1AY0A

Identification of catalytically important residues in yeast transketolase
Total Genus 245
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
245
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVAGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSKETOLASE
publication title Identification of catalytically important residues in yeast transketolase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 245
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1997-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ay0A01
3UPTA 4K9QA 4KXWA 1WCIB 4GM0A 2BEUA 3F6BX 1PI3A 2QTCA 2JI6A 1W88B 5EJ4A 1V16B 1T9DA 2BFFB 3AHIA 1X80B 1PYDA 1OZFA 4KXYA 5K6RA 2C3OA 4C7XA 2BEWB 1QS0A 2C3YA 1V5EA 2BFCA 2JLAA 5I4IA 5EXEA 2Q29A 1T9CA 1NI4B 4GPEA 2EZ9A 2EZ8A 2BP7B 3ZHRA 1AY0A 2IHVA 3AHDA 2VK4A 3DV0A 1X7YA 3EXEA 1Z8NA 3M7IA 5FEMA 3ZHQA 1TKBA 1X7ZB 1OVMA 2Q5QA 4C7VA 5EJ7A 5I5GA 3HYLA 2Q28A 2BFEA 2JGDB 3KOMA 1YI0A 1V5GA 4K9MA 1Y9DA 1IK6A 4MQ5A 2BEVA 2XT6A 1UPAA 1YBHA 2DJIA 4ZP1A 2PGNA 3L84A 5I51A 4FEEA 2NXWA 1OZHA 1X7XB 1WCIA 2FN3A 3ZHSA 4JUFA 1W85B 1ITZA 3DVAB 2PGOA 1QPBA 1OLXB 1V1MB 2G25A 1W88A 1V16A 2VK1A 2BFFA 3AI7A 1X80A 5ERXA 2BFBB 3EXG1 2BEWA 2XT9A 1RP7A 1UMBB 3F6EX 1U5BB 3E9YA 1YHYA 2WVAA 4GM4A 1TKAA 2BP7A 2IHUA 5C4IA 1POWA 4JU9A 1YNOA 3DUFB 2PANA 4MPPA 1X7ZA 1OLUB 3EXHA 1R9JA 2YICA 2JLCA 1UMDB 1OZGA 4JUCA 4MZXA 2C3MA 3EXFB 2WVHA 3IAFA 1UPCA 1UM9B 5K6TA 5EJ6A 2VBIA 2R5NA 3EY9A 4K9NA 1X7XA 2JI8A 1ZPDA 1PO7A 1W85A 1OLSB 3EXHC 3DVAA 1OLXA 1V1MA 4K9PA 2J9FB 3UK1A 1Q6ZA 1QGDA 1GPUA 2Y0PA 5EJAA 3AHFA 1V1RA 5DGTA 1X7WB 2O1XA 1V11B 2E6KA 3EXG2 2Q27A 4JUDX 2C3UA 5K3SA 2IHTA 4KGDA 5ERYA 2WVGA 2VBGA 5DGDA 1UMBA 3FLMA 2C42A 1U5BA 2EZUA 1UPBA 2JI7A 1QS0B 2BFCB 4K9OA 3ZHTA 4RJIA 3EYAA 3DUFA 3M6LA 2OZLB 3ZHUA 3AHHA 1POXA 3OE1A 1OLUA 4COKA 4JUAA 2R8PA 5EJMA 1UMDA 5EJ8A 2QTAA 3LQ2A 2G67A 3LQ4A 5EXDA 1JSCA 4RJKA 2AG1A 2C31A 3EXFA 3AHEA 3EXIB 3MOSA 5K2OA 1NI4A 1UM9A 2X7JA 4JUBA 3AHCA 3AHJA 2Q5JA 3M49A 4QPZA 1N0HA 1YHZA 1T9BA 2R8OA 1OLSA 2UZAA 5HYVA 4FEGA 5DEIA 2J9FA 2UZ1B 2O1SA 2JI9A 2PDAA 5AHKA 2JGDA 1DTWB 1X7WA 1V11A 4JD5A 2AG0A 5ESDA 3D7KA 1L8AA 5HJEA 2EZTA 4QQ8A 2BFDB 2V3WA 3LPLA 1T9AA 3HWWA 3HWX1 4WBXC 4GP9A 4QELA 4MPRA 1UMCB 1MCZA 4XEUA 2OZLA 1KEKA 2BEUB 2IEAA 4K9LA 2BFBA 5I5EA 1NGSA 4RJJA 3AHGA 2YIDA 4Q9DA 3RIMA 4KXVA 1BFDA 3EXHB 5IMSA 2Q5LA 2EZ4A 3EXIA 1TKCA 2FWNA 3FZNA 4K9KA 4D5EA 2VBFA 1TRKA 1YD7A 5EJ5A 3M34A 3JU3A 2Q5OA 2XTAA 5EJ9A 5HGXA 3ZHVA 2UZ1A 2VJYA 3DV0B 1X7YB 3EXEB 2G28A 3EA4A 2W93A 3LQ1A 1DTWA 4GM1A 4GG1A 4KXXA 5HHTA 1B0PA 4D5GA 4KXUA 2BFEB 1V1RB 2BFDA 1PVDA 3FSJX 4MPJA 2JIBA 4JU8A 1V5FA 2BEVB 3OOYA 1UMCA 2C3PA 3IAEA 2VK8A 1YI1A
chains in the Genus database with same CATH superfamily
4K6HA 4NBKA 4BB9A 1ZGAA 3IALA 4QAJA 1KJ9A 3WKAA 4DQ0A 3HBJA 3WE7A 3HDTA 4LHWA 1D2CA 3BWYA 5GP1A 3PRYA 3VSCA 5IT5A 2QT9A 5EYPB 4RZHA 5HWSA 1UC5B 2ZR9A 3PHIA 4ZYXA 3RIHA 2IPNA 1PWEA 4CMCA 2B82A 5H4GA 1C9MA 3A1SA 1P0MA 4EDFA 1XTJA 2HSZA 3C5EA 1AKQA 4RPIA 1BVHA 1WW8A 4Y1EA 1V16B 5DMXA 4YREA 1ODTC 1XCJA 2X4IA 2Z5LA 3PI7A 1UPTA 1FPMA 1PYDA 3GW8A 2ISSD 3PFCA 5EMNA 4IUBS 3RU7A 1NVBA 3EYWA 3L5OA 2PGXA 4G07A 5DGXA 3MJRA 4C7JA 3KOXA 4KDFA 4CIWA 2B7BA 1NZFA 2WWRA 2CB0A 2G1JA 2HMYB 4QDOA 2COKA 2RC5A 4KE9A 1OYVA 1H66A 4WN9B 3AEKA 1KZ6A 1WOYA 2JFPA 3W4JA 1NVVR 2B30A 1EGMB 2W2TA 2QZJA 5EXEA 2H1WA 1PR1A 1WVGA 5LP6A 2GRJA 1EIWA 4JBLA 4FFOA 3HR7A 2H1VA 3QE3A 3KQNA 1P72A 3NTQA 4EYQA 1SG0A 4LV8B 4MWEA 2CLDX 2H2DA 2AD5A 2B5WA 2ZI7A 3H2HA 3KCQA 2W71A 3WMEA 1PT5A 5H83A 5K8VA 3II6X 4C4RA 4IW3B 5AW1A 4E2YA 4MYRA 2X4GA 4ZCLA 5JSUA 2Z57A 1INLA 1W75A 2OHHA 1W36C 2OB2A 2CEKA 5AVWA 3IS3A 5T64A 4LMPA 2VP0A 2E9SA 2ADOA 4KREA 2ZYRA 5DSTA 3N8GA 1JGTA 1FDOA 1N2CB 2YVKA 1YXMA 4G1VA 3DONA 3ZWDA 1G5TA 3BCSA 3MS7A 3WJ2A 4FXPA 4ZT5A 4BN4A 3KWMA 3QXGA 2QL6A 4MWCA 1RD4A 5EKSA 1MAAA 2XWSA 3FWNA 1L5ZA 2ZJ8A 4DDKA 3TD9A 1N3BA 1KIFA 1U0JA 2HMTA 4RV5A 4BV9A 1XZPA 2ZSKA 2AJLI 3N9IA 3TNDA 3FJOA 4XFJA 3D2BA 5AD1A 1CG6A 4EI9A 1PWXA 2LRHA 2YV3A 4EM6A 2FN4A 3FOEC 3D5QA 2XDQB 4B7XA 1OILA 5LP6C 1T4BA 1JHAA 3G2IA 4NCJA 3TQQA 4D80A 4UE6A 3B5IA 4MP6A 2VDUE 4P93A 4XTRA 3W79A 2QZSA 4N5HX 4R8SA 4WESA 4X1YB 5C52B 4ISBA 2VDKB 3VR5A 5IK2D 1EI9A 3A6LA 3OZDA 2G9ZA 1MO3A 2I4OA 3WWZA 5CFNA 3FWKA 4EPRA 3H0CA 4B3TB 5G0WA 1BN7A 4I4LA 1SCUB 4YONB 4Z2AA 2Q2NA 5C8YA 3V8PA 3TK1A 2F43A 3ZNPA 2G83A 2HMVA 4K9DA 3SFZA 2WU1A 4C0QC 1THZA 1UBOS 1SK8A 1RT9A 2XB4A 1KQNA 2PJZA 4O5AA 2PBRA 4U4AA 1N1GA 4B3XA 3NM6B 4ERXA 3QY0A 1YR1A 4L4UA 1UKEA 5T41A 1SC1A 2HFJA 3V4SA 3DVAB 1DC7A 2XZDA 2XHZA 3C3WA 3DKRA 3G2KA 1OLXB 1TYDE 1MB0A 3OPYI 2PRYA 1VHWA 3P97A 4ML3A 4QXPA 1AV6A 3NHBA 1FIUA 1KK0A 1JR4A 1VLHA 2ALJA 2ZWIA 1JHDA 4AD8A 2P41A 2J6CA 3I1FA 3GLSA 2JCSA 4JLWA 1F51E 3IERA 1E9EA 1NMYA 3G17A 3SBEA 6GPBA 2EEPA 2G9VA 2O7NA 4J91A 2GZ3A 5DGCA 5DSXA 1GNQA 4P4GA 4CM4A 3PTAA 3T8YA 4BLVA 4BLUA 4CCAA 3D8BA 2Z09A 3QITA 3FCSB 5BV0A 1E3QA 2O3TA 4NG5A 4OOEA 2BSXA 2OY0A 2PL3A 5CHYA 1NJ6A 5K3FA 2P5TB 1ISPA 1JXOA 4LX8A 5CPBA 2PT9A 3KL2A 3DQPA 1ZAYA 2QRLA 