1AY0A

Identification of catalytically important residues in yeast transketolase
Total Genus 245
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
245
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVAGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of catalytically important residues in yeast transketolase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords TRANSKETOLASE
total genus 245
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1997-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A01
1UM9B 3D7KA 1T9DA 2R8OA 1YI1A 2QTCA 1UMBB 4K9NA 1X7XB 2C3OA 1R9JA 3HYLA 1UMCB 1W85B 3M7IA 4KXXA 5C4IA 1QPBA 2BFDA 3FSJX 2EZUA 1ITZA 1YBHA 2Q5LA 2E6KA 1UMBA 4RJJA 5ERYA 2BFCA 3EXHA 1W85A 3HWWA 5EXEA 4FEEA 4KGDA 2Y0PA 4K9PA 3ZHRA 2C3PA 1V5EA 1QS0B 1BFDA 2VK1A 2BFBB 3M49A 5I5GA 1W88A 1PYDA 2EZTA 2PANA 2VBIA 1IK6A 3KOMA 3RIMA 2G67A 1PVDA 2VK4A 1V5GA 2VBGA 4MPRA 3ZHUA 3UPTA 2FN3A 2J9FB 2X7JA 1OLXA 1UM9A 3EA4A 2G25A 3DV0B 2IHVA 3OOYA 4GPEA 1X80A 1UPAA 2BP7A 4K9LA 3DVAA 4C7VA 1YI0A 3HWX1 5EXDA 2J9FA 2XT9A 3IAEA 4KXVA 1Q6ZA 4MZXA 1OLSA 3DV0A 5K2OA 3EXEA 1X80B 2JLAA 3AHCA 2Q5JA 3EXHB 2BEWB 1V11B 1U5BA 1OZFA 2R8PA 2YICA 4K9OA 1X7WA 2R5NA 3LPLA 2JI8A 4QPZA 2Q28A 5AHKA 2WVGA 1X7ZB 4D5EA 2BEWA 1UPCA 3AHIA 1V16A 1X7YA 5HYVA 2BEVA 3EXG1 1T9AA 5ERXA 5K3SA 4COKA 4QQ8A 1OLXB 2Q5QA 1ZPDA 5ESDA 5EJ7A 3IAFA 3M34A 2VBFA 1AY0A 3UK1A 4MQ5A 2JIBA 4ZP1A 5K6RA 3AHJA 2EZ4A 2VK8A 4MPPA 2DJIA 3LQ4A 4GM0A 4WBXC 1QS0A 1TKCA 1U5BB 1NI4A 1V11A 3MOSA 4FEGA 1YD7A 4JUCA 2AG1A 5I5EA 1UMDA 2BFEA 2IHTA 2UZAA 3EXG2 2IHUA 2JI6A 3F6EX 1V5FA 3LQ2A 1NI4B 4JUDX 4JUFA 1V16B 4RJKA 2BEVB 1YNOA 2C3MA 2YIDA 1DTWA 4KXYA 5EJ6A 4QELA 2BP7B 5K6TA 2NXWA 1NGSA 2UZ1A 3EXHC 2QTAA 2C31A 3FLMA 4K9MA 1PI3A 1WCIB 2Q29A 3E9YA 1GPUA 3EXEB 5EJMA 5HJEA 4GP9A 5EJ8A 5HHTA 5EJ4A 3ZHQA 2BFDB 2PGNA 1UPBA 4GG1A 5I4IA 4KXWA 4MPJA 3ZHTA 1WCIA 4JD5A 3AHEA 2WVHA 5EJ9A 1UMDB 2BFEB 5DEIA 2EZ8A 1V1MB 1W88B 2C42A 2BFBA 2FWNA 2IEAA 5HGXA 1OLSB 2EZ9A 2V3WA 4GM1A 3FZNA 1B0PA 4JU9A 4C7XA 1V1MA 2W93A 3F6BX 1X7WB 1POXA 1TKAA 2JGDB 2UZ1B 4XEUA 2Q5OA 3AHFA 3AHGA 1OLUA 1Z8NA 1YHYA 2OZLA 4JUBA 4K9QA 3EXFA 1PO7A 1X7YB 1JSCA 3EYAA 4JU8A 4K9KA 5EJAA 3ZHSA 1N0HA 2O1XA 3AHHA 1V1RB 2PGOA 3JU3A 3EXFB 5EJ5A 2PDAA 3L84A 4JUAA 4D5GA 2G28A 1OZGA 1OZHA 5FEMA 3ZHVA 2XTAA 1KEKA 1V1RA 3EXIA 5DGTA 1UMCA 2VJYA 1YHZA 4GM4A 1QGDA 4KXUA 1RP7A 1Y9DA 2WVAA 5DGDA 4RJIA 3DVAB 3M6LA 2BEUA 3EXIB 2BFFB 2JI9A 4Q9DA 2BFCB 2O1SA 5I51A 1POWA 1T9CA 2JGDA 3OE1A 2C3YA 1OLUB 2OZLB 2AG0A 2XT6A 1TKBA 2JI7A 3DUFB 1MCZA 2BEUB 2Q27A 1TRKA 2BFFA 3AHDA 1T9BA 1DTWB 3LQ1A 2JLCA 1L8AA 1OVMA 1X7XA 3AI7A 1X7ZA 3EY9A 3DUFA 2C3UA 5IMSA
chains in the Genus database with same CATH superfamily
2DZDA 4S0ZA 1DV1A 4IIXA 1CR6A 1P9RA 2IODA 4Y2TA 3ZGLA 4FYWA 1CY0A 5DNUA 1TEXA 3D0KA 3EVGA 2Q5LA 3K53A 4E1BA 2XXBA 4NPAA 1V39A 1EFKA 2KBEA 2PT7A 3DHVA 3EXHA 2B36A 5CX4A 3DEYX 2XB2A 1HDOA 2VSQA 1GDDA 1E2IA 4WT7A 5LD2B 5ECDA 2XOXA 5E2IA 4NZ9A 2MR5A 5IULC 4J07A 3N7UA 1WWKA 1IN7A 2PZEA 3AM5A 4MV1A 5DHAA 4K6FA 4LA4A 2X2OA 5HILA 4UAGA 3HY4A 3EPHA 1E9VA 1QMGA 4Z3DA 2ZBVA 4JXJA 1RRCA 1P5JA 5JPIA 1CXZA 1AKRA 4KXQA 3JQPA 2IF2A 4MWBA 2YV4A 2VP6A 5JARA 1DBSA 4EMSA 2HW8A 2GTHA 3BYZA 3O94A 3OU2A 4HDQB 4O25A 2V9CA 1NP3A 3IP7A 1PZXA 3RS5A 3VKVA 1A9XB 4EYEA 1XDWA 3DLIA 1MNQA 1UBCA 2IRWA 3C3PA 3PQ2A 2PUCA 3NDBB 4ZPXA 5HK9A 5CFPA 3W9YA 4DBLC 1Q0QA 3OP1A 5DGXA 4RTSA 1FY2A 1RRPA 1JHXA 3FMIA 1NAIA 2IOHA 4PAOA 5CR9A 4C89A 2FZ5A 5JZOA 4XUEA 1P1CA 1RPTA 1Z0KA 3AUJB 5FTJA 3IMFA 3NWEA 1C9EA 1ODKA 1LDNA 1XVUA 3GNSA 3OU7A 1NBHA 4ICIA 4U2BA 4DMKA 2HEIA 4QGFA 3J81A 4FM9A 4KSCA 4KN6A 4TL7A 1Z0FA 1I51A 1T9KA 3GJ3A 1CUXA 5KAMA 1W7AA 1X94A 3D5TA 4D99A 3FNRA 1RWMA 3OT1A 1L5SA 2G9RA 4OJTA 3F4BA 1MAHA 1ZO8A 4Y2XA 3WLSA 5K99A 1M5RA 8MHTA 2ZRDA 3R5FA 1K08A 2JLUA 2FETA 5J4KA 1GY8A 4CMJA 1V4NA 2QK4A 1I6WA 2OECA 3OPYB 4KO3S 3ZHYA 1P6UA 1FYXA 4Q4JB 3ELUA 2GF2A 3TX2A 3U39A 3ZV4A 5IS2A 4BV8A 4FC7A 1OW3B 2FLVA 4QG3A 1BO6A 2CVHA 3QEAZ 1VPWA 2VDMB 3EFHA 4JI2B 1QKIA 3MTEA 3I01M 4IG9A 4KBGA 2Q5OA 3C97A 1W9HA 2REBA 4YFYA 1QB8A 4C2AA 1HURA 1C1XB 2Z8XA 1A50B 2LV8A 5EJAA 3WDKA 3MRTA 3S40A 1N7HA 1E61A 3ELBA 2VF2A 3U6KA 2H4ZA 3EB9A 3N39C 1J0CA 2Q6KA 3BICA 1U0TA 3GDHA 4ZQIA 1COWA 1Y4UA 2VJYA 1NI3A 1QE3A 5AW3A 3FCUB 4IGEA 4YAEA 5FBQB 3GZ4A 4C1NA 2R6DA 5IUNC 4C20A 1GCGA 4IDPA 1OHHA 2WJ3A 4NYJR 1E1KA 1GSAA 121PA 3QQPA 3ZJYA 1D5CA 2IXEA 4HVTA 4O4JA 4Q7EA 2O2EA 2CYAA 4QTXA 2NSJA 4BPRA 5EP4A 4B9AA 4XASA 1Z39A 1EUDB 4HAVA 4C07A 3RF7A 1ZMTA 4F56A 2ZCVA 1J9EA 1ADBA 3PWKA 3AFMA 4QRDA 4FOTA 3CIFA 3MJHA 4OYHA 1N2IA 3E05A 3MGCA 4P2BA 4WN9A 2PLFA 3RU2A 3DMGA 1OFVA 4QYWA 3GLKA 4KHPB 3OX1A 1DKOA 2TMDA 4M1TA 4OB8A 2HWYA 4H15A 4ACBA 2YJ5A 4JOSA 4YAGA 1N2BA 3U3JA 4BJ5A 1NQUA 2FUCA 1FFSA 3O8DA 4J7XA 4MIEA 1ORTA 4E07A 3ZHZA 5IZ4A 4EOGA 1G8PA 2O8EA 4QUKA 4MH0R 2CSXA 3UJCA 5BMVF 4NIMA 1SC4A 5C8YF 1W2GA 4WKGA 3WADA 1YRAA 2QB5A 4LCEA 3U4IA 2H4JA 3LZCA 1MZPA 2ORVA 4P4NA 3QX9A 1FVXA 2QR3A 2NXNA 2X3FA 2VH1A 4I4LA 4ALLA 4KO4S 4PN7A 3ETJA 4F93B 1EAYA 