficile 630 at 2.10 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
271
structure length
271
Chain Sequence
LYKLLILDIDGTLRDEVYGIPESAKHAIRLCQKNHCSVVICTGRSMGTIQDDVLSLGVDGYIAGGGNYIQYHGELLYNQSFNQRLIKEVVCLLKKREVAFSIESQEKVFMNQKAKEIFETMNQLKGTNSCINKQHIQEKITYENNIEEYKSQDIHKICLWSNEKVFDEVKDILQDKMELAQRDISSQYYEIIQKDFHKGKAIKRLQERLGVTQKETICFGDGQNDIVMFQASDVTIAMKNSHQQLKDIATSICEDIFDNGIYKELKRRNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative hydrolase
publication title Crystal structure of putative haloacid dehalogenase-like hydrolase (YP_001086940.1) from Clostridium difficile 630 at 2.10 A resolution
rcsb
source organism Clostridium difficile
total genus 97
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3fzqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fzqA01
5AKJA 2RARA 3ET4A 5AKIA 2HDOA 5AESA 5AKZA 4KN8A 5ALGA 1L8LA 3OCUA 2C9MA 5AM4A 1Y8AA 3ZWKA 5AKXA 5ALEA 1RPZA 1S2OA 4ZEVA 3NALA 2BDUA 3FGOA 2GHTA 5ALQA 4YCNA 2NYVA 4OHFA 3BWVA 4BEVA 1WPGA 3UMBA 4Y2RA 2NO4A 3HYCA 2ZG6A 2FPWA 4MUMA 4KNWA 1YNSA 4BX0A 4Y2XA 3N1UA 1ZS9A 5ALRA 3AR5A 1TJ3A 3DDHA 3UM9A 2G07A 4FFDA 3U26A 1RQNA 1ZD5A 3ZX5A 4IG4A 4FYPA 1S8OA 4KNVA 3TLMA 5AKEA 2R8EA 3A1CA 1AQ6A 2HO4A 2P27A 4F71A 4YGYA 5AM3A 3FZQA 4UAUA 5ALLA 2HHLA 4DW8A 5ALFA 2G09A 2B8JA 3QGMA 3FPBA 3IJ5A 2Q4TA 2YMMA 1NF2A 3QU2A 1EK1A 4Y2JA 1U2SA 1JUDA 4Y2YA 3S6JA 1U7PA 1Z4PX 3L0CA 2C8KA 1MH9A 2O9JA 3ZVNA 2YJ6A 4F72A 1K1EA 3WGVA 4J2TA 4YCMA 2JARA 3DV9A 1CQZA 1F5SA 5ALZA 2QLTA 5ALJA 3NUQA 2CFTA 2BY4A 3L8EA 3M9LA 3WK6A 3A3YA 2I6XA 1O03A 2EARA 5JJBA 3AR6A 4Y2TA 4KX3A 5AVSA 1Z4QA 4EEKA 3U7EB 2Q5EA 3HLTA 4H1WA 2G0AA 4C4TA 5ALVA 3A1DA 3KD3A 4PNHA 2W11A 2HSZA 2HOQA 3OCXA 2X4DA 4XOUA 1VJ5A 4L6CA 5AHXA 1KYTA 1T9ZA 2C4NA 4UU0A 2P69A 1YJ5A 3WKBA 1RKVA 2WM8A 5FP0A 4UMEA 4BKMA 2I7DA 3W5CA 2Q4RA 3ZUPA 3IB6A 3ONNA 2B8EA 3WKCA 3ZWDA 2HEGA 5AVQA 4KX5A 5AI5A 3AR2A 5AI6A 4DFDA 3ZVMA 3NASA 4NFLA 3SKYA 3VAYA 4JB3A 3N28A 1QQ6A 2JGAA 5AKYA 4YIHA 3QUBA 2I54A 3EF1A 2R8YA 3RF6A 1J8DA 3DNPA 2NO5A 4BX3A 5AVZA 5AW6A 3I76A 2YFYA 4CNQA 4B6JA 1QQ5A 3AR4A 4C4SA 1LVHA 2WFAA 5AI9A 4JDPA 5AK4A 1ZRNA 2PKEA 1LTQA 4UM7A 4EZEA 3QUTA 3FVVA 1SWVA 3QUCA 3ZTWA 2JAOA 3PGVA 1RLTA 4QQFA 3QU5A 3ESRA 2O2XA 1ZD3A 4NV0A 3WKDA 4E88A 2HF7A 1TA0A 1Z4JA 3I1YA 4UARA 1ZD4A 2RBKA 5AVRA 5AW9A 1NRWA 4HGOA 1Z88A 5IS2A 1RMYA 1Z5GA 4CE6A 1U02A 3R09A 1EK2A 1NNLA 5AW8A 3M1YA 3QXGA 1XVIA 4O8CA 3U7GA 2JAUA 2VKQA 3U7FB 2PQ0A 1L7MA 1Q91A 1ZJJA 5A3SA 5ALOA 3W5DA 1YMQA 4ZEXA 5ALIA 5AIAA 2GFHA 2P11A 4BBJA 3EF0A 3ET5A 2YMLA 5ALHA 5IT0A 3B9RA 3E58A 3AR7A 2FI1A 2IOHA 3K1ZA 4MWOA 2IOFK 3KDPA 4DCCA 2FUEA 2PR7A 4J03A 3GYGA 1WR8A 2FEAA 3E8MA 2YMQA 1RMTA 3OCVA 2G80A 4RETA 3E84A 1Z4NA 4C4RA 3N5KA 3SKXA 3QNMA 2YJ3A 3MN1A 2IA5A 2WF9A 5AKHA 2RAVA 5AM5A 3QX7A 2YY6A 1TJ4A 2IOFA 2AGVA 4HAIA 5AW2A 3OCYA 2YJ4A 4Y2QA 2FUCA 2WF8A 3NAMA 2OA0A 1YV9A 1WVIA 3W5BA 5AVVA 3WK7A 4I9GA 2ZBFA 1U7OA 1X42A 5AI4A 4AP9A 1T5SA 4ZEWA 2I34A 4G9BA 3EPRA 4OFZA 2BDEA 4EX7A 3L8GA 2WHEA 3L8FA 1TE2A 4UM5A 4XE5A 3KC2A 1Z4LA 2ZBEA 4AS2A 5AM2A 2B30A 2I55A 2B1QA 3B8EA 4FE3A 3OPXA 3QLEA 5AW3A 2HF2A 2CFRA 3OCWA 3QUQA 3UMCA 1RQLA 3N07A 2EATA 1L7OA 4L57A 5AK5A 4EX6A 5ALMA 2DQSA 3OTQA 4UMVA 3EWIA 3QU4A 2MSNA 2OYCA 1Z4IA 3U7HB 1N8NA 3P96A 4HGRA 3PGLA 4Y2VA 3R4CA 1Z4KA 3WK9A 1RMQA 2OM6A 4YIKA 5A3QA 3B9BA 2YBDA 4UMDA 3WK4A 5AVXA 4NAVA 2HX1A 4BNDB 1QH9A 3WK8A 2AH5A 1QQ7A 3KBBA 5AK6A 2D2VA 4DWOA 4CF4A 1L7NA 4YCLA 4Y2PA 5ALDA 2G08A 1RRCA 1O08A 4GIBA 2ODAA 3MC1A 4GXTA 5ALYA 1Z5UA 2CFSA 2G1AA 3I6BA 1VFPA 1RKUA 4L6AA 5AICA 3UMGA 3BA6A 2QYHA 3SHQA 2R8ZA 4I9FA 3ESQA 1VJRA 2G06A 5AW4A 4XPZA 2I33A 3WK5A 3L1VA 4Y2UA 2FPSA 2OBBA 3ZX4A 5AVUA 1XPJA 3IRUA 1WZCA 3AR3A 1ZD2P 3MMZA 4IFTA 3QU7A 4UU1A 3L0YA 4G63A 1YDFA 2C8LA 4UMFA 5AVYA 5IT4A 3KOOA 4UAVA 2AUTA 1RLOA 3QYPA 4EENA 3WKAA 3L5KA 5ALWA 4KYTA 4Y2SA 4UATA 2B1RA 4CF3A 2B82A 3U13A 3W5AA 5AVTA 5ALKA 3L7YA 3E81A 3L8HA 2FPXA 5AK3A 3FM9A 5ALNA 3AR9A 5AW5A 5E0OA 3QU9A 2YMPA 4UASA 1J97A 2HI0A 3CNHA 3PDWA 4HYTA 4NWIA 1L7PA 2W43A 5ALPA 3AR8A 4CF5A 5AW1A 1QYIA 2WF7A 1CR6A 1Z4OA 2FDRA 5AI8A 1YS9A 4Y3UA 4BNDA 2FPRA 2CN1A 2WF6A 2ZBDA 5AI0A 5A3RA 4NABA 4HGNA 1SWWA 4XQ0A 3A1EA 3OCZA 2YN4A 3CZ4A 3RFUA 3WKEA 5AKKA 2GMWA 3SMVA 1RKQA 3R9KA 4BX2A 1PW5A 3NIWA 3FPSA 2C88A 4UW9A 2W4MA 3KZXA 2ZXEA 5AVWA 1ZOLA 2MU1A 3MPOA 2B0CA 3D6JA 1ZRMA 3L1UA 5ALXA 1Z4MA 2GHQA 1TJ5A 3ZU6A 5ALTA 3PCTA 3NANA 4AS3A 1FEZA 3WGUA 5AIBA 4HGPA 1L8OA 2ZBGA 5AM0A 1T5TA 2RB5A 3SF0A 2JAWA 3J7TA 2ZOSA 3N8GA 5AW0A 3U19A 3ZW7A 3DAOA 2AMYA 4OCZA 4OD0A 5ALUA 3SD7A 2WF5A 3SLRA 4RESA 2FPUA 1RLMA 2EAUA 2YJ5A 4BYGA 5AKGA 3ED5A 1SU4A 4EELA 4YH1A 1RDFA 5AKLA 3ZVLA 2GO7A 1Q92A 3ZI4A 3NRJA 5ALSA 1XP5A 1RC8A 2IYEA 4QJBA 3ZTYA 3F9RA 1N9KA 2R8XA 3I28A 4HGQA 5AW7A 5T41A 1IWOA 1L6RA 3L0BA 5AM1A 4BEWA 2HCFA 2P9JA 1U2TA
chains in the Genus database with same CATH superfamily
