1AY0A

Identification of catalytically important residues in yeast transketolase
Total Genus 245
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
245
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVAGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSKETOLASE
publication title Identification of catalytically important residues in yeast transketolase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 245
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1997-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A01
4GPEA 2IHVA 4MPJA 1NGSA 5HJEA 2EZ8A 1YHYA 1QS0A 2BEUB 4KXYA 2O1SA 2WVGA 5EJ5A 2YICA 3EYAA 1UPCA 1GPUA 4MPRA 4JUAA 1UMDA 1OLUA 4K9OA 3EXIB 2C42A 1OLSA 1PO7A 4KGDA 2G28A 4KXUA 1QGDA 3AI7A 1IK6A 1YNOA 1L8AA 2Q5QA 2XT6A 2X7JA 5HYVA 2C3OA 1POWA 3DVAA 2Q5JA 1V5FA 2PDAA 2JGDA 1PYDA 4GM4A 4D5GA 3D7KA 3LQ1A 1OZFA 3RIMA 5EJ9A 2UZAA 4ZP1A 3HWX1 2VJYA 3ZHRA 5K3SA 2C31A 2E6KA 1YI1A 3FZNA 5DGDA 4JU9A 1POXA 3M49A 4XEUA 3EXFA 2OZLA 4KXXA 1UMCA 4FEEA 5EJ8A 1NI4B 1X80A 2QTCA 2BEWB 4GM0A 2JI9A 2JI7A 1V1RA 3FLMA 1YD7A 3IAEA 1DTWA 3DV0A 1UPAA 4JUFA 3EXEB 4K9KA 1V1MA 1V1RB 2JLAA 3AHEA 1X7WB 2Y0PA 2UZ1A 2J9FA 3IAFA 1ITZA 3LQ2A 5ERXA 2C3PA 3DV0B 2O1XA 5AHKA 1X7YA 4JU8A 5ERYA 2BFEB 2WVAA 1UMBA 1X7XA 5K6TA 3DUFA 3AHHA 1WCIA 2J9FB 3UK1A 2JLCA 2R8PA 3ZHSA 4RJJA 2Q5OA 3OE1A 1QS0B 2G67A 1QPBA 5EJMA 5C4IA 1MCZA 3HWWA 3MOSA 2YIDA 4QPZA 2VBGA 1UMDB 2BP7A 1OLUB 2IEAA 5I5GA 3AHFA 5EXEA 4QQ8A 1V16A 3EXHA 4MPPA 1OLSB 1Q6ZA 4GP9A 1TKAA 4MQ5A 1KEKA 4GM1A 4GG1A 2VK1A 1AY0A 2JIBA 1Z8NA 4MZXA 3DVAB 2BFCA 2BFDA 5IMSA 1OLXA 2JGDB 5I4IA 2VBIA 2EZUA 2C3MA 1T9AA 1YBHA 3ZHUA 3ZHTA 2PGNA 2EZ9A 2FN3A 1YHZA 1JSCA 1T9DA 5K6RA 1UPBA 2W93A 4RJKA 5EJ6A 2BEVA 3EY9A 2BFBA 2BFDB 1U5BA 2NXWA 5EXDA 1OLXB 1T9CA 3F6EX 3EXFB 3FSJX 2OZLB 3L84A 1PI3A 1UMCB 3AHCA 1X80B 4JUBA 2G25A 2EZTA 1YI0A 5I5EA 4K9NA 3AHJA 4K9QA 2BFFA 3F6BX 1BFDA 3M7IA 4JUCA 2BEUA 3LPLA 1DTWB 2FWNA 1RP7A 3EXG2 1V1MB 1R9JA 3EXIA 2Q5LA 1X7ZA 2BFFB 2UZ1B 4JD5A 1V5GA 2Q29A 3AHGA 1UM9A 5DGTA 4D5EA 2VK8A 5EJ7A 2C3UA 1X7YB 3ZHVA 2AG0A 2R5NA 1OVMA 1T9BA 1Y9DA 3M6LA 1UMBB 1X7XB 3DUFB 1WCIB 2EZ4A 3AHDA 1X7ZB 2Q27A 1N0HA 1W85A 3KOMA 5I51A 2XTAA 1UM9B 3ZHQA 4QELA 2PGOA 4KXWA 5ESDA 1TRKA 5K2OA 2BP7B 2R8OA 1OZGA 1V16B 1W85B 3EXHB 4K9LA 4WBXC 3E9YA 2JI6A 2VBFA 4C7XA 2IHUA 2QTAA 5HGXA 3EXHC 5EJ4A 2C3YA 1V5EA 1NI4A 2BEWA 2IHTA 2BFCB 1TKBA 3UPTA 1V11A 3M34A 5HHTA 2XT9A 3OOYA 1B0PA 1ZPDA 1W88A 3AHIA 5FEMA 3EXEA 2DJIA 3LQ4A 4COKA 3EA4A 3HYLA 2JI8A 4FEGA 2BEVB 3JU3A 1TKCA 1X7WA 2Q28A 2BFBB 1U5BB 4K9PA 1V11B 4JUDX 2V3WA 4RJIA 1W88B 1PVDA 4K9MA 2AG1A 2PANA 2WVHA 5DEIA 5EJAA 4C7VA 2VK4A 3EXG1 4Q9DA 2BFEA 1OZHA 4KXVA
chains in the Genus database with same CATH superfamily
3EPPA 1KNQA 2CF5A 4GPEA 3RUCA 4FYPA 4DDUA 1A1SA 2IHVA 3FGPA 3RGWS 2NO5A 3ZXUB 4XIYA 1EQ2A 4YJ2B 1WAMA 1RPTA 4DRXB 1O9GA 1PJCA 2EZ8A 1DL5A 4L4SA 1IWOA 1VJTA 4JB3A 1X7HA 2WJ3A 3TLAA 3ZNPA 2ZXEA 1SIOA 4XQ0A 1WTAA 2AW3A 3F3YA 4CQLB 4F3CA 4JBIA 5B55A 2OHJA 3HS3A 3C6QA 4H77A 2FPKA 4F46A 1FW6A 3FWZA 4NMXB 2R0QC 1TECE 1ZK1A 3R6DA 1F9AA 3LL4A 1Z7BA 4PWYA 5ECGC 3TVTA 3MCUA 1MABA 3TW8A 2GCOB 4UE6A 1FXWF 1CE8A 1II9A 5HUHA 3CSUA 5HZGA 3ADCA 1ENPA 5BWCA 3ZH9B 1IPHA 3A4TA 5ENVA 1OPRA 3DUWA 1DELA 1GEEA 2NTEA 5KKAA 1EM8B 2QZ9A 3DZHA 4BPRA 1EDBA 5CW2A 2VQ3A 3PUXA 4K05A 3E9NA 2FK7A 1XP5A 3NRBA 1R8XA 1XTIA 1V8DA 2KWIA 3LXUX 4G5RA 4GRDA 4PQFA 1DINA 1VE7A 4HWOA 2F1KA 5JYBA 1BDIA 4OJTA 1ZRHA 5EXTA 1D0SA 1V43A 1JBQA 4YPVA 1TYCA 1Z38A 1ZL0A 2GDZA 2P90A 3I5AA 1YE3A 2FUEA 1XN1A 2NU9A 3V00A 1B6RA 4N6NA 4GMKA 4N3AA 3NJ8A 1DO0A 3ILHA 4Q19A 5HTOA 1UXHA 2PSHA 1PV2A 2C98A 3AT1A 3DR5A 4NK4A 4QASA 4BO9A 1G3UA 1FA9A 4GDFA 1JHMA 2RARA 3L4BA 2WIKA 4RFVA 4MYUA 1EXVA 2IELA 2RGUA 2E21A 4V38A 2VLBA 2HSJA 5CX1B 1W581 2C8JA 4GO1A 1VLVA 2C3OA 4Z9YA 2I71A 2XHEA 3H0EA 4ZDWA 3S70A 1JYEA 3DP7A 3MMPA 3RGGA 5D1NA 4RIFA 4N5MA 3TE6A 2G1KA 5AOAA 5KYNA 2WHRA 4KMOA 4DSOA 4LS3A 4O29A 1U0RA 5EUCA 4LMAA 1QPZA 1KZGB 3ZE1B 2FXVA 2DQKA 3H9EO 1YB6A 4F4DA 2ZTVA 3LPDA 3B70A 3D7KA 4LZOA 1ONOA 1BX0A 2GHRA 2J3JA 4GE3A 4L08A 4QA9A 4M37A 4M49A 2O8FB 3O83A 3RVRA 2BFWA 2XIQA 2YVKA 4KGVA 4ZP1A 1AURA 3AP2A 2EBUA 2QNIA 1U8CB 2K4MA 1SUBA 4FHFA 2D0PB 2XB9A 1Z0ZA 4XYEA 2V59A 1H1LA 2GN6A 2QTMA 4RWEA 3U4AA 4CKXA 2DETA 3ZX5A 2FSIA 3CNEA 3F74A 1YZTA 4GFDA 1XZNA 5EE5B 2YZKA 2Y0EA 3RUFA 4JNCA 1SU6A 2NVOA 1C9EA 1XVTA 2FPUA 2WQ6A 3R6TA 5CDTA 2ZYUX 3KM0A 1FLAA 3H4IA 1U2RA 1TK2A 3BF7A 3H5NA 3HN2A 4AG6A 1EINA 1H5QA 4PXYA 4XEUA 4EF5A 3QGMA 1IPFA 5E9QA 3DD1A 3VPXA 1OI7A 1RRFA 1LDYA 4LZZA 2OZLA 4LQDA 3KUDA 3F90A 3G89A 4YRPA 3FYCA 2H2GA 4Q0MA 4KXXA 3B1YA 4XIIA 3QVMA 5TARA 1RIIA 1TADA 4PAMA 3AONB 4F6RA 1T1GA 1HWYA 3U3JA 4BWFB 1G66A 5KWEA 3PWSA 4IQ8A 4R6WA 2CMKA 4ZQIA 3FA2A 5DP1A 5E6SB 5I47A 1DAFA 2VNJA 4BLTA 5CA1B 1V47A 2WB2A 3Q8MA 4CEHA 3KU4A 1JFFB 1I5EA 1R6TA 5EWLA 5A1TA 4EB0A 2DERA 3SJBA 2HAEA 1RXIA 1IWBB 2UYHA 3SX0A 3RG2A 3PQCA 3REQA 1JHXA 1S2OA 3SXPA 4ZMSA 2HK6A 2ODEA 1TVMA 4FDMA 3O1LA 2KPOA 1OFUA 4YV0A 9LDBA 2CFSA 1NFRA 3C0KA 5F52A 2QS9A 