1AY0A

Identification of catalytically important residues in yeast transketolase
Total Genus 245
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
245
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVAGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TRANSKETOLASE
publication title Identification of catalytically important residues in yeast transketolase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 245
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1997-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A01
2EZTA 2C3PA 3ZHRA 4GM4A 1YHYA 2BFDB 2BP7B 2XTAA 2JI6A 4QQ8A 3FLMA 4GP9A 2VK1A 3AI7A 2VBGA 5EJ7A 2R8PA 1UMCA 4GG1A 2C3OA 2AG0A 1L8AA 2FN3A 4Q9DA 1V1MA 4KXXA 1PVDA 1RP7A 2Q5QA 3DV0B 1YBHA 2BP7A 2OZLA 5AHKA 3AHEA 5EJ5A 4COKA 2C3UA 3EYAA 2G25A 4GPEA 1W88B 4WBXC 3UK1A 5DGTA 5I51A 2UZ1A 2Q29A 3DV0A 1T9BA 1OLSB 2Q27A 5C4IA 5ESDA 3DVAA 3AHGA 1OZHA 3EXHB 2PANA 1UPAA 2JI7A 1ZPDA 3EXFB 1UM9B 5EJ6A 5HGXA 1OLXA 4K9OA 1X7XB 2FWNA 3IAEA 1X7YA 4C7XA 3EXHA 4MPJA 3EXFA 1UM9A 5EXDA 3ZHTA 1U5BB 2JLCA 5EJ8A 4GM0A 2VK4A 4MQ5A 3LQ1A 2JI8A 1X7ZA 4FEEA 4FEGA 4KGDA 2Q28A 2C42A 3AHIA 3ZHQA 3HWWA 2JI9A 3MOSA 3EXHC 2IHUA 1UMCB 4JUDX 1POWA 5ERXA 5ERYA 1V1MB 2IEAA 2EZUA 1OZGA 2BEWA 2OZLB 2X7JA 1N0HA 4JU9A 2PGOA 3F6BX 1TKCA 2W93A 2UZ1B 5HHTA 3EXG1 3M34A 2JGDB 4JU8A 1JSCA 4ZP1A 1UMDA 3HWX1 2R5NA 3KOMA 2UZAA 4KXWA 1IK6A 3DVAB 1POXA 3FZNA 2QTAA 1PO7A 5HJEA 2BFBB 2JGDA 3M6LA 4C7VA 2PDAA 1OLXB 1B0PA 1YD7A 1BFDA 2DJIA 4D5EA 1V16B 4MZXA 1X7YB 5DGDA 1Z8NA 3AHCA 1W85A 3ZHSA 2BFBA 2WVHA 3IAFA 2WVAA 3DUFB 3JU3A 3EA4A 1NGSA 1T9DA 5K3SA 4RJKA 4JUAA 1UMBB 2O1SA 2C3MA 2VBIA 1NI4B 5EJMA 1V16A 1X7ZB 3D7KA 2JLAA 5FEMA 5K6RA 3HYLA 3AHDA 3DUFA 3OE1A 5EJ9A 2C3YA 5DEIA 1YI0A 1DTWA 3EXIA 3EY9A 4KXYA 1UMBA 1V5GA 2BFCB 1NI4A 1OZFA 2EZ9A 2EZ4A 4RJIA 1T9AA 3E9YA 3LQ2A 5I5EA 3AHFA 4MPRA 2J9FB 2BEWB 4KXVA 2BFEB 4QPZA 2BEVB 2BFCA 1V11A 1PI3A 2G67A 1UPCA 1R9JA 5K2OA 4JUBA 2J9FA 1QPBA 2QTCA 1Y9DA 3F6EX 2BFEA 4K9KA 4KXUA 3UPTA 2BEVA 1UMDB 2VK8A 1Q6ZA 4JUCA 4RJJA 2Q5JA 2O1XA 2XT6A 3OOYA 5EJ4A 1TKBA 2YICA 3AHHA 1AY0A 1YNOA 2YIDA 2BFFB 1QGDA 1ITZA 1PYDA 3FSJX 1QS0A 1X80B 1WCIB 2BEUB 5EJAA 2IHTA 1W85B 1OLUB 4K9LA 4D5GA 3M49A 2BFDA 2BFFA 2AG1A 1YI1A 4K9PA 1X80A 2G28A 1WCIA 2BEUA 2VJYA 5I4IA 1OLUA 2XT9A 2EZ8A 3ZHUA 3EXEB 3L84A 5I5GA 2JIBA 4K9NA 1UPBA 3ZHVA 2E6KA 5IMSA 1DTWB 1V5EA 3EXIB 4K9QA 1TKAA 3LPLA 3LQ4A 1W88A 5EXEA 2C31A 3EXEA 1OLSA 2V3WA 2WVGA 1X7WB 3M7IA 2Y0PA 1T9CA 1V5FA 1V11B 1TRKA 5HYVA 1MCZA 3RIMA 3AHJA 1V1RB 1YHZA 2NXWA 4MPPA 4JD5A 4QELA 1X7WA 4XEUA 2Q5LA 1OVMA 1X7XA 1GPUA 1V1RA 5K6TA 4GM1A 1KEKA 4K9MA 2IHVA 2Q5OA 2PGNA 4JUFA 2R8OA 1U5BA 1QS0B 2VBFA 3EXG2
chains in the Genus database with same CATH superfamily
3D9QX 4BAUA 1LDGA 5AM4A 2BFPA 4XH9B 3UBTA 2W2NA 4OX9Y 4P4TA 3E9RA 4XR4A 2BGTA 4R7GA 3ZI7A 4AIIA 1T0HB 1W19A 1L1EA 2MIIA 4HAXA 3O9ZA 3ER9A 5LSAA 2ISSD 4DLPA 3CVOA 2OXEA 2Q7OE 4EI7A 3DOEA 4JLKA 2OILA 2P5TB 2PH3A 1Y5NA 1J24A 2GJ8A 2PRZA 2X9VA 4ZCPA 1E7YA 3OSUA 5F2EA 1XPOA 3I0NA 4R9UC 1NI3A 4ZODA 2F55A 2UUBB 3OM1A 1L5MA 1KVUA 4WOCA 4MVJE 2GUGA 2DUWA 1FJXA 1JSXA 2L19A 3BA1A 2QWXA 5FB3A 3GP8A 4NARA 4PONA 4P2BA 1L3CA 4XUEA 3VH3A 3ITKA 2QEQA 4QGBA 3KOYA 3ZWCA 1W75A 5GVSA 4A2WA 4RK0A 4DCVA 1T34A 3D1VA 2CNLA 4YBRA 1YJBA 1QGYA 3T1HB 1C9YA 3DBHA 2V1XA 3AETA 3IA7A 3SC2A 4JT9A 3QPVA 3DV0B 3TNDA 2W8BB 1SOWA 4OHFA 4TMKA 2ZBFA 1OV6A 3BORA 4ZT7A 5HS6A 3SLGA 4E09A 4K7JA 4C4OA 3DPSA 5HF8A 2PMEA 3X1DA 4MEJA 1JG7A 1NPTO 3VTZA 5A5GA 1J1ZA 2R6HA 3VJMA 2ZIXA 1HNNA 3FHOA 3DTVB 4MCIA 3CTPA 4HQLA 5TQ2A 4W5QA 1K98A 3QBDA 4MGZR 4PYNA 2OCDA 3RYFB 2G25A 1UWVA 3PGVA 3SJUA 5JR3A 1MF7A 1OWMA 4DIOA 2V74B 4YX9A 3U31A 1PGQA 1XX6A 1F9EA 4GS5A 5EWLB 2Q3FA 2I4OA 1H94A 4YRAA 2GKSA 4G67A 1G8SA 2WU1A 3WKEA 1GTMA 4G0MA 2P4QA 1TM1E 1JT2A 1W5BA 2FFAA 3KPWA 2IKSA 2HREA 4YCAA 2G36A 4CCYA 5JH7A 2AJCA 2EDAA 4ZVPA 1O5OA 4UULA 2EFDB 3HRIA 3WLPA 3JQ9A 2LNDA 1HRKA 4TZTA 5IN4A 3IDAA 2W4IA 1GPNA 3V2UA 4LKRA 3HABA 3CH4B 3OAAD 4MWEA 3C3DA 4PSUA 3V1KA 4B4OA 3X2EA 2ZB2A 1OPRA 1FS4A 1T0UA 4QVGA 3RFTA 3CV3A 3DEKA 1IMJA 2KW5A 1G5TA 3CW9A 3LPCA 4YMWA 4EYSA 3HEAA 3KTAB 1BCSA 1E4YA 1QE3A 2XQJA 1EFCA 3N0VA 3UC9A 5GZ1A 2QN8A 2NZYA 4DJAA 5DWVA 3IALA 3MJCA 1JKMA 1KDRA 2OORC 3DE1X 3L05A 4ERXA 5AESA 1J0AA 4I8IA 4MWCA 1CRQA 2WG1A 4OKNA 3C7KA 3NHRA 3GVCA 1JLRA 1QH1A 3LD9A 4W6ZA 5FA6A 5G1PA 5JALA 3AVWA 1IOZA 1LC3A 2DFPA 2O2GA 1Q1GA 1ZCAA 3KD2A 2ZJZA 3KSRA 5EP1A 1AC5A 3RO7A 3G2LA 4EHFA 5JY6A 4QJBA 1IUOA 2H1SA 3NBXX 4I4NA 5ERGB 3C6MA 2V7QA 3A9TA 3Q7IA 4C21A 2O0MA 3QBVA 4X20A 3R7WA 4QOGA 1O89A 2CVOA 4LOHA 3IUMA 4CUZA 3JQ9C 1CY2A 2RHHA 1DAIA 2PUAA 3WNVA 3PFIA 2WE8A 4P3PA 4J1TA 2PR7A 5TR9A 5CB4A 3N28A 5LQAA 4D6YA 2CSXA 3TTSA 3EBLA 4JI8B 2HRCA 1ZN2A 2F3RA 1V35A 2DB3A 4A73A 1G5PA 4Q3CA 4YT5A 1J99A 4CKWB 2VK4A 3MINB 4EY5A 3E9NA 1D8AA 4KO4S 3BH0A 3CUKA 4C6TA 4DRYA 3EN0A 3P20A 4EGSA 4P5EA 1UINA 1OXKB 2RK4A 3FPKA 3PRKE 4KLRA 4B5LA 5IUNC 4PXYA 4EATA 4ZCSA 4E03A 5C5DA 3SDSA 4QICA 4LWZA 2CZQA 4F1KA 2G0NA 4IDCA 1AHHA 2X7XA 4X93A 2ODNA 