1QG4A

Canine gdp-ran f72y mutant
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
b'EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKYGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RAN)
publication title Engineered mutants in the switch II loop of Ran define the contribution made by key residues to the interaction with nuclear transport factor 2 (NTF2) and the role of this interaction in nuclear protein import.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Gtpase
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qg4A00
4RZ3A 2O8FB 1W4AA 2VF7A 2PZGA 1XB2A 5E3HA 4GRAA 4TMZA 3OEHA 5FOXA 4LJ6A 4OK5A 3ZH9B 2B21A 2J9RA 2GJ8A 5JS7A 2CHVA 2D06A 2WJGA 1TTTA 1T4GA 4P3YA 3TR5A 3BAFA 4WZBE 5D3MA 1QHYA 3UWOA 2FX3A 1U0HC 4CW7A 4Q4HA 2FPMA 1HE8B 1E0KA 2QROA 3K0EA 3CRMA 2ZXUA 2GESA 1A7JA 2Z43A 1CJTC 3IIJA 2QAGC 1E2NA 3RDPA 3AVTA 2BCJQ 3UMRA 4UJ3A 1W48A 4HLDA 1P72A 1E3MA 2QP3A 4BFYA 1E9AA 4Z8XA 2P5SA 2BKUA 2ZS9A 3HPRA 1K5DA 4V0NA 1GDDA 2CHQA 2PZFA 2QGZA 3VKGA 1NG9A 1JPNA 1EX6A 2RCNA 3ZZ0A 1AM4D 3QF7A 3VQTA 1T91A 2ZQ5A 3R20A 2R62A 4ZKEA 3SYNA 1NY6A 4B73A 4C0KA 1VKJA 2DWOA 4U02A 2ZE7A 5TARA 4N3NA 3ND8A 1KZGB 2QEQA 2C9CA 1TQ6A 1KYIA 1L2TA 2KBEA 4HAVA 4QGGA 4RSGA 5FPTA 5B2ZA 4HEJA 1M2OB 3SI7A 3ZVNA 1KO5A 4LYFA 2RHDA 5EE3A 1R5NA 1U0JA 3IKJA 4D0GA 1KY3A 4D4LA 1N0WA 3A1UA 4IW3B 4KFSA 4E5UA 1KDOA 5JBQA 2PX3A 3DOEA 4FIDA 2DCUA 2HCBA 2N1BA 3LA6A 1WA5A 4TN1A 1VG9B 2OXRA 2IS1A 1UBEA 3LX5A 2A5GA 4EPVA 3AB3A 4K46A 1XD9A 4HAYA 1F5NA 3NIBA 4CEIB 1GKUB 1XX6A 4Q4AA 2P0EA 3Q7PA 2BMDA 4O25A 1P6XA 4ARZB 2J7PA 2F7SA 4TLAA 3U3RA 3K0AB 4GP7A 5HE8A 1S8FA 5FBQB 4PX9A 4TMTA 4XOIA 2IYYA 3O8RA 4AG5A 1J7KA 4M21A 4A92A 3U61B 5JEDA 1Q3HA 3HU2A 1MO3A 1RFLA 1GNPA 1XXHB 1LNZA 3U44A 3GLHB 5CM9C 2J0QA 1U98A 1GL6A 2QE7D 5AWFC 4PC1A 4XJXA 3S1AA 3MJRA 2B7BA 5AUNB 1IXSB 2WOJA 3CUEF 3HDTA 1DOAA 5SZJA 1Z28A 4PR0A 4GT1A 4H9GA 4TLBA 4C7OB 2O0KA 2BKEA 1R0ZA 2BMJA 2QSYA 4JKIA 3HPQA 3U60B 3QPUA 4DVGA 4PQFA 5CJ2A 1RRPA 4GSYA 4PPGA 3QOFA 4JL5A 2V55B 2C9OA 4QHSA 1WE2A 5FOWA 2GCOA 4UKDA 3W6NA 2VSXA 1AKYA 1QVAA 4BECA 4NL4H 1NBMA 3E5HA 1SXJE 1ZMXA 3JZMA 5EUQB 3WBJA 4A0GA 3PCRB 2GJSA 1SHZA 4LHZA 5IRCD 3P26A 3C8UA 1DAEA 2GAAA 3SHFA 2RKOA 4TT3A 1GFIA 5J40A 1KNXA 3WMGA 1YR6A 1XNJA 3AF2A 4M9XA 4LC0A 1KMHB 3CIOA 2QM7A 3RC8A 3BB1A 1S9HA 1P9WA 3NEJA 4JLJA 2EYUA 2FGKA 2GCPA 1JR3A 1E1RA 3B1ZA 2YZ2A 3O8DA 3KKNA 3RNLA 5BXQC 3BS4A 5F9HA 4ZCIA 2P2LA 1VYTA 3SEAA 4B75A 2ZI4A 4G1UC 3MWKA 3SDZA 2RGAA 1KJZA 3MD0A 5E95A 1I2DA 4ASUA 3AVUA 4NCHA 4I1SA 2HT6A 1IJFA 1IXRC 2X2FA 