5KX5F 5DIZA 4ASUA 3QY9A 4YJGB 1DEKA 2RIPA 1CQWA 1E1QA 3DC7A 3DXZA 5E2AA 3B8EA 1P5HA 3SBOA 1IXSB 2MJLA 2A5DA 8GPBA 1OTXA 2BDUA 3UWDA 1YJBA 1C8KA 4FZRA 3PUYA 1K7FB 1FYFA 3DWFA 3MTJA 5EXPA 3T3GA 2ASVA 2PGJA 3NJRA 4M36A 3ENQA 4MWBA 4OMCA 4RK6A 3TZLA 3DKPA 3QFCA 4ZEXA 5CFZA 3I4CA 4Y1RB 4G0ZA 3MVEA 4MPDA 2JANA 5A1JA 2ZQ5A 5LA6B 4WBNB 1HK7A 2X4DA 3P0HA 4MZDA 1MC4A 1F8XA 4Q7EA 3UH1A 3ZHCA 1EG7A 4BP1A 3HKCA 4TT8A 4BLSA 3TLGA 4HDNA 1D6SA 3ENZA 5D84A 4EY3A 3NBFA 4YDQA 4A1FA 2B7CA 3ISTA 3KLBA 1XAIA 2DQ4A 1ZH2A 2P65A 4JP5A 1F06A 1S2IA 3N2KA 5TT1A 4GKVA 2WUFA 2NVUA 3H5NA 2LKCA 4MV0A 2J6BA 2LD4A 2AWOA 4OMDA 4RD2A 4KPUA 2RAVA 4W7SA 4YJ2F 1XLWA 5AHOA 2XYVA 4OGFA 2AOVA 1YB5A 3KJGA 3ETHA 1BN6A 3H7IA 3IYLW 4DBLE 1ESEA 5IEJA 3VZCA 2AFIA 2JAUA 3SYMA 3ABSB 4DLNA 2ZIWB 5CW1A 4G85A 4IOKA 1G64A 1TO2E 3HMKA 4JUCA 3E9MA 5C18A 2UUPA 2QROA 1DEXA 4EMUA 3AK4A 1E2BA 4NYJR 5AVQA 3MTBA 4PM4A 4TL8A 4C0HA 4C6SA 4LDAA 1C3OB 1SIOA 2NIPA 3C16C 4DQUA 4I9UA 3H0KA 1E61A 2VBIA 3U39A 1RHKA 3C2QA 4XR4A 3CNEA 3ZWKA 4CF7A 2EQAA 2OGSA 3IKJA 1A72A 3QU7A 4JI6B 1PCXA 2P11A 3DCJA 1NIJA 4N6NA 3T7JA 4MI6A 1TD9A 5KC9A 2G1AA 3O2JA 5DBEX 1VC2A 4U9HS 2WW8A 3IJPA 1XMJA 2P8JA 4JBHA 2QNBA 3ZDFA 3DZFA 4AIIA 5J40A 3THXB 4I1VA 1YKSA 2WFAA 4CKZA 3Q98A 3RBVA 3ASUA 4D4IA 1RWQA 3SE7A 4ZTZB 1ZGHA 3O95A 3N39C 2IH2A 4DY6A 3HP4A 2AEMA 2PA3A 3IAS6 5TGZA 4TWAA 1NNSA 5L4LA 4EY7A 3B12A 5TVKA 3HJGA 4V0LA 3KYDA 3FTPA 1Z07A 2PWAA 3AQ4A 1V1RA 1QOPB 2X8WA 4G63A 4O0MA 4BWGA 4BBJA 5A4KA 1X70A 1W5FA 1W47A 2JB9A 1HDIA 4ZVTA 1RNLA 5AM3A 2JH3A 3GFPA 1BXZA 3KCNA 4O2AF 4ZI2A 2HMWA 2HHCA 2Q3EA 1MTZA 3E9QA 1DBIA 2DSNA 3GRRA 3GUCA 2IHTA 3KT8A 5IC6A 3UWKA 4BPRA 5IXJA 2WQ6A 1E63A 4PNZA 3RYTC 4DUZB 4F97A 3U4QA 4AY5A 2PX3A 4LDJA 2XVYA 4JX8A 2R9VA 4J0JA 2P6NA 2QTLA 5AUQA 2HQSA 1QR2A 2FPIA 4RPGA 1D7OA 2C42A 4HWRA 3V7UA 5HSGA 1B8VA 4TLCA 1AKUA 1DFIA 3SR3A 3W34A 3VPXA 2CV0A 3VOTA 1IXRC 1FNDA 2ZOSA 2H51A 3FR8A 3PVCA 4XLLA 3NB0A 1AA6A 3PYLA 3KOYA 1N2XA 1RJGA 2QMHA 2X0RA 2ZI5A 1KDOA 3GLHE 4I1RA 4ARIA 2BW0A 5FAXA 1AGRA 3EYAA 3QVKA 4DIDA 5LWHA 7MHTA 2GEJA 4AC9A 3COVA 4K8RB 2CDNA 4REMA 1CZUA 3LOUA 1QHYA 1T5TA 3HJCA 3MWLA 3N0XA 4KQ9A 1D2EA 1M2WA 1XCBA 5HQTA 3FLEA 4CM7A 1XD9A 4JHXA 1OLUA 4LY3A 4OAPA 1EK0A 1SQ0A 2QP9X 2Q0SA 4MHOA 3WWDA 3FB1A 2VQEB 4LCBA 5EJ8A 1B00A 1E79A 2DOKA 5LQDA 1R16A 1OIVA 3U4GA 1R2QA 1M2VB 4A2CA 4CIBA 1QB8A 5KSYA 2YN4A 3FCXA 2O8BB 1E96A 4C0KA 1AKVA 4WW0A 3ZW7A 2VHUA 2YR0A 3E15A 2AVDA 4LXQA 1R27A 2FZGA 4FNOA 2QTVB 3PNQA 3E3NA 3RD5A 1F3OA 1SZDA 2NUAA 3COSA 3D43A 4K6FA 2FQ1A 4IJVA 3T1VA 1NG1A 2X2PA 2Q5FA 1RAAA 3PP8A 1R00A 3ESDA 1A7JA 1W44A 3QLVA 3AHJA 3LXUX 3R9IA 3OZAA 2IVZA 4FEYA 2RHBA 1YJAA 2WLSA 4HTFA 3F47A 1TIKA 5A7HA 3WIDA 1U5AA 1EFAA 4H7DA 3OLZA 4EGFA 4OUDB 1N0HA 4JLBA 5CT5A 4AX8A 1C7IA 1P81A 3EOBI 5DXFA 2HXYA 1T8TA 4BFWA 4FX2A 3T5MA 4U9UA 2R751 4I50B 2QLNA 3DEFA 4X3OA 3AVUA 3BORA 1MP0A 4LNAA 3AKYA 1E7YA 3O8OA 4M8IA 4KAFA 5EQJB 2J9FA 3L79A 2OCDA 5JD5A 1JVBA 4F2GA 1QP0A 2GJKA 3B9RA 2QLLA 4K1LA 1DPGA 3UM9A 5JWOA 1KI4A 2VPZA 5DCWA 2I3BA 2FI1A 2C2MA 3H8WA 5ESRA 3CEPB 4B2PA 2Q6IA 2CVPA 3B38A 3KVYA 4V0SA 1UBLS 2XT0A 1HDXA 2D4AA 4JLJA 1DUSA 4ZVRA 5JMTA 1EBBA 3FCCA 3LSTA 3PUWA 4JGBA 4UM9D 4YDHB 3LAWA 4OBXA 4AF7A 1FTNA 4TV8A 2P9BA 2WHYA 3QLTA 4BQOA 1Y3CE 4G8CA 4KR0A 4WJLA 3DEJA 2Z2ZA 2Q4DA 3QLVC 1UBUS 4HMQA 1GNLA 1Q1GA 4Q18A 2I8CA 2I2WA 4QX6A 1T9AA 2ZB8A 4L8VA 4MS3B 4CF6A 5LZ4A 3NIBA 5FBLB 2CFTA 2N1BA 1U3FA 1QG6A 3H5OA 2HWXA 3AF1A 4NZZA 4RNCA 4GP9A 1DAIA 2CDCA 4TRMA 5F12A 3TQCA 3KSZO 2ON6A 2RONA 4KC0A 4BZZA 1G4HA 1TF5A 3B85A 3DBOB 4FZ5A 4I36A 5LIRA 3G0HA 3NGLA 1H9BA 4N82A 5DI3B 4RWZA 2OG2A 3D6TB 3TRHA 1PP4A 3QXJA 1ZIOA 4AX4A 5D1HA 4FDTA 3QYAA 1M1YE 4Q9AA 1F5NA 3DE3X 1EK1A 1JBKA 1NSYA 2FUCA 2DPLA 5KJ6A 4PZEA 3RQIA 3DE7X 1JHUA 3O1JC 4MJ7A 3GN1A 1BIFA 1E2HA 2CLMB 3AWIA 4MQBA 5JJKA 4YI3A 3CX6A 3LWZA 3RKSA 4BNDB 1AHNA 3IEPA 2C4KA 4IXNA 4M7OA 3ND7A 4NQZA 3U4MA 2FPOA 1OGJA 2H4WA 4QJ4A 2WU8A 2QORA 3EGDB 3ICPA 3QUBA 3BMNB 1O87A 1DIOB 3EVEA 4DSZA 5KOJA 4RJ2A 1ZGZA 1UOEA 2AC7A 4DLYA 3OURA 3VGJA 1WNTA 1CQZA 3EFHA 1I7DA 2IEYA 4IIBA 4AZ3A 1YTUA 1SJ9A 1SCBA 4V0QA 5FQNA 1ZJYA 3HC7A 4ENWA 1AHPA 1H23A 1HT0A 4DIBA 3TXXA 5EEHA 1BD4A 4HUJA 1I1HA 1SCKA 1B8NA 4PAGA 2FWNA 5AKGA 1IEVA 4C2UA 3F71A 5HKKA 1LZKA 3QPCA 3Q7EA 3DOIA 1ENOA 3WAJA 3NT4A 2PMEA 1CJMA 4PLHA 5LDGA 2IYZA 3L92A 2GGSA 1UK7A 3SWWA 4U5XA 1GPH1 3LQYA 2Y1CA 2J3LA 3G5UA 1IL0A 3ACBA 4Y2VA 4R2IA 3IH5A 1O58A 3JCZA 3DDOA 3WG9A 1OD6A 4DPMA 1CJBA 2XA2A 3NX4A 1II8A 1ZBQA 2AMJA 1WB4A 2GVDC 2JZNA 2WIDA 3DOFA 3INRA 3MAGA 3PWSA 4IIHA 1W94A 1X7YB 1KH2A 2W6JA 3QX8A 3DDNA 1XPUA 3C1TA 1YOBA 4UQLA 1T3HA 2P6RA 3RYCB 3PRJA 3V5NA 5GIOE 2JAQA 3MEQA 5EMLA 4HXYA 5DT9A 5BY2A 5HRUA 3VRHA 5AVYA 1PWYE 2EEZA 3GJ0A 2HKIA 2GBIA 1YQUA 2XD4A 4JB2A 4UFNA 2GM5A 1ZA2A 1U90A 3BMOB 3T15A 3CLTD 3ZQUA 4LRWA 3T1YB 1A2QA 3NUGA 2GKSA 5BQXA 2O0JA 3AJDA 5HHTA 1Y6JA 2IV7A 3VR5D 3T3NA 1CUBA 1VDZA 3CZQA 4HL6A 4KXUA 3FOAA 3L8YA 4UZFA 3VTFA 2EVWX 2PH5A 4Y6SA 3S5JA 2VHVA 5F73A 3TI7A 4LHXA 1PVDA 2QMZA 4DMFA 4GRIA 4YX9A 5ADWA 1RHJA 