1QTIA 5LQRA 4ZICA 4CLRB 5JLJA 2PNJA 4D5EA 2YYZA 3L6OO 1SKYE 2W2KA 3JAWA 5AM1A 3N8HA 2PX0A 3PNLA 3GG2A 3TRKA 3PUIA 5K3DA 4A8JB 1HV8A 3CPJB 2PKRA 6ADHA 3I6QA 3IVRA 3LU1A 3IE0A 2M2IA 2UZAA 5BOVA 3VH3A 1TK9A 3TD6A 1T4BA 1V5WA 3FYTA 4TTVA 4FMBB 2MSCB 4ZDIA 5IVHA 3OEHA 2Q0XA 3GLFE 1IHXA 1R8QA 1S7GA 4L22A 4C3ZA 4DIEA 4DGSA 4HLCA 2YV3A 1L5WA 2C9ZA 2XD9A 5JVDF 2FH5B 5CFLA 2BFOA 4RK1A 1ZUD1 4HZUB 1RHJA 3DO6A 3ORHA 5AFSA 3OTHA 1BVYF 3L0IB 3Q3GE 2J5RA 2UDPA 5B4UA 3IKTA 1SKYB 3FDJA 4N48A 3KOUA 3RRNA 1CS4C 5COQA 2B4KA 1G6HA 5DXFA 1KZHA 3UMFA 2JDID 5D87A 2WYHA 1HWYA 1S5PA 4KV9A 3VJKA 3ROPA 4QU9A 5A2QA 2RKWA 4RGVA 4ZOLA 1OH6A 2ZYWX 4OX9Y 1TADA 2PEZA 2P9GA 4ZALA 5BWOA 1SWWA 5BUQA 4B0OA 2QW0X 3M82A 4C3OB 2SHKA 4EDFA 4KAAA 2VP5A 1HE3A 5ADWA 1AVTA 4DQVA 3L84A 3EVZA 1QZXA 2X8JB 4Z0TA 1V9CA 2LZ0A 3LL7A 3ZX4A 4ALKA 4LBYA 3TAUA 2F8TA 2UV8A 2WVAA 3F7NA 5LA6B 1J9ZA 3PI7A 5TJ9A 3PKIA 4LRYA 1TMOA 4R1PA 1W581 2B30A 2FR0A 2X42A 1EVZA 3WIBA 3H83A 4KH0A 3OFVA 5J2TA 1PL6A 1X13A 4RD0A 1BX1A 4MW2A 1O89A 4QE3A 4MS1B 5KQSA 3Q8XB 1OT3A 1Q84A 3I37X 3A4VA 3UXHA 1E7QA 2R86A 4ZQBA 4KPUB 4PYIA 1J42A 4FYKA 1ZFNA 4RMJA 4Z2YA 5L3SB 2I03A 5J2UF 2OE2A 5C4MA 4EI8A 1JA0A 3PDUA 2X0EA 3ZY3A 4GD3Q 4MYUA 2J0UA 4RTQA 1FFXB 1IZ9A 1GPNA 3HN7A 4KHZA 1QC5B 3H1BA 2P8SA 2D6FA 3FPBA 1FFCA 3L49A 3VYUB 1VHDA 5LFAA 2WIKA 2J3HA 3ZCPA 4U9HS 2C9BA 4XE5A 4OXXA 4EFMA 4LDAA 5B53A 4F84A 3BGDA 3PENA 3LX5A 4HH0A 2P1ZA 2GRAA 3NHZA 4KO2S 1KR5A 3KQYA 4WKNA 1FJ2A 1S9DA 4YHHB 3ABSB 1FTWA 3K0FB 1ENZA 2H3HA 4GW3A 5GY7A 5JAIA 1I2DA 1ELOA 5DB4A 1U5BA 2DBRA 2R4QA 5K6AC 2Y0CA 4P8RA 4X95A 1C3EA 1J8MF 3VH4A 3O4IA 1T2NA 2W2VA 2WF9A 1SUPA 4GX0A 1MVOA 1W75A 4I4TB 4D8YA 4YEDA 2XMPA 4PNHA 2J9XB 4L1KA 2RGEA 4ZDJA 3QHQA 4MUHA 2OORC 5CEFA 3CRVA 3T3EA 1OLXB 2B5VA 2XDYA 5E4TA 1ZPDA 3RS0A 3V1NA 4CQMD 1AUQA 3HA3A 1Z7WA 1YZLA 4EZIA 1BAPA 1UIMA 2PUGA 1DDGA 3TL6A 4BO3A 1P2DA 3HKCB 5KWSA 4MTLA 1G3RA 4F92B 3R2JA 2NG1A 5JCJD 2FFAA 1Z12A 1G63A 4O3MA 2BL4A 4JUCA 5JZ9A 3B1JA 3ZGYA 1JVNA 3OI7A 4A8JA 3ZDQA 4PSCA 3PHJA 3CSSA 2B8WA 1T6ZA 1UK7A 3EN0A 4YP5A 5DM0A 3FBGA 2CNWD 4QOJA 4YJFB 1VCHA 3ACDA 2JGNA 3HACA 1E60A 1FRFS 2C0PA 4M8IA 2ZRIA 2P2LA 5F3RA 1CRPA 2ZUCA 3VDXA 4EGAA 1PQPA 1ENOA 2QAGA 4OHXA 1UBGA 5ESRA 2G4LA 3KWLA 4GQBA 4A2QA 2CJFA 1H2WA 3D3JA 3TOSA 2R25B 1L6IA 4CKBB 1EX1A 4OLAA 1QHFA 3MCAA 3ILYA 2ZBDA 1NF9A 1D4ZA 3GEBA 3MNFA 3LWNA 3PJGA 1KEVA 1T3ZA 3O7WA 4XWGA 4QJ3A 2IIVA 3AVVA 2J3DA 3OFSA 4JAVC 2VZ8A 1F38A 4JFRA 2A9OA 3EDOA 3SYRA 1LFAA 2XWPA 1IY1A 4V0KA 3SNKA 1RAIA 1UK6A 4JKOA 3E1GA 4EG5A 5F4ZA 3U2QA 5KOHA 2WSIA 3OEED 2R9VA 4EQ6A 3OP4A 1G20E 4ZDKA 5AI0A 3PLRA 4N12A 4ND1A 4O29A 4M8SA 4Q39A 3HJTA 2PUDA 5KIAA 4L8FA 3RVBA 2UU9B 2RH8A 1J8DA 2REXB 2HHLA 4ME6A 4ZZ0A 5JD6A 3FSGD 1Y80A 1H9AA 2GZ1A 4NL4H 3KDSE 1GKKA 4CG1A 2HCFA 4C7OA 5JSUA 3HGTA 2QRUA 3N0VA 2GFHA 1EHIA 1ZI8A 4EYGA 5IAKA 3CNHA 2DFDA 2P77A 4KOEC 5TQVA 4TV9A 3MN1A 3KDAA 1TE2A 4OXQA 1ZR4A 1QVZA 4CLDA 4ZYWA 4WFJA 4ZT2A 4X1KA 3LQ1A 4HWGA 1X7XA 1W5TA 4TMKA 4M86A 4TV9B 5B37A 5ALHA 4DV1B 4P93A 2Q0HA 3L4BC 2Z5GA 3OU6A 4JB8A 4UAUA 2NAPA 4Q4AB 5EKXA 5FQNA 2ODTX 4Z9BA 5JWOA 1GU1A 2L19A 3EISA 3ROXA 1Y7IA 1GR0A 3KQNA 3RROA 1KJYA 3X1DA 3CB2A 3AW9A 3T5BA 4EKDA 3S8EA 4DV5B 5IT5A 4BPBA 1Y7HA 2VS1A 3H2IA 3ROQA 5BVHA 4Y8VA 2ZDQA 1QUEA 3CLKA 1BD4A 2LW7A 3F4LA 3FZNA 4J0GA 5DTRA 1TAHA 1T6NA 2JS7A 2OL4A 4N47A 2YZ2A 5ITZA 3V4LA 1G2QA 1WM1A 4AKEA 1OD6A 2Z6AA 3JZFA 3PF8A 2LUOA 1P0QA 1X80A 2HHCA 1GZ7A 5KREA 2I4OA 1VKHA 4DR1B 4OHYA 4LECA 1W4CA 4DFDA 1HEIA 1EG2A 3MINA 1TI7A 2RHLA 4F45A 1NVXQ 3VOSA 4ZJPA 1RLIA 2F55A 1DJMA 4G09A 3IO5A 1W76A 1YKFA 4DPKA 4YWJA 1ZOPA 5IFKA 1CNFA 1HDIA 2BJVA 2DY0A 3G2HA 5CYOA 3LYAA 2WKQA 4LNHA 4C4AA 1VJCA 3G5UA 1ZRNA 3QVTA 1IQUA 1T8TA 2PMKA 5FPKA 3I5YA 2D2EA 4NECA 1XYVA 3TLGB 4RPHA 2NU6A 4OK3A 2HKIA 4M0KA 4H7KA 1KFCB 3MSCA 1DMRA 1PJ8A 3L79A 5AW4A 3FB4A 2YZMA 4GYWA 1ADGA 2EKLA 2ZI5A 3K3PA 1G6KA 3NWBA 5FOVA 1PV1A 3LSTA 1K98A 3F1LA 4IXMA 2RE8A 5G4KB 2BFEA 2KBFA 4GPD1 5IF9A 2O2JA 3C5EA 5K20A 1UJBA 3TCXB 5IM4A 1ZIYA 2FQQA 4IXTA 3NHJA 4BUJA 1WPXA 1ZCBA 2D1FA 2Q6VA 3VAYA 3SBEA 4B32A 2RBGA 2HK7A 4ZC8A 3K9NA 1ISGA 3T52A 4LRSB 3IOMA 4EJ0A 2BM0A 1Z8FA 3LS2A 4GOND 5E1BA 5ER6A 4E88A 3IXLA 5B36A 3GCGA 4R1LA 2HU8A 3V3TA 2OHHA 4UNRA 2QE7D 3FUXA 5DWQA 3NV7A 1LTKA 4M0CA 1JECA 1I36A 4HCJA 3UAOA 3F9RA 3WGYA 1E7SA 4RM3A 1A4UA 3TW6A 4EHHA 1RQ7A 3HJRA 5E6SB 2NACA 3HWSA 2ZRGA 1P4RA 1TJNA 2NO1A 1DEHA 2C96A 5BSTA 4B8WA 4CCAA 1B6TA 5FX2A 3PV0A 1VJ5A 3DLPX 3JATB 1FP4A 5DX8A 3A4NA 3JAKB 4PV7A 1NM5C 3A1DA 3CS3A 3C16C 1DINA 2EAUA 3OQ6A 3JQ7B 3S8YA 3WAJA 3DE1X 1Y3HA 1U0NA 2I4MA 2FFBA 4GBGA 4PXAA 4MV4A 3UEOA 1F7VA 5LPNA 1GUZA 1E2UA 1GKIA 2O52A 4CN9A 4A8PA 4YBRA 1KFJB 2W98A 1M6WA 4MWGA 2WJHA 5KTOA 3IBSA 2VPTA 1OLUB 3Q6MA 4PZEA 1KMCA 1Z74A 5FORA 2Z6QA 1R9MA 4ENPA 3M1IA 4NMLA 4ROTA 3FLBA 4M0MA 4LC1A 2ZEJA 4UUOA 1O97D 3KT6A 3CRQA 1JHYA 2X4LA 2GZ2A 1Y8ZA 3IULA 5JSKA 5KKCA 3O8QB 4D0LB 1Q0LA 2O8VA 3C6BA 4DWWA 2N46A 2B8JA 2FEXA 3DO5A 4P86A 4QULA 4HNAA 5BW5A 4FZRA 4BS9A 3QPVA 3OLXA 1D9XA 3AQ4A 2CFTA 3UHFA 4XUCA 