4G2TA 1MIOA 4QOIA 4B6GA 2FDXA 2FOLA 4JL8A 5KHOC 1NLFA 3L6DA 1AE1A 2QTRA 2ZJ5A 3GLFB 1E2JA 3EEBA 4RGVA 4N5NA 3LLVA 4A3SA 2NN3C 1LF5A 5JS7A 3IQGX 2WC1A 3A6JA 3KOWA 4ZGWA 2JFPA 1IHYA 2CEKA 1XZDA 3ROEA 5KAPA 5CA0A 3V1KA 2Q3JA 3L6BA 4Q9LA 1DX9A 1XA4A 1FFHA 1L5GB 2ALJA 3EEQA 1U0GA 3GVPA 4TMZA 3V46A 4OHXA 1MQ9A 1IK4A 4YDSA 3IPRA 2ZAIA 1SG6A 1ZP6A 4HYEA 2P9JA 1I6KA 3S2ZA 4V0NA 2WU0A 2XOKD 3UK0A 1GTRA 3KQMA 1T9ZA 5EMLA 4RVHA 2ZTSA 4ENQA 2QEQA 3O0TA 2NWQA 2SNIE 5T41A 1QVWA 1BVYF 4LQCA 5HRAA 1ZUNA 2J0SA 5DBEX 4MUAA 1KHHA 4LG1A 2VRWA 3DUFA 4R51A 2GBLC 1L5RA 4UBNA 5D5QA 3SN6A 5G1OA 4F0JA 2P3OA 5AVWA 2HSEA 2G9RA 4DVJA 3I9LA 3A2KA 3LUDA 4XLTA 4ZVLA 3TXAA 4A8JA 4C14A 5JNVA 4V24A 4JN6B 4TTSA 5JANA 2RHOA 1NI3A 4NG5A 4LF9B 4RJJA 1A50B 2E0IA 3ETJA 2PD4A 3FOAA 1KWKA 4Z51A 3WGJA 3LOUA 4KH0A 5BSMA 4URHA 3BERA 1QHIA 2X9LA 3L0IB 3B6KA 2CVQA 1PNVA 1V4NA 3EHEA 4IYJA 3T3HA 3VKVA 3WNVA 1DBSA 2E4XA 2XKBA 1K0FA 3MOSA 2IQ5A 5BSGA 1XL1A 4DA7A 3GLGA 4LF7B 1L5NA 3HZZA 3BH7A 1B93A 1OUMA 2OK8A 4XD7A 3M3DA 4DPKA 2F43B 2EATA 1BRMA 2G4VA 2JFQA 1LI5A 1PDWA 2WHPA 3KO8A 2VJQA 4NE7A 4ZEWA 4HNAB 3RSLA 3V4FA 3FWKA 3AHFA 2FF7A 4M8KA 5EXEA 4QQ8A 1DRKA 3Q6IA 1VB5A 3KHTA 1WY5A 1JBEA 5B2FA 1CQPA 4AFNA 1BKSB 2VOJA 3G0IA 2NXEA 3II6X 3RUEA 4BFSA 3ZG6A 4K9DA 1MRSA 2Z8YA 4C5BA 1FTWA 4TSRA 4YV1A 2Q0HA 4EHLA 1GD1O 3LDHA 1F1BA 3LLUA 1PZXA 4GF5A 4ZXFA 3CM0A 1V3VA 4PHHA 4K26A 3J81k 1IN6A 4D9HA 3KUUA 4KR9A 4NNPA 5TEWA 2YKGA 1WDMA 1QR2A 3RAJA 1PUXA 2VK1A 2BZSA 1CF9A 1DJPA 1UBNA 1VMAA 1XWIA 2ID7A 4I8XA 3VU8A 3JW8A 4H1VA 1XT6A 3MJHA 5F51A 3WA7A 5BURA 4BFLA 4KQ1A 2W22A 3KTOA 4MRSA 2YWBA 1SM4A 2QY6A 1T5OA 4NYJQ 4UMFA 4KODA 1N3BA 4Y2PA 3CF0A 2OCXA 3G13A 5D5HA 1KE2A 1X7DA 5CDGA 4IBOA 1VECA 3IKVA 3HK2A 1CQJA 2FP3A 2Q4TA 3HDJA 4YMTA 1X8XA 4AIRA 5G0TA 3L4BC 4IGAA 4OI2A 4EPYA 4RZUA 3VHRA 4TLEA 4KWTA 2FAXA 3EQ8A 3P9QA 2QVCA 2HRBA 2ZXUA 1GDHA 1Z37A 4FMBB 1THTA 1OBOA 1U94A 1NIJA 2C2OA 3GEEA 4NNOA 2IYVA 4IR7A 4KQHA 3GLQA 4QUEA 1DP4A 1QRSA 2DH6A 3LCMA 1E6EA 4FQ7A 4P2GA 4LX8A 3FCEA 2KI5A 4WMLA 3AOGA 4ND7A 5EIBD 3DDUA 3KJNA 4OUDB 3TZBA 3KIPA 3LCRA 1BVUA 5D3MB 2ZAMA 1K7YA 1DBPA 1K7SN 1ZJJA 1D1PA 4KE7A 4QRHA 2CE2X 5CT5A 5A9SA 3EULA 4LSWA 4KE9A 1TAUA 1YBFA 3U4HA 1GZVA 1N2GA 2FCAA 1N2HA 4KR2A 2Q9AA 1X7GA 1OREA 2ZRFA 3B3FA 4TKMA 2PVPA 2W6ZA 4XWAA 4KN5A 3Q9UA 2Q3MA 2XZDA 3ELWA 3M2TA 1MAAA 2XOKA 3JAWA 5EP2A 2FWIA 2WD9A 2XH8A 4NMLA 5A0FA 5CYGA 1YOVA 3ZDBA 5JD4A 5HE8A 3GRUA 5HKBA 5M34A 1MW9X 2PUDA 3B53X 3L84A 4Y7DA 3QW4B 4IEIA 3GUCA 3HGMA 3QMWA 3KQSA 1LLDA 2GAOA 3I9MA 1GZDA 4GVXA 1UJNA 4PNPA 1T5DX 1LW7A 3HACA 1JEYA 4DIEA 2FR8A 2AE2A 4J7XA 5EKTA 4W9MC 1G18A 1JR4A 3Q7EA 4J03A 2OGWA 4LCJA 3OA0A 3TL3A 5EQTA 1EJ6A 2W6MA 3P20A 1XAHA 4L75A 1YUBA 3WLSA 3QE9Y 3A3OA 3M7IA 3ND5A 1E9VA 4JUCA 4PO8A 4GEKA 3PPXA 1EAYA 4ZT6A 2WUWE 3VKGA 3EAQA 4POOA 3O4IA 3BHJA 3JSXA 1CVRA 2FWBA 1V41E 2AKAB 1B4DA 4XSHA 2BW0A 1H1DA 1CJUC 3OCXA 1OI2A 2XUZA 1H6AA 1FTYA 2FPIA 1E8DA 1I4OA 1ZWLA 3A0UA 3OX3A 4GT1A 2PYZA 4K6OA 3ZQJA 4GKJB 3LA8A 4WNYA 1KDVA 2H5EA 3WHPA 1LBIA 1XNHA 1TM3E 2GZSA 3HVJA 4GIBA 3T5CA 1KZYC 2RHDA 2Y2VA 3LC7O 3UZUA 2SCUB 4YT4A 4IXNA 4HLCA 1JU3A 2IOQA 2WJ6A 3PHCA 3UYLA 1XTZA 1K8ZB 2F1IA 2Z09A 2Z4RA 3FKQA 3EIFA 2DUUA 4Q7KA 3ZHOA 5A5EA 3EGVA 4PYIA 3AKDA 2QVBA 4DMHA 4QEZA 1NF3A 1H23A 1YRAA 4RSMA 1JAZA 1UJMA 2GI4A 3UM9A 4BX3A 3RBZA 2IEGA 4K6GA 1VHWA 1FMLA 3CE6A 2C3UA 2X0FA 3W6ZA 3KSAC 4J07A 5AI4A 4H0FA 5BXYA 1KJ8A 5LPNA 4R8KA 4DLWA 3EC1A 1PFUA 3IQIX 1QVZA 1XZCA 4HOYA 121PA 2PGJA 3I12A 4FE7A 4JBNA 5HILA 1WVMA 3HJFA 1PGPA 4IXTA 2QVYX 2VPZA 3ZJ5A 4RULA 2V55B 3L2OB 1ZONA 2UV8A 2ZUCA 4FYJA 4M9UA 2EZ4A 2BL4A 1OU0A 2EW8A 3AF4A 1X7ZB 3O1JC 4NBWA 1Z7GA 4NDNE 4P3KA 3RVPA 4YCAA 4I1SA 2QSZA 4IJ5A 1XTUA 2FMUA 1E3SA 1P7VA 4ON9A 4PCAA 1J39A 1KK0A 3ZXSA 3WGUA 1CUHA 1R0KA 1GPLA 4YI5A 2H1VA 5TQ0B 4BLQA 3GT7A 1OFUX 1KDOA 2C4HA 2QENA 2Z8XA 2OAQ1 3KVOA 4KXFB 5A1JA 2OKCA 1PIWA 2PUTA 4RPIA 4A8JC 2PWAA 4HLNA 2HYDA 1W8DA 4OJNA 4P81A 2IITA 2F1OA 1QB8A 3G5AA 1IOWA 4NABA 5FORA 3UT6A 1YDFA 9LDTA 5A03A 4I55B 1Q3HA 2RHRA 4E12A 4KNYA 3MGAA 1PEDA 4A23A 2HA4A 3JWGA 2V54A 3E2IA 4MLPA 4MGIR 3KKLA 1L7AA 3NWOA 4IDGA 1E92A 1FUKA 3IP8A 2D06A 1XKXA 1G59A 3PLAE 2WWYA 2QE7D 4FMDF 3SR0A 3UA3A 1TJ5A 1GITA 2J3IA 1T1EA 3A31A 3WIDA 5LP1A 1SOAA 1PLKA 1LK5A 4L16A 3A1VA 1A5ZA 1IHPA 2VBFA 4RKRA 4EDHA 4HZUB 4MQFB 1CIPA 1KAOA 2D4HA 4UCQA 4WKBA 3UTCA 4JP8A 4V0LA 6ADHA 1DVRA 4B6OA 1V37A 1RYBA 2CW5A 3AUSA 3W1WA 3D1JA 3DULA 4BVFA 1OZ0A 1Z3CA 4CCWA 2XCOA 1UWKA 4DW8A 4XVRA 2RIRA 3QOXA 1KZHA 2Q50A 2W8ZA 3KOZA 3W3AD 2AK3A 2IHZA 1UC8A 4QTUB 4F21A 1EVQA 1G17A 1SHJA 2XBUA 3QX7A 1KJWA 3ENVA 2VWQA 1B43A 1FDVA 2W98A 1BHQ1 2P27A 1GU0A 3K0BA 1EA7A 5EVCA 5NULA 4KX5A 2XT9A 3RR2A 4RF4A 3ESYA 1RI1A 2B83A 2X7XA 5A3RA 1OH6A 1QGAA 2ZSDA 1ODLA 3K70D 4DKJA 2WJGA 4TX1A 3E82A 5K3BA 2WA1A 1GGHA 3UFXB 4M1SA 3UXEA 4B73A 3V34A 5FTKA 4BNJA 4X1YB 4I9GA 3HNRA 4Y18A 2TMDA 2JRLA 5F2KA 4O2BB 1ZBDA 2CJFA 3LW8A 2PKRA 1V3TA 3OZDA 2PJDA 2R1VB 4OFZA 2N0SA 1SZCA 4NU8X 4P84A 4DLLA 2CXNA 2H9AA 1LPPA 3OZCA 3X3HA 3THYB 3SDBA 4XCVA 