2DPGA 4QBKA 3LO8A 4UASA 3Q8KA 3BE5A 1RFLA 4NU8X 4JODA 3FF4A 5CDFA 3SQWA 3FY4A 2ACKA 1N5MA 1NRWA 1O9BA 2ZAOA 1PLJA 4MUNA 1Z6YA 4DE5A 2JJQA 1R8QA 3K09A 4PYLA 1G3QA 3NM5A 2J3DA 3PCXA 4YR9A 1ZJWA 1TF2A 1XVVA 1YI1A 4BX2A 2GYUA 4KO4S 1UWLA 3NXSA 5HOEA 5SYAA 2HA4A 5KJ1A 3UAWA 1YR6A 2ATVA 4ID3A 5FP0A 4FD2A 1LRJA 4IXMA 1F0YA 3RTEA 5TIIA 3QMPA 1BX3A 1SRQA 2ECPA 3B5EA 3EZXA 4QNRA 3HVUA 3NGMA 3SK0A 5ICCA 2B94A 2JDIA 3O94A 2ZAMA 5U1PA 1YZ3A 4KZPA 1DADA 2HLDA 3PX2A 4A36A 1G8AA 5FDFA 3RJ5A 3HUEA 4H6PA 4ASUD 1T9DA 4O5OA 1P5ZB 5EIHA 4C1BA 4LQCA 1HF3A 2QN6A 2XNJA 4P84A 1QUEA 5EE5B 1OWLA 3L0SA 1ADFA 1KGSA 3B8HA 1Y5LA 5DCLA 3UJ3X 4GLOA 3KYBA 3GLIB 1YFJA 1NVMB 1C9DB 1D7AA 1N1MA 2G9UA 3E53A 3K09C 3MS2A 3SHTA 3A4MA 1CUWA 3GLFB 2VA8A 3QGMA 4R1LA 3K1JA 1NVTA 1XMOB 1HT2E 4A0SA 1F8YA 3LUAA 2R97A 1AQIA 3M6UA 4GPEA 5EUQB 3BG5A 1RI2A 1FRZA 4Q3KA 1KKUA 1A7AA 3H2YA 1TJYA 1IY0A 4MB6A 4MEJA 3U4IA 1AKRA 1G21B 5AUPB 1OH7A 2WJ3A 4QLBA 3HL0A 4UHCA 4BRSA 3LG2A 1CUVA 1RLMA 2HA0A 2F00A 4ZZIA 1AY0A 3ZLJA 1IOVA 1RWPA 2W22A 5K0EA 1OB5A 3AHDA 3B1FA 3V8MA 4EMSA 4K6OA 4BYMA 2D0OB 1O94D 1HDCA 4HATA 1YDMA 2XYGA 1S2GA 3QELA 4KYVA 5J9FA 5BRJA 4S05A 3AKDA 2AC2A 2QSJA 2HO4A 1Z47A 2NO0A 3I8SA 1TKBA 1YDWA 1CLEA 2AFRA 2CWWA 2NV6A 1G19A 2JGFA 4IIDA 4P7GA 3ONFA 4HI0E 4A0HA 2O0MA 3HZRA 1P18A 3HKBA 3BEDA 3NPMA 1QKIA 3B7WA 3OLCX 1L5GB 4CIDA 4IQ4A 5SZKB 2Q28A 1VCNA 1X1SA 3HNOA 3WYAA 3GJ8A 4JI3B 4G3XA 3YASA 1ZD2P 4OFZA 3AUXA 1WUYA 3ETCA 4U9IS 3TM5A 2GDJA 5G4KB 2J7PD 3I76A 1V5GA 2D1SA 4AS1A 2XE8A 4HCJA 2IY7A 4ZT4A 3IV9A 3FSGA 1JPJA 3PL1A 4FDAA 5REQA 1CRWG 2C5LA 4MINA 4PZPA 3IE0A 1Q91A 2HT1A 1MO2A 4KWEA 2G4VA 4WXPA 3WDMA 5HIMA 3GPCA 5MGBA 1QE0A 1SN7A 2I6SA 3HBFA 2EDAA 3AUFA 4IDPA 4J0FA 4YASA 1NJGA 4XDYA 1QXSA 3K9QO 2K4MA 1Y4AE 1XVLA 5CFOA 2V3CC 1BMFD 4FYYA 4KW7A 3PFKA 3UWSA 1G5FA 4CMIA 1PBNA 2GR9A 4WOPA 1N6NA 3W3AA 4IOMA 5L3RA 1O9HA 4IS2A 3UNXA 1HZZA 2FPLA 2VO1A 4KR9A 1E9FA 4F84A 2H5EA 3F3MA 2D1RA 1K8ZB 2ZRMA 4FQ7A 3WX0A 4ZWNA 4EFNA 4EY4A 4JKIA 3SYTA 4ZKDA 1QFZA 1JG7A 2R4UA 2HDWA 2BGWA 3ESCA 4DR7B 2WHRA 3S7TA 1Z5VA 5J2TB 2XNCA 3AY7A 5ITSA 1D1TA 3RDPA 3LLUA 1DRUA 4BGUA 4RDHA 1GA6A 3IEVA 1U2SA 4EQZA 1A9XA 2DR0A 2RBGA 2NAPA 2KX7A 2IW1A 5GADl 4PF1A 1B26A 1CY1A 1G9TA 1X80A 3NRCA 4KXLA 3PL5A 4UXIA 3PXAA 5AIAA 5EMMA 4G8BA 1LDMA 3OPNA 3H2KA 2O5EA 1ZRHA 3MJEA 5H1YA 2CJXA 4NC9A 4YN3A 5F7JA 3ZE0B 1I0IA 2E5FA 3GYGA 2BEWA 2Q9BA 16PKA 2XT9A 1XZAA 2I7DA 2RHRA 4DIFA 4KPFC 4R8RA 1WLYA 3PXBA 1CWUA 1CDEA 1SU6A 4RFVA 1AIPA 4LVCA 3KBBA 4Q3CA 4HH0A 1HZZC 4GXTA 3MRTA 3S8MA 2C2YA 1RXUA 2GCOB 3RGGA 3ABZA 4KN8A 1ZUWA 2AJCA 3D2LA 3G9QA 2ZRIA 3E8MA 4R54A 3HE3A 1H2EA 2WE7A 3B5JA 1LBEA 3CE9A 3IIIA 4JLKA 4UNSA 1IATA 1JXQA 1O8BA 1O4WA 4WFIA 4X3PA 2FNAA 3RYCA 3K15A 2G08A 3AP1A 2XXAA 1M34B 1UM8A 2R7LA 3T6KA 3HB1A 2PANA 1YJ8A 4NYJQ 3OZGA 1GUYA 2IU6A 3VJRA 1UXJA 3OCYA 2RGGA 4WKBA 3ML1A 1R9JA 3HRKA 3CG0A 2YICA 3Q5EA 4OX9Y 1VL8A 3IUJA 1ZGCA 4AUEA 1GUBA 2ECFA 2B34A 3OFJA 1T6NA 5EP3A 2P75A 1GT6A 2CB9A 2I3DA 3N2LA 2QMQA 2GK3A 2PFGA 2V5AA 4MITA 1DKOA 2BM9A 3I9FA 4KRYA 4Q39A 2V6MA 5DRTA 5EE1A 2VDMB 2G7MC 3VFDA 3WL6A 2IZ7A 4BNVA 3X1WA 4BTEA 3IQHX 1HX7A 4HNAB 2C7BA 3R8XA 1E8DA 2W6ZA 1TGYA 1W2WB 1NXPA 1W0CA 1WUTA 1Z7EA 3MTEA 4Z4FA 2JRLA 5EMHA 3I30X 4N03A 4EG4A 5EJ6A 1Q84A 1XTUA 1CKEA 1ULBA 2EGUA 2VDOB 1F4PA 3I6IA 4JP8A 4DMUB 3CPEA 5CLQA 1ZR4A 1AF7A 1VJGA 3I5XA 3ODGA 2OK8A 2AD1A 4KWTA 3BMQA 4P98A 1X7XA 1ZKMA 4G41A 2EBFX 3UK6A 2W43A 1Z6QA 3OQVA 4OAQA 4N7JA 2REQA 4YJKA 3BE4A 2BR5A 4S1WA 3V1UA 5ADUS 3Q7PA 4TM8A 4JJZA 4FB4A 1ONOA 4XWKA 1M5UA 2WU3A 1UJ2A 4RGBA 3UJ8A 5IJ9A 1GCUA 2VNAA 5TDHA 2MTBA 3NONA 4MRMA 5AI8A 1G16A 5ALEA 4OHRA 1QGDA 1GPUA 1GSOA 2CEAA 1ZESA 2DTEA 2K7ZA 3HUFA 4XIFA 3ST7A 3HXMA 5KREA 2VHCA 1Q7RA 3IT3A 4II2A 4MQ4A 3U1VA 3C4VA 1VCOA 4QPDA 2H08A 4KO8A 1NP6A 2J9RA 5JNVA 3L46A 3T5BA 4RTMA 2VSFA 3BHNA 3BXZA 1CCWA 1QHHA 1MGPA 2J5XA 1P1JA 5SY9A 4IUYA 4ZOLF 5C31A 4CLEA 1LQTA 2GUWA 3VZSA 5ED4A 3S70A 3QBDA 4DC0A 1TQ8A 2IX3A 3GVHA 4BPBA 4CEJA 3MWKA 5F51A 4O4HB 3R8FA 3QV2A 5DX0A 3RC1A 4DKJA 1FY2A 4M0EA 2CYBA 1NL3A 4V0KA 4DQXA 3HBAA 5ALGA 3C6KA 4AJOA 4WZZA 4YMLA 5JJBA 5B4UA 6LDHA 4MGZR 1RFGE 1VP3A 2WKPA 3JD2A 5D5PA 1P2FA 2ESRA 5A05A 2WHPB 3QLJA 4R8VA 1IUOA 4S12A 4XYMA 4RAQA 1AQLA 1NG9A 2Q99A 1GD1O 1E9SA 4WZBE 4V1CA 3WR5A 1GPAA 2CSUA 2HDHA 5CCXA 1CHDA 3P9RA 4N0PA 4NARA 4E33A 2FW6A 2VF5X 4G84A 3PGA1 4DMHA 1LX6A 4DL9A 1R9MA 2ECQA 5LU8A 4M1TA 1IUKA 2H57A 3OE5A 2X5KO 3AVOA 4BNGA 3VR4D 3AHHA 3TPZA 4OP2A 4CPDA 2UAGA 3L43A 2C9BA 4L5CA 2A7XA 1V4BA 3NH9A 4DCUA 3DLIA 1NU8A 1Z38A 4I99A 2PCLA 3UG7A 5ITZA 1DUIA 3G2HA 5BNWA 2YN0A 4RK5A 4DCMA 1GM5A 1PW7A 3TLCA 5G53C 4G97A 1HT3A 1LC0A 1KOFA 2FVXA 3RYIB 3ZJYA 1JF8A 1IM5A 4ABTA 4XWAA 1BCRA 1ICIA 3HDJA 4W9MC 3C3AA 1QH0A 2LDXA 4A26A 2NNWB 3VR0A 4Q1CA 3Q40A 3C6QA 4LMRA 2IIQA 1MDFA 2Q7DA 4DZZA 1IJBA 3IEXA 1J9ZA 2O3JA 1H2WA 4MCAA 4EZBA 3H2GA 4TMYA 1JQ3A 3A6PC 2B36A 5GGXA 3CWCA 4I4TF 5CA0A 3W1WA 5BW8A 4RV9A 2C88A 4LYHA 1XP5A 2W00A 3PXUA 3NJ8A 4MKGA 3OZWA 5H59A 1PQPA 2BEKA 4KO2S 5JNWA 4G26A 4M88A 3TCXB 2OXTA 4PPGA 