4DQKA 4DMRA 3V3KA 4ZYZA 5DLQC 4AUMA 4HNAB 4JWKA 4CFZA 1C7JA 4AZ0B 2AKAB 1IQPA 4H6PA 4IL5A 1VSVA 1FTSA 4MRVA 5DISB 3S2SA 4O59O 2V1UA 4G0NA 4YCAA 1XEWY 3D3WA 3UJNA 3S0JA 2Y1DA 4HZIA 2R00C 5KDOA 4MKHA 3Q87B 2V74B 1VSUA 5KQLA 2ZKIA 5FUXA 1BEZA 1N2SA 1YL6A 4I9NA 5A02A 1SCKA 2BCGY 5FI1B 3QRWA 1I7SB 2G80A 4Q1BA 4XX1A 3AONB 5B5SA 1V41E 1EK2A 4JBGA 3OTWA 5FOSA 4KJZA 3VNUA 3FXAA 5HKAA 3AUTA 4HEHA 7AT1A 3GPIA 3C70A 3QX8A 1Q1AA 3R4VA 4DJJA 1OX5A 4PYMA 4QVIA 1CDDA 3UK1A 1TO2E 1ECFA 2A5YB 2EZ4A 3VC1A 1H6AA 4JZYA 5TVGA 1CUSA 1EUCB 1QOZA 4NNOA 5FF9A 4AZ3B 5JV5A 5KU7A 2Q0SA 1V35A 3KYDB 2NYUA 4RENA 1ULHA 1DQZA 3AVQA 4UW9A 4XFDA 5HDQA 1T8YA 4FQ8A 3R7BA 4JJKA 4EB3A 4G85A 3WB9A 3MTGA 4LY3A 3WWDA 3WYFA 4CMIB 5CEEA 2J0VA 1APBA 2EKDA 2QTAA 1EE9A 4DMLA 4XVCA 1SD1A 5IVDA 1LPPA 2CCKA 2R5FA 2WM8A 2OG1A 2HJSA 1SKQA 3ZHOA 4ALMA 3S5JA 3K0AA 2GH1A 2GNPA 4JDUA 5EMLA 1G8AA 4MK4A 4WNYA 2HWXA 3PT5A 1EFPA 1S3GA 2O48X 2IEAA 5K0SA 1C41A 4IQGA 4MVJE 4O1MA 1SQGA 4EG8A 1ESZA 3I9FA 5I9LA 1GNRA 1RWXA 3DYVA 1JQBA 3ESCA 4I55F 3K0CC 2BI7A 3NBKA 3NLLA 5FWXA 1LRKA 4C0HA 3G0IA 4RJ2A 3OPXA 3PVCA 6Q21A 4A3SA 1XEWX 3GJ6A 4MWCA 1S2LA 4RW0A 1D3AA 1NQ5A 4B6RA 1OZGA 2P78A 4WNAB 2XTAA 1LWNA 4NCHA 3AY6A 4RHUA 4J3NA 4FU0A 4PXYA 2EC5A 4JI3B 3L8CA 1YQ9A 5JI2E 3RSSA 1JKXA 5LA6F 4Q3KA 5E8JA 2F1OA 3ASZA 1YQUA 3LDFA 1P3JA 1GZVA 3W2FA 1RWQA 2J5BA 1C0IA 3VNRA 2X1HA 4FYYA 1CRWG 3RFFA 3AI2A 3TLZA 1IATA 3NBAA 1C8LA 1MORA 2QN6A 3P45A 2O4UX 2GCPA 4GO1A 2ZU6A 4IKOA 4X63A 5DYWA 4BNTA 2Y77A 2O2IA 4QUIA 2OMKA 4ES6A 3GCDA 3TD9A 5T6MA 4JI5B 4F2DA 4FJ0A 1E1RA 2R5WA 3KJFA 4W8OA 3M5CA 3VU9A 3U7RA 2QF7A 1U9IA 3GQVA 3K35A 4MO9A 4P4TA 3AFOA 4EY3A 1UXIA 1ZU4A 4CT4B 1DFIA 1V0JA 2GPAA 2XOEA 4BVEA 4LW8A 2EW8A 4B84A 5EMHA 3F47A 3S8MA 5FUWA 1WMAA 2GZHA 2QE6A 3KYIB 4FSHA 4RVFA 3S68A 5JYBA 3OEHD 2PAFA 3Q85A 3QLTA 3G9UA 4RM2A 2P5UA 3U4GA 1LI7A 1NBME 1G0NA 1MOZA 4EG1A 1L5VA 2WAYA 5KYKA 2XMGA 5CVJA 1QQ5A 3H04A 3RQIA 1RYMA 4K87A 3UUEA 3DV0A 3BS4A 4D42A 1YKGA 2WABA 1SHZA 1OZFA 3F71A 3ZNOA 3T5CA 4DC1A 2VUSA 4EHNA 3KJHA 3PEEA 2ZDHA 4RIHA 3FYDA 1B73A 1I2MA 2FRVA 3K0SA 1OGYA 1SBZA 1T9AA 1KYIA 1HFWA 2RK4A 1QUFA 2PUJA 4MICA 4QQ8A 3UMGA 1XDBA 4QM7A 1ISFA 1KY3A 1NJGA 3QK7A 4O0MA 2F59A 4DUZB 3HCDA 3ONDA 1E5VA 1YRLA 3PC6A 3SHFA 1HQCA 3BL6A 2WZCA 3I53A 2H1RA 1H2YA 1I24A 1EQUA 2C4WA 3QOXA 3I64A 5AOVA 3IDQA 3TCKA 1UQRA 2OTCA 3VJLA 2CXNA 1NC3A 2FY8A 3CJRA 4XARA 4EDHA 3K0KA 5JYCA 3O6VA 3USCS 3KKKA 4NNJA 4BATA 3P9SA 2AXQA 3NGXA 2BMEA 4KLNA 4OF4A 2HU2A 3V4OA 3ZK8A 3FGZA 1L5MA 4PM4A 5DNVA 2B4AA 3KV3O 2H2IA 3F6RA 3UJ8A 3UXMA 3J7TA 4A10A 3UMMA 1HM5A 4EGJA 3TLKA 4QOGA 4JL5A 4RX1A 3MERA 2XXAB 3UWMA 5FAXA 4UBKA 1IOZA 5CDFA 1AQYA 4FN5A 1PSWA 4AROA 3HUTA 3RS4A 3U9TA 3QNWA 3W8NA 5MF6A 5JS1A 4NK5A 5J5VA 1DTEA 3GJYA 2IEZA 2VJMA 4RVGA 4HB3A 2IBSA 4LNAA 1VB3A 3UK0A 4BX2A 4EAQA 1WZNA 3ZH9B 1IZ8A 1YQEA 3PWTA 3PQDA 2QWXA 1WW2A 3OESA 3L9XA 3U3ZA 2G0TA 4KIGA 2YCLA 4GLJA 5DBOA 2QQ5A 3ZHSA 1ZI9A 2ZRPA 1JMYA 4DIOA 1JT2A 2O0LA 4L5JA 4JUAA 4G8DA 3TQIA 2NZYA 1DKNA 3D8BA 1GTZA 5U1PA 3AZOA 3DFKA 4LBVA 4WMLA 1IONA 5EZYA 2E4ZA 2QJWA 4KVGA 5FNVF 5LMUB 1ISHA 2EJCA 2A78A 2GPSA 4YCJA 3SPXA 1KKLA 5HUQA 2ANCA 4ZXFA 1JR3A 2JGDA 5ALKA 3WK4A 2IYVA 1QWOA 3FI0A 4NFSA 3QLVA 3KQTA 3GHHA 3M1AA 4HGYA 4JBNA 1DU4A 1XRSB 2R6CA 2JA1A 4HAIA 4LZLA 4RPJA 3U80A 1KTIA 3T5AA 1QM5A 1EHYA 1Z3CA 3OY7A 1JDTA 2IH4A 4PR0A 3LUJA 3M1LA 2AOTA 4I1VA 4N7BA 3UK6A 2E4XA 1UBJS 4DKJA 1AF7A 1F4PA 4DJ5X 3OZEA 3A6HA 4M37A 3NTXA 5JADA 1ENPA 4W9RA 1JLMA 2VUIB 3B7GA 3ETLA 4IZIA 5E3HA 4D8XA 3PYXA 1N78A 1DBWA 3VYVA 3WYEA 2FV8A 1DZ3A 1UKBA 4CIDA 2DVMA 3C5WP 4FYPA 3SNHA 4AJ9A 3ZHUA 4CL3A 3BE5A 2X13A 3BXZA 5I3CA 1F20A 1WS6A 5IJ0B 4CEHB 3PXUA 3PX3A 1U8TA 2G25A 3TDNA 4Y3UA 1SB9A 1ZONA 4F4FA 2BKUA 1EM8A 4FDVA 2WF8A 4CV3A 4DLLA 2XJ4A 2YYYA 6REQA 1WZIA 2E9SA 3FMOB 5HW0A 3AKYA 3KVNA 3QY0A 4JI0B 4FTWA 2E4VA 2WUWE 4NV0A 5AM0A 4QFDA 1GTL1 2HF9A 5BV1A 3ZVMA 2ZJ1A 3LT2A 4I08A 4TUYF 2XXJA 3H18A 2DMRA 2IKQA 2W6QA 4RGQA 2JIZA 3VRHA 4IXDA 2BGLA 3U1BA 5F7ZA 1SBTA 4F8JA 1C1XA 3C3KA 4WUVA 4UPEA 1D0VA 1KAEA 1JU9A 4P9NA 4I4TA 1N1EA 2YOFA 1CIJA 1EP9A 1BWSA 1X8KA 3HKEB 3M2PA 1DVRA 1R5NA 2XNSA 1D2NA 2E7ZA 5LXTF 3A9SA 3TLXA 3VSBA 4A0GA 4DABA 4DJAA 4WD3A 4DLBA 4YALA 4ZP1A 5KJCA 3DQQA 5TVKA 1KL7A 3COJA 1DHRA 2W6IA 3JCZA 2B99A 1M0EA 2AD1A 5F35A 2RGUA 2JCSA 2PYIA 1LC3A 1DJPA 4FYMA 1CV2A 3FNQA 4J1TC 2QN1A 3E22A 4N3BA 1Z25A 5JS8A 1EZ4A 5AI9A 1VP3A 5DCLA 1Q17A 1XJ0A 2HSGA 3JWGA 1FBNA 1FU7A 2DQKA 3LH5A 3A2MA 3DDZX 5CM8B 2W4IA 3V97A 4CLEA 2KQUA 4PO8A 1GUAA 1XMXA 1IUKA 1TC2A 4JJ6A 3BMCB 4TRNA 3NHSA 2H0AA 3Q7SA 4UZEA 2IS6A 1G66A 5F4BA 1U0JA 1MTOA 3BG5A 4B9EA 1T34A 4EK9A 1QLWA 4G81A 4JH0A 2ZIXB 4AQYB 1FQOA 5DHPA 5LP1A 1H3FA 1P9WA 5C1DA 1P2SA 4BFSA 2ASVA 1X2EA 1BTOA 3ICCA 2PLNA 3KZOA 1AH2A 4QDKA 3LQFA 3W5AA 3UK2A 1M66A 3R0IA 1I4EB 2CB0A 1U90A 2ZS7A 3ANNA 5IAAA 1MMFB 2V7EA 2FPOA 2V6GA 5HF5A 3P2EA 2P69A 1M0SA 3PU6A 5AJUA 3FZEA 5H0IA 4C0AC 3E5MA 4M9CA 1N5RA 1X1CA 1RHRA 2KMLA 4G63A 4J4BA 4DJTA 5AK5A 4PS1A 3A9WA 2O6LA 4GXRA 3QV2A 4RYDA 3NTQA 1N5LA 1YCDA 2PSHA 