3WYFA 3AF5A 1W0KD 1U31A 1ZM9A 5T3YA 2V3WA 2B6NA 1RAEA 1T5BA 4IZOA 3FZGA 4B4UA 4BTVA 3U49A 1PGQA 4AQYB 1Q11A 2XB4A 1EX9A 1KYZA 2Z5LA 3WDKA 1CIVA 1LF0A 3GLRA 4J76A 4B87A 1XRLA 3FM9A 4HKTA 4IH4A 2ZRPA 3IXMA 1EM6A 3FW1A 3SGLA 3WLQA 4EFDA 1FY2A 4LHYA 5K03A 1VSQA 1A88A 2GF2A 1VDMA 1P0QA 4JYCA 4G0UA 3H6GA 4J0IA 2O8DB 2AMJA 2J9GA 3W5DA 2BFEA 2P2CA 1PFWA 1G5HA 1UBSB 2BE7A 4RH3A 4YJFA 4ENWA 1QC5B 4G0OA 1DBQA 1FOEB 3LHIA 3MBKA 4RIIA 5C9ZA 2BAGA 4LC1A 4OQFA 4P53A 4XUGB 2EKLA 3E05A 2RGEA 3LAWA 2Y0CA 4LPSA 4TUYA 5BSFA 4XSGA 2XGSA 3QWFA 2JBHA 4G67A 5JJIA 3RU3A 2QXTA 1CZRA 3JQGA 2CLCX 4RS4A 1GSHA 1E61A 3DDNA 4JX9A 3RYFB 4QTYA 3UC5A 1I0IA 3DFFA 5BW4A 1W48A 4MZDA 1K3FA 2V98A 4J7AA 4LJ8A 4KXYA 1QYVA 2FR8C 2NXNA 5IZ4A 3KWLA 3OOHA 4PG7A 4ZCTA 3A2NA 4X64B 5INTA 1KXZA 4OQQA 4WBSA 1Z7EA 4YT5A 1KY5A 4EKIA 2P5SA 4NENA 3WLJA 1YKGA 2NZXA 4UOQA 5KOHB 1ISSA 2Z4TA 1V3QE 4AYTA 1WRBA 1JQJC 2QE7A 3UJCA 1BD3A 3O9ZA 4CM1A 1EBFA 5F3WB 1I80A 3EXIB 1TFUA 1E2MA 4TWBA 3QQ5A 4EM6A 1QG6A 3TTVA 5KOIA 4KO8A 3ZVRA 1IATA 1UBUS 2AFHB 4KV9A 1Y0BA 1U98A 4MNTA 1ZI9A 2ZCUA 3FFBA 2H07A 2H16A 1CXZA 2QW8A 1KRWA 4CF6A 3CLHA 1KF0A 1W5BA 3LUGA 4OM8A 1YTUA 1RWBA 2AC2A 4YLGA 2H4HA 4Z4FA 3W3AA 3AL0C 1CE8B 2QT1A 3UKDA 1O6CA 2NYVA 2QD4A 4PEVA 3H0KA 4A27A 2FU5C 3IH5A 5SICE 5BQ3A 6GPBA 2X42A 4F96A 4GNKA 4OLBA 3VDNB 3R5KA 4P36A 2RG1A 3OZFA 3RSSA 1GQSA 2VWHA 5DLEA 2NO6A 5U4XA 4AUMA 3HP1A 4LAFA 4Q1BA 1K2VN 4XA8A 3Q3GE 4TL7A 2QTBA 3BJEA 4OATA 4XDYA 3UJBA 2IYPA 4J49A 4HNRA 2WWWA 2WIDA 4X6XA 5BVHB 1XG5A 3QA3E 4RA9A 2D0IA 2W4QA 3RIMA 3L01A 4UE3S 1I10A 2Z5GA 1D2MA 1VKZA 4CG2A 5BYJA 4KHPB 3I2YX 1A8SA 3R9IA 2H65A 3R0IA 5CXUA 1E69A 2QD2A 3BQ9A 1TVKA 1UOQA 3UEOA 1W0KA 1W4AA 2GHTA 3L8CA 4V02A 4AAYA 4CMIA 4HDQB 5EIBC 3BWCA 4UJ3A 1JPUA 1Q92A 2C31A 2GYYA 3VYSB 4XIJA 1YBAA 1E1DA 4ETNA 1HE2A 5THKA 4CMBA 3DKVA 3V8NA 3GUHA 1E2NA 4X44A 2JLRA 5LR6A 4QPDA 4IF4A 2I4RA 5BT9A 4PX5A 5JCXA 1L4FA 1WB5A 1E89A 5JSHA 4L2IA 1DJNA 3SJUA 4AZWA 4E3WA 4ZVKA 1WF6A 3EOAI 3EGIA 3O9VA 3QITA 2C2ZA 5L7WA 2BDUA 3KV3O 4JCOA 1XF9A 3T6KA 2H3HA 2HNAA 5AHWA 1QYDA 3O93A 2QE6A 5JQWA 2P11A 4CMHA 4HXGA 3NV9A 3JAKB 4LCBA 4DLTA 5LBUA 4FR5A 4GM0A 1KYWA 3FOBA 3WKBA 3GZJA 4WEQA 4P83A 1XWWA 4AD8A 4D4IA 5HKOA 3DMPA 2E1PA 3GW8A 4ZYTA 2OGZA 4PGHA 1KMHA 3IAM1 3P2OA 3DDHA 5E4TA 3ROZA 1RBQA 4BO0A 4CM7A 3D3JA 1Z8DA 2NUAA 3K30A 3RIHA 2Q3LA 3JQRA 3TL2A 3C7KA 3E3OA 2JW5A 1Y3BE 1P19A 2P65A 4UFOA 4HWTA 1OC2A 1OX6A 1FMCA 1THZA 3I2FA 4NE2A 2XWBF 1X3SA 2A6PA 1L5LA 4KDFA 3UAOA 2E48A 1L7VC 1D2GA 1PJQA 3E7XA 3IUMA 4FZ3A 2WWVD 3VV2A 2Z8ZA 4B0PA 1NZFA 2BDEA 2CL5A 1EH5A 1HT1E 3OBBA 4LWPA 3WIOA 5HNKA 4TMXA 2ZSJA 2GWHA 3CTMA 5JBNA 4OGFA 4Y2YA 2YWHA 4PNHA 5MN5A 4MQEA 1HTWA 3CKMA 1ESDA 1WZEA 2Y0PA 4JXKA 1GDTA 2IHJA 3AL3A 3LX6A 2W43A 2RC5A 4MCJA 5EWLB 4DDHA 2XCLA 2Y3IA 3IESA 3PF9A 3SZGA 1AXGA 4LRSB 4MCIA 4AL4A 2WF7A 1GLNA 4NBTA 3OLXA 5K4AA 1YZVA 3RSHA 1SXQA 2NO4A 4JLBA 4QU8A 1KY3A 1Q1QA 3U81A 5BYKA 2WUDA 5AI6A 3QW2A 3ZZUA 5KBYA 3ONDA 1W47A 3OIGA 3TBFA 3VC7A 5F3RA 3P19A 4QWWA 2BWJA 1RLIA 2LP4Y 2CVZA 2ZRMA 3KU1A 2GM5A 2OQ2A 4DY4A 3GFSA 4JENA 1T1RA 2Y93A 1F4VA 2WFLA 3AETA 5ERYA 1DDGA 1XZMA 4O4LB 1TM1E 3MCZA 3ZUGA 4BAUA 5KYWB 5CU7A 4D56A 2A59A 1RYHA 2DHCA 2JAPA 4FDLA 4MLDA 3ZY5A 4D80A 4DLRA 4DUZB 4Y9RA 2DULA 5G40A 4A0GA 3QKIA 1XZQA 2E82A 2JLCA 3O38A 4HNGA 1Z0UA 5JARA 1FFBA 2AZTA 3QVJA 4RMJA 3O8LA 4GL4A 5IBCA 4LRXA 2Y1WA 1Z4JA 1AUXA 1I30A 3EVCA 4FIZA 4MDFA 4OJMX 3UMYA 1P1RA 5CX4A 4F9EA 3FSEA 4DR1B 4F4HA 4HAUA 2PMCA 2JFUA 1TQ2A 4OHOA 3TRHA 1SOWA 1J70A 3IULA 4ZVQA 1OIXA 5B4UA 4GPAA 3SYTA 3OSUA 4QPZA 3KJZA 1CJSA 4F4IA 4OJKA 1DFHA 1ZUNB 1Z8HA 3PQFA 1YB4A 4RD0A 4TV8A 5FQOA 2QX9A 4EOGA 4G0VA 4DNOA 1KJIA 2IEAA 1SBZA 3BHMA 1YZHA 1LJLA 3GELA 1KY2A 3OCCA 2HD4A 4L8VA 1DGQA 1XXHA 1ZU5A 3RYCB 3DO6A 5JNUA 1WXGA 3G8AA 4MPPA 5H81A 1T2CA 4GP9A 5A9TA 2VSFA 1N3IA 2YN0A 4J0DA 1URPA 1E2FA 1KU6A 2G7MC 2QZJA 1UK8A 4UOZA 5EHZA 3RO7A 1Z47A 3BXXA 4QBTA 3NALA 3GAFA 1R6DA 2IV3A 2WT9A 2YHUA 3GIDA 2ZIVB 4JJ6A 5JPIA 3M0EA 4KYVA 2R8XA 3HU5A 1M2OB 2WHPB 1Y42X 3NHRA 4LRUA 3H1AA 1EFPA 3D2AA 2AGVA 1WUKS 2GLTA 3HRKA 1QG0A 3B7PA 1SKBA 4UXHA 3JYOA 2TYSB 4Q3LA 5A05A 3WLPA 1VPDA 1Z74A 3DWGA 4C7BA 3BHNA 1C1XB 5DGXA 5E8JA 2NQTA 5GGYA 2J41A 2A0WA 3BWDD 5H68A 2ET6A 3IVGA 4H0NA 1N1MA 2A5LA 1Z08A 3HNOA 4PLPA 3RYHA 1IMJA 5J43A 4WNCA 2FA9A 2DBQA 3KXIA 2Q7DA 5DE3A 2R6ZA 2JLZA 2II6A 3K5HA 3VKUA 4PX2A 1JSCA 5LLDA 1GDDA 3D8SA 4HNHA 2ONJA 3K70C 1J0EA 5K6RA 2OG2A 1CT9A 1OFHA 4RY0A 2W42A 3BGOS 4RJTA 2BTEA 1V7CA 1NC1A 2BEVA 5TMEA 4F8YA 3W8EA 3HJTA 3KAJA 3Q5EA 3ML1A 1U5BA 1DC4A 3H86A 5EXDA 4KVZA 4GGPA 3K4PA 3NOOA 1D7AA 4N6GA 4Y0VA 3IOYA 3ZYZA 3V33A 4WPGA 2ZIXA 3HXKA 3LO8A 2PXAA 1GPAA 1A0OA 1QSGA 4RFLA 1KDYA 4F3NA 3D6FA 1OGJA 4EB6B 3A4IA 1C9DB 2DCUA 1FUEA 2EIHA 3QZUA 3LBYA 3PUHA 1OYOA 3W2HA 2ST1A 3WWCA 4AG3A 1TU3A 3C45A 3GO4A 1EB8A 1K5DA 3R5JA 4CTOA 1BXZA 5E4YA 1AQNA 3A6EA 1I5RA 2PGIA 2VQ6A 3EZ7A 3D8TA 4P33A 4UDXX 5FXMA 5ALFA 4IDAA 3SHWA 5JT1A 3P2YA 4Q4JB 4F72A 4TYNA 2ERXA 4ZVTA 2W6JD 4ZVOA 1QWSA 2WSSD 3VJRA 2CGEA 2R65A 3D4BA 1JLMA 3FGZA 