1KAGA 4WESB 3URMA 1M2NA 2GXQA 1Q21A 1LF5A 3PUKA 3ICQB 1QPZA 1QF6A 5J4LA 2JATA 4MR7B 4ROSA 5L6LB 3WRYA 4FS3A 2HX1A 1KYTA 1VLJA 2IEDA 2O2ZA 3DJFA 3H5LA 4K3VA 1EFDN 4AMVA 5C2JB 3E7WA 3NNNA 5C8YB 1VXOA 3PYMA 2UZ1B 621PA 3IPRA 5ALDA 521PA 5IJ0A 2Q6KA 2WP8J 2IZ6A 3KZXA 4OHBA 3ND9A 4RS4A 1C7RA 3CFYA 4JVSB 4AY4A 3CG4A 2CWDA 4JT8A 3BOSA 4EQ6B 2OA0A 2JGDA 2OBYA 4AG5A 1ZRSA 5CU7A 5CYOA 3ER9A 1Z08A 2BGNA 1IQPA 3D7RA 4GL2A 2O7RA 4ZVPA 2F90A 1QH9A 4JCCA 3ZXSA 4LJ4A 3ZD7A 2F8TA 2D5CA 1ADCA 5IFLA 1L8XA 1L8AA 4IVNA 1O1YA 4UPVA 2H52A 1R4ZA 1UFQA 3H1BA 3P45A 4FMDF 1PVOA 4OHFA 1MAVA 4FUTA 4LYAA 1KO5A 5JS8A 1FXSA 1QPGA 3LPLA 3I4FA 4BVKA 4EZEA 3KSBC 2GVZC 1WHTA 1Z0KA 3TUZC 3VISA 3K6SA 4QWMA 5F1YA 4XWTA 5FKJA 1VL5A 4A82A 4LC1A 4P1ZA 3A9UA 4H1TA 3WL3A 4F4HA 3WRYC 1QK5A 1Z68A 2JDID 4QU9A 3LCRA 3RC7A 3QIAA 2ZVPX 1QCDA 3LCUA 1B1CA 2XUOA 3UCEA 2GERA 3GVCA 1J0EA 1Q7GA 3OF3A 1KZYC 1MCZA 5DBHX 3ELDA 4N47A 4ND8A 1KORA 1VB3A 1H8HA 1SR8A 3K9LA 3Q88A 4HQ6A 2O1WA 1EQ2A 4EGSA 3FMVA 1ZHOA 3HB7A 3R6LA 2C4VA 2COEA 4UAGA 3U49A 5A4AA 5F77A 5DW0A 4OLHA 4B17A 2O7VA 5I5EA 2F8MA 2VSOA 1PQUA 3CIOA 2JCVA 3TLGB 5DLPA 4R9SA 2H5IA 3FFTA 3T7KA 1GWNA 1XEWY 1EG2A 1IJFA 3N2KB 3GJXC 1TCBA 1MNQA 3CUVA 3MWDB 4TSKA 4JX9A 2I2CA 3IAUA 2CXQA 5ALRA 3TRDA 4RCZA 1TIBA 3OC6A 5HJ5A 5BUSA 2XCSB 4JJIA 3DMPA 5AVSA 4S0XA 3ND5A 4Y6LA 3STWA 3EJWA 4IFIA 5HX7A 2WMNB 1QFYA 5KYXB 3PQCA 2QT1A 4B9AA 4M4SA 4HDKB 1BZYA 1COZA 5BMVF 4OQFA 2ZU6A 3RTCA 1J07A 2XGOA 3BWBA 2X14A 5FWAA 2H63A 1ODSA 2VBFA 2PT6A 4DQVA 4XQEA 1Z8DA 2FPPA 1NWHA 3L8EA 3L7BA 3IE1A 3RT9A 2I2XB 4GMFA 5G1PA 2F1KA 2ZTVA 5KDLA 3GP3A 2HNBA 2G07A 4H0CA 7REQA 4PYMA 1GA1A 4B4WA 4I6EA 5EUMA 5FTWA 4CEIA 1PR5A 3LLMA 3RVMA 3SX0A 3H1EA 3VV2A 2KSQA 2HIGA 2ZK7A 4IQ0A 1G63A 1T2EA 5TS2A 1TUGA 1ZINA 2FP4A 4NCIA 4NP6A 4I55B 5HA5A 1M6YA 4ACBA 3U5ZB 3ENVA 3F2VA 3V1KA 2C57A 2X9LA 3PHCA 4FQ8A 2NXNA 2BN4A 4R2MA 5JS2A 2GLUA 2NUBA 1GZ3A 2PIDA 3M1AA 4Q3EA 3FSGD 4LJ7A 4RCVA 4UBLA 1JX6A 5FUYA 4F6CA 1WUJS 1GG5A 3ZK8A 4GG1A 3ZNOA 5IVPA 2OD2A 3GJYA 4KQ2A 1GY8A 5B1EA 5AM2A 2IHJA 3DDCA 1OXSC 5FOQA 1TM2A 5FADA 1GAQA 3KKKA 5C53B 4OGWA 5C37A 4PIMA 3JWIA 3U48A 1XAHA 1JHMA 1K5DA 1V1RB 1FDRA 2VPTA 2O5RA 3GFGA 3MLBA 2IKQA 2VWGA 1N8TA 1W52X 1OXBB 4IO0A 2WWXA 5HBGA 1QYRA 1SEPA 1W5SA 2LCQA 3RK0A 1AHIA 2WD9A 3P4UA 3F7TA 4N0QA 1MRNA 2N46A 3E9EA 5E95A 3AESA 3DJYA 3EA5A 2PX2A 4HQLA 3TSZA 4HB0A 2MR6A 1RKUA 2P6PA 4G4IA 2BMWA 3GGGA 4PPFA 2XZLA 1PG5A 2IYRA 2PXAA 2VT6A 2GYVA 2ZWMA 4NBVA 4AJLA 1FUYB 1W0KD 4JLMA 1CZHA 4NJMA 3RUCA 3LDFA 3VNVA 2NSHA 3OUZA 2CVFA 4Y2YA 1IPFA 2R8BA 3F6BX 4B3CA 2XWBF 2JA1A 2FU5C 4OHKA 4MUJA 4HNUA 1QGZA 1EDZA 4NZNA 3KE9A 3M8KA 2F3UA 1GTRA 5EPOA 1V39A 3CRW1 1TQ4A 3ZHYA 3KSDO 4CM1A 2GCGA 2JJMA 3C85A 3GUHA 3IQXA 1R5BA 2XE7A 1XN4A 3WGGA 4I6GA 1XGKA 1WKVA 1GPKA 4G4SO 3VNAA 1V7PC 3AF0A 3MJVA 4E5KA 1YOVA 4K28A 1DKMA 2HRRA 3MERA 1XK7A 5K6RA 1DXQA 1KY3A 3U7FB 1PEDA 5BNTA 4IBOA 1T5IA 1WHSB 4C7XA 4UXJA 3ZQ4A 5BW6B 2HZBA 5C5IA 2ILTA 4PGGA 4UAUA 4C0WA 1YZKA 3L5KA 4RHYA 1XC7A 3LY5A 1QX3A 5TR9A 2EERA 4QHSA 4Q3OA 1P2UA 4UBMA 2LDBA 2NUAB 4KRXA 4QARA 1L7EA 5HR5A 5BOSB 4BLOA 4JR0A 2G6BA 3SX2A 1XROA 3ABQB 3KKMA 4JA2A 1W96A 1YWGO 5JADA 2HPHA 1L1QA 1RQRA 1ODFA 3BB1A 3M1YA 1UANA 4NECA 3UG6A 2AYYA 2D3WA 4YEDA 5HJ2A 4QC2A 1KMNA 2ZI6A 1FYDA 2FKAA 3R7WA 4Y2SA 2QVYX 4TLLB 4AN4A 2JGMA 3FTNA 1WPXA 3QVUA 4FDMA 1NDHA 3BJZA 1XZGA 2OZKA 1BYUA 2QPTA 3C6XA 1EUCA 2FOIA 8ADHA 3VV3A 3GHYA 3PQ8A 1HDRA 2V7QA 4HDSB 3O2QB 3VR3D 5FX2A 4L72A 4DNXA 3NYQA 3PXCX 4YPFA 3S99A 1YUMA 3PE6A 1JNYA 3WP1B 5JS7A 1EBUA 2XYHA 5EJ7A 2J1LA 4OOFA 5JZMA 1AS0A 1X2BA 1LTKA 1MPXA 1Q14A 3QEJA 1OBHA 3TRJA 2EW1A 2QLBA 4XPZA 3RS7A 4CQMA 1WM1A 3OOSA 2PSSA 1ZI9A 2R96A 1R0XA 1AGPA 3FUVA 1X7HA 2G40A 2P4EA 5K3EA 2JBAA 1OAAA 2OXCA 3AJAA 1W4RA 3QMVA 2R84A 3SIPA 1Q95A 2NUPB 1T8UA 1SKYB 3PFIA 2PUFA 2KE5A 3F2IA 1AHHA 3PDWA 3I28A 4MQ5A 2OCAA 1BEUB 3QMMA 3L3BA 1RMYA 3A8TA 3DLHA 2W8BA 4Z1OA 4BTVA 2HPAA 2Q3DA 1WF6A 1CUJA 3B3JA 3KXPA 1JN0A 4W8OA 3T1OA 4RIHA 4PC2A 1NUSA 2JVKA 4CKYA 4D4MA 5BPHA 4PONA 1PT9A 2XQJA 1AQYA 1BE1A 1NYQA 5IAEA 2JHGA 4O63O 5IUKC 4CW7A 4TV9F 4H7JA 4ZDIA 1DDOA 2FN3A 4J76A 4BO9A 5LJIA 3DMYA 4CKCB 3PDJA 2A35A 3OC0A 3PUHA 2XB9A 3QQPA 4M1WA 3HBMA 1SPBS 4KQKA 4O4IA 2Q7XA 4GSYA 4S0ZA 1UBSB 1BEZA 2LXNA 5HE8A 1IHUA 1X9GA 5CEJA 2CCKA 4AF6A 4JBWA 1JU9A 3SQDA 3K5IA 1X14A 4GVXA 1VECA 3ICCA 1VMIA 2H9AA 2G70A 2OPBA 1DKPA 3D7LA 2QTWB 2XA9A 4UJ5A 5BW5A 1GSIA 1I2MA 4BDTA 3H11B 1HSZA 1EA7A 5GONF 4C7BA 1YZVA 5F4ZA 4DR3B 3BT7A 2WILA 5ERXA 1XT6A 4L8YA 2CLCX 1L9XA 5ALKA 2LGJA 4XLZA 3GFBA 2J3KA 3BIOA 4JAVC 2Q1TA 3DB1A 3OPMA 4RK0A 4EF6A 4RY2A 1F2TB 5COQA 4EHFA 4FGZA 3PD1A 4LTNA 5A4MS 1B93A 4C6TA 3N5CA 3H2IA 3JZMA 2O05A 1F7VA 1B4DA 3GZTB 2V6IA 2XQVA 4REQA 5KVVA 4NXMB 3OT1B 4HQFA 2OZPA 3MF4A 4LXHA 2I3ZA 4HNTA 5LXTA 2PQMA 3FDZB 2DU8A 1RCUA 3P9CA 1SUAA 4Z2YA 4G0QA 3REFA 4HPJB 2GHTA 4F2PA 5LPNA 5CXQA 2AN1A 3MMPA 4I66A 2AKYA 4PQRA 5JAPA 5B7PA 3WMGA 2A3RA 1DLJA 2WM9B 1C4XA 3B6EA 3QZUA 4Y9DA 4CL2A 2PMCA 1PT8A 4MV6A 1FU8A 4KXFB 4ZC8A 1U8UA 2W5UA 5MDHA 1N2GA 1U02A 