1VBNA 1KQNA 3ZE9A 4AXBA 1U8ZA 4FT2A 1XRQA 2X6QA 3ACBA 3W4JA 1JR3D 4M22A 5HCIA 1ZK4A 5F73A 1DI0A 2L17A 3ECSA 3W9SA 2H08A 3BD9A 3KVVA 2VPWA 1QIIA 4MV6A 2FK7A 3SKYA 5DULA 5DNCA 4LF9B 3V6LA 2I6SA 2XNJA 1DADA 4DC0A 3MTDA 5EA2A 1K8ZB 2Z5VA 3OPYI 2Y71A 1DBPA 4MP8A 1DJOA 1OXVA 2A14A 4LN1A 1A1SA 5JFOA 5F98A 1FDUA 3VSEA 5T64A 4ZHQA 1E2FA 3DG9A 3IR6A 4MVJI 5F77A 3VDRA 1DIRA 1DTWB 1L3BA 1M7GA 1Z0ZA 2EQ5A 2H1FA 1Q0UA 2WJAA 2WWFA 4A2CA 5F23A 2ZRJA 4KXXA 3AR6A 3WHPA 1G42A 1LPNA 4MV5A 3QBVA 3LYLA 3O4GA 1E96A 1ODCA 2QV0A 4JJIA 1ADFA 2WU0A 3PZRA 4HAOA 3I92A 1KP3A 2WIAA 5TS2A 1GADO 4MWOA 1W88A 5JNWA 4LMBA 4NS1A 4QGBA 3L4KA 1QQAA 4MPRA 3AL0C 1QIMA 4Q6BA 3QXXA 2PQMA 1BX0A 3AEQA 3QBTA 5HMMA 2E4YA 4MR9A 3WLRA 3B82A 2QPAA 3FJYA 3R3WA 3OOYA 4MRPA 3TFOA 5KNDD 1F2DA 3OG9A 2YXEA 1H2HA 3ESBA 3YASA 3X44A 4P3XA 3RUCA 4WWHA 1H42A 1N5IA 4OQNA 1CY4A 2ERCA 1V11B 3BKXA 3KETA 4QEZA 1NMQA 1J5PA 4ZU6X 4TT3A 1FTYA 1SKMA 1UPCA 1L5ZA 2ZRCA 5JSFA 1LJUA 1T8RA 2FUG1 3S2IA 4AMZA 1S0UA 1WXFA 1R8YA 2W6PA 3H1TA 4N3GA 1WB6A 4F4HA 3A27A 1ZVKA 4L4UA 4B3IA 2JGFA 3RVSA 3WSWA 2RDMA 3L6BA 3PLNA 3BFXA 5AVKA 3GFPA 2EHDA 3ZDEA 1M6NA 5FT9A 1DCFA 1MX9A 1R0ZA 2MSEB 4LZOA 2I3DA 2CZCA 1HSZA 1QSGA 2A5GA 3D6JA 1W6UA 1XQYA 3PITA 4F3KA 1NG9A 4DR7B 5AKIA 3GMIA 5ELXA 2VHXA 3UAYA 2XI4A 4BLPA 2RGYA 7ABPA 4CKCA 3NJRA 2O0KA 1U2SA 3PCRB 1E59A 3WBKA 2P35A 3CC8A 2XUOA 5ALWA 1TOAA 2FZGA 1RI2A 2WE7A 2Q1YA 3NPAA 3PUKA 4X1OA 4BOYA 4D9CA 4Z4QA 4LRTB 3UXYA 3ZUGA 1QOQB 4LMRA 2R65A 4TLEA 4H31A 3M4JA 2XUIA 1BROA 4NDZA 3LUAA 4XSHA 2EYUA 3W8RA 1E8DA 4NBWA 2OQVA 4E03A 4AJOA 2P6NA 5FUQA 1RFGE 4WHMA 2PGXA 2EKPA 1QTRA 2F6RA 3KAJA 2IV2X 3MJEA 2Z04A 4KZKA 2PX6A 1JFLA 1U1IA 3O0TA 5IAEA 4EO4A 3HVRA 3A6LA 5JH7A 1MJNA 1W0KA 1NPYA 1YHYA 1II9A 3KTFA 2VJNA 3DL7A 3LY7A 2HK6A 2ECQA 2D5BA 3BZWA 3K73O 5AJXA 3T3OA 2QJFA 1WULS 4LUCA 2UAGA 1Y6FA 2HA4A 1C9NA 1YZQA 3GVXA 3SOPA 3K70C 2JFYA 2W2LD 1FP2A 3GCXA 3M6FA 4LHWA 4FZ3A 3VNAA 3THRA 3NM6B 4W8GA 2C2ZA 3CB4A 4XCQA 4H6XA 3TIVA 1PLKA 3TW8A 2G7MC 1J25A 2QMZA 5ILOA 1I4LD 1OSNA 4R40A 1SD5A 4XFJA 3WE7A 5K03A 1W52X 3DMHA 3P2OA 1SN7A 2JLZA 4HWRA 2Q3FA 3Q3EA 2GDZA 2GJ4A 4AX4A 5BUZA 4JI6B 4BMCA 2QRPA 4IO1A 2LR0A 2IJGX 4N0PA 2EBUA 1N2GA 1P29A 1YI1A 1NWHA 4MVJA 1YWGO 1R00A 4M49A 4WVFA 3IRVA 1DIAA 4KQKA 3V4VB 4KWTA 3V2IA 4B73A 5IJXA 2L42A 4MQEB 1G5RA 1AG9A 2SICE 3V5NA 2C3PA 1E1DA 2WUEA 4KN9S 1K8QA 3K32A 5EIAA 5G53C 3WBFA 4YXWD 3MWGA 1EU1A 1G8GA 4GZ3A 1FW6A 1UKAA 2QUBA 1G18A 3FW1A 4OFXA 4BKPA 4ED9A 2C2GA 3ZU2A 1FC0A 5A5DA 1P4JA 4EY7A 4XPZA 4F5WA 5JDCA 1L4UA 4QJ5A 3EDRA 1PDVA 2EFCB 3HP1A 2O3TA 1GQSA 2C9YA 4MS3A 2XZLA 3UANA 4C4PA 1U8EA 3D3WB 2ZIWB 3L7OA 3CLTC 3H75A 1XKQA 4JLSA 4X60A 5CT5A 4EABA 5JMOA 3G68A 3UQYS 4K7JA 4CT0A 5JZMA 3JASA 3NALA 5CTAA 2ZTUA 3AWIA 2BW0A 3O75A 4HUTA 4OHZA 3ETGA 1JFRA 3STHA 3ZCQA 4C0XA 3KYBA 2GTPA 3GRCA 3RGWS 5HKKD 2C04A 1FXUA 2X9GA 1JUDA 2FMHA 3K9LA 4GXQA 2BKXA 3L0PA 4F9GA 2JIBA 5IZCC 4F46A 1QHNA 3H9QA 3EVDA 3D4OA 5ALQA 3N07A 4Q3NA 2R6R1 4GM0A 4R2HA 1PD1A 3JVDA 4TM7A 3T4EA 2DT8A 1XEXB 2WSLA 1EBBA 4G5SA 5AXDA 2CDAA 2WWHA 3WHLA 1L3IA 1GZSA 4NEQA 5CRIA 1NVWQ 4C03A 4XQEA 1KOFA 2UYYA 4NP6A 3RYHB 4HVLA 1PT8A 2DXIA 3JY6A 1PAUA 3M81A 3MA0A 4IKPA 5AVJA 4JV5B 3CQ9A 2BZ0A 3UH0A 1G98A 1XCBA 2QYSA 4IJKA 5ICFA 4LXQA 1G8YA 4YMTA 4ZTUB 1RT9A 2ZRKA 3RVJA 1FDRA 1HOTA 3DEKA 5DIFA 3EPPA 2Q6OA 3E3LA 1BXRB 3R41A 7MHTA 1LBHA 2VPYA 1HZZA 4X1YA 4JLBA 2JLSA 1JPNA 3A58B 3PUJA 1CRLA 1ZOLA 3D7LA 4H7HA 1TF5A 4IY1A 4MJXA 3OE4A 4EJ6A 2QAIA 2W2NA 5JEDA 2PH1A 3UMYA 1E1RD 3JWHA 3NBYC 4FDUA 4RE5A 2BH9A 3RKUA 1U0HC 5FUVA 2H0RA 5JCPA 5T8KA 2OQRA 5JBIA 3A9VA 2RH9B 4DHWA 4MUIA 1EFPB 2ZI6A 4HNHA 3A6GA 5FIUA 4LY9A 4YV2A 5JSQA 2BSXA 2C5HA 3JQAB 2ZAYA 2L69A 4WOCA 2YDYA 2FKNA 2VOEA 2OY0A 3QX7A 5E8RA 4WASA 3JQAD 2RMKA 4MW5A 1Y7LA 2XX3A 3UQZA 4FMPA 4TZ0A 2A1TR 2UVQA 2VP2A 2C5GA 4GX1A 1H4QA 3RVNA 3RRBA 1GL7A 2YJNA 4F72A 3RJMA 1S3SA 5C5IA 1AUPA 1CU1A 2OYSA 3UJ9A 2J09A 1LK7A 4U1RA 2QRQA 4H1VA 2PX3A 1C4KA 3L0CA 5DI3B 4DLRA 3MEQA 4QUDA 3SZUA 1RC8A 3DL4A 2PWPA 4O2BF 5C0OE 4URXR 3VH2A 4I3FA 1QANA 4INPA 1DC4A 1TA0A 3ADKA 1Z82A 4LHEA 2VDUE 4G5FA 4OFWA 3UAXA 4UM7A 3IBGA 1N92A 1I01A 2XF8A 3KD3A 5C5EA 4FHZA 5CFOA 3T1OA 5GV7A 2HHAA 4J16C 2BMVA 3NAQA 1L5LA 5JXHA 3FVWA 1UBHS 2B98A 2FK8A 3D1VA 5HOQA 2M6RA 1EDOA 4HKTA 1YA6A 2I55A 3EIFA 2C5EA 3FPAA 3OLZA 4C4TA 4J90A 3ZWMA 1US8A 5BSWA 5AXBA 3SHWA 1JIIA 2C4VA 2CFRA 2R751 2VA9A 3NT5A 3TN7A 2BISA 3K6KA 4EP1A 4NCXA 3AJEA 4DMGA 4HWTA 4I50A 3KLNA 4XAQA 4EW6A 2M9MA 3T0FA 2PMBA 1ZWKA 4GI1A 3U4DA 5JJCA 3PL1A 1KAQA 1HTBA 2NO0A 3L7NA 2OOSA 4GYKA 4HYEA 5K0NA 5KU1A 1K4YA 4HDOB 4HGRA 1B6RA 2V7XA 4Z1MD 3DONA 3BEDA 1U2PA 2V1XA 3OF2A 3PGA1 1DBRA 2E5WA 3D3KA 4GVXA 2JLQA 2FCAA 4TM8A 4BLWA 2XOKA 4O4LB 2PBLA 3CUEF 4TXMA 2ZYAA 4ZVMA 3BE4A 3JAKA 2QTFA 1RQNA 1XX6A 5EJGA 3OQ1A 4EPVA 1R27A 4B4WA 2Q5QA 5C37A 4V0ME 4X20A 5EIWA 3V8PA 2IV7A 4D4LA 4F3RA 2FSHA 3LC0A 5FTKA 5BYJA 4YRKA 3WLFA 3WIDA 4XTRA 4NQRA 4BJHB 1AV6A 5JPCA 2F43B 3B85A 4MUFA 2I2FA 4TSRA 5FA8A 2PXCA 3LUHA 2KB0A 5CK5A 3S1AA 2WKRA 3WMXA 2WI8A 1YA8A 