3FZQA

Crystal structure of putative haloacid dehalogenase-like hydrolase (yp_001086940.1) from clostridium difficile 630 at 2.10 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
271
structure length
271
Chain Sequence
LYKLLILDIDGTLRDEVYGIPESAKHAIRLCQKNHCSVVICTGRSMGTIQDDVLSLGVDGYIAGGGNYIQYHGELLYNQSFNQRLIKEVVCLLKKREVAFSIESQEKVFMNQKAKEIFETMNQLKGTNSCINKQHIQEKITYENNIEEYKSQDIHKICLWSNEKVFDEVKDILQDKMELAQRDISSQYYEIIQKDFHKGKAIKRLQERLGVTQKETICFGDGQNDIVMFQASDVTIAMKNSHQQLKDIATSICEDIFDNGIYKELKRRNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Crystal structure of putative haloacid dehalogenase-like hydrolase (YP_001086940.1) from Clostridium difficile 630 at 2.10 A resolution
rcsb
source organism Clostridium difficile
molecule tags Hydrolase
total genus 97
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3fzqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fzqA01
5ALFA 4DFDA 1U2TA 3ZVMA 2CN1A 2QLTA 1J8DA 3KD3A 5IT0A 1S2OA 2HF2A 4EX7A 4Y2JA 2YFYA 1ZOLA 2O2XA 1Z5UA 3L8FA 2P69A 3AR2A 4NFLA 2W11A 4EX6A 2HHLA 2B0CA 2HOQA 3DNPA 3NASA 2X4DA 3DAOA 3QU7A 1Z4QA 3FPBA 4G9BA 3A1EA 4Y2SA 3R4CA 1ZJJA 2YMPA 4UU0A 2I54A 2B8JA 3N5KA 5ALJA 3ED5A 3E81A 5A3QA 5AESA 5AW4A 3ZX4A 4UAVA 2YN4A 2QYHA 4CNQA 4YIHA 4HGPA 3WKAA 4DW8A 4HGOA 3QU2A 4J03A 4UASA 3U19A 3N8GA 1RMYA 1L7NA 3WGVA 1X42A 2G09A 3FVVA 3WK6A 3U7GA 4HGRA 2G1AA 1Z4JA 5ALWA 1ZS9A 2D2VA 1VJ5A 2EATA 2RARA 1AQ6A 1IWOA 5AVRA 5AVQA 1RRCA 3A1DA 3R09A 3OCUA 1LTQA 3SKXA 4GIBA 4FFDA 1QYIA 2HF7A 5AM4A 3AR3A 1T5SA 2ZBEA 3WKDA 5A3RA 3AR8A 3M1YA 5ALUA 1Q91A 5AVWA 3QUQA 3PDWA 3WK5A 3U26A 3N1UA 3L0YA 2WF6A 3QUBA 1Y8AA 1RKQA 5AI5A 3NUQA 4BYGA 1T9ZA 1TA0A 1L8OA 1N8NA 2FUEA 2WF7A 2FUCA 3IJ5A 3MPOA 2B8EA 2EARA 3WKEA 3MC1A 4KNVA 3E8MA 2DQSA 3FPSA 2HSZA 1XP5A 4CF3A 3B8EA 5ALTA 2FI1A 1RLOA 3QYPA 3AR6A 3QU5A 1YNSA 2GHQA 2P9JA 4F71A 4NV0A 1CR6A 3ESRA 4HGNA 5ALHA 2EAUA 3NIWA 2AMYA 3UMCA 4GXTA 4BEWA 3MN1A 5AI6A 2NO4A 3L1UA 5AKZA 3J7TA 4HGQA 4BX0A 3R9KA 2FDRA 5AVSA 2I34A 5AKXA 2YBDA 5ALVA 3ET5A 2R8ZA 4H1WA 3IB6A 2I33A 3F9RA 3L0CA 1RMQA 3L8GA 2ZG6A 4G63A 4I9FA 5AIAA 3HLTA 1JUDA 2YJ3A 2JAOA 4JDPA 3ZTWA 3WKCA 1NF2A 2RBKA 2CFTA 2C8KA 4EEKA 1O08A 3W5CA 4NWIA 1WR8A 2PKEA 2PQ0A 2AH5A 3QU4A 4YH1A 2AUTA 3ONNA 3P96A 1EK2A 5AM0A 2Q4TA 2HEGA 3M9LA 4BKMA 2YMLA 2NYVA 4EELA 1Z4KA 1RLTA 4CE6A 3E84A 2WF9A 3L8HA 5AKGA 3QXGA 4KN8A 5AVUA 2G06A 1QQ5A 3L0BA 2R8XA 3AR5A 3D6JA 5AVVA 4C4SA 3QLEA 5AIBA 3QX7A 4KYTA 2ZXEA 4B6JA 4Y3UA 3QNMA 3OCXA 4IFTA 1ZD4A 2W4MA 2ZBDA 1O03A 1L7OA 2C4NA 1N9KA 2FPWA 1Z4IA 5ALEA 4DWOA 3NAMA 4Y2UA 2GFHA 4BNDA 1ZD5A 5ALMA 1PW5A 3PGVA 4O8CA 2YMQA 2CFSA 2YJ4A 1RC8A 5ALIA 3OCYA 4UAUA 3RFUA 2AGVA 2JAUA 5AHXA 4KX3A 4BEVA 3CNHA 3WK7A 4MWOA 3NANA 2G0AA 1SU4A 1VJRA 2GO7A 2Q4RA 4Y2TA 4UARA 1SWWA 3U7EB 1YMQA 3E58A 4YCNA 4NABA 4MUMA 4J2TA 1QQ6A 5AICA 3L5KA 3U7HB 1L7MA 5ALLA 5ALDA 3ZUPA 3W5AA 2JAWA 5AW7A 4UM5A 4YCLA 3FZQA 4XOUA 3OCVA 1YDFA 2FPRA 1U02A 2WHEA 3SMVA 3NALA 3SHQA 4OD0A 3EPRA 2RB5A 4FE3A 4EENA 3ZX5A 4E88A 1RMTA 2HX1A 3OPXA 5AKEA 1KYTA 3OTQA 4AS3A 3QUTA 5T41A 4UU1A 5AI4A 1U2SA 3UMGA 4BX3A 3ZVNA 5AW5A 3CZ4A 2FPSA 5ALKA 4Y2VA 3QU9A 5AKIA 2GHTA 5ALXA 3KZXA 4FYPA 5AKLA 2IYEA 2OYCA 4NAVA 1F5SA 3U7FB 1K1EA 1XVIA 4BX2A 4XE5A 3A3YA 1S8OA 2HDOA 2JARA 3BWVA 5AVYA 4IG4A 2WF8A 2CFRA 1L8LA 1TE2A 3A1CA 1ZD2P 4Y2YA 1VFPA 1YJ5A 4OCZA 1Z88A 3ZW7A 1WVIA 2MU1A 5ALZA 3I28A 2B1QA 3WGUA 4YGYA 1TJ5A 1Z5GA 5AW0A 5ALSA 5AK4A 4BNDB 3EWIA 3ZI4A 1NRWA 3PCTA 3DV9A 3AR7A 3K1ZA 3BA6A 2O9JA 3UMBA 5AKYA 2HI0A 5AM1A 3KBBA 3WK8A 5ALPA 1CQZA 4C4RA 2C88A 2P27A 1RPZA 3SD7A 4PNHA 1RQNA 2YJ6A 4BBJA 2NO5A 5ALQA 3VAYA 5AK3A 3L7YA 2WM8A 3I76A 4Y2QA 3ZTYA 3EF0A 5AM5A 4OFZA 5AI0A 5AI9A 2RAVA 1WZCA 1QH9A 3OCZA 3KDPA 4XQ0A 5AW2A 5AW3A 5AW8A 1RDFA 2R8YA 4JB3A 2W43A 1EK1A 3ZVLA 4RESA 5AK5A 2FPUA 4L6CA 4UMDA 5AM3A 1Z4OA 4YCMA 2C8LA 2YMMA 3GYGA 5AI8A 2BY4A 1XPJA 1LVHA 5ALNA 3AR9A 3B9BA 1Z4PX 1RLMA 3QUCA 3N07A 1U7OA 4AS2A 3I6BA 1ZRNA 2OBBA 5AK6A 4Y2RA 3FGOA 4OHFA 5IT4A 3B9RA 3ESQA 1Z4NA 2YJ5A 4F72A 1ZD3A 3FM9A 1RKUA 3EF1A 4CF4A 5AKJA 4YIKA 4I9GA 2OA0A 2I55A 2MSNA 2HO4A 2WF5A 1RQLA 4UMVA 2I7DA 3ZWKA 2WFAA 4ZEXA 3TLMA 5AVZA 1Q92A 5ALYA 1FEZA 2VKQA 1QQ7A 2OM6A 1Z4LA 1WPGA 2BDUA 1T5TA 2JGAA 2C9MA 4HYTA 2BDEA 2IOFA 2ZBGA 3KOOA 5AVXA 1MH9A 3W5DA 5JJBA 3MMZA 1ZRMA 2B30A 4QQFA 4KX5A 3SF0A 1RKVA 2R8EA 5AW1A 2YY6A 1L7PA 1U7PA 4UM7A 4L57A 3IRUA 5E0OA 4RETA 2FPXA 5ALGA 3WKBA 5ALOA 4UMFA 3QGMA 5ALRA 2ZBFA 1Z4MA 3N28A 2Q5EA 4KNWA 2B1RA 3WK4A 4UW9A 4XPZA 3ZU6A 4CF5A 3S6JA 2IOHA 2G08A 4UMEA 3RF6A 3PGLA 4AP9A 3WK9A 4ZEWA 5AM2A 5FP0A 3SLRA 3HYCA 3AR4A 4QJBA 4UATA 2PR7A 3NRJA 1SWVA 2I6XA 3KC2A 4C4TA 5AKKA 4Y2PA 1L6RA 2P11A 3W5BA 2HCFA 2B82A 3ET4A 2GMWA 4EZEA 1NNLA 3SKYA 3UM9A 2ZOSA 5AKHA 5A3SA 3L1VA 1YS9A 3L8EA 1TJ4A 2FEAA 2ODAA 3U13A 4ZEVA 2G07A 5AW9A 5IS2A 3I1YA 4L6AA 4HAIA 1TJ3A 3OCWA 2G80A 3ZWDA 2IOFK 4DCCA 5AVTA 2IA5A 4Y2XA 5AW6A 3DDHA 1J97A 1YV9A
chains in the Genus database with same CATH superfamily