3JAWB 3OCYA 4JB2A 1L4YA 3KJFA 1NBIA 1TEVA 4I4NA 1F20A 1JQEA 2DZDA 1YOVB 4U02A 4Q00A 4EI7A 1N2CA 1WKCA 1NXVA 1NXTA 2RHMA 3BZWA 3L0PA 4X5OA 3PIDA 4M22A 2XRFA 3ZZMA 4R8RA 1BHSA 1SG0A 4UHHA 4ZCPA 5IAJA 3TFWA 3UT5A 3CRNA 3T0GA 5IN5A 2XKAA 2XCSB 2J6IA 4IV5A 4ALMA 2X14A 2A33A 4P4SA 4L15A 1JEDA 2BF7A 4UUNA 1U8YA 1R9JA 1MAWA 3WB2A 4P4UA 2FEMA 4EMBA 2GOYA 2PFSA 4FXOA 4B74A 1D2NA 4CKCA 5BSHA 4N47A 5AJWA 5JFGA 3WIUA 4V39A 3KYCA 3D5TA 1WV0A 4RMGA 4YFYA 3F7MA 4CKEB 2ZJYA 4P4GA 1VHJA 3PGLA 4Q12A 3GZ4A 3T4EA 4B6JA 4BLUA 4DA4A 1QH0A 2TECE 4ARBA 4UOEA 2WJPA 3QPCA 4TQAA 5IWAB 5JSQA 4IILA 4C0SA 4CL3A 1TAGA 2P3LA 2MIIA 2FPIB 1B1AA 1R64A 1TIKA 2IZ0A 2PT7A 1OVMA 4DQUA 2IJGX 1X7XB 3SM9A 4HH0A 1CU1A 2V9ZA 3WDLA 4H17A 3WDSA 2QX8A 1VHDA 1KAEA 5BNIA 4N6OA 4TLMB 3MLAA 3ZHCA 3DT6A 4ZV9A 1QFSA 1UBJS 4WLEA 3KPUA 3QOWA 5H83A 2I87A 3WIEA 3DSRA 2IYRA 1P4HA 4IO1A 2WY2D 3CLSD 3RFFA 5EMKA 3IP9A 2ZSKA 4FGJA 5DHAA 3CVJA 4WA7A 3FLEA 4DJEC 2XB8A 3IOMA 3FBGA 4KITB 2OGUA 2ISSD 5I4CA 5AJHA 5FTJA 2V6GA 3V7FA 4EUEA 4KR3A 3CYFA 3GZNB 4IS2A 2WKRA 1NVFA 1G64A 1TUEA 4HVAA 4Q6BA 3H2SA 3MB8A 5BP7A 1W5FA 3EF1A 4ZEOA 4RTNA 1WXDA 4NPAA 5DCUA 1P60A 1DLJA 4Q4AB 1TKRA 4R1UA 5CIWA 3EDQA 3ZI0A 1EFCA 2FMFA 1BE1A 4URYR 3S8EA 3KQQA 3FOEC 1O5OA 2WIAA 4R81A 4LWZA 3PJEA 3GQBB 4MICA 5AM3A 3A7EA 2YQ4A 4ALKA 4MOWA 3WL3A 3FYUA 1NDUA 2CMDA 2QN7A 5FOTA 3D59A 1Z4QA 3R5SA 1YQ9A 3WYEA 4E31A 2WMDA 4EX7A 5T3UA 9ATCA 3A3KA 2P9CA 1PLJA 1U9JA 4WNAA 3DM5A 4ES6A 1ZISA 3K9NA 3CU5A 2Q3EA 1H8HD 1KH3A 4RZIA 1ZL2A 2PFGA 3R23A 1B8UA 1P9OA 3G59A 4GE0A 3TTXA 4FWTA 4OXXA 3DE2X 2WTEA 5DYGA 2BEWA 1WY7A 1WOMA 3PDCA 1GLVA 1RABA 4N0EA 3I9V6 3X0DA 3MOGA 1G98A 2W6JA 1KFCB 2WSSA 4LY0A 2F3TA 2XNCA 1G8AA 4B7AA 2VBCA 2GD1O 4AP9A 3OOSA 3NJRA 2C04A 4BO4A 3NEYA 2B8TA 3M34A 1KAMA 3TBKA 3JVIA 3M82A 4BMZA 5IHPA 2PZ8A 3V2UA 3OZGA 3TLBA 3PNVA 1W34A 5G0SA 3ZJYA 2B4YA 2JZNA 2R1UA 3BZUA 3WI7A 1PJAA 2DQYA 3IIIA 4ICIA 3EIWA 3B9PA 2A1TS 2VDVE 3KBOA 1BU5A 2D59A 1YQGA 2DECA 2J9RA 2JLQA 3HYLA 1YZLA 3LQ4A 5CM9C 4F2HA 3E2PA 2XKJE 2OA0A 5ILGA 3PDJA 3ORYA 5D8DA 2Z57A 4F92B 2AYZA 1C4XA 4FEGA 3JXEA 2FQWA 2Q2WA 1ZG3A 3ZWKA 3TRKA 2B30A 3H6HA 1TZ2A 1NMSA 2YXEA 4HNTA 2WDZA 1DBIA 4EG1A 4ZT7A 1M54A 2QYHA 3KKMA 3L77A 2Q2QA 4KQEA 4PZLA 3F0TA 4B3JA 3UHFA 2GILA 3PKIA 4LRYA 4DNPA 5SYMA 3C43A 2FPGB 3A6DA 2OQIA 2IEZA 3AP3A 5JAPA 1K8XB 3EQZA 3CWQA 4WD3A 1PL6A 1WUJS 3CLTD 3HVHA 1V2GA 1JA9A 4RLSA 3H2IA 3BWVA 1D9ZA 5J4YA 2Y1XA 4AM8A 2YV4A 3CY6A 3MRXA 4PPYA 2Y8EA 3EXG1 4Q9DA 1YT5A 1S1CA 2W2OA 2VHJA 1NLMA 3KSMA 3PSHA 4D98A 5ICMA 3U44B 3GAAA 2PWZA 2ZRBA 3LBNA 3LOPA 1PFKA 5KJ6A 3KQOA 2NXCA 4FEYA 1MB9A 4EBBA 2JIOA 5IH7A 4MPJA 1YQQA 5JTTA 1MC4A 1E99A 3IR5A 4OQMA 1OU4A 3LPNA 2RAPA 1Z73A 3SQNA 1Y8QA 1KFKB 1IXRC 1K0UA 1LXCA 1XYYA 2OUIA 2VDLB 4MUBA 1P1CA 2FH5B 2QL9A 2XDWA 4U2KA 1ECGA 2ZTLA 4Y7CA 1GU1A 2BEUB 2XDAA 4CMKA 3O8QA 3T3IA 1P4AA 2BE9A 1QMPA 1X1BA 3I6ZA 3ZW9A 3FCXA 5ADHA 5EVJA 4G37A 4JC0A 5IDVA 1W2HA 1OT5A 2QL6A 2CNNA 2YQ5A 4GOXA 1AS2A 1M5UA 2YDYA 1FSGA 1U28A 3AERA 4JQZA 5JS1A 4NMMA 1KYVA 5D86A 4BNFA 2CC2A 3L49A 4GYKA 1CJTC 1FE8A 5AJUA 1A5SB 3T95A 4RADA 1QIMA 4PBSA 3WV5A 3O3CA 3HJGA 2HBYA 3Q8WA 3JQGB 1AZSC 1TJNA 5FUQA 1EGVB 2QUBA 2B8EA 3WRXA 5CFLA 1WJGA 3FPKA 2P8SA 3T06B 1H8HA 1WPRA 2ILTA 4HWGA 4DUPA 3O3NB 4PYJA 2PWYA 1XO1A 1Q0QA 3RSZA 4M53A 3GLVA 2R7KA 3KPWA 4BV2A 3AINA 2IPXA 1C1HA 1THMA 3MUOA 2IBMA 3A32A 2KMLA 1ZM3A 4WFKA 4DLKA 5TRTA 1TOAA 1SUCA 1YB2A 4UNRA 3IMGA 5ER6A 3L9WA 1I9GA 4F4JA 2RBEA 3V7YA 4DR5B 1RD4A 2YN2A 3AVXA 4PQGA 3OPXA 5JEDA 2OO3A 3AF3A 3IR6A 3MSCA 2Q5JA 3P4YA 4INOA 1SUIA 1T13A 2ZFUA 2RH8A 3TVYA 4P35A 5K0LA 2NU8B 4A36A 3DC7A 3ILYA 5AFSA 4KFCA 1T2DA 3OHPA 3WLTA 4WOKA 4FQ5A 2MR6A 1T3TA 3L7AA 2FQQA 4EJ2A 2B8WA 1YR2A 2IIPA 4OIMA 2ZSHA 1LRKA 3FTDA 3IO5A 4GX1A 3SZOA 2ECFA 3QKTA 3RE1A 3T1YB 5IAGA 1RYYA 1IQUA 3AVOA 5FHRA 1EFUA 4U3JA 1L5KA 3W2TA 1K1EA 2GCNA 4UBMA 5DXAA 1IB6A 4C0JA 5A5FA 4PR0A 5KQSA 3JQQA 4KREA 3FUVA 3PWKA 4JB0A 3T5AA 2DX7A 5GADl 3RU9A 3CCBA 3K2EA 4GOND 1EDDA 3IEIA 2C4NA 3V8VA 1K2WA 3WS7A 2ZUTA 1TTQB 4FZ5A 4BWGA 4TTPA 2YVQA 4NFLA 4ATNA 3U13A 3HI4A 4AQ7A 1G7CA 2FWRA 2HADA 2QTLA 2XI4A 2YASA 3AX6A 1GSOA 3HP7A 1ZRMA 4K81B 1POXA 2NQ8A 3A0RB 2B99A 3AESA 3TUJC 3I1IA 3NV7A 3MWGA 3RUAA 3ROFA 1BMQA 3SDZA 1IIRA 2ZSUA 3W9YA 3ZBUA 5J2TB 1X1TA 4PGGA 4BJHB 3NBQA 4NG4A 2VJPA 1AB6A 2YC2C 1E2PA 4PNEA 3KB2A 5CMLA 1DAMA 3GGPA 3JVUA 3P2MA 4ZC1A 3FYUC 1DXHA 3EDMA 4Z4EA 5AK5A 1CRPA 2NGRA 1DKRA 2V6FA 4K6HA 4DGQA 2H57A 4P22A 1IZ8A 3FDJA 1DFIA 1KVUA 4HDSB 1G9XA 5CXXA 4S05A 3QLUA 1N6IA 1KC1A 2OE2A 2R11A 2Y76A 3L7NA 1S4MA 1SXJD 1P33A 2J3DA 4R8MA 4BGIA 4P4LA 1AN9A 3CNNA 3DV2A 2JZCA 1JE0A 3DFUA 3WK5A 2ASEA 1I6MA 1YTLA 4BBJA 4YMSA 4CKWA 2SHKA 1JV2B 4L2IB 2JF0A 3AWIA 2LNDA 1Q7TA 1NVTA 3NBMA 1VPTA 1Y6GA 5B30A 1LRLA 4MYSA 4BRZA 3QEAZ 2ZUDA 2G63A 1UBCA 2GJ8A 4JR1A 3EXEB 2VT6A 1V6CA 3WK4A 3K6SA 4U4AA 1MLDA 5FHQA 4EY8A 3P94A 3EZYA 2GD0A 4LDPA 1XOIA 3FF1A 1XZGA 4J6EA 4RDHA 4AZVA 3LGAA 1BXGB 3PXAA 4HDRB 3B1JA 4YEDA 4CQNA 1X7WB 5AOVA 2GZMA 2UZ1A 3MTAA 5ALRA 4LXUA 3AG5A 3EE6A 4NU5A 1KMHB 