4IIJB 1KDTA 2QUIA 4MKXA 4Q02A 5IZCA 1V5FA 2P9EA 3VH1A 4CM4B 4AAYA 1IUNA 3A2NA 3T4PA 5CCXA 3P2MA 1KQPA 3CUUA 1NUSA 4EHFA 5A3RA 2IXDA 3EW9A 2ZKLA 3M89A 1ZOIA 4MUYA 5L3QB 1WO8A 1GPUA 3FOWA 4A0QA 4R01A 3G7SA 1QV9A 2OHJA 3PFIA 4G01B 4HV4A 3MWFA 3LX6A 1A5SB 1W2HA 5FBWB 1I30A 1Q1EA 4E30A 5E1MA 3A1VA 3CZQA 3P9CA 4NBTA 5L3QA 3M3PA 2JDIA 4FWBA 1VSQA 3H7IA 4DIUA 2F3QA 3U61B 4GOOD 4RLFA 5HS6A 1KDVA 4AMVA 3IALA 2AZMA 2DTXA 3K1JA 5LDDC 2II6A 5AKJA 2GTIA 4B31A 5MN5A 2NU9A 1Y3AA 1OASA 4YLGA 4B87A 1GPLA 3FPLA 4ILKA 4JP2A 4PFQA 4B4DA 2QSJA 3K8YA 3C8UA 4EBBA 3FWPA 1Q2XA 4H35A 3AVYA 4YRMA 1NVAA 1Q3KA 2PVSA 2R1TB 3HDGA 2GDJA 5LIRA 3NHFA 3ZBTA 1JQ3A 2QVBA 2C0QA 4M6WB 3IP1A 4Y2RA 1QGED 1VMIA 2WFMA 4H16A 4D5GA 2NGRA 2GVNA 4Q4JA 1W0JD 3PA8A 4E3ZA 3LCUA 4WLUA 1GAJA 3X2SA 4C08A 1KZ4A 4MVXA 1GPDG 5CT9A 3N1UA 4AICA 3GWGA 1NJ5A 4YLEA 5KTSA 1ZJ5A 3M9WA 4CUJA 2ZIFA 3C3DA 5FV4A 1ONSA 4CR8A 4OM7A 1XCOA 3MCUA 4NOJA 4EMTA 3WK7A 5A2GA 2YFYA 3PEWA 3DEJA 5A1JA 1TYBE 3TF5A 1AO3A 3THWB 1C4OA 3K6JA 5JASA 2HMTA 5HMLA 1XEXA 3P20A 4JI7B 4JLMA 3L7AA 3HBAA 3TIIA 2IP4A 3GAZA 3JARB 1YAJA 3VU8A 1SBIA 4AZWA 2M6KA 3I4LA 2QDKA 2X8AA 4NWIA 5IC4A 4QYMA 4N39A 1WD5A 4E2WA 2ZJ2A 3ABRB 2P9TA 5ALTA 3K2BA 3TSCA 4ZEMA 2GD0A 3HCNA 4F04A 5M04A 5FLYA 2EP5A 3RRMA 1W5FA 2FN4A 2XNHA 3NEPX 4YJFA 5A5GA 5EIEA 2VHTA 1H6DA 2HMWA 2GHQA 1UJ6A 2H2WA 3H1EA 4P38A 8OHMA 3EOBI 1YI0A 1L8XA 1HE5A 1PD0A 2NO6A 3QJ5A 4KWIA 4MGKR 4OBBA 5CH5A 2C1ZA 3RBAA 5JC1A 3W3ZB 5JYEA 4C2TA 4NK4A 4XJTA 2BLLA 3AHCA 1LF5A 1Q1GA 5JTUA 1VL6A 3MWDA 4B35A 2ATIA 1EP2B 4ER3A 2YZ7A 2HA2A 2O7VA 4RY8A 3WTCA 2H1CA 2QKYA 1JKMA 1SIBE 3BJEA 3NQ41 4MO2A 2EIXA 1VMKA 2B1RA 4EFNA 4FZVA 4WESB 3SYTA 2Z56A 4MUKA 3PYLA 3EH2A 2HV8A 2OBNA 3DVLA 3DYIA 3RE1A 4A4DA 5CB4A 4A23A 2RAFA 5BRAA 2IL1A 2JJ2A 4ZVTA 4JJZA 5JFGA 4O5AA 2Q4DA 2QENA 4LC9A 4U3JB 1QS0A 3ESAA 2ZLBA 1HDCA 1WXIA 2X6RA 5F52A 2C7RA 1VL0A 1F6WA 1Y8RB 1UFQA 1XCGB 1P19A 4B1FA 3RYFB 4QUGA 1CNMA 1RZRA 3HSKA 3DR5A 4HAZA 4UNSA 4AY3A 3RNOA 1RRMA 3UF0A 4DWVA 1EVJA 3LOUA 5H7XA 4BZQA 3NIFB 1RAAA 1VHJA 5JAOA 4QLOA 1JDBC 1C7IA 2C2HA 1PWZA 4GVLA 4I99A 3ZV5A 5LZ8A 4GG1A 2IUUA 2GK6A 2J9ZB 1MB0A 3C1OA 3EFOA 5K3CA 3BCHA 3TB6A 1YK0A 4CEJA 3ENKA 1UZLA 4OH1A 4V02A 3T9BA 2ZIZA 3IV9A 1JHPA 1V1MB 4WERA 2QZJA 2Q3HA 2XTNA 4TTSA 2FG6C 5BOSA 1L7AA 2VYQA 3SDSA 1PFYA 1KARA 2A8YA 1TQ8A 2EOAA 2CUKA 3FGNA 3NHKA 3OX4A 4IGFA 4EUHA 3EAQA 4I6JA 1X7YB 2IUFA 2R6GA 3GGDA 4F7DA 1M2VA 4TPKA 4B6SA 1V8BA 4GI5A 3FTQA 5ICMA 1ZLYA 4ND6A 3BH0A 1O6CA 1CG6A 4DB2A 4LFCB 1FX0B 1AF4A 4HD8A 3EEBA 1T13A 4KGZA 1S9HA 4XCXA 5COBA 1NNLA 3UAGA 4EZEA 1TMGE 4E4TA 4AK9A 3ANYB 3TZKA 2NW6A 3BH6A 4YJ3F 1JG6A 3VHLB 4DQDA 4ZGWA 5LOVB 3CG0A 1OX6A 3KX2A 2K2WA 8LDHA 1Z26A 3W7VA 2GHIA 2Z1MA 2J67A 4V2UA 1WXEA 3VHXA 2FR1A 3QSGA 5A0VA 1KJ9A 2Z1NA 4IYRA 3WIUA 4PGHA 4FYVA 3MWEA 2JGRA 3G9TA 5GINE 5D86A 1I7DA 4GS5A 4IICA 3GEDA 1Y6GA 1M2OA 4Y6RA 1GSHA 2DHDA 2GRUA 3CIOA 3FVRA 2DGDA 1BXGB 4UEKA 2JRLA 2XHEA 3JZAA 4KGDA 4Q48A 1U3TA 2O9JA 3S28A 1FJGB 3I5XA 2Y4NA 4KVFA 4Z0HO 4X6LA 2C7GA 5KYVA 2H2AA 2POCA 3LHFA 5J1TB 2H7VA 4YMUA 4IHQA 4G0UA 2QBYA 2AHRA 2H1IA 4OBXA 1QJCA 4KE6A 3NAGA 5AKKA 3E1KA 4ND7A 1IYZA 1F8GA 3S2FA 1F6BA 2AQHA 1W4ZA 2AJCA 2VHEA 4J1SA 1NW6A 2EBWA 4KUHA 4LSGA 1C1DB 4RNDB 4DA4A 1SK8A 2Q5JA 4DUGD 4M53A 4ZYLA 1F2TA 1O97C 4L78A 3TRHA 4BWYA 3RODA 4S1NA 1XTIA 4TKUA 1U04A 4C0SA 1DQRA 3EYWA 1XQ1A 3VTFA 3C43A 2ZE7A 4XDGA 2QX9A 2ZJ8A 3W9BA 3AY7A 3O21A 2DWOA 2AR9A 3B6EA 3OCCA 5ALMA 2RGWA 5B3LA 1Q92A 3NT2A 3TZQA 1BWQA 2AN3A 2IELA 2DJIA 4JNCA 4TKLA 2VQ3A 3KCNA 3L7LA 3WRVA 2C4NA 4D25A 5L51A 4UCWA 3ETEA 1FXSA 3LCCA 2C0CA 3F6EX 2FSVA 1PEDA 1EDZA 3NUQA 4HADA 4Y6QA 3Q7PA 2D2FA 4JJEA 1BVRA 1D1TA 3L8HA 3H5LA 4C5AA 3Q8KA 1EWTA 2O2GA 2CMGA 4AP5A 4MRSA 2ID8A 4DSZA 2GFIA 4FFDA 4RD3A 3K05A 1DEAA 5GIOE 1G7RA 1L4KA 3I9LA 4P81A 2HCBA 2PN1A 5I8ZA 2ZSAA 4PPNA 3EZ2A 1GEEA 4YAOA 4FP9A 1JAYA 1U2QA 1UC8A 3IBYA 4QTUB 3V34A 3ZX5A 4P7KA 4EG6A 4QXRA 4JMPA 5CXXA 3N8IA 1HH4A 5MFZA 3EF1A 2LTAA 4C0WA 3NJ4A 3AKDA 2VJAA 1Y4ZA 1IAQA 2Y66A 3K6SA 4Q1EA 4Q9IA 5DLDA 3V6MA 2H31A 3M33A 4EVIA 1D0IA 1FFDA 3AP1A 3D4NA 2FGKA 3NJ8A 1M5TA 4G86A 5LYJB 4TS9A 1C0EA 5GM1A 2PJRA 4KQCA 2QROA 3V1UA 4G0ZA 4ZEXA 3V7UA 2PUBA 3AKCA 3HCEA 4Q1DA 2F8SA 4YBZA 4RTNA 3CUYA 3G89A 2Y93A 1DRUA 6REQB 2FPUA 2JZNA 5K0LA 5DNYB 1P6XA 3K5IA 3IL2A 3I3OA 4EEKA 1N2OA 4I4IA 4DS3A 3TIGA 1H0SA 4CLRA 4X65B 1KNQA 3JQBC 5CIWA 1OR8A 5HPYB 1VKJA 1SBCA 4MVJF 2GA9A 5TEWA 9LDBA 5CDSA 3AF0A 2V4ZA 2BEUA 2EBHX 4TWRA 2X2EA 3QVSA 5CNMA 3S2UA 4ZEVA 1QHSA 2I9KA 5AVRA 2VG8A 2VIIA 1JR2A 1TUBB 4LZAA 2RHGB 1XNGA 1ZHFA 4EA6A 5FFNA 2L0XA 3D4BA 5EE3A 2Y68A 2ZJ0A 2ZTLA 5DV9A 2I8CA 4DLPA 2P9BA 1J99A 3CZAA 4ENRA 1UOQA 3QTTA 1E79D 1GZDA 2V7TA 5FPSA 4DARA 5K0CA 1QPBA 4YO7A 1TYAE 1NC1A 1SHUX 4IIHA 4MI6A 3SR3A 3TRIA 3U40A 5KKNB 1UK9A 3MPOA 3TSWA 1SG9A 1RXUA 2PCLA 1V45E 3EOAI 4XWTA 3N70A 5FWYB 1EUCA 4D57A 2AQKA 3PGJA 3IELA 1RC0A 2VYVD 4HMOA 1FP1D 4L7VA 1MQ8B 2G1JA 3T7KA 4DSUA 3SWWA 6LDHA 4CL0A 3JQGA 4MDYA 1E69A 1M54A 1UP6A 3O3OB 5D3ZA 5A7HA 5AESA 1RQRA 5CLFA 3AEUA 4M87A 