1GDDA 2EHDA 4BNKA 1MRNA 3ENVA 2H1VA 4G2NA 2RGNA 3UXMA 5HMLA 1I2MA 2A5GA 3BTSA 4R16A 3EVBA 3DA8A 2WSMA 3ZE9A 1YQEA 2HDWA 3SXJA 5M7EA 2CE2X 1SKQA 5C1BA 1LS1A 3SDBA 3AJEA 5AOBA 5EJEA 3F73A 4R3WA 5CU7A 4GI2A 3UHOA 3NC1C 3JVEA 4LHSA 1E2LA 4GVXA 1IE3A 1L8QA 4D41A 3GFGA 4ABYA 4BQNA 2IWRA 3DBHB 3AETB 3SC2B 2IPMA 1R50A 1N8NA 3ORSA 2IEIA 4XDYA 2XSZD 1A5SB 3W9UA 1OBHA 3U7EB 1WQ3A 1KHHA 2X1LA 4EYGA 1G5QA 4OJNA 4UXJA 1NVVQ 1IBMB 1U04A 4BP1A 4UU1A 4B31A 4D2IA 1CUYA 2HIGA 2ZIXB 1Z0UA 1DC5A 1R8QA 3GBSA 2C9ZA 3D6UA 4M83A 4H0FA 2B1RA 3Q10A 1LLCA 3P9SA 3DHVA 5IZCA 4QVIA 1N5MA 3HO1A 3CJQA 1F3OA 4B3GA 1XCOA 5TGZA 4QT4A 1SFRA 3HP1A 3N6RA 4WE3A 3CF4A 3MCVA 5B58T 1ZICA 3H75A 4NCAA 4I50A 4MQBA 1O6CA 4ZALA 1RYNA 1U7HA 2DG2A 2P65A 1ZU4A 3LP8A 4OQFA 4QYIA 5KNBH 5FO0A 2GCGA 1P0PA 1R0ZA 1K88A 1RRVA 2DULA 1S89A 2X2PA 4CCYB 1SVKA 5DBHX 2H8GA 2JB9A 1N6LA 1E6EA 3AB3A 1CUVA 5ALXA 1JJIA 2PD6A 2BOVA 4PBSA 5LNK1 3HUUA 4KXWA 3ZHOA 2GT1A 3C45A 5C4MA 4MA5A 2YWDA 8AT1A 1RRGA 4ASUA 1JSZA 1PBNA 2GK3A 4L5BA 3C48A 4U7WA 5B6JA 1E0KA 1N6PA 3MILA 1Z4QA 3ZHCA 1KR5A 3STHA 3LLMA 3WGVA 1DRKA 4MKZA 4QUEA 1QHFA 4Z54A 2I33A 3GA0A 3G7SA 2EKZA 4GBMA 1LRJA 3K9FC 3EF0A 3QZUA 1K8RA 2Q41A 2GCPA 1R6BX 1T0BA 4EYOA 5IZCC 1Y7HA 3NH6A 4DR4B 1JA1A 1L7AA 5KCMA 1KQFA 1J2YA 2XBUA 4EEKA 3JQAA 2MINA 1I36A 4MGYR 2CL5A 1QH1B 4F5EA 4OX9B 3PDHA 1CULC 4G5XA 1VBKA 4IOJA 5TY0A 1T4CA 2QZ9A 4OA5A 4UHCA 1RQRA 2OXTA 4F38A 4ZJZA 3AHCA 1T3TA 1SUEA 1J8DA 4JL6A 2QUAA 4DAEA 1GILA 1WO8A 4MRPA 5AICA 4Y2SA 1P6UA 5LQUA 3BYZA 3LBYA 5ENZA 3LOUA 1ST3A 2IEBA 2OFWA 3U4AA 2FHSA 4HRYA 4FOLA 2D4AA 3QF7A 3VVBA 1DX4A 1PQPA 1MVLA 2KPOA 2WF8A 3RS9A 5KQGA 3HQ4O 1LPMA 2G83A 4MICA 2ECKA 4XLLA 3RRBA 2BMEA 2F67A 2WF7A 1BXRB 3M6UA 4MGHA 2CXXA 3R75A 2GAIA 2QQEA 2VBIA 3A25A 2GPJA 1XYYA 5EE9A 4C6TB 1OHHD 3HB1A 3U9TA 4CEJB 3UMGA 1ORHA 3LT0A 4XUDA 2FW8A 1JBKA 1HE2A 4KREA 1X1SA 4OFWA 5AKEA 3ZU3A 2IU3A 3R6WA 4OHMA 5IS2A 1ZUHA 4OKIA 2YUTA 2K5UA 4JWKA 4KJZA 1NQ5A 1WMAA 3SVTA 3ZK9A 3K1TA 1UQUA 1Y4ZA 4W7IA 2C9BA 2WRZA 4ENSA 1I94B 1J21A 1YDFA 2QNIA 1M3SA 2BFCB 4Y2TA 4CZ2A 4DNFA 5GM2A 4PFQA 4DMHA 3BXFA 3DAYA 2EZ4A 1L1QA 2XD4A 1VRVA 3AVQA 1W4CA 1W2WB 2EW1A 2C4MA 3KOXA 1CR4A 3B52X 4CQJA 1SBCA 3CLTD 3DEAA 2ZWIA 4DCCA 4CQMA 3ZJYA 3R23A 5I4CA 3TTUA 1U8UA 2NLOA 3L7BA 4G6ZA 4HN9A 3KJGA 2JIRA 2ZROA 3F49S 3EQ9A 2JLVA 4KI7A 2I2AA 1HKHA 4JI2B 2QHXA 2CKMA 3ZY4A 3WAKA 5KTRA 3QLVA 3EPRA 4HXFB 2HMUA 5K1ZA 3MT7A 4C0HA 1EGVB 2X5NA 1Y81A 4HGOA 5KNLA 4DV0B 2YBEA 3KKZA 1VSQA 3ZLBA 2V96A 2WWWA 5MN5A 3FFAA 3RASA 4O4JA 4F4FA 2PUBA 2YMMA 3GEBA 4ETNA 1L5YA 2BGWA 3JR7A 5C7IO 4ABTA 2GBIA 4WOBA 5T3YA 3GNTA 5B55A 2CV2A 1FU8A 1W6RA 5AMXA 3HA5A 5TEVA 2NV0A 1TCUA 2WNHA 4KO3S 3O21A 5LLSA 1UK9A 2CWDA 3NETA 4E51A 1KA9H 2HV8A 2VOEA 5G0VA 2G09A 2X8WA 3FHCB 2AWNA 3UOGA 3H4IA 3WL6A 2BEVA 3RVSA 3A6ZA 3FPHA 2OFPA 2Q6IA 2IYNA 3IIJA 4QRDA 5DFAA 4QREA 4O6VA 1DQZA 2B8JA 2O1XA 5DSTA 3FSEA 4DTCA 1GNRA 3IMEA 1PN3A 2FQWA 3DAFA 2XMGA 3OX3A 3ZNNA 1KKLA 4QLBA 3ZNQA 4YROA 3OPQA 4J49A 2GN9A 1II8B 2WA2A 3AKYA 3KZXA 3LC1O 5CYOA 2HQ1A 5DHAA 2WSYB 3FNIA 3ZLUA 1CVRA 2HMVA 2NYAA 3IX7A 2OD9A 4AZ0B 3DWEX 5M29A 4K03A 3UW1A 3ND9A 3JQAB 2W6ID 3TW8A 5E1OA 3JZFA 2QL7A 3JX9A 4RLSA 3HDQA 4BDTA 4XFKA 3NRJA 5AWFC 3EA0A 3IT2A 4JC0A 4KK4A 5B4VA 1M9NA 1WCIB 4HLDA 3DSRA 3NKLA 3GLFB 3PZBA 1XLTA 1P8AA 1T4CB 1YL5A 1L3IA 4HVAA 4TROA 3PQDA 5L4LA 3UFXB 2EXXA 3G5AA 4ZQBA 2BM1A 3M5PA 4D9KA 1W1WA 1WE2A 1Z29A 2ZAGA 2ZYGA 3LT2A 3GEGA 5JAQA 4B0PA 4R0MA 5JRZA 4EAAA 2BC9A 2MT9A 1FL9A 4WBSA 1LH0A 3FNEA 4RZXA 4C78A 1W29A 2PH5A 2XWJI 4K9PA 4ZVOA 2G40A 3HNPA 3FW1A 1KOGA 1CTQA 4NCHA 1ZBQA 2AMLA 1CCWA 2OK8A 4HZUB 4JIMA 3NX4A 3WYCA 3C24A 1M2VA 2BEUA 5B1YA 4KPFC 3CINA 1BGWA 3ECAA 5IASA 2NTVA 2CLMB 3K5PA 3TX2A 1I3NA 3TTTA 2C58A 4FC7A 3ZHZA 4P83A 3EXEB 2GBCA 2PCLA 4TWRA 3ASZA 1R15A 5JATA 2ZREA 2HWUA 2IV2X 3OJ0A 3JWGA 4F2PA 1XLTC 3D8HA 4NV0A 3QXJA 1USKA 1FF9A 2BHSA 1UUFA 1AA6A 4RLFA 2ATVA 5EMJA 1PUXA 2K87A 3L1HA 4F4CA 1JA0A 1SZDA 5TQVA 3LY8A 4P4NA 1JFFB 4YIHA 3DEFA 3EDCA 3V4VB 3Q72A 2OLKA 3MELA 4Q1AA 4S24A 5U9CA 4J94A 1GQ2A 2ZYSA 3LOPA 4R9SA 3LRPA 3LXMA 3N0WA 4K3VA 4D82A 5LWHA 1WUKS 2XVYA 1Q22A 2Q1TA 4DLZA 4C20A 3NBFA 5I9SA 1Q95A 2RAPA 4RCZA 5CJ2A 1OLSA 3O1IC 1S2IA 3FYTA 4H6XA 4KFUA 1ML3A 2AE2A 4FZ3A 4RJ2A 1IG3A 4BO4A 3TOXA 7YASA 5TMPA 4CLXA 2KQUA 3TYXA 1V2GA 4CCWA 3EULA 1JHQA 1RYHA 3GRUA 4IX9A 2C7OA 1IBLB 1JBEA 2IVFA 3GN2A 1ADBA 1NBMA 4V0OA 2IUTA 1V5FA 3A3KA 3F9IA 2BIFA 3IP9A 4HAUA 3BAFA 1IVSA 2A4MA 3TCKA 1J90A 4O4JB 2EG5A 3HJFA 1TFRA 3VYTB 1L5SA 4EVQA 2JFPA 1KSHA 1FE8A 1MB0A 1O7JA 3OO0A 3UHJA 3VU3A 3CUTA 1B15A 1QFMA 1YHZA 2HO4A 2JJQA 3NHKA 2Y05A 3B6ZA 3AXSA 4MPPA 1B00A 4DEYA 4QOHA 1UOQA 4M0FA 1DKOA 4P6VF 5J5AA 1AMOA 1I7SB 5ALEA 1F20A 2DZDA 3FF4A 3JS5A 2JGIA 1U8EA 1DBIA 3HGMA 1EBUA 1ZIOA 2RH9B 1V7PC 3O93A 2WMDA 3QX8A 3DL2A 3R44A 4FU0A 4H08A 4JQSA 4UU0A 4UPEA 3U39A 1M83A 2IYTA 1TM4E 4MVXA 4WA7A 4FFVA 3R7SA 1F5NA 1JS1X 2YUIA 3M8KA 3ENNA 3PGKA 3NRCA 2CLOB 2VP0A 5TARA 1PEKE 1J39A 4FR2A 2H06A 3BC1A 4MW2A 3GT4A 5LBTA 4F3KA 1Z0FA 3ZIAA 3NDBB 3GUUA 3COVA 