3AW8A 3SDSA 4CMAA 4HN4B 1W49A 4H7FA 2BEVA 4C4XA 1MG5A 3FYSA 1LLDA 1VDZA 3GDHA 2X4IA 3GX1A 4O2BB 4KLNA 4EKEA 1PJTA 3K5IA 1I1NA 3H1GA 1SKYE 5LFAA 1JSLA 4QT4A 1BSVA 2IRWA 1OX5A 1BA2A 1KMNA 4R1UA 4TXHA 1W85B 4H1TA 3UIEA 4HTFA 5JEEA 5BSRA 3R3XA 4CLOB 4DSTA 2P69A 4YQFA 1E7WA 3ABSB 3ACDA 1ZEMA 1ZEJA 1D4FA 2AF3C 4MKHA 1UXHA 2Q1WA 3MQ4A 4M54A 5JG7A 3RC3A 3C3AA 8LDHA 4UE2A 5B1SA 6AT1A 2BFNA 1BW9A 3OJCA 4RABA 5A9RA 1NDUA 4G09A 2VDPB 1J06A 4FGWA 5E9JA 1B8NA 1C30B 3A1EA 1ZJJA 3OIFA 2B8JA 3AI7A 3H2BA 2PT5A 3N5KA 3QITA 2D74A 3FZEA 1EFHA 4UZEA 2Z2XA 2ZUSA 4J16A 2WUWE 4NI5A 3O8CA 1SVSA 4G9GA 4GOKA 1HRKA 1N2GA 1T2DA 4F2HA 5TMPA 3THWB 1OTHA 4ATNA 1XTSA 3ZWYA 1EQUA 4K28A 1H3FA 3GLTA 1YCGA 3VM6A 2EQAA 4JENA 5CH8A 1EFAA 3TGLA 2IYPA 4P5EA 3QA9A 4Q6BA 4Y9TA 4HLUC 4UQPA 4PLHA 1EKXA 4J4HA 1FUKA 5ALWA 1ZS9A 1MAVA 4L4UA 4UEJA 2GZHA 5I9LA 2Q1UA 2HHAA 1US8B 2P79A 2X0IA 4L5YA 2DBQA 4BQFA 3LA6A 3QP9A 1OGYA 2JGRA 2X9LA 3OLXA 3K9HA 1M8JA 1FP7A 1KC1A 4PAGA 4ITVA 4RLSA 1VFNA 1PW7A 4NV3A 5FOTA 4EOGA 5AXCA 4UTPA 1Y9AA 2JLQA 2R4QA 3KPWA 3A58B 1TU4A 4TRJA 2NO6A 5K51A 2MMCA 2QF7A 2FMIA 3JQAA 1YHZA 3PUZA 3ZD8A 3Q9LA 4KJZA 2R65A 1H3EA 1V4BA 5I6DA 3D4IA 4GWGA 3T1QA 1YKSA 2NADA 2HT6A 4MO2A 5GJBA 3E9CA 5GADl 3REQA 3PPYA 2W6PA 2KWIA 2W58A 2YV2A 2O8FA 5ER9A 3PLRA 3W05A 1E8DA 1MPXA 1R5NA 1KP3A 3HU5A 2PHZA 1GTG1 4OUDB 3KP1A 1GVNB 4LQDA 1O94C 2A0FA 2GXQA 1DAMA 1Y8CA 2WKWA 5DB4A 3FROA 1E1DA 1PEDA 4OU4A 2BHSA 2PD4A 3CLTC 3GRCA 1CS4C 3BXFA 1VQ1A 3FN4A 3GI1A 2D54A 3FTDA 4MKIA 3ROFA 2IP1A 4GPBA 3GIWA 2PIDA 1NR1A 1H4SA 4QDZA 3HN7A 4BKUA 1NM5C 2IIBA 4GHWA 3ZWQA 3IVGA 2HJRA 5DTMA 2JFGA 3HDVA 3WQQA 2F4VB 4YP5A 1HDZA 3P9RA 4GOND 1PJCA 3GRAA 2CBZA 3HCRA 3P19A 4PO1A 4AYXA 2CNBA 1FP2A 3RUFA 2RH5A 3RUIA 4PFSA 3FDZA 3V1UA 3L1UA 2Z83A 3E15A 4PPFA 5FYQA 3DWGA 2Q99A 1DC5A 1IYZA 3IR7A 1EMDA 1G55A 2HPZA 4K9LA 5CT4A 4BX0A 3QY0A 1EFPA 1LF0A 4RAOA 3DUFB 2WJYA 2VPTA 3OZTA 3KD2A 4FUQA 4MV7A 3Q5DA 3WRWA 5E1OA 2BFWA 3LFTA 1G4HA 5LYJA 3H8SA 3K94A 5KQGA 4I9FA 1BWRA 5LLDA 1FYVA 2OT3B 5C0OE 3TINA 3P9IA 1KNXA 2O6LA 2QYTA 4TZKA 3F90A 3ZLUA 1VKHA 4YHHB 3RG8A 4R83A 5CVTA 2FWRA 4F2WA 5BMOA 2BTQB 2R6R1 4CM8B 1FJHA 4BBPA 2JLYA 2YDYA 2XF8A 5GY7A 3RNLA 2GCIA 3D8UA 3F96A 1XD9A 4IX1A 4OP2A 4U7TB 1NF9A 4BB9A 3CGWA 2Q62A 4ND2A 4M8SA 1AMNA 3KAPA 4JELA 3H5VA 3QQ5A 4A92A 4EO4A 3NGXA 3E84A 3HJUA 3I3OA 1PT8A 5CGZA 3MS7A 3LWBA 1PVVA 2O05A 3NZEA 3HN2A 3Q7IA 4NFHA 1XZEA 5KWEA 1ILEA 4DLAA 2R8XA 5AVVA 1PJ8A 3PEWA 4KWIA 3V2GA 1WPQA 2VKTA 5KOIA 1C7QA 3UG7A 3ZH9B 2XB8A 2ZJ7A 2IS1A 4PN7A 4YAJA 2OBYA 3N58A 1KAQA 3SEAA 2QLBA 3J81k 1S8NA 4HDCA 2GLXA 3Q2IA 4E2XA 3X2EA 3ZK9A 1P1HA 5FEUA 3DVRX 1SC1A 2B2NA 2CLKB 2W2TA 2GH1A 3M1IA 4LZOA 1G5HA 4JC8A 4P58A 2GRJA 4XIJA 3U3OA 1SUIA 1NE2A 4HNAA 4EHNA 4R7TA 3VH2A 4OHUA 1B16A 3R1IA 4Z0TA 5JYBA 3TX2A 2HCRA 5LZ4A 1I2BA 3FNGA 4LHEA 4EH1A 1E4EB 1WDMA 3H5OA 4GC5A 4CR6A 4ETNA 2OV3A 3M5DA 3WGMA 2AOTA 3KKEA 4UNQA 3OKCA 3MJSA 2GQ0A 4QUGA 4RK0A 3RFUA 5EI5A 1NIPA 3GMSA 1WMSA 4MVJI 4B9AA 2Q4RA 1SWWA 3LSTA 2C8JA 3WB1A 3X1WA 3JQBC 4DDKA 2C4MA 3BF8A 4U2DA 3R3ZA 4WA7A 1NXSA 3VKWA 4OBEA 4TN5A 4EI7A 2HC9A 1R4NA 3QUAA 1QMGA 2PAFA 4QOFA 1I32A 2BGIA 4KBGA 2NXCA 1GKUB 2CCGA 2IYZA 1GL9B 4NL4H 5ALDA 3BCHA 3WAGA 2C3PA 4JMPA 2PH5A 3V1NA 2PT6A 1BRTA 3WDKA 1N2IA 3QIVA 4CMIB 4BEBA 1ZNQO 2Q41A 4NBLA 1NQTA 1OASA 2RK6A 4XOUA 4K8OA 5A5DA 2B36A 2V7EA 3ADKA 4XWYA 5HXAA 2WHEA 2YDXA 3W9BA 3NALA 5JS6A 1NJFA 3GGPA 4RDHA 1P9LA 1NVDA 1V3QE 2QQFA 4DC9A 3L6BA 1K3FA 3FYHA 5CXXA 1GZ4A 3RODA 1JDTA 3NB0A 4K9RA 1H94A 4D6PA 1T9DA 1ZK3A 1I2AA 3AW9A 3T3HA 4HDMB 5AW5A 3I5XA 4MVJH 1G98A 4RK6A 3RVMA 1MT0A 2VPXA 3WMEA 3BL5A 1GRRA 3WYDA 4JJ6A 1KWGA 5DPMA 2I91A 3B3QA 4LPSA 1MTZA 2Q1XA 2W2NA 1AG9A 3L4EA 3B85A 2IYEA 3CX4A 4J0FA 4PICA 4HUTA 5BY2A 2QXUA 1ZM3A 4M83A 2O2DA 3K2QA 3SDZA 5FTLA 3Q41A 1TFRA 4BCBA 2FQWA 4LVCA 2WFLB 4HTFB 1LNQA 2PWYA 1W36B 4XI9A 2XSZA 1C8LA 1JFLA 3A9TA 3G2IA 3ZDQA 1P44A 1G9XA 2VJKA 2HJWA 4WLOA 2YC2C 2DG2A 1BW9B 3GC6A 2UZ4A 1Z7GA 3F7OA 2JIRA 3NIFB 4NBRA 4U8GA 4F8YA 1ISIA 5DDIP 4FNMA 1OFTA 4KIJA 3GPBA 4MR7A 2QXYA 4A4DA 1XP8A 4QUHA 4JJ7A 5DGIA 3OZIA 4KIUA 1FDRA 3AQ4A 2AYXA 4GE0A 4TMKA 3PLAE 4TXLA 2II6A 2K7ZA 2Q5JA 2XZTA 4UUQA 3TKAA 5A9SB 4A2CA 3QPWA 1Y5LA 5CCXA 4HWRA 1U8YA 1JPVA 1BKDR 1ZZGA 3OLYA 5L45A 2ZSFA 5LQSA 1KI3A 3N2NA 5AHKA 4C2TA 3M5WA 1IPEA 2XT6A 4KUEA 1L4GA 4XPIA 5HA5A 4DPKA 3FHTA 5NULA 3S81A 3QSYA 5GTDA 1Q74A 1NNI1 1JEEA 3KT8A 3TOVA 1NU6A 4LV6A 3WK8A 4LAFA 4O63O 4GOLD 2AK2A 4N54A 1COWD 1KEVA 1QVAA 2QT1A 1BDJA 2X77A 1T2NA 1CF9A 4OH1A 4BGIA 3EXHC 4W5OA 4BNFA 2PBLA 5C34B 3EARA 5CLFA 4MGHA 3AOEC 2KQUA 4M1OA 3WADA 4XGNA 1RQNA 2YJ6A 4OB7A 3ZE1B 4W4TA 1MX3A 2CHQA 3KHUA 1B0ZA 1M1NA 4F3YA 4N3NA 3ZG6A 1GYPA 5ESDA 5JAHA 4YACA 2X5XA 3H2KA 4BLRA 4YAIA 2PA0A 3HLYA 3OUTA 2B3DA 2VDKB 2CXRA 1MV5A 3TRDA 3V3TA 1FTQA 3TSAA 1B43A 5ER6A 4E11A 1IUKA 4LWQA 1Q6ZA 2HDNB 3GXOA 3JQAB 3PGKA 4Q7JB 4AKEA 5K8LA 1OYYA 2ZRGA 1T1IA 1HMYA 3NTOA 3IEPA 3K1YA 1AZTA 2GZMA 1E1QD 2BLNA 3MBIA 4KN9S 4LMAA 4M1WA 4Z86A 2E5FA 3M82A 4BJ1A 1QE5A 1W0KA 3RVRA 3W8DA 3REQB 1FS5A 3ROZA 5CA1F 3A9SA 5IAOA 2JFBA 4BVAA 2H06A 1N6NA 4X1IA 2O8FB 3RB8A 2MDTA 3NETA 4M21A 4OI4A 3N8HA 1YWGO 3VSCA 2HK9A 2VYNA 5DLEA 3RYIA 4DIOA 1II9A 2E55A 4HNGA 