1MNAA 1SD2A 4LYJA 3URMA 1FTQA 2EDAA 3GGOA 4IIYA 2JZCA 2XHZA 2MMCA 4IH4A 2GEFA 1FMJA 3ESXA 2GMWA 3FFTA 3L8ZA 5CNIA 4AMBA 4D9GA 1T3SA 1FS6A 1ZRSA 1QHGA 4BRUA 4ESHA 5JVDA 4XTCS 1F8FA 4NV3A 3CW8X 2QN3A 4IDDA 2R5NA 4I1IA 3HLKA 1BQ3A 2XGJA 2GEVA 2VLIA 3JD3A 4OQZA 3V8MA 3VO2A 2WYVA 4C6SA 1VZ3A 1F0KA 3UA4A 3K8ZA 4EX6A 1U94A 3KBBA 2EF1A 4E1AA 3NUZA 3D2CA 3VNQA 2IT1A 2EU8A 4KUEA 5C7IO 2H1LA 4CR6A 3R4CA 4L4SA 4MSUA 5FL7D 3Q41A 2ZSIA 3WDMA 5JWHA 1C9DB 3IP9A 4BO9A 4E3WA 5EY5B 2QRKA 5TB5A 1EZ1A 5F2NA 3TOVA 2XNDD 1MW9X 1QDUA 4GSKA 1S96A 1IDOA 2QS9A 1QK4A 3ITKA 5HKLA 3GJ8A 5ADHA 1P60A 1G59A 2IHNA 3H5TA 3RVLA 1B7GO 3RVKA 3ZDZB 1TL7C 2CLDX 4F2HA 4F3CA 1DIHA 2O05A 3HZHA 1GCUA 3G5AA 3ACCA 5BN4B 2VHJA 3BF7A 5TGZA 1FSSA 2V45A 2IITA 3ZVRA 2VEDA 2JFGA 3L1JA 1ECGA 3GLQA 2VUUA 4J16A 4O63O 4R9SA 2H8KA 5CLHA 3Q0TA 1A04A 2V5UA 5T4HA 1TCCA 3ETHA 4WFIA 3EUFA 2JD0A 4ZCRA 2OGSA 4ZGGA 1QO0D 1EG7A 3PIDA 4AO6A 2Z2XA 4G1UC 3UB2A 2KW5A 4LRXA 3CF4A 4R41A 2KSQA 2DHEA 1RYBA 4LTNA 4Q9KA 4F60A 3FOZA 2B35A 2AOUA 3IMCA 4W7IA 1E2JA 4HK4A 3A2KA 1WDMA 2HCJB 2J7PD 2HQRA 1SXPA 4LXTA 1GTMA 1SXHA 3RUIA 2WUDA 2YWCA 1YSCA 1IB0A 3SVTA 1DELA 4HT3B 1ZXXA 3DS8A 3HN6A 2EWVA 1XZDA 2ZSJA 3GRRA 3K9WA 3ZU6A 3ZV6A 1ZVQA 4E4YA 2DAPA 5CDYA 5LNK6 3M5DA 1CDZA 2GILA 2JL1A 3WYDA 3BGSA 4BC1A 2Q62A 1XD9A 4IUBS 2RB4A 2JHCA 3PHCA 4OMUA 1QAOA 4UE6A 1VKRA 2HU7A 1Z22A 4ALIA 1PHRA 1MGOA 4BLQA 5DGDA 3SF8B 4ASUA 1NOJA 2OFPA 3ZBQA 4QASA 1F9EA 4WX2B 3RRYA 5K09A 2JKYA 3JQBA 2DRIA 4BO7A 1RVV1 1SB8A 3ZCXA 2N1MA 1Q0RA 1Z88A 2QZPA 2FWMX 3DUFB 2LVBA 4HGPA 2X5NA 2H2DA 3AB7A 2OD2A 1LX7A 2WPDD 4JGBA 2AWOA 2AZ4A 5EYPB 4YT2A 3ODGA 1ZZEA 4CYMA 2DWUA 1TZKA 4Z9XA 5IJ0A 1MA0A 3F2VA 3WLAA 4PN3A 3PEYA 4MPDA 5E4YA 1E6WA 4DV0B 1AT1A 1XHEA 2HX1A 4RA6B 4D9MA 1KJ8A 1U99A 1TJ5A 1T8PA 2ZAOA 2ZR0A 3IA7A 1T1IA 3OLQA 4QDOA 4V0SA 3L9WA 1M83A 5JSHA 4YMLA 1WXGA 2QA5A 3A6FA 4KQMA 1TJYA 4YS6A 1K5HA 4ZARA 1MDFA 2VBIA 1M67A 1UJMA 1W2WB 2DR0A 2A9PA 2YOGA 1G0OA 4WNAA 1OLXA 2H4XA 3HVUA 4JBWA 3M6UA 3KLPX 2VHVA 4LVNA 1NMZA 4L5YA 2DKFA 1M1YE 4P4UA 1R64A 4UVEA 3U9SA 1O08A 2Q8NA 3BEOA 4DA9A 4ABYA 3CN7A 5LMNB 4WA7A 2QTZA 3B9PA 2B4YA 3LUGA 1UEJA 1G5HA 2NUAA 4M0LA 5B1SA 1TVCA 2NU8B 2W8ZA 3S70A 5E7JA 2AZXA 1ZKMA 3NBQA 3LWDA 4JX8A 2YRXA 4YJ3B 1U28A 3E03A 2OA0A 2JK1A 4XR4A 3F67A 4GI2A 4H9GA 5T4FA 4F4CA 3OCZA 3PVZA 4G3XA 1GO2A 2IUEA 2FF5A 3K1TA 1PVVA 1C7EA 1VB5A 5EZ6B 1OFTA 2J9YB 3BTVA 4ESOA 3HXMA 1KSJA 5JPDA 1DO2A 1CEYA 5D01A 3T7DA 1FRQA 1N3YA 5ALXA 2AEFA 2JI4A 3DZJA 3KC2A 5G0SA 2OKCA 3GVIA 2N1BA 3ZU3A 4URFA 1N8NA 1ORHA 1GN8A 4G5HA 4V0OA 5BQ5A 5C4GB 4CQLA 2JLRA 3HVHA 4JI1B 2ZUUA 4LWZA 4CDGA 1UDBA 3BJRA 3ZQ4A 3IT2A 4ZVPA 1MB9A 3A14A 5EZYB 1A7UA 3OMLA 4BNYA 4ETMA 3W2HA 5A3SA 2YJZA 4IWXA 3GOQA 2B5WA 1LBIA 1PJZA 3NM5A 1UWVA 4MR8B 4CKWB 3LYUA 5L6LB 4PFSA 3WKBA 3EGOA 1XQVA 2ZM5A 4RPKA 1AZWA 3KYDA 3HJFA 1QGZA 1BJKA 4DLNA 3O1IC 3G23A 3B20A 3SXUB 1YTLA 2VK2A 3FRHA 1NASA 1T24A 1NRXA 2NNWB 3GYBA 1F5SA 4LRUA 5LQMA 1AQUA 3KKMA 1C3LA 3JZDA 1GFIA 5AW7A 4PG5A 1MH1A 3SKXA 2O20A 5CVCA 3NEJA 4KGVA 2NMVA 1T1SA 3NUGA 1AXEA 3SZGA 3VR2D 2HUPA 4WRRA 2I3GA 1R18A 4ZHQF 2EQAA 3D6HA 4IMRA 3T6KA 3LUPA 4FHEA 4NBKA 4HQ6A 5FUBA 2XT0A 1E1LA 3AETB 5IJWA 1K06A 4P54A 4HOYA 5K5EA 1TMYA 1XTVA 3QE3A 3AKZA 4FNMA 1C80A 3L6UA 1M1XB 2E48A 2QMEA 3CKKA 1BSVA 3I5AA 3O91A 3N2ZB 2VATA 1PS8A 3QEMA 3D4IA 4N8EA 3SDBA 1TVKA 2BDUA 1C0LA 1P5RA 2OXCA 4HVCA 3ADBA 3VZCA 1F1BA 3P2JA 4DEYA 3F8TA 3SEQA 2GSWA 4QHSA 1RXSA 1C30B 1DS6A 4LTDA 3S44A 3QBEA 3G02A 4RADA 1MX5A 3I52A 2V6BA 4V2IA 4D0GA 2KLHA 4BX8A 2EATA 2NPFA 4UXHA 2PKQO 2BF4A 5KNCD 4ZREA 4HDSA 3MUNA 2D0IA 4MQFA 1Y1SA 2D74A 4R0MA 4W5TA 3WS7A 3AZPA 2X0JA 3DTTA 2IEDA 4JSTA 1E1NA 2VA8A 4RO0A 4YMSA 5BN4A 1V71A 5I4CA 3I9KA 4JQOA 5ES4B 1LPBB 3QPAA 4ILEA 4OFZA 4LF5B 3QVJA 3KOMA 4P3OA 3GLHB 3TRDA 3X1KA 2J59A 2RGGA 4B6PA 4YRPA 5FKJA 5HIIA 1GGHA 3QA9A 1PE0A 1XT6A 1QZZA 2GN0A 3FYHA 2GJ9A 1G291 1E7YA 1GU7A 2P9HA 4IFTA 1X42A 4JL6A 2P4SA 3B9BA 3FPJA 3KEFA 4G5YA 5TE9A 5A6VA 5AIBA 1H8HA 1FYWA 2H11A 2GB4A 3U09A 1VMAA 1S2GA 1L4EA 1X8JA 5BMOA 3V80A 3QLUC 2NWQA 3CXUA 2QQ0A 3EASA 5LDGA 5SY9A 3DBIA 1U8XX 3HU1A 4H7IA 2QU8A 4QBGB 4HSEA 4G89A 4UPVA 3SM9A 2HQ1A 4AO8A 4PC3A 1HQYE 5THKA 3TTUA 4RMNA 2GF0A 1F17A 3MS2A 5JO9A 4AU1A 5JNLA 1H66A 3L8GA 5CD9A 4AP6A 2D5LA 2VBFA 2OO5A 3GIWA 5K6RA 4YQZA 5AWFC 1RI4A 4GR9A 1AV7A 5ULLA 5JTTA 3OTGA 1QC5A 1XZHA 1CDEA 2OT3B 1AE1A 1GRVA 2FB9A 1VHLA 3C3EA 4KQ2A 1W0KD 1VPDA 4B44A 3G2KA 1A9OA 3FSGA 4DZZA 1QH9A 3LGAA 4GX2A 4GUAA 1REQB 4ZJYA 4UNIA 4Z86A 1FX0A 2C2WA 4KXYA 1P8JA 1N5JA 2H5JA 3EIOA 2CGEA 4IWYA 1PW7A 3PUHA 4LOJA 5E0KB 4QEKA 4Z1OA 1YB2A 1LS6A 3DDHA 3CZMA 5G1PA 2FW7A 5SYAA 2P1DA 3VR3A 2HL6A 3BDVA 3KXPA 2C03A 1CY8A 3RAPR 3WLOA 4ZC1A 4NHEA 5LZ7A 5JQGA 3GWZA 1BX3A 5DHQA 1SUFA 1F60A 2HK9A 4P53A 4KUGA 2QDXA 3NXSA 3EDYA 3RIEA 1VTKA 1KPGA 1PG0A 3OZXA 4BMNA 1ZK3A 3WKEA 2UUBB 4ZJZA 2ROQA 3BMQB 5I9NA 2FMIA 3NRCA 4LSMA 4TVKA 4WK6A 3ZC3A 5AVQA 2HLNA 3OT4A 2HOQA 4X61A 1NRIA 2FPMA 2I29A 1B8NA 2FXIA 1VYUA 3WL7A 1V3UA 1AZTA 4WXMA 2E1PA 4HH4A 4KXLA 1CY1A 2HLDA 2AN4A 