2OVBA 2WOJA 4EF5A 2DTDA 2FW8A 1R4NB 4ND7A 3I72A 3EDRA 3JQ8B 4ARUA 2Y1EA 4I9FA 4AJHA 3DHWC 1M1NB 4RKEA 4N01A 3DZJA 4XH9B 3HV0A 1E62A 3QKWA 1CVLA 3TNJA 3J81k 1E92A 1SIWA 3QKSA 4IR7A 4LBVA 3ILXA 4YJFB 1XMQB 3E3AA 3EW9A 1Z6PA 3PQ7A 3SFVA 1CULC 5BV2P 1M5TA 4Q1VA 4MV7A 4ZQBA 5DNEA 2DFTA 4IWNA 3RS4A 3FN4A 3TG8A 2PE5A 3VU0A 2WP0A 5AKLA 1S96A 3ITDA 4A23A 1YE8A 2XXJA 2PBLA 3E22A 1MNAA 2VR1A 3HO8A 1TJ5A 1JJIA 1T6YA 1Z4LA 2C3MA 1J2RA 3ANMA 3K6JA 3P5SA 5TPZA 4AMYA 2MR5A 3V4PB 4CODB 4JL5A 2BWJA 2YX1A 4PQYA 5TQJA 3V4LA 1XFAA 2JVJA 3CXUA 4F6RA 2H1OA 2ORYA 2ZAYA 4OB6A 1FUUA 4LF5B 4X92A 1X92A 2L42A 3NC4A 2PRZA 4ZVUA 1XZIA 1KAOA 2L0XA 3MJDA 3NOQA 3ONEA 3O0DA 3T1NA 4Z4IA 1EZ4A 3F0TA 4I1YA 4RWEA 4TS4A 3GBSA 1M0EA 3KZKA 2QRMA 4XVHA 3N8DA 5F3RA 4LE0A 4NKRA 4BP9A 1P2TA 2IA5A 3A9RA 3HZHA 4ALMA 1UK8A 4CWAA 2OORA 3D8RA 1U1CA 4KN6A 1TTQB 4JEUA 5AJHA 4BLWA 4DCTA 1EFVB 2WZQA 2JFQA 3ZEIA 1AA9A 1YZTA 4Z7JA 3L01A 1MB9A 3GA7A 3HYRA 2JKYA 3D6UA 1P29A 3WVNA 4IHJA 3MILA 2FCRA 1G6KA 2TMDA 1V7CA 4FE3A 4OG2A 2YKGA 3MT7A 3V4ZA 1XTSA 4KBFA 5AQ1A 2YHIB 2ZZNA 1T1IA 4EAQA 1VKJA 2VXYA 1U11A 1X8JA 4C43A 5EIEA 4LF8B 1AT1A 3JALB 2F1HA 2QNIA 5K8LA 4MR9B 2B1RA 4M21A 3VOBA 2Q8PA 5AUOB 3U7IA 5TXGA 2OGTA 3EZGA 4DV2B 4ADSG 2D4HA 1UPFA 2O1XA 2PZMA 4YMVA 1SQSA 1MJGM 5JC8A 2AQKA 3MNFA 2FEOA 3Q3VA 4NX2A 1C1DB 5KQPA 1I4TD 1RI3A 3G8AA 4B7UA 1TU3A 1GPBA 4RK4A 2BBTA 4LN1A 3D4PA 2YXBA 2GQ0A 4JS0A 4EO9A 1JQBA 1RBMA 1P8AA 3IBGA 2GNOA 3E9DA 1T26A 4WNCA 1KEEB 1QH8B 3GXBA 5LKAA 2E4XA 4OSPA 3MCVA 3KJFA 3T3IA 5KX5B 4MQEB 2R44A 5T6BA 1CE8B 2FMUA 5C35A 1DAOA 2OORC 2BF4A 2EHDA 4NNJA 4BQNA 2PS1A 4ZU6X 4NF2A 1T25A 1K08A 4BIIA 3MMSA 4A8HA 4ZC1A 2X5OA 4PCVA 1FUKA 3V9PA 1I01A 1LRLA 3P52A 4NHEA 2JZCA 3HY6A 4OV6B 1OFIA 8ATCA 3QVMA 1ISMA 2ADMA 2AUMA 3CF4G 4HEJA 2PM8A 4UDNA 3FVWA 4WECA 3DBLA 4AG6A 2W0MA 1LH0A 2X9NA 3WISA 3IEUA 3SC2A 4W9RA 4ZOAA 3P2YA 4ZAFA 5FD8A 2ECKA 2EFCB 2A9OA 2AFHA 4QU0A 2EKZA 4S35A 4ZGBA 2FGJA 1LFAA 1OV4A 3GNQA 5HMMA 2FDXA 5A2QA 5IDXA 3UXEA 5GIPE 1K7EB 3TR6A 2Q0HA 4XFDA 3RAEC 2FPWA 4QVGA 4TV8F 3AVWA 3AIOA 4QJBA 1RLIA 5ER9A 2BTQA 1YQDA 1QE5A 4QYMA 4O1MA 4QUDA 5CLFA 2V7UA 4PYIA 5BXQC 1LDBA 3V1LA 1QANA 2J9GA 5BP7A 3GCXA 3SM3A 4OX9B 4D9IA 1C2TA 3DAFA 1I7LA 1P1CA 4BX8A 3AFOA 3HKBB 4EO4A 3AGQA 4XUDA 4C87A 3MOSA 5I9MA 4BKOA 2DYKA 1V3QE 2JGEA 3DLPX 3PIDA 3T3EA 3W5HA 1UBKS 3D8NA 4UE3S 1KO1A 4XUCA 3PXGA 4BMNA 4YCCA 1A9RA 3AHCA 3MWGA 2PKYX 2VCYA 4J0KA 1U7HA 1GAJA 1T6XA 2XKAA 3NHSA 5JTUA 4I1PA 3KKLA 3ZTWA 1U9IA 2O1EA 2P9EA 2XQKA 3CZRA 2XDAA 4PLZA 1JFFA 2YJ3A 5IHPA 4XIJA 3WBFA 3RUAA 2W2LA 4G0NA 1U1FA 3HL4A 4H27A 1EFRA 3IOCA 5TEWA 2ZT5A 3UMSA 1IBKB 4JP1A 3C6ZA 5KSZA 4OJNA 1IHOA 5JLJA 3F1KA 4QICA 1SVWA 4QPJC 5HM6A 4O59O 2IXDA 2ZSFA 3O9VA 5CCDA 1MHTA 1B16A 4JR2A 1JZQA 4L6CA 1T9GS 4PV7A 1BA3A 4CMIB 2GWHA 1W0JD 3AEUB 3DMTA 4EDHA 1ZD1A 3FPEA 4S1VA 3VOSA 1O95D 3H5WA 4XSGA 2IXBA 4NNPA 4GRAA 5AHKA 1SBNE 5T6MA 1YO6A 5CVDA 1YKGA 2NTJA 1ECFA 3QK7A 4R9RA 3VI3B 4YLYA 2VUTA 5H7XA 1HLDA 2IGBA 2ZT8A 3IKVA 5CYGA 1E77A 3O8DA 1CUAA 4Z0HO 3WAGA 2CXHA 1PV4A 4N0EA 1I4LD 4J3FA 4FCWA 4O2AB 1W6UA 4OU5A 3ZDZB 1V3VA 4B44A 1U9IC 3RSHA 2GN0A 5KQLA 4BVBA 4PEVA 1DJQA 4B6OA 5HIJA 2I4TA 2PMFA 3HWX1 4GBGA 1QCCA 4N0MA 1HRDA 1PV2A 1S7GA 1UXOA 3TW6A 4JJGA 3ABRB 2BOVA 3KBOA 4AS3A 3NATA 4D1YA 1KK1A 5D00A 3VTAA 4L2IA 4MUBA 3UMJA 3DNMA 3UB4A 1IZ0A 1KY5A 2JJ1D 5EVJA 3NM4A 3DMTC 4NZPA 5HW0A 3JR3A 3GLGA 4KAAA 3HKDA 2IP1A 1WCYA 4Q48A 1OHHD 2Q7OE 3CRNA 3G7NA 3AYXB 3RFXA 1WBDA 1IY2A 1J33A 3SHVA 4UHFA 5DM60 1XA4A 3B1XA 1IK4A 5CLGA 1BWSA 4FOTA 5L45A 1R0SA 5TLSA 5KSPA 3ZCTA 4F86A 3R44A 2DWUA 4PIPA 3OCWA 4MV8A 1X1RA 1YR9A 2C4HA 3A4VA 3IHLA 2FFRA 4D92A 5JQGB 1N0UA 2O8EB 3ZY2A 2YQ4A 3KXKA 1DEAA 5HMLA 4IOLA 2F2TA 3IDQA 1DG1G 2YV4A 2LNDA 4WJKB 3RVPA 4KQCA 4DLVA 3ZHOA 1HI9A 3HA7A 4RKFA 1JHXA 1U2DA 2AH5A 2GS9A 4MQLA 4RS3A 4DLAA 4E6PA 1UKVY 1K7XB 2HK7A 3JQ7B 1YRAA 2C4UA 3BYZA 2I71A 3IUNA 3R3YA 3OVMA 4HN9A 4ZO4A 3ZZNA 1FJGB 1CJCA 4TYQA 4NRDA 1U81A 1WR8A 3LZDA 4JZKA 4YRJA 4L0DA 2B9EA 2P9ZA 3WMRA 1N33B 1DIHA 1K8YB 4DXAA 1PFVA 3MMZA 2XQFA 3VO1A 2G0TA 2B3DA 1K97A 3KL4A 1GADO 3W05A 2HDOA 2WYVA 4Q12A 1EXNA 1ECGA 1RBZA 2ATXA 1R5JA 3OQNA 1GNTA 3CQ9A 1GAWA 1CDZA 4MYSA 3UAYA 1COWA 1X19A 1SUWA 3H75A 2WK1A 4YRSA 1Y3HA 5FAKA 4RTOA 4J9VA 5HGXA 4GGPA 2ZIZA 2A14A 2DERA 1VSVA 2NZJA 3RVLA 4D4HA 3DV0B 2R5FA 3RBZA 3DAYA 2HLNA 2EIXA 3H1FA 2GNAA 5EVCA 4YIKA 5L4SA 1KAHA 3EA4A 1U2DC 4QOHA 3LQ1A 3GRYA 3UCXA 1XU9A 4JCOA 1LTHR 4UTRA 1X7DA 2VP9A 3O9MA 1H2XA 5B36A 2G4LA 1VCIA 1WU8A 1ZEMA 5EEGA 2MSDB 1MQ9A 1HE4A 3BREA 1E4EA 4IG9A 3WB0A 5JD3A 2GN1A 3C1OA 2BM1A 2P62A 1GPYA 2EBUA 3BZUA 4ANFA 1T91A 1H9CA 2QG4A 2FRDA 1M6WA 3K30A 2Q07A 1ZI6A 1U4SA 2VJOA 3G79A 4M9QA 2WJYA 1USKA 2CLSA 4OYLA 4X3CA 5KVQA 4AUKA 1KK3A 2Y4NA 1GITA 1YMUA 4WCDA 3ZCSA 3T9EA 3D2AA 2WI8A 1JT9A 2HSJA 1Y3IA 3I9OA 2IXFA 2H9IA 2ZDQA 1MA0A 4HJRA 4UM5A 5LBUA 3LY8A 1C9YA 2L2QA 4IUCS 3DCIA 3RTDA 4EFMA 3L06A 4HFJA 3REQA 1V7ZA 3MIIA 4EB6B 3GCDA 3JZAA 3E7DA 2P9QA 4ZEOA 3OOHA 4LZNA 2BAGA 4RACA 5FOXA 4D0NA 4GNRA 3TFQA 2FR1A 4K9QA 