3FZQA

Crystal structure of putative haloacid dehalogenase-like hydrolase (yp_001086940.1) from clostridium difficile 630 at 2.10 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
271
structure length
271
Chain Sequence
b'LYKLLILDIDGTLRDEVYGIPESAKHAIRLCQKNHCSVVICTGRSMGTIQDDVLSLGVDGYIAGGGNYIQYHGELLYNQSFNQRLIKEVVCLLKKREVAFSIESQEKVFMNQKAKEIFETMNQLKGTNSCINKQHIQEKITYENNIEEYKSQDIHKICLWSNEKVFDEVKDILQDKMELAQRDISSQYYEIIQKDFHKGKAIKRLQERLGVTQKETICFGDGQNDIVMFQASDVTIAMKNSHQQLKDIATSICEDIFDNGIYKELKRRNII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
molecule tags Hydrolase
source organism Clostridium difficile
publication title Crystal structure of putative haloacid dehalogenase-like hydrolase (YP_001086940.1) from Clostridium difficile 630 at 2.10 A resolution
rcsb
total genus 97
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3fzqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fzqA01
5ALKA 1XVIA 5AI0A 2GFHA 1ZD3A 5AKYA 4AS3A 4UW9A 4HYTA 1VJRA 2NO5A 3QU9A 5AKIA 3B9BA 3ZVLA 5AVVA 3L5KA 2PQ0A 2B1RA 2FPWA 3OPXA 4OD0A 1ZD2P 5AM3A 2HDOA 4IG4A 2EAUA 1CQZA 3WK6A 4KNVA 4Y2JA 4C4SA 3ZI4A 3FZQA 4NAVA 1ZJJA 5AVRA 2G09A 5AVQA 2FPXA 4BEWA 4BX3A 3I76A 4UU0A 5ALRA 3AR6A 5ALHA 3EF0A 1ZRNA 2CN1A 4Y2SA 2B0CA 4DW8A 1Z5GA 3SD7A 5ALJA 3WK4A 3AR3A 3NUQA 3A1DA 3U7FB 5AESA 2Q5EA 2G1AA 5AKJA 3K1ZA 5ALDA 4OCZA 2W11A 2B30A 2WF7A 4KX5A 3PDWA 4XPZA 1Z4OA 4Y2PA 5ALQA 3RFUA 1O08A 2ZG6A 2QYHA 1VFPA 4YGYA 2G07A 1Z4QA 3MPOA 1MH9A 1RMQA 1RQNA 3U7HB 5A3RA 5ALPA 3B8EA 3MC1A 1O03A 2O9JA 4BKMA 4UMEA 1L8OA 3BWVA 3UMCA 3ZWDA 2ZOSA 4L6CA 2R8YA 1U7OA 4YCMA 4L57A 2YJ3A 2W43A 4HGRA 3KZXA 3FPSA 1YMQA 3ESRA 3QU5A 4UAUA 1LVHA 5AW3A 1YNSA 1RKQA 3ZTWA 3W5AA 2FUEA 5AM1A 1RC8A 2RARA 3WKCA 3W5BA 4EELA 5AW2A 3M1YA 3R4CA 5AK4A 3L0CA 1Q91A 5JJBA 4AP9A 4MUMA 1WPGA 2G08A 5AI6A 4JDPA 1AQ6A 2I33A 2HHLA 3PGVA 3QXGA 1Z4MA 2VKQA 3ZU6A 5AKHA 5ALEA 2FPUA 4BX0A 1KYTA 5AVYA 1SU4A 2HCFA 3ZW7A 2JAOA 2GO7A 1Z4IA 3HYCA 3ZX5A 3QU7A 4YCNA 3WKEA 1Z5UA 3EPRA 1TJ3A 1TJ4A 4Y2TA 5AW1A 3N28A 5IT4A 2AUTA 1YJ5A 5AK3A 2PR7A 1NNLA 2R8XA 2RBKA 2YMLA 3U7GA 2IOFK 2ZBDA 2JAUA 2JAWA 1WVIA 3KBBA 5ALWA 3DAOA 5AK6A 3SKXA 2X4DA 1F5SA 3R9KA 1VJ5A 2IA5A 3HLTA 5ALYA 2R8EA 1U02A 3ET4A 3WKDA 4UASA 3IB6A 4YCLA 2YN4A 2P69A 2HF7A 2OM6A 4UU1A 4QJBA 3AR9A 2RAVA 5AKKA 2JGAA 1NF2A 3ZWKA 5AIAA 1L8LA 2NO4A 5AVZA 4C4RA 4BEVA 4F72A 3AR2A 4EENA 3ZTYA 1RMTA 4EX7A 3OCVA 2IYEA 4IFTA 3UM9A 3P96A 4HGQA 1RDFA 3L8FA 3DNPA 3OCXA 4DWOA 5ALVA 3N07A 2WF9A 1FEZA 5ALXA 3FVVA 3I28A 3QUQA 2EATA 3NIWA 3QNMA 2FDRA 4KN8A 2O2XA 4UARA 1YS9A 2OYCA 1S2OA 1JUDA 1S8OA 3EWIA 1Z4LA 1XP5A 3OTQA 3W5DA 2YMQA 3U7EB 3WK9A 5A3QA 3N8GA 3WKBA 5ALIA 1L7MA 3F9RA 2FPRA 2IOHA 1Z4JA 3UMBA 1U2SA 2BY4A 3ZVNA 4C4TA 1Z4KA 2WHEA 3SLRA 4BYGA 3QLEA 3SMVA 4Y2YA 1XPJA 2G06A 3L8HA 1TA0A 1ZD4A 2EARA 4ZEWA 4DFDA 2MU1A 3D6JA 4MWOA 3A1CA 4UM7A 1L7PA 5AM0A 4CNQA 3TLMA 3E8MA 3I1YA 5AW6A 2G80A 1SWWA 5ALTA 1TE2A 5A3SA 2C8KA 3DV9A 3S6JA 2Q4RA 5AW0A 2I54A 3A1EA 4OHFA 2YBDA 3CNHA 3I6BA 3WK8A 3NRJA 1L6RA 2CFTA 3ED5A 4Y2QA 1RLOA 5AM2A 4XQ0A 4OFZA 1Z4NA 4HGNA 1TJ5A 2B8EA 1QQ6A 3KOOA 3AR7A 2ODAA 3OCZA 4GXTA 3ONNA 4NABA 3U26A 5AW4A 2AH5A 2HSZA 3GYGA 4I9FA 3L1UA 3WK5A 5AVWA 3E84A 5ALLA 4G63A 3A3YA 1L7NA 3NALA 5AKZA 1QH9A 2FEAA 1CR6A 2P27A 2JARA 3KC2A 1RLMA 3B9RA 4H1WA 1EK1A 3OCUA 4JB3A 4FE3A 2HEGA 1U7PA 4ZEXA 4BBJA 2HI0A 3N1UA 3E58A 4KNWA 5AM4A 3QX7A 1RRCA 5AKEA 2I7DA 2GHQA 5AI9A 4Y2RA 5IS2A 2GMWA 5ALSA 3L8GA 5AM5A 5AW8A 5T41A 5AW5A 2WFAA 4CF4A 1WZCA 4CE6A 1RKUA 4F71A 4HGOA 2YJ5A 3L8EA 1RMYA 2CFSA 3U19A 4Y3UA 3ZX4A 5AVTA 5ALZA 4Y2VA 3UMGA 2BDEA 2WF6A 1J97A 1SWVA 5AI5A 2G0AA 3U13A 2I34A 3QGMA 3ZVMA 2ZBEA 4NV0A 1J8DA 4CF5A 1T5TA 2WF5A 5AW7A 2YJ4A 3QU4A 1K1EA 1QYIA 2P11A 4BX2A 2CFRA 1YV9A 1U2TA 2YY6A 5AVXA 3AR8A 4HGPA 2AGVA 4EX6A 1NRWA 2YMPA 4UAVA 3BA6A 1EK2A 1RKVA 3OCYA 4ZEVA 2NYVA 2C88A 2WM8A 4NWIA 1QQ7A 2DQSA 4FFDA 5AVUA 2P9JA 1L7OA 2HX1A 3FGOA 2B82A 4KX3A 2RB5A 5AI8A 1ZD5A 4BNDB 5AKLA 1WR8A 3ZUPA 3KD3A 4CF3A 3NASA 3MN1A 4B6JA 5AK5A 5AKGA 2YFYA 4G9BA 4O8CA 3WGVA 1RLTA 1LTQA 3MMZA 1YDFA 1T9ZA 3SF0A 5ALFA 2D2VA 2I55A 4EZEA 5FP0A 1IWOA 2HOQA 4NFLA 3R09A 5AW9A 4Y2UA 1Z88A 4QQFA 2ZBGA 3OCWA 2R8ZA 4UATA 2ZXEA 5AI4A 4E88A 3QUCA 4RETA 3IRUA 5ALMA 4UM5A 2W4MA 1X42A 2BDUA 3WK7A 1Y8AA 4HAIA 2Q4TA 3J7TA 1N9KA 4PNHA 3IJ5A 3L7YA 3VAYA 4XOUA 1RQLA 3SHQA 5AICA 4J2TA 5IT0A 2B1QA 1ZOLA 4YIKA 5ALGA 2QLTA 2ZBFA 1PW5A 4L6AA 5AHXA 1ZRMA 4J03A 3PGLA 3WGUA 2YMMA 3L0YA 4XE5A 2C8LA 4YH1A 5AKXA 5AIBA 5E0OA 4BNDA 5ALUA 1Z4PX 2MSNA 3FPBA 5ALNA 2C4NA 2I6XA 2OBBA 4UMDA 3ET5A 3RF6A 5ALOA 4AS2A 1N8NA 3NANA 4EEKA 2HO4A 3SKYA 3FM9A 3QUTA 4UMVA 2FPSA 2IOFA 2WF8A 3L0BA 3M9LA 2FI1A 2C9MA 3AR4A 4DCCA 4Y2XA 4RESA 4KYTA 3E81A 1RPZA 3ESQA 2YJ6A 3PCTA 1QQ5A 3N5KA 2FUCA 3L1VA 2HF2A 3EF1A 4GIBA 3QU2A 3KDPA 3QUBA 5AVSA 1T5SA 2B8JA 4I9GA 2GHTA 3DDHA 2PKEA 4FYPA 2OA0A 1ZS9A 3AR5A 2AMYA 4UMFA 3WKAA 3CZ4A 1Q92A 3NAMA 3QYPA 4YIHA 3W5CA
chains in the Genus database with same CATH superfamily