1GDTA 4HG2A 2NPOA 2UZ1B 2RARA 3VTKA 2Z04A 4DR2B 4N5MA 3B2QA 2ZIZA 1IEVA 2LXNA 4MQEB 4B82A 2QY6A 1AB5A 1ESZA 3AU9A 3EXG2 3PD0A 4GO1A 1FYVA 4MW4A 2A1TS 1P5FA 5CLIA 2CVHA 2C5EA 4BMCA 2ZE6A 4AJLA 4EW1A 3K70D 1QUFA 5JPDA 2WRZA 3FMOB 3RAJA 2VAWA 1SFRA 4MV5A 4RACA 4RE5A 3RRBA 1TGVA 1YUBA 1Y6ZA 3GEIA 1KF0A 4QJ3A 4X7BA 3UAWA 1K7XB 2ORVA 3S8MA 5A5FA 1CDEA 3I6IA 4ZIRA 1ZYUA 4D4HA 2ATVA 3DEFA 1W0JA 4TUYB 1XU9A 4UHEA 2EGGA 2JH9A 1AZSC 3AIIA 2BFEA 4LXGA 4P35A 5T4EA 1GU0A 4BX0A 1XE3A 3HV2A 2IYAA 4YP6A 5LLDA 2OLJA 4WLVA 5K4AA 1H0HA 2ES4A 3MHTA 3IQXA 5J4VA 4GL2A 3PSHA 2OV8A 4IO0A 3VZPA 2R86A 2VF7A 4NG4A 3L4JA 4IM7A 4B6GA 2OUKA 4CIXA 4DJEC 1QCDA 2VDQB 3EZXA 1U04A 2IITA 2QW8A 5K0NA 1INLA 3GMDA 4ALIA 3R0XA 2PNFA 4P08A 1GNTA 4AZWA 4B0PA 4B43A 4DC1A 3UA4A 5CNJA 4KLCA 3VYVA 5KTKA 2XTAA 1X7XB 4DW8A 4LMAA 4QDTA 1UAGA 4BN5A 3WSVA 1Z8NA 1XL1A 4RQTA 1DCKA 3H84A 3IJ5A 3LCRA 2Q4TA 2YMMA 4X1IB 3MTIA 5ERYA 1U2SA 1JUDA 2V59A 2Q2WA 1BCSB 4CEHA 3UJBA 3NHPA 1G63A 1T1RA 2GEUA 2I71A 2AE2A 2M2IA 3EVCA 2O9JA 3MJCA 3CNEA 4LF7B 3EPPA 1HRKA 2NIPA 4FK8A 2YJ6A 3DPUA 1JG7A 3CLTC 4E30A 5AQEA 1PZEA 1ZIPA 3IV9A 3ZH9B 4F72A 5F78A 2QUJA 2RHHA 3HXPA 2EFYA 2J9RA 3FPGA 4DLSA 3FZNA 4FGLA 4GRIA 2AW5A 1RC0A 3EZYA 2BY4A 2V58A 1G5RA 5KTRA 1SIUA 2GKGA 2UUAB 1U99A 4YAGA 1SHTX 3AZOA 3EGOA 3UG6A 4NZ9A 1Z6XA 4RKEA 1ISPA 5EQTA 4CGZA 1NVGA 2WU1A 4HZUB 4YWJA 3DXFA 4P5EA 2DUUA 4KCGA 4MB2A 4JJ8A 2G0AA 5JNSA 4TMKA 4MVJG 4C4TA 1IAQA 1GKLA 3H65A 1A7UA 2JC3A 1GRCA 2YHBA 1OIXA 2NZWA 2X4DA 1F8FA 4NV3A 5JUWA 1XKXA 3G0GA 3SIXA 4LA4A 2C4NA 2Z3ZA 3G2MA 4IW3B 4J1SA 5DCLA 3VUFA 3IQEA 1DINA 5CBKA 2Y1FA 2B4YA 5FI0B 2E5WA 2A0KA 2C00A 2VDNB 4R84A 1EX1A 5IEBA 5JPIA 5LQCA 3E9QA 4HH1A 2W8BA 5G4KA 2PX0A 4D8WA 1K6MA 2PL3A 3KXDA 3R0VA 4D42A 4ABTA 1J1IA 5TT0A 1K5PA 3RVLA 5AVQA 1EB8A 4KX5A 1FXUA 4NY1A 5AI5A 3STYA 1GPNA 1AC5A 5JSYA 4YPVA 2I6TA 3V4ZA 3OD5A 5DMXA 2XQFA 1QQ6A 1JEDA 1JG6A 4NE2A 3UAYA 1RQ2A 2FGJA 4IY1A 2XUJA 4Q3EA 5JY6A 4RF4A 5JXWA 2V4UA 4DSTA 3RF6A 3WE7A 5CDSA 1P1CA 2GH1A 3D6TB 1EJ2A 3N2ZB 5LMZA 3AM1A 2Y0PA 3ZDZB 1SXJE 2FR0A 3GIWA 4EHNA 4RK0A 3TIVA 4R98A 3I76A 5I7FA 4YY3B 3O9VA 4QSHA 4MS1A 1CUJA 3F2IA 2BBSA 3RAFC 2LVBA 1QSGA 2QRVB 2H2FA 3R3SA 1Z06A 4O2AF 2OCLA 4OLBA 1ZRNA 5K3AA 3TD6A 4JVSB 1C9NA 5KJFA 3NWOA 2I6SA 2ODWA 3WLQA 4JEHA 3RQSA 2GLXA 2H1WA 4ZU1X 3ZTWA 2EYQA 1RACA 3L6RA 3M4XA 3QSYA 5DBIA 4L5IA 5J40A 4N7MA 3H6HA 1G3QA 4JBYA 3PHJA 5E6SB 5KAMA 3U44B 4RL4A 5KQPA 5EJFA 1O7JA 4URFA 5DYWA 3QA9A 3GZJA 4IINA 4LRQA 1DJMA 2RBKA 1XRSB 1R66A 4UHHA 3GRPA 2QD5A 3C14C 3V4LA 1O94D 2WUVA 3PVCA 4O1HA 2DT5A 4ASUA 1TTHA 2GAFA 1UDBA 2QPTA 3R09A 4YYEA 3W9BA 5B5SA 4LV8B 3L46A 3MBKA 3K0CC 1IC6A 3F6CA 4IR7A 2B4AA 4OMDA 3B38A 3GNLA 4QJ4A 8ADHA 3T9EA 5IANA 3RUFA 3WQHA 2HCRA 1S3SA 3BKXA 1Q91A 3JAWB 1WSDA 2FW8A 1B8NA 2CGEA 3DM5A 3EXG1 2D0IA 1KSHA 2C3OA 2JLCA 3KUCA 5K3FB 4HUTA 5KVAA 3V8NA 3JRWA 8MHTA 2Q29A 4BDSA 4HNSA 2FQQA 3BJRA 1VBNA 1LXCA 3IUBA 3N2GA 5ALIA 3ZH2A 4X62B 1BS1A 1GNRA 1Y3IA 3EA0A 4BBJA 3H4MA 3HU3A 4F2DA 4LDRA 4Q3AA 3ROKA 2HD4A 4IJMA 4ZQFA 3CR3C 3DV0A 3PWZA 4FGWA 4F56A 4OJTA 3OOJA 4BMNA 5KINB 3RG8A 3EJWA 4YRLA 3NMUF 2Z1MA 3F46A 4JOQA 5A03A 4B79A 2W98A 3AEQA 5KYUB 1JH8A 2QG9A 2XW6A 2OLEA 1DUIA 2Z8XA 1PGQA 3QENA 5DP1A 4ZCRA 1Z4NA 3CA8A 3D31A 3Q12A 1JXMA 2R7MA 2DQZA 2WSMA 4I19A 1BFUA 2BUCA 1SG6A 3QFCA 4RKQA 2A9VA 1DQSA 3ETHA 2TECE 4WNCA 4ZRDA 3AG5A 5EJ8A 1H2EA 4L76A 4IDCA 5JISA 1CUBA 3GNSA 1UODA 2GFIA 1XCBA 2JI7A 3GGDA 1V5GA 3ZWOA 1M10A 4CODB 4DIDA 1XN1A 2JCSA 3ELBA 2V1UA 2B8NA 2FB9A 2R79A 3A3PA 3BXFA 4JSTA 4GMHA 5AW2A 3VR6A 2JGMA 2QVXX 2RBGA 1ZSNA 2HUPA 2YJ4A 3GFPA 3IKJA 3LPMA 5B3JA 1IWPB 2CNNA 2Q6LA 3GFRA 1XZBA 3ZE0B 4RLSA 4BP8A 2HDNB 4UBJA 1Y42X 3D59A 1YV9A 3PUWA 4V3CA 2ZT6A 4TPKA 3KP1A 4V3BA 4EPTA 1PEDA 2GN1A 2I2CA 4GZ6A 4PQRA 4BN0A 2BIFA 4EFMA 1YK1A 1Q14A 3GHYA 4LRXA 3RVSA 2I2AA 1B8UA 1T1GA 2AG6A 3SJCA 4H7JA 1Z47A 4WUVA 2YXDA 3ZYCA 2GUWA 1SN7A 1XI2A 2OXEA 3NHUA 1WCWA 1QHHA 2JZCA 4IEFB 4QDUA 4IMJB 3VKVA 1AKUA 1LZLA 4EPXA 1PJCA 3OTWA 2JFUA 1Z5PA 1KIMA 3AVWA 3D8BA 2BZSA 2YBEA 1E6WA 3BJIC 4QUJA 2C31A 3L1JA 2FR8A 3VBCA 1MB9A 4BLSA 2ZVPX 3VJRA 5DHSA 4ZKDA 2OKGA 1EFCA 1WVMA 1SPXA 2BMEA 4I1SA 5CR9A 5AYVA 3HO1A 1Z08A 2QRHA 2ZB8A 2HYDA 1R4AA 2VT7A 4W7HA 2LTAA 2Q8NA 2Z43A 2PA0A 3ZW8A 1LW6E 4EX6A 2W6NA 1JE1A 4RDXA 1XRMA 3I0NA 1KDPA 3K30A 4I55A 2NU9B 4GYYA 4B9AA 3Q3CA 2V6JA 1NMQA 5EIAA 5E7QA 1GZ5A 1R4ZA 3P9YA 5KWIA 1XT6A 1AMNA 2OV3A 2VPPA 4UMVA 3BJZA 4EUSA 2P5TB 3C3WA 4FFLA 1PQYA 3VVMA 3LUCA 1C3OA 2DSNA 1HYQA 2VDVE 3KZOA 4URUR 4D9GA 1LC3A 3AOEC 5I7EA 3QY0A 2FVYA 1MW9X 2FJPA 2PIDA 1U65A 2A30A 2PT6A 1I2AA 3RJZA 1GPDG 4QQNA 3WK4A 4OATA 4REOA 4K1XA 1BS2A 3OETA 4HQKA 4M54A 1P29A 1GTVA 5DHQA 4REQB 2FYTA 1CSEE 3MINA 4TOIA 3DZHA 2OPHA 3I5MA 4HQRA 1GZ6A 4IL5A 4AY5A 2XZOA 1F51E 2CBGA 3G2OA 3PTLA 3DKRA 2FZEA 3PFGA 1JYSA 2REXB 3WMEA 1DWOA 4JFRA 1WAMA 3NJRA 3ZXXA 1YK0A 4JLMA 3LKDA 4BGDA 1MIOB 3FSEA 2G08A 3TNDA 1YR3A 1R16A 2K4MA 2PXHA 3BHIA 3ITKA 4H77A 4TWBA 3B52X 1VLLA 2PRSA 3DMHA 4M1WA 1F38A 2JFQA 2NXCA 3CO0S 4HJXA 3D2AA 3UJDA 2EVWX 1JKFA 1DC4A 3EQ6A 5CTAA 4YXWA 4B7ZA 3OZIA 4YP0A 1J06A 1ZJ5A 1ZW1A 5JCXA 2VJQA 2E49A 4TRMA 3SHQA 1C1DB 1CF9A 2F1HA 2GKOA 3KZMA 3LS2A 3CNLA 1VJRA 3ZE8A 3PGKA 2BMFA 1FB5A 2COKA 5EMKA 4US2R 1FMFA 1AN9A 5ADVA 2J9XB 4OFWA 3HGQA 1DV1A 1J0BA 1XTQA 