4X8LA 2FQ1A 4R54A 5KDDA 4C7OB 1SVIA 1LNSA 5IK2D 4UTOA 3TEMA 3H6GA 1BW9A 1ETHA 5C7YA 4X3CA 1CWUA 4Q7JB 3VNBA 3NBMA 1NVKA 3E9CA 4NG4A 1Y5LA 2Z98A 4O8ZA 4G56A 5DASA 4MX8A 4IP0A 4WBNB 5U9CA 1N5OX 4JC0A 2FJPA 2GK4A 4L73A 3HFRA 2A5JA 2B61A 3PX2A 3QPCA 1J2EA 2ZIXA 2WWVD 5IK2A 4CIWA 5J3JA 1XA0A 1JPJA 4WXYB 2FUG6 5TPWA 1RACA 4GLLA 4C05A 1JAHA 3W2TA 3P0RA 4BEBA 4GL2A 3QIVA 2O8BB 2FSVC 3SP1A 1UMBB 3KEGA 4B3HA 4N41A 1L8LA 4PYNA 1G8MA 4YV7A 1ITZA 3ZE1B 4DCUA 1YO6A 4OHOA 1GTRA 4MB0A 2CNNA 4B4UA 3OQPA 3ZHRA 4CGZA 2CMFA 1UBLS 2CK3A 4HUQB 3TLJA 4TMWA 3LZ6A 3ANMA 1VHWA 2AG5A 3JQ6A 1TYEB 2E89A 3OQOA 4N7RA 3IURA 4MINA 4WK4B 1LS1A 2OXEA 3IMKA 4BQIA 4C21A 2WHEA 3KV1A 4LYFA 5EHIA 5A6SA 4Y6SA 2VYVA 5D3QA 1HGXA 3JSXA 3I72A 5DYTA 1BD3A 1HY3A 1RKVA 3DF7A 4W6QA 2O7SA 1RE1A 4GBJA 4B7CA 2VRCD 2GRJA 3ZLVA 1BU8A 5H3LA 1T36A 4UATA 5LLDA 3D8SA 1AK9A 3CTMA 3S5UA 2X9LA 1CS0B 1DBQA 1Q22A 2XPCA 3DMFA 3LQRA 4D81A 3ZJVA 1U8YA 3REQA 2KLBA 4OGFA 5CJPA 3OCWA 4RKFA 5L8VA 5LWHA 1EWKA 1BH6A 5K0FA 1D8TA 1EGHA 1ZM4A 2PGDA 2BOVA 5EGNA 1XNQB 4QTTB 4IWNA 1WCXA 2OKGA 1P2UA 1NONA 4MV0A 2ACEA 3O9VA 4PPFA 1K1EA 3W3AD 1K66A 3H11B 5H3HA 5DXJA 3ZPXA 1F14A 5DBIA 2OENG 2AFHE 2PH7A 3DWIA 1S3IA 2XMRA 3HY3A 2HRZA 2Y1LA 3PI6A 4OLHA 4EJFA 1L8QA 3CZ9A 2WAOA 4B85A 3OFND 1NFRA 1EVLA 1EGAA 4BX9A 4L95C 3DPIA 1JJVA 2QEQA 1FK8A 2PBRA 3VHRA 1DAMA 1VHTA 2XUQA 3DKRA 4K9MA 4YRJA 4DZRA 3MINB 4L2IA 2H51A 4BB6A 1CUZA 1AHHA 4QJ4A 2DBQA 5TMEA 3VU1A 4DV3B 3CVUA 4OKIA 2BEKA 3ITNA 4LI3X 3KVOA 3R9XB 1VCNA 1Z2PX 2W0MA 3MD0A 1S7CA 4RGBA 4PFKA 3GJ4A 3H5RA 3K15A 1JHUA 3RLIA 3WO0A 4DC9A 4PSUA 5D6OA 2B4QA 5B7GA 2ODAA 3LRXA 4HLUA 5HIAA 1SVKA 2BBWA 3TD2A 2PMDA 3Q6IA 4BX0A 4BMSA 5M34A 3UY4A 2B3TA 1XPJA 3I01A 2JCBA 1OWOA 4QLBA 1QFYA 4CM1A 2FVXA 1NTRA 2PS3A 1NP7A 3H9GA 3LVQE 4POOA 2V5VA 3Q8LA 1O5IA 3IBFA 2G1PA 1T35A 1YT5A 2RHMA 3DBRB 3H97A 1ZGHA 3CO5A 3LC2O 3V4PB 4YWHA 3VI4B 3AUKA 5L3RA 1Z0UA 2BM8A 4JKIA 3DXZA 3W1EA 4KXUA 5IYZF 1SEVA 4LAFA 1RPJA 3EAFA 1ZY2A 1G1AA 1N0WA 1GRNA 1H5QA 2A1TS 2QG4A 2WTAA 1KOLA 1OBFO 5GJBA 4KQXA 1UBTS 2BKLA 2RHTA 2OYCA 3W79A 4IOMA 4IDFA 4KFUA 2Z5LA 2NSLA 2QYHA 1GL9B 1MA3A 1NM5A 1PKEA 1EDEA 1ZVMA 4JLOA 4QOFA 3P0JA 1XVLA 2I8LA 5F1PA 2PS1A 4PSAA 5AK3A 1BEUB 3EOZA 4KRXA 2H2HA 2G09A 4R16A 5EKSA 3TFWA 3IOEA 3R3SA 4YTEA 5CNJA 2BSQA 4LOLA 4Q4HA 2PFGA 1N2XA 2QQGA 4XLZA 4QYTA 1KI3A 3S1SA 2DTDA 4K1LA 4NZMA 1C4XA 1CP2A 1PFGA 2V7BA 1MABA 2XUDA 2A5FA 2ASEA 4X7BA 2BZGA 4R7GA 1L5NA 3WDSA 3ZGVA 1FTNA 5FBKA 2GN2A 1Z9BA 4KXMA 5JJLA 4H7JA 3RS8A 5LQDA 4F9FA 3IP8A 1XWIA 3OIVA 4Y9TA 3JV7A 3RBXA 3OX3A 3A9TA 5CVUA 1NG1A 1Y89A 2IEBA 5ALFA 1K75A 2WUVA 1DXOA 3MJVA 3OFKA 4BGUA 3OQBA 4LZNA 3PC8C 4WKOA 5KNBH 1HF3A 2N42A 3GDWA 4MKZA 4E12A 3WNCA 1Q7GA 4ONEA 2P3LA 2FW9A 2HCTA 1R8SA 1X7YA 1RPAA 1NX6A 3CGGA 4CPDA 2C8KA 2HAEA 1BA2A 1LPMA 1NBIA 3LHSA 4R31A 4TYQA 4I2NA 3MB8A 2OVBA 4M88A 4G0MA 4WZAB 2O8CB 1P0MA 4CCYA 4WLVA 1I5OA 4G0XA 1TEVA 2UVPA 3WBBA 1F0PA 1P0IA 1S4QA 1WABA 5IVPA 1Y98A 4GXTA 1SIOA 3UUGA 1F2VA 1WL8A 1TCVA 5CLJA 1RDFA 1VPVA 5G3YA 1SELA 4XYEA 2GBGA 5ITWA 4CG3A 2DFTA 2AOTB 1PL0A 4LKRA 4KZPA 3T7AA 4MCJA 2Y8EA 1M1YB 1VFNA 3PFKA 4QRHA 3TJMA 2ZBPA 1KBQA 2CLEB 1LI4A 2BI4A 1K7XB 1WEKA 4OHWA 3ZWQA 4J9VA 5E6RA 4P0PB 1ORIA 1P2BA 2O2YA 4KQFA 2I4RA 4B79A 4C1BA 1A4XA 3VAZA 4PC7A 3NO4A 4A36A 4HO1X 4D3XA 1U7TA 3QKWA 2D00A 3U1VA 5KUTA 1TAUA 3FUTA 4EG0A 1EVIA 3QXHA 4G1VA 1EQAA 4UREA 1Y6QA 4XWAA 3IDAA 3TZHA 1QFZA 3KFLA 4P5PA 3SEFA 2G72A 4CKZA 5AJZA 1VE3A 5BO5A 2ZYSA 3CSUA 1UKVY 5I9MA 3SJAA 3WYGA 4C7XA 4MS4B 2VTVA 4DDVA 6PFKA 2IYYA 4BWGA 1BDHA 2O5CA 1TQ4A 1Y6RA 3WJAA 5JRJA 2IHBA 2XZPA 3C3YA 2XE6A 5E4FA 2JFQA 1TDJA 2R87A 1JBQA 2C29D 3M5WA 4IJ6A 4J0IA 4ZRNA 4US2R 1FPMA 4HLUC 3BZUA 4BY9E 2BH2A 3CMCO 4GVPA 3G79A 3MUFA 4MMZB 3QEBZ 2F7SA 4IVNA 1OB2A 2P4HX 1HEYA 1RCTE 4S24A 3UUFA 4BU0A 1JYFA 4GM4A 1G2OA 4DG8A 4XDHA 2FXVA 2K2QB 2PE5A 3MWKA 2NM0A 1ZNXA 3I34X 2BFFB 1V6CA 3L1IA 4L07A 3RC1A 4WZBB 3S2EA 1Z4MA 5I51A 2GZSA 1RLOA 2MJLA 1BCRA 2YZGA 3VNSA 2VF8A 2XECA 2WOOA 3QVGA 4JP8A 4M9ZA 3TZ6A 1QR6A 3OJ0A 3OURA 1WY5A 4J3FA 3ZXYA 1UXOA 3KQVA 3R40A 1KIAA 3ZEIA 1PV2A 1QH8A 4YV1A 3ADPA 3GO4A 1RQ2A 2QT1A 3JX9A 1L5OA 4BRSA 3FSRA 1L8OA 2ST1A 4G0OA 4FQ7A 3EWAA 5D51S 3BK7A 3K1ZA 2IS4A 1A2OA 2XB8A 1Z2NX 3RU3A 1D6MA 1JKFA 4JJAA 1QP0A 2XCLA 3GP3A 3NT4A 4ITUA 4FNOA 1LBSA 2DEUA 4COOA 3M9XA 3R3XA 2P79A 2R1VA 2NVWA 3HO8A 3AC0A 3SQXA 3STWA 2I67A 4JOCA 1R4ZA 2XE8A 2YJ3A 2X1LA 2OQIA 2WA2A 1ODSA 3PNYA 4Q3EA 1H5NA 2FI1A 3ORYA 2FWAA 4H27A 4BFXA 4U6SA 4PC1A 1QJ4A 1RC1A 3PC3A 5DM70 2AQ8A 3FG9A 4B3CA 4MQEA 2H52A 2OORA 5CNKA 2WM3A 5LYJA 2IY8A 5FWYA 1E92A 2OLEA 1JQ5A 1T0JB 5C3UA 3ZZ1A 4LDQA 3WMEA 4ZIRA 5JAZA 2GK7A 1L9KA 3EG9B 2H1SA 2CMHA 4LISA 4YXFA 6GPBA 3SU8A 1NLZA 4RETA 2OO3A 2VPQA 3HB0A 3EDQA 1NUPA 1VPTA 1SQ6A 3IPYA 4CMBA 2E55A 4C2BA 4BNXA 1ZX1A 3A10A 1XGKA 4X90A 5KYYA 1Q0SA 2O7RA 1FU4A 2JKVA 1TKCA 4QICA 1KZ6A 4FEGA 1N8TA 4DUGA 2WSBA 2YOHA 1OIWA 1W44A 4NDNE 1IFXA 2Z2ZA 3NHLA 1HT3A 3DAFA 3CY6A 4EWLA 3OOHA 3AJ8A 1B76A 2XDQA 4KVZA 1KQ3A 4R3NA 4XD7D 5DYGA 3VR6A 3GLUA 4FJ1A 