5CG1A 1NNEA 3KJEA 4RVGA 3JYNA 3LW8A 4ZA2A 3A4IA 3QG5A 4ND2A 2QU7A 4JASB 3FETA 4J7CA 1PJ8A 1PI3A 4UBOA 4XWGA 5DN6D 2OXFA 4XX0A 2D2IA 5ADHA 1YC2A 5L3SB 2QV7A 5J1SB 1JWBB 3DVLA 4LE2A 4NE7A 3CH4B 1DFGA 1JUDA 4ARZA 4C88A 2GHRA 1Y98A 3ZXXA 1ZOPA 2FRDC 2LUOA 4Y2TA 5EINA 3C3EA 4HD8A 1TQ6A 2IEBA 1OXMA 4NK5A 3DEAA 3TCKA 3TJRA 3UGTA 4DNQA 1OZFA 3HYSA 2W6CX 4XCVA 2CMKA 3WLJA 4JKOA 4B2LA 2P0AA 4J07A 4D6YA 3M3HA 4TS9A 1PUIA 1VE5A 1L8OA 1BCRB 1P73A 5GJCA 4Y8VA 4DAEA 2GEBA 5B58C 2HIAA 1P5JA 3OU2A 2CHUA 4K2HA 4H3SA 3JAMA 1HYQA 2RARA 3B6KA 4NTZA 1F7UA 3BL6A 2O6LA 1FS4A 4OSOA 3K0EA 4BNNA 1RQ2A 4BTLA 4F92B 1C14A 2V0NA 1QHXA 1V25A 4ZVVA 1QC5B 2C2XA 2G76A 3BXPA 3KPWA 1VSBA 2BP7B 3L02A 2C8JA 3MCTA 3MJFA 4MA5A 2ZZMA 3J80A 3NVMB 1BCSA 4OYRA 4RY8A 4XUEA 5EE9A 3WAKA 4BEWA 4TWIA 3AYZB 3SSOA 1USIA 3UOGA 3UMGA 1BS1A 1GL9B 4FIZA 4MJ3A 2QGFA 1MAUA 1MN6A 3IO5A 4EG8A 3F98A 4C14A 3ZZMA 1L6IA 1UJ4A 1VI5A 4FC6A 1Q16A 1ZIPA 3GDWA 4D02A 1HSOA 3UK0A 1C29B 2J4DA 2NLOA 1G20E 1RCTE 2JARA 3EG9A 2WJHA 1NYTA 2J46A 2NNLD 3L6UA 4YP9A 2I3GA 3DOHA 3F6YA 3D3KA 3IELA 3LFUA 4KFSA 1JEJA 1TPZA 1ZOOA 2VSQA 3LO5A 1YCFA 3FPAA 3BERA 3MCAA 1RZRD 2V98A 3UT0A 4QDKA 2FW1A 2VJPA 3MGBA 4FMCF 4EUKA 2QDKA 2HA7A 3G8DA 4R6XA 5A6SA 4PZ9A 2NU9B 2J08A 2JGDB 3FJ1A 1GTL1 3HJNA 4QU5A 5DB4A 4FW8A 1E1RD 1WE2A 3DFZA 3SX4A 2NTEA 2Q3CA 2QWXA 3HVKA 4C0BA 2J48A 5BN5A 3LXRA 4OQZA 1DC3A 1SOMA 3FRIA 1KQ3A 3IUBA 4JC8A 5IJAA 1QP7A 3LC7O 4XYGA 5IF3A 3ZD8A 1NXTA 3ZZ0A 3H3JA 1Z73A 1JKJA 3HU3A 2G63A 2R7AA 4P34A 4BMYA 3CZCA 2MIIA 4P3NA 4BO4A 2JLSA 2IYFA 3OEHD 4WOKA 3KZVA 1T4GA 1EHYA 2CXRA 2G88A 3T5CA 4DMGA 4ZZ1A 4YY3B 1MO4A 3AUJB 4FLFA 4DR1B 5KPJA 2PGNA 1QFSA 2RBKA 4QOIA 1WHTB 2HU2A 2YW2A 1W5AA 4TVKA 5EJGA 1PQWA 3HUUA 1LJ8A 2JGAA 2BJWA 3OBIA 3LPMA 5EWLB 3KAJA 1SPXA 4QT0A 4A6XA 3VYSB 4D44A 4Z1MD 2AQ8A 2NQ2C 2F3RA 4ZCPA 1Z7YA 2PUBA 1A9SA 1AZLA 1Q11A 3JWGA 4IWYA 4A7PA 1TCAA 3WL4A 4WKPA 3BB3A 4J75A 3JQAB 3RT1A 3W2FA 3K1AA 2B5OA 2DUNA 4P3OA 3H13A 2MYUA 4F45A 3T5DA 5I9LA 2YC4C 4IF4A 1D0IA 2YH2A 3CURA 5JCPA 1KOGA 1I2CA 1DKLA 1O6BA 2ODWA 1ZFNA 4KMOA 2MSLA 4CIXA 4EARA 4HVAA 4PSDA 3N2IA 3WBKA 1V43A 2C61A 3R75A 1VBFA 4W5OA 1T2AA 2HTFA 3IURA 2EV9A 2VAMA 3AUSA 2ZVDA 3GPDG 2O3UA 3B2QA 3C8HA 1ESZA 4OIFA 3C6BA 4N40A 1WXXA 3AEXA 3BA1A 3CNNA 5HZGA 1NHGA 3E27A 3OUTA 4TM7A 2WF9A 4JROA 5KWIA 4KDCA 4L27A 3IIKA 3I2HA 1H0KA 1N5IA 2ERCA 5HTKA 1AB6A 3DGEC 3MLAA 4EYKA 1XRMA 5DLQC 4POOA 3DTVD 3JVIA 3WJ1A 1AXRA 1OKKA 2Z56A 3P26A 4G8JA 4U2FA 4HLCA 1YZLA 1U5BB 1KRHA 2VYND 2FHSA 3AR6A 4G0MA 1R1DA 4X6LA 3A6ZA 2FXIA 3JV7A 3IGFA 3U7JA 3ROQA 3BWMA 3ZH9B 3ZZ1A 3KHTA 3BZBA 4INAA 1SAYA 2A86A 3HO1A 1GPLA 1L7AA 2WOOA 2FPPB 2OPHA 4JU9A 1IOWA 1PHPA 2HCTA 1DL5A 1Q0PA 1T3LA 2WSLA 2XDWA 2ZJFA 3EGXA 2GO7A 4DA7A 2B78A 4YRKA 3VVMA 2IYUA 1MQAA 1WXQA 3EVDA 4MB0A 2XF2A 2G5CA 4OYHA 4PCUA 3I6YA 5ENDA 2BDTA 3HXOA 1X7ZA 2VF7A 3DL2A 4CEIB 3BSSA 3ANTA 2Q5CA 4V0OA 3KNZA 3SF0A 3ISJA 4OLFA 4X85A 3SR4A 2EAUA 2WUEA 1HETA 2BBWA 3TZCA 5K3OA 4O1IA 2A8YA 3NR2A 3BAFA 4H2DA 2VOJA 3LBHA 3MWYW 4QFMA 5INTA 4GPD1 3S27A 4AFNA 3P20A 2FPGA 3U7QA 1Q0RA 5LKRA 1EFRD 2H2IA 1BE6A 4PNHA 3UFXA 1OSNA 1C7ZA 5FBKA 1KYYA 3H4VA 1UPCA 2HEGA 3JQDA 1U3DA 2W2KB 2ZI9A 3LUHA 3OJFA 4M55A 4OY3A 3I05A 4QDJA 5G1OA 1QX4A 4C7OA 4P0PB 4TZ6A 4HEQA 5HZMA 4NFSA 4BVHA 2IHKA 2P91A 4TUYA 2Q2OA 1F0NA 1V3TA 3C74A 2D2EA 5KNBH 2QAIA 2QN8A 3GUZA 3MSXA 4KOAA 1EZZA 3KKZA 4D0GA 1T3GA 4BAZA 3GCGA 2A78A 3CTPA 3GT0A 2XSZD 4NQRA 4KAJA 4V0ME 2JHCA 1XL1A 2HU8A 5H81A 3RODA 3QHAA 3ELWA 4TQAA 1Y5RA 3TMKA 1FUIA 4FHCA 4N5LA 4L1KA 2I8AA 3R0XA 5IJWA 1W4LA 5E1DA 1RYDA 1UIRA 1JBEA 5ERGB 1IBRA 4U02A 2H00A 3Q9LA 1DJMA 2X9GA 3EHEA 5TGDA 2FEKA 1TFUA 4YJDA 3WICA 2X40A 4P4NA 1PTKA 4FTWA 1C30A 3ZWXA 3KE8A 1EVLA 3DA8A 2C7PA 2B5VA 1BQ3A 3IOEA 4L9RA 2AJTA 2GZAA 2PKEA 2WJWA 2Y2UA 3WK4A 4ZHQB 1EE2A 3N6XA 1C7EA 1ZM3A 4Y6RA 3T7TA 3E4DA 1T8WA 3WB1A 2C3UA 1N9KA 1NBIA 3CPJB 2EP8A 4UXHA 2BKVA 3FKSA 2ZS8A 4Y0AA 3EW7A 4M0KA 3ZWMA 4CGYA 3TTSA 1BS9A 5E1BA 2F1JA 3WLOA 4F3NA 5MN4A 1YOVB 3KK0A 1SIBE 3F7MA 1NUPA 4YRRA 2X2FA 5JBNA 3PUIA 1A4RA 3QEBZ 3C3MA 4PTLA 3TAXA 4EA8A 5HF9A 3ZY4A 2IWRA 5A3QA 5EZYF 3DPIA 3FYUA 4X6YA 3ZE7A 3IE2A 3PK0A 4ZI5A 5CAEA 4BP8A 4KSCA 2QNRA 4OI0A 4UATA 2JJ2A 2ZFUA 5F4BA 3STXA 3SC3A 5FORA 3WFIA 1FNNA 4EYGA 3MSCA 2XCQA 4EG0A 5FV4A 1VPLA 2DT8A 4H08A 1LY1A 1GFIA 2R3SA 1M74A 3FKJA 2GHQA 1D4FA 4Q0MA 2TSYB 5KTMA 1LW7A 1KWGA 1FC0A 1T8RA 4QJ5A 2WC1A 3CT4A 3BTSA 3MJSA 2JEZA 4WLFA 5M3BA 3PPXA 1Y33E 1B8PA 4M1SA 2QD2A 3V00A 2ZSUA 3LHDA 3H2JA 3OE1A 1M2OB 3W2EA 3GARA 2V7GA 1N6RA 3CUWA 4RF2A 4YMHA 4COKA 4IOJA 1WXIA 5EMJA 2QTRA 3GFVA 3S2YA 2AG5A 3DE4X 2Z1DA 1L4UA 2E4YA 3C5WP 3PUVA 4GUAA 4AKSA 4B32A 1PQ4A 2QKYA 3LQ4A 2O0KA 3LA6A 3U56A 2O4UX 2Q9CA 4JVMA 2IEGA 1HTTA 2FB9A 3Q12A 4MWOA 5TNXA 1SCNE 1UBGA 2XYPA 2B25A 1DINA 2XF8A 4UVEA 1RRPA 1QIKA 2JLZA 3FYUC 5CM8B 1SWWA 3SJZA 4FYIA 1DAEA 1VKHA 4FFNA 4KXMA 3TX6A 2A5YB 2QN9A 1AU9A 2XUPA 3A3KA 2YYAA 3SI7A 2EKLA 3VNUA 3ZWYA 2QX7A 1ATZA 1MFZA 1QVVA 5DLYA 2QSYA 3TGWA 4WOBA 4F38A 3DDZX 2RE8A 1L2TA 3NBXX 2OCYC 4AF8A 3LUDA 1P1FA 