4NVRA 4K9MA 1R18A 4YCLA 3EC2A 1WB5A 5EQFA 4DSZA 5ICGA 4H3SA 1F2DA 2V7PA 2AKAB 3ZDXB 1US8B 1CG6A 4PC3A 1Y8RA 2R8OA 1D6JA 3IEKA 3ONVA 1TM5E 4X9XA 1QK5A 3VJLA 7REQA 4LF6B 2SCUA 4NC9A 2J6BA 3DOIA 3QG1A 1M1NA 3C7DB 1W4AA 1IUNA 1L5RA 1Y3DE 3DAHA 1MPTA 3OF5A 4LIPD 5CGQB 4RIHA 3ZDCA 1QIDA 2P75A 3ZBUA 4B7XA 2QGNA 2O2SA 2F3UA 1VI5A 4CCSA 1G20B 3NIFB 2XCQA 4GL2A 2BLNA 3GZ4A 1PJ2A 1TCVA 3QWFA 4L78A 4F9TA 2VF7A 5EGSA 1Q15A 3R5SA 4DV7B 3P1JA 3V8EA 1OAAA 4R2JA 4Q6WA 2R8PA 1WDLA 2H11A 1RJDA 3ZE0B 1YZUA 4B46A 5K0LA 2ONZA 2W7TA 3M6VA 1FTNA 3WLRA 1NW5A 5FPYA 4EKYA 1F8XA 3RVRA 1KRHA 3NAMA 5ALNA 4O25A 4AJPA 4CHGA 5BV0A 2AOVA 3CXRA 1J5EB 1ETUA 2LV8A 3S5UA 2V6IA 2O7QA 1IJKA 1QGUA 3F78A 3ZDZB 4UU7A 1DXOA 1YBHA 2PQMA 13PKA 4GWKA 1YVEI 2VRCD 2R751 1XVTA 3ZX5A 3IEPA 2HF8A 4H7EA 3Q5EA 4XGIA 2REBA 2Y77A 3KYIB 1TW3A 4BV8A 4C22A 1H8HD 2EKDA 4ARIA 3IXMA 4KIGA 1P45A 1UKZA 2XWSA 1DOHA 4XM2A 5KJEA 4JP2A 3NC0C 5IULC 3ZDBA 2YNMD 1DQYA 1EGHA 1GR0A 1SC3A 2PT5A 2GYVA 1IBSA 1PNTA 3LRXA 2NZJA 2I76A 1XZGA 3LQYA 4X8HA 3WAGA 2G17A 3KB1A 4WBXC 3HM9A 1W35A 2HF7A 1OFVA 5ALRA 3JRWA 5IFKA 2DPMA 3TBKA 1NW4A 2YR0A 1TTTA 2Q29A 3HR7A 1UPFA 2VXBA 4GWGA 1AKYA 2WLTA 1OLSB 3RGGA 4MUHA 4REMA 5F9FA 1QIKA 1P3DA 2B4QA 4PG7A 1HEUA 4OHWA 3UW3A 4LHXA 2C84A 4RBNA 4UTNA 1GPJA 1NVAA 5HM8A 2ZI9A 2F9MA 3WGIA 4BE9A 1YRWA 3PUZA 4AURA 1V8BA 5FBVB 4PYKA 5BW5A 3AKZA 3I9NA 2IU0A 5TSDA 1USIA 1RWPA 5DLEA 4B4KA 4W5NA 3OPXA 4QPCA 1DKUA 1OSNA 3IEIA 3MWJA 4H7KA 3GCXA 4B17A 4BXOA 1LZLA 2BISA 4KQ2A 4CI9A 1H2ZA 3B1JA 2JIQA 4IGAA 3REOA 3QKTA 4GAEA 4YRBA 1U1GA 3KHUA 4FDUA 3UWDA 1JRLA 1TT7A 3QXXA 2IZOA 5BW6B 1B41A 1JWBB 1DUSA 1M66A 3GYBA 4DV3B 3E4DA 2OHFA 1GPLA 5LUBA 3RS4A 1JI0A 1H6AA 1EPUA 2BCEA 3OPYI 2O0HA 1XE3A 5DX8A 4WEOA 3GVIA 3LC0A 4FGWA 5IC5A 3V3KA 4ND5A 5F5LA 5JUWA 2FFJA 1O5IA 1WF3A 5AI9A 2II6A 3C6KA 5K45A 2JFQA 2HUPA 1UBCA 4HRVA 2CJYA 2CBZA 3IR5A 1X2BA 2G08A 2O07A 1LRLA 1UM9A 4ENVA 3GAAA 4WCVA 2P2NA 1MJ5A 1CUGA 5EKXA 4JBYA 2QM3A 3HVJA 4Y9UA 1ZXLA 3S1AA 5I7OA 4MYUA 1NYLA 5D5HA 2YS7A 5BYKA 1QK4A 3SOZA 1PJSA 2ZQ5A 2Q9CA 4KVZA 5EQDA 1I8TA 1ZM9A 1WW8A 2G7MC 2SCUB 1I3LA 1KH2A 1CUJA 4QQKA 5GVRA 2XHEA 3VUFA 4HJRA 4L4UA 4WLVA 2ZB4A 2R66A 1ULAA 3IO5A 4LPSA 2VTVA 4J0HA 4Y2GA 2W0SA 3U6KA 1YZYA 1TJ3A 3JASA 2C42A 4WZAE 4A0GA 3EIWA 3RBVA 1LPNA 2KE5A 4IIYA 4DRXA 3ZJ5A 2VWPA 4U2BA 3SHTA 3V6LA 4MHTA 2WJHA 1LQ2A 2C9YA 3MBIA 1O9GA 4CL3A 3SKYA 3GLIA 4JYZA 4FC6A 4MVJD 2ZR8A 1XXHA 4KQKA 5AVKA 3TZBA 3W3ZB 3I32A 4FN5A 4H18A 3BB3A 1W5FA 1P9OA 4B6FA 4H6VA 1XAJA 1ZUNA 3HLKA 3LNTA 4G0VA 4QUBA 1JI3A 3ZX4A 1EE2A 4RY8A 1F0NA 4G4SO 2VAPA 2ZS9A 4UZSA 3H1PA 1CJUC 3EJ6A 3KOWA 2XCTB 2A8YA 3CA8A 4LC0A 4D80A 3RHFA 5J58A 2QZ4A 3LUAA 1RM5A 1ZMOA 3WIVA 1RI2A 2AQ8A 3ZI4A 1E20A 4D3XA 3G23A 5T7BA 1EX7A 3B5EA 4MWTA 4B48A 3DO8A 1SOVA 1RWOA 3WK9A 2Y1FA 1N0HA 1RAAA 3BGSA 4M37A 2Z95A 2ETXA 1CP3A 5H5JA 3R0IA 4BEBA 1RU3A 2AOUA 3HKEB 2YXBA 4B3FX 2LDBA 3T7DA 2FJUA 5D1HA 1ZH8A 4DN6A 3OJEA 3FPBA 3NB0A 3OJOA 4PNEA 2Z04A 2PGAA 5IVDA 5BWNA 4FNOA 1WV1A 3GJTA 3TNJA 1PR1A 4DLSA 3ASYA 1IY0A 1P62B 1X8JA 4MR9A 4BUZA 1VJRA 3D4IA 5CGZA 2JFZA 2Q7DA 1WEKA 1ZO8A 4B43A 1FUKA 1HZJA 1VMIA 2YKGA 1G7RA 4D42A 5EZYB 1AJEA 3IMCA 3CMMA 1NQTA 3ANMA 2BH9A 2HWYA 3OJLA 3NIGB 3KBOA 1FVHA 1IBKB 1Q92A 3AX6A 4AUKA 1I33A 5C5CA 2QN7A 2XGOA 4E7OA 1BKSB 4MDYA 1GA4A 3I9V1 1VTKA 3IQDB 2CSUA 3OT1A 3RUFA 2RGYA 1DGQA 4AF6A 2R86A 3CZ9A 4U4AA 1GM5A 2Z6AA 1U8ZA 1VYHA 4GOXA 5L3QA 2GI4A 2C03A 3MYRA 1A97A 4RJLA 3KYDB 5F77A 1G2QA 3VAAA 4WH0A 5DM4A 2HA3A 2Y0BA 2ANBA 2GQ0A 1QAMA 2KMLA 1AUOA 4TLEA 4D3SA 4ENPA 4BXOB 3KQYA 3MWEB 1ABBA 5J4LA 1JHDA 4IMRA 1CNMA 4MV3A 4G1BA 1I4TD 2PA3A 4EF6A 5CFNA 5IBRA 1A8SA 3ZWXA 1B0UA 3VR6D 5HZMA 2CLKB 1L7DA 4PXSA 3WK8A 3IQFA 3Q3CA 2B0JA 4RZQA 5CK4A 3GEEA 1M34A 2X0KA 3HA2A 3CVXA 1YACA 1FMLA 5DGDA 1IXZA 1LQUA 4RWEA 2O7SA 3KZNA 1Y9ZA 3CB4A 3O4JA 4K8RB 1DT5A 3BH7A 4UE3S 4UEWA 2Q6VA 4TWBA 4K0RA 2H7XA 1P39A 3A2NA 4F1JA 2PPLA 3QFFA 1TGVA 3GGCA 4G41A 5ECGC 3SIWA 5EKDA 4LDNA 4ZOLF 4ATNA 1QVRA 2J87A 5HKAA 3N2IA 2EFHB 5IVKA 3GB9A 4URHA 2FPGA 3MOGA 4PR0A 1AO0A 1FRQA 1YB6A 4ND6A 4ITVA 3OU7A 5ENVA 4PG5A 2H54A 2NO6A 4D3ZA 5C5EA 1VCHA 2PGDA 2R7AA 2BGRA 2UUCB 3M33A 3OEEA 3CX8A 2NTEA 3FNBA 3KZ1E 3L40A 3OE1A 3TQIA 1U3CA 3OOSA 3EZ9A 1E1QD 3HXOA 5CHYA 1DTWA 3TR0A 2NZWA 3EY9A 1VMDA 1MC5A 3BZBA 2QW0X 4JLWA 1KS2A 3RYCA 3P0FA 2AJTA 2EP7A 1XXHB 4G85A 1VLVA 5FHRA 4UM5A 4UUNA 3F3MA 3BMXA 2EZ9A 1YIOA 3LAWA 4KDEA 4RMGA 4ZA2A 2OWDA 1ZUNB 1JDUA 3KXLA 1QOZA 2PLNA 1T3LA 1E1MA 3QPUA 4UAJA 3ZNPA 3UCFA 1EGAA 3W7AA 2J0SA 3AHFA 3G8DA 1RXCA 2EW2A 4CDRA 1NRJB 5B2EA 3T34A 3GMTA 3CRNA 2YCBA 1D04A 1P8JA 4LECA 4LHZA 1DAFA 1U0RA 3CF0A 5B30A 2WP0A 2LXNA 3BB4A 1TF5A 4ZV4A 1HUQA 4YCJA 5I8PA 5JBNA 3DDHA 2WOJA 1JR6A 4XB1A 2AOUB 1KAHA 1O87A 4RKEA 4B9AA 5B36A 3I2HA 2IDZA 4LOJA 1SCKA 1RMQA 5JBQA 4X61A 2GZRA 2CNWD 4OQZA 2NYVA 3FIJA 2FZGA 4DCJA 1U7TA 2A5JA 2OVBA 3MJTA 3OQBA 4EJSA 2QAGB 3PICA 4BTLA 5H70A 1JR3E 4PVDA 2QENA 3X1MA 1A9SA 1T1GA 3CX6A 3RF7A 1NX6A 1QPBA 3RK0A 3E0XA 1YQXA 1CF2O 5CT6A 3LCVB 5KKAA 3RWOA 3MN1A 2CCKA 2ZXFA 2DYKA 