4HB4A 3K09C 3LV8A 3RYTC 2AWNA 1W0KA 3TSWA 2PX0A 1N5IA 2YOGA 3O8BA 2FV8A 4E22A 4HB0A 4JLNA 1OH7A 2FFBA 1RC8A 1E32A 1MRNA 1TEVA 3EIEA 4HLCA 3PEUA 1HA3A 1FP7A 3DMNA 2RGGA 2ZRIA 1FMLA 2R8RA 2ZREA 4TMXA 4MQBA 1CJKC 1HTWA 1OXVA 1XWIA 3AKEA 1NMZA 1U9IC 3N70A 4HLUA 4ILEA 1UAAA 4Z1MA 2IF0A 3TW4A 1BYIA 3TVDA 4OJKA 1UBCA 2BC9A 4LBVA 5DLQC 4GDFA 2GJKA 3TH5A 5KDLA 3ZS9A 3WBKA 2ZJ5A 3SBEA 4Q1AA 4RD3A 1W0JA 2ZRPA 3T1QA 3C14C 4LJ9A 5KYKA 1H65A 4S2EA 1UBGA 1W47A 4OKSA 4EQ6B 2NO7A 4ZIRA 3KXLA 1R8SA 4B3CA 3W8RA 4XVUA 2PCJA 1UF9A 2GXSA 2IL1A 1KSGA 3TRFA 5J4HA 5L3QB 3U6BA 1OH6A 3EZ9A 2JA1A 1IBRA 4QXAA 2HT1A 1N0UA 4WIAA 5FUYA 1KI6B 3PUXA 4O2RA 1FNNA 3RVBA 4DEXA 2ZSFA 2O8BB 1DARA 1YRAA 2CBZA 3NBFA 3CPEA 1W5TA 3BFVA 1CR4A 3I62A 2DPXA 1E2MA 3CH5A 3LFUA 4X8MA 4FCWA 1UPTA 1AS2A 3I1FA 1Z0JA 4LCBA 1C1YA 1GVNB 5JLJA 1ZM4A 2W2XA 3NWJA 3Q85A 3SOPA 3EX7C 1R5OA 3OZXA 2ZSDA 4EJSA 4QM6A 2JLUA 1O3YA 2B7CA 2ZRFA 2J46A 4EPTA 5SZKB 4JZKA 4DLYA 1Z29A 421PA 1N25A 4I4LA 4O3MA 2C95A 4YXWD 1M7HA 3DOFA 2YWEA 4BRWA 2OG2A 2FDCA 3AVOA 4A36A 2NQ2C 2XTMA 3GJ8A 4R2IA 2QAGB 3G82C 4LJ4A 1G1MA 2GBLA 4AIIA 1Z22A 1NKSA 4NZYA 4R7ZA 3U7EB 3CWZA 1KIMA 1FOEB 3V4FA 4JLBA 3RS5A 2D3WA 2HEIA 5BW8A 2F55A 1EWQA 2GZDA 5KTYA 4CRWB 1PVOA 1KO1A 2IUTA 3L0SA 4LZZA 1GIAA 5D3QA 3TBKA 5L3RA 1G8GA 4Q7JB 3ZS8A 1Z6AA 4RD4A 2BJWA 4CIDA 4Q7LA 3FFAA 1EG7A 3SJBA 2H18A 3QKRB 1FMJA 4HDCA 1D2MA 4URVR 4LYAA 2AHOA 2D2FA 3A4LA 1P9NA 1CJVC 2OZEA 3Q3JB 5JFGA 1I4TD 2BM0A 1Z3IX 5KNDA 3IDQA 4P0TA 1WBBA 3C41J 5FOUA 2P6RA 3QKTA 2H5EA 3WHKA 3GJ6A 1DAHA 2G83A 4TYNA 5TB5A 2V54A 3QXSA 2V4ZA 2UZIR 3U3JA 3KL4A 1AKEA 1S2MA 3MWYW 3RAPR 3LQQA 1AQYA 4NKRA 3QEJA 4C30A 4NPHA 3I8SA 1G41A 1BO6A 4EPRA 2PT7A 2QBYA 2JLYA 4OI4A 4D80A 4PHTA 3E1SA 1IN4A 1XEWY 3DZDA 3QG1A 5J47A 2ANBA 2ZM5A 3AF3A 1P3JA 3CNLA 1LS1A 4XD7D 1DAFA 2JDID 1CIPA 1OPXA 3G5UA 1W5SA 3E2IA 2QMEA 3MFYA 4WZAE 1G20E 3ZYCA 1Q1BA 1MV5A 4PAQA 4GPTA 5KHOC 4US2R 2K5UA 1XTKA 3EWAA 2VBCA 4ABYA 3FMFA 5DSZA 2OFXA 3W8NA 2A5JA 3M1IA 3QQ5A 4XTRA 2XOKD 3BJIC 2XXAA 3CF2A 3VMFA 4CEHB 1E9DA 1FPMA 5GJCA 2YC4C 1CRPA 1A2KC 2IYXA 4D4KA 3SE0A 1F2UB 2W6ID 4UJ5A 4OI0A 5JSZB 3LBHA 1QHIA 3VX4A 1PUJA 3J81k 3FMPB 3DKVA 2G0TA 3CNOA 5FBWB 4IDHA 2B92A 4K81B 1N6IA 1R10A 2WJHA 4HUQA 5CITA 5HPYB 4TMWA 3ZGXA 1OB5A 1NRJB 3EA5A 3NKVA 2IYRA 5C4GB 4DDVA 2D2EA 1EFTA 1M6NA 1Q1QA 2VQSA 3WP1B 1H8ED 5JRZA 3W6OA 3X2SA 2FN4A 4BLRA 4EIWA 1XPUA 2H57A 5FR2A 4EPWA 1XEXB 4PFSA 4R98A 3TKLA 4DJTA 4CT4B 3MUFA 2ZUCA 2AFIE 4UXHA 3AM1A 5EQTA 5AR1A 2CCJA 2F3TA 1NP6A 5DI9A 1KKLA 2JLRA 1AN0A 5TXGA 1GM5A 1T8TA 1JJ7A 1QHHB 