1A96A 5DOVA 3DVRX 1JV2B 2N1MA 3PWKA 1GL3A 3HADA 1K6IA 3N8HA 3S40A 4P6VF 4C0LA 4EVRA 4WLNA 4LFBB 2BKUA 1ZU5A 4F8YA 3HSKA 3ADOA 3Q1KA 3VKGA 4B3FX 4O08A 3ONWA 4ND1A 1G2OA 4LX0A 4Z6KA 3HGQA 3PJGA 2ISQA 3R5JA 5KMGB 4YV1A 4OFWA 3LS2A 2QTMA 4WASA 4RCYA 3CHYA 3MAJA 4ZO7A 1I33A 2V6BA 4XIYA 5KC8A 1XZCA 2I7TA 3IDFA 1PJSA 2G72A 2YCBA 4D0SA 1QO0D 2IEIA 5GVSA 1J5XA 3MD0A 2H7XA 4G5XA 5CDHA 2YY5A 4PICA 1HFJA 4GOND 2HOQA 4YCMA 1YRQA 1X7WA 2J0VA 1QRDA 3UEOA 1ZISA 5KAPA 3VPAA 1E0AA 1Z12A 2NVBA 1A8QA 4PX9A 2ZKIA 5JALA 2GJ9A 2R1VB 3FRHA 5LZ9A 3HU5A 1KMCA 1G3UA 2GD2A 1YMVA 1E3MA 2WNSA 3RLIA 3HHPA 3P2JA 3X2EA 3RIYA 2QUAA 2UYCA 5KQMA 2HN9A 1RMTA 3EC2A 1C8VB 1M73E 4FI3F 4P53A 4QQ8A 2SCUA 5DASA 3RABA 3NDBB 4MA4A 4D9GA 1RXWA 3ENWA 1YJXA 1OB2A 2G09A 4J9UE 5DNYB 4R9VA 1TC1A 1UQUA 3QEKA 2O2HA 1X9IA 1FFXA 3UHPA 2F64A 4RTKA 2Z8YA 1JIUA 4HN4B 3MHPA 2HRCA 2FV8A 2G5TA 4PFQA 4REQB 1O2DA 5KO2A 2ZS7A 1CR0A 2ZP1A 3KFXA 4XARA 5JASA 4OQ4A 3WYCA 5DEOA 4IDBA 4JWKA 1TM3E 1GQ2A 4QFBA 4QYIA 5I7WA 3EEFA 2KWIA 1ADYA 1RM0A 2BBSA 4ZJPA 2FMTA 2E4UA 1H3EA 1UXKA 2NO9A 2SKCA 5AR1A 1Y8QB 3GLHB 3OKPA 4DB4A 1R4MB 2D0PB 4RIEA 4PS1A 1T29A 4LZJA 2OV2A 4LWZA 4DMCA 3T7AA 1KS2A 3GJSA 2BFBA 3BGWA 2P9FA 5B4TA 3ZWPA 5HQ3B 4JI5B 3N59A 4OA5A 4WXRA 3JZIA 2E37A 4RNDB 3E9NA 1HNNA 2GD6A 3OHMA 1M0SA 1KVTA 1WDKA 4XOIA 3WV5A 4ESVA 3PQFA 3WMFA 5A3RA 2H11A 1JIVA 1SHUX 3OFNA 5IMSA 3R9XA 3LT4A 2CDBA 2RK3A 1HE3A 4IVRA 2LKDA 4WCFB 1FLDA 3QVSA 4XGKA 2P4QA 3GRPA 3JQRA 4B6SA 1C3LA 2Y1GA 2ETXA 1C50A 3I9LA 3GQBB 3E22B 3Q6IA 4MQFB 4CU5A 4DV7B 2YJTD 1REQA 4CG3A 4KLZA 1XZJA 3WJAA 4AJEA 4B43A 2QP4A 1OR8A 2DJ5A 1FX0A 1MJFA 4K9KA 1ZC3A 2I3AA 3ZHBA 2BH2A 1G2QA 1CUZA 4B35A 5EIFA 1SOAA 3VPDA 2OHJA 1W4ZA 2PU5A 2ACEA 4RFLA 3RAJA 3JU3A 5AHRA 3VU1A 2IS4A 1EQAA 2PLWA 3SXJA 1YNSA 2O2CA 1E9RA 3CIFA 4WY2A 5B5SA 4NDNE 4EYSA 1N2ZA 2AX4A 3KR0A 4FBMA 1TAUA 3LNCA 2QRVB 4BYGA 2PX4A 1B6GA 5JH7A 3LH5A 3IMGA 5I7FA 4HDCA 3TBFA 4ZICA 2AOTA 4KOEC 4D26A 4RDIA 1T3ZA 3FHLA 4OU4A 3QFRA 3FCAA 3O2SB 2FSVA 2IOFA 4UTOA 3J81A 1P2SA 5FQOA 4BFLA 1V95A 2QVLA 5BVGA 1VJDA 4WKOA 2POQX 1EXWA 2ATEA 2HF8A 1NLUA 1ZN7A 5IKEA 5IKMA 2NZ8A 2PLFA 2QX6A 2PT7A 2O0LA 5DZSA 6CHYA 1OAKA 3C14C 2B61A 4JEMA 2XV1A 2CJWB 2ACWA 3G7SA 3HJUA 1DUVG 1LQ2A 3OZEA 1V8PA 1C7QA 1N5KA 2WM2A 3ESYA 4J3JA 4UD6A 2UUBB 1CR1A 2OEPA 3O4GA 4FMDB 2D2XA 2VRBA 3ADPA 4JT4A 3A7EA 1Q17A 2HSDA 2WB4A 4TT3A 3DFIA 2PA0A 1VG8A 3B7PA 2RHHA 4OA8A 4B74A 2R4QA 4IIYA 4FWTA 4DJ5X 3GFRA 3TTVA 3B7GA 4RMGA 2BEVB 2I4LA 4PCAA 1AC5A 2HRBA 2O2DA 3ZHXA 4RO0A 3MWEA 1C1YA 1SXHA 3EG5A 4O4LB 4X93A 4XWYA 3T4PA 1CUYA 3OJWA 3UF0A 4U7DA 2Q5EA 3ZDQA 3BCRA 2HV8A 4HUQB 4G0XA 1F2UA 4MRRA 5G0TA 4Z0PA 4DARA 4EA6A 2UZIR 2FSVC 2O9JA 3ENKA 1WCIB 3HUTA 4YAFA 2XCIA 3KU4A 3WGNA 1V8BA 4MDEA 5B6JA 3LWBA 4BKPA 2WG1A 4GH5A 4WNIA 4ER0A 4PZYA 1H4TA 1WDTA 1WO8A 2FSGA 1VOTA 1E20A 3IA2A 1VGRA 3QVJA 4HB2A 5DOZA 3TZ6A 1N7IA 1UBEA 1XDGA 1VL1A 3AUTA 4HDRB 4MHSA 4ESEA 5LJLA 3AKEA 1GNPA 2IJGX 2DCMA 4C03A 4YXWD 2QTTA 1LK7A 2JGRA 2VNSA 4DT1B 1P6UA 1DS6A 2FSIA 2C5BA 3EE6A 1KQGA 1UBCA 3RREA 5L3VA 1EUYA 1ULTA 3T7CA 3N0RA 4NPAA 1NBEA 2C3OA 2Y0DA 1F6DA 3Q0IA 4FSDA 1MVLA 5TE9A 1JXMA 4IMJB 2UVQA 1D2GA 4B6JA 4C06A 1J7KA 1J25A 1CR4A 1U7WA 4UW9A 5IHXA 5KNCA 1LV7A 4YMWA 5E4YA 2HA5A 3DYBA 5BMVB 4S2EA 1NX6A 2WIGA 4Y9SA 4M0MA 3RQSA 3GJ4A 4TN1A 1XAJA 3HB4X 3E4CA 2VBCA 4R1NA 3K2IA 3FVVA 3THWA 2ODBA 3LDUA 3EPLA 1ZN2A 4O4IF 2D1TA 4ME6A 1LWOA 1ISIA 3FYDA 4GR9A 1ZG3A 4BE4A 3N07A 3GRZA 2FJ0A 1GIAA 4MS4A 3G6WA 2WIBA 3H87A 1E60A 3ZBQA 1DFHA 1LPMA 1QHEA 2CK3D 3W2TA 1KEWA 1KDPA 5K5EA 1LS1A 2OECA 2W2PA 1W1UA 1VPVA 1F1JA 1NBMD 2EF0A 4XB2A 2X76A 4FR0A 4NATA 4AY2A 1Q3KA 2BE7A 2JIPA 5HF5A 1HPLA 2YQ5A 3BHMA 4GOKA 2OOKA 5CCEA 3RIEA 1RHMA 2EQ5A 5LUAA 1J4AA 4H6XA 4F9FA 4BMSA 3EIQA 3ZDDA 4F3CA 3TIVA 5K99A 1PJQA 4RX1A 3SOPA 5CB4A 1ZS9A 3OP4A 3L4EA 1PBTA 4IJQA 3RH0A 3G1TA 2W0SA 2JC3A 3T9BA 1E3TA 3U0VA 2REOA 5AI6A 3T95A 3CWQA 2PV7A 4NJOA 1A95A 3R6TA 4IH9A 5DO9A 2RGWA 3FAKA 1V5IA 5DM2A 5GVRA 3R7NA 5FHRA 3OZRA 3PR3A 4UVIA 4UU8A 3TWOA 1SKMA 3F6SA 2A92A 3WRVA 1GGJA 1FW8A 4FFMA 4Z3KA 1AV7A 4CFSA 4DLWA 5JD6A 2A9KA 3V7YA 3FNFA 1QK3A 3Q2OA 4LC9A 2C7VA 1BXGB 2XWPA 1KEZA 2CUKA 2WV7A 2ZYDA 3EOAI 1ETHA 2WA2A 2DCUA 2H17A 2YVUA 3B1ZA 4IGAA 3W5DA 3MC1A 2XTNA 4MTLA 1F5SA 4R2WA 1UP7A 1WEHA 3ZHSA 2ONCA 1G66A 5BV1A 2P6OA 3IHKA 1V9LA 1N9GA 1NXSA 4UAVA 4UNNA 5IULC 1XYYA 3SY8A 1VPDA 4ZT2A 4D9HA 4F4UA 5ABPA 2DHCA 2FH5B 4JJ7A 4UBKA 4JUFA 1NBME 1DLIA 3OIDA 3SZRA 3WNQA 1RS0A 1DO8A 2BMDA 3HKDB 4BNXA 5AM4A 5EFZA 4DVGA 1Z25A 2PSEA 4F71A 3GH3A 1NMXA 1A7KA 1MJHA 1W88A 3ABOB 1MTOA 2FZKA 2VK1A 3VR5H 3WMXA 4RVDA 4D4GA 3TCNA 2I2FA 3KQTA 5ICSA 4B7CA 1AO3A 3IOMA 3OICA 1NMZA 2QN1A 1K27A 1E0DA 1K66A 1VIVA 3A58B 3DXYA 4WEQA 4YWHA 2XLCA 3UBTA 2HF2A 5H02A 2JJ2D 4OHMA 3VYTB 3NPAA 4IXTA 3V46A 2YRXA 3D4IA 1LNQA 1BXKA 4BCBA 4M9CA 4A0QA 4DADA 1RWWA 4DIEA 4DYVA 1YT5A 4YDRA 4JBNA 4GPAA 1KZHA 4PS0A 4D8WA 2NZUG 4B34A 1X39A 4M0LA 2H48A 4FJ1A 2ZBVA 3N2YA 1TQDA 1SXIA 4J4BA 4RY9A 3DSRA 2VAWA 3UYKA 4EY8A 3BX1A 3E9YA 2XBUA 1YHYA 2P77A 4UQOA 3E0QA 