1M67A 1XUOA 2IYLD 3QYJA 1A5BB 5BXQC 4ILKA 3W8NA 2XUHA 4XCXA 3IHTA 3MERA 2DR3A 1NMXA 3U9LA 1XPRA 2C3PA 1X0VA 3DL0A 4NJEA 1WHSA 3B3AA 3WYDA 1WDKA 3WL5A 4PO3X 4PSUA 4II3A 3BE8A 4ZO8A 3STUA 5F21A 5FP0A 2KQUA 2HMWA 4JU8A 4W7SA 1F4LA 2XX3A 2ZE7A 3FOCA 3TRFA 1PR5A 5BQXA 2Q4BA 3LNCA 1UT5A 4Q18A 1ZIOA 2HLPA 3TF5A 4QPCA 1QO7A 3LPAA 3ICOA 3PTZA 4MQEB 3VH4A 4WESA 3S2FA 2NYUA 3KAKA 3HGTA 3I1YA 1HEIA 3PRKE 4L76A 1D1SA 2FRXA 1QLJA 1E3TA 3MLEA 4FDTA 1WD5A 5CA0F 4G0YA 2F3QA 1ESEA 3R4VA 4OI0A 1TGVA 2LCFA 4L73A 3B38A 1CUYA 4RS3A 1PGJA 4X41A 3QELA 4XH9B 3RKUA 4ERNA 1PV4A 3NHYA 4U9UA 3DM9B 1DRWA 1Z34A 3UG7A 3W5VA 5LQUA 1RBMA 3ROTA 3SS8A 1DQZA 1NW8A 1O57A 3B6JA 3K0FB 4ITVA 4MX8A 3CLSC 2Z08A 4RTLA 4EUHA 1YZ3A 2PMDA 3QPDA 1SUWA 2PLWA 3H8WA 3I5MA 3M4XA 4AX8A 2YMLA 3CUYA 1KP3A 2ODBA 3O8OB 3VM6A 5BOSA 4DMFA 4PN7A 1OLUB 2W2KA 5K6AC 1ADYA 2OXTA 4TVKA 2NUTA 2YV1A 2E9SA 4O3FA 4Y2JA 1Q0RA 1XMVA 1GA6A 1P2TA 4WDRA 1QIGA 2QP3A 1O97D 3R3HA 1V16A 4YUWA 1GZ7A 4ZRDA 2P9TA 1P6QA 2OFWA 2Z1DA 1Q6YA 1P61B 2FW7A 1CUWA 3LHFA 1MB0A 3OQ6A 3QENA 4DYHA 1U28C 2HV8A 3ND6A 4I1UA 1MX9A 5E3IA 3T3MB 1AK9A 1VI5A 1TMGE 4EA6A 1RCFA 3IRVA 4ZYLA 4G86A 3ZLUA 1WW8A 1U0NA 2JJYA 3I52A 2C88A 4UZFA 2FTKE 1BTOA 1DG3A 1K4MA 3A58B 3Q12A 4W9RA 3WRXC 4F2WA 1DC8A 4HB2A 3PFHA 2VHXA 4N41A 1QGUA 4I1RA 3ENQA 4MWDA 2NXJA 3RVJA 1SXJA 5KOYA 3K0SA 2GBCA 5CLFA 1Z8NA 3ZE0B 3NYIA 4U7PB 5DB4A 3TIXB 4O2AF 4Z0TA 3D8BA 3TUIC 4XGRA 3ROQA 5C32A 4IWXA 3NBAA 2I54A 3KG2A 2PLRA 2FPPB 2Q1YA 3ETEA 3EZGA 3LF2A 4V0KA 2RKOA 1OKKD 5JRZA 4H7EA 2H52A 2IVZA 2R60A 4GBMA 1QYIA 3MTBA 4P54A 1XRRA 4ZDJA 3SX2A 2IPOA 2NTYC 2WTAA 3PSAA 4R31A 3ZHUA 4ARUA 1SBIA 4YP7A 4HNUA 2FN3A 3H19A 4QGAA 5DSTA 2J0QA 1T25A 2EBHX 3FMGA 2PV7A 2ORWA 5BW6B 1IQ0A 1X9IA 4ZOCA 2QUHA 3JARB 3MTGA 4WCFA 3CWZA 1Y7IA 2OLEA 2WYIA 4DDTA 2XOXA 2QR3A 4Y2XA 2OBNA 5IDYA 3G5MA 3PNOA 4JSTA 4C3UA 4AK9A 4IV8A 2Q6OA 2NNWB 1QH9A 3I8SA 4E6PA 3PFGA 1WQ3A 4N7BA 5CNJA 1YZFA 3IEXA 4X0EA 5K0NA 1XJQA 1PL8A 3M5PA 2EG9A 4YCSA 4KIWA 5TX7A 4GQAA 1X1DA 4PX3A 4WZBE 4ER0A 2BBWA 2ZUWA 3Q7SA 4KMSA 1VBFA 4IAOA 4WXHA 1R0XA 3GPIA 4RA6A 2WJIA 4LKOA 2IFTA 4EFLA 3Q88A 4MS1A 4F4FA 1LVGA 2ZM5A 1E77A 3CLTC 4JYAB 1LPNA 2C2XA 4Z3OA 4LVCA 3UK7A 2BGTA 1WXFA 4KMRA 1X87A 5JPCA 1HL3A 4QT4A 2QPTA 4WKOA 4XTRA 5G3YA 5P21A 3SHOA 5K8IA 1Q1GA 2V7PA 3PC6A 4NZNA 4D9IA 3N2ZB 3GP5A 1GL6A 1QORA 2AN5A 2B5VA 5CD1A 3HO1A 1LSUA 1Q5PA 3WK9A 3BTSA 4K6MA 4ZK6A 5JH7F 4PLGA 3W5SA 1KIMA 1PR3A 2QJFA 4MI6A 4PIMA 3QLUC 1CR2A 1PQPA 4LF4B 3E8XA 3NFYA 4HB4A 2XUJA 3I4CA 4X24A 4EH1A 1H2BA 3F3KA 2AFIB 1G7TA 1II8B 4CCYA 3FNIA 2YN4A 3TOCA 3G0BA 2UYGA 3D5EA 4JBXA 2GAJA 3PQ7A 5FA8A 1EU1A 3LXRA 2BC9A 3WKDA 4DR3B 4RTOA 2MINA 3HDYA 5AIBA 3R8CA 4MAFA 1FVXA 3EW9A 3IURA 3GNQA 5J4LA 1V7ZA 4K87A 3C5VA 4OAPA 2J3MA 4MQMA 4OXIA 5E0OA 3SIRA 1R8JA 5DHPA 2CUNA 3OO1A 1CUZA 1XDSA 2FB9A 4DCMA 2VCEA 3EEIA 5AT1A 3VKFA 2E1RA 1TQHA 3KQWA 4YALA 3B5EA 4EMUA 1OQAA 4DOMA 2QTNA 5ER9A 1ADGA 3MTQA 1NQAO 4PHCA 1QQ5A 2VEOA 5AHXA 4P4SB 1UUFA 2F6RA 4J0GA 1XC7A 4I1OA 3CR8A 4AW9A 1OKKA 4CKBA 3GYGA 1NNI1 4MVJD 4CKCB 4LA4A 2XBLA 2ES4A 1RHUA 1N0HA 5LZ9A 2NP6A 3FTNA 3KYCB 2JB9A 4Q1CA 1FRNA 1ZD3A 3BWXA 4P2BA 4MEBA 1WQ1R 3AR2A 3TG2A 5MFPA 2XBMA 1AZWA 2H1HA 2VJOA 2VYFA 1KSJA 2EW2A 3NIBA 4LJKA 2X8BA 1DJQA 4TN1A 1RVV1 1DX6A 5HP4A 3KRTA 5L3SA 3HXQA 4CODB 1XRPA 2Y71A 3KYIB 3H9GA 4IGIA 1I0LA 4PN3A 4DQDA 2JHPA 4NWIA 3CB4A 4ZGBA 2RSLA 4Y6PA 3R6LA 1S0UA 1A9TA 1RBZA 3MIIA 3KAQA 1A2OA 4L22A 3DDSA 2I2FA 3PRJA 3UWKA 1VJ5A 2J48A 1L4LA 4UQLA 3H0CA 4GMFA 3ICQB 3IS3A 4HGNA 1Z5UA 3LT0A 3FTQA 3D6JA 4MUKA 4ADSG 1XTQA 3KDSE 1Z06A 3P0IA 2QLLA 1YWGO 1LC3A 3FG9A 4KK4A 3DEFA 1MOQA 3PIIA 3ZWDA 4Y0AA 4EPWA 4M46A 3NX4A 4HN2A 5IT9A 1T4MA 3RRZA 1BWRA 3S8YA 2H7VA 2FEOA 5KNBH 4BMNA 5DV9A 2BFNA 4KTTE 4O4JA 4IDBA 4N9QA 2AI1A 4IMPA 2VT3A 2O2GA 3LL7A 4NZMA 1KBQA 4GAEA 4MQ4A 4BEWA 2UUAB 5BR7A 1Q12A 1C3OB 2A9JA 2P9EA 2X2FA 3JVDA 4B4KA 1FP4B 2XDQB 3SQOA 2BBTA 1X8KA 2H92A 2OCYC 4Y2UA 4DMMA 1MJGM 1HQCA 2ERYA 4PE5B 4EIWA 5HIAA 3AJAA 4CNQA 1NQXA 1SBQA 1A8UA 2BF4A 3BXGA 5BR8B 4U2CA 2JCVA 3U6BA 1G5QA 1A5AB 1CHDA 4ZVSA 5BSVA 3BC1A 1JSLA 1S3SA 4J91A 4PLZA 1LDBA 3WJ2A 1PUJA 1WZNA 1NW3A 4IRXA 4G5OA 1WXHA 1SXJC 1GNRA 4GPD1 4YAWA 3BQMB 4HVCA 1H2HA 1OAAA 4WNAB 3L6CA 5AW1A 3QY0A 3I2KA 4ND3A 3JZAA 2HSGA 3DONA 4H1UA 5HK9A 4JP2A 4OX9Y 2PMWB 5BSEA 3LT4A 1PJ8A 4XYGA 1RJGA 2FUNB 3PR3A 4FSHA 2R1TB 3JQDA 1FZTA 5EHNA 3U5ZB 4XJTA 1CZUA 4ZOLF 5TC4A 2DR0A 1GNPA 2JI8A 1HFEL 4OM7A 3FR8A 1DO2A 4LPKA 5CEJA 2G7ZA 5TY0A 2YBEA 5IYZA 1MP0A 1W96A 1L8OA 2B7LA 5EA2A 3A4VA 1QFYA 1Y1SA 2PMKA 4NU6A 4U00A 2IKSA 2WHXA 3JQPA 1AU9A 2PZBA 2QMUA 3FYDA 3L0ZA 4Q24A 1C41A 5EN4A 1AS0A 4WCFC 2DWUA 5DMHA 1KE1A 2A3NA 1PVDA 3IDQA 4ZRMA 3EPRA 2TS1A 1L5VA 1CUIA 3ZVKA 4W6ZA 3BA1A 4J4HA 2ZJ1A 4G23A 5EJAA 3G0HA 4JJGA 1XL0A 1XTSA 2DFDA 5TPWA 5MN4A 2FLWA 4BL5A 1ISIA 1RM3A 4RD1A 1Y7TA 1WX1A 3AZPA 1H2FA 1M1YA 4MVJA 1E2IA 1QHEA 5B4TA 1WPQA 4I7EA 3RK1A 2GM4A 4HQ6A 4KVFA 5KQLA 4C7JA 2BH9A 4HCJA 4GYYA 5EY5B 3T3PB 3ESDA 3VR4H 3F98A 3ZHYA 3ADKA 3QF4A 4EW6A 4JXZA 4DM7A 3FLAA 4FGSA 4L7VA 