2AKAB 3E8XA 4UOEA 3LL7A 2YZNA 2JH8A 4RTKA 4PS1A 1E1QD 4GI7A 3REOA 1DUVG 4QYTA 1DV2A 1WMBA 1GFWA 3DVQX 4O0MA 4B6RA 3UCXA 1E8NA 1GZ3A 5AFSA 1YBMA 3VYWA 3LUBA 4O3MA 2FMKA 1AXRA 4JSRA 3VAAA 5AVVA 1NYQA 2ZYAA 1AGRA 1PJAA 4HQOA 4P1ZA 4OD0A 2IXFA 3ZWCA 1DIHA 1Y98A 1H2BA 1KZYC 2IDKA 2IHJA 3R5HA 2PKYX 3MWYW 2DTDA 3GCWA 4HYYA 1GQYA 4CGYA 3MWEB 4YAWA 1SKMA 5C81A 2RH8A 4TWZA 3VTAA 4N76A 1QK4A 5AVRA 1VHWA 3TDMA 2HRBA 3AESB 2FPXA 3CF2A 4M99A 1V3QE 3AF3A 4X1IA 3KPWA 2Q4BA 4BX3A 4Z8YA 3HB7A 3D3JA 3NIDB 1RXWA 2J5BA 3HU5A 1D4ZA 3OLWA 3DD1A 1Q0SA 2WZDA 2PLWA 2BFCB 1DELA 1G5PA 2XX3A 3PU6A 5LLTA 1PJQA 1F6DA 1NR7A 4C07A 3SD7A 2ONCA 2Z4RA 4GMGA 5HBRA 2OM2A 4NKRA 3QENA 5JZOA 2QTMA 3GLIB 3S1AA 5K6AA 3PNBA 2Q5EA 5LZ4A 4HMPA 3ND7A 3HBNA 1T8YA 5JPCA 1TD1A 1C4KA 2IPMA 3OICA 2JK0A 2XSZA 1SMKA 3PR3A 4XD7A 1E1LA 3VDMA 4BWFB 3HR4A 3PXXA 3MWLA 1CRLA 1E6LA 2QB5A 3DO6A 1BH6A 5CVDA 4AJJA 4CXMA 5ALQA 4I5DA 3FUCA 3PPWA 3D1LA 4X20A 5BSMA 4C5CA 3M7IA 1E5DA 3ETHA 4JROA 4M0DA 2Y77A 1A1VA 4U2DA 1JHAA 1BKDR 1VXRA 2DPHA 2FPKA 2H4ZA 1U0HC 1CP2A 2R47A 3FUWA 3HM2A 3JQAB 2IU0A 3CFYA 4RTRA 1MH9A 1YZLA 4FGUA 1FMCA 1O54A 4HXGA 1QG4A 4LWOA 5IDVA 3STVA 3EXHC 1WB5A 4O6VA 3MJFA 1YAJA 2YN2A 2IHUA 1J42A 1PT9A 2X4LA 3E3AA 1J1ZA 3GA0A 5EFZA 3BXGA 3DFKA 3WRYC 4V1CA 3HU3A 1TCVA 3PIDA 3EVBA 1AHNA 1DXYA 4G67A 2A9VA 2LXNA 2GASA 4ZI3A 1VKNA 1YMQA 2F9FA 1LBSA 13PKA 3HUTA 3ZKWB 1HT3A 1T4GA 4FNGA 1SVIA 1ISMA 1NASA 1W5FA 4BFTA 1EP2B 4NXMB 1HRDA 2ZRKA 1TM5E 1QH8A 3NETA 1RP1A 1L9KA 1VSTA 4XCVA 3BRCA 4M9RA 3K9CA 2XGJA 4EELA 2GAJA 3PXDA 3M1YA 1SOUA 3IBSA 4L0MA 5JSZB 1QCDA 2BUCA 4O4LA 5IPFA 1TI7A 3WQQA 1G20B 3FNQA 3TFQA 2ZRFA 4INZA 4JKYA 4E1VA 4JVLA 5FOVA 3LIPA 1KL7A 1GXSA 1E4VA 1K6MA 1N6OA 4LW8A 1B26A 3MMSA 4CBVA 2O8CA 4EJSA 2DLDA 4K3UA 4V3BA 3JWGA 1UQRA 2FPUA 1EJ0A 1KYTA 3H84A 4N0EA 4RGVA 3ZW7A 4D56A 1MQ8B 3OOWA 2XCIA 2D54A 5TY0A 1LPOA 1G18A 4ERNA 4QJ5A 2FN4A 3EGDA 1FYXA 3Q6MA 1MRNA 1RRPA 1UP6A 2DHDA 5SY4A 3TO5A 2HJGA 2WYWA 3I6QA 1OA1A 3EPRA 1WDTA 3K96A 1TJ3A 3B1XA 3CH6A 4AULA 2PXHA 2R7LA 2V3WA 3GAFA 3MD9A 5IT4A 4R7ZA 2HLDA 4E3WA 1ZN7A 3QPCA 4KH1A 2XRFA 3HXKA 3TQIA 4B74A 2WIBA 5BYBA 1XZHA 4I1UA 4B31A 3WYFA 2OZKA 3N05A 2IHTA 2QN3A 4EPVA 2J85A 4QQNA 5B3JA 2GYYA 4PLVA 1TIKA 3PSAA 2LCFA 4FKBA 5REQA 5CVVA 4AZWA 3HLTA 4CR6A 3T3OA 3ILYA 1QIKA 2R8EA 2H7CA 4IDFA 1AY0A 3WFIA 3WKDA 1VMAA 5HQ3B 4CTMA 2X3FA 1HL7A 2J41A 2Y3IA 3B36A 4ZDIA 1XMVA 3IX7A 4KCGA 3HXQA 3L5OA 3AR9A 4EGQA 2ADMA 3NVDA 5KBYA 1QGUB 1T9KA 3ZWKA 1CUCA 2OHGA 1P1BA 1QO0A 4CKYA 3HFRA 1HUQA 5KNBH 2XUZA 2I1QA 1F2TB 3BD6A 1C0EA 3TAHA 4JEUA 2ID8A 1SJ9A 4FDTA 1YQGA 4I5IA 2GSWA 4J1NA 4PM4A 1F17A 2FPPA 3FMFA 2WUDA 3FCCA 5FORA 1XELA 5B3LA 2J0EA 3ICPA 2D74A 4IFTA 2EKDA 1G8MA 3UM9A 3OBBA 4GE3A 3V2UA 5IVPA 1RDFA 3I32A 2ODQA 2PKRA 4DQDA 1JHZA 3CVXA 1QPZA 4W99A 2PMKA 2XT0A 1SKBA 4QD3A 1E0AA 3DLHA 3O2JA 1NN3A 5DB4A 1WUIS 1XZFA 3FETA 2RONA 4P4NA 1S2NA 4KWHA 2QDKA 2AHOA 1MAAA 1NHGA 3GMTA 3LGSA 4FNOA 4OFWA 4OH1A 5FL7D 4R4JA 4WZ6A 5BSWA 4TXNA 3UY4A 4Q16A 3ZK7A 4DM4A 1JX6A 1JTEA 5ER6A 1W93A 2EIHA 4MW2A 2W6ID 4E46A 1D6SA 2YMQA 3C3EA 1EJ2A 1QU2A 1E60A 2ODTX 3N59A 2WD7A 3AHDA 3FDZA 3N8GA 1L4EA 1ZONA 4V0LA 3EVCA 1HNXB 1ZSYA 2PD6A 4EB0A 2ATEA 1UBTS 1DQNA 1PHPA 3I3SR 3WB9A 4BO3A 1MEEA 1E5VA 2W7TA 1J23A 1JEDA 4BNTA 2QP4A 4Y1FA 3W4KA 4MITA 1RCUA 5BSEA 1A9XA 4FMDB 4BFLA 1XLTC 4NBLA 3OQNA 1YDWA 2IEIA 4MVJM 1I6MA 2OECA 4YRIA 1OYOA 2QTWB 4TXMA 3ZHYA 4I4NA 1O57A 1Y1QA 3AQ4A 3B70A 3E9CA 4MUAA 5CPFA 5BYJA 3S5UA 1H93A 4HADA 1MZVA 3CB4A 4URXR 4H0CA 3FFXA 3FOWA 5CA0F 1OXKB 4P3YA 1M6VB 3E8MA 4Q4HB 5ETJA 4G4SO 3TUZC 1JFLA 3KYDA 5ICEA 3ETCA 3HVJA 4MKXA 4Y30A 3TYXA 4D4GA 1DEXA 1OJ7A 3BXEA 4QIHA 1WCWA 3RC9A 2V97A 3WYNA 5HPYB 3E18A 2WJ6A 5JCJA 2H1IA 1Z07A 3FLAA 2I54A 3DH0A 2YV2A 1L3IA 5HCIA 5GWXA 1RHUA 1R88A 5DLDA 1A9YA 1C81A 4G1EB 3T4XA 5AWFC 4WACA 3C6MA 4UHJA 3V7UA 3QX9A 1WCV1 2OILA 1JQLB 2AX3A 3K4PA 1QHGA 4DR1B 4RJIA 4DKXA 3M6FA 2HPVA 4MW7A 4YBZA 3MRVA 2VHJA 3A36A 4D4KA 4LJYA 3NAZA 5BOVA 1J20A 5IAJA 2JFZA 3FCAA 1OBCA 1US8B 1P62B 2PRKA 4UJ5A 3QWAA 5K9ZA 4HZIA 4Q9NA 2XBUA 2C8JA 2QRZA 2ZRIA 1YKGA 2I62A 2OUIA 2PWYA 3BIFA 3I8SA 3L1UA 4JP8A 1A95A 2V7WA 1GAWA 2Z9BA 3H4IA 5LDDC 3PQCA 4M0LA 3G13A 4Q9DA 1XXLA 3T61A 5AKZA 3VH3A 4FP9A 1YJAA 4E12A 3JWEA 3I34X 2D4HA 1RLMA 1L5OA 3Q8XB 4W7SA 1V8OA 1Y8QB 5ANRB 3WJ1A 1A69A 4HF7A 3Q3GE 5A4DA 3GLHB 1KTIA 1P7CA 1VE1A 1E32A 1OPRA 1OFUX 3CE6A 3K0HA 2ZKIA 4AURA 1IHXA 2X58A 1S4QA 4LYJA 1HG1A 1YS7A 1AO3A 3PHCA 4NOMA 3VKFA 2OXFA 3QX7A 1LDEA 4WOCA 1H6CA 4OB6A 4DSOA 5CVUA 5LBUA 2Y1GA 2ZT6A 4FX5A 5LOVF 4XWGA 2CL7X 1U8ZA 2VDPB 4Z4FA 2AC7A 3D0OA 1ZNXA 1VMEA 4UD2A 4AECA 3KQPA 1IBKB 1ZI8A 1ZJYA 3U7RA 5C51B 3W2FA 2YHAA 1U9IA 4RF2A 4POOA 2CUZA 1QOZA 5DK4A 3ROKA 1GAJA 3W9UA 5HOEA 4LJRA 3QUAA 2VCYA 4LF7B 1RAEA 1VJTA 5E1DA 1C80A 1JECA 3RHTA 4R9SA 2J1LA 4R9RA 2JVJA 3BCRA 1NONA 2IKSA 1JIQA 3MJHA 3WDKA 1PR6A 4QARA 3KELA 4D8TA 5KHAA 4GZMA 2B61A 1J7KA 2D5AA 2IKQA 4FMCF 4M1QA 1J8DA 1BXRB 1WTCA 2GJAA 3CRNA 3H2BA 3MT9A 3NM6B 3PHIA 2JI4A 3R7DA 3RBAA 1QWSA 2R68A 1VE5A 5DW0A 1ZXLA 2F3UA 3L7IA 4H7HA 4K9RA 1AXEA 4AJNA 2KX7A 4EG5A 1EESA 4X65B 4DMKA 1GVHA 3HKEA 3PX7A 2ZEJA 3I2JA 1E6KA 4HDRB 4ON9A 4F5WA 3JD3A 1J90A 1KFEB 1YV9A 