1Q44A 1VYUA 3BC1A 4IFBA 2QM8A 3BH6A 3NBZC 1JNYA 2F1IA 2PL3A 3KJHA 3TJZA 2R6DA 2FE4A 1KGDA 1Y3AA 2FOLA 1XPOA 4Q48A 1VIYA 2XJ9A 1UKYA 4JJKA 1E69A 3VX3A 1X86B 4ERNA 5JWHA 4U7DA 3CONA 1Z47A 1CP2A 3QXHA 4DDTA 1XMJA 4RVCA 1LW7A 4PXAA 3GLGE 2F9LA 2HUPA 1HE1C 1O87A 4FCTA 1T5IA 3HR7A 4W9MC 3U4QA 4LDJA 4URYR 2QSZA 1QBKC 1OH5A 1G5PA 2V6IA 3W34A 2O8FA 1TPZA 2GEDA 4L4UA 3EC2A 3NEYA 4ZV4A 4EFNA 2W6JD 3U3KA 1G3IA 1T9HA 2QTHA 1IY0A 1BH2A 1X1RA 4JVNA 5EP1A 2VL7A 5TMPA 1T3SA 2FPLA 2GK7A 3QBVA 4JYCA 3NG1A 5BN4A 4R9UC 3AKDA 4OQLA 1NNEA 4AK9A 4B6EA 1P7CA 2EFGA 2ZI6A 3K53A 5A4JA 2WZQA 1OLOA 2DHRA 4Q1DA 3CPHA 1OYWA 4KV9A 1ZNXA 3AV0B 2J1LA 1ZUIA 4LY6A 2OAP1 5DGXA 4ASUD 2ATVA 3BFXA 2QT1A 1US8B 4DB2A 2HJVA 3KB1A 1LTQA 3CWQA 2QE7A 1J90A 3NXSA 2XX3A 3AUYA 4C4PA 2FFAA 5TVKA 1XTIA 2A30A 3IIKA 4JBXA 3QXCA 4QNRA 5AUOB 5CYOA 2GXQA 2WV9A 5G3ZA 5H70A 2N42A 2V1XA 4E03A 1W44A 2KB0A 5EP2A 4EFLA 3HJNA 3GPLA 2ZI5A 3LWNA 5L8VA 3QVVA 2ZU0C 2FFQA 4M9ZA 3BK7A 2CNWD 2PLRA 4IEIA 4C0JA 5TDHA 3LW8A 4LYHA 2GKSA 3OF5A 1ZRHA 4NHOA 4FCVA 2O8EB 1N6OA 2IYVA 4NH0A 1U0LA 4UXJA 1F48A 1KSJA 2FPKA 1SZPA 3EG5A 1S1CA 1AS0A 3B1YA 2ZANA 1TX4B 5AJWA 1E2FA 3JVVA 5FPSA 1Q0UA 4IVRA 1NN3A 1Z6XA 4MITA 1G19A 2JLZA 4B3GA 1AGPA 4JJZA 2JLQA 2JCSA 5JJLA 5LDDC 2ONKA 1NLZA 3CZPA 1OH8A 4DZZA 1CTQA 3UK6A 4QNMA 4CEIA 1KI8A 1D2NA 1NVXQ 2Q3MA 1PUIA 4ARZA 3PEVA 4U5XA 4PC3A 1NIJA 3K0AA 1JJVA 1ZCBA 1V5WA 1JQLB 4HYYA 1N6RA 1UADA 2XNDA 4LHVA 1D9XA 1SKYB 1IN8A 4MGIR 2IK8A 2O5VA 1ZC3A 1P60A 4NE2A 1XXHA 4MYCA 4DLTA 5AK0A 5FR1A 3GLHA 3Q5DA 4TL6A 4ZDWA 4V03A 1GL9B 3GEIA 4JVMA 2VP4A 3ZVRA 2RGNC 2V8OA 3EZFA 1Z6TA 3NDBB 4M9SA 2VYFA 1GTVA 3CPJB 1E98A 1U8YA 2UZ3A 4KBGA 4C7OA 3I8XA 2AK2A 4PZYA 5HE9A 1UDWA 3AGQA 3H1TA 1OXUA 3ICQB 5G53C 3K0CC 1ONBA 3OFND 3ZLJA 1Z08A 2NIPA 4US0R 4LRWA 2ZI7A 1AZSC 4F4CA 2XXAB 3DL0A 3NHAA 1D6JA 1JXMA 3KJIA 5E4FA 2EYQA 4E09A 2OCAA 5GJWC 4KSCA 1N5KA 1GZSA 2XSZD 1MO4A 1F3OA 1S9DA 3B6EA 1QF9A 4O0MA 5C1BA 5L3SB 3FYHA 5H1YA 1W4RA 4PTLA 4TQUS 5F98A 1EFCA 2BJVA 3TR0A 3IEVA 1P75A 1CJMA 2J59A 5JJIA 1KMHA 3LD9A 3FOZA 2QRNA 4ON9A 4BUJA 2V6JA 3RS7A 4JT4A 3ADCA 1CS4C 3FHTA 5JJKA 4MRNA 2ZJ8A 1KMQA 4RD2A 1NF3A 3FTQA 1QRAA 3LX8A 1VCNA 1Z2AA 4RFSB 4MRVA 1P5ZB 1BS1A 2FSFA 2CL6X 1ZJ6A 5CIWA 2YYZA 1TF5A 1XJQA 1NVWQ 2A9KA 2IEYA 3DHWC 521PA 1SGWA 1ZM3A 2WWWA 2TMKA 4PC6A 1DAGA 5FPHA 5K8TA 2WPDA 3AVWA 3HP1A 3QVUA 1Q12A 3R8FA 1XPRA 4YXWA 1E1QD 3VNUA 4DC9A 3CRVA 2PJZA 3GEEA 1FQKA 1Q22A 1WB9A 4YMSA 5IDVA 2WKRA 3BBPA 2YNMA 3GJ7A 1Z63A 3AUXA 1ODFA 5JCZA 4LPSA 4Y0VA 2ZRJA 2AX4A 4P4SB 3ZIAD 2HV8A 5K8UA 4X8HA 