5CJJA 1X13A 2MYTA 2ZROA 3NIDB 2WWFA 1U2ZA 1A2OA 2LP4Y 2P2DA 3L6DA 3ZWQA 7AT1A 4Q4HA 3HN2A 4PZUA 5TQ2A 1VRCA 3TZBA 4FFBB 2DFKB 2J4FA 3KDSE 5IM5A 3ZUPA 1JDBC 1JXAA 5ENZA 4E0BA 1KJIA 5FLKA 1USUA 2HQRA 3BDAA 3D31A 3LRXA 5IYZA 1E9AA 2ZSEA 4PLPA 2HNKA 3U81A 4FOPA 4B0PA 5IM4A 5F7XA 2B4AA 2QTHA 5DP2A 1CZLA 2IUUA 1YGPA 2IQ5A 1DI0A 1IUPA 4PGFA 5IK2A 2KBFA 2FR8A 1ZK0A 3DHVA 3UA3A 5T8KA 4CKBA 3KPJA 4MV1A 5LMZA 1LGYA 3KRTA 3M70A 3P0RA 2H1LA 4MUGA 3LHFA 1C1HA 3UK2A 3K0SA 1ND6A 1A5SB 1F9EA 1Q20A 2C84A 3CLVA 3MUOA 2W6OA 5CX1A 5IC4A 4EJSA 1P74A 1TJ3A 2J5RA 4L76A 3SYKA 4Q4JB 4YQFA 3FBWA 3D7SA 1XXHA 3LPAA 2JH8A 4LTMA 2C4TA 4PBSA 4G37A 4D74A 2ID8A 3IIMA 1SUBA 1DRKA 1V5WA 1FBNA 2F3TA 2UVPB 3QYPA 2WSSA 4U6SA 4DC1A 4DLLA 3GJRA 4PRYA 4UM7A 3GOQA 2FMHA 1PS0A 6ABPA 1WZNA 4E70A 2RGAA 3GHHA 4BXOB 2OLEA 1QDLB 3COZA 1LNSA 3KWJA 5L95A 2PZBA 5IF9A 2PR7A 3IVAA 4W63A 4C5BA 1OY1A 3H0EA 1Z2CA 2YYZA 4Y2GA 4NCNA 2XODA 2ZGVA 1G4AE 1SHKA 2EWWA 5FL7A 1P1KA 2G0NA 4TV9B 1RPJA 4U7PB 2UXBB 3NANA 1IM2A 2FR8C 3UW3A 4D57A 1PO7A 5T8KC 1G59A 1HQKA 3MCZA 4X84A 5E6SB 2WWHA 1SVLA 1XRSB 1O9GA 3AGPA 3T38A 3UENA 2RKBA 3FMFA 1DXHA 1W5TA 1ZXLA 5BSUA 2Y1WA 1SXQA 1ZLXA 1KY4A 4J4HA 5EJAA 1FSZA 1N3LA 3BTUA 4X1KA 4GMGA 3QEOA 4ZOCA 3E70C 4HTAA 1KKLA 4R5HA 4LJSA 1G41A 3IKLA 1WDMA 2BF7A 3NXKA 2BRUA 2YRWA 5GONB 4Y9TA 5EA2A 7GPBA 4XJXA 3FE2A 2A67A 3QBEA 4XCXA 2ZUVA 1NONA 3MMXA 3JAKA 2I1QA 4EF4A 1UT5A 3H9JA 3KJQA 2NSDA 4IJMA 3UZUA 4ARZB 1YE3A 4K26A 4CZ2A 4PWYA 1L7OA 4IYRA 3SHWA 5KDDA 5M29A 4G1EB 3LZCA 3TAHA 2D74A 3O3CA 3JATA 5CA1F 4AYWA 3AILA 4MQUA 3FLMA 4KH0A 3SEAA 3GY0A 2GSWA 2DAPA 4DJAA 3NKVA 3GPBA 1PD1A 1Q74A 2Z43A 5LDDC 4PLYA 4LPKA 4AQ7A 1T8SA 3KTAA 3JYHA 1W8DA 3DL7A 3FB4A 4R40A 1CUHA 5H70A 3A32A 3AEQB 4Y6OA 1G98A 1GFWA 4BL5A 1DRWA 4QIHA 1JEOA 5D3MA 4L8LA 4ZIRB 1TVCA 3KXIA 3MBKA 3ORQA 3Q8WA 2VRCD 4C2BA 1B6TA 3ROMA 4A1OA 821PA 2B37A 3NFYA 4OQNA 4EECA 4AKHA 3BGDA 4DQLA 2CLOB 3BF8A 4B6RA 4IQFA 1SULA 4C20A 2PUVA 1BCSB 2BRUC 3BK2A 4P82A 4YRIA 4EHKA 3U61B 4OO3A 3A3PA 3C3PA 5FPYA 5E4FA 1EWYA 4TLAA 1R5OA 4ZAXA 3N87A 1NVXQ 1X1BA 2JBWA 4FHEA 5EJMA 2Q3BA 2FW7A 2FFJA 3I52A 2YWRA 2GZRA 5E7QA 2G67A 3TE6A 1TC2A 5AKHA 1SOWA 3N3AC 4RGYA 2FXVA 2X8BA 3GWZA 4UMDA 2H3HA 3GGOA 5EXDA 2M6LA 5L3QB 4GD3Q 1NVWQ 1BGVA 1OAOA 4OH1A 1PIWA 3NYIA 3NO4A 2VTDA 2PYIA 2OAQ1 3EXFA 2V3VA 3NETA 4ZV7A 1ZU4A 2EJWA 3AHEA 3VHXB 1H42A 5JV5A 5K03A 1Z0SA 3JVEA 5KQSA 1B43A 1CUSA 3KC2A 1GTJ1 3KB8A 1ZRMA 2X7JA 3KHKA 3LF1A 3MRXA 3JQGA 3BCHA 4WT7A 5ELMA 3WZLA 4RANA 5KYYA 1IG3A 3KHSA 4KE6A 1ZM9A 2Q5JA 3NTOA 5T57A 4BFTA 4I4IA 4OH7A 2IY8A 2XYRA 3M49A 3P94A 4DW8A 1DBQA 1Z4MA 1RYYA 1UEIA 2I7XA 3IO3A 3RVQA 4EH1A 3PJRA 1CETA 2EP7A 1I6KA 3GGPA 5JWHA 1FRQA 5GZ6A 1QNLA 5HFJA 3I9NA 3ZE8A 3AEZA 3HEMA 4JYCA 5AW0A 1DDIA 2CXTA 2WAOA 3L1HA 1V8OA 2WAAA 1OI7A 1B0ZA 5LOVF 1ISRA 4BGVA 1KE2A 4CLHA 1UL1X 1A9PA 2XR1A 4HMPA 3U4CA 1GLGA 1FFGA 3H4TA 1Y4UA 1QKKA 2J59A 1SD5A 3CUUA 5IANA 5KCZA 1BKSB 1AQNA 5IPFA 1OAOC 3K32A 3D6HA 4A91A 4BE9A 1TCUA 5ESXA 5C7YA 3UT5A 2VG8A 1IN8A 2BM0A 4TT3D 3WWEA 5LMNB 4JELA 4Q7QA 1Y8RA 2DMRA 4I2VA 3K16A 4M9XA 1Z5NA 4IV8A 5EY5B 4EELA 3TFOA 3GVXA 5ETJA 1TECE 5HJEA 1P45A 1JEYA 3NOOA 3VU3A 1G2IA 4BVJA 2ET6A 5ECYA 3O83A 4H1HA 2P9GA 1W5EA 3PKJA 1KI6A 3L0OA 3RTGA 4E22A 5KYUB 3UAXA 1OH8A 3CUEF 1DO0A 4DCGA 1MX3A 3OMWA 4DZRA 2LBPA 2X0DA 4UCXA 2JFYA 3FDJA 1L5HB 1ECCA 3A9CA 3VKFA 4ZCMA 4C0JA 3LJKA 4HNGA 1UMCB 2JEYA 1AK9A 2P0YA 3IEKA 1D9ZA 3P2OA 5CYPA 4US2R 1A50B 1N0WA 4BU1A 2IL1A 4Y6QA 5D5QA 2EX4A 3GIWA 1QONA 2G8NA 5C8VA 2FWJA 1II0A 2GPYA 2P35A 9ATCA 4KWHA 1SXJD 2GPAA 3A27A 3C24A 1D2HA 2VDQB 2LIPA 2WYHA 1DAGA 1GTMA 4KI0A 1N0VC 4P22A 2QX9A 5FB3A 1A3CA 5K4AA 1UKZA 4CMEA 4RVNA 1YJ5A 2IEAA 4WZBB 4EKIA 1J99A 3MIZA 5FLXA 1T1RA 1JVNA 4W1RA 3KO8A 1G291 3HJFA 3QI7A 2XMRA 4TMTA 3FNHA 3HSYA 3Q41A 1QIDA 3VPBA 2DUMA 2KW5A 4S1PA 4N6OA 2YIDA 3LYLA 3BBLA 4CIAA 4Q9DA 1AO0A 3PFHA 4KXVA 4YYEA 3PNVA 5AVTA 4MUIA 5AP9A 5HOQA 2YWXA 3OD1A 3VKUA 3P0IA 2XIQA 3G59A 3QOYA 1YVDA 4KSYA 1M8KA 4QBGB 3CXRA 5IJZA 1R6XA 2HQBA 2NU8A 1AKEA 1FUEA 4M8KA 1GAXA 1X1DA 1OC2A 4YJ3F 3QF4A 2HJVA 1OROA 4UNIA 4IS3A 4F04A 3RSCA 3U7QB 4UBIA 1U7ZA 1JKIA 4O3MA 3C8DA 4DVJA 3P2KA 1JFVA 3H5IA 3QV1A 4J0DA 5TARA 3TQIA 1Y37A 4DLKA 3G2NA 1F8UA 1GZHB 2O5VA 2PMDA 3KPVA 4O4JF 3UN1A 3GUUA 1Y9JA 3O4JA 3GRVA 3I3OA 3PD0A 4KV9A 1X3SA 1SXJE 1PTJA 3CN7A 4R6WA 1DHRA 3K72B 2IP4A 4EP1A 2GM3A 2PFKA 2OLJA 1I9CA 4OKIA 4RPJA 5AW3A 5TMEA 2EARA 2IYLD 2EDCA 3R0QA 1N0IA 3IP7A 5IVDA 3OT5A 3B82A 1KOLA 2YHAA 1QYXA 1EP1B 2E4AA 2B8NA 3RF6A 1T34A 4RYLA 5LR6A 4U6QA 2B6NA 2A9FA 5DFAA 3OJCA 3IR5A 1UBHS 1ANKA 1P6XA 2FZ4A 2ROQA 2I54A 4GM1A 3L8ZA 1G55A 2Q4RA 3R23A 5EESA 5EWJB 3PDHA 4WZ6A 3KOZA 4F5EA 3PGLA 3TEJA 3AZQA 4DM3A 5BQOA 1Y63A 2YJ4A 4QDXA 1RHRA 1ZXBA 2RD2A 2CNWD 3K3PA 2JF0A 2BFEB 1PGPA 3HCRA 3ZX4A 4KLCA 1YBMA 3JRNA 4MUHA 4FYHA 2C5GA 3ECAA 2PX5A 4MGEA 5JXHA 4WK2B 2J7KA 4OB8A 4Q21A 2JIBA 2IIVA 4G0YA 4NPHA 1P0PA 3KXDA 4OQQA 2VP6A 1T0BA 1DARA 2YJ5A 4IDFA 3T52A 5K7SA 4J0GA 3B9PA 4RTQA 1KY2A 1FJXA 1ZJ5A 4MO2A 1PTJC 5BR7A 3PCTA 2BFMA 1Z7BA