4LJ8A 5CA1F 1YQUA 3MWFA 2XQKA 2VATA 1FFGA 4EZBA 1ND6A 4GMDA 2ZJ7A 1NDQA 3OFNA 5K3FA 3F8TA 3DLPX 3NO4A 3QVMA 1Q6ZA 5IH3A 3RS8A 3C15C 4M99A 2P91A 1I6KA 5JJIA 3AVUA 1ZOOA 1A2BA 4BNUA 1DCMA 2HB6A 4K05A 4JT2A 2F3TA 2IODA 3HBNA 5K7SA 4UTRA 1DP4A 1R4MA 2ADMA 3AF3A 1CZOA 3R5KA 2RI1A 1TO1E 3P0RA 4KWCA 1B73A 1QGAA 2I3DA 1SD2A 3C8ZA 2C07A 4HSEA 3QTLA 3RUIA 1XROA 2IHJA 1LD3A 4MV0A 4MVWA 3G6KA 1XMIA 4LZNA 1YNSA 4E12A 1TM3E 1NKTA 4Q9HA 2BD0A 5CDSA 1NG9A 2VYVD 4AK9A 1ZUD1 2Y99A 4J3NA 1KDTA 4S1PA 3T6KA 4E3WA 1M34B 5A04A 4PFSA 4B73A 5ICFA 1TQ2A 2OE2A 1JFSA 2IXEA 1SIBE 3ISJA 2NQ2C 2ZYHA 2IH5A 1F6BA 3VYRB 5LR6A 8LDHA 4HFRA 3TAHA 1VJDA 1T8SA 5BUSA 2RGRA 5A05A 2X8AA 4DLUA 5JVDB 3STTA 3U3OA 2ZIUB 4IIJF 3RBXA 3VRHA 4DR5B 3OIUA 2Y4NA 5DM60 3FF1A 1GTG1 2PZMA 2WWRA 2E7ZA 5KMGA 1CR2A 3IVMA 4KV7A 3UHAA 4R8MA 1T26A 2G28A 4A92A 2EX0A 1EUQA 3Q4GA 2YZ7A 4NYMR 3B1FA 2G6BA 2IBTA 3ILHA 1DFGA 2EERA 2FPGB 1AKTA 2MTBA 2FETA 4TKVA 2V4MA 1ENOA 1X6VA 2WUGA 5C18A 3KL2A 4MUJA 2RARA 2AR7A 1XFDA 1QYVA 2EX4A 1ACLA 3BDVA 2ESRA 3LDGA 4HC4A 4E31A 1S02A 1VKNA 5KINB 4EG1A 5FDFA 1E3EA 2NOAA 3G13A 4XYLA 5F9MA 4CEIA 1DTWB 2R1TA 4RCVA 2BGGA 2FKNA 5DLDA 1SVUA 4P0QB 2VAMA 1WB9A 3V42A 2DHDA 3E84A 5AUOB 3K2BA 1E2PA 1XIVA 2Y93A 3NONA 2RK3A 3TZEA 4AMVA 4JWTA 1BW9A 3I2JA 3LX5A 3L8GA 4O1IA 1N25A 3QV2A 1DAGA 1NLFA 2R6JA 3RSZA 1IM2A 1FZTA 1CY8A 3S44A 4ENRA 1NN0A 1PJAA 2ODPA 4OEHA 5HBGA 2HSDA 3RNLA 1E3SA 2VC2B 1MR3F 2HI0A 1BYUA 1YGPA 2P9ZA 4LX0A 5FO1A 5JQWA 4RQBA 5DN6D 1V4NA 3MJVA 5A0FA 3AR6A 3H1GA 3GDFA 1QKJA 3LFTA 4B71A 3THRA 4L0CA 4YRLA 3WE7A 1AXEA 3TB6A 1XV5A 1OTHA 5GONA 4NFSA 4ZT4A 4I81A 1ZNWA 1KEWA 3DEZA 3HVRA 3R3UA 4DIFA 2VDRB 4QFMA 2PYDA 2XKAA 4EJSB 1ESMA 1EFAA 2Z5LA 1KOFA 4JR1A 4PV7A 1Z6GA 5ALQA 3WQSB 3BCHA 4KUGA 1OFHA 2PX3A 1V5IA 1PR6A 3FDXA 2I62A 4F85A 3EVNA 2J30A 5L3SA 1Y42X 3NOOA 1FFCA 1HNXB 1T2AA 3MIZA 4XEUA 5CW1A 3H2IA 4B79A 1KRXA 3GPLA 1TIPA 2MDTA 4EPYA 4R31A 3IPCA 1KFEB 1MNAA 3WBJA 1JEEA 2NACA 1BD3A 1HDYA 2GSDA 1BIFA 2PZLA 1NURA 1VSUA 5K3FB 3UGJA 3T9AA 3O8DA 1P72A 2B83A 1T6YA 2J9RA 4YO8A 3D4PA 1LLDA 2HSWA 5ALIA 1GNPA 3FGPA 2QUBA 3F4KA 3I09A 4IHJF 3HWSA 5C34B 3UMMA 3COPA 3IVAA 1GPUA 4DYHA 5C3UA 3P32A 2XMRA 1R4MB 4ND2A 2P9TA 4U7FA 4N0PA 1RIIA 5HGJA 1J56A 4M1MA 1ZESA 5FBWB 5GOTA 1WVMA 2AZTA 3DD5A 1QU3A 1XPUA 4URUR 4PAQA 3HC7A 4MW5A 3PRHA 4QT0A 3VX4A 1PR2A 2AI2A 1IZZA 4N39A 3SC4A 1OF1A 1JDBB 2QJFA 2GJAA 2Q2QA 5BR8B 3NGLA 3MAJA 3W06A 4BJ6A 4OBBA 2FAXA 3NWBA 2C3PA 2UYHA 1JLKA 3OMWA 5CK5A 5JH7F 3AEUA 2AYZA 4LQCA 4FX2A 3KYJB 1II9A 2ATEA 2WWIA 2Y1GA 3TD9A 3AR8A 1FTWA 1TE2A 3MGGA 2VLIA 1LFAA 4AROA 1RPTA 3AZPA 2NU7A 5BSRA 1TGYA 1K92A 3E2IA 1NBOA 1QTIA 3PTZA 4GP9A 3R6LA 1T5BA 5A7HA 3OF2A 3UAYA 4R1TA 2VBGA 4KOEC 5EHZA 3ILSA 4OXNA 5KMGB 4JS0A 3FWZA 4LJRA 3QKUA 1RAEA 1JUDA 1IUKA 2XUQA 2WFAA 5C81A 821PA 5GOZA 1JYSA 2PE5A 1XCLA 3M1YA 2VYNA 2X76A 3OLCX 4MV5A 2O14A 1I1NA 2OHOA 1Q5PA 2V7GA 3T9DA 4WLOA 3KRTA 3V6MA 1UC9A 2WM9B 2NNLD 3OIYA 5KTSA 3ESCA 3OKAA 1BMFD 2R1TB 1QB7A 2C29D 5EE1A 1ZINA 1OIWA 5JDIC 1GZSA 4FW8A 3LDAA 3X2FA 1MENA 3ZE2B 3JPWA 2C3UA 3MYYA 4JBGA 4AM8A 1LBHA 2JZNA 3PUXA 2D5IA 4TQAA 2CWWA 1SH7A 2N46A 2NSLA 3D02A 2YYSA 4B9EA 4BZWA 1PL0A 1XZNA 1YTLA 2QAIA 3E1GA 4TL8A 5J40A 4NS1A 2OGTA 1JDZA 3MA0A 5E1DA 5DKFA 2DT8A 5DP2A 5TIIA 1N0WA 5G40A 1ZQ1A 3BMCA 4HFJA 5JCJA 3U19A 2DTDA 4P7FA 2JIZD 3AY0A 2W70A 1DXQA 4RKQA 5KYTA 3D2AA 1EA7A 4RYDA 1NRXA 1RM3A 4LFBB 1E7MA 1BRMA 2O50A 1OI2A 3E3AA 1P7WA 1B93A 4PFKA 4RX1A 1QIIA 1X87A 5L3RA 3LUJA 2HDNB 3BERA 2P5SA 1OQAA 2I1VB 4PICA 4G65A 2ODQA 1UBSB 5FTJA 1RQLA 1X2EA 3NHZA 3WGUA 4DV4B 1EWYA 2BHLA 3HRKA 2WIJA 3AEZA 3WL5A 4B84A 5ITZB 3CR3C 3GAMA 1VJ1A 1SHKA 2PFKA 3SYTA 3ABRB 4OHVA 3UMJA 5AVQA 1DG1G 3DT8A 4TWZA 2JI4A 3K92A 1M1YA 2IZ1A 1LTHR 2VDMB 4PQFA 4KR2A 5ALVA 4HLNA 4UEQA 5L3SB 4IV5A 2ZB3A 3RT7A 3V8MA 4ZANA 7ABPA 2C83A 1GU0A 3M4JA 1JQ3A 3KEFA 4Q00A 1L5KA 3DVSX 4ER6A 5L9AA 5A4FS 2VDOB 1YUMA 4NBLA 4E22A 3N59A 3ED1A 4W1QA 5LB4A 4DVGA 1N2SA 3DZFA 2JFGA 4P4LA 3LU1A 4XOIA 2C8VA 1LNSA 2AJLI 3CS3A 3L8YA 4BVBA 1QG6A 1G19A 4EW1A 4MV1A 4JX8A 2RHRA 4QRIA 5F73A 3I9FA 4WD3A 4BZPA 3R20A 2O06A 3ZVKA 2ACVA 1SVSA 3EAQA 3LHFA 3OE5A 5LQJA 4TSKA 4FYKA 4EO9A 3BFKA 4DB2A 4DWJA 4WEQA 4QBHA 4QIHA 3A0RB 3PC2A 4I50F 3T5CA 3M4ZA 2Z4TA 3TL3A 4GM0A 1G38A 2PX8A 2QRNA 1TW2A 3IJEB 4MQ5A 1JBQA 1NT2A 1V9SA 3LT4A 5JPIA 4B8YA 4EEZA 5H81A 3NIBA 1GG5A 3KM0A 3KWJA 4WAUA 2AYYA 2A0XA 3OCXA 4D0GA 3AL3A 1W93A 2E2WA 3AEUB 2Q28A 5IVIA 1JXMA 4XYMA 1SOUA 1F38A 3O1JC 4ND8A 3V7YA 3ZYZA 2WPNA 4MSUA 3T3OA 1Z75A 3ZXUB 4IKPA 4LSGA 2HRRA 4LI3X 3HWWA 3ORRA 2G9RA 3RE1A 2JJ1D 3CZRA 4RVHA 2DWUA 5E8RA 2GCEA 4DIDA 1GAWA 3ZDRA 3NP9A 1G3IA 2YV2A 2E1PA 1CUFA 1MP0A 4UD2A 3AF1A 5AFSA 1RXVA 2ZBVA 2DAPA 3NAQA 1K2VN 1P7YA 3AIKA 1DIRA 5JV5A 3HJTA 4JP3A 1R5BA 4AJNA 2AN9A 2WABA 3D81A 4YP0A 2ACKA 2V6BA 4A23A 1N9GA 5BVHA 2IEAA 4Z4QA 2J33A 1AGPA 3AEXA 1WMEA 2IYQA 1CERA 5ENDA 5JMTA 2HIMA 4TS1A 4G5OA 5FULA 1SM4A 4V38A 3T1VA 5SZIA 4B8ZA 4EB3A 1L5QA 3PHBE 4OU4A 4PVCA 3I76A 1MFZA 4ZI5A 1LK5A 1GPBA 2LDXA 1ZONA 2PKXA 3E1SA 4B3MB 2GH1A 