4ENVA 4PRKA 2OOKA 4L85A 2C4KA 1SRRA 1NBMD 3JYHA 3KWFA 4P58A 4TV9A 4WINA 3WP1B 5JBQA 5DGHA 4CYMA 1GPDG 1X0XA 4D0SA 5C37A 1Z6ZA 1NR1A 2BI7A 4WL0A 2IZZA 3FUUA 3TDMA 3H2ZA 1BCRA 4B40A 3SOZA 4IWYA 1UPCA 5AUQA 5C34B 4K7JA 4D3FA 3Q0EA 1Z0SA 4BNKA 2OHVA 4F04A 4DS3A 1DADA 4JKOA 5L4SA 4HAIA 2QZ4A 1RXUA 2O20A 1HOTA 1N0UA 1WOYA 4HEA1 4I1PA 3LQKA 4B3MB 2RHGB 3W9SA 1EB9A 3E84A 3QU4A 3L06A 3OLCX 4H15A 4PPQA 4R8VA 3DPSA 2W83A 2Q2VA 2X6TA 3BM5A 1O97C 3V9AA 4J29A 3RUDA 1YRLA 2RMKA 2NO9A 3T38A 2DJ5A 1FX0A 1MO6A 3JR7A 2AQIA 4IDQA 4JAVC 1VI2A 4IXWA 3ZQ6A 4C07A 1JTEA 1M83A 2BCGY 3P0HA 4XR4A 2RBKA 1DKNA 2MMCA 3LPMA 5T4HA 5CXQA 2H8GA 2QD1A 3W5CA 2X0NA 1VMEA 1FP7A 3PQ6A 3MWKA 4GI5A 1XZKA 5C18A 1HQKA 2XT6A 1XDUA 2Q5QA 3NEAA 5FPHA 2QR2A 4KQIA 1U3GA 2ODAA 5EYPA 3WYBA 2NU7B 1U1DA 1K5GA 4KIUA 4TZKA 3RIYA 1T9HA 4A10A 5KWIA 1U7XA 4V0MA 1FFEA 4CIAA 2PDAA 3PNMA 3TAUA 1PR2A 5KWVA 3K9WA 3SNKA 1YA8A 4CTNA 3TYXA 1GN9A 4ZK2A 3U56A 3A7DA 2V6IA 4MO9A 1PR0A 4Q4LA 5EC8A 4BEJA 3SVTA 2BUCA 3KEFA 3IVMA 1Q3TA 2CZQA 3DO5A 2AN1A 3GJ7A 3PEEA 3QIAA 3N0RA 3V2IA 3QEKA 4YRLA 1QG4A 3GJ3A 3ZV7A 2A94A 3V1LA 2QF7A 1VCNA 2GTPA 4FYMA 4NSNA 5AW5A 1X94A 3IVXA 2YHBA 5CLGA 2WKPA 3IMEA 2BFAA 1IJBA 2PUVA 1N75A 2QA5A 2YJ3A 4EL5A 4X97A 5IARA 1IULA 2JCXA 2QGNA 4BCDA 1W59A 3OESA 4IM7A 3X1WA 1KPHA 2LKCA 2WILA 4JI1B 3OIFA 4UPEA 5FUBA 3V2GA 2KHZA 2VTVA 3T5TA 2IBTA 3BXOA 3FF4A 3L7JA 1DIAA 4DNQA 2H6EA 5KKNB 3PX7A 2QUZA 2ECQA 5J5AA 3QEJA 5K09A 1MGPA 2D2IA 3TTUA 3I09A 3B48A 1ZGJA 5EAIA 1COZA 4JODA 1EFTA 3UNXA 2JGIA 3STHA 1D2CA 4YV7A 2PPVA 3TS1A 3ETGA 1C0KA 5D51S 5H02A 1Q20A 4Z7QB 4S1PA 2H4ZA 4GWGA 7ADHA 5E4FA 1WB6A 1ESCA 1RKUA 1Y89A 2PX4A 3M1LA 4WE3A 4XX1A 3M9XA 1E96A 3R7WB 2JK1A 3H16A 4FEEA 3WYGA 4BC1A 1V96A 4G5XA 2H5LA 4JL6A 4R1LA 2GJ9A 1ADFA 3BB3A 2WIBA 1JU9A 5I7EA 3B85A 4KAXA 1ACJA 1P8JA 3FWHA 1NBMA 1ZC3A 5DRYA 2CCJA 2ZE6A 2HRRA 4AUEA 1U1GA 4I4TA 1UJCA 2QM8A 3KE9A 1NOKA 2XVZA 1E6MA 3RFTA 5B3LA 2CY0A 4C22A 4GP7A 4EG0A 2QTVA 2QQFA 3AESB 5C1OA 4FD3A 1KVTA 1X1QA 1P1IA 1R9GA 4TYWA 2C5EA 2WU1A 4GYJA 3HXTA 1Z0AA 4HN9A 2ZSAA 1EUYA 2HZBA 3E8MA 5FBZA 1QIDA 2PRJA 1GV0A 2JGRA 3PNPA 2WZQA 4H35A 4QXAA 3DMFA 5JJ5A 1TQ8A 2XY4A 1AV6A 1KO1A 2EYUA 1NYLA 4QECA 5EQJB 5E6RA 2YIVX 1A4UA 4B84A 1PT8A 3EIQA 2QRLA 2HWXA 4B48A 1M66A 1AKEA 2CEAA 2FPXA 1T4CB 5DSZA 2VHZA 3WRVA 5IJ0B 2J9FA 3LIIA 3LBAA 4O25A 3IDZA 2OQRA 2GJKA 4UD6A 5BSUA 1F3LA 3FTFA 4U1RA 3VTAA 3STTA 1XF1A 3R0ZA 4UNPA 3TJZA 2POCA 4LOLA 2O2EA 3CF6R 4DANA 5CPFA 1FYDA 4X85A 3N87A 1DXYA 4ETIA 5LVAA 2NSHA 1B2RA 1P73A 1X7YA 1SCDA 1V6SA 4RE6A 3T3NA 1E62A 2XVXA 5MHTA 3L6OO 2NADA 4FDAA 2R79A 4O4HF 4KR6A 4O02B 1TK9A 1S8NA 5KJCA 4P3OA 4M89A 2BOVA 1Z2AA 1GT91 2BHRA 1X8LA 2WBLC 4KU4A 2FEWB 3CG0A 1O03A 1IL0A 1UDCA 3I04A 3NWPA 3NRJA 1EJ2A 3PFNA 4ZPXA 1N7JA 1PT5A 3VTKA 5K0JA 4DG5A 2X0EA 4JBHA 4M8IA 1KK3A 1AKWA 5SZKB 3ZZ1A 3NFRA 1S7CA 1VBKA 1I36A 1UC9A 5KO2A 4U2FA 2ZU6A 3Q9NA 3OC6A 4NJEB 1NAIA 1WHSB 1Y48E 1X9HA 4GS5A 1KSFX 3P97A 3QA9A 5G0VA 5LQNA 2QN6A 2QN9A 4PTYA 3OC0A 1RZUA 1UKZA 1WHTB 1TZCA 5KKCA 2D62A 2YIDA 5TDHA 3ZHXA 1A82A 2GBFA 1I6LA 4IZIA 2DUMA 3HR8A 2V97A 4X7MA 3IMFA 5DO9A 3FUXA 1DDOA 4XCQA 2O4CA 2VWPA 3VNQA 2XQGA 4F93B 2FFAA 5KVVA 3JWIA 5ALTA 3T99A 4B80A 4C2UA 2OV6A 3F5DA 2QI9C 4Q05A 3TAHA 3R0XA 2XOEA 1RS0A 3QVKA 2J8ZA 3ER6A 4ALLA 2GAIA 4CF7A 1M75A 2EKZA 3A1TA 1C9MA 4CGZA 1KEVA 1BH6A 2OENG 4EATA 5DX8A 3GX1A 3MRSA 5JEEA 3EISA 2JKYA 1ZOPA 4INPA 5HX7A 2D6FA 3NANA 5KEIA 4ND8B 4KO1S 1X9GA 2JLVA 2RJNA 2FVYA 2M1ZA 4MQUA 4NEQA 3VKHA 2BMVA 1T5IA 3OFJA 5I9MA 5HE9A 1EFLA 5LSAA 1V9SA 1CULC 4CIWA 2CXUA 1SCJA 2DQZA 2YJZA 3NUZA 3DL2A 1HT3A 5DYNA 1FSPA 2Q46A 4L28A 2MSKA 3HB4X 1P5JA 4MDEA 1DKLA 1CJKC 3DVAB 3G2LA 4DCNA 5C8VA 5E3HA 3IEMA 2Z4SA 3DMHA 1PU2A 5K7SA 1SG9A 4D0LB 4LEIA 2ICAA 3S5JA 2ID4A 2WB4A 1D9XA 1FLNA 1QYWA 2ANBA 2FPSA 4M1EA 2I8CA 1N2BA 4B82A 5JU6A 3LZ6A 1RC1A 2H3EA 3CRVA 4X90A 3LT5A 4A0HA 4TWIA 3HMQA 1MJHA 3DDZX 3AB3A 3KAPA 1RRVA 2IZ1A 4WZZA 5LOVB 3N2EA 4MJXA 1L5OA 3CMCO 5LIPA 3FBTA 5EJ6A 3LFTA 1E3DA 3IPLA 4DPMA 3EMDA 3CF4G 2AOTB 4ZU6X 2DCMA 3FWNA 1JPVA 4IOJA 1VIYA 3DMGA 2BFBA 1JDBC 4MMZB 4NKRA 5G2OA 5IC5A 3IE1A 4TWZA 1M0WA 2QQEA 5CBPA 5KU1A 1AUOA 1UT6A 3DJYA 3EW7A 1H3EA 4UM5A 5KSOA 4I99A 4UHBA 4B9EA 1BVRA 3DMRA 3P9YA 5E1OA 1U8UA 4ZQBA 1AKUA 3RPEA 4FGLA 2ZJ4A 4GUDA 2IY9A 1R4ZA 4E46A 1H4TA 4X6UA 3GLGE 1QFMA 1C4OA 2HM7A 5BW5A 1J42A 5L4LA 3X44A 2HXGA 1BOFA 1FTQA 1QH1A 4BE7B 2L18A 4IDNA 1HMYA 4E5PA 3EVZA 5SY9A 3UN1A 1ZX1A 4U7FA 1H9CA 4WCFB 3E7DA 3C3EA 4KLCA 1Q1BA 2HK7A 2RFLA 5EP4A 4IIGA 1FIUA 4LRWA 2AHRA 4A2WA 4NCHA 2PS3A 4F6LA 1RWWA 2BFOA 1CY6A 1NURA 2PSSA 5A4IS 4QDJA 4M38A 3AV0B 4YRJA 5DASA 4QPJC 3GH3A 2J7KA 3PHJA 4UBJA 5GY7A 4QBGB 3GQVA 2AR0A 3BGVA 1S2LA 1O94D 5P8WA 4YGXB 3UWDA 1DO8A 4C03A 3GPDG 3LLMA 3N58A 3HFGA 3N70A 1C0EA 2OTCA 1JSRA 1PQ4A 3PHGA 3LWNA 4H1TA 2XGJA 5LYJB 4RA6B 2I1VB 2F2TA 3OIWA 1JAYA 1E5VA 1P1BA 1XAIA 3RRFA 1JH8A 4BMSA 2VF5X 1EHCA 3QXCA 4WACA 4F3YA 4CLOA 5LN1A 2AI2A 1ONNA 5COBA 3VZSA 1NUSA 3MQ2A 4LYAA 4NI5A 2JAOA 3DLPX 1E1MA 4RD4A 5ILQA 4CL2A 4TMTA 1NF2A 