1D07A 3V1UA 4DNPA 1RZRD 4GW3A 5KS2A 2HWWA 1ZU4A 2IPNA 2GWHA 4FLFA 4F96A 3SQNA 4HDSA 1GQFA 2OB1A 4PSDA 4MGYR 2CNWD 2B3TA 4U7GA 3CUTA 1VLQA 4U02A 1Y1LA 2J59A 1O77A 1V9LA 3ZBQA 2WAYA 2HB6A 2OP1A 1WKBA 1A8QA 5HKLA 5TPZA 5KOHB 5G1OA 2V96A 4FR5A 2EFDB 3BE4A 1DU4A 1SIWA 1Y1SA 4I7EA 4TSRA 5EXXA 3T35A 3ZGNA 4CIAA 2EEPA 1KK0A 2H8KA 2XTZA 3TE6A 3E5MA 3VU1A 3E1SA 4F2DA 1KY2A 3EXFB 2XCQA 3TW0A 3WOVA 3KXKA 3NWJA 2YWDA 4MS4A 1GEEA 2OAGA 3KV1A 3NT2A 4CIDA 3O8RA 3DBHB 2PBFA 5CA1F 1ZJ6A 2CJFA 2O5EA 1T2FA 1PFVA 1G8GA 3ZUPA 4J0FA 4HEA1 2UZ1A 1AGXA 1KIMA 2XHZA 4JJIA 4I5GA 1A82A 4RTMA 2G83A 3IUJA 3NDIA 4H3SA 4IIUA 4RVCA 3K9FC 3PF8A 3DHNA 2P5UA 4KSBA 1ZESA 4Q7LA 5JAOA 1PJZA 3ESYA 4F3CA 4Z9AA 4HH3C 4M87A 2XT6A 4I19A 2VF5X 1RI3A 3HB0A 1I7QB 1GZ7A 5K0LA 2JF0A 4OAPA 3RUPA 4HDRA 3SVZA 1IEVA 2WU4A 1U94A 3IPLA 3MJRA 5BT9A 5JJIA 1GEGA 5E8JA 5AUNB 4KVGA 4NFHA 1K7YA 4RV5A 2OZVA 1MG5A 1I0IA 1UBRS 3QI7A 1U7ZA 2JGMA 4BNZA 1AF7A 5EOVA 5K03A 5KTTA 1TC2A 5F5LA 2P6PA 2R8ZA 3CC8A 5DJ5A 1ONPA 5ECGC 2OB2A 1GPUA 1RWOA 1TAQA 1F3LA 2CJYA 2EL7A 4BZXA 1KO8A 2PGLA 3N8HA 1X8LA 2WPDA 2V1XA 2ZRHA 2Q9CA 3IDOA 4RPGA 3TUIC 5EHQA 2WWVD 1T1GA 3AC0A 4LDQA 4DUGA 5IH7A 3WK7A 5FPPA 4QOJA 1XZEA 4S35A 1LLQA 2DKOA 2VJNA 4WBSA 1Q20A 5BSUA 4O1MA 1N6KA 1V26A 3GHHA 1WX1A 4ID9A 4QUIA 3H05A 3JR7A 4Q3BA 1YHZA 5D3KA 1KJNA 2HSGA 3QVLA 2PUAA 3HCBA 1EDDA 3NZEA 3OTGA 4LE2A 5ALGA 1XCBA 1JU3A 4FSXA 4JI3B 2VJKA 3WGIA 1ZICA 3PPIA 1FW8A 4HEHA 5BUZA 4XGRA 4H59A 2F59A 1W0KD 3FVQA 3JY6A 3RHFA 3WGUA 2J48A 1Q0TA 3LYUA 3HTXA 4O4LB 5DKFA 4KUGA 1GZ6A 3IB3A 4RGYA 3VDNB 3VC3A 1HDXA 4DYHA 4JB2A 1JQEA 3FYTA 1PQ4A 4MV5A 1KPGA 4G85A 1R0BA 4J94A 3PTAA 4DUZB 5IT9A 4D3YA 2DTXA 4QHTA 4D9BA 2D7JA 2C7BA 2P9EA 1WBBA 2A8YA 2R4QA 3N0TA 4B3XA 4U6SA 1J07A 4MEJA 3AF0A 4Q4AB 1ZVMA 1LZLA 3SX4A 3OE7D 3WGGA 4BB6A 1QHIA 1S3SA 521PA 4E4YA 1RQPA 2IHVA 4WMLA 2IYPA 1JMYA 4X3CA 4Z0TA 3GLFE 4YV1A 1VIAA 2BFEA 3HB4X 2ZQ5A 5FYDA 4MR9A 1TGYA 2GD6A 4GX0A 3QUSA 4D02A 4LZWA 2GPBA 5BW8A 3IUPA 2VWQA 5IKOA 2C5GA 4LZOA 5DIFA 7MDHA 1CUWA 3ZTTA 3WGZA 4G5RA 3H13A 5K3BA 4S2UA 4AJPA 3DOJA 3V4OA 3E9EA 1BFDA 1PDOA 4JLOA 4RF5A 2WAAA 3M33A 3MUFA 4OK3A 4PRYA 4J75A 4YPOA 1RPZA 2YWJA 3QMMA 1Z8NA 3TW4A 2VDVE 4DIFA 2BTEA 4M0CA 1OHHA 4FBMA 1ST2A 5KEIA 2C42A 3QKIA 4QBGB 2RHTA 1ZQ9A 2QX8A 1CY1A 5GONB 2GXAA 2ZS7A 2CK3A 1C7RA 2VLBA 4L5BA 4YAIA 5FFNA 1Z5WA 3GFRA 4BLRA 2OENG 1U9IC 5CIYA 3N2EA 3MHPA 5CK5A 2PUWA 2DLNA 3CG4A 1A0OA 3OHSX 4B35A 4OU4A 5CNMA 2FW0A 2BISA 2PO5A 3CRW1 3DS8A 2GFHA 2AUMA 3L7OA 1ZJ5A 1PE0A 1Q7EA 3N75A 4GZ6A 4LRTB 3ZOKA 2IY9A 1QSGA 1Y6QA 4LA4A 4H1HA 3OD5A 2Q62A 1HFWA 2KHZA 1N5KA 3BSSA 4HS9A 2FMXA 1HEIA 1WXQA 3B9BA 2AOXA 5ADVA 2X77A 2JLCA 4F3NA 1A1SA 4FCCA 2AB0A 2JHAA 4PC2A 3U17A 3WLAA 2ZIUB 1NSTA 4QUGA 4OMFG 4OQFA 1CS0B 5CLIA 1SVNA 4WUVA 1F4VA 1QBGA 4O63O 3L06A 4OKSA 3V9AA 2J32A 2G5CA 2RHLA 4FQ5A 4IWNA 3WK6A 1GWNA 1TK2A 4GR9A 2FZVA 1IHYA 5GTDA 1PG5A 1I10A 2ETXA 4LYFA 2A1UA 2ZGVA 3AEXA 5J2UB 2DWUA 3AL2A 4M76B 5LMZA 2XW6A 3B3AA 3MINB 1EG7A 2QQGA 1ISRA 2DR3A 3L6OO 4JSYA 4MINA 4ZIRA 4U7HA 5DEOA 3I01A 4U5XA 3T9FA 1AM4D 3NTQA 4M98A 1B0PA 1F51E 3JTMA 1JAZA 3QG1A 3WK4A 1NI5A 1ZCZA 1FFDA 4B3SB 2JLYA 4KYVA 4MYUA 2G1AA 4KMSA 1NRIA 3IFSA 5AJXA 3Q0EA 4BO7A 5ECYA 2WKPA 4ZRNA 5LJIA 1U7UA 3TLEA 1WAMA 4WCFC 4EY3A 3NONA 1M1NA 2FSHA 4BMZA 4YLGA 1MTZA 5LBIA 4PCVA 1YFJA 3RYHB 2VJYA 3LUGA 2E5WA 3JVEA 1V8DA 3LCMA 3OTWA 5CDFE 3AJ8A 1K9VF 3CNQS 3MC1A 3B60A 5GJBA 4CDRA 1QP0A 1JIVA 5IC6A 3HMQA 4LXIA 1KOLA 3LX5A 2DECA 2DFKB 2P3QA 2WVJA 1TA9A 2X41A 2YHIB 3LY5A 3VR6D 4L08A 5J58A 1B14A 3H4TA 5J2TB 3NBZC 4PO3X 3NG1A 5FWAA 2ZWVA 6PFKA 3QU5A 1BHSA 3WMGA 3H8JA 1OR8A 3ANLA 4MUFA 1V6CA 4JNCA 1S2LA 2H29A 3T7AA 1XSEA 1X9GA 2ONJA 2DX7A 4IIGA 1NUAA 4RD2A 4KAAA 1G2OA 5F98A 3AGPA 5TMDA 4TXHA 3RK0A 1AKWA 4NPHA 1AN9A 3L84A 1E1NA 2QJOA 5AHKA 4YAEA 2HTFA 3QV1A 1VRVA 2R751 5G0VA 1X7WB 3IPAA 3KFVA 5KCZA 5D1NA 2W8BB 5HRCA 3OQVA 1XR3A 4D6YA 1Q91A 1SK9A 4LE1A 4ITVA 3PGA1 3BWBA 3ILVA 3F6BX 1B93A 1W5SA 1OKKD 3GJ0A 1PJCA 5GQSA 3SJZA 3OUZA 4MAFA 1CLUA 2LIPA 4RULA 1NJFA 3AWIA 3QXGA 4ED9A 4PG4A 5AUPB 1M72A 3QLVC 1A7KA 5JARA 2H2AA 1Z12A 1UKVY 4UAGA 5LVAA 3KZVA 4MMYB 2MTBA 2XUGA 1Z4IA 5D85A 2B36A 1R27A 2WYHA 2CDAA 3CMCO 3H1AA 4AYTA 4LKRA 1PR2A 1BFUA 1Q6ZA 2ONKA 4I1PA 2O2GA 4AF6A 4V0RA 1L5HB 4AQ7A 1FBTA 3A9TA 1JEAA 4O2BB 4J0HA 4XTCS 3UHOA 2EJVA 2R8XA 3JW8A 3P0JA 1WXHA 4KREA 1AV7A 4INPA 4QUJA 4MWZA 3OTIA 1E58A 1JKFA 4GD3Q 5ED0A 2J7KA 2Q6TA 3O9VA 1XMQB 3CY6A 3M70A 4A6EA 4IIJF 3JS5A 3WIVA 1P2GA 3Q6NA 4WLUA 2DHCA 4MIOA 4BZQA 1AK9A 1U80A 2R7KA 3NC4A 3OO1A 4K9KA 4AZTA 2YCLA 4IF6A 4LF8B 3JAMA 4RK1A 2GPWA 4HBZA 1Z0IA 2OM6A 3BEOA 4ZO9A 1NU8A 2BI7A 4JZKA 1A4IA 2Z56A 3WHLA 4L22A 3ZE7A 1X7WA 2AVDA 3CVWA 4YLEA 1U0SY 3H2JA 3WFZA 4NMMA 4RO0A 1W46A 3TJZA 1GRVA 1RI1A 3CWQA 4L8GA 1X7ZB 1NOKA 1Q3HA 4J7XA 5AVZA 2XUJA 4RIHA 2EW8A 3EGEA 2XVAA 4GPD1 2I99A 2VK1A 1CUFA 3N8NA 5ARDA 1YQUA 2D5IA 4FGSA 1B3BA 3T4UA 1K3TA 1AKTA 2XMCA 4PGAA 1NYRA 3AKCA 3DBHA 2ZDHA 5EJIA 4TT8A 3TOXA 1K7CA 3CLRC 3U4DA 3A26A 2IBSA 4PCLA 3ZR4B 2IYOA 2IS6A 4FEEA 3AEKB 1ISFA 5KIAA 2PG3A 1M7GA 1HYHA 1UQTA 4EVRA 