5CH5A 5CDFA 3R0VA 3KQLA 1HQCA 1HT0A 3E7XA 1TJYA 4TRRA 3GWZA 1U9ZA 2BFFA 2E18A 3CM0A 4NCKA 3RJ5A 1U0SY 4F5ZA 4C0WA 5A5EA 2HM7A 1J20A 3EQ8A 4WERA 5DFAA 4W1PA 1QFMA 4DEVA 3NBXX 4US0R 5EHGA 4MVJA 4J0HA 1RZVA 3ND9A 1I9GA 1T4CA 5IMSA 1DL5A 1GRNA 3EXAA 1IE3A 1OT5A 4U39A 4ZHQA 3QVOA 2J0EA 2P3SA 4YGXB 4IIBA 1JAZA 2AC2A 1I2ZA 2V58A 4HDQB 3BAZA 1QRRA 4OHFA 4RS3A 5FNVA 3ZI7A 1QAMA 3FDZB 3NC1C 2YYZA 1QONA 1JW9B 1WEHA 2QU8A 2HWKA 1WW2A 3KJIA 1EXMA 4OVKA 5JIBA 4WUTA 5K6RA 1N7GA 2P5SA 2VLIA 3L5OA 2VNJA 1WHTA 2YUIA 4IDEA 3LBFA 3QVVA 1L5QA 3IUNA 4PINA 1K8QA 1M2OA 2HBRA 4QASA 3TLMA 5AVZA 2IPLA 5A1JA 2BE9A 4EHFA 4CM9D 1L1FA 5LYJB 3KBOA 3UXYA 3OQJA 3L7OA 1T4MA 2IZ6A 2JGAA 3EDMA 1ISFA 3E1GA 3GJ8A 1C2TA 5E1MA 4F3KA 3IDZA 4MRMA 3MTEA 1DQYA 1I80A 1N0WA 2CHUA 2YTZA 3PPIA 4EEXA 4CEHA 3MWJA 4DQLA 2J48A 4JS0A 3DBRB 4BQSA 3GP3A 3QHAA 4LWOA 4MB2A 1E0DA 1KEUA 4F85A 3ZY5A 1KAGA 4AT1A 1UBOS 2PX6A 1OFVA 4E5MA 2C42A 4FDVA 2WT9A 3HFSA 4BKRA 5ILOA 3B20A 2YY6A 3I04M 1QP8A 3RPEA 1X92A 3MLBA 5EKUA 1UMDA 4ONEA 5ALGA 1Z5OA 4FHZA 2OD7A 1SEVA 2TMGA 4XTCS 3WGGA 5FV7A 3UVEA 2PUHA 1ZWKA 4ZT5A 3UFBA 3DD1A 5ALRA 5A5FA 5HQ3A 1GT6A 5GPBA 4JAVC 3L06A 1C8VB 4DNPA 2Z08A 4M7WA 5FBZA 3ISTA 4JNKA 1ZQ9A 3WK4A 1N8TA 3ZU6A 4BJ5A 5LP6B 4E1AA 4HB0A 5DGTA 2OBMA 2V6FA 3L1HA 4UCQA 5ADWA 2RD2A 4FKZA 4PVDA 5K8VA 4XM2A 4IEIA 3KYJB 4MWCA 4RTQA 3EBLA 3OLWA 4GPD1 3AR4A 4YMIA 3W79A 4CZ2A 5BWMA 4HNAB 1D7OA 3DEHA 5DZSA 4MVXA 2Q8PA 5CDHA 2EHDA 4FKMA 2QM7A 4WXPA 1HDIA 1M8GA 2NNWB 4NEHB 1JR4A 4MUKA 2IEYA 4UHHA 4CLXA 3EGEA 2HCFA 2A35A 1DIRA 3H1FA 3QHPA 4IH4A 4RJIA 4PE5B 5LBTA 2J5XA 2CF5A 3GT3A 2W00A 5JBQA 1I3NA 5FFNA 4D9HA 2YJNA 4LTMA 3JQFC 3ECAA 1KKMA 1A5AB 1SUBA 3M8KA 5D2CA 1DT3A 5EXSA 4FN5A 3MIIA 1PQUA 4DC1A 3A4NA 3HFGA 3U13A 4ZEVA 2D4AA 1CVLA 2OWDA 1V35A 3LD9A 4G0ZA 4BNVA 1D9XA 1KR5A 2D3TA 3I1YA 2FR1A 4HQOA 3HO1A 4G5RA 1MRNA 2GPTA 1DWUA 4MO9A 3GRYA 2XMDA 4KO4S 3VFDA 4EKNB 2VJPA 1PR5A 5EPOA 4DZZA 5H80A 3P4YA 5AMXA 4YRJA 5F1YA 2MCFA 2H16A 4B33A 3W7BA 4G0QA 5CB6A 1LBTA 3AEUB 2D6FA 1DVRA 1L5OA 2GJKA 7ADHA 3RHSA 4YCSA 1SBQA 1I0ZA 4W1QA 4AY3A 4P4LA 5TX7A 5TR9A 2HMAA 1NVTA 3IMGA 3JX9A 3TOZA 1QV9A 1VXRA 4LHYA 2FB9A 1SVLA 3HCPA 1W6RA 3E03A 3B7GA 3OZCA 4L7QA 3KQSA 3FCAA 1QIEA 3CIFA 3L9WA 1QF9A 4JP3A 1FMFA 3WTCA 1U81A 1J25A 2QN1A 2HSEA 3MM4A 2J33A 3AJRA 1U65A 1JTVA 3AR2A 4KDEA 4ZU3A 2P9TA 5CA0B 1GA4A 5LNK6 3B3GA 4F8EA 1FRQA 1T36A 2B34A 1EUZA 3QHQA 5KC9A 5HFJA 1KEPA 5D1NA 5EHZA 1R37A 2ZJBA 2CB0A 2IYVA 2X5NA 2J9YB 2X7XA 3WLFA 4AMBA 4G9BA 4Y6LA 3RBVA 5T4BA 1L6IA 1NQAO 5G1OA 1QIMA 2YKGA 5B3JC 5IVHA 3BGVA 3F47A 3S28A 1XNQB 2DFVA 1BVUA 3Q11A 4HRXA 2VHVA 5A62A 1PGJA 1N3BA 1OC2A 1J2JA 2Q21A 4TRMA 5T57A 3T9EA 3OBIA 2O2GA 3V9PA 1JYEA 4MR7B 2OSBA 3WRXC 3C1AA 4KRXA 4JCOA 4ZV4A 4JI5B 4G5SA 1LJLA 3DKIA 5I7FA 1QSGA 4M88A 5JEDA 1O0SA 2YBEA 4Z53A 3T9DA 5CH3A 3BJEA 3SF8A 2CL6X 1WE2A 2I87A 2RBGA 3D2AA 1OLXB 3HJHA 1DBRA 2TMDA 2BKXA 1SFRA 4P84A 4OY3A 4BCCA 4D3XA 4RGYA 4MAAA 2VP2A 3CNEA 3T1VA 3UWKA 5JSZA 3TM5A 3EOAI 3PDCA 2X4GA 4HYEA 5DMHA 3FYUB 5IJ9B 5CDGA 3TTYA 1E3WB 1EFVA 2LKDA 1E2LA 3B5IA 3IHTA 3D7RA 4U7HA 1YKFA 3EQ7A 5EVCA 3RVKA 5LB4A 1AHPA 2ZUVA 1FX0B 3M1YA 4LOHA 2BKUA 1D2AA 5A05A 3DTTA 1ZU4A 3JWGA 2AZ4A 1AKMA 3Q7RA 1W2HA 4YCJA 5ITWA 3DS8A 4BFLA 2JCXA 4TLEA 1AK1A 2QJOA 1UZUA 4DMHA 1UPAA 1DO8A 3LQYA 3N0VA 4KXFB 4L5JA 2BZGA 4IDHA 2PZ8A 3GWGA 3IPAA 4PG5A 1S8AA 1I4LD 2FSIA 2FHSA 2R00A 3OPYI 5GJCA 1Z0UA 3QVWA 4X1YA 3RSLA 3ZDAA 3MWLA 3FBWA 2JH9A 5I7SA 1KVTA 1U3GA 2PL1A 2X13A 3I6QA 4V0MA 4X1IB 2FOIA 2Q3DA 1E5XA 3DBOB 1PD0A 2Q5CA 3MJHA 2C2ZA 3HYSA 2HJHA 5TQ2A 3HABA 3LC7O 1ISMA 1XTIA 1K98A 4HVCA 4KR3A 3IQDB 1R9NA 1MJFA 1XWWA 3QKSA 2NTVA 5EXDA 2IIPA 1LD3A 3R9WA 1O6ZA 1Y98A 2IW3A 2HDHA 5J4LA 2AKYA 1E9BA 1VJGA 4M0UA 3UMCA 4ENQA 1X3LA 1Z62A 1VHDA 4NSNA 4XXHA 1CZNA 3W4JA 5M2QA 3ZCQA 1MW8X 4I66A 1RI5A 1VKRA 1FPQA 3VC3A 4TL8A 2W6JD 1T4CB 3CKKA 2EZ8A 3H3XA 3C4JA 4EMUA 3N2YA 3OJOA 1BOFA 4TXJA 1H8ED 3N7AA 3HXKA 1QLJA 3KDSE 3NBYC 1CVIA 3T7RA 2H9AA 5C9ZA 4G0OA 3R7DA 1SU7A 2JLUA 1EIZA 4L4YA 3L6OO 5F5LA 1K3TA 3MGAA 1WPRA 2YV5A 4KVZA 1MQAA 1T3LA 3KUDA 4DQVA 2H18A 3ADCA 4G37A 3BYZA 1EK5A 4M9QA 1QKIA 1XHLA 2OHOA 3KXLA 3LQ1A 4WZAE 3WMGA 2XUQA 1PSWA 3ND6A 1PEAA 1Y63A 1IL0A 1KJ8A 1ZUNA 1X77A 1VHJA 3F7MA 1E94E 3IKJA 4XB6B 2V4UA 3FTQA 4NWIA 1ELOA 4JVNA 4Y67A 4QNNA 2QP9X 2AUTA 1A8QA 4KOAA 2I7VA 2JJ1A 4I5GA 4Y1FA 2ZQYA 3K9GA 5KPJA 1RRMA 1FMLA 1UC8A 2RONA 2HK8A 1CIJA 4QUEA 3LQFA 1J0BA 5DI9A 3FFXA 1J7KA 5LA6F 3TFOA 4FYXA 2HO5A 4S3MA 4QOSA 4C3ZA 4ZI2A 1TMOA 2J4FA 3HL0A 4Q1BA 1TVEA 1GUYA 1U1DA 1XXLA 3S2YA 5JC1A 2F17A 1AKNA 3KJXA 3MTIA 4EY4A 2DH6A 2Z8YM 2J9GA 2QX9A 1V0JA 2DFDA 3QLEA 4D0NA 5AIBA 1YRLA 5IJAA 3NHKA 1Z8DA 4MPDA 3Q15C 3FETA 1KPGA 4IXWA 1UDAA 2MTBA 4U7PB 3RR2A 3UNXA 1JU4A 1H2BA 1MVOA 1UMDB 1YQEA 4PLWA 4H77A 1AQUA 3I4FA 5BORA 5T7BA 1LZKA 3GGDA 2GYYA 4N0QA 5KJEA 1QHIA 1IHPA 5EQDA 5HQ3B 4AJ9A 4POAA 3IMFA 1IXRC 3SDBA 3HRHA 4M89A 3LLVA 4E6PA 5K6AA 3I2GA 1TZCA 4DWOA 1IZ0A 3T7CA 5JXIA 1IB0A 1ZD5A 3ICQB 1ECPA 3Q7TA 3MGKA 3TJZA 3CZAA 2ETXA 1GZ7A 4U2CA 2QG4A 4RY8A 2Z95A 2EGHA 3E3MA 3GJZA 4C01A 1TQ8A 1A8UA 