3V8RA 2FDRA 1OWLA 1M2VA 3MHTA 3MGCA 3C15C 3SYMA 1CV2A 5C81A 1X1AA 3K9HA 4HDMA 1KH1A 3BL8A 3FFTA 3L7IA 3QNMA 3O82A 1K6MA 2WKQA 2QRQA 2BFPA 4HGZA 1QCCA 5G0WA 3FPFA 1JR6A 2PQ0A 4WDQA 2ORED 1LI7A 1OASA 4OXKA 4DBVO 4NQRA 1Q3KA 4J1QA 4UQOA 3PJRA 1GCUA 3GLUA 4JXXA 4CCYB 1KFJB 1ZBQA 3DAPA 1O8CA 1T9BA 4XQGA 5CYPA 3QFCA 3H05A 4AURA 2A4KA 4GC5A 1C8VB 1JG7A 1TD1A 1ZVQA 2HXYA 2J3QA 3A28A 4GXTA 5J4HA 3BJMA 3MMXA 2QN2A 1UPUA 2DPGA 2NV2B 3WP0A 3IPXA 2OHXA 5CB6A 1P9WA 2IEBA 1U5CA 3ZLVA 4EMTA 1PJLA 3AEUB 1JX6A 3OT1A 3FUTA 2QMEA 2O59A 1Z35A 3OVMA 3ABRB 3DA8A 4AU1A 1ILEA 1ZGZA 1AIPA 1AKQA 1JLHA 3H1FA 3SSNA 2H1IA 4MKZA 4P08A 4DSUA 4ENUA 5CLJA 1Q1NA 1T6YA 2ABWA 5B53A 5ABPA 2BKVA 1QKIA 3MGKA 4HN4B 1ZVVA 4R2IA 3AFNA 3N0VA 1DOZA 5K8TA 4MR9A 5ECYA 3K09A 3G0DA 1I7SB 2GPTA 3K6KA 3LZCA 3LU1A 3QE2A 3MWFA 4WXEA 2PUFA 4LTMA 1VBMA 3WE7A 5B6PA 4JIMA 2VF8A 4ZQEA 5EE1A 3L0OA 2D3TA 3GVIA 3VU3A 4CKBB 1P7CA 2ZU0C 5KX5F 3C1AA 3CE9A 1V8PA 3PR1A 2V74B 1FRVA 1JJIA 4ME6A 1SHKA 3R24A 1CUSA 4JGBA 2X3YA 3ABOB 5FNVF 4K8OA 2YHAA 1MXHA 2WYWA 4BVEA 3BQNB 3CLUD 3GMDA 1AGXA 1BDBA 3AP1A 3OMWA 4LMRA 2CKMA 4ZVRA 5BN5A 1J9GA 4WJLA 2ISQA 1OYYA 3CH6A 2IYZA 4CLEA 2SKEA 1A7KA 1HRKA 2XF2A 3AU8A 4K9SA 1VIDA 4P4TA 4UEKA 2NV6A 3O1HB 4WN9B 2X3FA 3AF6A 3MT0A 5LUBA 1DMSA 2FOIA 3ENWA 4FWBA 4TS9A 4DLZA 1R3DA 2HRQA 3HJAA 5HM8A 3OQ1A 3RF6A 1PDVA 2VSQA 1WU8A 3IPYA 3IP1A 3KPJA 4L5CA 4LI0A 1FBTA 1LFAA 2G72A 2SICE 3LCVB 1XE3A 2BGJA 3PDUA 2I8AA 2VQDA 5CFNA 1F8FA 2BFCB 5J63A 5EJ2A 3PUWA 5AUPB 4J3FA 3MUNA 5DHFA 5DWVA 1N57A 3P27A 3W4JA 1B0ZA 1JDUA 2HF8A 1K6JA 3EZLA 3JS5A 4K03A 5HJ5A 1E2EA 1ZA2A 1JHUA 4LBZA 3X43A 4BVJA 4DSAA 4RPLA 5KU7A 2C0QA 2WF8A 4PYOA 4G07A 2P7IA 2RHTA 4DEVA 4QG3A 3U39A 1B00A 2OT3B 3RNLA 2ZZNA 4B31A 3QM1A 1ZU4A 3FDZA 4IJVA 4KYUA 1Q0ZA 4DXAA 4EHNA 1X13A 5ALVA 3MZ0A 3QVOA 3W2FA 1JIKA 5B1DA 1EWTA 3TLGB 2QJRA 1LQTA 1CZNA 4G24A 3R76A 2P9ZA 1RSZA 2QKYA 2CFRA 3MJRA 2PX0A 3LRPA 2J4CA 3B60A 1TZMA 4RK5A 2AOUA 3AUJB 3ESRA 3NAMA 3KR0A 3S68A 4DV6B 2M1XA 1OB5A 2AWNA 1GQOA 3ZVMA 1DEOA 1G38A 3EVBA 1VI6A 1GKKA 1PAUA 5DNYB 5CFRA 2ORVA 5JSZA 4HNVA 3FN4A 4H3VA 1R66A 5JALA 1I14A 2CVPA 3AUTA 2IPMA 3LF1A 4K9MA 1NUUA 2Q45A 4PZ0A 3RAFC 2XPCA 2YMQA 2O3JA 3FCOA 3ZDZB 2FI1A 1QHFA 1MMFB 4GZ5A 4JGIA 1JJFA 2Z98A 1Y7PA 1NNSA 4QVGA 4Z7NB 4ZI3A 5KYXB 1TYBE 3FE2A 1JZSA 1N5KA 3IQFA 3L82B 4NS1A 2Q1XA 3WLOA 3ZWXA 3UFBA 2VT2A 3OJFA 1RZRD 3OQOA 5JY1A 4BVLA 2YV2A 3GAMA 2ZT6A 1IEVA 3GFTA 4PZCA 1DV1A 3AXTA 4KQ6A 3V1NA 4BZZA 1O5IA 1ID1A 1YL5A 1S4QA 4RK7A 1B73A 1C5KA 4YI3A 4AJ1A 1T9KA 2FFHA 3JQ7B 2H08A 3RVNA 4P5PA 5FR1A 4Q9HA 4Q7QA 5AUOB 3R0JA 1VLHA 1AV7A 4UAGA 2R66A 4I46A 2F8TA 1BQ4A 3HBAA 3RJMA 2CYBA 5LZ2A 5L7YA 4QT0A 2IS2A 3GJ8A 1ZD1A 4QUAA 1H5NA 4QSMA 3OQIA 5TPWB 1WF3A 3ET4A 3I0NA 3D3EA 4RDIA 2P6UA 4P0QB 2I4MA 3NDJA 2HMUA 1M1YB 3TDNA 2NVWA 2J0EA 3IQXA 1MC8A 4L74A 3D2BA 1PG2A 3L8YA 1R6VA 2OCLA 1AS3A 3KB6A 5FLEX 4M1OA 1VKOA 3JD2A 3UENA 1F12A 3OFVA 4XFDA 1QLWA 1XEWX 1YOBA 3K9BA 3G1TA 3TSZA 4V1CB 2HHAA 3AC0A 3RSOA 2V3CC 3OZBA 1MOSA 4M4SA 1UWVA 3QU5A 4MW1A 1CY2A 4YR9A 4XPIA 2GKGA 4IDDA 3IO3A 5C1DA 4F11A 5IXJA 1MDFA 3U3ZA 4TROA 3WO0A 3HC7A 3PXCX 1NV8A 2H4XA 4K40A 1BRTA 3F96A 5IM5A 3HNPA 3SBXA 4BNVA 4GI3A 4ZVMA 4C4SA 1WEHA 4WJZA 1JHDA 3Q9LA 1CVLA 1UKAA 5CP8A 2ZI9A 4Z8YA 4YWJA 5EIEA 3PNBA 2HHCA 2XQIA 3VA7A 3GUYA 1G7SA 1R0BA 3N3AC 3OM1A 5IT0A 2GA9A 2O2SA 1KVRA 1PR1A 1TQ6A 1UK7A 5F77A 5LDHA 5DM2A 1G8PA 2PL5A 5DNUA 1L1QA 4J4BA 4XB6B 4ZHSA 1PG0A 5DSXA 1PYDA 1SBTA 4L8GA 2FSPA 4UMEA 1O4WA 3SLRA 4HUTA 4QIHA 4O6VA 3NYQA 4RY8A 2Q5EA 1MO5A 2GKSA 3HEAA 1E2QA 3ISTA 2JCYA 4QPPA 4R1QA 3UMVA 5I9BA 2YOGA 3IT3A 5F35A 3B20A 1JAIA 3GRVA 1TLFA 3KPVA 5K3FB 1DBRA 5LCXA 3UMBA 1IDOA 1QM5A 1IRIA 1ZN9A 3TSWA 3JASA 1CUAA 3ZCSA 4KBGA 5FLKA 4HGYA 2IYWA 2C2KA 3SYLA 3VX3A 2I29A 3P26A 2EXXA 3MWEB 3SKVA 5BVGA 2XXJA 5K8JB 5IM4F 1GNVA 3NS7A 1UCFA 3Q1KA 3S1AA 3LCJA 4N0PA 4BAZA 3UB4A 4RQBA 5AKGA 3K09C 4AZTA 3TQIA 1BE0A 1BXRA 1LSSA 4PFKA 4JROA 4XRRA 1MX5A 1EYZA 2C4MA 4WSOA 1PX0A 1I1QB 3FPAA 2ZPUA 2Y1EA 3I2HA 5DXJA 2IKQA 2CCKA 4AMYA 1LX7A 2WTNA 1ULTA 2O57A 3KLOA 2C78A 3COVA 3H84A 2INGX 1RZRA 4YUYA 1EBUA 3DJFA 3B6EA 3T7DA 1ZK4A 3I4FA 1NSTA 2IYOA 3PFFA 2DPYA 5SZJA 3TCKA 5HUJA 3DKRA 5CDFA 3KLMX 3N8DA 1WE2A 3D43A 4F9TA 1JDTA 4TT3A 4DXHA 4C2TA 1PZNA 2OOSA 3GNLA 2P9HA 4HX2A 4NYMR 4YR7A 2X15A 3ASUA 5FWXB 1AN0A 5JYEA 4Q9IA 1S2DA 1LNQA 2QJWA 1GAXA 1C3JA 1SB9A 4IS3A 4EAAA 3Q6MA 2MT9A 3TR6A 4PPFA 4IIDA 1F7VA 4IQFA 1JWAB 4KN8A 2C5GA 1RYNA 4YRSA 4FYXA 4L27A 2ZDHA 2AFVA 2WSIA 1FJ2A 2HDNB 2CT8A 2BEJA 3EZNA 1JDPA 3K73O 4MW4A 3HUDA 3LXXA 5TJHA 1TCVA 2YZNA 1O94C 2PIDA 4RPHA 2C9MA 4YUAA 1RXSA 5JH7B 2CB0A 1M6NA 1IBMB 4DCPA 3N7TA 1RJWA 3OETA 1NN0A 4ISBA 3VSAA 3LZDA 2REQA 1DJLA 1EWKA 2PWBA 3V42A 4OFWA 5JSFA 1I8TA 4ZTZB 4Z4GA 3DZGA 4HP8A 4DV0B 3E22A 4UREA 1BQ3A 2WHEA 3MWYW 4JZKA 4N7MA 1VQ1A 3FAZA 4YBRA 2QJOA 3OOJA 3ZBPA 3WOHA 1XRMA 3AHEA 5DI3B 4ARZA 2YZ2A 1JB1A 2PU5A 3PUZA 4COOA 5CB8A 1NR7A 3D4PA 4REOA 4GMDA 2ZCJA 1BD4A 3OI7A 4MV5A 1W36D 1RM0A 3IAFA 4I9FA 1JHRA 3MSXA 2FFRA 4YRIA 2ZXFA 5K0BA 2L0XA 