1NZDA 4FMPA 4NE9A 4YRBA 4J3JA 4C7BA 3S1LA 4LYHA 4RV4A 2Y6UA 4YROA 1WZIA 2O2XA 3G85A 2XUDA 4WVFA 1U1EA 4GRDA 3TGLA 1ESNA 3MUEA 5ITWA 1YDHA 2BHRA 4V0SA 1U28C 1W87A 3ZXXA 2C1EA 1JIIA 1LI7A 2W8BA 1JQBA 1E6UA 2Z30A 3FKQA 3IUEA 1XEFA 3W5JA 2GN2A 4ZCTA 4NYMQ 1W4RA 2JCYA 4M8IA 3WO0A 3ZHRA 3I1FA 3WG9A 4M36A 1X3LA 2QP9X 2ZTMA 3ZD6A 4MULA 4N3BA 1AA6A 1QGDA 1DHRA 1KC3A 1WSAA 5EN4A 3AYXB 1UBFA 3UMBA 1E2PA 1OA0A 3DMFA 2ZYWX 4IO0A 2GKGA 3JD1A 1M6NA 3V7YA 4E7PA 2Q1TA 2J7PA 3FRJA 4JUBA 5F33A 3PB3A 1J33A 3D6UA 1TEXA 1BSVA 1VMIA 4P3PA 1MDFA 2GGSA 2EARA 2GYUA 2UZ4A 4YO7A 1KJ8A 4G37A 3L01A 3U4QB 4Z4GA 1QP8A 1F4PA 2NO1A 2WMYA 5HA5A 3ZK8A 4RJTA 1FUUA 1IEXA 3L7JA 4JLPA 3RDPA 1M5UA 3JQQA 4HRAA 3U3MA 5FF9A 5BMVF 1VRWA 3AFOA 3JYQA 1RBYA 3EFHA 2BSXA 2CCJA 2MDTA 5A3SA 3THRA 2Q07A 2V0GA 1CB7A 1MQSA 2VHTA 1RAGA 2CNDA 2Q1XA 2WILA 3QE9Y 4RDXA 2AD5A 2NO7A 4HQFA 1P5JA 1IQRA 1GUAA 4FUQA 5LFAA 3HP4A 3L7LA 1YI1A 3MMNA 5LIPA 5BW5A 5TF0A 3OEHD 1EVLA 4GI2A 1AKYA 1ODJA 3DZ8A 3I6BA 4MV8A 4WZBA 1RTKA 3TRFA 5IANA 2QLLA 4KE9A 3I2HA 3MJDA 3EZYA 1DRKA 1R10A 4URUR 3MWDB 1C0KA 2EYQA 3NX4A 1GCOA 4UBJA 1YCGA 1RC0A 3H5NA 5M29A 4U9IS 4JN6B 4ARCA 3K8QA 2NU7B 4QU5A 4V39A 1JFRA 2B2CA 3IDSA 2B4YA 1SQ6A 5KNCA 2Z04A 3H19A 1ARZA 2REBA 1R0RE 5MF6A 3OY2A 3FMIA 1FFBA 2RHCA 5DTRA 5FNVF 4F4UA 1ZUHA 2Y8EA 4P33A 2ETVA 1GADO 4E70A 2GBCA 2H9YA 4I9FA 2PUVA 2RAUA 3STHA 1XMOB 1KRXA 2NACA 2WC1A 4TRRA 5KI6A 1OU4A 3FHLA 1FSSA 2P78A 4AMVA 4C7OB 3NBUA 4URYR 2JLRA 1QDUA 3EIFA 3COJA 2HFJA 4IVRA 4CEIA 2OK7A 1XF9A 3KOYA 3LDUA 3AG6A 4M7WA 5AYVA 4BATA 3KKPA 1OAOC 2X0JA 3LUPA 4AYXA 1FDOA 5KAMA 4D6XA 3R5TA 4KXFB 1NUHA 3E2MA 4N65A 4EAQA 4PANA 5C9ZA 3MJEA 4DVGA 4BBJA 1PWZA 2XZPA 3O38A 5AM4A 2CJWB 4INOA 1E2JA 2HRCA 2H5IA 1USIA 1XKQA 2OD9A 1XVTA 3QPWA 4M89A 1U3GA 2QA5A 2VUUA 2X8BA 3R8XA 4S1VA 4Y2RA 4WI1A 3R0JA 5ALSA 2YWXA 1I2MA 3CLTC 4C78A 1U8XX 3V4LA 1QIDA 5AW5A 3PNYA 1FP1D 1A9RA 1HDOA 3MWFA 1KNXA 1RS0A 4KI7A 1XEWY 4QBFA 4BFCA 1CYEA 4RIEA 3X1KA 2OAEA 1T8SA 1GZHB 1LPBB 2VSXA 2IXBA 3GVXA 4YRJA 4BFVA 5DH9A 4IHJA 3NVMB 5HK9A 2D0IA 1MGPA 3O31A 1N3YA 4ISBA 4OJMX 2YOHA 1CIJA 3V4FA 3HGMA 2J9YB 2NZYA 4CN8A 4WA8A 2XTJA 3UMGA 4AN4A 2VA9A 4EY5A 1Y9EA 1AQJA 3HYSA 3ORYA 2ZRQA 5TQ2B 1E7WA 2GT1A 1LBQA 2F1RA 2EZ9A 2JA1A 1HKUA 3O92A 5AI5A 2GN0A 4BIIA 5FTLA 4M1KA 3C1UA 1ZAKA 4GWKA 4HVAA 4DLAA 4GVLA 4AM8A 2FP3A 5LR6A 4RH0A 1D4AA 2V7UA 2WF5A 5FPSA 2PIDA 1XZQA 1QGOA 2ZE5A 3A1SA 3AEZA 4RVUA 1SXJD 5D7BA 1L5MA 3D8NA 3ZHCA 3B9PA 3FI0A 1BFKA 1NF9A 5IJXA 1WIWA 2H2HA 4MKGA 2YY6A 3MUOA 3O3MB 2CXXA 2C3PA 4HGPA 5JMWA 4L4YA 5EA2A 5SV2A 1EFVA 3TUJC 3QBEA 4OPMA 1IYZA 4Q1CA 1A98A 1MDBA 1OHHD 3ASVA 3UAZA 1P29A 3EZGA 3BORA 4IIEA 1NXVA 4TS1A 4R01A 2R85A 2X3UA 3DJYA 7REQB 1KFCB 4B6OA 3PQ3A 1MJNA 4XIJA 4MPDA 4UM9B 4YQFA 4FFDA 1I9GA 1SUCA 4B4DA 2XGGA 3FWZA 2YINC 1GG5A 2XCLA 5TPZD 2V98A 3A1UA 1A50B 4GLJA 3QXCA 5TQ0A 1G38A 4I81A 5K3EA 3KVYA 1HGXA 1VMKA 3O90A 4KX3A 1YZVA 4UPVA 3BIXA 1QGZA 3F5SA 4TRNA 4DNFA 2ECOA 2X86A 1ONOA 4RF4A 1T3ZA 4JLNA 3M1LA 1OYYA 3IQWA 3H4VA 1C30A 1E3QA 1UXGA 4IR7A 2L42A 1SXJA 3PHHA 4XM1A 4IEIA 1IOWA 3A7EA 4BO9A 3KZMA 4Z7OB 2OFOA 2Q4DA 2P3OA 4DPKA 3ERCA 4TL7A 4YAJA 2X8LA 3IP3A 5L4NA 5E4YA 6REQB 3ZGOA 1RWMA 1Q3TA 3WLTA 3KCNA 1W4AA 4JUCA 1JQDA 3QPVA 2GRUA 1W36B 3U49A 3JQBC 4G24A 1N2CE 2I7XA 1C2TA 4YJ3F 4I36A 3UUWA 3EFOA 5FBQB 4PG8A 5JQGA 4LSMA 5LA6F 1G64A 1JDPA 3BSYA 4R1TA 2YVQA 2E2WA 2C9OA 4LV8B 2O8EA 1QFJA 3O83A 3OCWA 5IXJA 2V3VA 1WD5A 2XB9A 3F6YA 3VJMA 1U8FO 2H0AA 1MJFA 4AJEA 1PTJC 2VAVA 3ZHUA 1QKKA 3RFVA 4PYKA 4TLLB 1JHPA 1VRCA 3LWZA 5KYYB 1NPTO 3QA9A 5DBEX 3CO0S 3H8WA 5K0BA 1R6AA 2WPNA 4URWR 3C74A 3RK4A 1G21E 4KQJA 4WZBE 2EZ8A 1W4ZA 2PJDA 3D6MA 4D25A 1QIFA 3HEMA 2JEOA 3JQAA 5BRNA 2PS0A 2ZWPA 4OK5A 4PYNA 3IQFA 2VYND 3STWA 3F2IA 4UHFA 5E7IA 1N0VC 2A57A 3CR3C 1N9KA 3KU1A 2Y92A 5E2IA 4AYWA 2GZ3A 4WLEA 1QGED 2NG1A 1Q0LA 3FVWA 3MW8A 2IUYA 1ZGBA 3G8BA 4KAXA 3QX8A 2XY4A 4R5HA 1OCEA 2QTBA 4CKEB 5BRJA 1L7RA 3PR1A 4PXSA 3H9CA 4R2LA 4DWWA 3DQZA 4MICA 3SDSA 4JI1B 1RFLA 2YMMA 5IYZB 2P2GA 4GT1A 4BAGA 1TQ4A 2Y99A 2ZYUX 2G25A 4NZ9A 3DDZX 1H65A 1O0BA 4BNDA 3K9BA 3MBOA 2QT9A 3DE5X 1O4WA 3MB5A 1QOPB 1GFIA 3QE3A 2G9VA 4TN5A 2PUEA 5F9FA 2ZKLA 4LJ9A 1FFWA 3C43A 3ROFA 1SKYB 3O4FA 1ESCA 4XYGA 2XQJA 3ET5A 3GDFA 3IP7A 4LBZA 3BCHA 1E4YA 1NMXA 3CIFA 3M49A 3MNFA 2IYZA 5CFLA 3H2IA 5TEVA 5CDFA 2C8VA 5HQJA 1E98A 3I64A 1L7VC 3LZCA 1XKLA 3MM4A 4P22A 5IH3A 1KOJA 2C4MA 1UDRA 1F2DA 5INTA 3C6YA 2VNAA 3VV2A 5CCEA 3V2HA 4AU1A 3KJNA 2C9MA 4YRKA 3ILXA 4M86A 1SVWA 2WT9A 3KUXA 1D9ZA 2QTAA 3ES9A 4ZTZB 3CIOA 2XQIA 4ZTBA 4L5IA 3W6ZA 3ZXYA 3C7CB 3COZA 3NV9A 3PUIA 3F49S 3U1TA 3RD5A 4KI0A 4XB1A 3HJCA 3T8YA 1R5JA 3KQUA 4KOEC 3B48A 4N39A 4M55A 4NYJQ 1RVDA 2VCEA 4P3KA 4LEIA 3QUBA 3NRBA 1WJGA 2CBZA 1JHXA 3FOEC 3UAWA 5JRDS 4DV1B 1G3UA 4Q7MB 1UKAA 4CMHA 3A9UA 1GZDA 3BB1A 4J7CA 1PJ4A 5JMPA 3NAMA 1Z6QA 5J2UF 1M6EX 4P4SA 3A1TA 3VZPA 3QY9A 5H1YA 1UAYA 1ZD3A 4L27A 5SZJA 5GJWC 2ABWA 2J0UA 2HA4A 5AKYA 1OLXA 5ITSA 1WABA 1F2TA 1VE3A 2VQSA 4PLPA 1Z22A 2RHMA 3F5DA 2NZVG 3ESCA 1QRSA 3G5LA 1TL7C 1I3MA 3OZRA 3CO5A 3LA6A 4WGGA 2YR0A 2Y1FA 1MV5A 