2PGDA 4PHCA 1PFQA 3O3MB 1QANA 4YFYA 4BO4A 2WSIA 1R8QA 4TTJA 1XFAA 5FOUA 1K9SA 1X7XA 1XDUA 2HK6A 1Y7HA 4P0PB 4B5KA 5FI0B 2P2DA 4HZIA 2Q2OA 5CA1A 4IJVA 1CWUA 3U7HB 1L7MA 1WSAA 2J31A 4BFTA 2IHZA 5ADUS 3A10A 3DOJA 3A1WA 2OXFA 3L4BA 5EJGA 4J43A 1I10A 3G2KA 4X93A 5A4KA 5DNDA 3VVBA 3SKVA 4QXOA 3HKCA 4AURA 2VATA 4DQUA 1VTKA 1AKTA 1X2BA 2GZRA 2YWGA 4GI5A 4U7JA 1NX6A 3FPKA 1I4DD 1O6BA 1SQFA 2BGLA 4LJLA 1ORWA 1XCGB 1SZPA 3OPYA 3ZLVA 2BMAA 4J0EA 2GCPA 3ZPXA 3R0ZA 1L5HA 4GC9A 4QDKA 4HO1X 3MD9A 4MV1A 1OPRA 3VOTA 3BFVA 3AY0A 3U7RA 1NLYA 3FJ1A 3EA5A 3ENVA 3ZGZA 1NRXA 5LBIA 3CTPA 5EUMA 1PAUA 3OO1A 1TUBB 5CD1A 3QWHA 3OPVA 5ALXA 5U9CA 3DEIA 1A9XA 3QVKA 4CQJA 4D8TA 2IYSA 1YL6A 4F2DA 5KYWA 4COOA 4HZUB 3TRIA 1BN7A 2A9KA 2C83A 4ZVNA 1TM4E 3HHEA 4JXZA 5UKDA 4DYHA 2Y77A 1YTLA 2GETA 3E0XA 3P0IA 4R0VA 4WKOA 1C3LA 1ZN8A 3KNZA 1A2OA 4ASUA 1QIJA 1TAHA 3DWFA 2E6KA 5J1TB 2F9FA 2O7QA 4NTZA 1FYFA 2XNKA 1IN8A 4HNVA 4Z4IA 1N78A 2M9MA 2Q9AA 3FMOB 4R2IA 3RTGA 5DOVA 3HY4A 4QUAA 1BMFD 2PKRA 1LSSA 3PDIB 3AV3A 3PNVA 4BO6A 3ORRA 3WBFA 2PEYA 3A04A 1VMAA 4BY9E 4RL6A 3UUWA 5FXMA 3IULA 2YW2A 4D0LB 5ALSA 1MNAA 1JH9A 1JHUA 2J6IA 1JHAA 4H3HB 2LDBA 2RSLA 3BE6A 3CS3A 4II7A 1JB1A 1GR0A 3DB2A 3E9RA 2VSNA 2W8ZA 3BRWD 3HKEA 3OJWA 2ZYHA 4H1HA 4INAA 3MWKA 4K1LA 4RH0A 4U02A 1VGVA 3REGA 2JFFA 4LJ4A 3IQZA 3HO8A 2RK4A 3SF8B 1U2RA 3KBBA 1ZOPA 3KTAB 3SWWA 4CUJA 2AMJA 4PF1A 3ZC3A 3FNBA 2GJSA 1Z16A 2HUPA 3L05A 3GFQA 2E4XA 2MR6A 4YASA 3CSSA 4C7XA 5JRDS 4UE3S 2H4HA 5FADA 5IUJC 4DMLA 4LVOA 1VMEA 2J6CA 1R6TA 2C92A 3ZR4B 1EFVB 3I76A 2QTLA 2ABWA 1TT7A 3DR5A 2ECQA 2FPOA 3ZHQA 1E3MA 2FX5A 5SYAA 6REQA 4Q4JA 1W4LA 4JB8A 3CO0S 3EVBA 3ONWA 3RVJA 1A04A 4ML3A 5LZ7A 3MRTA 3UEOA 3HB5X 1EQ2A 2QVYX 1L1EA 4K86A 5LL6P 3BWYA 1ODFA 3DB1A 3E2MA 4I5DA 2J9FA 4JT2A 4ZJPA 5K7SA 4HTAA 3MS2A 4QTUB 1PG0A 2MYNA 2G25A 2ZS7A 3DFUA 3E18A 3GLVA 2Q4OA 4KE6A 4Q1DA 3S4YA 3W04A 1L5FA 3ZV6A 2A84A 3BPSA 4F3NA 1KZYC 3R77A 4BNGA 1PDOA 4XDZA 1VM6A 3L40A 2BFOA 1QAOA 5AM3A 2FSVC 3ROKA 1IAQA 2GCNA 4X1YB 5CFRA 1VYTA 3PJFA 4FEYA 2OXIA 2IHYA 2VPYA 3Q3EA 3U0VA 1UWCA 3UXHA 1MPTA 1IZYA 2Y68A 1QF7A 4E3ZA 4YI3A 3R24A 3HV2A 3AZPA 5G4KA 4CMCA 1JG7A 5TQ2B 3AERA 1E1CA 1J8MF 1ZBQA 3AVTA 4K8RB 1PTJA 4ZT3A 2ZWIA 4F60A 1ZA1A 5IVDA 3N3BC 3QKSB 4WECA 3AEQA 3KWLA 5HF6A 3MAGA 1XZDA 2IX9A 4YJ3F 3UB4A 3VPCA 6YASA 3U4MA 5CJJA 2Z2ZA 3CNLA 3QX8A 3QXSA 4EITA 3NC4A 4QUJA 2DHDA 4RS4A 4RTOA 3EQZA 1BQ4A 3OZBA 4QOIA 1U3DA 3TRJA 4GWKA 4F72A 2PSFA 3PRHA 1HI9A 4CF4A 1PG5A 4YNBA 1Z35A 5DVZA 5DWVA 2JDIA 4J7CA 2JH3A 1Q15A 2QN7A 3K4QA 3SZOA 3V7NA 1A4RA 2RCNA 4WVLA 3X0DA 4F9GA 2WNIA 3HV0A 3O1IC 4ROSA 3LCJA 3O7MA 1RRGA 1YB4A 5HOQA 1GQOA 2ST1A 1NATA 3RYFA 2ZVDA 5ALYA 3UMFA 1D6JA 1A82A 2OYSA 1LUAA 1QQ7A 3CUTA 3AB7A 3MWFA 2RHCA 4M8KA 3T3GA 2IEIA 1FB5A 2IT1A 1KK2A 1J70A 3A4TA 2R1VA 2CL5A 1G21A 2OCAA 4D45A 1IUNA 3GF4A 2K2WA 3W5DA 2HNAA 4TLDA 5I3ZA 1ZRMA 4UBOA 3SF0A 4E33A 4EI9A 4R3NA 2QTFA 3QY9A 3L92A 4NS4A 1Q3TA 3RJZA 3VTFA 3PUXA 3EXG2 1TQ4A 2VP5A 2SICE 4KB5A 2BP7A 3HZOA 4C08A 3MSCA 5CFMA 1WB4A 3W34A 4Q16A 3H84A 1M0EA 1SVWA 4LRTB 2WP0A 4X41A 1SN7A 2H57A 4S12A 1TIBA 4D9FA 3ETJA 1EVJA 4LBVA 4GPIB 4KV9A 4WNAB 4YUZA 4IJWA 2G5GX 2ZSJA 2MYPA 4LV8B 2GK4A 521PA 4NCBA 1KYZA 3WGZA 3ZI0A 1IHYA 1EZ1A 1QHYA 1TKBA 2EEPA 1Y5NA 3M70A 3GD7A 4L8FA 4O33A 1I1OA 1LJ8A 1C3XA 2BMVA 2VHZA 4M7OA 5DULA 1LX7A 2AHOA 1TZMA 2AQ8A 1EWYA 1GUFA 3QI7A 3DKRA 5E4TA 3VNRA 1EB9A 4HVLA 1AN0A 3HR8A 1NWHA 3AEYA 3CWQA 4NZMA 5I5EA 3UTCA 3NH6A 1YK1A 2E82A 1ECGA 4L28A 2FSGA 3A6EA 2JIBA 1BVRA 5EHQA 4Y1EA 4ZVVA 1TKAA 4YO8A 4AMGA 2NV0A 4CL2A 4OGFA 3EBOA 1XIVA 1OD6A 3LL4A 1LB1B 2ZIAA 3R5HA 4W63A 5EMNA 1N2BA 4KNYA 3JQ7A 4OHWA 3OF5A 3PFIA 1EUCA 1K6EA 1ZH4A 3NDRA 2DFKB 4INPA 1AUQA 2VT3A 2YOFA 4P4UA 4BLTA 4BO0A 4FPXA 2VTBA 1BWSA 1QNFA 4DA9A 4EYEA 1M1XB 3USZA 2IXTA 3F49S 4MRPA 1DADA 4BMVA 2AUNA 5DBIA 5CG2A 2CMFA 3K92A 1D1TA 3B5JA 9LDTA 5I9IA 4NDZA 4NU8X 2Q5HA 1RE1A 1TPZA 2JIOA 1Z0JA 3TQHA 1X7XB 4C22A 3PB3A 5DCLA 4JI2B 2Y8EA 3IERA 2NSDA 5AUPB 5EWLA 2H1RA 4H16A 5CA1B 3D4OA 5IS2A 5BNFA 3NIBA 2IPAB 4JLJA 3O8QA 4P2BA 4YJGA 3UOGA 2C0QA 3HN6A 3I6IA 1L5KA 1P5JA 4HAIA 2M6LA 3OKAA 4MYHA 1TJ3A 3ZWDA 2IOFK 4E6EA 3Q2OA 3NKFA 2BD0A 3DE2X 4IDDA 2BBSA 3C0KA 1PI3A 3WGHA 5T6BA 3EVAA 5C4GB 3KAKA 2I2DA 4GR4A 4XVCA 3L49A 2CK3A 4I1RA 5IRCD 4UTZA 3WLAA 4F7DA 2QLTA 3GFSA 2GESA 5FWNA 4CG0A 4B6QA 1QOZA 3PNLA 4Z54A 1D0VA 3PHLA 4B6PA 5JSYA 3GQBA 5I7AA 5K0BA 4BFXA 3FBGA 5EIAA 3PD7A 1YZYA 2QT9A 3DOFA 1B4DA 2DLNA 4OQMA 1Z74A 1ULBA 1N5JA 1M0SA 4ZOBA 3U9SA 2YNMA 4AXBA 4B84A 2XUAA 1BIFA 3MRVA 5LQCA 2AN5A 1LC3A 3PRYA 1A9XB 2CC2A 1SH7A 5KYWB 3UMSA 4KE7A 1Z83A 2IYUA 3DHWC 2ZRJA 4IIVA 4L0DA 16PKA 1O57A 4XCXA 2XMRA 1LLFA 5IEBA 3JSAA 4CETA 3HNRA 4BQEA 1QQAA 4FGSA 2Y66A 2I1WA 4FYMA 4XSVA 1DQPA 3VR3D 5L9AA 1NDHA 2JCVA 2QW1A 3OCCA 2DULA 2NX2A 2Q46A 2C9BA 2ZETA 1L5NA 3DTVD 4PRLA 3INTA 1D5WA 2NT3A 2R8RA 3C5WP 1OY1A 4GDMA 1PYDA 4A3SA 1BH2A 2AN9A 1Q0HA 5A3QA 4R84A 4IXDA 2KB0A 3DP7A 4UAVA 4DLLA 1ZJWA 4R81A 1NURA 4ZT2A 1IRXA 4HAYA 4H6VA 4B8YA 4B82A 5D7NA 1CP2A 4R2XA 4UASA 4R6WA 3A3OA 5LA6A 3G17A 1QBGA 1G4UR 1I7LA 2G3YA 1YQGA 