5J23A 1CEEA 3O0TA 1IBRA 1TU4A 4YCCA 3EY4A 4WGFA 5ITWA 1LC0A 1IYZA 4UNNA 3E5MA 3KLNA 4RFVA 1U3FA 1YJ8A 2JRCA 3EVGA 4I2NA 3NXSA 5ALJA 2R6DA 3AUKA 3ETJA 3I42A 4BE4A 4IIUA 2YWFA 1DU4A 1R8XA 4FILA 4PGGA 4MV8A 2RGBA 2OBYA 3FDZA 1VLMA 3ABZA 3I5MA 2IHZA 2JC3A 4S0XA 2QOEA 4Q3OA 2Q1WA 3R7BA 1JB1A 2MYUA 4UHBA 2PBLA 2VZ0A 1C9JA 3P2EA 4D4MA 3C74A 1T4DA 4G89A 1OUMA 5CW2A 2SECE 1RI4A 4GXTA 1NF8A 2HM7A 5BQFA 1N78A 1LWOA 4BGUA 1WB6A 1V26A 3AUJB 4R8RA 1DRUA 3KTOA 4CFZA 1EESA 2VP2A 3L79A 2YW2A 4AYWA 1XHFA 4DJ5X 2FRDA 4GI7A 2G1AA 2PJZA 1OFUX 3DQPA 4Q4DA 2QYOA 2XTNA 3FZNA 1E60A 4PPNA 1PGOA 2HCJB 3MCWA 4R71A 1BXZA 1FQWA 1OJLA 2P2SA 1M1YB 4N3NA 3UAXA 3A26A 1VDZA 3HVHA 1J22A 4MH0R 2J45A 4QODA 5KQSA 4E3ZA 5KYGA 3BJEA 1EUCA 1CBUA 2C2WA 2JJ2A 3M6LA 3COYA 1R0LA 4X6UA 5IBPA 3EGEA 3RTAA 4ZO4A 1EGMB 1MO4A 2R6ZA 4LISA 1SC4A 2B7BA 2J1LA 4Z1OA 4KAFA 3N2YA 1Z17A 3KEQA 4FOSA 3KUUA 1D2HA 1HOTA 1U4SA 3Q1KA 2WUDA 1X74A 2FRVA 2L17A 1J0BA 2JCGA 2YVAA 1HT2E 1C4XA 3H86A 1C80A 2DFKB 3NDIA 3SAJA 4DLLA 2ECPA 2OD2A 4JXXA 2H7CA 1OZ0A 3EEFA 1UFQA 2ZQZA 5C80A 6PFKA 3FPLA 3ZZMA 3EIXA 3ECCA 3PYLA 1UXHA 1XELA 4X6XA 2WYIA 3DDUA 1QHHB 1KBZA 2FPPA 3DUFB 1XZPA 4CIAA 3NDJA 2P1RA 3JARB 1A4IA 4AULA 2ATXA 3CIOA 5BYJA 4JV5B 2D5LA 5DYIA 5H0IA 4DV6B 4PYIA 1GY8A 5AD1A 3MF4A 3NTXA 1EWVA 3M1LA 1JB9A 4HBGA 1NI4B 1EVJA 2DSTA 3DBOB 3FX2A 4FD3A 4KH1A 4RQAA 4QQNA 1S4MA 4NS4A 4NEQA 4FMCF 2WQ6A 1CUUA 4DUYB 4OQQA 3D4NA 1JIJA 5AKXA 5FEMA 2WUWE 4EW3A 3GGGA 3ODGA 4ND8B 3LTEA 3X43A 2IBMA 5E38A 4BCCA 1YI0A 4D0NA 3R3ZA 1IY8A 3EXIA 3TOZA 4X64B 5JHGB 2CBGA 1RBZA 2B94A 2NT4A 2QORA 4PS0A 3COJA 1YVPA 1R16A 4ZAZA 1ECPA 3CZPA 4U9UA 3WK6A 1PR4A 2XGMA 5JZOA 2VHEA 1QGZA 1F14A 4WPGA 4RJIA 5KKCA 2FZEA 3LFHA 1YOBA 2AOXA 2XMDA 5B1HA 2YQ5A 1ABFA 4ND4A 1D5CA 1QX4A 1V45E 3G2OA 4J75A 3CLRC 4ZRNA 3QQPA 1YSCA 3IUBA 3GPBA 1BJTA 2F1RA 2RHGB 4L4SA 3W78A 1KXJA 3CLSD 4RPHA 5DB4A 4DVJA 4EENA 3R5FA 1KGSA 3QHPA 1JG1A 2P9GA 1UAGA 3E70C 4XUCA 4DF3A 3J7AC 3ZD8A 2ST1A 1FXUA 1P6XA 2ZIZA 4KLZA 1NP6A 3HCNA 1GKLA 4O4IB 3EZYA 2XBLA 4H31A 2O8CA 1GTRA 2P79A 1E61A 3KHSA 2QR2A 2W6ZA 1B4DA 3IVCA 3E61A 1GCGA 1H5QA 4QBIA 1RVDA 2W43A 3CCBA 3N0RA 5J2TB 3HU5A 3AJAA 3EWNA 3UV3A 1MB3A 2FN8A 2EYQA 4JUBA 4AJHA 4ZZ1A 5GQSA 5BOVA 5KNDD 2PX4A 2FPKA 1BS9A 1OB2A 1DCFA 3CG0A 3IV9A 3NM6B 2H48A 4ND3A 3UM9A 1Q0TA 1M2WA 2AFIA 2QJRA 3M6XA 3MXTA 1T5SA 2G4VA 1JTVA 3UMFA 2J3JA 4KXMA 3DJYA 1Q20A 1FW8A 4R3NA 5KTMA 1KI4A 4NK4A 3OPNA 3E23A 1H8ED 2R1VA 4X97A 2E37A 1YK1A 2Q5JA 3OZGA 4FHZA 4G1MB 1QIEA 1V39A 3JV7A 5BSGA 4RA6A 3FCYA 2D1SA 3JAKA 3L7MA 1XTPA 4LRXA 1E8DA 4LFCB 1OGYA 5F4ZA 2D62A 2JGMA 5CA0F 1SXJE 4KBYA 2WSBA 3PV0A 5BWLA 2GDJA 4HRAA 3EK2A 3FCXA 3QE2A 4EKGA 3VDRA 2WKWA 1UOOA 5EMHA 5KYNA 1KQPA 1UXIA 3L77A 4FPXA 4GLBA 4DWWA 4Z7NB 2VHZA 1I13A 1V47A 1RHKA 1TIKA 4BAZA 1SCBA 5IABA 2PK3A 5JE8A 3EH2A 3K2IA 3FOFC 1KYVA 10MHA 2CXQA 2IP1A 2AC4A 5EQTA 3W8DA 1EVYA 2DQSA 1HI9A 2N0SA 4E5VA 3A4IA 1HE4A 3DKIA 4PQEA 3UJHA 5AKLA 1WDTA 4N6GA 2GZSA 3ZOZA 3G0OA 4G86A 4TWAA 2A1TR 2JDID 4DLBA 1BFUA 2XX3A 5JXHA 1XKXA 1UIMA 1CS0A 4RK1A 1S8FA 1VLLA 4YP9A 3SOPA 4ZKDA 3GP3A 1NASA 3ESYA 3NBQA 4J0QA 1VQ1A 3ITEA 4PX2A 2ZB7A 4LAFA 3ZZTA 4AWAA 4G1UC 2CXUA 2Y92A 5H4HA 1FA9A 1Y5IA 1PNRA 1OW3B 4GMHA 3UAZA 3DLAA 5G3ZA 3ZHVA 4O2AB 4PG8A 1HV8A 3EOBI 1XZLA 1ZK3A 3EXIB 4A27A 2AIRA 3LY9A 3OECA 4JAVC 3V4FA 4U2FA 5E7JA 3PS9A 1Z4KA 3IPXA 1O6BA 1BNCA 3AC0A 1WZ2A 3WGOA 1QQBA 3UJ8A 3GLGA 4UAUA 5T6BA 1KJIA 4ZEWA 1Y3AA 3ZTYA 2WP8J 3OQPA 4JOQA 5AJZA 4E94A 4RM2A 4CLOA 1NUUA 5EKTA 2XMCA 4MZDA 2Z6UA 1KETA 1RW4A 1ZVMA 1N5LA 4DA6A 3MFQA 3DTYA 2GTHA 3K0HA 4R0NA 2JF0A 4RMNA 2LR0A 1JMKC 4P4SA 2JRLA 5JDCC 2SHKA 4ZK2A 5IEJA 1FDWA 3RSCA 1D2GA 3SJBA 5JD4A 5K0SA 4RKRA 1XYVA 2KSQA 1HSOA 2P9CA 4A0HA 3DDSA 3ZCSA 2Z2XA 1JG3A 3ZU4A 3KPVA 1NXVA 2I2BA 2VT2A 4IJQA 1PQ4A 3VAYA 3WYGA 4BVJA 4O1HA 4GKAA 2CFTA 4LDJA 4Q7JB 4IGIA 2PV0A 1JQAA 2IYSA 2VVTA 3P2IA 1RBYA 1NR1A 3P71T 4WJKB 2X86A 4QD3A 5KHAA 2V1UA 3LUHA 2CNNA 5E3IA 2P9JA 1JR3D 1XEFA 4KBFA 2HSEA 5KUTA 3CEHA 1QRTA 3T5TA 5THQA 1PL7A 1GCOA 1TZJA 1KERA 2GERA 1WNFA 3QVUA 4R1LA 3VO1A 4X62B 1ZMTA 1PTJA 3HK2A 1U3GA 4AZ3A 3WA7A 1B8PA 1R27A 4FFLA 3IBTA 2Z2ZA 1TRHA 2A7QA 4L0QA 1XWFA 1X7XA 1AGNA 1O0SA 1ZNQO 5E8JA 3IRUA 2GMWA 2M6RA 3EVDA 4HVCA 1D2RA 5EIWA 4DUGD 3L4BA 3CNHA 1VKJA 5IANA 2DQYA 3OT5A 4HMOA 2TRSB 1LV7A 3O8LA 1WU7A 4G37A 1KZGB 1TECE 3JAKB 5CFQA 5FNVA 1W6UA 2XUJA 1ZOPA 4HH0A 1IHOA 5BOSA 1KEKA 4XIGS 4RSMA 3ZWNA 1ZR2A 4NBTA 5H1YA 3W3AD 4LY6A 2JBHA 2A86A 4EHAA 2O8FA 3OCYA 3QKIA 1RT9A 4JUFA 3N5CA 1CY6A 1PP4A 2XF8A 1GNVA 4NV1A 1I10A 2E18A 5IT0A 2A0KA 1QP8A 4WTOA 4RGYA 2MU1A 2EFGA 2QRMA 3GEPA 5BT8A 2EEZA 5DYTA 2WKQA 3KXIA 2XRYA 3ET5A 2H1RA 4I9FA 1MPXA 3IGFA 2WMNB 1BS1A 5B7NA 5HK9A 2YZMA 2FMFA 2MHCA 4NQRA 5CM2Z 3IESA 3NNSA 4RHFA 3DXFA 4V39A 4BB5A 2QP4A 4ER0A 3LPAA 3PUKA 3BUSA 4PC2A 1HYBA 4LRTB 1YZLA 4RHYA 4OQLA 1NQVA 1A9OA 4YMGA 1G60A 4RPLA 4Q03A 2VDVE 3U3JA 4OFZA 2VP4A 4BLSA 3K20A 2XW6A 4S12A 1MGPA 4GG1A 4Z3DA 3DEJA 2V0GA 1CX9B 2HNKA 1YE8A 3DZ8A 4IMJB 2O2YA 5EIFA 3RS3A 1MN6A 2AX3A 1B1AA 1CS0B 