3DTNA 4R68A 1I2CA 4JLSA 1AS0A 1NQAO 1T13A 1U2QA 3PJDA 1KS9A 3GN2A 4KLCA 1CDEA 1A77A 3AG5A 4M7PA 4XDZA 5D3QA 6GPBA 4DIOA 3CPHA 4EDHA 2O57A 5AOBA 2QUAA 1GUBA 1L8QA 2G09A 2NXNA 3P0RA 1PNRA 1G55A 3CEMA 2WJWA 3UJBA 5LOVA 2ZUWA 3HKCA 1N32B 2H1OA 4UU0A 1Z2DA 1YB2A 3QVTA 4GPAA 4G2NA 4GMFA 1YU6A 2HGZA 3P2MA 4TL6A 1F2UA 5T8KA 2NPOA 1AV6A 4Y2SA 4B0PA 1E2MA 5IN4A 2PSDA 3KKOA 1DTWB 2FB9A 4XYMA 4XXHA 1VDZA 2XMQA 4Z4CA 1ZNZA 2G5PA 5EZSA 3DONA 4NU8X 3G82C 2LR0A 1EBFA 5KU1A 2WYUA 4JOQA 2GXSA 3K1ZA 4R1UA 1FLVA 3ZZMA 2KW5A 2ZIGA 1AZLA 4JNKA 5A0TA 4MMZB 4OI1A 3AW9A 1T9BA 2SKEA 4I14A 1AURA 2Z9CA 3R0XA 3R40A 4MPJA 4N7JA 2BE9A 4K9SA 2OCXA 5HOQA 1Y6GA 4GMHA 2BP7B 2J0UB 1XNHA 3MJVA 1V37A 2PSHA 2XYVA 4YGYA 1Q50A 3NAQA 4M0FA 4AB1A 3MPOA 4PGFA 2X76A 4LWPA 5HF5A 5ADWA 4QJ3A 1N0IA 5FYQA 5DYWA 2WSSD 3UGJA 2CLLB 2I2DA 2WKSA 3RI3A 3FGNA 3WHIA 4EIWA 3FNEA 4IHAA 4ZHQB 1PWHA 3IR6A 1P45A 1ZUNA 3DLPX 4IG9A 2BGGA 4R9NA 4H17A 3RNLA 4Q21A 4GI1A 4HPWA 4WOJA 2MOKA 3AIOA 5H02A 1QUFA 1IVNA 3LZDA 1I1NA 5EXDA 3SEQA 5KNDD 2G4VA 4QPJC 1NW9B 1EUCB 4LMPA 4N0DA 1OXXK 4PXYA 2DWQA 4L7VA 4QRIA 4GBMA 5E6UB 5B1DA 1PP4A 1PFGA 1EK0A 1LBIA 2JIQA 2VDWA 4LX8A 2BHSA 1SA0B 3NBQA 4R5MA 4A1OA 5K3OA 1EE9A 4FEAA 5KVSA 1D4OA 2OV3A 3ESDA 1FDWA 1XQ6A 1NJ2A 2ADFA 2JJ2A 3HCCA 3IODA 2Q9BA 4CQNA 2GYWA 3DO8A 1WZEA 4X62B 2X14A 4KQHA 4HAWA 1JE0A 1J5PA 1GY8A 5IJZA 5CVTA 4DMCA 5DN6D 2Q46A 5GV7A 1YASA 2AEFA 2IVZA 3OLZA 3L7DA 3WP0A 4WCFB 4BO5A 1J6UA 4BNJA 3CUVA 4XSHA 2YN0A 3JARA 2XXAB 1L5ZA 1CZRA 1EA5A 1DDOA 4UNNA 4MRVA 4W1RA 4HNTA 1MB9A 3F6RA 4F84A 2WWRA 1QR2A 2YRFA 1J8FA 1EG2A 2AXEA 4W1SA 3NUZA 3LQQA 2Y6VA 5FEUA 2Y0PA 3EY4A 4CKCB 2WIKA 4GECA 1G291 1RXIA 2FEXA 3AONB 3B6ZA 2M1ZA 3CLSD 4OUDA 4XCQA 1SURA 4LBYA 2OC9A 5EJ2A 2CJWA 2IP2A 4LECA 2DBQA 5E9AA 4QFCA 3OPQA 4WRRA 1JDBC 1ORWA 3VZQA 1NP7A 1O8CA 1BS9A 4FGZA 4AQDA 2O5RA 1USGA 5G53C 3B3GA 3RC2A 3D59A 2EKLA 4CL3A 1X1BA 2D7CA 4C2BA 4KG7A 2WJJA 4D3ZA 1M7HA 2Z4SA 1G5TA 4HN4B 4Q7EA 5KYUA 3SHTA 4OXIA 4ZD6A 4JYPA 1YZNA 3A06A 3DE2X 5LB4A 4IINA 3F46A 3JVVA 2F1JA 2JD1A 3FTNA 2Z83A 2FETA 4RELA 1USWA 2V59A 2JGAA 5AKKA 5SZKB 4GM4A 2AMFA 5J63A 2Y1WA 2GJ8A 2BI4A 3R6TA 2J3EA 4D3DA 3PUKA 5JNRA 1VCIA 5LP6A 1SOMA 3M3PA 2QRVA 3W2HA 1Y8QA 1NWCA 3GVHA 1AA9A 4EEXA 3Q7EA 4BEVA 3Q3IA 1J2TA 1YQQA 2DFLA 4MCIA 3JRXA 3NS7A 4X61A 1MBZA 2JEYA 1QYXA 1X7HA 3DEIA 3JSXA 3W6OA 2VH5R 3SY8A 2IYEA 4IVPA 3PYXA 2V3CC 1UMBA 1ECJA 4QKQA 2HMYB 3R77A 2G70A 4Z0NA 1Q95A 2YWRA 5KOJB 2QTLA 3R3YA 2CKDA 3IQHX 4DIBA 3N07A 1NW4A 4PR3A 4Q3NA 2D2FA 4RKYA 1RYMA 3RYFA 5ALXA 2G3YA 4W8GA 3HN7A 4CTNA 4YUYA 3RSFA 3RTDA 4B40A 1XQXA 3W9YA 2CT8A 3PC4A 3VKUA 4Y9RA 5EP3A 1DT3A 3M82A 4ZJPA 4ER5A 5J4YA 4GP7A 3I45A 4EO4A 2VDLB 5F7OA 5FT9A 1RXUA 2BCJQ 3TTXA 1DKRA 3TQCA 1TKCA 3AL0C 1N1GA 2ZI3A 3NWPA 4P7BA 4ADSG 1NMEA 3CA8A 2NTVA 3RADC 1G98A 1ZVQA 4WUTA 2B98A 2YHUA 4IUCS 4Y9UA 2O06A 4YRDA 5F7ZA 2QRLA 3G5TA 2A1UB 2EHJA 2ILVA 2B4TO 3EA4A 3RVNA 1NDQA 2G9QA 4HLCA 2DJIA 2J09A 3ZZNA 1PF7E 4ZI7A 1ICIA 1SC1A 2C2HA 1VYVA 3F1LA 4GVXA 2HLDD 3TWOA 4XWYA 4KK4A 2NUBA 4OQPA 4Y98A 3IEVA 1JDUA 3EIOA 2LNDA 2A0XA 3JQCA 1MW9X 3ADKA 4IGKA 4DZZA 3FJYA 4UBIA 4UUAA 2GD1O 3X1YA 5J2TA 2UXCB 1ZG3A 4QXOA 1S0UA 3IP5A 5C8DA 1RXCA 3MWKA 2BM0A 3LF2A 1CUJA 1ZD4A 1XYGA 2JFYA 2MU1A 4G0MA 4GFDA 5CB4B 5AVJA 1UT6A 4P3XA 1AS2A 1GFSA 1ITZA 2X7XA 4CNQA 1BOOA 3TLMA 5CDYA 1CP3A 5FI5A 1FY2A 1KH2A 1YNOA 2FRXA 2QRJA 4DL9A 2RH5A 4DV3B 3NTXA 1RPTA 1QDEA 2GKSA 2GZRA 4TMFA 4ARBA 1H66A 2XD9A 4MJLA 4P34A 1VOTA 3SQMA 2XMBA 3ZQKA 4E5VA 1GG9A 5BUSA 3HHEA 1B8PA 4WFIA 5I7AA 2QYSA 3FYUA 3ULKA 3ZJYA 4Z4EA 1PV4A 3USES 3CRMA 2IODA 3KJIA 4M1TA 3KQMA 4TYPA 4ND2A 2A5JA 3PS9A 3RKRA 1P0PA 4QBKA 3ZIAA 5ITVA 3UJ6A 1T8RA 5KQPA 2QBYB 3ED5A 1U4NA 4D4JA 2WUVA 5LU9A 1UH5A 3GRKA 1FU7A 3FDFA 3DP9A 4V03A 3QKSA 1OC4A 3A6ZA 1X1AA 4HDNA 4BASA 1FFYA 1F60A 3MBIA 2VXYA 1N0UA 1L7DA 4J91A 1DJMA 4OP2A 1UDXA 3KVNA 1SHJA 2EBFX 1XVVA 2PBLA 3PI6A 2WHPA 3ONNA 2J31A 4WLNA 1YA8A 1KEEA 4D41A 4DWVA 3PSHA 2ZJFA 5T7BA 4YCBA 1GKYA 1JR3D 1O5TA 1P2UA 1JG3A 2WIAA 4I9NA 3ZWMA 4PR0A 1ODSA 1YS4A 2YVAA 3PUZA 4J49A 3ZIUA 3OPYI 4U63A 5GOZA 1C8LA 1Q44A 4PFJA 3TIIA 3DLBA 1XZIA 1YK1A 2J9ZB 2JARA 1SOWA 1E5QA 1LDBA 1O9GA 3OCUA 4RVHA 4HNUA 4EL0A 3C87A 2YRXA 1FQWA 3FIJA 4JA2A 4N48A 1XXHE 1SBTA 2BRUA 3DR3A 4DMLA 3B51X 1VLJA 3KEOA 5IAOA 2NZXA 2C9YA 4XH9B 5DM70 1IBRA 4TMYA 3R24A 3PEUA 3IQDB 5JYDA 1TZKA 1Z74A 1L3BA 2HIGA 3N87A 3N6RA 3OZGA 1EWQA 1TGVA 1WV0A 2GARA 4FPXA 1Q3KA 2HF8A 5K0SA 1V43A 5IS2A 4I55A 4GMKA 2X22A 1NOIA 2E9SA 1CJTC 1NRJB 4CE6A 4TWBA 4YQYA 2AC2A 1LWOA 1YQTA 4BE9A 2PX0A 3L40A 2Q49A 4I9HA 1JR6A 1BKSB 1XTKA 2EWMA 2HZ7A 2VJMB 3KTDA 4UUOA 3QPBA 1YE5A 2J9RA 3ZX4A 5AVTA 4L8WB 4U7TB 3A6JA 1PYOA 1JBQA 1ZY2A 1ZXBA 3GMSA 4RJKA 4XARA 3OJLA 3PJEA 3ZYCA 1MC8A 3BKXA 3VPBA 1WHTB 2XE4A 3FFBA 2ZJ4A 3V7NA 3HVUA 3CBQA 8ADHA 2IT1A 1FX0B 3TSWA 3PPYA 4Y9SA 5L4SA 4QFDA 3U80A 1E2UA 1MF7A 2GBGA 2EGHA 2VP0A 2UXBB 1FJGB 1CEXA 1U7TA 2Q5FA 2QUKA 5DDIP 3UXMA 3HK2A 3S5JA 3LUJA 4U8HA 1OWNA 3QVOA 4NEQA 1W85B 4KYUA 2FN7A 3EQ8A 5L9AA 3FDXA 3FWHA 2FSUA 3DD5A 4KB5A 4MKHA 1NW8A 4ZRMA 2C2GA 4G07A 1Z75A 1RZVA 4IMIB 