1UKEA 1ZU4A 4G5RA 4RCYA 1AJEA 1U8AA 3MMPA 2V7QD 2OBNA 3A1SA 4EQ6A 4AWXA 1W2GA 1BKDR 5FBLB 4DEYA 1B23P 1R7RA 3PXGA 1WP9A 2OFOA 4M1TA 1N6PA 1X8JA 4LV6A 5CLQA 4DIEA 5L3QA 3IQWA 3T5DA 2G6BA 2QTFA 1KK0A 4H1UA 5EE9A 5JCPA 4MKFA 2QPAA 2PH1A 4V0LA 1KAGA 3LO5A 3TW8B 1KI6A 3SJZA 5DYGA 4BFZA 4KFTA 5EUMA 3KUDA 1M8PA 3AF4A 1S4QA 3C16C 3PITA 3SJAA 2O8BA 4QGFA 1E2PA 2ZPTX 3FHCB 3MLEA 4NCJA 4M0LA 4AD8A 5KSYA 1KK3A 1XCMA 5FTJA 1HT1E 4M8NE 4KFUA 2W83A 1G7CA 4OHWA 3ASZA 4OBEA 3TSOA 1CEEA 3IPXA 2F6RA 4DLUA 2DWPA 3I72A 1U90A 1EFRD 4AY2A 5AJZA 2ZRBA 3ZD6A 3REFA 2OAQ1 4D25A 4UXIA 1LY1A 2AN9A 2GHIA 2W58A 4I81A 2JJ8A 1ESMA 2BM1A 3IQXA 4MRSA 4XD7A 2HYDA 2JDIA 3GEHA 1E2KA 3L8YA 4DLWA 4A0HA 2NO6A 1OIXA 1JR6A 4UNPA 3C4JA 5DI3B 2FA9A 5F2EA 2QAGA 1E2EA 3B2EA 4D26A 2Z6VA 5L3VA 1W36C 1GAJA 2GVZC 2R9VA 2VO1A 3AVXA 1P2VA 1ZD9A 2KI5A 1E4YA 2YOFA 1RJ9B 4OJQA 2XOKA 3R7WB 4A8JC 2QQEA 1RKBA 1GOTA 3KJEA 2DB3A 2ZU6A 1OYYA 1HEIA 1YKSA 2H16A 2D7CA 3QKRA 2W6IA 4A6XA 5CDFA 2ZI9A 3CX7A 1L4UA 1DELA 1NSFA 3PEWA 4GL2A 2FSHA 2XZPA 5FOSA 5CB8A 3ZD7A 2ATXA 2BEKA 5FTNA 4YMTA 5HCIA 1ZVQA 4BFXA 3RSOA 4HSEA 2JATA 3DPUA 2ZITA 5DN6D 2G0NA 4LJ8A 4WXPA 3RSLA 1GRNA 1JAIA 1H8EA 2OCYC 3EARA 4NYMR 1DBSA 4OQXA 2NZ8A 2IYQA 1J2JA 2QU8A 1G6OA 1NJFA 1E4VA 4Q4LA 4LX0A 1XRJA 4B34A 1CU1A 2DFNA 3T1OA 4XVRA 4ZKDA 3LBNA 1WRBA 2O8DB 3B85A 4GP6A 4V0MA 1X6VA 1L8QA 2OBLA 2OLKA 2YV5A 3DO6A 3GFPA 5ANRB 3GLIB 1NY5A 4CEJB 5E7IA 2O0JA 2WJIA 1QZXA 3BB3A 3TGPA 3WNCA 1IJEA 1E9FA 1DO2A 3QKSB 1CXZA 1G21E 1G291 3CX6A 3IEUA 4PQYA 1QHXA 1OV4A 3B1XA 3AVYA 2I1VB 2NO0A 1CR1A 3A8TA 3UG7A 4BLQA 1A1VA 4QJ4A 3GLFE 1Q1EA 1CKEA 1DG1G 2ERYA 4Q7MB 1CULC 3VHXA 4A0FA 2W00A 1T0JB 1PZNA 4D4JA 4DSUA 1Z0AA 4CEHA 2OE2A 3W9YA 2JJ2A 5JMTA 1SVSA 2W6JA 3GD7A 1F2UA 4HUTA 5JECA 2AXNA 4LJ7A 5JSZA 4N0EA 5KOYA 5CJPA 1F6BA 1GRRA 3BWDD 3BB4A 4ZCMA 2ANCA 4HI0E 2WWGA 4ESHA 1MKYA 3NC1C 1NMYA 5HTKA 2XEXA 4RY2A 1E9RA 3CF0A 1KKMA 3HU3A 2XNDD 4M9QA 4PHHA 4PQRA 5DE3A 3M4YA 4A15A 3KB2A 2X77A 1COWD 1H8HD 3FB4A 3AKYA 3OEED 3AF1A 4BFUA 4B6FA 3LLUA 2G1JA 4F4IA 4F92B 2LKCA 1LV7A 3UWKA 2OLJA 5FUXA 3DMDA 1XEXA 1T3HA 5IT5A 4DB4A 5GADl 2BOVA 1E9EA 2JGNA 4YMVA 4LHYA 2H8KA 4M1SA 5B64A 2ODNA 4Q9LA 1C9KA 4QHYA 4GMXA 1QHHA 1VG0B 3WP0A 2ZR9A 2WKPA 4V02A 4JLPA 3KKMA 4LSGA 3D6TB 4C0LA 2C99A 4BGDA 2GEUA 4FN5A 1EFHA 1G3MA 2VHJA 5KPDA 2ZYUX 3P32A 1DAMA 4Q66C 4Q9KA 1RIFA 5CK4A 3OIUA 4A2PA 4MYTA 4M22A 2CNWA 2ZROA 3CR7A 1S3GA 5GVSA 3VKHA 1G3UA 1RVDA 2J5XA 3K09A 1L4YA 2EFCB 2F1HA 2HJGA 2I3BA 1U81A 3NTUA 2ODEA 3NBYC 4M1YA 4EPYA 5F3WB 5DHAA 1LFDB 3HR8A 1FW6A 5AJVB 