2NWQA 3PUYA 4LXGA 3ZV7A 3G59A 4HGRA 4H7HA 2CLMB 2A9JA 3H83A 2AOUA 3JW8A 4R9SA 3W9SA 4BE9A 4HWPA 4U1RA 4GX5A 2BJVA 2EATA 4JIMA 4JUAA 4MIYA 4QFDA 5T5QA 5EYPA 5JJ5A 3QEAZ 5AVRA 3ON5A 3RO7A 1Y1SA 1ARZA 2JPDA 4PZAA 2XTNA 4LY3A 4TV8F 2O3UA 2W6OA 3DC7A 3HKEB 5DBHX 4GIBA 4HX2A 3EY9A 3KHSA 4D3ZA 2PJZA 1L9KA 4RU1A 2ZB7A 1GQSA 3TI9A 3PYXA 4QBHA 3QWBA 1L7QA 4J29A 4TYNA 4X24A 3HXTA 3K8ZA 4MLPA 3UYLA 3NT5A 1N5MA 3PC8A 4FLFA 4V0NA 3WK5A 1O0BA 1TFUA 1U3TA 4ZZ0A 1G6KA 3N1UA 4XM1A 3T35A 2O3JA 3NU1A 1FCJA 2W2LA 4AK9A 2DHQA 4UBMA 4TX1A 1HTWA 4HVAA 1GHTA 4Q4JB 4UKDA 4BO8A 1V26A 3RFVA 1G60A 1N8NA 1NLMA 2WF7A 1E5DA 1P2SA 3IJ5A 1Z3IX 4QBKA 3MPOA 5FB3A 2H2AA 1SULA 4KQIA 1RXIA 4FZVA 2EARA 3IELA 5FBWB 2J9FB 4CHGA 4URXR 3I61A 4FX2A 3EJWA 3WKEA 3NV7A 1W88B 2VUUA 1E3DA 1MVNA 1X94A 1L4MA 4CF3A 4E5NA 3R4VA 4CFZA 3QNWA 4B3RB 3O4IA 2ZCUA 1T1SA 2E2WA 2W0MA 4Z4HA 4LF8B 3BIFA 3C6ZA 1WTAA 3I3SR 1M6NA 3JSXA 1MORA 2P8JA 2R5FA 1UQRA 3QK7A 5T3UA 4OFWA 3EVGA 4XGIA 4HMOA 2OHIA 1GL3A 4NARA 1PGNA 4BOYA 2VZ8A 3IAS6 5G4KB 3TFQA 1NJGA 1OAAA 3UK6A 1PBNA 1Z6AA 3AERB 1E1CB 4BNNA 1VI2A 3OFND 4FLMA 2K6GA 4FGKA 1QHSA 2CHGA 3NI2A 3SC2A 2WJVA 2ZROA 3GUCA 1XZKA 4Q4AA 5FUYA 1K4MA 3N7UA 1ICIA 2NZXA 1HE1C 3AEQB 5AVSA 1EK0A 1HKUA 1LLUA 3G68A 4CTNA 2CWWA 5DM70 1NUTA 3JS5A 3ET5A 1VIMA 1JAIA 2Q6IA 5D5PA 1OFUA 3IDAA 2FN8A 1GYQA 1G8KA 2QRKA 4JJGA 4W82A 4CW7A 2PUFA 1YGPA 1QTQA 1ZO8A 3GLSA 1U6KA 1T4DA 4UVEA 1Y37A 4V0LA 1DE0A 5C18A 5SZJA 2Y67A 1W1UA 1N4AA 3TZCA 3SYTA 4AMZA 1GY8A 1CFJA 1LDBA 1T2EA 1AZLA 1TM5E 2BV3A 1YOVA 1L1QA 2H4ZA 2IYWA 2JAOA 3AHHA 1RM5A 4DJFC 1FOEB 2XGGA 3OD1A 4JT8A 1EFKA 4FW9A 2ZJ4A 4IF6A 2XAAA 2PKEA 4EAAA 3COZA 4I1SA 1D3AA 1OFGA 3RYFB 3EG5A 4E2WA 2RHGB 2RHDA 3LCMA 4BO5A 1LFDB 5CNJA 4RK7A 5BOSB 4DV1B 3QPCA 2YYAA 3FG9A 3DEFA 3INRA 4EW1A 3KWJA 3H0EA 2ZEJA 3B5EA 1HYEA 4FI3C 2B9EA 1MLDA 1D1SA 1E3EA 1R16A 3FRHA 5AKGA 3RASA 1IZ9A 3D4BA 1VXOA 3G2OA 1Y9DA 4IUBS 3W3AH 1T8UA 4GYKA 5AVUA 1THZA 1WM1A 3MW8A 1IU9A 2ZSIA 1N9GA 1AQYA 2O7VA 4AKSA 2EGGA 2BP7B 2PRYA 4H59A 4CT0A 3FDXA 2B4RO 2VWHA 1T26A 1UM9A 2QZSA 1QH1A 1XZQA 4FDAA 3U31A 4I1OA 3RIEA 5FPTA 2NLOA 1VGQA 2QGNA 2VHQA 2VYCA 2I7TA 4UULA 3L0SA 1PZGA 4RZXA 3RIXA 5BUSA 1E5VA 2W4MA 4Z9XA 3VMMA 4HR7A 1U8ZA 1GKIA 3MJRA 3TS1A 3GELA 1F8FA 3V00A 1QOPB 1XJ0A 2Q9CA 1Q1ZA 4FMPA 4RK4A 4UNPA 2VDRB 3BXXA 2EQ5A 4L78A 3I0ZA 5LMNB 1M34A 4YAOA 2CFSA 2I3ZA 3B1JA 4PQFA 2RAPA 4WADA 4D9NA 1GRCA 4U5XA 3TDNA 1EFUA 1NJ8A 5HJEA 1KBZA 5EFZA 3EC1A 3WK7A 2O7RA 4XH9B 4ZCTA 3GB9A 4I3FA 3PJEA 5M3BA 3JQ7B 3T7EA 2OR3A 2I1VB 1Z82A 3GP5A 2XIJA 5B1HA 5K05A 2GZDA 2PL3A 4DPMA 1EUCB 5BVGB 2IYYA 4G1CA 2VXOA 2FXIA 5JMTA 1YVEI 1QQ6A 3JWIA 1F2DA 2ZI7A 3DEJA 1WXGA 1X87A 2PSEA 2H1FA 3ZYCA 4KUHA 1ZG3A 4I08A 3DOUA 4DMKA 4Y9UA 4RIIA 5DN6D 1W36C 1QIFA 2EJVA 5KWJA 1Y3FE 2I71A 2JAWA 1WTCA 3CF2A 5FORA 3KB6A 3RV3A 2P6MA 4AZ0A 5EWLB 4PG8A 4AAYA 1D8TA 2ODEA 5DHSA 1CS0B 1U8TA 3MGGA 3VO9A 4CM5A 1V48A 4YJGB 2P2LA 5E1BA 1RAFA 2JFXA 3M1LA 4II3A 4EENA 5KREA 3CH5A 3TCNA 2VJQA 2ZRAA 5JISA 5ESWA 2WIAA 5JWHA 3VTZA 3SS8A 1PR3A 3HR7A 2WM2A 4HFNA 5CPBA 3BVPA 1HA3A 1P2FA 4RELA 2BM0A 2ZJ5A 1C1XA 3TK1A 5IULC 3HNOA 4LEIA 3JPYA 1NU8A 4J16C 4CV2A 3VKGA 4DMMA 5TNXA 4OQDA 4BS9A 4AUMA 3V34A 4DUGA 3BRCA 3KXKA 5C1DA 4QD3A 5CDUA 2F8TA 4DJEC 3NNDA 5EJAA 3T4UA 3E1KA 3V8BA 1RQPA 2KX7A 4P6VF 3PL1A 2CLHB 3EUFA 1N77A 5KNDH 1ZCZA 3FH0A 5JPDA 3GQBB 4MPJA 3X44A 2P65A 3DMRA 4MVCA 4L51A 2HA4A 5CDTA 2A1TS 4FFLA 1XTBA 1T4BA 3KJNA 1D8AA 2DE0X 2DTXA 4RSHA 4X5OA 3V4ZA 1E9SA 3E9EA 5M29A 3L7BA 4YV1A 1QG4A 2PSDA 1TE2A 1Q6YA 2JI8A 4BFSA 3FOEC 3JRWA 3K6KA 1Y4ZA 3OC6A 3WOVA 5JXHA 1VFPA 3JYLA 3W3AA 3HL4A 4QE3A 3QBEA 5EZYA 4CT5A 3ZDZB 1UBNA 4HNUA 1VJ0A 1WVIA 2QN8A 2D0DA 3VVLA 5DEIA 4AB1A 3HMQA 1VRCA 4UCXA 3WLEA 3Q5EA 2VLBA 3PE4A 4HMPA 3REOA 5JC8A 3DLIA 4OL9A 1Z5NA 4YRMA 2P1DA 5AHWA 4EJFA 4D43A 1WBBA 1GSHA 5F4BA 5IX8A 3S2IA 3TW8A 1LSUA 2WTBA 5LA6B 2BKEA 5DIFA 2GBIA 4L5CA 3PS9A 3ZU4A 1NX9A 5DM2A 1KZGB 2R6CA 2NTJA 2YHBA 2DWUA 4J07A 2IUYA 3PTZA 1QZUA 2L82A 4U63A 4CLRA 3OLQA 4XWGA 5DHTA 5CT6A 3IEVA 5DLPA 1VBNA 1NAIA 5EYPB 1H5UA 2WZQA 4WLUA 2C88A 3TBKA 1MOSA 4BDSA 1RHKA 2M6KA 5L3SB 2CSXA 4EB6A 2ZATA 4BCDA 3AVYA 4PSCA 3EVEA 4PIMA 4TWAA 4RTSA 1N0HA 2BFDA 2ID8A 5JNTA 3PJGA 4N5LA 2PANA 1GQRA 1IN7A 2PLRA 2C61A 1AHNA 3DC2A 2FLWA 1Y3AA 1QG2A 3BGWA 2PLAA 4ZRMA 4JBNA 3WFIA 1W5BA 1H85A 4DARA 1H5QA 3WR5A 4DRYA 3LY5A 1JR3E 1QH9A 4BGVA 3G02A 3KDPA 3TRKA 4EABA 2I66A 2A0WA 3IAAA 4P31A 1QG0A 3BTOA 4Q24A 3ADBA 1W2WB 1ZISA 1Z39A 1WY7A 5HTKA 3VHQA 4OLHA 3PFKA 4JJ8A 1JKXA 2Q4EA 4JBYA 3IVRA 4G5YA 3UMRA 3H18A 5IBRA 2DAPA 4K6FA 4B7CA 3V1YA 2F59A 4G2NA 3LOQA 4RQUA 1ZXLA 4FSDA 1C9JA 5HG0A 5I7WA 3UC5A 4KPGA 4B3TB 2FW0A 5MGNA 3QXHA 5IYZF 1NY6A 4JODA 5EPEA 3DBVO 2ZPAA 1AA9A 2X6QA 2QRLA 3FPFA 3WLPA 5FUQA 3QVJA 5LIRA 3BD9A 2FSFA 1P75A 3EHDA 3ENWA 4NIMA 4RHTA 4F6LA 1HETA 2O3QA 2HTFA 3LC0A 4JJ4A 4ABYA 1IFXA 2R87A 2X8WA 1T5BA 3CUUA 3LHIA 2AL7A 3ZU5A 3W1VA 1T6ZA 2IGTA 4HN9A 4R1PA 3EXIA 4RKRA 5KNDA 1HNNA 4Y2RA 1PJBA 4JDUA 4GS5A 4N8SA 4E5VA 5FBVB 2A7XA 2VJNA 1I5OA 3OQHA 4I8XA 5IABA 4S0ZA 6PFKA 4MEBA 3WG9A 4EQ6A 2PGLA 