1KGSA 3NBAA 1EUZA 3DT8A 3QMVA 4JQSA 1Z7YA 4YK7A 3O4IA 3R0ZA 2MYNA 3M9XA 1RXYA 1VKJA 2YYSA 2B1IA 2A3NA 4L9AA 1PKEA 2Q3LA 3LUCA 3OCYA 5BQ3A 3Q98A 3TZBA 1HBJA 3Q40A 2DJ5A 2OORA 4RA6B 3NPMA 2DSTA 2J3KA 1V8PA 2A1IA 2F1HA 2PL3A 4RPKA 5ILGA 2ODBA 3H99A 5AVUA 1JG7A 1X0XA 1WF3A 2GM5A 3C1TA 2OXEA 4GICA 4L4UA 2XIQA 4MUXA 4A8TA 1DC4A 1QR6A 2XNDA 4GPTA 3TDNA 3QVMA 3NEPX 2XHEA 3G6KA 2W2TA 3NUGA 5GVSA 3A32A 1PD1A 1OH8A 1MOQA 3OZBA 3TLGA 2TSYB 1GRNA 1SC9A 2WJAA 2ZI5A 1TW2A 2D1RA 3ZZUA 4AT1A 4DQKA 2A7XA 3MN1A 3UWSA 3QSYA 4CU2A 2H0QA 1I1OA 3ANMA 4BNVA 5JD4A 2CVPA 4QL3A 1H05A 4F7DA 4CM4A 2OZEA 3THYB 4CCAA 3MINA 3P9IA 1JV2B 4CQJA 2NV0A 1GNRA 1K66A 1G3RA 3U31A 2PBZA 3FAKA 2WU0A 3P9SA 5GZ3A 2QN2A 4ETNA 4EHLA 2BR4A 3KYCA 2FUKA 1NVGA 1SN7A 2H85A 3L8CA 3O4RA 4O4IA 1WOMA 1IHUA 2XNCA 1Y63A 3I52A 3OLQA 3G5MA 5U4XA 4E1AA 3EVGA 5KHOC 2O0KA 3W5VA 1UBOS 2ZBGA 3HWSA 4KXNA 3M5WA 2AN1A 5T64A 3F67A 1TZ2A 5GADl 1MRZA 1JFFB 5EIOA 3RKSA 1LD3A 2QV7A 3JATB 1Q1NA 2AJDA 2GF2A 3OPMA 4G86A 4RETA 2ZJ0A 5JH7A 2QYOA 2UVQA 1E20A 2PUGA 5B36A 3IBFA 1DAKA 2YDXA 4O4JA 2VZEA 2C7VA 4ZTUB 5SY9A 1BD4A 5G4LA 5CX4A 1UDBA 4C22A 1K5HA 4JLDA 3UANA 4EYOA 3LF1A 3DZCA 4BCBA 2VL7A 4LRQA 2RKBA 1KSGA 4XVHA 1P5ZB 2YIDA 3P4YA 5DCYA 3SHQA 3ZY5A 1ORIA 3BMNA 3LUFA 3X1WA 1RCFA 4NPCA 3FTCA 1YTUA 4DYVA 1VCMA 3GUUA 2WG0A 3EQ9A 1Z3IX 2ZTSA 1TM2A 3WLJA 2VATA 2PVCA 3RUDA 3U0VA 3KQKA 1WZNA 3VZDA 1L5HA 3R2JA 2IHNA 3E5NA 5L6LB 1J70A 2Z3ZA 5JHHB 3NXKA 4ZOAA 3BRWD 1M6WA 3EZFA 4NXNB 2AFIA 3QQPA 5CJJA 1QF7A 4Y1GA 5AT1A 2PLFA 4KPYA 3SU8A 4RPIA 2N3ZA 3T3MB 3KR1A 1QTQA 1YOVA 3BTOA 3IAS1 1IHPA 1LI4A 3T3IA 1GGEA 4DEYA 1SIOA 1Z15A 3KO8A 4UCWA 5EIWA 4C2AA 3SOZA 1HRKA 5DYNA 3IO5A 4KW7A 2VDOB 3LY9A 2C95A 2HNBA 3ANYB 3GGGA 4IRXA 4U00A 4UMVA 4E14A 2G76A 4MRRA 3UOWA 5ILOA 1ACJA 3AKDA 3KOWA 4YXFA 3RCBA 4DMGA 2GOYA 3PVZA 6NULA 2FWIA 4XVUA 3KPYA 1W2HA 2REXB 1VJCA 3CVOA 3RYCA 1OF1A 1JEOA 1PR9A 3OOSA 1E2GA 3VNSA 2O7SA 1K8YB 2HCBA 2GTPA 3C3MA 3HVKA 2VNSA 5K3FB 5BN4A 1QQ5A 2O2JA 4Q1FA 5AJHA 5LN1A 2ZRBA 4NS4A 4B48A 1P0IA 3HG7A 5EGSA 2WWFA 3SZOA 3GG9A 2CF5A 4P84A 1U2DC 1FRQA 2C07A 2C03A 3PUYA 4TLAA 4R05A 3I6IA 5A9TA 5K5EA 5KX5F 3WGNA 1BO6A 1LH0A 1PT8A 2B94A 1YE8A 1YB1A 3DE6X 4UMFA 1N25A 1VBFA 3CWZA 1L7BA 3IV9A 1FB5A 1AVTA 4BFUA 4QG3A 4UDXX 1Q0UA 2P4EA 4MK4A 3L4SO 2XBLA 4QVGA 1J2RA 2XD4A 3CZ9A 3V6LA 2O8DA 2HHCA 2GJ4A 1P3JA 3ADCA 4BB0A 1JQKA 3M5PA 1V25A 1OILA 2F3RA 3DEFA 2CXUA 4Y1EA 2O52A 4ZYZA 2C96A 5IBCA 1YQWA 3U3ZA 2I9KA 1Y89A 3OIVA 1ZM4A 4MDEA 2FW7A 3IP9A 1KO5A 4MKZA 1TTHA 1QCZA 1FXWF 1Z0SA 5HZKA 2B1JA 2W2LA 1RJFA 4CEHB 1M2OA 4L50A 1DAFA 1UXOA 3SXJA 5HBGA 4C0BA 1R5NA 4OP3A 1XCOA 1MQ9A 3FZQA 4WASA 5BNFA 3T41A 3ITKA 4MVJA 1FSGA 1GU1A 1HE1C 1RU3A 2ZBUA 1P61B 3IEIA 4KLAA 2OCLA 5DP1A 5B30A 1LUAA 2PX3A 1XTUA 1OY1A 3R44A 3BGIA 3N76A 1E2NA 1SO8A 2E1RA 3QVWA 5DBFA 3WVNA 1AN0A 3GIDA 1EGVB 2C5HA 3AOGA 3EF0A 3BZWA 5HCNA 3WRYA 1U0JA 1F6BA 2H1LA 1BMQA 3HABA 4FDLA 1CQXA 3A1DA 1D6JA 1U0TA 4NF2A 3ZIDA 2P6MA 2FK7A 4YAKA 5TLSA 3VA7A 5EIXA 5JAQA 4U9UA 1C50A 5EUQB 3HBAA 2Z3WA 2GJ9A 3PDWA 4XB6B 5JTUA 1SC3A 3JAKA 5KHLB 2PUTA 1NW7A 3ENKA 2ZG6A 2QYHA 1NBMD 5JTTA 3LDGA 4C7VA 4MUGA 4ZXFA 2XZTA 3RVPA 1QV7A 1OX4A 3ETEA 4ZVVA 2FPGA 4QPPA 4Q9IA 2H59A 5HEKA 2WWWA 3AVUA 3MBKA 4V24A 2CD7A 1RWKA 4H16A 1OT5A 3ICVA 3IE2A 4GGMX 3PEWA 3KB6A 3AZPA 1HPLA 5H8WA 3P9KA 3UMCA 1VI6A 5TT0A 3SLGA 1TEHA 5JCOA 1RADA 3E4CA 4K6MA 3WMFA 4GLBA 4JBNA 4YCMA 2ZUEA 2XUKA 3F3MA 3UC5A 2C1ZA 1OFTA 3DO5A 2Q3JA 5D3MB 4FK8A 3DPIA 1HOTA 3LQRA 4RK5A 2PA3A 1JMKC 1HE2A 3TIVA 3NNDA 3QFHA 2J4FA 1TTPB 3TIXB 2PAAA 1CZLA 1SC6A 2C2ZA 4H6XA 4CN9A 5LJLA 4P2BA 1GPH1 2PJUA 3BQNB 2EXXA 2GAOA 5FOXA 3H9BA 1W1UA 3A2MA 1GGHA 3A6EA 3EYWA 5GGXA 4LXUA 1P9WA 3C1OA 4RZSA 2IX3A 2O2HA 3T7JA 1XTTA 4FNAA 4LYYA 3JPWA 4BNXA 4IXWA 2CV1A 2HHLA 3N2NA 3PGVA 1EM6A 4OI0A 3D8HA 2FX5A 3BG5A 3GAZA 3STXA 2A0UA 4KR6A 3GFBA 3OMXA 1QIEA 1YVUA 3ZV6A 2HQBA 2JAOA 2GN1A 2WT4A 4WHMA 5E3HA 4MVWA 4TTQA 1QRTA 2QPTA 5DLYA 1XEAA 3EXHA 4ZANA 5KYKA 1UBUS 2FP4B 2NNLD 4MUKA 2VQFB 1D2MA 1N4AA 1PR3A 1E2LA 4QDTA 2Y1LA 2CL6X 1BE8A 2R5FA 3A1WA 4RD6A 1YVRA 1R16A 2BZSA 2Q28A 1TU3A 3COYA 3K94A 3PEFA 4EUEA 2AOVA 5JQGF 1Z56C 1P91A 2CVHA 2RBKA 1ODIA 4I1IA 4QYMA 2JFHA 3CTPA 1AQNA 2PLNA 3GC6A 2IOFK 4HFJA 3GFTA 4NSNA 1V1RA 4LFAB 2JAQA 4D96A 2BJHA 5CXQA 1JU4A 5I45A 2YRWA 2ZCJA 2P2CA 9MHTA 2JIPA 4FYXA 1CR1A 1NX9A 3KLBA 4GGOA 4M1SA 3U4GA 2WM9B 4KDEA 1VSBA 2OFPA 3C3CA 1A7JA 5A04A 2O8FA 3QKWA 4MARA 3MTQA 4QJBA 3CGGA 4JJZA 2I1VB 1KVUA 1I3KA 2JASA 2O1EA 2QD5A 4OGGA 5AIAA 3V48A 1SPXA 3I2FA 4OYRA 2YXLA 2QI9F 3R9IA 1L7AA 2JFQA 1WHTA 2FPMA 3B7WA 3Q4GA 3R3SA 3C16C 5B3KA 2JBAA 4S12A 1AD2A 3OJOA 4MV3A 1G41A 3ZTYA 4EX7A 5ELMA 1DMSA 1QUEA 3OCVA 4QNMA 4PLGA 1MAVA 1SZCA 4A3SA 5BQFA 3O8DA 1ORVA 3FKJA 4BS9A 4DOMA 4AS1A 4HWSA 4W82A 5EKUA 3TLCA 5BN1A 1D1QA 4B8YA 3K0FB 3UHJA 5CEFA 1UPUA 1JJIA 1UK8A 2VK8A 3KLMX 3QITA 4N3GA 5I7UA 1OB5A 5ICMA 1QHYA 3COWA 4RJLA 1IH8A 5ADUS 5C1PA 5EINA 3EX7C 3NIWA 5F4ZA 4ZJZA 4KN8A 3T9EA 3BF8A 3HCRA 2A3RA 4QELA 4V0NA 2PZAA 3GT0A 4P7GA 4NZMA 1DVRA 3AY7A 3AZOA 3BPSA 3LNTA 4NI5A 4O2BA 2FY8A 1S2OA 1UPTA 