3KJGA 1T6NA 2WTUA 2BDTA 1ZIOA 4HDOB 1AA9A 4WBSA 5G3YA 3N2EA 1ZCAA 2O0HA 2VRWA 1E6CA 2VSOA 4GOKA 4PSKA 2H1LA 5UKDA 2GZAA 4KODA 4LV8B 1PV4A 3U3MA 4AI6A 1G8HA 1GL7A 1U9IA 2CE2X 2YWGA 4JMPA 4M1KA 1KZ7B 1OFUX 1XXHE 4Q1EA 2VP6A 4KXFB 3I5XA 3QE0A 4RD0A 4I1OA 4LJAA 1XZQA 4Q19A 3EASA 1FTNA 2NOAA 1KY2A 4QJ5A 3K0SA 4IXMA 2QMOA 1ZUNB 4LBZA 1PLJA 1IHUA 1EWRA 1JPJA 4NONA 2G3YA 1NLFA 2OILA 2PEZA 2VP9A 5FUWA 3ND9A 1TQDA 1ZD1A 3TVTA 2OXCA 4EUNA 3RWOA 4KITB 5EP3A 1G9XA 1US8A 5HZHA 2CJWB 3A4NA 4P4TA 4YQFA 3JZAA 2R6GA 2OO7A 3TIFA 1P73A 1ZM7A 3KFXA 5H68A 4EPXA 2IC5A 2WPDD 1U2RA 3B7GA 2GCNA 2OHFA 5KNCA 1E0JA 1E2JA 2A5DA 1E2HA 2PMKA 1U99A 4URWR 4YC7A 2HDNB 4B32A 4D81A 1BOFA 2NTYC 4FXPA 1CJUC 4V0OA 3O8CA 2XAUA 2ZRKA 4IDPA 1RE0A 1XMVA 1AIPA 5IK2D 2OFWA 3ZJYA 2JLSA 3OFNA 5J5CA 1GSIA 3ZDQA 5FI0B 2DFTA 2GEVA 2XITA 5BQ5A 5FI1B 1IONA 5DNYB 2RGDA 4B48A 3OAAD 4ZDKA 1V43A 4TLEA 1II0A 3QENA 3SHWA 4R71A 8OHMA 5KSPA 5JI2E 1C4OA 4HZIA 2AXPA 3B9QA 4FWTA 3GJ3A 4KJZA 2KJQA 1EK0A 4F4JA 2GK6A 2XSZA 4NBSA 4OQMA 2EW1A 3K0FB 3ICEA 3VNVA 4URUR 4MGYR 3TQCA 1AS3A 4F91B 2IEZA 4YDHB 4BWYA 3LRPA 4EAQA 3TAHA 1ZP6A 4JLMA 3MWLA 1W7AA 1UM8A 1W36B 3QPWA 3EZ2A 2RH5A 5FPYA 2P5TB 2WVJA 4EKDA 4QG7A 2QT0A 3SS8A 3K70C 4CF7A 1Y63A 4A8JB 2Q9CA 2IWHA 1YVDA 1GILA 4KLZA 1RPZA 1IN7A 1YZNA 4DWJA 4NP6A 3KQHA 3PUVA 1KDTA 2MSDB 1UKVY 2QPTA 3MRSA 4TL8A 3SU8A 3GLGB 4EFMA 1IM2A 3VR6A 3P27A 1I2MA 5HKKD 1K8RA 5FL3A 3T35A 5HZKA 4NYJR 4R2HA 1FL9A 1YU9A 3L82B 3BERA 3UMSA 1E1QA 4OI2A 5G41A 4PC2A 2IHBA 4GOXA 4HAUA 4RZXA 4RKFA 4B47A 2I4IA 3X1DA 3FKSA 1M7GA 3P4XA 3CX8A 1A82A 3KUCA 5A5GA 3QBTA 1QG4A 1YZKA 4AKGA 1S3SA 4BLOA 1X3SA 2REXB 4QJ3A 1J8YF 1SULA 4QC2A 3ZIAA 1JBKA 2CCKA 1P2UA 5FBVB 2QI9C 2VHTA 1XU4A 821PA 4QBHA 3T61A 4QKQA 4P33A 5JHGB 4TLDA 4GI7A 2V7QA 4BFVA 2HF9A 2GTPA 2OCPA 3DVLA 1EESA 4JBWA 1SHKA 1KI4A 2Z83A 3EPKA 4PSAA 4AYWA 2WOOA 2GETA 4LJYA 1J70A 1QDEA 3LY5A 2PLFA 3AEZA 1ANKA 1JI0A 2QPOA 5L3SA 3KQKA 5F9FA 3Q8XB 2WWFA 2KBFA 1II8B 3F3YA 4KSBA 3RLFA 1UEIA 4BFSA 1JXOA 1N0VC 1MABB 3SQWA 1W36D 4DSTA 1W4CA 1S96A 2QTVB 4I1VA 5KPJA 2UVQA 4NCKA 3VR4A 3C7KA 4EDHA 2X2EA 1OFIA 4M53A 4RFSA 4KYIB 2ZS7A 2CK3A 4A2QA 1M1YE 3GJXC 3GQBA 3KKPA 1X8LA 3U2QA 4C2UA 2FFHA 1G5RA 121PA 2NGRA 2WAYA 2ZJBA 3AF0A 4P4UA 4WW0A 1F2TB 1N2CE 1EFRA 2ZI3A 3QSYA 4IDQA 3B5JA 4B71A 3P20A 2C8VA 4JLOA 5CLLA 2ORWA 2WKQA 4B76A 1G4AE 1OHHD 2FZ4A 3UG6A 2QENA 4LK2A 1VHLA 3CB4A 3KX2A 2J0VA 2F43B 5C46F 1Z07A 4TSFD 1NN5A 1MH1A 2XB2A 3LVRE 3TSZA 3K9GA 2YC2C 3KDSE 3PQCA 2CCGA 2G1KA 1N5LA 6Q21A 3V4RA 2XGJA 2BV3A 3KKQA 1YR8A 3AVPA 4TYWA 3Q9LA 