1N2ZA 3D6JA 4HZIA 1ZL0A 5EUMA 1KPIA 2CUNA 1XHLA 1QZUA 4BL5A 4OBEA 3GC6A 5JAPA 2DKFA 5KQMA 3O4HA 4NL4H 2VJMB 4LN1A 1P7VA 2V5UA 3GRYA 1FFAA 1Q2UA 1HYQA 4YJGB 2HN9A 4X65B 1AUQA 3SHFA 4C0LA 2H57A 2H5IA 3G7NA 1PEDA 4N6NA 1NW7A 3QEBZ 3JALA 5JQGB 2BFWA 2C2HA 4AG3A 4BMNA 1U9YA 2CUTA 1ISSA 2JVJA 4EMUA 4QASA 3GLGB 5BORA 5ICMA 2HD4A 3TQCA 1E18A 5TPZD 1NJ5A 1WBDA 3BDIA 4AN4A 4CLOB 2H2GA 3AF4A 2FE1A 3B36A 3GRZA 3UJPA 1VMAA 1Y1KE 2UYQA 4J9VA 4RDIA 1SCIA 3OEWA 5KSOA 4DMRA 1SBZA 3HPRA 3RH0A 3CRQA 4DMMA 2LZ0A 3MWKA 4G8BA 1SVWA 4PFJA 5AR1A 5K03A 5KYUB 5SZHB 3ZBPA 2XB6A 2Q7XA 3PWKA 1PS8A 4QWMA 5DO9A 4PYLA 5EHXA 4GOND 1T3SA 6LDHA 5D01A 3ZGZA 1U3UA 2YWJA 4HNTA 4PN3A 2OXFA 5TT0A 3E3OA 4MRRA 2JD0A 4TLDA 4MLPA 3M9WA 2CEAA 4UE2A 4K28A 2CVFA 3ZN2A 3AHGA 3D8SA 4GT1A 1G16A 4DREA 2FOIA 2YXDA 2ZUVA 2CLDX 3I6ZA 4TL6A 4A0FA 5E4TA 2AL7A 2IGBA 3HXKA 3H42B 1DXHA 3TQHA 4NK5A 2H4JA 5JJCA 3MT9A 3C3PA 4RE6A 1HT3A 1OYWA 2JLYA 2ODAA 3ONFA 4GW3A 4AZ3B 1T6XA 4HNAA 1GFWA 2IOQA 2PTHA 3IILA 3AW9A 1OLXA 1C30B 4IFIA 2FK7A 5CPFA 5AK3A 3UJ7A 1U1DA 1IMOA 1HYHA 1X7XB 4Q4CA 2LWIA 2PUGA 3RVJA 3BL8A 3NYWA 3K70C 1N2CA 1UMKA 3C5WP 3HB4X 3QI7A 4P3YA 3OPYA 4C7XA 4C7BA 1U0HC 3EXHA 3OHMA 2J31A 1ST2A 2FFBA 1FYXA 2BLLA 1JYEA 1NF9A 2AOWA 3L6UA 4W5HA 3TX6A 2JLSA 3LK6A 2YTZA 5G4LA 4YV7A 5DXAA 5EAIA 5BOSB 4CR8A 1XJWA 3GROA 4RS4A 3WMFA 2QK4A 4PLVA 3ABIA 3MMZA 1EIWA 4TTSA 1F4LA 1XVIA 2PWZA 1Q0ZA 2IUEA 4TLBA 2QT9A 5JSQA 1SHTX 2FDXA 5BV1A 1WDKA 4FI3C 4MV4A 4PRZA 4RD4A 5FH9A 2HMYB 4MNTA 5LLDA 2QD1A 4I6JA 4MVJH 2JI8A 3BMOB 3IPLA 4QU0A 1WMDA 1TJYA 1VCMA 4M1ZA 3V97A 3GFOA 4BNVA 1VOTA 4BTVA 5JTTA 1V48A 3OBBA 2RD2A 4I7EA 1SGWA 3D5EA 3MSXA 1X92A 1Q11A 1V8FA 1E59A 5IWCA 3CVUA 4JC5A 3TRHA 1HDCA 4PO8A 5AJYA 3T1NA 4J91A 1JEJA 5JCPA 4PLHA 3KZMA 3MOSA 2BN4A 4R8LA 3PUHA 9GPBA 1RXWA 3EXHC 2IHUA 4KCGA 5T5QA 2IYUA 1SKAA 3WAJA 1NMSA 3CNNA 4RKYA 2DE0X 2QL6A 3GLSA 4RSHA 5CVJA 3PFGA 4JN6B 1QHYA 5WRFA 4HHEA 4LYGA 2AN1A 5ALHA 5KNBA 3HDYA 1ZXXA 4O3FA 5J2UF 4BLVA 4LDPA 4EGAA 2FR0A 4WZBA 1L7XA 2DF8A 2HMTA 2OCAA 3WK5A 1KFCB 2FYTA 2PXXA 4AT1A 3U5TA 5DHFA 3A9SA 2DWCA 2Q1XA 4P31A 4BVGA 3S70A 1RXUA 1UZAA 3LW8A 3EAGA 3PT9A 4XB6B 5FBRB 4CT5A 3CSDA 2VJDA 3ABSB 4IFTA 3JALB 2HYIC 4F4DA 2CXNA 4DBLC 1P1RA 3HNRA 4BWVA 3VV2A 1FYWA 3AONB 1XEXB 2P1ZA 3NYRA 4O1MA 1MEEA 3EIFA 2HA5A 2IVZA 3MGAA 2IV7A 5JTUA 4C5AA 2D1YA 3W6UA 1SZPA 1T8UA 3G8CA 1J7JA 4YJ3F 4CMGA 3GJ8A 1JR2A 1PWZA 3EXG1 5LA6A 1M33A 2E89A 2YOGA 4MRSA 1M8JA 3ETHA 1JAIA 1X77A 5COBA 5CEJA 3KOZA 3CPSA 2X4LA 4TXHA 3RC2A 1S4QA 4YC7A 4ZD6A 4RTRA 1AGXA 1W5SA 1Z38A 1NM5C 5AXCA 1PUJA 2VSXA 1YWGO 4XR9A 3WGKA 3FVVA 5F52A 1KVSA 4JBIA 1B6SA 4L15A 3A0UA 3KOMA 4B3HA 5K4HA 1GAQA 1E1CA 1KZ4A 2NO0A 3VR6H 2FNAA 1OBOA 2F3QA 5EEGA 4KQFA 5DHTA 2ZRHA 4BO5A 1ONPA 2DPHA 2ZRNA 5JLAA 3QUQA 2ECOA 2NM0A 4PO9A 3EIUA 1DRWA 4LBWA 4MS1A 1A0OA 4NZNA 4PG4A 4G9EA 4Z9BA 1SD5A 1VL0A 2HK8A 5KX5B 4YWHA 1XNJA 1VGQA 4NH0A 1CVLA 3E7DA 5G3YA 4F9EA 4C3OB 5H80A 1J09A 4YAIA 1OLXB 1N1MA 5IVPA 1P75A 4I8XA 2YMPA 3RDPA 5CDUA 2C5BA 4ESEA 2XGJA 4NBNA 1NN1A 3D0RA 4RVDA 4MZXA 3Q3HA 4AFNA 5FA5A 2Y68A 2ASEA 2CMFA 2GILA 3OPYB 2D5CA 4NR0A 5BNIA 3PX7A 1N2EA 5EIXA 1BD4A 1WXGA 4FLMA 2C1XA 2QL9A 1X1CA 3ZS8A 4MIYA 4PC1A 1MOPA 2J85A 1YTUA 2ZYIA 4G0OA 2GAFA 3HDGA 2ZJ5A 4E5KA 5AVYA 1E4OA 2B8TA 3CUVA 4BBAA 4X95A 1DO0A 1UKEA 4XQGA 2WAOA 4B34A 3DR3A 1HQKA 4JQOA 3DHYA 3ZCVA 3R9IA 2J5XA 2IQ5A 3HJBA 2XAUA 2BCJQ 2RAUA 1MBZA 1QO9A 1OYYA 5A4AA 4XA8A 3TIIA 1BTOA 4GR5A 4RKWA 2GR9A 3STYA 3WMEA 4I4IA 4UPDA 4GZ6A 1PFYA 3TIVA 5L51A 3A6EA 4Q7KA 1CF4A 3RVLA 1DB3A 1OD6A 1PKXA 1U8TA 3D8BA 4KQMA 1XRJA 4YALA 3UKDA 4XWGA 5DM1A 1B0AA 2AXNA 1EK0A 1OR8A 2CFRA 3GGDA 1IHUA 2XYPA 3HVKA 4FWTA 5B3JC 4JL8A 3WIOA 2PZFA 1LJLA 5AJXA 1OB5A 2Q1SA 4MIEA 1OIVA 2P0AA 4Q5IA 1Z34A 4CM4B 4EVSA 2XH8A 1L5ZA 2ZSBA 1MDBA 5F4BA 1ZJ4A 4BNIA 4DABA 1OXTA 3PD1A 3EZ6A 2CCGA 4MYSA 5EHNA 2GEJA 4NP6A 5C8DA 4LS3A 5FUQA 1N6RA 2IYEA 1U65A 4WZBB 3SZGA 4NYMQ 2WF9A 3MCUA 1HY3A 1YK0A 1PGNA 4XRGA 2Y66A 3CYFA 1BVRA 3KAJA 4ZCMA 4NCIA 3PE3A 2OM6A 2ZWMA 2YN4A 1QX3A 4H59A 3WOHA 4OMDA 4A0QA 2TS1A 4IDQA 2YN2A 5AYVA 1A9QA 3KEOA 2WPDA 1YRLA 1DPFA 4UTPA 1VSBA 1WXHA 1VBFA 3CNBA 3GLFE 1Z07A 4MJLA 3SF8A 4IV8A 1EEHA 2ZM6B 3AG6A 3BGOS 5TDHA 3FKSA 1ZZGA 5CD1A 1QSGA 4NBRA 1KWKA 3GUHA 221PA 2JBAB 1IEXA 2ZJ0A 3HKCA 3ZBQA 2LW7A 1W4BA 2VRNA 3NAGA 4KXQA 4F93B 4LX8A 1R0WA 1EM8A 1HQYE 2OSVA 5A3JA 2B34A 1Z25A 3QX9A 4P53A 4V0MA 4JSRA 4DV2B 4FYXA 4P0PB 1E8NA 3DAOA 2GAJA 3M5WA 3NXKA 4HD8A 3NJ4A 4JBWA 3FGZA 4ESHA 3D54D 3KPUA 1ENZA 3RG2A 5KWIA 1NJ6A 1P4AA 3O0DA 3DMNA 1TUGA 2XT6A 4HO1X 2XVZA 1XK7A 5JAOA 5I7VA 4RPKA 4UKDA 2ZPUA 2X0EA 1CJKC 3C4JA 1FFXB 1H6CA 3WA6A 3O3NB 2D8AA 4NMWA 4UDNA 4MS1B 4EW6A 1QNFA 2CHGA 2ERXA 3DE4X 3F7MA 3Q2IA 4N5IX 1S6YA 2OWEA 4QXOA 3T0FA 3AR4A 1ZUWA 3ILXA 4G23A 3O8QA 2ZIWB 1Y8QA 5F64A 4E07A 1BAPA 2IYLD 3DCJA 3HCCA 4J7UA 4R9VA 4YEDA 5IWAB 4TT3D 3HXLA 1GA1A 2FZKA 3KT0A 1X80B 1M2KA 2J3KA 2AF3C 3MBKA 4NBWA 5EUBA 4DJDC 3U1BA 3S2EA 3TGWA 1OX6A 3AIOA 2QRKA 3I8XA 3ZDAA 5KO2A 2YASA 2FKAA 3LA8A 3CLHA 3E8SA 2FQXA 1LPOA 5EJAA 