2FPSA 3DQZA 1LTHR 2OHGA 2OGWA 2ZUVA 4OHWA 4WWHA 5FBZA 3UXYA 2QE7A 4GP9A 4RJIA 1YA6A 2ILTA 1ZD2P 1NLYA 2WFMA 5IVPA 4EUFA 1ZRHA 3EQZA 3TDKA 4F96A 1DCFA 2VT2A 2QUHA 2WKRA 2C8LA 1CZKA 1U5CA 3VR0A 4DLZA 4NZZA 4EI2A 1F17A 4I4LA 2A33A 1TRKA 2H2WA 3FUTA 1NVTA 4PEVA 1NI5A 5TEWA 5THKA 2IBMA 4DQDA 4AKIA 1HY3A 4PBSA 3TR0A 1QKKA 1RWOA 2O7RA 1ZUHA 3FVRA 2ZDGA 1NQWA 3C3MA 1K08A 2WAXA 4KYTA 1K8YB 5JANA 4M9RA 1XN4A 4DR7B 3PNSA 4NG5A 4XWTA 1SBNE 3PZBA 2RB4A 4G5GA 1Y4SA 2JBAB 3D9QX 2VJMA 3EG5A 3FCUB 1A8HA 1L9XA 4FWBA 4IGEA 3T7CA 5CM8B 1VDMA 4CMBA 1E5TA 1AD2A 5E0OA 4N12A 1L8AA 5AW5A 2HBRA 1PGOA 1KOJA 4HO1X 3ERCA 4N65A 4ZDWA 1DRUA 1PR4A 1Z9BA 1E79A 2FWJA 4MJLA 3A9UA 3VGPA 1VE6A 4DLTA 2A1UA 3SC2B 1USIA 2X0RA 3P94A 2G71A 1Z26A 4JLUA 1BEZA 1Q11A 1RAFA 3E5NA 3Q6MA 1N4AA 5L3ZA 4BOYA 1CR6A 4PX2A 4XFDA 2HJWA 3RJMA 2FDRA 1PLLA 1NUPA 3V1NA 1V0JA 1OX4A 1WW3A 2VRWA 2JI6A 3IE2A 4ZVMA 3WRWA 2Y0DA 2AQIA 1PN3A 3EDCA 1MA0A 3FHCB 5GONF 4BQSA 4CLDA 4ZZ0A 1QTIA 1GTMA 1VCNA 2NT4A 4MXDA 2PX4A 4TTVA 4DIKA 2DR2A 2FWIA 2Y1XA 4N49A 1NJ8A 1PG2A 1YQDA 2HPZA 5JQGA 1XROA 5I45A 5BQFA 5HGXA 4CEIB 1C8VB 1KEKA 1P2TA 2D5AA 2P5YA 1RRGA 4D9CA 1MO6A 2YINC 1F3OA 4YMHA 3ORFA 3ANLA 4FMDF 1Q95A 4FSDA 3R9KA 3D0OA 3AP2A 5L3QA 1BRMA 2R1TA 3I4FA 3IJEB 4K03A 1KEPA 4CWAA 1AZWA 1O95C 3D4OA 3SMQA 2ZJZA 1NUHA 2F90A 4MUBA 5G0UA 3TFQA 3TZCA 1YS7A 5AVWA 4YJFB 1TO1E 1U9ZA 4TQAA 4AX8A 4C1BA 1FQJA 2HNAA 1V96A 2Q62A 3C8DA 4R8KA 5EP2A 5IASA 4GE3A 4WKGA 1OMOA 5EMNA 2IRWA 3D64A 5B1IA 2C7OA 2V3CC 2AJBA 3G8YA 1B26A 3NFRA 1XMXA 3T12A 1FFYA 1EPUA 1QFYA 5GWXA 3WGZA 1H4QA 3CNQS 1JX6A 2R4QA 4POAA 3EVNA 5A6SA 1G8YA 1ZN8A 5E4JA 4BNJA 5CFZA 1OAKA 1GRRA 1OFGA 4JBXA 3SQDA 4ROTA 3WOVA 3DLHA 2HZ7A 4F4FA 3DO5A 3HGTA 4EJSA 1IZ8A 3SOZA 4QFDA 3T3HA 1XD9A 1JHRA 4FSHA 4AJPA 3EMKA 3V3TA 2JAWA 5C53B 4QC2A 1ODTC 1CUYA 3A14A 1M34B 2GASA 2H9AA 4ZZ3A 3TGLA 5DXJA 3O0DA 4B7XA 5I01A 1TA9A 2V96A 1JFFB 1KAHA 1NF9A 5CJ2A 3WHPA 1TO6A 2OCIA 4M9UA 5J2TB 3PDJA 4NCJA 5JFTA 5K4GA 3HM2A 3U7JA 1NBAA 3IR7A 4M1MA 5ESXA 3JWGA 3L04A 4S0XA 5EJIA 4DDVA 9ATCA 5A5EA 1TTTA 5A9SB 2KYRA 4A5OA 3E18A 4IIGA 2BFDA 2QT9A 3EEBA 1IN5A 1CD5A 3ND9A 4DMRA 3STHA 2XF2A 2COUA 3Q6NA 3WNQA 4ENUA 3Q3VA 5JAUA 1TCVA 2EBUA 4BEJA 1IEQA 1SBYA 2YV4A 4NATA 3VJLA 5JI3E 1N5KA 4RHCA 1RXSA 3GP5A 5D7BA 5HOEA 4AKHA 1PT7A 1EDOA 3U4GA 1M6VA 3EXAA 1E99A 1TQ8A 421PA 2CCKA 3P0JA 3RROA 4Q39A 4PZZA 4Q0MA 3F6BX 3VKWA 4RJ2A 1USGA 4D6PA 1M1UA 2V7XA 1OIWA 2GZRA 3TRKA 2E1RA 4TX1A 4UDXX 2MINB 1S8AA 4I9NA 4K9KA 1MP0A 2GF9A 1FDVA 3ZWKA 2WJYA 1WB9A 4W5TA 2GN6A 3RKRA 2BELA 4ZEVA 3C3JA 3Q2IA 4PX9A 1KGSA 5A4MS 1EAMA 3DE1X 2J6BA 2ZFUA 3L6CA 5BW5A 2B7BA 3EVAA 3THSA 1VL8A 4CL3A 4CM7A 2CKMA 1R6TA 1TF2A 2NUPA 3HEBA 5COQA 1HDXA 2FUNB 3Q41A 3VC3A 2V9CA 1RI3A 1ZH2A 1XP8A 3BXGA 4L5AA 4QU5A 5HF8A 4Y6SA 3CLRD 2EWVA 4TZKA 1WOYA 4ZQEA 4A2PA 5IABA 1RJEA 3KXLA 1D2NA 2DBYA 2QTWB 3U4HA 2SKDA 3JWPA 4YI5A 1KA9H 3PQEA 2W6ZA 4LISA 2GK7A 4PZEA 4MUYA 2WYUA 4NI5A 3UAOA 1ZC4A 4URYR 1EFRD 2HN9A 4WXEA 4F4HA 3LXRA 3H11B 3FYHA 2V97A 1ZXLA 3HABA 2L17A 2B5VA 2IYUA 3F47A 2R87A 3SIRA 1IZ7A 3OT1B 1DXYA 1ONBA 1PJBA 1BU8A 2CEKA 2FJUA 3AEZA 2BFBB 1O8BA 3QVLA 4JI6B 4DTIA 4F97A 2RAUA 4P9NA 5E4TA 1TYBE 5C1IA 3KL4A 4DLLA 3BEOA 2H51A 3ZHVA 5ALFA 1W87A 2G09A 2P6PA 2VJNA 2DBQA 4IJUA 3VKUA 3ZD8A 3ITEA 2ZIXB 1V3TA 4GC5A 1CVRA 1D03A 2YDXA 5JWHA 3ZDYB 2FKAA 1F60A 3OTIA 4RJLA 5E8JA 5BV1A 3EYAA 4YJ3F 2C7PA 3GGGA 2J9FA 3OSUA 2POCA 4IRMA 1BA3A 4S2UA 1U2RA 3C41J 3QXSA 4BL5A 3VZQA 4S3MA 2FU5C 3I6QA 1SY7A 5ECDA 4A1FA 4P32A 3TJRA 4OQ4A 1IHOA 4RTOA 5EQFA 4RCVA 3A8TA 4BXOA 4PO1A 4RVUA 1C9EA 1YZGA 1G2QA 1KNXA 3PQDA 4AMGA 3EUAA 3DV9A 1V5EA 4K87A 5DN9A 1Q22A 2FX5A 5B6IA 3EH2A 2BFFB 4AJ1A 1NYLA 4QM7A 4C5CA 2IEAA 1RYEA 4H17A 1JH9A 4GWKA 4LF6B 1GARA 1E2DA 1XKQA 1FU8A 4NYMR 4Z4IA 4F91B 3HU5A 1DKPA 4UHKA 3N74A 4Y2TA 1T3GA 1MXFA 1LSUA 1Q83A 3LZCA 1NVUQ 1PF7E 4KMOA 1CUGA 2J7PA 2FY8A 3NNNA 4H0CA 3JATB 5D5QA 4CNBA 5JS6A 1W4BA 4QD3A 2VNAA 3QP9A 4X1OA 4YLGA 3RSOA 4N3BA 1LDYA 1M67A 4NU8X 4OSOA 4F4JA 3JZIA 1VOTA 2XA2A 4QYSA 4ENTA 4WCDA 3E7XA 4JI5B 4MITA 1KWGA 3MIZA 4KN6A 5ENZA 3HJNA 2J3JA 2RKBA 2DWOA 3OLXA 4JUCA 1NSFA 2QTHA 3LGSA 2YS7A 2ZSHA 1FSSA 4IX9A 4HR7A 3LQ1A 3FSGA 3JR7A 3B1YA 2BZGA 2GN0A 4JY7A 5DK6A 3QTTA 2B8EA 3ZUPA 4A8TA 1LF0A 3DZIA 5C51B 5TV2A 4ZOLA 4A0RA 4E09A 5FL7D 3ZLBA 1XFAA 4UCXA 1YR2A 1ULHA 4TWZA 4JI8B 1P5RA 3C87A 3AYXB 3OFSA 2G76A 3MS7A 1GQRA 1N2JA 5F4ZA 5J3JA 1FSZA 3PA8A 5IT9A 4UTRA 3RBZA 5KB3A 2XQJA 3LDAA 1PSWA 3RSGA 1GPJA 3E5HA 3NBZC 1R0LA 4FONA 1KPHA 1J8DA 2YIDA 1KJIA 4MGYR 1GZHB 1E3LA 1RQ7A 2AD1A 4X1KB 2DPMA 3QOYA 3A4MA 4UM9D 2ZUCA 4HYYA 1KI6A 3Q98A 4F4UA 3VR3D 1AJEA 2IQIA 1P19A 2Q6VA 3EXIA 3H2JA 4W5QA 4DM3A 3AR4A 5ADWA 2WFAA 2KBFA 4YMTA 3AFOA 4OSPA 3GGJA 4QT4A 4S04A 3HKCA 2L19A 3UH1A 2OBLA 4LC0A 1E6KA 4QG7A 4TRNA 2VI5A 4ZHSA 1VPVA 1FNMA 3E2IA 4W4TA 3ASYA 3K0AA 4HRXA 1H93A 3I1YA 1EX9A 4FEGA 2A9KA 5GZ3A 1NIJA 4XQ9A 3MLEA 2QZ4A 1Z88A 2M32A 3II6X 3A9SA 3AXTA 3JPYA 1TW3A 4O2BB 1PQPA 1TUBA 2QL7A 4BQEA 1L5VA 1L4UA 3SHTA 5IT5A 4QECA 2UAGA 1GDDA 1GN9A 3HY3A 2ADOA 2XY4A 3M1YA 1XVIA 2D1QA 