4Q4AB 3SC2B 1R8XA 1K8RA 2J4CA 3GN1A 3PFNA 3L7KA 4J2HA 4TMZA 4MHOA 1EXNA 1JVNA 2PH3A 1XA0A 3ELDA 4LRQA 4PAMA 4PSVA 3N70A 3DVAA 3TSOA 5C8YA 1AMUA 4JJIA 1JU9A 3L7JA 3I2YX 5CUQA 3OT1A 1E59A 3AM3A 4O02B 4RD4A 4IOLA 5LP6C 1NBHA 4H9GA 2V7GA 5B12A 2GX6A 2ODNA 4MMZB 2ZPTX 4C2UA 3N8DA 1DRKA 3ND8A 5B4UA 1YOVB 5JMWA 1NJSA 2PGXA 1TCBA 2FE4A 2FN9A 2WAAA 2ZLBA 4GLBA 4PR3A 4RMHA 1COWA 3KOOA 1PR0A 5AHRA 2B92A 2BVNA 2QMHA 3KKNA 5AVXA 5JUWA 3LF1A 3O3NB 3JQEA 4XOIA 1JAHA 2F1OA 4RKFA 4C0BA 4RD2A 4IDOA 3CVYA 4N7JA 2O2IA 4KVAA 1DUVG 1WX1A 4V2IA 3DULA 2GTHA 1T25A 5KYGA 4LZNA 1AXEA 2HHJA 1P60A 2WAOA 1QP4A 1JQKA 5C8VA 3Q98A 1ULTA 4P3KA 4RETA 4AF7A 1MQ8B 2X3FA 1LVUA 3HJCA 3LYLA 1FNBA 4RXUA 3A4YA 4X54A 1GJRA 3BWBA 3B9PA 6Q21A 1TIKA 2ZBFA 4O29A 4IIYA 5BN3A 1MEEA 4NEGA 5F5XA 2I99A 1VE7A 1BC5A 2BT4A 5DT9A 1Y6QA 1NJ1A 1SHJA 1MC8A 2FR8A 4PRZA 1UM9B 1SGWA 1U80A 3NGMA 1P2VA 1UK8A 3K8QA 3OOHA 4WKBA 4H4DA 1BHSA 4I2NA 5AM2A 2IHNA 1KYQA 2F67A 3SBDA 5JAIA 2FPPA 4M36A 4GL4A 4HWTA 3B48A 4I4TF 4ZI7F 3HYCA 1C3EA 1C2YA 4QJBA 3WGLA 1YL5A 4HNTA 3PD0A 3W5VA 4K9MA 2IE8A 1IEQA 3O91A 2DWCA 4RJLA 4R3UC 3TGWA 1I3CA 1RXVA 1Y3BE 3BWCA 4BP8A 1M34B 3DYIA 3GGOA 4PYQA 4PGMA 1FNSA 4FMCB 3RFTA 5JS8A 1H1LA 3GRPA 1I9CA 1HQYE 4L9AA 1KWKA 3L7IA 2PLNA 1HDGO 3IAM1 1SK9A 1CJBA 3NPMA 3U3KA 1IK6A 1JSRA 3DL4A 3S1AB 1MW9X 2CHVA 3EZYA 3UM9A 1ZGAA 3Q2KA 3IOEA 1ULSA 2XMPA 1F3OA 3L1VA 4HEHA 3QE4A 4FBGA 1E2NA 5K0ZA 4FZRA 3BJMA 1PO7A 2QTAA 3FSGA 2B5WA 3PPXA 5TARA 1L5RA 1Z36A 1R2QA 3THRA 4DIEA 4ZYUA 2ZUFA 4XRGA 1TJPB 1X1BA 3Q12A 1AE1A 4TV9F 1SCAA 4N12A 2VK1A 5AXDA 1LH0A 4WKNA 4FSXA 4INJA 1MZVA 1PZFA 3FXAA 3QW2A 5EGNA 1VG9B 4Q03A 2PNJA 5ADVA 4KQKA 3H8VA 2NSJA 3L1KA 4AZ0B 1DPFA 1UMCA 2ECOA 2FWIA 3ER9A 4PNZA 1BGVA 4R1OA 1QIGA 3RAFC 5K0NA 5F33A 1U94A 4AUNA 4EY5A 5AJZA 3CCFA 2G1KA 1E0AA 2IUSA 5B7QA 1HORA 1KO1A 4RKQA 5L7YA 5IDQA 2PZEA 2C2XA 5DASA 2CD7A 1WXEA 1C1XB 4RMNA 1RP1A 1N92A 4MUJA 4WXEA 3R6GA 2XGMA 1O8BA 4P7JA 4U2GA 4UHFA 3OIYA 4EUNA 1DKUA 1WZEA 3ULKA 5JROA 3HCEA 5BT8A 4YJ3B 1Z5UA 1CRQA 3BCSA 1R0BA 3DR3A 5E3JA 3ZJVA 3AO0B 2VUSA 3V4VB 4HWKA 5FH9A 4PCAA 2CXOA 5I7EA 4AM8A 3P0HA 1A5ZA 2R96A 3AVQA 3FYUC 1CR1A 4R8MA 5CJPA 2QB5A 2ASVA 4TYPA 4BFUA 1A88A 1H4VB 4J3NA 2D7CA 3A3NA 3DKPA 4LY6A 1F60A 1TO6A 1I36A 3QMPA 1S4QA 2VDVE 4C7BA 1JEJA 4PLFA 3N0RA 3ZX4A 3OF3A 5JAMA 2C8VA 1ORRA 1SUPA 1XD2B 3BL8A 3EOBI 4FBLA 3R3JA 2IVZA 1PFWA 4MV6A 2WUFA 4I6GA 5EZYB 5FR2A 4C05A 3F6SA 5ICSA 1G2PA 6NULA 5ES4B 4M3NA 1CTQA 3AJAA 5KVSA 1Q95A 3PQ3A 4IZHA 1P1BA 5F77A 4OLAA 4PTLA 3WGVA 2LIPA 3VUEA 3T1YB 4CU5A 3NHLA 5FWYA 3U81A 1R27A 1A50B 5F35A 3GO4A 4JY7A 1SBNE 1BU8A 4OG2A 3TQFA 4Q9LA 1YJCA 1JE0A 3EULA 5IJ0B 3CLUD 2W2MA 3TW8B 3JYPA 4TTSA 3N2LA 2NU8A 1K3UB 3E3AA 4EJ0A 4DQXA 3IUSA 2ZJ8A 3EPLA 2O2YA 3V2HA 2I9PA 4BQPA 1JZSA 3BK1A 1E1KA 2X1MA 1KE1A 4DTIA 3T5MA 3LT5A 2PH7A 2EQBA 3NEAA 2HZBA 3GLHA 4LIPD 1T5SA 3S7ZA 4D2IA 1ZJZA 4IW3B 1UP7A 3PXDA 1ECLA 1YSCA 3UWDA 4CIYA 1U1EA 2JLSA 1UP6A 4EB6B 4L0CA 3P1JA 3SLKA 2D4HA 2QD2A 3I9LA 2NZUG 3QLUA 1RE0A 2N9UA 4J0IA 4M8IA 4M46A 2K5UA 2X4LA 1E1RA 3QUBA 4FS3A 4MRRA 4TTPA 4TVBA 4PYKA 8OHMA 4Z9FA 3MJDA 10MHA 1KC3A 1Y8QA 3R6TA 4E07A 4BRUA 2BM8A 1YBMA 3JASA 2XUJA 2FUG1 2WM3A 4BBAA 9ABPA 1L8OA 2HSWA 4OX9Y 4QGSA 2HRDA 3FPAA 4QEDA 2QY9A 3PP8A 3WGJA 1I3MA 4DADA 3EZ7A 1E58A 1D09A 3DKKA 4HADA 4TTIA 4YA6A 3QG5A 2PZLA 2XKBA 3FOZA 1HFEL 3I01M 3ZWMA 1GAJA 4KYVA 3W2GA 3E8MA 3HU1A 4C7MA 5EJ8A 3L77A 3OJEA 3CXRA 1QYXA 3L7MA 2XNCA 2TYSB 2V3WA 2N42A 2FI1A 2ZKIA 4NQZA 2Q1TA 5KTKA 2F64A 2QVGA 1W48A 2G9RA 1K86A 3O74A 4GO1A 1ZKDA 2V7WA 3JD4A 3X2SA 4QWWA 2CNDA 1CR6A 1YA8A 1ZGJA 3T0GA 1HYBA 4GYYA 1SCKA 3X1JA 3R7NA 3ORSA 1RZ3A 2E4YA 4JHXA 1E60A 3CX3A 1K4YA 3AKDA 1NGSA 2YXLA 4NX2A 7REQA 2NG1A 4ENTA 3F7NA 2FFQA 5JXGA 4ZO6A 5J4KA 2PSHA 4A15A 3W90A 4DUPA 3EGXA 1XZBA 1CUEA 1Q2UA 1I94B 4P4TA 1YB1A 4O1HA 3EXIB 2FPKA 5HWSA 4CDRA 1SD2A 1HE3A 2PBZA 4WESA 3U4IA 3IB6A 4X60A 2WFZA 4K9NA 4WN9B 2JI9A 2MYUA 2X0FA 1L5VA 3COVA 5BPFA 3K6SB 2R84A 3MUEA 3OZFA 4EQ6B 2QTHA 2Q2VA 2PWBA 4B76A 4V1CB 1XRLA 1YBFA 5L3ZA 2VL7A 3QV1A 4MUNA 4M2LA 3W5SA 5I8PA 3W6NA 4ZVUA 1NP3A 3ZIDA 5JHHB 1O08A 1WP4A 4FGJA 4LN1A 1W4RA 3FLBA 5SZKB 2ZE6A 2ORIA 4AXXA 3ZD7A 1LBEA 2QN9A 1P5FA 3WWDA 1KQGA 4EZIA 3FVTA 4XWTA 4AQYB 3ONNA 3P96A 3LXRA 3RJ9A 2XB9A 3ZIAD 2RGNA 4MP8A 1FMTA 3W5UA 4LE1A 2ORWA 1YQWA 1RZUA 1KI8A 2F3PA 3CC8A 3AJ9A 3FOAA 4L72A 4U6SA 4B4DA 1EUDA 4BV9A 2PPVA 3OC0A 4ZI5A 5BV8A 1U9YA 3ZDDA 2HLDA 4LZJA 1DJMA 3S1LA 3LT1A 2OQVA 4PLCA 1NW4A 2HA7A 4KBYA 1UBLS 4J7AA 3KKZA 4TROA 3AUUA 3TNLA 1J0DA 3DPSA 2QAJA 3K4HA 1HT1E 5IARA 1KFCB 1WOMA 5B3LA 1QPZA 1MC4A 2CSUA 2HXSA 2IC5A 1I8TA 4ZZIA 4BKPA 3A1TA 2ZDQA 1RR6A 1SBTA 2RAFA 4NYJR 3L4JA 3WSWA 3UN1A 1N7JA 2RH8A 1N9KA 3IP3A 4E21A 3IQIX 3MJEA 1C1DA 1J2EA 4TV8B 4JP8A 3WYGA 1Z6XA 3F46A 4OBBA 4HRVA 4ZVTA 3NAQA 4EHJA 1MHPA 5C5CA 3FVWA 3HDTA 1FA9A 3B6ZA 3CPJB 3WGTA 2JEYA 2OXTA 4QQNA 2Q6LA 1J0XO 1JG4A 1N6RA 3KPJA 1PLLA 1V43A 2BM1A 2HBZA 2QD1A 4K9SA 5EERA 4IVNA 1JBEA 2FG6C 1WDKA 3G79A 8ABPA 4UARA 3U7EB 1LDNA 3E23A 4QX6A 3SQMA 4DQDA 2HCBA 4MUMA 3CF6R 2IL1A 2JGIA 2W6JA 1E77A 1H1LB 2CE2X 