1W44A 3GLTA 3ONEA 1MG0A 4MHSA 1SC1A 4RD6A 4B3DA 4ZZ1A 1TA0A 2EX1A 9MHTA 1XHLA 2F17A 4I6JA 2Y1LA 4XXHA 3HB7A 2CHQA 2PKEA 4QJ4A 2D13A 3H9CA 1QHGA 2O3UA 2VDWB 4B3BA 3LDGA 5HR5A 5E6RB 4XR9A 2UKDA 3UJ6A 1U4OA 4B4VA 4B7XA 2YWDA 2QN8A 2O7SA 1MRZA 2Z9DA 3KCNA 3WAKA 8AT1A 4BFTA 5JZMA 2BCJQ 1QVVA 5K01A 5JXHA 1TT5A 3OZEA 3F6YA 4TKVA 5JNLA 2C94A 2J9FB 1AM4D 2V65A 1TW2A 2WSBA 3WK6A 5JISA 3O92A 4MRPA 5CCXA 4OGKA 1UEJA 3W79A 3NC4A 1GGKA 4OQLA 2X7HA 5DF1A 3KNZA 3OPYA 3ORRA 3LP6A 4LN1A 3VHQA 4EUKA 4Y6LA 4TTQA 1TUGA 3L40A 2E89A 1HNWB 3VBCA 3DBLA 3G8BA 5DHRA 4EVRA 1AHPA 3G8DA 3JZIA 5F4BA 3I23A 1IZ9A 1WULS 2A1UB 5GONB 1KQGA 3FNGA 1AMUA 1VJ0A 5FI3A 2FQXA 3QV2A 1NW7A 2OXCA 4C89A 5A4JA 1GYPA 1GG9A 3G9XA 1ECJA 5F1PA 1KS2A 2PSEA 1H0RA 1QUEA 2FSUA 3M5DA 1IY8A 3OCWA 5T5QA 4OQYA 2YR0A 4NQZA 1DPGA 4J0HA 3TRDA 4BWYA 2NZUG 1KTVA 1EFAA 1P17A 5BN3B 3QVGB 3BMOB 4L57A 5E7QA 2XYPA 4B5KA 4KDCA 4OHKA 3L7YA 4TTVA 1UAAA 4UMDA 1PZMA 2JIDA 1DG9A 5E3JA 3GL9A 3FDXA 5ADWA 5F1OA 4ZJZA 1TRHA 1I51A 2QU7A 3PP8A 2QNBA 4BNGA 1EJBA 5AVSA 3H5RA 1IUOA 1UFOA 5FO0A 5GIOE 3CLUC 4NY1A 3T9CA 1HDYA 4ZKEA 2ZUSA 2C2YA 4X8HA 4DVGA 2NAFA 3IUYA 2MR5A 4YRRA 1SC6A 1G20B 5LWQA 4MCHA 4Z1OA 1G8MA 1KMNA 3P8ZA 1RQGA 2QAGB 3I0ZA 4I2VA 1B0AA 1JIIA 1SHZA 3MAJA 4IP0A 1VMKA 1VXOA 3EF3A 4MP8A 4A92A 2WU8A 5EUQB 5DCWA 1DCMA 4I81A 3BX1A 4G97A 3TXYA 4BWVA 1E1QD 4OQ4A 3PTLA 3DEIA 1TVEA 1Z63A 4Q01A 3STWA 2FJ0A 5DWDA 4UAVA 5BWLA 4WECA 2B2CA 3F7TA 5FBKA 3VXKA 1L5QA 4YECA 1HSOA 1PZFA 1ZCFA 4BX8A 3QUCA 3DBRB 2POQX 2ECOA 1R0YA 2ZROA 1YQUA 4JOSA 4N0MA 5AW7A 4RSHA 2VTEA 3AGQA 2HR1A 3ISJA 5K45A 4B85A 3DCJA 2R85A 4Q7EA 5FRDA 2AMLA 4B5LA 1VL1A 5I3ZA 2DSTA 3L8ZA 2LR0A 2KW5A 2XMRA 2FFJA 3PUVA 1NZDA 1U0FA 1L5YA 2D1SA 1ZJ5A 2VK2A 3C7TA 5L40A 3GCXA 1ANKA 3BEOA 3JSAA 3JQ6A 4HS9A 2BM0A 3COYA 3QRWA 3FCUB 4WKGA 3IVCA 5TS3A 3WLRA 4WZAA 2X5XA 4OH7A 4HHEA 3KEQA 1AQYA 3VHLB 3JD1A 5DVZA 3RC7A 1XZ8A 3GDWA 5TB5A 3SEQA 2OV4A 1P1JA 5ALLA 1BEUB 1Z4NA 3OFND 5ANRB 1YF3A 3GLHA 3BD8A 2DC1A 3CNOA 3ELBA 3QWHA 2AMVA 2WDPA 4H7IA 5LBTA 3QXXA 3VI3B 4OSPA 5C7OO 1OXXK 5CD9A 3BBPA 4FSXA 3V32A 2B7BA 3M5CA 3DFMA 3PYXA 4QYMA 4QO8A 4C0LA 5FWYA 3I2GA 3HSYA 4A6EA 3OD1A 2RONA 3TH5A 4GRIA 1JPNA 2Q9BA 4TQGA 4D79A 5GJBA 1M6EX 5AW2A 4M1YA 3HYNA 1JKXA 2FFQA 3NWEA 3RC3A 3N8HA 3E0QA 1MHPA 1QRRA 3NASA 1A7UA 3QHQA 4RE5A 1O2DA 5HMMA 4C4PA 2FN9A 1Z13A 3A1EA 1XXHE 4D3SA 2W0SA 2WJHA 2BLNA 4MR7B 1XU4A 1GA4A 2MJLA 1B14A 2V7TA 1AQLA 3CZPA 2H63A 4XJXA 1M6VB 4Q5IA 3N3BC 2I99A 4H7DA 5F9FA 2ZRHA 1KORA 1SCQA 3E0XA 4PSVA 3A9RA 4B2LA 4W5WA 2ENUA 3JTEA 3LPLA 3MWLA 4MS3B 4UVIA 1CWUA 5TQVA 1G4AE 1NJ5A 2GN2A 3BDVA 4CIBA 5KYGA 2VDNB 4B7CA 3C4VA 3GLIA 3FR7A 2J5KA 4Y2SA 4IL5A 1XEXA 5M29A 1COWD 4YHBA 3NR2A 2H2AA 1RQ2A 5COAA 5EXPA 4EA7A 5EWJA 3O8BA 1MA0A 1Q91A 2A9RA 1Q83A 4LHEA 5TGTA 4LF5B 2HQOA 4C4TA 3HVIA 2ACWA 3ZDQA 5A62A 1AHNA 4A9AA 4F12A 2BMAA 2FUG6 2HBQA 1RQ7A 4I9UA 1VG8A 2X8LA 1V5GA 1S01A 2UVPB 4WOPA 5BRAA 1LS1A 1RPAA 4RMNA 1UM9A 1E7SA 3TLMA 4BQOA 4Z4QA 1J21A 1SCNE 4TYYA 1CJVC 1DC6A 4YIKA 2R84A 4ENTA 1L7RA 1CC1S 5CIQA 5HFJA 3RFVA 3I39X 4MVJP 2AJBA 4OCZA 2C1XA 5KZMB 4M0CA 2EG5A 3I37X 1T6XA 1SBYA 1ZVMA 1AK2A 2D5IA 4RK6A 5FFNA 4JYMA 3ZHVA 1VHTA 1E0DA 2ZOSA 3FHOA 1Y5NA 5AK0A 2B34A 2QTTA 1E1QA 1FX1A 5L6LB 1T24A 2K5UA 3L8GA 2KSQA 3G3EA 1E79D 3H1GA 2ISCA 3M6LA 3T9DA 3ZX4A 4MWEA 4U7GA 4FFMA 3WNBA 1R5JA 1J56A 1ZRSA 3JQCA 1Z3IX 5CM2Z 2HT6A 4C0XA 4YV2A 4H7KA 1GLGA 1GT6A 3AFIA 1G2IA 1M6HA 1R12A 4CXMA 4IFEA 3KLPX 1E4EA 4F60A 1HH4A 1NRJB 1PT6A 1W85A 4R9UC 5LNK1 2O14A 3CZAA 1QF9A 3COSA 3A4LA 4C06A 2WRZA 3HCFA 3MNFA 4IKPA 4WCDA 5CB4B 1L7EA 4YRMA 2HKIA 4JOBA 3BDIA 2I7VA 3JYPA 1J0BA 4LOIA 3AEKB 4LV5B 3X1XA 1I3LA 4YFVA 5IPFA 5K0TA 2X19A 4XM2A 4Q66C 3CVXA 4EA9A 3DHNA 3MUEA 4C7OB 5J1TB 3G85A 2JCSA 4D2IA 4ANFA 2YRFA 4AECA 1GL9B 1NUPA 2JEZA 3I9V1 3A04A 3BJZA 2FZWA 3OFNA 4JQSA 4PYKA 1D2RA 5CLLA 2BSQA 2Q8QA 4XUCA 5FTLA 3WWOA 4MV0A 1C4KA 3SXUA 2HJGA 2ASVA 3HG7A 2JJQA 5IAOA 5LP6C 1MXFA 4D6PA 5EKDA 5IULC 1QZUA 1EP1B 4GPBA 1AUPA 3H2KA 1N2CE 4MULA 2SBTA 2NUPB 3OT1B 4NATA 3OMXA 3ZCXA 1F2UB 1U2DA 3R6WA 1YA6A 2R44A 4S04A 2JDID 2IE0A 1TO2E 3BK1A 521PA 3B2QA 2ZWIA 2DTDA 4UUQA 3AB7A 3VR5H 2XNJA 1BGXT 1SBHA 1WM1A 2YXNA 3HCAA 2B1RA 1NVDA 2ZWAA 4MR9B 1KARA 3VMMA 3PBKA 1R6BX 1DQYA 3GBVA 1V5EA 3VVCA 2GPSA 1IXZA 3D7RA 5LMNB 1DPFA 4BV9A 1DBVO 2GX6A 3PT9A 3THXB 3FCAA 1R15A 1M8GA 1Z45A 5K8UA 1GUYA 1GTMA 2XB6A 1YRBA 5AVKA 1RWPA 3GRYA 1HORA 5DKFA 2WF9A 2OYSA 2OYCA 1H9AA 3AJ9A 4RHXA 3ODPA 3UPTA 2UZ4A 1HE3A 2GGSA 1P81A 3EGDB 4LJSA 1JEQB 3FNFA 4JMLA 3EFOA 4MUFA 1OWOA 1HE4A 4ZALA 4AMUA 1S3FA 5LQMA 4LJ5A 3OM8A 4JFRA 1JFLA 5LFAA 1COWA 1F06A 3B7WA 1RAHA 3ZWBA 3LY9A 4CEJA 3DBIA 3F5QA 3H04A 4TTAA 4FB4A 1Q16A 4WFJA 5FEMA 2Z2XA 1GCIA 3B1KA 5F33A 5WRFA 5BUCA 1H6CA 2IXBA 4CN8A 4CUJA 3K1AA 2RD2A 4IG4A 3FWPA 3GFQA 2I6UA 4YGYA 3LVFO 2QVGA 4KPUA 3LY5A 2Q41A 3CGGA 1G1AA 3GYBA 4GQIA 4KWCA 2WE8A 5DBGA 4FC6A 16PKA 4P3NA 3DLIA 5IBRA 1LPBB 1R5OA 1USUA 1GJRA 2HLHA 1Q7RA 4TLDA 4IDOA 4B6EA 4LXXA 5E2AA 2QJTA 3H2JA 4LFCB 2RIPA 1FBNA 1KSGA 3UVEA 3GWZA 3WJAA