4P4SA 2W2VA 5EXSA 2ZTSA 4JLDA 4JLAA 2R6FA 1IOZA 4Q9JA 2FSGA 1AZTA 1OT3A 2RMKA 3QEOA 5M04A 3VR1A 2ZRLA 1KK2A 1NLYA 1J99A 2FSIA 4DT1B 2OM2A 2JAQA 1SVOA 2JJ2D 3EZ6A 3R9WA 1ZD8A 2ZRNA 1SXJC 4Q1FA 4Z51A 4DRZA 5FOVA 4WA7A 1XD2B 2GZHA 2ZRCA 1WQ1R 3F5FA 4U00A 1A5TA 1RRGA 3EZ7A 1OXXK 4B43A 3CRRA 4M1MA 3GFOA 4DUGD 1CF4A 4IRUB 1YR9A 2ZR7A 3WYAA 5DN6A 4BZQA 2JLVA 4OQNA 1E0SA 3WMEA 4ZDJA 3DKPA 4PC7A 1G8FA 2GILA 2VIIA 3T06B 3VTKA 4MRRA 2D7DA 1B0UA 4W5WA 2ASEA 3SN6A 4Q02A 1S0UA 5J4YA 5FL7D 3I73A 1DADA 3R9IA 2VA8A 3QY0A 1HV8A 1NBME 2C03A 1J8MF 1TUEA 4Q5IA 2JASA 2P67A 1NIPA 1A2BA 4OL0A 2J0UB 1ZYUA 2ZJOA 5SZHB 1QVRA 2RAPA 3CKLA 5EZ6B 2UKDA 3W90A 1DVRA 2AD5A 2P6UA 2QN6A 1KSHA 3VR5A 3W5IA 4A9AA 4C3ZA 2IYWA 5DI3A 3FMIA 4N0DA 4CDGA 4MYUA 4GBMA 3AQ4A 5BWMA 2PJRA 1ZM9A 3L0OA 4NYIR 4HZUB 1JEEA 3QXJA 4URZR 4LYJA 1RJ9A 4H1VA 4OHVA 3QUSA 3R7WA 2VF8A 3E70C 4LBYA 3PJRA 1JR3E 3TUJC 1DE0A 3AGPA 1G3QA 5JRJA 1TAGA 2OV2A 4KVAA 2OUKA 4D0NA 2HLDD 2B8TA 4WOPA 1CBUA 1GP2A 5KUTA 2CVFA 4G5OA 4P32A 4XTCS 5DO9A 5J4LA 1G17A 3WY9A 1II9A 1Q57A 3A36A 4XWOA 4D2IA 4GZLA 1ZC4A 3D31A 1BMFD 3PV0A 3GJ5A 2WHXA 4Q00A 2QP4A 2RGBA 1E2DA 2XZLA 1E2LA 2F3RA 1Q21A 4OQFA 3EPJA 1VMAA 1G6HA 2OESA 5C2JB 1COWA 1H8HA 3OEEA 4A6PA 3LXXA 3EW9A 2WAXA 2ZETA 2CLDX 5B57C 4LUCA 4CYMA 3ZQJA 4B35A 1OSNA 4II7A 4JKYA 3B60A 1KNQA 2HXYA 3I92A 1GITA 4Q01A 1E79D 4GFDA 5KNBA 3H86A 2O8DA 5ELXA 2ODBA 2VLIA 3MCAA 4C9BA 4C2TA 4QGHA 1EXMA 2HF8A 5FOTA 2WBLC 1UKZA 4HATA 4Q1CA 3UIEA 1QG2A 4BEBA 2ZE5A 5EE1A 3K70B 3GLIA 2C2HA 1ZM2A 1VIAA 3CZQA 2XTNA 2QG6A 4PAOA 4CEJA 3IBGA 2JIZD 2P65A 3SR0A 3IHWA 2W0SA 3DEFA 2RHMA 2X19A 4OK6A 3QKSA 4OHXA 2EFEB 2F1JA 2BWJA 1KDRA 1KI9A 2CVHA 4G3XA 1NMXA 3AP1A 3VFDA 4JS0A 1E94E 5GJVC 2RGNA 5LB4A 1R2QA 3A37A 2IS4A 4GNKA 5SZIA 2AL7A 1TMKA 2VHUA 4F38A 4MKIA 2QMUA 3DM9B 4JYBA 1AGRA 2XB4A 2YHSA 3NDPA 1XTSA 3N2IA 4QOSA 3DM5A 2ZJ2A 1ZU5A 3LW7A 4IJMA 3A4MA 3K0CA 3P1JA 4PZLA 1NN1A 4Q03A 2O8EA 4JSTA 3CBQA 1YR7A 1WF3A 1WDTA 3H4MA 3BOSA 3GP8A 1E2GA 4MYHA 2G88A 1P2TA 1HH4A 1GUAA 4HAZA 4BEJA 2REOA 4AYXA 1ETUA 4DXAA 2QAJA 2A78A 2XTZA 1XTQA 1OIVA 2VP5A 3AKCA 1U8ZA 4CGZA 2O8CB 2QRZA 2GRJA 4MRPA 1Z6YA 2EQBA 2WJYA 3F0TA 4ACBA 2NO1A 4L15A 1FX0B 5LD2C 3G0HA 4Q9IA 3CLVA 1OFTA 5TY0A 3AP2A 3B8HA 1R5BA 3KZ1E 4MUAA 4LJ5A 3FKSD 1G7SA 2NG1A 3NVAA 1XJ0A 5CK5A 3K70D 2YWHA 2JJ1D 4DLSA 1Z6GA 3OIYA 1R6BX 1EGAA 2WJVA 5IK2A 4DLZA 5JEEA 1VYVA 2WWIA 1WCV1 1BIFA 4C0HA 3LDAA 1YZQA 4IKEA 1RRCA 1IN5A 1TADA 4BFWA 3U6KA 1P9RA 2BBSA 3OAAA 3BE4A 3QF4B 1Z0FA 3MJHA 4LBWA 4QBGB 3KQLA 4TTQA 5C18A 4CT5A 2A3RA 3K8YA 5KO2A 