1XO1A 1NUAA 2ZIUB 4B7AA 2OILA 3KOZA 3WJ2A 4XD7D 5ALLA 1YO6A 3HVHA 4NJEA 1TQDA 4Z2YA 3RSCA 2I2WA 4OOEA 3M3PA 4F46A 4CYMA 1FBNA 3A1SA 1DJNA 3E5HA 5E4FA 2B1JA 1RXSA 3O8LA 1P77A 1CUXA 2DWOA 3CNBA 4M9ZA 4BNJA 3VJRA 1UMBB 1PN3A 2A5LA 4ZYLA 1Z22A 1EWTA 2PM8A 4IUDS 4MK4A 1BU5A 4DLTA 5IYZA 4I9HA 3K7EA 4ZU6X 4BZZA 3LZDA 4PYRA 5LOVF 1KVSA 3UCEA 2AXQA 1QB7A 3PUVA 1USKA 1N2CB 3TZBA 2CXQA 5K8CA 4UBIA 4D4JA 3LVFO 2LIVA 2YXNA 1QG6A 4AS3A 1RJ9B 2DY1A 4UOQA 1QS0A 4XAQA 3ROEA 3OJFA 1UMCB 5EJ5A 2B8NA 3I04A 1UJBA 4RV4A 2LTAA 2J30A 1UJ5A 1T2FA 1KHTA 4Y2VA 5JATA 3DZDA 2GHTA 3H42B 5BQFA 2IEBA 4IRUB 3AF5A 4YT8A 4BNIA 4J7XA 3HZHA 2HXGA 3KO8A 4FR2A 4ZQFA 1ZW1A 2GXUA 3GLIA 1TL7C 4UHKA 4R7GA 5FTNA 3PQEA 1UK6A 4CL3A 4CXMA 1ZGGA 3FNRA 2OAQ1 3KT0A 4IIGA 1KL7A 1MDBA 4RZQA 2NUBA 3DAYA 2B4YA 3F98A 4Q18A 2MHCA 2WF8A 3ZLJA 2NP7A 4TKMA 4K0KB 2CDNA 2YY5A 4K0RA 2FQYA 4G36A 1YJ5A 2P40A 3T52A 2QTVA 3JWHA 4BFVA 1DKLA 1JIVA 4X97A 1WLSA 2X7HA 3I2IA 2FZKA 5ALZA 5JE8A 4EJSB 3I28A 1V4VA 3TLJA 5L95A 4DA0A 2NVBA 2YQ5A 2QUAA 2B1QA 2VG8A 1JAXA 2YHUA 3EQ9A 3G49A 2BFBA 3K1JA 3IPRA 4QGHA 5AW0A 3ESAA 3U1BA 2GILA 3CLRC 1GEGA 1ZVKA 1KYVA 4MUHA 1WS6A 1G0NA 1XQ6A 2FWBA 4G24A 3UGQA 4BUCA 1CRPA 2VRWA 1DU4A 4PFJA 3DZCA 2DLCX 4CKCA 3V5NA 3GMIA 4EF6A 4BB5A 3HM2A 1IEXA 2CF6A 2V6BA 1CD5A 2ZYTX 1ZM2A 3AHFA 3D0RA 3FRJA 3V7WA 1UXOA 1BS9A 4PO9A 1P6UA 4E4TA 2P78A 3TUZC 4JYAB 4LJRA 4B45A 1L3IA 4HBGA 4JVSB 3D8RA 1OXVA 1W0JD 1IH8A 1QWSA 2WU0A 3IBYA 4FNAA 2NU8B 5LQNA 5DKFA 1BS1A 1L9XA 2MMGA 2ZR9A 4BBJA 4IVPA 3QTLA 1YI1A 5ALQA 5HW0A 2ZPUA 5IBCA 4GPEA 3L7YA 4LISA 1OVMA 4LOKA 3JATB 4A8JA 1KIAA 2J9XB 5FUBA 3MGCA 3SE7A 2XXAA 3NDIA 3PXXA 4QTTB 1GAQA 4ZI7A 1EX9A 3C5CA 3NCHA 4YFVA 2RAVA 3RVQA 1E61A 1LBHA 2DLDA 3FMFA 4NBVA 3WYCA 4WZZA 1KI4A 4HP8A 2Q1SA 3A1NA 3DMPA 4K9DA 4K9QA 3DV0A 5F1KA 4ZAVA 2EKPA 3QBJA 1Y1TA 1RDFA 2R11A 3SCZA 3VKUA 2QUJA 1Y8QB 1T3TA 2P35A 2OGWA 3HEAA 2JKYA 4GBGA 5H3CA 2KPOA 2BFPA 1MR3F 2XNHA 5CITA 4F4HA 4J0GA 4RY0A 1DOHA 4V24A 2YMMA 2FUKA 3B6KA 1FS4A 4DZTA 2XCSB 3ABZA 4MZXA 2OCLA 3A6JA 5EP2A 3PEFA 3RBZA 5CCDA 3ZY4A 3S8MA 3T7AA 3AGQA 2D62A 3OM8A 3KYIB 3D8SA 3C3KA 5TGTA 1T8YA 2H52A 3Q0TA 1E2QA 2QEQA 4MW5A 4TV9A 1KZ4A 3CTMA 4LJAA 4I4IA 3FMGA 1F0YA 1OLUA 4QLAA 1X1DA 1O3YA 4DM7A 4GRAA 3QUCA 4BJ6A 1JECA 2C3MA 2HIGA 4YREA 1U2DA 3IAFA 1FU4A 3KDAA 1Y34E 4HSEA 1FLDA 4DS3A 4EMBA 2JGMA 4HGZA 5KNBH 1BXRA 3H04A 3LGSA 3O6VA 7REQB 3K0FA 5K3SA 2Q5OA 3RAEC 3QELA 4F1KA 1PL0A 2XI4A 2YJ5A 4O3MA 1M2HA 1Z2AA 1N7HA 1E9DA 4NF2A 2GBLC 2Z56A 2GNAA 2DF8A 3LGXA 4TKUA 3UXEA 2JCBA 4WESB 3ETCA 3K31A 3A27A 4X94A 5IUKC 4ZTZB 2HO4A 1T0JB 3B6MA 3DFFA 4JUFA 4E2ZA 1NW9B 2O3SA 2WFAA 4PLPA 721PA 4BU0A 1RPAA 3CV3A 1Y1LA 3ETGA 3ICOA 3FHJA 3WLTA 4Z4CA 2P41A 5EAIA 3BRWA 3VNUA 2DU8A 2R48A 2VKQA 2WOOA 4JB2A 4WUVA 1XK7A 1CQIA 1F51E 1RU3A 2JJ2A 3HCNA 4R1SA 5J5VA 5ELMA 2DPHA 5E7IA 1NUSA 2D2XA 2D5BA 3OTGA 4TGLA 3FVRA 5K6AC 1KGDA 2P9QA 1U0EA 3CMMA 4BPBA 3H9GA 4XR9A 2QL9A 1BE1A 1P0FA 2RHMA 1L8QA 1RI2A 2I7CA 2PZMA 4MQEB 3E9ZA 4IIHA 4NK5A 4OQLA 1P2DA 4M0FA 1HURA 4D8YA 4AYTA 2ZE8A 4B2LA 2I4IA 1I4WA 4KMRA 5EIFA 5G1PA 1NMZA 2C54A 1EUDB 2YC4C 2X76A 1PQ4A 3AHJA 3GFBA 3LPLA 4L08A 3OG9A 3ITNA 4A16A 1CUAA 1KO7A 3GARA 2R2AA 5MDHA 8GPBA 4KN5A 5FLXA 1XTRA 2JJ8A 3FLAA 1NN1A 1QWOA 3HBLA 4GGMX 4X45A 5A4MS 2XKJE 4GEKA 2I6SA 3BBPA 2ZIXA 4M7PA 3L4BC 4W1RA 3Q8MA 2A5YB 3Q7QA 3N0WA 1PHRA 4LX8A 1MA0A 5SY6A 1JYFA 2G04A 5AXAA 3OZEA 5F9MA 3KVRA 3WL7A 3LXMA 3VR2A 2ZT7A 1T9GR 1SVMA 4R98A 1C1DB 3GGCA 3P94A 5IKPA 1UKBA 3PK0A 3IIEA 1MB4A 3TTVA 5DO9A 3AM5A 1Z18A 5KYYA 1G8AA 5A6VA 2P11A 4KV7A 2DYKA 3JQCA 2A7QA 3OU7A 4GKAA 4OB8A 1G1MA 1W5FA 4RJKA 5CT9A 2QMYA 3RC2A 4WBNF 4WV3A 3RYCA 3WZMA 2ZYAA 1YF3A 2UDPA 2P6PA 3RRNA 3PR3A 1IM2A 4TYMA 1AGRA 5C5IA 1ZGBA 4KU4A 1IUOA 3D7SA 3MILA 2ILVA 1RYBA 2FEAA 3U4QA 2ADFA 1UJ4A 2ZQZA 3FFAA 4KACA 4N65A 1DGQA 5JXWA 1KZHA 1U2GA 2GEBA 4NJEB 4ON9A 2PFGA 3PA6A 3TQTA 3UUEA 2DMRA 3LSYA 4JR2A 3ZZ1A 2BGJA 2KBFA 2ORYA 2HD4A 1ZSNA 3LXUX 3WICA 2FKNA 3E5MA 1YJQA 3NIDB 1A9ZA 5K3CA 5KNBA 3FHCB 5HDQA 5DT2A 1U2ZA 2BLLA 3JARA 4AN4A 4Q00A 5IYZB 3TSYA 3M7IA 4RANA 1VYHA 5EWJB 2PCLA 3MJVA 3PGMA 2OCYC 4DCPA 5KQSA 4Z4FA 4U7DA 4ZA2A 7MDHA 1JR3D 2CV0A 1H2ZA 3K9BA 4BQIA 1XRSB 3SJCA 1VYVA 1QS0B 5IT0A 1ACJA 1N2ZA 1XI2A 1E2JA 4FYYA 4IIUA 1RZRD 2WA2A 4LQCA 4OBXA 4QBIA 2OCDA 2FRVA 4EB0A 1U90A 3AJEA 4XDGA 1SEPA 3CINA 2O0LA 3CPSA 4F9TA 2IYAA 4A91A 4FDLA 3ME5A 5JZOA 2VT7A 3BORA 1B8VA 3GLIB 4O8ZA 4EHLA 3R7BA 1UXIA 4OHYA 4QGAA 4HQRA 5GWXA 4Y8VA 1OWMA 4EO7A 1SKYB 3M9WA 5C4MA 3ZXSA 3JZMA 2X8AA 1PP4A 3RS4A 4HLNA 3EGOA 4DR4B 2I54A 2OSVA 1T0PA 4HWSA 1SBYA 1CRWG 2JFUA 2I6UA 1RC0A 3N86A 2GLUA 4A82A 3W6OA 5AW4A 1N2SA 4WPGA 3EIEA 2RIPA 4YIHA 2R5NA 3WMWA 1VJCA 3G89A 4KDRA 4X8LA 4EHAA 5ADHA 2D1SA 3GLKA 1AN9A 4INZA 4RY2A 2EFGA 4WFKA 3C87A 2BBOA 3SM9A 3ZWNA 1KGSA 3ZZ0A 1V41E 3ZZTA 2BFBB 3SG0A 2F8MA 2D2VA 4YB8A 4AO8A 2B3TA 2ZZKA 3L8DA 2X2FA 3SFTA 1AY0A 1RWVA 1VSTA 2HSDA 1T8TA 2JZCA 3DHYA 1V1RA 4FYKA 1X2EA 3ND7A 4QU5A 3RW9A 1QLHA 4C3VA 4ZOQI 5L51A 2IYLD 1UBKS 4M8LA 4CKCB 4AC9A 2D0PB 2ADMA 4ZMBA 5MFPA 2EU8A 1KSGA 4FWTA 4MV8A 4ZPXA 1VC2A 