2IHTA 4EQ6A 2ZVPX 2QZJA 1O9BA 2YWBA 3PGLA 1P3JA 2JFHA 4FP9A 4UTXA 4Y8VA 3RSHA 2JIDA 1U94A 3M49A 2Y8EA 3KU4A 1ZM7A 2VFAA 2BFDA 4M60A 1H2XA 1VHDA 1VZ2A 3ISTA 3I0MA 4OCZA 4PGAA 4KAXA 1G291 1QVAA 1YZHA 2EBHX 4PNHA 4LYEA 4WLUA 5AI5A 5GONF 2A1TS 3I2GA 4KL8S 4AVYA 1PFKA 3OF3A 2JGFA 2Q9UA 1S2LA 3NOXA 3FHLA 4AJKA 3QBEA 2AQIA 3BRSA 3L18A 4RVNA 2IDJA 4XCVA 1JTFA 2AXEA 2YHIB 3OHSX 4UTOA 3TECE 2BGNA 3LHIA 4E5MA 1T5LA 2ZWAA 4NU6A 4BKPA 3L7LA 3VSCA 1IWPB 1VCOA 2DBQA 1EFVA 2QRLA 3EWAA 1XAIA 3G0BA 4I5GA 1W0JD 2AN4A 3I6BA 4JOCA 2Q3CA 5IEBA 2P41A 3DFKA 2EZ8A 3OTIA 4I5FA 3VO2A 4B2PA 5F98A 2G5TA 1M8GA 1AB6A 2WWYA 2GBPA 2V65A 3EWIA 5LMNB 5DLPA 1KAMA 1SVIA 2PT6A 1DAMA 1W0KA 4AJ1A 2E6KA 4BBPA 3KUXA 2Y0DA 3AW8A 1ESNA 1YT5A 3BGVA 3FUCA 4CL0A 5K09A 4PBTA 1L0BA 5A4KA 4LI0A 2FZVA 1A5BB 2AX4A 2K6GA 2LIVA 2YYYA 5U1PA 1V1JA 3NVKI 2W6JA 4O3MA 1R0SA 4QQRA 3RTDA 2HRBA 1GO2A 5DE3A 3BE5A 3ND5A 3G2KA 2H4FA 4PAGA 2IS1A 4JHLA 4CMIA 5JSHA 1SXIA 5BR7A 1BHQ1 3SKXA 3THXB 4D0LB 3CH5A 4Y0NA 3ZXXA 2L2QA 4ACAA 2QVBA 2Z1DA 2EV9A 4PX9A 1AA9A 1N7HA 2INGX 3PA6A 4Y3UA 4TTJA 2NZVG 3PWSA 3V8RA 5FKJA 2Q50A 3KBBA 5AIBA 3LTNC 3IODA 1I3MA 3RRJA 2IXFA 2Z08A 4PHCA 4RD2A 5JY1A 4H7PA 4DUZB 1JILA 4F86A 3RARA 3RIMA 1T0PA 4AUNA 4XI9A 3AH8A 4UZFA 1TOAA 4JLPA 4XARA 3REQA 3G5TA 4L85A 5LPNA 5LL6P 1EX1A 1N0IA 4JD5A 2WJ6A 1A98A 2QUJA 1U9CA 4ONEA 1FP7A 1AXGA 2R6R1 3UMBA 4JA2A 4A6XA 2XNHA 3TIXB 3T7TA 3N0TA 1GZ5A 1UC4B 2D1RA 3EZGA 3UGTA 4BJ5A 5CM8B 5KDDA 1DTEA 2ZJOA 3PTLA 4L6CA 2HCBA 4WNAA 1MAWA 5BWCA 3U49A 1XMJA 1NSTA 3KQTA 3UJ9A 2YFQA 3RAPR 1UQTA 1WMBA 1Q0SA 4B5KA 3MGCA 1V0JA 1OXXK 2WZQA 4C87A 1HWYA 3PGJA 5IXJA 4R05A 2WY2D 3H3JA 3K09C 3KQVA 1JAXA 4P93A 1DV2A 4NRDA 3JRNA 2DRIA 1KFJB 2AMVA 2ZUTA 4MRNA 2KI5A 2CT8A 4KC0A 4INJA 4YAFA 2DUNA 5HKLA 1TCCA 5BQOA 1RXSA 1WMSA 2IHVA 2V45A 5CYFA 4IQ8A 4MRVA 1Y8QB 4M88A 4KXLA 4J1SA 5SYNA 1BKDR 4M46A 2IY7A 3TRKA 1F0YA 2AQKA 2V3VA 3EH1A 4KNVA 1DWQA 4ZARA 3RANA 1GTL1 1JHXA 2P4SA 5DBGA 5E6UA 4D3FA 1LI4A 5IKPA 2BM8A 1I4OA 3ZJTA 2R9VA 3RM3A 2HT1A 1FTGA 1Y80A 2AMYA 4BAGA 4KIJA 3SQDA 3W77A 3WWYA 1KZ6A 4ID9A 4X44A 5F2OA 5T8KA 1YVUA 4IPTA 2DU8A 1YHYA 2WUVA 3AF0A 3T3IA 4IAOA 3TSCA 2BFDB 2IUUA 3NQ41 2XTAA 1E9SA 3LWBA 1QP0A 3AIMA 2Q62A 1N2OA 3FB4A 3NHUA 1JECA 4YJDA 5B58C 3VZRA 4RY2A 4CW7A 4UCXA 2FX5A 1AQ6A 2JKZA 4GSLA 1UMCA 4QM6A 3LUGA 1AKNA 1W73A 1XRSB 1Z74A 4E11A 2PUEA 3A32A 2ZYDA 3ANNA 1V6AA 3HI6A 3C3CA 3LDFA 5IAJA 4K6HA 4WKPA 1Z4PX 3H8SA 2HHCA 4IOKA 3SZRA 1W581 5ITVA 2BY4A 2H1WA 1NKSA 1SCNE 4FHDA 3AL2A 3LPDA 4U9HS 3AMVA 4UUPA 2UVQA 1CEQA 2X58A 2Q5QA 2P6MA 5CYGA 3U1VA 4E2WA 5JNWA 1CUHA 1M5RA 1W46A 3B3GA 1H22A 4NZ9A 5IBCA 2KM1A 521PA 4I36A 5C8YA 1D3AA 4WVLA 3TVYA 1V9LA 1LDEA 4CV2A 1QIGA 5CCEA 4DJFC 1ZCZA 2PKQO 3D4LA 5T8KC 2PKCA 3R9WA 4FDTA 1AK9A 4C2UA 2V4ZA 2YMQA 3WWPA 4URFA 4NCJA 1NLZA 1ZVKA 4NXMB 4RV5A 1LK0A 1G8JA 2PBZA 1KAGA 2V7EA 1V37A 1FBNA 1Y98A 2PAAA 2RHBA 5A5EA 3ZC3A 3LSYA 1AN9A 3VHXB 1I4EB 3IQWA 4GI3A 5DGTA 4CMIB 1RQGA 4MUAA 5K5EA 1KZ1A 3H5AA 3O3MB 4RZHA 2QGZA 3PEUA 2BUAA 3RG8A 3PIIA 4AMBA 1G18A 5B7GA 2ASVA 1EUDA 4IH4A 1A3CA 4L3OA 4R1UA 1SKMA 2HNAA 2XYGA 4B4DA 1I3KA 1RRPA 2HSZA 3Q87B 4NOMA 3H9EO 5BN4A 2HCRA 4D8XA 4ZYVA 2IEYA 1GP2A 2W2LA 5ES3A 2BMVA 3DQQA 4XD2A 4WK2B 2RCYA 5CX4A 2EW8A 3A1SA 3RUEA 3MHPA 4GL4A 5G1NA 3TJMA 5DMHA 5U4QA 3KSMA 2WYUA 1CUZA 3CIFA 5ER9A 4XGQA 4R41A 3K8OE 3EUEA 1U98A 4JBHA 4ALMA 4UU8A 1K6MA 3A2MA 5BURA 2QQ5A 5BN5A 1FLVA 1QVWA 1XVVA 2P78A 2Q0XA 1KO4A 2QLMA 1CEYA 3WFIA 5E7QA 3BOSA 2NADA 4URXR 3T1YB 1KC1A 2FEKA 2VP9A 3FPAA 1VFNA 4PYOA 3IVRA 4L8GA 3U0BA 2P2YA 1AZTA 4BFUA 5EJ6A 4I5DA 6NULA 3NUQA 4WNAB 1SBIA 4BNJA 2XB2A 4YB8A 2ETVA 3R76A 3TEMA 3HNOA 3NANA 3IDQA 5JBIA 3R5JA 3W5DA 4JLBA 4Q9LA 2IDKA 4ZHQA 1IL0A 5ECWA 5HIAA 2O3RA 1Z3IX 1ZI6A 1H69A 1NE2A 3OMXA 1V5WA 4FNAA 4U7PB 4PZEA 1HTBA 3GPIA 4EA6A 3E9MA 5H3CA 4LHWA 1VB3A 1IG0A 2QRGA 1ZKMA 4JR2A 4LE1A 4N47A 3IR6A 3DZIA 2Q6LA 3MT0A 4RESA 2Y9MB 3PDIA 1DL5A 4MA4A 5ES4B 2QMUA 2QY6A 1UEJA 2XZPA 1FUUA 1QE0A 4HGPA 4W5OA 2YRXA 4RXMA 5BW4A 4HF7A 5TS2A 3UCEA 2OFOA 1XD2B 3IBFA 1J33A 5LQRA 3C4QA 5LZ7A 3DTVD 3EARA 1M75A 1MRSA 2V6MA 4HH3C 2YV5A 4MR7A 4QA9A 2XMSA 3N8GA 4JKIA 5KYVA 4AL4A 2HK9A 1YS1X 2O4CA 4I6GA 4R1MA 4ALIA 4BV2A 1IULA 1M8FA 1FXWA 1NVXQ 4EHJA 3H11A 5HKBA 5EJFA 3M70A 4GEGA 3N2GA 5DK4A 4JI5B 5AVOA 2K2WA 4O08A 1NUPA 4ED9A 1GNQA 2PQ6A 3AHIA 1NMQA 5CG1A 2FEWB 3HLYA 2J5QA 2P6OA 2GZDA 1P0MA 4KYVA 1QTRA 3AVOA 1E2MA 4GRDA 2RGDA 1UXGA 4DLWA 3VKWA 2GN4A 3BEOA 4OJTA 3FTEA 1M0TA 4I4CA 4LJKA 4YA6A 1UMCB 5GZ6A 5HJ2A 4UOZA 3CLRD 1KWGA 1G17A 5JJKA 1T9KA 2Z8XA 1VRWA 2P9YA 4DQXA 3CN9A 1IJBA 1DI0A 3E8MA 4N5HX 1POWA 4R84A 4X1IA 5T41A 3WB2A 4EMSA 1GTSA 2IOFK 1NULA 1Y9EA 3TZCA 1FYEA 3PC8C 1GCIA 2FMXA 3H17A 4NG5A 1U7PA 1A9RA 2D8MA 2EZUA 2PVSA 3N53A 5DM0A 1NXTA 3I01A 2Z2YA 4F21A 3QIVA 3BZUA 2YOFA 3ZLTA 1X86B 2HLNA 3DEIA 1FSPA 4HLQB 3PEEA 1WEHA 4KX3A 4LHYA 1JEDA 1P4RA 1SQ6A 4NOJA 5AK4A 4F3TA 3W4IA 3ELWA 3DO5A 5AW6A 2D6FA 4D0SA 2LVBA 2R8XA 2BYTA 1FSFA 1KY4A 1Q44A 2MWMA 3BFVA 1CJSA 1VIAA 2D7CA 1MHPA 1WNTA 1YCFA 2FCAA 1CQIA 2NYUA 