2ZEJA 3TK1A 3L0PA 3TUIC 1YZUA 2ZSEA 4POAA 3UMFA 2IYZA 2ZSAA 4HB3A 5LB2A 2NPFA 4C0BA 1SKYE 3BGWA 4OHZA 1N6HA 3PEYA 5GJBA 2BIFA 4RD1A 4B44A 4XH9B 4RZUA 3UATA 2LKDA 4DDWA 4M1OA 2DBYA 5FUVA 2WM9B 3D7MA 3TAUA 1K5GA 1YHNA 2IWRA 2ZRAA 3K9NA 1KO8A 1LVGA 4TTPA 5DISB 4G01B 1YRBA 4DCTA 4DLXA 1E2IA 2CK3D 3SQXA 4XIGS 1GNQA 1G8PA 5EXXA 1X8KA 2VSFA 1Z0KA 2Z4SA 3VAAA 2J45A 3SNHA 1ZUHA 3UXMA 2CEAA 1SXJB 2EVWX 2QNRA 2BHRA 3FPAA 1IY1A 4ZI3A 1D9ZA 2REBA 2CJWA 2LWIA 3T1TA 3GLFB 1MO6A 2OBMA 4Q7KA 1OJLA 5B30A 5HKKA 2EU8A 4IDNA 4L16A 1FUKA 3RS3A 1JECA 3EPLA 1NJGA 1IN6A 4V0KA 2WMNB 1NVVR 2NZJA 2OT3B 4FMBB 1D8TA 1OB2A 2WMOB 2DR3A 4PZZA 3N5CA 4PAMA 5FBRB 1FQJA 4JBYA 4PO9A 2G77B 3RHFA 4B3FX 2IS2A 5JWOA 4TMKA 2CMKA 3F8TA 2Q0HA 2NMVA 3LNCA 1W49A 3I32A 5AJYA 1YZGA 3P4YA 3Q72A 4PO1A 4B2IA 4B3DA 2C96A 4KFRA 4NYMQ 1VPLA 2R65A 2AWOA 2WWHA 1FZQA 2C77A 2MMCA 1N5JA 1OXSC 2QORA 1N6NA 3SC3A 4AC9A 3LQRA 1DEKA 1NKTA 2ECKA 3BXZA 3K0FA 4TYQA 2IXFA 3CM0A 4JLKA 3ADBA 1P2SA 1VTKA 3U5ZB 3SZRA 3KTAB 2ZYTX 3GFTA 1HURA 1SQ5A 1IXZA 1T0HB 2YINC 4FW9A 2FF7A 2B6HA 5KU1A 3U7GA 4LGMA 3WNBA 1XMIA 2VH5R 1W2HA 4XSHA 3B82A 1R0WA 4NTZA 2HXSA 4A82A 1XTRA 2HCJB 4W7SA 3BH0A 4JSYA 3C5CA 3C5HA 1XCPA 5CB6A 3M6AA 4RD6A 4A8JA 1L7VC 4HAXA 2OSBA 1Z0DA 1HQCA 2IUUA 3ZVMA 1KTVA 3SJCA 2CHGA 4DLVA 2FH5B 3U7HB 3REGA 1SXJD 3L2OB 4GZMA 1PLKA 5JZVA 2FEOA 3GLGA 2MSCB 4KLNA 2ZE6A 4KAXA 4DCVA 4ESVA 1XEFA 3CF6R 2NPIA 3ECCA 1OFHA 1MRSA 4MGZR 4F7WA 4Z54A 1OHHA 1UEJA 3THXB 2ORIA 3NBXX 1XEWX 4J0QA 2BBTA 4TSFA 5EE5B 1E9CA 1G7RA 1GG2A 2AK3A 2FNAA 2VPPA 4AYTA 3SFVA 4FD2A 1R8QA 621PA 3A58B 3OE7D 1SVIA 4B33A 3OIWA 1HY3A 4QM7A 1PLLA 3GJ0A 3K9LA 1AQUA 4IOLA 3NH9A 4M2LA 2EWVA 2P6NA 2QL6A 1SVLA 2ERXA 5E7JA 4KCGA 3A6PC 3RC3A 2J87A 4JVSB 5LPNA 4RFVA 5BN5A 4DHEA 3IIMA 2GJAA 4ZCLA 3SYKA 3I5YA 3UPUA 3D3QA 2VEDA 1II8A 2R6AA 5KSZA 3THWB 1HYQA 1KSFX 2C9YA 4WZ6A 2ZR0A 1OKKD 1MABA 4QL3A 3ASYA 2Q9AA 4YONB 4OYHA 3GJ4A 2JLXA 1SVWA 4DUGA 3PUYA 3VU9B 2OEPA 4A0RA 5JI3E 5FPKA 2GVDC 2XJ4A 3WYGA 4Q4JB 2ZJYA 3X1WA 3B1VA 2Q9BA 3L0IB 4BFTA 4YMWA 3NHBA 2VHQA 2X1VA 3RRYA 1AK2A 3TNFA 1EFUA 1KI7A 3K1JA 4LC1A 5FL7A 4KBFA 1F2TA 2IYLD 5EXPA 3RS2A 4DSOA 5B58C 2IA5A 4TQ9A 3WMFA 3MSXA 2CE7A 2X8AA 4HLUC 3RRNA 4BZXA 4E07A 1ZW6A 3K9HA 2GAOA 4TYPA 4ZI2A 3B1WA 4KHZA 3CNNA 2F43A 1EX7A 2IYTA 3KFVA 4G5GA 3TQFA 3A1TA 2J0SA 1W1WA 4IXNA 1GKYA 4ZDIA 4MDEA 3CO5A 4K8OA 2P3SA 3L8ZA 4W5HA 4XVQA 1ZNZA 3ETLA 5EE0A 2Q3HA 2VP2A 1NG1A 1XZPA 1ZBDA 2PMDA 4FMCF 3FDIA 2KWIA 1XF9A 5AJXA 4KI0A 5BYKA 5LD2B 1XTJA 4DT1A 5J4KA 1I4DD 5K8IA 1RYFA 1LF5A 1ZIPA 2SHKA 5J4VA 