3S0JA 1GTSA 3V34A 2JAUA 2X9NA 1FNCA 4B3TB 2HPHA 1T2FA 3AWIA 3PI7A 5IDQA 5DI9A 4M83A 3SR3A 1YCGA 2BHRA 1W73A 2YZMA 3OM1A 1D4AA 1USKA 5LQSA 4E12A 3AP3A 3H0CA 4ZFNA 1R15A 3AK4A 3PC7A 3G0CA 4NHOA 4FLFA 4TN5A 2P9YA 3TYXA 3MB8A 1AZTA 3UMJA 2WSIA 1H23A 4KK4A 3RSFA 2O8DA 1D0SA 3AESA 4RPIA 4RXTA 1S9HA 3D4PA 1OHHA 1TVCA 3L7CA 1N6PA 2QUAA 2XRFA 2AQKA 2UVQA 4HAWA 4MVJD 3ENKA 5LOVA 2C8VA 2C99A 1UBLS 1YQTA 4KI7A 3GYGA 3RNOA 3PQ5A 3AHJA 4LS3A 3Q8KA 2F8TA 4Q4AA 3T3GA 4NZNA 5CNMA 3T5DA 1C9MA 2NYRA 2WU4A 1TVKB 3MWEB 1HFJA 2WZQA 4ESEA 1C8KA 2D4HA 3N05A 4YAIA 2ZJ0A 1NG9A 1CIVA 3KQTA 4GF5A 1X13A 2O2EA 6NULA 1M2FA 1PNRA 3AVPA 4K0KB 4M1YA 2BKEA 2P9ZA 1YE8A 3HUFA 1XUOA 1YCHA 3ZHRA 2NNLD 3EK2A 3TINA 4GL4A 1TJ4A 3AF1A 5FIUA 3F5SA 5FUWA 2XB4A 4MV3A 4MRMA 1JKJA 3OCYA 4RY0A 3HCOA 3S29A 3HL0A 2R7KA 5TPZA 4EMBA 2QN2A 4JJAA 2V9ZA 4NVRA 1NVAA 2P6NA 3SFTA 3OJLA 2HR1A 1IY0A 4U6SA 1IBSA 2NSLA 5KNLA 1NIPA 1CB7A 2PJZA 3I61A 1D07A 3C6ZA 4QVGA 1S9DA 1X42A 2CJFA 4OKSA 3WP0A 3CM0A 5IEJA 1WEKA 4X60A 1DFIA 4W8GA 4EX7A 2VT6A 3HCNA 4P54A 1WXIA 4EJMA 1IONA 3L4SO 1TE2A 3AGQA 4MS4A 4XE5A 3ND8A 2MMCA 1WULS 1UOPA 2FSPA 3QFHA 4HH4A 5JFGA 4EPYA 1B6RA 1A3CA 1DJPA 1FQOA 1KH1A 1XDSA 1YS4A 3EGIA 2QP9X 1QGED 3KQOA 2AKAB 3GJRA 3PFNA 4L4XA 3OD1A 3L4KA 4X41A 1OU4A 2YWEA 2ISSD 5BYKA 3BXEA 4DZRA 1MX1A 1T0BA 3WJ2A 5GIOE 5FCDA 3SOPA 3LV8A 4LK3A 4XUEA 4MRSA 1ZK4A 4M88A 4DMHA 4MKHA 4E5KA 1MRZA 1NF8A 1QV7A 4AN4A 3BAFA 2D2XA 5BW6B 4CM4A 2E5FA 5E2AA 1MNQA 2AJCA 1SU7A 2AKEA 1BZYA 1CUIA 5JE8A 4NAHA 2H65A 4IZIA 1JALA 2V65A 3MWDB 3BGWA 2OQVA 5EHGA 1L4BA 2H0QA 1U11A 3GCWA 2W2XA 3GZNB 4KFUA 3ZKWB 5KU7A 2ZJ2A 4GYJA 4IIUA 1KVQA 4J16C 5DTQA 1V16A 5DSTA 4QIHA 2JS7A 1VSUA 2W2NA 4YT2A 4OQXA 1QTQA 4YHHB 1I7PA 1U2QA 4HGRA 5KAPA 1HV8A 3GPLA 1DIRA 2P0AA 3W9SA 3C5EA 3DWIA 3OQOA 2OM6A 2GVZC 2QN6A 3PEFA 2DKFA 2GJAA 2HA6A 5DXFA 1WB4A 3CV3A 3WYEA 5ICSA 1UANA 5AVXA 1W9MA 1YOBA 4RPKA 1ENZA 3UXMA 4CKYA 1JBEA 1U2DA 3FKJA 4I50B 4J4HA 1A97A 2NO9A 4MR7A 3UJ7A 4JYBA 4MV0A 2O8CA 4FS3A 2X8BA 4P82A 1ODCA 3T35A 3CT6A 1E2JA 3DBRB 2K7ZA 3LX8A 4L5CA 2FVXA 4WXHA 1WV1A 3OY7A 1J5PA 3BCHA 4QXQA 3OEYA 4DS3A 2RIPA 3K0KA 2BWJA 1O9GA 2EZ8A 3AV3A 3MA0A 4DLPA 3DEKA 1P62B 1L0BA 2QN1A 3MC1A 4P5PA 4WJKB 3ZHYA 4TV9A 3CVVA 1AQNA 2ETXA 2EP8A 2G1AA 3D4BA 3NRBA 2OGZA 3OFNA 4ND7A 1LCIA 1XEWX 2H2DA 5DEIA 1XOIA 2QLFA 4ALMA 1DEAA 3GELA 3H9EO 4OXNA 6YASA 5L7YA 4OV6B 4ZI3A 2IP1A 2FR1A 2ZCUA 4QSMA 1I3KA 4E07A 2C77A 1P45A 2QS9A 4KQFA 3FA2A 1FDTA 1NBOA 5LVAA 2C7QA 3T7JA 3BMOA 3QXXA 4WCFA 1SU8A 2HLDD 2OFWA 3WYNA 3L7AA 1NLMA 3VSBA 4Z3OA 1NVVQ 5IFLA 4WZBB 4I7EA 5TR9A 3IRUA 1A27A 3AFHA 3PU6A 1G60A 3L93A 3GBPA 4HWRA 4OGGA 1T3TA 4PYLA 4LVOA 5FWXB 2JB9A 3ZCRA 3COJA 3UMMA 5AQ1A 4DQLA 5F52A 1L5HB 3M8KA 3I04A 3ROQA 2ZIVB 3C97A 1CUVA 3GLGE 1WMAA 2CZGA 2XPCA 1TX4B 5JNUA 2PX2A 3IXQA 3KOOA 4JJ4A 2JD1A 4UAVA 1EG2A 3RS8A 1HSOA 2QIPA 1RLOA 4GXQA 4S1TA 2XZPA 4W5RA 5KQRA 4LSWA 4KZKA 1JDVA 3DDWA 3ZHXA 3ZNQA 4UCFA 5G0SA 2ZAOA 2B1RA 3IB3A 3ZE9A 3ER8A 2P68A 4CMIA 3RUPA 3LU1A 3EQ7A 1Z0DA 1BQ3A 1ANKA 4C0KA 4YJHA 3BQ9A 2IF0A 3C98A 1I7NA 2ZJYA 3LC1O 2J09A 3E81A 3JVUA 3LL7A 4KMMA 4K6MA 4MA0A 4NBUA 3BVPA 1YJ8A 4JOBA 1X3LA 1YCFA 3KR1A 3QXJA 2C95A 2XXAA 5DYGA 4R2LA 1AZLA 4JR2A 3Q15C 4UASA 1J97A 3PDWA 4CUKA 4EZIA 3PIIA 1GQQA 5IBPA 2GM9A 5LZ8A 4NRDA 2JBHA 3BMCA 5IZCC 2AMFA 2PT9A 3PJGA 4ZEMA 1X39A 2C5BA 3FF4A 3EGDB 3M5CA 4I9UA 2D0PB 4Q4HB 5HM6A 2VPQA 2TMGA 3PPWA 4ALLA 4IS3A 1K3UB 2BFAA 2V6FA 3GOQA 5A9RA 1YKFA 2Z9BA 3MCAA 3B89A 4QYIB 1BWSA 1WBJB 1OLSB 2VLIA 4YP5A 4Y3UA 4BO7A 4C3ZA 2JLAA 2I8CA 1E2LA 4RANA 4DDKA 3JQQA 4E70A 2QQ5A 1AQUA 1JPJA 4FLMA 2HJVA 1DPGA 1KAGA 3SI7A 5JFOA 1HTBA 5GADl 2GYYA 2X6RA 3HU1A 4PICA 3EPJA 2GI4A 3B1ZA 2I9KA 1N5JA 2Z1NA 2HXSA 4HOYA 1R6BX 4BB5A 4C0HA 2JI9A 2BF4A 4IDFA 3I3SR 1IDOA 1ILWA 1RLUA 5SZKB 2B78A 4BX2A 3UAXA 4L4UA 3C3KA 3CPSA 3AOGA 4F60A 4EHHA 3PTZA 3ZY2A 3ICQB 1Q7CA 2FEOA 1L5SA 1VTKA 1QAQA 1JLRA 2GA9A 1YB5A 1EGQA 3GRZA 3STUA 1L4FA 1XQ9A 1FS4A 4H7PA 5DX8A 3CHYA 2CL0X 2QD1A 2PSFA 2GLUA 3D6HA 2NGRA 4ZMSA 5HIJA 5ALXA 1V8BA 4G0YA 1DQRA 2QMYA 2J0QA 3PXDA 1TLFA 2YDYA 2NU8A 2GHQA 3T52A 3LXUX 1GEGA 5ABPA 3OI7A 1T2EA 5L7WA 1VCOA 5F2EA 4LJYA 1FPQA 1JHZA 3PI6A 5TDHA 1R8YA 1BQEA 2XBMA 1N2CE 1PG5A 3KQMA 2RB5A 4FHZA 4URZR 3SE7A 3TGPA 1J33A 2D2FA 3NLLA 1D1SA 2H4ZA 1Z0JA 2GPYA 5AW0A 4C08A 3ADOA 4XDZA 5LZ2A 2PT7A 3U19A 1NONA 2X0KA 1A71A 4X54A 5TARA 9LDBA 1W93A 3SLRA 2XYVA 4G5SA 1SJ9A 2HGSA 3DO8A 3OJCA 4WASA 3TTVA 4GP7A 3LK6A 2F9LA 3K4QA 2H85A 3LY7A 1AV7A 1FLNA 1QP8A 2D8MA 2FPUA 4MEJA 5DTJA 4RD4A 1L6IA 4NOKA 4L1KA 2W42A 1Z16A 1Y37A 4DLUA 1UM9A 1YCDA 1ZBDA 3FPAA 2BGTA 2EV9A 4HB2A 2WVJA 1RC8A 3P9NA 2I3BA 2IYEA 1XMPA 1TZMA 3GLUA 4ARAA 2G0TA 3PGXA 4II2A 1FDRA 1IBRA 3K9QO 3TWOA 3WV4A 4UVGA 3K9GA 2GHIA 1L6RA 4KO4S 5EYPA 1AIPA 2BFCB 3RABA 3QI7A 1U3WA 4LCEA 2UYOA 3HB0A 2R44A 4YMWA 5AM1A 1W35A 4U2DA 1KQOA 1GXSA 4BQRA 1R9MA 4PINA 3R0JA 2A0FA 1KZHA 3W8FA 1U8TA 2Z98A 3X1JA 3PB3A 3BMQB 1ZK1A 3M4NA 3D8HA 3JVVA 2VHUA 1OT3A 2RCNA 5K3DA 3FCXA 2JLBA 5HFNA 4JVLA 1JIVA 1CV2A 2Y1EA 4TS4A 2AOUA 1HQYE 4A2CA 1VXRA 4EGJA 1W4CA 1D2GA 