1GZ3A 2OBLA 2YXDA 3LXMA 2VOJA 3HVJA 1U3GA 2OZVA 3H8WA 1RTKA 2C59A 1A0OA 4OUDB 4P92A 4PRLA 1DLJA 5GM2A 5BXQC 2H29A 1DC7A 2PGNA 2VH5R 3BX1A 4RVHA 3UJ7A 3IKLA 1NW4A 3FYSA 4IJ5A 1GRQA 2PL3A 5HFAA 5IX8A 4G0WA 3T9AA 3A2LA 4YCMA 1Q12A 4IGIA 1GZ4A 3OJEA 4BKUA 4S1OA 3RW9A 3HADA 3A3OA 3UMSA 2ZS9A 3HB7A 4N6OA 3PS9A 1UF9A 1F8XA 5LWQA 3K9GA 1DUIA 3ZIUA 2RAVA 2YNMC 4GAEA 3ZE7A 4FB4A 1M1UA 1ILWA 1J0XO 4MULA 1E0SA 4RH3A 3T9FA 1Z17A 3OKPA 3DEHA 4DCTA 4G1BA 1W36B 4K46A 1RLMA 2A9RA 4XIYA 2P9CA 5LQAA 2WZBA 4YRQA 2FPGA 5IMBA 3V7YA 5DHTA 4Q21A 1MO3A 3GAAA 5IW8A 2CVZA 2GO7A 2CBZA 4ND4A 5IANA 3AG6A 2XT6A 3C4VA 3L4EA 4WLEA 2P30A 3G0OA 3REFA 4CCWA 4G9BA 5ALIA 821PA 3M6AA 1CEXA 3RBZA 5B7NA 1RR6A 1L5YA 1CIPA 9GPBA 1IPFA 2LWIA 2PS9A 4RKQA 3NTUA 3LO8A 3TPCA 3ZGZA 3GXOA 1WBBA 2FZKA 1O0SA 2G7ZA 3D0OA 1A5ZA 7ADHA 1YBHA 1ZW6A 3I4CA 5KQMA 3HI4A 2WT8A 2ZYGA 3K4HA 3QJGA 3LVRE 2V7QD 4Q3DA 5HG0A 2PSSA 3KWMA 4CIVA 1QS0B 1R4NA 3SZLA 1NVGA 2XD4A 3FHLA 3EA4A 3KPJA 2UXCB 2HDHA 5AVYA 4MVJD 4DNFA 3GDFA 2NYAA 4KFRA 3ZTWA 2CLCX 3E81A 1NBWB 2JHPA 3MVEA 2C2KA 1Q7BA 4FIZA 3SQLA 1UPAA 1LBEA 3KM0A 4OB7A 4RQTA 2CK3D 2OBFA 3HWX1 3WRWA 1VRWA 3SF0A 1G60A 1CUIA 4G5QA 4MZXA 2R7NA 4UD6A 4D9KA 2J8ZA 5FD8A 3MTJA 3G0BA 3DGEC 5JY1A 3LPLA 2K5UA 5HTKA 1ZQ1A 3AGPA 5G0VA 5FAKA 3PF9A 1Z08A 1ONBA 4CU2A 5E38A 3F90A 1JDZA 1EXWA 1E1CA 3IB6A 4QUHA 3E7DA 4RZHA 1XHFA 1Z8DA 2ZUSA 1DKRA 3TQCA 4R8LA 3UWKA 3MG9A 2EX0A 2JIZD 4F5EA 3O8RA 1JEYB 1QHIA 3K16A 1P7WA 2JFWA 3OC6A 4NPCA 4Q4LA 1Z7GA 2OXTA 1NE7A 4RHCA 2A4MA 2IZOA 5IDYA 2FWPA 3OPVA 4PQYA 1JTVA 4IAOA 2BKAA 2NV6A 1Q74A 4J75A 4KU4A 4R1SA 1AB5A 4XM2A 2XCSB 4ZAFA 3K9BA 4IDCA 4Y1FA 2ID9A 4WXPA 5K0ZA 1I3KA 3QXSA 5CVEA 2NXWA 5E3IA 2AKYA 3R3JA 2C31A 3KAKA 2Q41A 3NNSA 2AX3A 4G9EA 3ROKA 2EBFX 3T3MB 2HPHA 1V95A 1X39A 3LT5A 3MSXA 4D79A 5JS6A 2JJ1D 4KDCA 4CV1A 3CNEA 1C4WA 4JD5A 3WLEA 1R4AA 2WVHA 2C58A 2ZG6A 3MIIA 4RK7A 3HCPA 4LYDA 4BNKA 5H4GA 1HNWB 4QOIA 1LX6A 2XQFA 4FMCF 5J2UA 3LBHA 3AXSA 3JYPA 1JJ7A 4YJKA 5JAHA 3VV2A 3TNFA 3HFGA 1GNTA 3CNLA 5AO9A 3JASB 4K81B 4YUWA 4XJVA 3ER9A 3U7HB 2FP3A 2ZJBA 4ZVOA 1PZNA 1HKUA 3VGPA 2J3KA 2PJDA 2VJPA 1U7XA 4J2OA 1WZ2A 2O3JA 3V8QA 4CODB 1SZDA 2QZ4A 4JMLA 1GGFA 1WKCA 2HA5A 2XA2A 2VJBA 5B1DA 1ZJWA 2AG6A 3WWEA 4N18A 1KEKA 5SZJA 1WP4A 2O5EA 5IYZB 3TNDA 2XTZA 3TE6A 3N86A 3V2GA 3IEUA 4IUYA 4Y1RA 2MWMA 4YYZA 1KO4A 3IIKA 3U4HA 4D46A 2FWBA 2DFKB 3WGKA 4E5NA 4RY2A 4UAVA 3FWZA 2OC4A 4JOBA 4YDRA 2EXXA 4OHFA 4JIGA 3U7EB 1B8PA 1E89A 2AK3A 4WNCA 1DB3A 1YHNA 4MGIR 5EKTA 2RGNC 4Z1MA 4QT4A 3MLEA 5EPEA 3QJYA 2SCUA 3F2IA 3UKDA 4R1NA 4NXMB 1CZRA 1P8AA 1EFLA 5CLQA 2I1VB 4QO7A 5KYTA 3D7KA 2O7QA 5TC4A 4ZPJA 3WYNA 1E3MA 4U39A 4KNVA 4BVBA 3LQYA 4G84A 4WEOA 3C7AA 5IT9A 4B4KA 3A1FA 1DAFA 3U37A 2XRMA 2XCIA 1EFAA 1LLQA 1X7DA 2HZBA 3AERB 5BNTA 4R1TA 3FWHA 5BN3A 721PA 1L4BA 1QTQA 1W8IA 4BCBA 2E85A 4JXXA 4P2GA 1QG2A 1CP3A 5DRYA 1YVDA 1G5TA 5TQJA 2DQZA 3NOXA 4CQMA 5CCBA 2Z9CA 2WINI 1ORRA 2YFKA 1E0KA 3FIUA 3AJ9A 5FTMA 3FOFC 2GD6A 2OCAA 5JJ5A 1E6MA 5L7WA 1N36B 4OEHA 1QQBA 4PLWA 5A5VA 3URKA 4MI3A 1VG9B 3FNHA 4CQNA 4HF7A 4IDAA 4XIIA 4ZANA 1FLNA 3VPGA 3V4RA 4RSRA 5HA5A 2PT9A 2OXFA 5AHKA 4R84A 4GSYA 1QCYA 4BNUA 4NCBA 1N5KA 3MAGA 2ZUTA 1AU9A 4GQIA 1ZKDA 2IX9A 1TNDA 1P3DA 3L5KA 3PE6A 3I30X 3MGAA 5KYNA 1O95C 1BHO1 1MO2A 1EMDA 2VF5X 2JGJA 3B6ZA 1KC1A 1JIUA 3HYTA 2NVOA 1AGNA 3O5AA 1BXRA 3R5SA 1TZMA 2I87A 1X74A 3AM1A 1VSBA 4D0SA 1Q0HA 1ZLXA 3HLTA 2ERYA 3Q3CA 1SVLA 1TC1A 3KSRA 3TRJA 3H11A 4IHJF 1E3SA 2VVTA 1M10A 1IHUA 1ZITA 4YMGA 4IG4A 1WQ3A 3HNPA 1NJFA 3R09A 1IOWA 4FE3A 3RTBA 4B0PA 4NBNA 2V3CC 3G9XA 2H0QA 2ETXA 4EI9A 2RKOA 3V46A 5CXSA 4E08A 1IBKB 4UTXA 4RVNA 1QIJA 2V7PA 3GLSA 4YI5A 4YR9A 4B3BA 2C99A 4HAWA 4H6VA 1JXMA 2ISSD 1NBOA 1N6LA 1WF6A 3DE5X 4X6UA 4YVFA 4QWWA 1FNCA 3NNDA 1S8NA 3E61A 2HBQA 4ZU1X 4HJRA 3WB2A 3L6CA 2LDXA 3TW4A 5IKXA 1B0PA 4UNQA 2YH2A 1I0IA 1NQAO 2GAFA 1F8YA 1G2PA 4PTZA 2P0AA 3ORSA 2LKCA 2IU0A 1DC5A 3M2TA 3SJUA 1SQSA 2J07A 3IQXA 3LI2A 4BQNA 4E15A 3NGLA 2I3BA 4PRZA 4CW7A 2RC5A 4M9SA 2HN9A 1LD3A 4PIMA 2IYRA 2PPLA 3LX8A 1F3LA 2CYBA 4QNMA 5BPFA 1K6IA 3Q98A 4HAXA 1GWNA 1EJBA 5KHOC 2B83A 5F76A 3VJRA 5TRTA 4G07A 1T4DA 4ITRC 1A72A 2WU4A 1CF4A 1JEEA 1EPUA 1E3WB 2BY4A 1POWA 4EUFA 2QD1A 3STXA 2C3YA 3FETA 1LU9A 2O0MA 4GZ5A 4AD8A 1XWFA 1Z5NA 3C1AA 1NLFA 4RLSA 1R4MB 4X54A 4BO8A 1PX0A 2FP4A 3X0DA 4ZO6A 1VPLA 2HMSA 4OFBA 3OZ7A 4FFNA 1YZKA 2WIJA 3JD1A 1JPVA 5CFMA 4RY9A 5COAA 2OB2A 1G64A 3CLTD 4BO0A 5KJEA 3I4FA 3THSA 1V4VA 2Q5IA 1MW8X 2D06A 2Q6TA 3KEQA 3QH4A 1YRBA 2Y1FA 1TGYA 3AR5A 4ID9A 3AUSA 1O2DA 4IVQA 3ABQB 4LXIA 2QHXA 1KERA 2B2CA 4KMOA 3WQHA 3DOHA 3PG5A 1K0FA 4MAAA 5I7FA 3CE6A 3FPCA 4PQFA 3AUYA 1J22A 5HRAA 4DSTA 1BWRA 3ZWVA 2PH3A 4NZNA 1SRRA 3HFJA 4MWSA 5AKGA 3EVFA 3B6MA 2FPLA 3R0JA 2D0OB 1NN5A 4PEVA 4Q3AA 5EFOA 4DLTA 3OQVA 5B4TA 3DVQX 1RHUA 3TBFA 2HF2A 3ZDBA 1NJ8A 1FVOA 3OY2A 3MJTA 2QJOA 4GP7A 5EMKA 2GEJA 3ZNQA 2Q4BA 4MW7A 3I1JA 2OV2A 5HFNA 3FTCA 2F3RA 3L7CA 4ZJUA 4IS3A 2H65A 3FYUC 5KNDA 3E0QA 1H1LB 2CHGA 2QTRA 3G5TA 3KZCA 2VTKA 4YRGA 1KAHA 2N47A 2FJUA 4MYDA 1HEUA 5A5FA