4XEHA 3SN6A 4D9KA 2I6UA 3CNLA 3PPXA 1A7UA 2CW5A 4OIFA 2FFJA 3T15A 3T4PA 4BGVA 3HHPA 2AMVA 2D6FA 1EFVB 4HDAA 1XCMA 2P2SA 4TL8A 3OQ1A 2X6TA 3SBOA 2GLXA 2MJLA 3TNLA 2XRMA 1H8ED 2FPRA 1I4EB 1S6YA 1NSYA 4KE7A 4D46A 2ZREA 1BWSA 1X70A 3NBXX 3OU7A 4RD0A 4EO7A 5KTMA 4U7DA 3ZLUA 2VBFA 4NULA 5FADA 1LRKA 4L9SA 4PZUA 5FUQA 3LTEA 2CKMA 4RCYA 2RD2A 1SRQA 2VHUA 4R0NA 4LSZA 2Y67A 1ML3A 5B3AA 3WFJA 1Z6TA 3ZJ4A 1C7ZA 2JBAB 2AG5A 2E37A 3TZ6A 4EITA 1BX3A 2DFTA 4MWOA 2QROA 3ED1A 3EBOA 4QWMA 1UK9A 4PRKA 4Z51A 2ACWA 3LY7A 3WLEA 1G5FA 4X66B 4DIEA 1QRRA 4PSAA 3D4IA 1PCXA 4PNEA 3ISTA 3KXDA 1N5OX 5HIJA 3U7IA 2BEUB 4DQLA 2ZP1A 1PYDA 2OMKA 2P91A 2Q8PA 3HSSA 3GJ3A 2YV4A 4XVCA 2C8KA 3EQ2A 3L7NA 3E6AA 4QECA 4DWJA 3BHJA 3O1JC 3S6JA 5I4CA 2Q4RA 3K15A 5BWBA 2PZBA 1VTKA 1E0JA 1KH3A 2X0NA 2Y1DA 4YVFA 1DFGA 1YGPA 2W5UA 3TMAA 1TK9A 2Z2IA 1H5NA 3MMXA 5EQFA 1FSZA 3ZBUA 4A0SA 1FNDA 2PWAA 4CLRA 4GL2A 2O4CA 3CNBA 4JJGA 4NFSA 2YWHA 3KTAA 1DIRA 2YNMD 3EUEA 3ZHXA 3AHHA 4M4SA 4RSGA 4RTLA 1C30B 1EK5A 2GPAA 4FC6A 2EBHX 1ETHA 4URZR 3I72A 5HYVA 5K8IA 4NK4A 4XGKA 5FH9A 1UPBA 3SYKA 4GXTA 2WZQA 3RRNA 4N41A 3O47A 1DG1G 2NM0A 1HORA 2P9GA 1HDRA 1AK1A 2C4UA 2YWEA 4FM9A 3V3TA 4BU0A 5HIIA 1BC5A 2G72A 4AMGA 5JAZA 2ECQA 5IZCA 1BG6A 3LU1A 5I48A 3JQ9A 1W59A 1N78A 2A1TS 5A71A 3VR5H 2J3DA 2PSEA 1NJGA 1T9GR 5CW2A 4W5TA 2WSYB 3TEMA 4DNXA 3H0CA 4KUEA 3LPAA 4OU5A 2ZJ3A 3QWBA 3TM4A 3RRXA 1ILWA 5C7OO 1ND6A 4C21A 4TS9A 2K4MA 4TZKA 2EFHB 4EG4A 2EZTA 3Q88A 4ZZ3A 5A6VA 2FJPA 2ODWA 4ZT5A 3FDJA 2Y1EA 2EBUA 2GHQA 4MRNA 3CONA 1EVZA 2Q0HA 5K4HA 3D4NA 4N7BA 3RV3A 5DX0A 3RRJA 4NECA 3SBDA 1K92A 2X0IA 4G5FA 3ENWA 4GMDA 1Y0BA 4A4DA 4NL4H 5T41A 5LZ5A 2G6TA 3O94A 5FQNA 3OF3A 4J7UA 4QO8A 1X80B 1YBAA 4XIFA 5A62A 1YSCA 2R1UA 5CB4F 2L19A 4IIHA 4ZT2A 5DV9A 4HTFB 3HGQA 4WJLA 3GLSA 1BQEA 1D1PA 1DG9A 5GM1A 4Q01A 3ZCRA 2H1VA 4JD5A 4TUYA 3IBTA 1ZGZA 5EI5A 1IN1A 4KN6A 5IUNC 2AYXA 1BX1A 1N6RA 1SWVA 2GLUA 2PTGA 4XX0A 3HDYA 1OBFO 1T6BY 4G6ZA 4HQ6A 4NBUA 3RLIA 5HF9A 5CITA 1TTQB 2FFRA 1NTRA 1LJLA 2TECE 4ARAA 1ZYUA 2QY6A 3ZHSA 3D4OA 1GA6A 3FKSA 2ERXA 4BQPA 2CXSA 1L4LA 2JFVA 5JS1A 5TNXA 3REFA 2P9CA 3PNOA 4JDUA 1LDNA 1JKIA 4BVLA 4ETIA 1L5RA 4BBZA 3H75A 4JKOA 3HC7A 3FYHA 3W3AD 5I51A 1VBKA 5CLGA 4TKZA 1JZQA 1F12A 2QZJA 2BOVA 2I78A 4C04A 3TGPA 2AK3A 3UYKA 1T1EA 4QDKA 3AR8A 5DWQA 2X5XA 2NUTB 2ZTVA 3FJ1A 5C37A 4EJSC 3FN4A 3E0QA 2PWZA 2ZT8A 4K86A 5AJUA 2NYVA 3BTUA 3JQPA 3KKQA 1P2VA 3OF5A 3R3WA 3UA3A 1E3LA 4OG2A 3WGHA 1QQ7A 1XJWA 2RGCA 1Y8ZA 2CC2A 2WSIA 3SSAA 2DFPA 1T2NA 4L28A 4PU0A 2VDNB 4QDUA 4PLHA 2PYZA 1H3NA 4Y0NA 4FFRA 1QB8A 3QFTA 4IIJB 3GXBA 2VJPA 1NLYA 3GB9A 3WZ2A 3R1IA 2JIOA 3IMCA 2VKTA 3FGOA 5A9RA 2OZLA 5LSAA 2EC5A 4JLAA 4AKTA 2GAIA 4BVGA 4QPZA 1LLCA 5AI8A 4DR3B 2GAFA 1RJ9A 1NOJA 4A82A 2GF9A 3GLGE 3FPHA 3R7AA 1P80A 5A5EA 3NASA 4L6IA 3LVBA 3P26A 5CCDA 3AV0B 3H5VA 2RGUA 4MGHA 1G6Q1 4RIFA 3H9GA 3LQFA 5JAIA 1JDZA 4CUZA 5I9LA 1VYUA 4G4IA 4YYEA 4EFMA 4F93B 5LDHA 5KJEA 4C0KA 5H3LA 3RYIB 3MTJA 2BFEB 1TCCA 3BB4A 1TLFA 3KUCA 4EZEA 2YNMA 1GKLA 4RU1A 1HY3A 4B4KA 5IASA 1OH5A 4PHTA 4DRZA 1EUCA 1N5MA 1FFXA 2YY5A 4BV3A 1BZYA 1UFVA 2RJ3A 2AQKA 4BO6A 1S96A 1FE8A 4RACA 5BWLA 2XEXA 3HCEA 3V8VA 3W8EA 2I2WA 2IXEA 5IC5A 4ECAA 4IX1A 5DW3A 4IXMA 2GEKA 4NHEA 2PH1A 4CF5A 4HNVA 1NXPA 3LPCA 3DYBA 5JI3E 4O2RA 1PEAA 3EC1A 4L1KA 4K05A 2BKAA 1PQYA 2WJYA 3JQ8A 2WNSA 1JN0A 3AJAA 3GEEA 5CDUA 1EM8B 1YO6A 1UL1X 2QL7A 3P5SA 4LGYA 3GEGA 1GRCA 3CLHA 1GSHA 1U9YA 4B1FA 3AY0A 3L4BA 5E9JA 5FLXA 3ABZA 3SGLA 2MR5A 1GP2A 1WVMA 4QQRA 3DTVB 3CRZA 4BEJA 5REQB 3ZQ6A 2FE4A 1THGA 4J2TA 4BRZA 2JFNA 4JC8A 1PYGA 3SC2A 2BCEA 1Q6YA 5E4TA 3RJZA 1KMCA 3NJ4A 2LKCA 3T38A 2AJLI 1KOFA 2C00A 3OEWA 5TT1A 4JL6A 2XKJE 3DMTC 4WERA 3RRFA 1LI5A 3VU9B 5BV7A 5JI2E 2FX2A 2FR1A 2C3YA 5A03A 1M8GA 1HZZA 5T4HA 3G59A 1EVYA 1CWUA 3ROMA 1E4OA 5EERA 3U60B 4WEQA 5JNVA 4DA0A 2V45A 2AX4A 4PFSA 5KNDA 5DNVA 3DXZA 4WK6A 3DLTA 3EAGA 1Y48E 1PV1A 2VAWA 5CGZA 5JECA 2QE7A 3W4IA 3ECAA 2E85A 2VHWA 1GUZA 3GAMA 5CFNA 5LXTF 1Y1PA 4DG9A 421PA 4EABA 4ZAZA 2R48A 1RAAA 4GUDA 3IIJA 4X0EA 1O0CA 3P19A 4JT4A 1JZSA 2NVWA 3JD4A 2FWMX 2F7SA 2I80A 1MFZA 3INNA 1XHEA 3F78A 1QCCA 2QQ5A 2QT1A 2HA3A 2GKOA 4YP1A 2IOFA 1A96A 2ZUSA 3MT0A 2CLHB 2W2XA 5CK4A 2IFTA 3IELA 4MTCA 3ZJ5A 4R51A 3IESA 9GPBA 5GPBA 2P9ZA 1E9AA 3EFEA 3I53A 3PT5A 1POXA 4XUGB 4D7AA 4C9BA 3K2IA 4FEYA 3WGQA 3AXTA 3AIKA 4FU0A 1MIHA 3T0GA 4AXXA 3E81A 4HAZA 5K20A 2J6BA 3IXQA 4TKVB 3GLGA 1DPFA 1XJQA 2TS1A 4NIMA 3G79A 3UMRA 3IQEA 5I7RA 2CSXA 3AIMA 4LRYA 3IDFA 2ZSFA 1I2AA 3IGFA 2IYNA 4D97A 5JLJA 2D0PB 4MWBA 2QIPA 4BUZA 1DC8A 3EPPA 2ALJA 2OO3A 1HTBA 4FFWA 5FOWA 3TZKA 1YJQA 4FJ0A 4YIHA 1BNCA 4ZQEA 3OLYA 3Q5EA 5D2CA 2I7VA 3HY3A 5AI0A 1M66A 2R6JA 4OQYA 3VMMA 4P5EA 2JIZA 1GNSA 4UW9A 5HK8A 2IU6A 4RNCA 2NO5A 5MGBA 4PAQA 3QU9A 1X7DA 3DVSX 2W48A 3TLJA 3FHCB 4C87A 4WJKB 4N4AA 4XASA 3VYSB 1XYYA 2NIPA 2Q6IA 1BXGA 1PNOA 1WP9A 1H5UA 3WQHA 2G0TA 4QBHA 2OWEA 1W7AA 1P17A 3GRPA 1Z0AA 1Q5PA 1QHSA 2CMKA 3NP7A 3EHDA 1XCGB 1MXFA 1PZMA 4NCNA 4C0AC 4FFVA 1HXHA 5DTMA 4I50B 4J90A 3K32A 2ZUDA 2COUA 2ZDQA 3UMVA 3AM3A 5IFKA 2FEWB 1NA5A 4NU0A 1GT6A 1L7EA 3G7SA 