3L49A 2GJSA 5AKXA 5ALEA 2RAPA 2ZW9A 4B4VA 1NP3A 3AW9A 2CY0A 1QBGA 3CGWA 3ESDA 3F6RA 4C4OA 1QIEA 1C4KA 2XV1A 4MQFA 4AO6A 4YCNA 1XMJA 1M76A 1QO7A 2Q5IA 3TOXA 3F8WA 3OY2A 4AIRA 1GKKA 1XD8A 4EEZA 5IPFA 3A6DA 3U4QB 1E7SA 1EFHA 2BKUA 2FFAA 6PFKA 5KOJA 4GE0A 3FPCA 3OPYI 2NT3A 2UUOA 2VP6A 4U7WA 3RUIA 3D3KA 4IDGA 4KQHA 1LF5A 3I2FA 4DIEA 4BKUA 1SBIA 1ZS9A 4FN5A 2UZ4A 3B48A 3FG9A 1BDBA 1Y9EA 3FNGA 3G7UA 3TK1A 2CDBA 3TLYA 1RQNA 3KZNA 2G1KA 4GBMA 4KNVA 1KYIA 3R6GA 2HO4A 5GGYA 1X80A 4C89A 1FFXB 2BEWB 4YGYA 1RAIA 4JLAA 1SHKA 4GI5A 4EA9A 5TX7A 1ZA1A 5LP6B 5C8YB 5K8VA 2Y0BA 5ALLA 3AVXA 1DEHA 2Y68A 3QWHA 3FFAA 2KBEA 3TPZA 1YDWA 1GGJA 4B3BA 2Z2KA 5EIEA 1O5IA 3ZLJA 2BR4A 1IHDA 4GR9A 4K6GA 2VJDA 2NYUA 2IX9A 1L2TA 3IR6A 3LY5A 5I3ZA 5C81A 4IO1A 1EK1A 5DM60 4LFBB 1HEUA 1I4TD 4TLLB 1KZGB 1H2ZA 2GZ2A 1A8QA 4FWIB 1D8AA 2WU3A 3ZVNA 1M5RA 3T5AA 3W7AA 3DHYA 3PGMA 3NTXA 3JD3A 1KE1A 1C7QA 4EHKA 2QTAA 1J39A 2ZKIA 5IAGA 1C81A 2ZUUA 2WSYB 2NTJA 4LXIA 3SDSA 1ZU4A 2QLTA 5KC9A 5CDFA 4EYOA 3AKZA 4B3SB 1VQ1A 2ZR7A 3W2IA 5INTA 3AFIA 5CB4B 3IQDB 3PL5A 2WJHA 4P93A 1VKRA 3A3YA 4KPFC 3UUWA 4MGIR 4QRDA 3ZQ4A 2OD9A 4UVIA 3QV1A 1ZCBA 3FH0A 4R1OA 4G2NA 1YBMA 2CBZA 2J6HA 2XUQA 3GLVA 3MWLA 4MHSA 3QA3E 2FFQA 5EQJB 2XNDA 4BKRA 4DNXA 4EY5A 1F6DA 4L8WB 2CK3A 1BA2A 2W2OA 4RVHA 3WDKA 5DWQA 1EE1A 2ZAGA 3MCTA 3LDHA 3BGDA 3QVOA 1Y82A 3A58B 1FRVA 2PRYA 2XZDA 3MJSA 4MGEA 3TLBA 4AJ9A 1LVGA 5L3RA 4JSYA 4IIHA 4ZVLA 4DE5A 4GI1A 2HOQA 3QE0A 3HTXA 3FI9A 4BUZA 1MX3A 2FQYA 1T9ZA 3TO5A 2JK1A 4AW9A 4EFKA 1JW9B 2BEUB 4RJTA 1NZFA 1ZDMA 4US1R 4ACAA 1PQUA 3PNLA 1DKLA 3CUVA 3K05A 5FF9A 4MP6A 1X7GA 3S27A 1EUYA 5EHIA 3E23A 1NHWA 2OD2A 2R00C 2UVPA 5IUKC 3GARA 3R7NA 2XUFA 2GM4A 2X0DA 4UVHA 3I6YA 5CFQA 2HEGA 1U8XX 4LGCA 2O1WA 1CJSA 1SHZA 3PL1A 4LTDA 5LMUB 3U3KA 4BVHA 2JJ1D 1SUAA 1WL8A 3BTSA 2FPGA 3EF1A 2OB1A 3EVZA 4M9XA 2BGIA 2PUEA 1XCPA 3L6OO 1CT9A 2Z56A 3A9TA 1YQEA 1YWGO 3TOVA 1X7WA 3N7UA 5DI3B 3UK7A 2X5XA 2NX2A 4NZOA 1ZM9A 4EOGA 2XWBF 3EJ6A 4M7PA 3N8KA 4HDRB 2BR3A 4RA6A 4CW7A 4RLHA 4ALNA 3GC6A 3VPAA 4BMOB 4B7AA 1QRUA 2HO5A 3DXZA 4XFKA 4GM4A 2NAFA 1ESEA 2GERA 3FLAA 2EG9A 2ZB3A 3EA4A 3ESZA 3FHOA 2O23A 2PRJA 2XVYA 4G0QA 1SWVA 4LJ8A 1SUSA 3RQIA 3HEAA 2I8AA 4KG7A 4BWGA 4E5NA 3IUYA 3WO0A 2LPMA 4S35A 1CKEA 4D41A 1JR6A 3TLAA 1I3MA 4JS0A 4KK3A 4IJ6A 4RZUA 1XTJA 1ZD4A 2VH1A 1J7KA 2X7JA 2XE7A 2CL7X 4D45A 1RMYA 3NHFA 1O1YA 4CE6A 5FH9A 1ECBA 3X2EA 1J9GA 2WSLA 1GZSA 5EPEA 5GVSA 4AQYB 3HK2A 5C1PA 1ZNZA 1W19A 5CT6A 3T3NA 1QG2A 2VSXA 5DLYA 1SM4A 1J42A 1RJ9A 1J0EA 2IDMA 3QXGA 2TS1A 4PTLA 1JHAA 5LA6A 3ZCUA 3LPNA 1VPTA 2EDAA 1CEYA 4ZV7A 3UQYS 5E3HA 4KKXB 3O2JA 1J00A 1NBMA 5CIYA 2X58A 4DQUA 1ZLYA 3KQPA 2O14A 4RCYA 3RRYA 5K7SA 3O94A 3M6UA 2A88A 4FI3F 4GLOA 1I7QB 1IEXA 3HKEB 3ZHUA 2VSNA 4TWAA 4OGLA 3G2LA 1L5FA 4U9IS 4G37A 4NCHA 4WBSA 1X87A 1U2GC 3ET5A 1KI9A 1KMHA 3I4LA 4MV9A 5FHQA 2IUUA 4DTCA 4FUTA 2Q7XA 1WB6A 3FMPB 2Y71A 4GD3Q 4LDZA 1FLAA 1T2AA 4K6CA 2J0UB 2NTNA 3FDZB 4LHZA 4E2YA 3OIDA 1VB3A 5TGDA 4L07A 3B60A 3UT6A 1C0IA 1N6RA 3P2IA 5CVJA 4LVCA 4RTMA 1K6XA 3K92A 2ORED 3ZY6A 1EUCA 2W6CX 3KVRA 3R5XA 3MYRA 4AZSA 1DIOB 4XZ3A 1O5TA 4DQXA 2PSEA 1E1QA 3B6IA 5IVDA 4OQYA 5FNVF 2P1ZA 1UKEA 3BBLA 1KR5A 2AMLA 3A1FA 5EA2A 1QH0A 3GGCA 4UEQA 3EISA 3VHXB 5JZOA 1SBTA 2K7FA 2X4GA 4FHDA 1FJ2A 2CKDA 3O75A 3T7KA 3MAJA 4CFZA 4E4TA 2X9VA 4IHJA 3B2EA 2B99A 4WGFA 1R4NB 2OZPA 1NVMB 1Y6QA 5KTMA 1NT4A 2W4IA 4B5LA 1C7IA 1WCIB 4HB0A 3OC0A 2X22A 4MLZA 2QX9A 4FFVA 5AVVA 1XMVA 4I1RA 4NPHA 3GP8A 1J09A 4DZTA 1YAHA 2RK3A 1NVVR 3K0FB 3IRVA 2PKWA 1NUTA 2Y05A 4II7A 4JGIA 3CNNA 1BDIA 4ZK2A 1X1DA 4KVFA 4ZOLF 2GCOB 1XYVA 3NB0A 4FC7A 4HTAA 3D3EA 4GMKA 4OP1A 4YCAA 5EEHA 4ES6A 5JYEA 2Z5GA 1SO8A 4K1LA 1XTRA 4Q37A 3TPFA 4ARZB 4YCSA 1XK6A 1Z4LA 4KQCA 3W2HA 5LZ4A 3HCPA 3AI3A 3P9ZA 4AS2A 1KJZA 2O06A 1OFUA 1TGYA 1DMSA 1Z39A 2AFRA 2WOJA 3MBIA 4YUVA 3WMWA 1OUMA 2C3YA 3EXHC 4H60A 4IIVA 3OE1A 1DWPA 1I4OA 4EQZA 5B2EA 4RV9A 2CUNA 2OCAA 5ELXA 1BXRA 1I2DA 1PUXA 2HF2A 2OOSA 3IV6A 1S7GA 3R7DA 5B64A 2O5EA 2QE6A 2HMVA 3N07A 2DULA 4ZOBA 2LW7A 5AK5A 1ZNXA 1NMXA 2E21A 2XLCA 1OLXB 2ZRCA 3QW2A 1R6VA 4IH9A 4KE8A 4M99A 2OWEA 3ZHSA 3BC1A 4FD2A 4IIDA 5BSWA 1DRKA 3CZ9A 1G16A 5H4HA 1E7WA 2DQSA 4K6FA 3WNDA 4WJLA 3EGVA 3UJ3X 4U7DA 2DWUA 4KDEA 4LI0A 1ENPA 1KPIA 1GFWA 1RW4A 2H07A 1U90A 2P7HA 2R2GA 1RM4A 1S6YA 1Z4KA 1V7CA 2RKWA 3K09A 4Y2GA 4Q4JA 4BO5A 2JVKA 1MO2A 1YFKA 1PD1A 3TR5A 1I2BA 2M98A 5KWVA 5KCZA 2HX1A 3AF3A 5ES3A 3LI2A 1UJ4A 2FPIB 4L27A 3GEMA 5HF9A 1G41A 1WXDA 2V54A 4PS0A 5EWJB 5JMPA 3W77A 4DCNA 1Y9ZA 1SQSA 4NYIQ 5ES4B 1N0WA 4N0PA 1UC5B 1IOZA 2CT8A 4QARA 3SVLA 2IZ5A 3KYCB 4ER3A 2D2VA 5T4HA 4D7AA 5LLSA 3RIMA 4B4WA 2OORA 3VPXA 1H66A 2P41A 4LUCA 4GKAA 3W5UA 2IHNA 4G01B 3RE1A 5L8VA 2FOLA 3BF7A 1K75A 4UEOA 4GNKA 4MWSA 4GIBA 3RIGA 2D74A 3AHIA 3QELA 4GZ5A 3GLFB 1FBTA 4GMDA 4Z1MD 3HJFA 3QQPA 3WA6A 2XLBA 4R8LA 1PEAA 4B9EA 1MOSA 5EXPA 4D96A 1P2FA 2VUHB 3O3OB 4WT7A 1P3JA 4BLQA 3WB9A 4HI0E 3HUTA 4J6FA 3RTCA 2PS0A 3UAGA 5LOVF 1IZYA 4QHYA 2E3JA 2IEZA 5HS4A 1BJTA 3OQBA 4XPZA 2QQFA 2Z09A 3ETCA 3OZCA 3KSDO 4U2EA 3ORSA 4JROA 1X9GA 4BVAA 