3EODA 1S2GA 2MSKA 2NAFA 2QLFA 2YV1A 1VLQA 1XF9A 3WGZA 5K9ZA 2HHHB 3TSWA 5C8VA 5IW8A 1YZNA 3SLKA 2ODBA 1SRRA 3KL4A 4D56A 5B57C 3A3YA 3W7BA 5IKMA 4OY3A 5FORA 1Z0ZA 2DPGA 3K8YA 2XWBF 3O74A 1E94E 1W8IA 3Q15C 5FI3A 4BMOB 3KC2A 4BFTA 1VZ3A 3WBBA 2IX9A 3T99A 2PEZA 2ZWOA 1TUIA 4OLAA 4X3OA 3SM9A 3TTXA 2ZOSA 1CQJA 1IDOA 2F2TA 1FOEB 1L7BA 3EEQA 3KD3A 3QNMA 3DFUA 4HQ0A 3HR8A 4L8VA 4O2BB 4QTZA 4COOA 3P9IA 3USCS 5CT8A 2WIGA 2XF2A 3PLRA 5EOVA 3STXA 4QVKA 1MT0A 2W2MA 1LWNA 1UJ6A 3WKDA 2XA9A 3OJCA 1RPJA 1Z4OA 2YVUA 1UEXC 3LLCA 3M82A 4BOYA 3D6TB 3G17A 1UL1X 1ZKDA 1YMUA 3NHJA 4BEVA 5A5VA 2I03A 3AF5A 1CQWA 3DYVA 1CHNA 1JDBC 4IWYA 4I9UA 4ML3A 2R8YA 4RY0A 4FYIA 3W8FA 1T2FA 4MJXA 5CVUA 4LF8B 4MVJM 4S1OA 1AUVA 1SQ0A 2WQZA 4PSKA 3C70A 3RFFA 2P5UA 3DKKA 3IV7A 4RH1A 2IYRA 3FHTA 4U0JA 2I1LA 2QW8A 3TXYA 2DM6A 5IT4A 3C7CB 3GVPA 1FNMA 3WLMA 1EQAA 4JA0A 1Q16A 1XXHE 4PYMA 3K9BA 1P2GA 1M6NA 4BJHB 4GIBA 1ZA2A 4ZHQB 2XTZA 2ORIA 2PKYX 2ZATA 2QS9A 4RHUA 4JENA 3GJXC 3AUYA 3RWMB 3GF4A 1H1DA 3IYLW 2ZJ1A 5CM9C 3ZHSA 3EOZA 3O6VA 4TTIA 1GUZA 3RC9A 3OFSA 1QTQA 4FLEA 1FTQA 2XUPA 3FMPB 1NN3A 3HB0A 3WWZA 3IAFA 2CJFA 3SJCA 1X42A 2ZIFA 3CVVA 2WT4A 1PEYA 2ODWA 1P74A 1WB4A 2PAFA 3W8NA 4DM7A 2VT7A 1CU1A 1EDBA 3N9IA 5ED4A 3CVJA 1QHSA 4IQFA 1PR0A 5I9MA 4GBED 3FIUA 1LY1A 4HUJA 4RYLA 4Z2YA 4AECA 2OUKA 4HBZA 3GGOA 1M73E 4MR7B 1VXRA 3UB4A 3OPVA 2YZGA 2H6EA 2ES4A 3I3SR 4WVFA 4NDAA 3N2GB 4L4YA 4F2HA 1B6RA 1SXHA 1H9BA 2DFTA 3AM4A 2C7RA 4A8JB 2H7YA 2QW1A 3HYLA 5JAZA 1YB1A 4YWJA 3EVCA 2BGKA 3CURA 2C3YA 1BH6A 3HJCA 2RB5A 5I47A 5LKRA 3C6ZA 1TPYA 2B5WA 1PIWA 4MW7A 3ZY5A 5J4HA 3RSGA 3IA2A 4WRRA 1MEJA 1NOIA 3BQMB 3QU7A 4MHSA 4R69A 2DX7A 2OCGA 4YMHA 4OSEA 3VPDA 1E9VA 3A70A 4AJOA 2FZ5A 4KWHA 4HNVA 1F8GA 1ZIYA 3OEHA 4BC1A 2ERYA 3G5LA 5K0ZA 2BSAA 3PD7A 2AUTA 3G8AA 1E58A 3PFNA 4FMDF 5A3SA 3QU4A 1QGED 4BLTA 4RMHA 1RLTA 1MTZA 4WFKA 2O2JA 1A5AB 1XSEA 4UVGA 4YP5A 1NVEA 2ZBEA 2G4LA 3VO9A 1R7RA 4BQRA 3VKGA 1K27A 4QECA 3EG5A 1T3GA 3A1WA 3M4NA 5KNDH 5EFOA 1XA0A 1K5DA 2H31A 2FW0A 4FFRA 5DU2A 5TQJA 1KEUA 4DC1A 3VC3A 1O9HA 2A94A 2HK6A 4HGNA 1SR8A 2RBEA 5JZVA 3GUYA 1CQIB 1TYDE 3D3EA 3NDRA 1B1CA 4HXEB 4ZT5A 1M34E 2ZGVA 4PYRA 5FEUA 1HORA 1PJBA 3DLHA 4B35A 2DHQA 3DFFA 2B2XA 5HWSA 3WSTA 2DWQA 4EG4A 4ETWA 4J9UE 2Q9AA 3MJ4A 2AJ8A 4JROA 2IXDA 1THMA 3USES 2QTCA 4AO7A 1QH9A 2CFOA 1W44A 1PDVA 2X0FA 1T1SA 1WULS 2IK8A 3T3NA 2XYRA 4UNQA 4KLAA 3V80A 1Z7YA 2BFEA 4K9KA 5FOTA 3ZTWA 3ZWPA 1GR1A 3UPTA 1EFDN 3T12A 3ZNOA 3N2LA 3NOQA 1Q84A 3G9ZA 3LY7A 5LP6A 3ZWBA 2QG4A 3FOAA 1NLYA 4GLOA 4YASA 1F2TB 1SEPA 3IAS6 1EFPA 1KXZA 3PX3A 4WX2B 4Z99A 4RC9A 4R2MA 1SELA 2E0IA 2JHGA 4NKRA 4F92B 2X1HA 1YS4A 2IIBA 2NO5A 3NALA 1C9NA 8ABPA 3EC1A 4N5MA 1CP2A 3UB3A 5KYWA 5F7JA 5TS3A 2IITA 4J16A 1LLFA 2EVWX 4OMFG 4WHMA 3LL7A 5JC8A 3UTDA 5HIMA 5BO5A 3TGLA 1G6HA 1D2EA 1AGYA 1XEAA 4GNKA 3EVEA 4O5AA 2NPIA 4OAOA 5TV2A 2G1PA 1BOFA 4IF6A 4OHYA 4NMLA 2GAOA 1JDTA 1ZFNA 3Q41A 4L5YA 3SBOA 1M8PA 2OBNA 1DWOA 2JARA 4GEKA 3GT0A 2HMAA 2FUEA 4RIGA 4YMUA 2WF6A 3X3HA 1I6WA 1EJ6A 2ZUDA 4L9AA 5LM3A 3H9GA 1U81A 2P9HA 3KXDA 4ICIA 2OHJA 5ALWA 1FYVA 4GF5A 4PWYA 1BXKA 1OCEA 2NX2A 3W34A 4EITA 1NSYA 1XMVA 5DGXA 3DCYA 2DECA 4B33A 1RE1A 5JXIA 4PU0A 1ZI9A 3HCRA 3LW7A 3Q0TA 5DM2A 4ZI2A 1N77A 2I6FA 3HB9A 4YIKA 4MQMA 3BWMA 3HSKA 1JQEA 2P67A 3JQBA 1PKEA 1GRNA 1XCPA 1E2FA 1CJVC 1Z0KA 3I73A 1NMZA 2W58A 4IJUA 5JW6A 3C2QA 3FCCA 1Z82A 5I4IA 1DBQA 2HJSA 3S2GA 1LJUA 1E4EA 1AT1A 1WHSA 1CB7A 4AKTA 3N8NA 1M2GA 1LK7A 2XR1A 4DMCA 3IOCA 2IZ0A 3SBDA 1ONNA 2PXCA 1CLEA 1ZMXA 5L95A 4REQA 1DBWA 4M1TA 2QMOA 1UBGA 3KLPX 4K9QA 1O94C 2GARA 4X91A 5FNVF 1FY2A 3MQ2A 4MUBA 1I3OA 2Z8YM 1THTA 5HX7A 2UZIR 1FQOA 2C94A 1EK1A 2DUMA 3GBPA 1ZBDA 4HQKA 1JJ7A 5CNMA 3A9VA 4A1FA 3PQFA 3ENQA 1V7QA 2VCHA 1X9GA 2D4HA 3GOQA 2QQGA 3ZGVA 5M34A 4OYYA 4M9UA 3NYQA 2GO7A 2MR6A 2R7NA 3JQBC 1R3DA 1BGXT 2R4UA 2VPQA 4O02B 4RANA 5CLJA 4HDRA 1U8XX 2BKVA 3LFUA 1GCAA 1R2QA 4RV9A 4UAVA 2XB4A 4CM9A 4DPLA 1M6YA 5ALDA 1AS2A 3SQWA 1LJ8A 1IXRC 1H0RA 2RG7A 5REQA 1TF7A 8ATCA 2PMKA 4L4XA 4PRKA 1ID8A 1J70A 3H5VA 4ZEOA 1REQB 1MCZA 4TN1A 3CWQA 3PL5A 1RWKA 3H97A 4CLRA 4HI0E 1BU5A 1BC5A 4FFPA 4TKZA 2IEZA 4EY4A 3DDNA 3PHLA 2NXWA 5H16A 1UJ5A 2L0XA 2B6HA 5FWDA 3ZY2A 5KNCD 3LLUA 1RAHA 3ZV5A 4G84A 1X7WA 3FJOA 4OHZA 1GRRA 1CLUA 4C5BA 1RYEA 4WECA 3TFWA 4EH1A 1QOQB 2W2XA 2Z56A 1OOEA 3HEMA 3USZA 1ZJYA 2PZ8A 2WM3A 1C9MA 1FFSA 4I3HA 3SYLA 1N1EA 1VE3A 4PC6A 4XEHA 1T3HA 3W3AH 5LP6B 3UJNA 16PKA 1ZA1A 3IKLA 1RIFA 4ALLA 5LBIA 3IDSA 3L8DA 4BO1A 3ANTA 1SVLA 4OATA 5KCZA 3TG2A 1WV0A 2HV9A 3A9WA 2YWXA 2XXAA 3NJRA 3A6HA 4V0NA 3EJWA 1JVBA 3KJHA 2P2ZA 1ZN7A 3HXPA 2NN3C 4GM1A 4ZAXA 5FXMA 3VDQA 5L6LB 1LPSA 5MN4A 1QG0A 3PR3A 2ZE5A 1E77A 3BCRA 4NYJQ 3UK0A 1YA6A 1HC7A 4IP0A 3E7PA 1JTEA 5KS2A 4HB0A 4Y30A 4LYHA 4M1SA 4TKUA 3GJZA 2IHBA 3W4JA 5JNSA 2AHOA 2B3DA 2XUDA 2P3OA 2G70A 5FFFA 1YFZA 2OV8A 4V1CA 3E5RA 3EUAA 1Z33A 4IEFB 1FPMA 2Q99A 4HY3A 5AQEA 3N2NA 1IN7A 3RC8A 2B61A 5D51S 4ND7A 2VF5X 5DV9A 1C9EA 2BP7B 3C0KA 1E6LA 1YQDA 1IK4A 1YR6A 3OC6A 2Y9PB 1PJZA 3QE9Y 1T8TA 2IFTA 4YAGA 2J0EA 4LKOA