1HV8A 4JMLA 2I66A 2VWGA 4V02A 3V80A 3KKKA 3NJ8A 1LDMA 3G3EA 4JVSB 4US1R 4FGWA 4LI3X 5ICCA 1QHNA 1XNQB 1QFXA 4C5BA 3ND6A 4EMUA 2QP3A 1T5IA 5TF4A 1OKKA 1R9GA 3WLNA 2WTNA 1OXMA 3IYLW 4KDRA 4JELA 3SG0A 2JB9A 5CFQA 2PXAA 4BP1A 1E2EA 4JFAA 1VJDA 1V4BA 3G1WA 2W11A 2Y05A 2QNBA 2XVYA 2RKOA 3ND9A 1Z4OA 1V7QA 3GXOA 2B5WA 1NY6A 2E4ZA 3G9XA 1UWCA 2JGIA 2R4UA 2ZI7A 1H2ZA 3M6UA 3ZEAA 4AZSA 4ZO6A 4CG3A 1RP7A 3R74A 5CD1A 1T5LA 3N3AC 4JI7B 4FQ8A 1UOQA 3BH0A 2H7XA 1AHIA 3DGEC 4HWTA 1QG0A 1E66A 1NURA 1JNXX 1TPYA 4JYCA 2WM3A 1TQ2A 4RF3A 1CBUA 3F9IA 4ZV9A 4RKFA 3ANXA 4RTQA 1XMPA 2WR8A 1A9OA 1MKYA 3EDMA 2XVZA 3OIFA 5EMHA 3FCUB 4MIEA 5FOQA 2GD0A 1KIAA 3GT7A 1T34A 1N8TA 3CZAA 5DI3B 3RTCA 1XKTA 4WK0B 1SPBS 2J46A 1KEWA 1O6BA 3BYZA 3SCZA 3FPSA 1Y7TA 4CLXA 4LHEA 4YJFB 3BE5A 4WAUA 1W8IA 3CU5A 2DPMA 4UAUA 1LVHA 2VXBA 5LD2C 4URVR 3KBOA 1Q77A 1ULHA 1FU4A 4BGEA 3T3PB 4G84A 1WZ2A 3I37X 3HFSA 4IDHA 3VPGA 5KTYA 1XA0A 4I4TB 4JT8A 4XQ9A 4KSCA 5FA8A 5HXAA 2NTJA 3DULA 1QH8B 2YS6A 1RWVA 5C46F 3R4CA 4M46A 5TGTA 3KJGA 4AY4A 1CHNA 4JWKA 4B73A 2VO1A 3PGKA 3B12A 2QD3A 4DTCA 2H11A 1JMVA 3V9PA 3EZ2A 2INGX 3IKVA 2WP8J 4HVCA 2VHZA 3IT3A 4J0JA 2BGLA 2VKQA 3OIGA 1GSAA 3FAZA 4HG2A 1SU4A 3K73O 3RTAA 1CUVA 5JDIC 4MAMA 1QQAA 1YRHA 4AJ2A 3MQFA 3SC4A 3A9SA 2DFVA 3FW1A 2O2DA 1O4VA 4XJSA 2PH7A 1MNQA 1DBVO 2AG6A 2QDXA 4X7BA 3M8KA 1Z5UA 4V0QA 1H22A 3INYA 3JQ7A 4Q48A 1PJBA 1QMPA 5EWLA 4OM8A 2BDTA 4JCCA 2RH4A 1DMRA 2Q5HA 2QBYA 2WHRA 3R3JA 4JJ7A 1N2ZA 4ZVNA 2PCLA 3EULA 2JHFA 3KG2A 1E1RA 5EHIA 4CCYA 8LDHA 2ET6A 2OQVA 4XRRA 4MIKA 5DYTA 2GWRA 3FOCA 1DTEA 3PCXA 1PT6A 1NVAA 2IZ0A 4UPEA 4I8IA 1OREA 4CM9A 2WW8A 3G0IA 1G5IA 1VJ5A 1UBLS 3V8BA 4IILA 3C6XA 4QPCA 1CQJB 4UASA 2IPXA 4BVFA 1JXMA 1VL6A 3H1TA 4FR2A 3BD7A 4RHUA 2O50A 2IIVA 4UNQA 3PR2B 1CVIA 3CN7A 1S2GA 1XRPA 2RAVA 3KEGA 5C31A 3BJZA 4HFRA 4IQ0A 5CBPA 2NO4A 5M3BA 3NBYC 4WTOA 2ZM6B 2XNDD 2GERA 3FSEA 2JEZA 1ADCA 4JLWA 2ZJ5A 3HP7A 2ZIXA 3A3PA 3BHIA 4Y8VA 2GEVA 2BCGY 4I2NA 5AVOA 4DLZA 4E3ZA 2QD2A 4GVPA 3Q3CA 4QGFA 3E7PA 1KE2A 4DA8A 4NDZA 1D09A 5FDFA 1P3Y1 2UZIR 5KYGA 3SJCA 2C59A 3K0EA 2O1XA 5TGZA 5BUQA 2HQSA 5ECDA 1LBHA 1XT6A 4FHFA 4WXHA 5EIFA 1P77A 4E2ZA 3PQFA 2FPOA 2FQWA 2WQ6A 4KFRA 4PVDA 1QTNA 3DEZA 3DM5A 3FD8A 3DE7X 2FDRA 1Z17A 3UIEA 4F04A 4IFBA 1Z0KA 2BKXA 2V5VA 4CNBA 3KFXA 1V2GA 1O95C 2ICAA 2YYYA 3N2GB 2B9EA 1KZ1A 1YB4A 4Z9FA 5TMPA 2JAXA 4ZOQI 2WVGA 4FVTA 2LUOA 3M2PA 1I5EA 1M1ZA 4L4RA 3KQOA 4ND5A 3C5WP 3DZFA 1NW6A 3OTQA 4CM8B 1U63A 1KAGA 1DKLA 2HSDA 4BFSA 4O5AA 2WUEA 1J8YF 1K0FA 4HZUA 5C52B 3Q3HA 5TARA 1EGMB 3RYFB 5KDLA 4DCOA 4P08A 3PHJA 5A7HA 1A8HA 2BN4A 1ACMA 3AB7A 3D02A 3KJEA 1CZOA 3BHMA 5F7XA 2DBZA 1E9FA 1MUUA 1Q0QA 3TX6A 2POCA 4NNPA 3OP1A 4EARA 1JXOA 4ARIA 2QL6A 1H1DA 4BCDA 2F67A 1SHTX 2JGJA 4Y2YA 1DXOA 3I9LA 3I8OA 4GX5A 8ATCA 1K8ZB 2R8RA 1ZM2A 2QAGC 2QN9A 2X2FA 4I6JA 4RLQA 3WGLA 4XSGA 4UNPA 1I6KA 3IDAA 2ROQA 3PVCA 4S0XA 2NYRA 2WYIA 3E22A 4Q93A 1DWOA 1KGDA 3SIXA 3VNAA 2EOAA 5HZMA 3DPSA 3DYVA 4ND8A 5EC8A 4Y7CA 3L0PA 1GILA 3AP2A 1J39A 4BY9E 3X1JA 5JNTA 5DOVA 2IOYA 1F4LA 5AW0A 3ZC3A 3SI7A 4DV5B 1DC6A 4KMOA 5F3DA 4DJ5X 5LWQA 4A8PA 4YHHB 4CKBA 1ZA1A 7GPBA 3VBEA 1V95A 5DX8A 1B8VA 2Z5GA 1V5WA 4UNIA 1ISHA 2XYQA 5DASA 1VL8A 2ZYHA 4JR1A 3LCCA 2W2KA 1KDYA 1TYCA 4J2OA 1DV1A 1X2BA 2NO6A 3ETJA 3PWTA 4MRPA 3HGTA 2VDJA 3VQTA 1ECPA 1CRWG 2AUNA 2CXHA 4IGAA 4JB8A 3ZH2A 2V7PA 3P27A 3AR7A 5F4BA 4WXYB 3NHZA 2EW1A 3QW2A 4G0PA 3UJAA 4DSAA 1YVDA 2RGNC 5A4AA 4HYQA 1O96A 5B7NA 2XECA 1UZUA 2C78A 4KKVA 1UINA 4IQGA 1PIWA 1EQAA 1QONA 2PGNA 3MLAA 4QDJA 4D0GA 1UBCA 1E1KA 4IRUB 2IF2A 1KS2A 1SVLA 5D5PA 3OOYA 5ES4B 1OFVA 3L92A 4GI5A 1C7JA 4A2QA 2VYQA 2C2BA 1LEHA 1Q84A 1JG1A 3F8WA 1F8UA 1Q2UA 1HR0B 2PJZA 3BXOA 4IKEA 1IVYA 3U9TA 3I6ZA 4YRCA 4C03A 1U7PA 4LBVA 4YASA 3DDUA 3B20A 3E9YA 3EUFA 1FP7A 1YZGA 3M3DA 3N1UA 4NY1A 1QIIA 4CMKA 4EA7A 1L2TA 1I0LA 4P9NA 3J80A 2XRYA 5AKEA 5I6DA 3AI3A 5BPHA 2C97A 1B41A 4X60A 2FR8A 3RRBA 1A9SA 1NNSA 4XDHA 2G88A 1G42A 1T0BA 3OQIA 1E9CA 1ZISA 2CVFA 3FYUB 3IUBA 1U4OA 1I2ZA 5DNUA 1DOHA 3CUKA 5HUJA 3RT9A 1V6AA 3G8AA 2F6RA 3N0XA 4KXMA 1SIUA 4M6WB 4MVJE 4IDCA 3ZGYA 1G8AA 2AG1A 4Z3DA 3K2QA 1YE3A 3U7QA 4R6WA 1MAHA 4Z53A 4CRWB 4LJ6A 3TZQA 4YUXA 2A86A 2YTZA 3BVPA 1ECGA 4KQIA 1JI0A 1SOVA 4PGHA 3TMYA 4PNZA 4COKA 4E1BA 1LA2A 3ER6A 2VYFA 3NYQA 4DXHA 3JATA 1ZK1A 1BKYA 4U7WA 1HDZA 1N34B 3FTDA 1WU8A 5ES3A 5IVIA 1VSVA 2FMUA 3TZHA 3ANTA 3OCCA 1RQGA 1N1MA 1WHSB 1G2QA 2I3AA 3MK31 1EX7A 1JQ5A 2VUTA 4MCJA 3JYNA 4UE6A 2ZAYA 5FOTA 1MA0A 3NYWA 1YBVA 3U3OA 3VNRA 4F92B 1A4XA 1E7MA 2A4KA 4AF8A 1M2OB 4C0LA 2B4AA 3ZWYA 5L6MB 3CUEF 3AVQA 2C58A 2YJ4A 1UC8A 3BMOA 3HCAA 3R4VA 4DUYB 2XITA 1Y4AE 4FZ3A 5AJTA 3SS8A 1RHKA 1I7LA 3PI7A 2P2YA 1NM5A 4FYVA 1YONA 4FGJA 4BO0A 2D62A 4HNQA 3ZW8A 3IT1A 3ON5A 3A4TA 3TRJA 4FE7A 5JJCA 1NBHA 3ROPA 5BV1A 3CF4A 4NZPA 4IJWA 4UEQA 2ZRAA 1WDLA 3TLAA 3NHWA 2NN3C 4CMIA 5IMSA 1R18A 1E18A 5JAHA 2I6SA 4ND3A 3BMQA 5TC4A 2DUUA 5TB5A 5BSKA 1DQRA 1O6FA 2V4UA 4YJFA 3Q2KA 1CJSA 3OFSA 4DJTA 1AUVA 4F0JA 3ZE2B 1HNNA 1WXDA 3NHJA 4QTZA 4YUVA 1XXHB 1VLVA 1I1QB 3A4NA 4ALNA 4ZQFA 5IJ0A 3G2OA 4M9CA 2WI8A 2B82A 3QVUA