2R4UA 3HB4X 4AC9A 3O73A 4DR6B 3M6VA 2YUIA 3TTTA 3VGJA 4QYTA 3TW8A 5KYXA 3CGGA 1AQLA 3DB2A 3NVAA 2ZUFA 1CIPA 2BGUA 2XTJA 2OBXA 2QQ0A 4BQPA 4AJ4A 3NQ41 2YQZA 5IT4A 4G1UC 1YZ3A 2EWMA 2AWOA 4CQMA 3UW3A 2XMZA 1QXSA 6Q21A 2A9OA 1AK9A 2GZ1A 3BDAA 4NS4A 3O9MA 2WSBA 4OL9A 1C30B 2H1FA 3KVYA 2X1MA 1Y6GA 5KDOA 3BGSA 5KPJA 3JAMA 1CVIA 4IOLA 5FQNA 2ZEJA 4X63A 1W2HA 2G36A 3MZ0A 4NONA 4C1NA 5JYBA 1CRQA 1M2WA 1YMVA 5JD3A 2DGDA 3HYSA 4PN3A 5EWLA 3IALA 4H35A 3BFVA 2QRZA 4LBWA 4KACA 2ZPTX 3HLYA 4Z0PA 2BONA 4FJ0A 2IK8A 1GGMA 1ZIXA 2YFHA 2R1VB 2YYSA 5KREA 1IXYA 1X1SA 2IF2A 3AHFA 2YL2A 5CFPA 2ZDHA 2VTBA 1RI1A 1A4IA 3PUXA 1IXSB 4ZREA 5EZYB 3WRVA 2K2QB 3ZBTA 1TLLA 2W6ID 2ZYUX 4A8JB 3A36A 3L8DA 2I1VB 5ALPA 1R37A 3T0IA 1GLNA 1QYIA 3DR5A 5HK9A 3AJRA 3NYRA 3WYAA 2JKVA 1GN8A 1DDIA 1C5KA 2GM5A 2P4SA 1WZUA 1Y7TA 4YX9A 2CVPA 3L5OA 3RAPR 1YL5A 2WQ7A 1RFLA 2VDLB 3I9FA 2D5LA 1BDMA 4EGSA 1NRIA 5B1DA 4N0QA 4NC9A 3WGYA 3JSXA 5JNVA 1H9AA 1EP9A 1UQRA 1UWVA 2GM3A 3FVQA 1XXHB 1QFXA 2B36A 2WTEA 4KOAA 5DF1A 4L72A 3WKEA 4K9OA 5I9SA 3RYCB 2WTUA 5IRCD 3GRKA 5EFZA 2XVMA 3I2HA 3G9QA 4BCBA 3U31A 2RJOA 4WHMA 3G5UA 1TD9A 4G09A 2RHGB 4AULA 3QKWA 4RGYA 5DN6D 3P4UA 1T8WA 4HDKA 4F9GA 4U3JB 2RK6A 4L4YA 2YS6A 1EIZA 5BOSA 1YRQA 1ZG3A 8LDHA 4OI2A 3SZ3A 3LTEA 1H42A 3GW8A 2ZSKA 4X85A 4EP1A 5BRJA 1W76A 3ICOA 1GL7A 1Y5LA 3CJTA 2PZJA 2ON6A 3QWBA 4JD5A 5JROA 1F6BA 3QMWA 3H86A 4BMYA 3B6JA 3ZU6A 1Z17A 5ALTA 3QIAA 4PR0A 3QEKA 1FTWA 1YASA 5A71A 3RYIA 1Z0IA 1FFWA 5FOXA 3SICE 1N57A 2O4CA 3PC6A 4GSKA 4M0EA 4Y0AA 5CT9A 1B0ZA 4BO2A 1DIAA 2WMOB 1TU4A 4G9GA 4I6EA 2CDCA 3FMGA 1IATA 2R68A 4PFSA 1QTRA 1JHXA 3MS4A 3OIYA 3RV3A 5EJ6A 2ZSFA 3O1HB 1UAYA 3DAOA 1BD4A 2VBGA 3BCSA 5IKOA 5BUCA 2G4CA 4L2IA 1NC3A 1U9IA 2P2NA 3OZWA 4NCXA 4U9UA 1U1FA 4DA0A 2FHPA 4UOEA 1T5OA 3SM3A 4EEXA 2DUNA 3TDNA 5KJ1A 1GCGA 1QUEA 1W9HA 3H0EA 4KO8A 4OHXA 3SIPA 3K2IA 4AI6A 4YDSA 4FMBB 1SU4A 1ML4A 2ZI5A 4YH1A 1H1TA 1H0SA 3BORA 2G67A 2VNIA 4KQIA 1XP5A 4ZI7B 1F4VA 4GQIA 1N1EA 4EGAA 3OTHA 3GEPA 3I28A 5DIZA 4X3CA 2PXAA 1CZHA 3RUAA 4Z4CA 2VDUE 1QF7A 4LE0A 3T7IA 4XD2A 1I94B 5L3SB 2W2KA 4D9BA 3LTNC 3A04A 2BE9A 1NE7A 1O8CA 4U7JA 1TECE 5KC8A 1NOIA 4HADA 5H82A 5JI2E 3U2QA 3INRA 1KGDA 2YFQA 1LI5A 1E2QA 1NN0A 2HDOA 3AUYA 3I58A 3KKQA 5E1MA 6AT1A 1ZL0A 4E1AA 3WVNA 1S89A 2G1UA 3UMVA 1M1NA 4U02A 1HRDA 4FFSA 4E1BA 4HFNA 1Z8HA 4H18A 4J43A 4LJ4A 4AMUA 4D1YA 5KKNB 1GJRA 1ZHOA 2O54A 4PHFA 2FDCA 5E7JA 1ZP6A 2JGRA 1DBSA 5HZKA 1AKQA 5JASA 1CY7A 3EIOA 4CDRA 2AHOA 1AHIA 2YW2A 3OKCA 3TAUA 5CVCA 2A2ZA 2HIHA 4N8SA 3EARA 5LDDC 1BFDA 2DHCA 5BSVA 1U2EA 3MUOA 4UQLA 2QTVA 3V55A 2XCQA 1HFWA 1M8KA 1V2GA 2YIMA 4HTFA 3PBKA 3ZNNA 1UFKA 2DF8A 3GFFA 3D1JA 4OJNA 1CQIB 5B3JC 3P7MA 3O6VA 3U4IA 2YVKA 1SQ0A 1YC2A 3STWA 2AC2A 2HPAA 1NE2A 2P65A 1T0HB 4GBJA 1U8EA 4GOOD 4PVDA 3UWMA 5ARBA 3PRHA 3GPBA 3JU3A 3M6FA 3KWFA 1GPYA 1LRLA 3BGIA 1UWLA 3CUKA 2ZYRA 3C1UA 4IFIA 1JL3A 3KJFA 3NC4A 3FE2A 2JFNA 4XIIA 4PYNA 4YECA 3DVLA 4ITUA 3LO5A 1HDZA 3QHQA 4L73A 2WIAA 5EXDA 5F7OA 3U80A 2RGRA 2OO3A 4K81B 2V7QD 3LQRA 1PT9A 2XKJE 3LIPA 4KXUA 4DL9A 1R88A 2EX4A 1QHNA 1FDWA 3TSYA 2FR8C 2XKAA 3IH5A 1JI3A 4IPTA 4X20B 3KJZA 5JXIA 4D9NA 1WNFA 3KKPA 1Y4UA 3KJNA 2NW6A 3TQRA 2G5GX 2HKIA 5GJCA 2V8BA 3GJXC 4X65B 1MVLA 1K4KA 2ZYDA 5GVRA 1UKAA 2CNWA 3TLXA 4XIGS 3SZGA 2O59A 2AWNA 3UC5A 1XRJA 2H5LA 3KDAA 4TVOA 1G21B 3W2TA 4MCAA 1PU2A 1MC8A 1R27A 2Q6KA 3D8RA 1VMEA 4KGDA 5EN4A 4CHGA 5MFPA 2D0OB 1SC6A 2EOAA 3CCFA 1MHTA 4YN3A 4KIGA 2F1IA 1O03A 5IAJA 1I6KA 1GIAA 3CBQA 3CINA 1KJQA 1OREA 1I30A 3KV1A 1QO0D 4IVNA 5K3EA 1DO8A 4KX3A 3B51X 3RR2A 2PG3A 3JYHA 4BFTA 1DC3A 1M1YB 2AJ8A 4ZMRA 4MR8B 5LD2C 4OYRA 3ZY4A 1USVA 3B3AA 5JCJD 3O4FA 2W11A 2GN9A 5CJPA 3OF3A 3DWGA 3CUEF 5DZSA 3STXA 1X77A 1A96A 4YRNA 4DEXA 2QORA 2HJRA 2FZCA 4P3PA 3OKPA 4UU0A 3U3DA 2ZJ7A 4OI1A 3ADBA 1NTRA 1PJZA 2H8KA 4BKMA 3L7JA 1W6RA 3U39A 1PL0A 4TUYA 3SYTA 3R41A 5C2JB 1NF3A 4AMVA 8ABPA 2XMGA 1QQTA 3GWGA 3DMDA 2Q21A 3BF8A 3MJFA 4EYGA 1NNEA 2Z8ZA 4EZBA 3ICEA 2C4UA 3DMYA 2HMAA 4X0EA 3C3DA 3UHJA 3K8ZA 3CEAA 3OTGA 1I36A 3SKYA 3B1WA 3ESXA 4DHEA 3PNPA 3UYKA 3BICA 3FVWA 2BFNA 4N8DA 5BRAA 4BWVA 4I2NA 4YB8A 4GC9A 4WDQA 2R5NA 2ZBRA 2FEKA 4C6HA 3HEMA 2H0AA 3C3CA 1ONSA 4MWDA 3E5RA 1NRJB 3EZ2A 2JGEA 3FRIA 3OLQA 5AVZA 3KJQA 1KR2A 2JFYA 3IHWA 1WETA 4B6JA 3Q8MA 3AVUA 1CHDA 1QC5B 1YZQA 4TMXA 3V7YA 4M7RA 5AI9A 3EW9A 2FX2A 2O7QA 4XFJA 1BCSA 1Y34E 2HCBA 1RYMA 2QJTA 4PC2A 4DWJA 4M98A 1N6LA 2XDYA 2YJGA 1IY2A 2IY8A 5KWJA 5CCEA 2OBYA 2VYNA 1HSZA 4FOSA 5BVGB 1NI4A 1WLSA 4IF4A 3Q8XB 5HZMA 3NGLA 2P2YA 4P7FA 3A2KA 5EZ5A 3T5BA 4YRMA 1J9EA 1XSEA 3D2CA 2XTZA 3VZRA 4UDNA 2H92A 2KX7A 2A86A 3DFZA 1VZ2A 2KLBA 2VH2A 4IIJF 3D4LA 3UK2A 5C5DA 3FPHA 4R40A 1OTXA 1NNLA 2GX6A 2XA9A 4OQEA 1P9WA 3Q1LA 4IIYA 4O8CA 1PWYE 3QX8A 4Y2HA 1V25A 3Q7QA 1GPKA 2O3UA 2ONYA 1RPNA 3JS5A 3QPVA 2CV2A 3C6BA 1N3LA 3IAM6 3SDZA 3V42A 4AD8A 4LYEA 4MWGA 4BQOA 5REQA 4DMKA 2EW1A 2EG5A 5CUQA 3TKLA 4Z9YA 4H0FA 3U9LA 5IWCA 3JPWA 1GA6A 2O2IA 3OSZA 4CV1A 2P11A 3H2BA 3WBKA 3EF0A 4XVCA 3DCIA 3OZ7A 5B3LA 3AR7A 4LXQA 2HJHA 3GA7A 4R4JA 3K1ZA 3LQYA 4LRTB 4MWOA 4XYEA 4DCCA 2PMCA 