2QRMA 4ZVLA 3BH0A 1G19A 2YCBA 2F1KA 4HDOB 2POCA 3H7AA 4AKIA 1UBJS 2ZBEA 3CVOA 3ZDXB 1JA9A 5CXQA 1M5UA 2AEFA 4CDGA 1N2HA 1YIAA 3JR7A 4G4SO 1E2IA 3FTFA 3GZTB 4JC0A 1XU7A 3IVMA 1NVEA 3INGA 3TKLA 1EGVB 2QX7A 2PLWA 1PTJC 1RLUA 3B36A 1XTUA 3EASA 3GPCA 5DXJA 3LKBA 3WMXA 4A8JB 3S2ZA 5AI5A 1VSQA 3QSGA 3IDQA 4OQNA 2AW3A 1QHGA 2W9XA 3ZEAA 1V5EA 4ZI7B 4MPTA 2M98A 2C0CA 1HDCA 4XLTA 5JZBA 1W4AA 2BHLA 3C2QA 2IGBA 2WWHA 2J59A 2YX1A 4XCVA 2FSSA 1RWWA 3DV0B 3PF9A 3UHOA 2HKIA 5T4FA 2ZFUA 1Y1KE 3HVJA 4RK1A 1HG0A 3IEUA 5ED0A 5LLSA 5FA5A 1KI7A 1OBHA 3VYUB 1Y80A 4DLVA 1RKXA 2G28A 3ESCA 4BGUA 1NZFA 4EGQA 2V59A 3A9VA 3OUZA 4P86A 4PLYA 5E7JA 1MRSA 3U7QB 2C4WA 1EFTA 4LWZA 4JBXA 2EZ9A 3ZHVA 4F3RA 1WA5A 4NV0A 4EW2A 1GITA 3ABRB 2NW6A 3EJ6A 1ISPA 3ER8A 4B3HA 1Z3CA 1EYZA 3GIDA 2D7DA 2O52A 4B32A 5LOVA 2AKAB 1DP4A 1W0CA 2OFOA 1H6DA 3ICVA 1V6AA 4YQEA 2ALJA 4TV9B 2BHTA 2O8DA 4L8LA 1DMRA 1PR9A 3KJZA 3LDHA 1OLUB 1X86B 3H87A 1XCJA 3VVCA 3HZRA 4HLQB 5SY9A 3TLAA 4PBTA 3G88A 5CVUA 3R9KA 2NV6A 3V6MA 5G0TA 4C21A 4M55A 4UDNA 4BNTA 1GPKA 3CZ5A 4JJZA 3LX4A 1ECFA 3P0JA 1BXRB 4YRNA 2ZAMA 3FTNA 1EBUA 1RVV1 1CDEA 2NXEA 3QELB 4E5YA 2XQKA 1NR7A 3GZ4A 1QO7A 2VBIA 2VTDA 1JJVA 2HV8A 2POQX 3D3EA 4L4ZA 1HQDA 2WTXA 3PNKA 5AWFC 5JLAA 2FRDC 3G2QA 4TKUB 2VA8A 2ZBVA 4F6RB 1K7SN 2ZK7A 3A6ZA 1E66A 3FZGA 5DWDA 5CT5A 3U4AA 2GYVA 3ZLTA 3KOMA 3AP1A 1Y6GA 4RTJA 2G8LA 4X8OA 2OHGA 5B6IA 3IXQA 2EDCA 2PQ0A 3FE2A 1POWA 2ZCVA 3O1HB 4EBFA 1CRZA 3GAAA 1K8XB 1F4PA 1UDBA 2J8ZA 2AZTA 3KSMA 1X6VA 4NBKA 2FEXA 2YMLA 4YJFA 2FGJA 5BVHB 1HYQA 3CNOA 4UEQA 4B3BA 2W42A 1WEKA 3RSHA 2HF8A 4FXOA 4W6ZA 2CVPA 1Q0PA 3PYMA 4U7WA 2NSYA 4YQZA 1BDMA 3DEYX 1ULZA 1OXBB 2G06A 3HB9A 4J3FA 4ENSA 5LDDC 3PTAA 5JHGB 2HR1A 2V6MA 3TQRA 3QXJA 1NSTA 2JCYA 4CDMA 1ONNA 2IS6A 2DVMA 4GF5A 3U3MA 4YP9A 2C5AA 1JWLA 4TM8A 1L8XA 1MO2A 3L8MA 2K7FA 3AXTA 1YCHA 4C4AA 2PMWB 1NNSA 1VLLA 2FK8A 3EF3A 3OFJA 2XWJI 1ZK0A 2J6BA 4Q82A 4S1NA 2ZVQX 1ZR2A 1C0EA 1WCV1 3SMQA 3SP1A 3H2GA 3C3YA 1SVUA 3UJPA 1Z4IA 2FMTA 1NNUA 2WKSA 3NAMA 3SYNA 2FDCA 5DSXA 5D3ZA 3BS4A 3WLLA 5HZHA 4O8CA 1IWPB 3AL3A 1NQUA 2WJWA 3DDSA 1QAQA 1VL1A 1X13A 2YXBA 2EKQA 1TM2A 1Z7WA 1P9OA 3FZNA 4NS1A 3SJUA 1RC8A 2YS7A 2YV3A 4B48A 1KEKA 2RGCA 1D03A 2CXPA 2W6ZA 2XRMA 1TYZA 5LPNA 5FA6A 1G7RA 3JZFA 4MQFA 1F2TA 3THSA 2GGSA 3I34X 4Z9YA 2EFHB 1SU4A 3FJYA 5THKA 5IAGA 3B6IA 4LJSA 4ZFNA 5EIEA 3VBEA 4J2TA 1QGED 2CGEA 5HRAA 1JA0A 1YGYA 2BCGY 3FMIA 2C84A 2DBZA 3PZBA 3QBDA 1PK8A 2J9ZB 3FCSB 3RYCB 2CXNA 4J0DA 2H29A 4URYR 5DGDA 4ZCQA 1ZW6A 3O2SB 1U7ZA 1WV0A 2YNMC 3GRFA 4WWHA 1HDXA 1TUIA 3FVQA 3KQMA 1X0VA 1ZSYA 1ODSA 3ANNA 4UM5A 1T8RA 5AW7A 5D7BA 3FCXA 4N3BA 4RVGA 1JF8A 1O95A 1DAHA 1T2AA 3K6RA 4XQ9A 4FDUA 3U4QB 2WK1A 1JLKA 3SMVA 3L6RA 1FF9A 1GQYA 4W7SA 1YUMA 3BG5A 1P9NA 5BO5A 3IUYA 2W2XA 5ECWA 1C9KA 3MQFA 1CBUA 5IVKA 4LC0A 1B3RA 3C5VA 4IP0A 1G16A 5BQOA 3OTQA 1ZLYA 3LHKA 3QUTA 4IIJA 1IXSB 1J33A 4Q1FA 1JT2A 4C7KA 1SIOA 3ZWXA 5KOHA 2XOKA 3JARB 1RKBA 4BX3A 3ZVNA 3SXUA 1SCQA 2PUVA 4U9IS 1GGHA 1T2CA 1S2NA 1T6XA 4MWGA 2A3NA 3F6EX 1BMQA 3D64A 2UUBB 3PHIA 1SXJA 5EZ5A 3ZS9A 1M3SA 3TLEA 3T1TA 3U7FB 2B4TO 3UPTA 2PQ2A 3TX6A 2J3LA 4OBWA 1Z29A 4DJAA 1JTEA 1AKEA 2A9PA 3GA0A 4KPUB 1N5KA 4ETWA 2AZXA 1F4LA 4WOKA 4A2QA 3ES9A 3AG5A 4OQXA 4DG9A 3PD1A 3RHFA 3INYA 2VTKA 3HBFA 1JHQA 1ZD2P 3L04A 3OVMA 5F3DA 4OV6B 5F73A 4KPFC 3TM4A 3W3ZB 3G7NA 2J5RA 1UK7A 3ABQB 1IXYA 2A94A 2C2HA 3Q6IA 5AUQA 1C41A 1OVGA 3KXIA 4ZKDA 1KDYA 1HEYA 3K0EA 1RJGA 1WCIA 2QR3A 1N32B 4DG8A 2WV7A 3CVUA 3PC8C 1PQPA 4WCVA 1Z9BA 4Q3BA 1RXWA 3EVZA 1X7WA 3LT0A 3BTUA 3LPCA 2VDLB 2QUHA 4FR5A 3U3RA 4G3XA 2P1RA 2C2OA 2PT9A 2ZANA 5AJWA 3O8RA 2XBMA 3UV3A 4LC9A 3I2JA 2J0SA 2O3TA 4GXRA 2AJDA 2AI1A 2QIOA 1E89A 3GOHA 4MUBA 4BMYA 1KOGA 4GLOA 2DHRA 3LBYA 4D6XA 1NXXA 1J7JA 2AJLI 1PGOA 3C8UA 5AKYA 2HI0A 1N7IA 3TTSA 2B4AA 13PKA 1KMHB 1RXCA 2R7AA 2XMSA 1Q17A 1IN4A 1V1RB 2OGSA 5K4HA 2FSUA 2V0NA 4P3NA 5GM1A 3V46A 4ARIA 4NE9A 1ONSA 2C98A 4QWMA 4KEAA 2O57A 4BE4A 1FTYA 3TZHA 2WVJA 4RFSB 1CQJA 1HE8B 1XJWA 1Z17A 2C82A 4NNPA 2MSDB 4DKJA 1EJ6A 3UTDA 1UKZA 4RENA 3JD1A 4R7ZA 1DXQA 2QGFA 2HFJA 3T9BA 3NCTA 1M76A 1V5GA 4LXYA 1QPGA 1A9PA 1NJ2A 2PK3A 4QU0A 2PX8A 3EZLA 3I5UA 3OKPA 5CEFA 3EFBA 3EGDA 3JD2A 3HEMA 3L43A 3LP8A 1TB4A 5HQJA 1GARA 1Z6GA 1BQEA 1X1CA 2ISCA 5B2EA 1RFGE 4I1VA 4Y9DA 3MELA 5JALA 2UYGA 3WL3A 4F3TA 4IQFA 2H8KA 2Q3FA 2R66A 2Y1FA 3ZHXA 4DBLE 1EK1A 1YQTA 2PRKA 4KP7A 3RREA 4A0GA 4EK9A 1FNDA 3FLEA 5GONA 2H7VA 1J99A 2WYIA 1ZGCA 4OYHA 1Z4OA 2C1ZA 5E6RB 3V8MA 2IJGX 2OAEA 1JLHA 4MDYA 2C5LA 1VJ1A 1DDOA 3IA7A 4ZU1X 3DNFA 1XZFA 1CJTC 2BY4A 4JEHA 1IBMB 5EIWA 4BVKA 1LVHA 3AJ8A 2JK1A 2O20A 2V55B 4KRYA 3LOUA 4YRCA 5HS6A 3LKDA 4I1IA 3TD9A 4LGCA 2WBLC 1IG0A 2ZSEA 4Q1AA 2C1EA 1J0CA 4KMSA 3GLRA 1YI0A 4WHMA 1KDVA 3RSZA 4RHUA 4DIMA 3J81A 1PFKA 2EJWA 2I3BA 4AS1A 3NS7A 1BHO1 3PIRA 4GR5A 3WIDA 5LOVB 1UZMA 1FSSA 4AWXA 4Q4LA 4MVJM 2O8DB 3U49A 1GXSA 2W6CX 4HFMA 1KA9H 3ESQA 3KJHA 2JD1A 2BI7A 2FSPA 3PQ5A 1UDWA 1E3TA 1DJQA 3DTVB 3IDSA 2XJ4A 2Y1WA 3D1LA 4JB0A 4JJEA 4KG7A 5DBOA 1T8SA 4OKSA 4ZOLF 1PS0A 5BV1A 3KQOA 3UKOA 5K0JA 3L0DA 2RGEA 4JIGA 4MP3A 1L5SA 1RRK