3UHFA 4BMXA 1KORA 1QZZA 2VP3A 3COPA 3I9KA 3R3HA 1VBMA 1LBTA 1VIMA 2ZQYA 5JD4A 4NYIR 1R0KA 3DWEX 2IL1A 1G59A 3LSYA 3E84A 2VEDA 5CB6A 3GRFA 1FUIA 1JDBB 4BV9A 4YCBA 1B1CA 4ED9A 3UJ9A 2GZAA 2OXFA 3Q85A 1EWYA 1T8UA 1PWHA 3ZQKA 5K0EA 3CVXA 3QKUA 4QUGA 3WLMA 3BWBA 3AB3A 5AJWA 4PIMA 3F6PA 3A4LA 3NWJA 2CXHA 4R6XA 1LS1A 5LJLA 2QJFA 1JZSA 4BNVA 1A9XB 3H8SA 2X0FA 1FFHA 1Y1PA 5B3KA 2XUZA 3FPLA 2Q4BA 3GRAA 1MIHA 3DL2A 4LCJA 4TYYA 3IEUA 1G3UA 3JWJA 4B6OA 3T7AA 1UMDA 1CR0A 4KQEA 4KMRA 2EX1A 2C2WA 2EYUA 3NPMA 4JJZA 5AI4A 4RNCA 2G8NA 3ROXA 3PQ3A 4ZVPA 3GFTA 3RRXA 3TZLA 3PTAA 4QJ5A 2GN4A 3QXCA 4V0QA 4XIFA 4DUYB 2WJ4A 3U44A 1D5CA 1NGSA 3CIOA 1G8GA 1VGQA 3IGFA 4JKOA 3E1GA 3JVEA 4K8OA 4R1TA 1II9A 1KEEB 3KLBA 1KVTA 2JIMA 2H08A 4DCUA 4EW2A 2YWRA 4PAGA 5TPWB 4DJJA 3QLTA 3HJUA 3AC0A 3WB1A 1HZJA 1NHGA 1N7JA 2WG2A 1AKVA 2RH8A 3UBTA 2CVOA 3BAZA 4I4TA 3AFMA 4NNOA 1VL6A 4WFIA 4Y1RB 4OJKA 4QDZA 5LYJF 2R751 1YE5A 2XDWA 1NATA 3EFBA 2PZAA 2HQSA 3I2IA 4KXLA 2YZNA 5CM9C 4DJDC 2KI5A 3QYAA 4H4DA 3HYTA 3HVRA 1AA9A 2G77B 2Z4SA 1OYOA 4OP3A 5FTLA 5K3FA 3LWZA 1KOLA 4CU2A 5BVHA 2VJOA 3ZCTA 3VHLB 3Q87B 1ZICA 1Q6ZA 2DM6A 4BEBA 1G20E 1HGXA 3TJMA 4JXXA 3EH1A 4QZVA 1TDJA 1PX0A 2FRDA 3FSJX 3W5SA 5FWNA 4EVQA 2PJRA 4DEVA 2PANA 2YY5A 3TG8A 1A5ZA 2W2QA 1EG7A 1LPMA 1G3MA 1VHWA 1XVAA 2JFOA 3PQ6A 1PLJA 1DNPA 1P0PA 5JARA 1JGTA 4WQMA 1C1XB 2YBDA 1AF4A 3X3HA 1NDUA 2QVCA 4IDHA 6CHYA 4FNOA 3CS3A 1CR4A 2BTOA 1KK0A 2ZZKA 3BXZA 4ND6A 3E27A 1OZHA 5KYUA 1VPLA 4BNDB 1JLSA 2JCBA 4JZKA 3KKLA 4ND2A 4MV6A 3WJ1A 2XKKA 2KWIA 3P52A 2Z57A 5IVIA 4BRZA 4IJ5A 3ZDCA 2O5CA 3WMXA 1DTWA 5LA6F 2Z83A 2G72A 1NC1A 2ZIWB 3DFFA 4YRQA 4DV1B 1EGMB 2H4YA 4CF4A 2I80A 3OZFA 2L18A 1WXFA 5ALDA 3QLJA 3DKVA 2JG3A 3CUTA 3WB2A 1HLPA 1OXXK 4PO3X 4B1FA 1RE1A 4C0BA 3SR4A 3PIRA 1U8ZA 4PXYA 5H1YA 1IM5A 2VG8A 1E2MA 1RZVA 2M6RA 3ER6A 1QFZA 2N47A 2QN3A 3Q40A 5DGDA 2H9YA 5G02A 4MVXA 5EG5A 4D56A 3LRXA 4BFCA 2F62A 1WY7A 2CMHA 4QODA 4S1WA 3I72A 3V8BA 1FNNA 3IE0A 1YGPA 1DG3A 2XCIA 2CHVA 3CO5A 3FTPA 5E4FA 3Q9SA 3DD1A 2HRCA 3DTVD 4QATA 5L7TA 5LXTA 4V38A 3L1VA 1Q12A 5T64A 3FYUB 4HWOA 5DHUA 3WJAA 1M2OB 1RIIA 3T1YB 4KN9S 4Q9JA 2O3TA 4P4SA 4CCYA 1CJBA 1W0CA 4GMXA 3ZNOA 1E2FA 4D8TA 3O2QB 3MMZA 3EB9A 4YGXB 3UANA 1XNQB 1KP9A 1E8DA 4Q9NA 1IN7A 1UFRA 4UMFA 5E9WA 1CE8B 1W5TA 2WUEA 2H3HA 2QXYA 4MIKA 4B44A 2AT1A 1P1HA 3H0KA 3OVMA 3R6TA 4KLNA 4R8RA 5JNLA 5TNXA 2ZYHA 1F06A 2IPMA 3GN1A 4FGUA 4M6WB 3H1PA 4O4JB 2QPOA 4I1YA 4Q9AA 5CEFA 1K9VF 5TMPA 3H2GA 5CIQA 1S2GA 1NW3A 2QD2A 3HDHA 4OBWA 4WUTA 3DNMA 2WIDA 1JQ5A 2NU9A 3ZU2A 1TEHA 2H8GA 3FM9A 3DEZA 2PLRA 2VRCD 1H4VB 5AD1A 4ZANA 1QFMA 5GOZA 4DSZA 3M2TA 4N5HX 2CSXA 1Q7TA 1PKEA 1CQXA 2HA5A 3SU8A 1VCHA 4WKCA 2ZYAA 1OH5A 4IS2A 4TT8A 5DM4A 5JDCC 5CVTA 1M8FA 1L7PA 2OV2A 2WT4A 1CY0A 3I1IA 4P3OA 4M49A 3B20A 4OMFG 1DDGA 1P0CA 2AJLI 2F67A 3E35A 1KAEA 1NA5A 1PFYA 2JCVA 3RT1A 1NPTO 1ODFA 4ZVNA 1DBRA 4BU1A 5ECGC 1QKJA 4JEUA 2Z4RA 3KELA 3VZDA 3EAFA 2IX3A 2WWFA 4KGVA 1YIDA 2CVZA 4N3AA 2EFDB 3MTEA 4YP9A 5TMEA 2XVAA 5A3RA 3GDHA 5C5IA 4J7UA 1BDHA 3BRWD 2HSGA 3PNBA 4Q1CA 3A4VA 4FMPA 1KI2A 4FMCB 2XX3A 1AM4D 5E1BA 2YN4A 4P33A 5EUQB 3CG4A 3DGFC 4RYDA 3VDMA 5A0TA 5J59A 1GU7A 3THWB 2GZHA 1V11B 1HLGA 3PT5A 3P4YA 3ZZMA 5ICCA 2AOTB 2MR5A 4GNRA 2VPWA 4OYLA 1XMQB 2C9ZA 4LMRA 1O94A 4ZT2A 3ZWYA 2AJTA 3Q5DA 2GAAA 2WYVA 2PMFA 2ZXEA 3DBVO 4LE2A 1E18A 3Q5GA 3L8YA 4NCKA 1GP2A 3IQZA 2MYPA 5KOHB 4D81A 1C1DA 2IBSA 1DAIA 3TG2A 1E9VA 3EDMA 3GJ4A 4PX5A 2JLQA 3MXTA 3W4JA 4S12A 2YYAA 5KNBH 2POQX 4DBZA 4RPHA 3FTNA 3E4CA 4LJ6A 4WNAA 1N6HA 4JEMA 1ISRA 5IKMA 1VMDA 5LQAA 1S3GA 3O9ZA 2ZBUA 5EOVA 3F1LA 3DE6X 3I01A 1YR1A 3JD2A 4PG6A 3GUUA 5ECYA 4FNGA 1XEAA 3UENA 4HGPA 4FGSA 1R0SA 2NO1A 2QK4A 1W85A 3SNHA 4IXWA 1FUYB 3SF0A 1WP4A 5FWYA 1SA0A 4YCDA 1IZZA 1C80A 1IRXA 4U8HA 4TQUS 3VU9A 5ILQA 1RWWA 1ZN7A 3R3ZA 3N7AA 3SD7A 5JCZA 3MJ4A 4KPYA 1GSHA 1TZCA 2J5RA 2V45A 4A0SA 3ZDEA 2ZRAA 1MMFB 3ZR4B 1JDNA 3GLIB 1JPVA 4Z1OA 4FFBB 2VZ8A 1MVOA 3IVCA 2P6RA 1P33A 2I6UA 2W48A 1G6OA 1UFQA 3KO8A 2JBAA 3HVIA 2X6TA 4BP9A 1FX1A 2P9GA 1YBVA 3NRJA 1I1OA 3D3NA 3QEJA 5EHQA 4CEJB 1P2DA 1ZIDA 4G8DA 3V2UA 4UHFA 1R64A 1HI9A 4FQ5A 5D6OA 1FYXA 3H8VA 3BKWA 1B43A 2GBCA 3VYRB 1H9BA 4E2ZA 3AJAA 3PUIA 4D2IA 1XLVA 4MIOA 1G8SA 4EW6A 4BB6A 5CLFA 1EFVA 1YU6A 1YR9A 4ID9A 3OJFA 4UNNA 4ZXPA 5FR1A 1JHQA 4XD7D 5BQPA 3TXYA 2F3SA 3KUKA 4CQLA 2DPGA 1M7GA 3CZAA 1GPUA 3ET4A 1PV2A 2DPLA 2J6CA 3JRNA 1V6CA 3CX8A 4C4PA 4A8HA 5I4BA 5DBHX 3S2GA 3TEJA 1NXXA 3DTVB 5D1HA 4DABA 2Q2QA 2PKYX 2H2AA 4BKOA 2QTTA 2JF0A 5AM4A 2PZ8A 3OCUA 1JMKC 1OI4A 1I7DA 1OAAA 2FOXA 3WADA 4R1QA 1G5TA 4XCQA 1P9RA 4O08A 2L69A 3MYYA 3IO3A 1NI3A 2WA2A 2N42A 4MX8A 1P0MA 3HP7A 5DB4A 3R8CA 2XUKA 3RIYA 3RNLA 3V2GA 2NYVA 4L51A 1E6CA 2ZS7A 3G79A 3IP5A 1UK9A 3BS4A 2OECA 5JBIA 3QV2A 2Q1YA 1JAZA 4PIPA 4ADSG 1IBLB 1EVLA 4XXHA 2YWBA 1UPTA 2WJPA 4HDSB 4HZGA 1AK2A 2WWTA 3IEXA 1M9NA 2BTQA 4MUMA 5B37A 2B9VA 1Q1QA 4HN9A 2IHVA 4EIWA 5DBFA 3EVEA 2R85A 5ALRA 4DIFA 1P1KA 3OLYA 3ZJTA 3B85A 3DDHA 3QVGA 3K31A 4HWTA 1RWQA 1ZHFA 7REQA 1KMQA 4KXNA 1Z3CA 2O2GA 2AZ4A 3HXKA 3SQOA 1OE0A 1ZIOA 3PD1A 4V39A 2WB2A 2UYCA 5FEMA 1OILA 5LUAA 3PX3A 2M6SA 4S05A 1FVXA 2WIFA 3HCEA 4IRUB 5IBQA 1RXEA 4QTZA 1PBTA 2WNHA 4OK3A 1H22A 4AY4A 4QXPA 2QG4A 2PQ2A 2IYVA 3PJDA 4U1RA 2VDWB 3DE3X 3IHLA 3QWFA 5ESWA 3O1LA 3L41A 3MLBA 4G8CA 3W3AH 1NJ6A 3KSBC 4DSNA 4DRYA 1QM5A 3QZUA 4JI3B 1XTKA 2F00A 3CMCO 4N8EA 1NF2A 2VXOA 4JB2A 4ZDJA 3PRJA 3W8DA 1EVEA 5BV2P 1D0IA 4HL6A 3W8EA 2M9MA 2PUGA 1N8TA 2FEWB 1PAUA 5J2TA 3JQ8B 2C8KA 1YKGA 3MXOA 5DLPA 3L8MA 2FPPA 4PZUA 3OQIA 4RS4A 5JSQA 1ZKDA 4I6JA 1IXRC 2J3QA 2JAPA 3NBKA 1ZVQA 3O21A 1XD2B 3TQTA 3BYZA 3ZG6A 1VG0B 4A2WA 4EG4A 1YBHA 4O4HB 4EUHA 4OXKA 4PZCA 2UYYA 4L6IA 1QU3A 3AEXA 1FQKA 1JVNA 1WMBA 3EXFB 4LJ7A 4KYVA 4MIYA 2J46A 2E4YA 4J9VA 1OH7A 2JJQA 3DMFA 3DG9A 3UKDA 4HQFA 3FLBA 4IXTA 4F6RB 2CV0A 3JYQA 1I3CA 5CLHA 1LNSA 2AVNA 2V8OA 3SWWA 4HX9A 3L18A 2H00A 4FVTA 3H5LA 3KFVA 1JWAB 4JMPA 3KD3A 4OBBA 2MYTA 2W0SA 4P7JA 3ZUGA 4F7DA 1U2DC 1JIKA 2ZE7A 4PNZA 1BE1A 1S0UA 4OBXA 2PUTA 1A9TA 4L6CA 5AHXA 3T34A 4MYHA 1N0UA 1RWPA 4YCCA 3KLOA 4TYWA 1U0OC 2IELA 3MTAA 2Q4RA 4AECA 4CUJA 4ZCMA 1U8FO 5DLQC 1X1AA 2XAAA 3T8YA 5YASA 4WE3A 5FO0A 5CDFE 1VPDA 3VI3B 1EXDA 1ZW6A 2P2GA 4O2LA 1WABA 2X14A 1GL3A 3C7KA 3N28A 3SFZA 1H8ED 2IHKA 2QMQA 2RGCA 3TCXB 1DT5A 4EFDA 1SIWA 3C8MA 5B58C 1Z6AA 1U5BB 5FQOA 3T1QA 4JI7B 1BE6A 2NQTA 1F5NA 2RGDA 2PLWA 3DEHA 2RKOA 1QNLA 1CQJA 3HWX1 3ILVA 3OT1A 4RU1A 4WCFC 1CY6A 1ZMBA 3HFGA 5A7GA 2NVUB 4BNHA 4BAZA 1ZK3A 2QZ9A 3C48A 4XM1A 1JA1A 5J1SB 3MT0A 4FWTA 4TL6A 2WHYA 3QIVA 1C3XA 1S2DA 4MDHA 4Q66C 1UJBA 1WXQA 4UCQA 4AWXA 4CT5A 2IP2A 4MWTA 4MINA 4DT1B 5LJIA 4CNQA 2EKZA 5BSMA 1CZNA 3IAM1 3PNQA 1NXWA 1OFUX 2REOA 1NW7A 2VHVA 1EWKA 2XTNA 1FSFA 2X6QA 1UPAA 4RVCA 5EINA 4Z7JA 2IH4A 2DLDA 1U4OA 1VM6A 2CL5A 2GZMA 2BHTA 2YRWA 5GPBA 1SXJB 3TLEA 1XAGA 4QT0A 4OI4A 2BHNA 3IQGX 4A27A 4A8PA 1S1MA 2RONA 3NYWA 1VJ1A 3PGA1 2GN2A 1VSQA 4ZVSA 3UHPA 4J0GA 1NBHA 1E1CB 1NWCA 2Y6VA 2CXUA 2RHJA 4TTJA 1PO7A 4HGOA 2BFFA 3ZDFA 4CKEB 5IS2A 3IODA 2G7ZA 2MSWA 3LBNA 3LHKA 4KPUB 4ZJUA 1AQYA 4Z7QB 3R75A 5FPTA 1LLCA 3AVTA 3FPJA 3TFWA 1WEHA 2OVFA 1LQUA 1X74A 3EMDA 3M49A 4O2RA 3WNZA 1QVAA 5LQKA 5FPKA 2H63A 1R1DA 3DVSX 1KNQA 1R5JA 1OXBB 1Z28A 1Y9DA 3BOSA 3OESA 4QUDA 1UBOS 3RHTA 3QX3A 1EBBA 1EZ1A 4ZQGA 4PHHA 4NDZA 4LF4B 4E31A 4YUAA 3OZAA 3UGTA 4RY8A 4V1CA 3B53X 4WOPA 4ZJYA 2VNKA 3P2OA 4FR2A 4KLZA 4ODIA 4A6DA 3Q6IA 4ZDIA 3UUFA 1DGQA 1EU1A 1ZPDA 2C4HA 3CC8A 3USES 5AIAA 1K7FB 1XF9A 4DNPA 2L0XA 3FF1A 2HU5A 4QEZA 5FPPA 2ODNA 1Y3BE 2GPJA 3B9RA 1GUYA 1IHPA 2IOFK 3NONA 2AZXA 2PR7A 5BMVB 4FX2A 4LGYA 2RGUA 3O8QB 1J25A 3V9PA 1ZGAA 2C2HA 3E9MA 3OP4A 4JXJA 1QYWA 4KU4A 1P18A 2G80A 3E8SA 3ABSB 1FU7A 4KXVA 2QAGB 3UHOA 2ZJ4A 4HEJA 3ECCA 3KXIA 3IOCA 3ZW9A 4LYJA 4XJXA 2C94A 3OEWA 4IDAA 2R3SA 4PXSA 1H2WA 4WGGA 3N5KA 3ZGYA 4ETNA 3U7QA 2JHPA 1VHQA 2QKYA 5IDVA 1REQB 4WLOA 4N6OA 2FFJA 2ZUTA 3BCRA 3TCNA 4E22A 4WOKA 2JD2A 4C01A 4PC3A 1B74A 4NP6A 1GZ7A 3UB4A 5CA0B 3VTFA 1NBME 3P27A 5IZ4A 3F1KA 3U1BA 1GL9B 4AM8A 2BLNA 3OA0A 2B5OA 4A6EA 3EQ8A 3B3FA 4MV1A 4QGAA 5D3MB 3VOAA 5JW6A 3EMVA 3VR2D 4EG8A 4QOIA 5CXUA 1TTPB 3VTZA 4B31A 4Z5XA 1YTLA 3T0GA 5JHHB 3DLBA 4COOA 4C3UA 3LUDA 4L22A 2PUFA 1U7OA 5KNCH 1KBQA 3I9NA 3QJYA 4H2DA 4N47A 3LVFO 2AEMA 4HLUA 1ZQ1A 3FMFA 3HJAA 4RMHA 2BGRA 1Z0FA 1WJGA 3AYZB 4TS3A 2RH4A 4W7SA 4IG9A 5IFKA 1ZSVA 1WKCA 3DBLA 1E3SA 5IC6A 5CLGA 1E6EA 2B30A 5TB5A 3KB1A 2CCGA 4Y9RA 1L1QA 4QBIA 1PGPA 3ZS8A 1JQJC 1VE7A 7MHTA 5JC8A 1VJTA 4G0ZA 1WXEA 5EXXA 5JAZA 4H6XA 1TPZA 2BHSA 4H08A 1C50A 4HLQB 4MJ7A 3HXOA 4YUZA 1VHJA 4OFBA 2VYFA 1FMTA 4UPVA 2EZ4A 3UQZA 1IHXA 3TQQA 3JXEA 4ZV4A 2AC7A 1MB0A 4MUXA 1QH1B 3VDXA 1G3IA 3WHIA 2FTKE 3C7TA 3LM8A 1SKBA 1EFRA 4PQGA 1JQDA 1U3CA 3L84A 5BSFA 2RK4A 4OI0A 4YV2A 1BJKA 4RQAA 2MSNA 1QP4A 1E2EA 4LIPD 1OV6A 2D1RA 2QL9A 1JXOA 2V7EA 3S1AB 4NSNA 4K6HA 2VHZA 2W4QA 3JQ7B 3EAGA 1K89A 5C18A 4UDYX 4NIMA 5GP1A 4B4DA 3GJ6A 2IJGX 2B6NA 4C0LA 4IGAA 3MWEA 3RSHA 3FD8A 4NU0A 1YOVB 1NKTA 3G1WA 5KZMB 2QB5A 1KEZA 3QX9A 2JD0A 4C88A 3CKLA 1QRRA 3DS8A 4F9TA 3I37X 4RJJA 2DT8A 3Q7IA 3TM5A 3V1MA 3PITA 2FCRA 3WR5A 1SZJG 2JGJA 4CMHA 4N0MA 2XD4A 5IF3A 1MEEA 1YVDA 1Z5UA 2CFSA 3FVTA 3KS9A 3I6BA 1EEXB 3OC6A 2C2YA 3C5WP 4PYMA 1FYFA 4LSGA 4RX1A 2HJ9A 3TQFA 3P8ZA 1C9DB 1KYVA 1PS9A 1Z68A 3ASUA 3ELDA 3GEGA 3SVZA 2PBZA 3QUAA 4FOOA 1FDUA 4FYHA 4BMSA 3CWZA 4BNYA 4ZK6A 3LCMA 4X94A 1ADCA 2Q3BA 3PF8A 1G4HA 3I8XA 3HGMA 2PYZA 1JEQB 4RGVA 1B93A 4N3NA 2D5IA 2IXTA 2O57A 2RDMA 5DISB 1L1RA 1DQZA 4LOAA 3TTXA 2DFPA 3HBNA 4F86A 1H3EA 1T3HA 5L95A 2C5LA 4JK3A 4TGLA 2BL4A 4WBNB 1B0UA 2AC4A 1APBA 1ZRSA 4YTEA 5E8RA 2BCGY 1J0AA 5ALWA 4ZGGA 1E5QA 1I7LA 1FX0B 3L79A 4RMIA 4TL7A 3UFXB 1VKJA 4C0WA 1RPJA 3LAWA 4FOLA 4BASA 4KQMA 3MAAC 3L01A 3OTOB 5FL7A 2F3PA 3DW1X 4Q18A 2J9GA 5J2UB 3TRFA 2YKGA 3EUFA 3RTAA 1Z6QA 3TZ6A 3MWDA 1OC4A 2OCGA 2ZB2A 4R1SA 4RTQA 4ESOA 2E0IA 1IVNA 2Q2OA 3GZNA 2NXNA 3HWRA 4I4CA 4QBTA 1R6AA 1B8PA 5DPMA 1VA5A 3TLJA 3M33A 2FF7A 1BQ4A 3L7OA 4CIBA 1GKYA 1N92A 2WWIA 1X6VA 4FUQA 2N9UA 1IPEA 1NJFA 1UT5A 4RH3A 1UMKA 2YJZA 1JHDA 4UDOA 5DJ5A 3W7BA 2NV2B 1E2IA 1N2BA 3V4RA 5T5QA 1ZL2A 3CLVA 3VR3A 2WSSD 4OGWA 4B2PA 4ZHQB 4O4LA 2OT3B 2A5JA