1M7BA 4JL6A 3BH7A 3QJYA 1UDXA 1QHSA 2HLDA 3X1YA 4A2WA 1E0AA 1XD2A 2I1QA 1DAKA 4RKEA 1T8UA 1BYUA 4MKHA 1HT2E 3GLHE 4B2PA 3MG9A 4FMCB 4M4SA 2DWQA 2ZRDA 1BMFA 4LV5B 5CM8B 2QP9X 1VHTA 4XSGA 3BRWD 3MAAC 1M34E 4JT2A 2FEMA 3B13B 4EJSC 1D2EA 2Z5FA 2ZUDA 2C78A 4DDUA 5EJEA 4KU4A 4MUBA 3GLIE 4KYUA 4IVPA 4OI1A 2C5LA 1I4LD 5D3MB 1E79A 3ZZTA 4M1WA 4WXRA 1YJ5A 4MGKR 4UQOA 4Q4HB 4JLVA 1HQYE 1YQTA 1FNMA 3I61A 1QHNA 2QA5A 2QMHA 1DS6A 5JHHB 2RGXA 2J0UA 3LBIA 3TMKA 4F93B 2GBLC 4TWZA 3NC0C 3H0KA 4Q47A 1IAQA 4L9SA 2JIZA 2DFKB 1CR2A 2A2ZA 3CH4B 2WIBA 2D62A 3PG5A 3BIFA 3THYA 4LWZA 4C0QC 2YOHA 5FTMA 3CRW1 4HZUA 2N46A 2A5FA 1M74A 4QBIA 1KO4A 1KO7A 4IOKA 4RZ2A 1CLUA 2FMXA 1TU3A 4I1UA 2ODWA 1KI3A 2CLSA 1FUUA 1N6LA 3QXXA 3ZVLA 2MMGA 4NYJQ 2AKAB 1GKIA 1KOFA 2QZ4A 3T12A 2BBWA 2WSSD 4HB2A 5JWRA 5A0FA 4W5JA 3KQNA 4QRHA 5H8WA 1KI2A 3EC1A 5DH9A 2Q21A 1ZNWA 1XP8A 2AR7A 2R44A 3OEHD 4TQAA 3WNDA 4LOAA 4X8OA 4TTRA 4IOJA 4Q4AB 3HYTA 1E9SA 1GNRA 2FJUA 2ZYVX 1KAOA 4WVFA 2W0MA 2PT5A 1G18A 3QIAA 4I99A 4TYYA 1G4UR 1TU4A 1ZINA 2YWFA 3EA0A 4NDZA 2V3CC 4A1FA 2FZLA 3CRQA 3IHLA 4MA4A 4Q18A 4WAUA 3EPHA 2E87A 1ELOA 3V00A 1Z0IA 4B3BA 3U44B 4PO8A 2JJ1A 1TQ4A 4IOMA 3U7FB 3AH8A 3L43A 4G5SA 4BLSA 1XFAA 1G3RA 3PVSA 1NVUQ 1DPFA 3QI2A 2PEYA 3ADKA 4X8LA 4ZPXA 3S1AB 3U3OA 3X1ZA 1VCOA 2ZAOA 4PPFA 1JQJC 2EFDB 4DIDA 2GF0A 1UJ2A 2ZRGA 3TLXA 4B3XA 4KO8A 3LLMA 3EAQA 3PUZA 4IFEA 2YKGA 3H84A 3ONWA 2AKYA 1D5CA 5K8LA 2ZVQX 3HYRA 4QHTA 2GCOB 4AKIA 3I3SR 3KQUA 2E1RA 1XJCA 2IT1A 3W3ZB 3O47A 3PENA 2CXXA 5C4MA 1GRQA 3EIQA 4TMVA 4BZPA 1JAHA 2IYUA 3T34A 1PJRA 3QNUA 2WICA 1T3LA 2B8WA 4ZO4A 4URXR 2O52A 3PR1A 5HCNA 1TUIA 3WRYC 2RGEA 1FP6A 4G5QA 1TQ2A 2YVUA 1YZTA 4GMDA 1CRQA 4MDFA 5KSOA 2J7PD 3A1VA 1VCIA 4C0AC 2VP0A 3WHLA 4TZ6A 2R2AA 2H17A 4JVLA 1KK1A 3QKUA 2O8CA 4GOJA 3AP3A 2ZJZA 3SFZA 2RGCA 3RABA 4BPBA 1FX0A 1W4BA 3AVQA 4PHFA 5GVRA 2HYIC 1NSTA 2R6CA 1WMSA 1G16A 4DBLC 1MOZA 3IPYA 1TEXA 5LBIA 2DY1A 2ORVA 3FFBA 3PIRA 1WBDA 2PCLA 1WXQA 5CDFE 4DKXA 4D4MA 1KJWA 1U94A 3AVVA 4DCUA 2Q3FA 1LF0A 4HDQB 4UNSA 4Z8YA 3QF4A 3LXRA 3IGFA 4MKGA 3CR8A 1N3BA 2V9PA 4NCIA 4YLGA 3RRMA 4NCNA 1P4SA 2EFHB 4QFMA 3IBYA 1G64A 1VECA 4AKEA 4BE7B 3LH5A 4A4DA 2FG5A 4OK3A 4UNRA 3HU1A 3W6PA 4Q21A 1SKQA 5HR5A 1JALA 1NBMD 5CIQA 1T5LA 3BD9A 4NU0A 4CZ2A 2A5YB 2DFLA 4TL7A 3FGNA 1KJYA 1MR3F 2IUSA 1FTSA 4TT3D 1VG1A 4ZIRB 4LHWA 4V0ME 1DO0A 3RS0A 4FWIB 3JVUA 1TF2A 4B74A 3T15A 1CR0A 4YMUA 2BVNA 3D8BA 4BRUA 1HUQA 5FH9A 2BMFA 4NYIQ 4IHQA 1LS6A 2EWWA 4L9WA 1OE0A 1SXJA 2C98A 4DLRA 1R0YA 4PPQA 4AG6A 4HAWA 4P31A 4D82A 3GLFA 1Z8FA 5P21A 3SBDA 1X1SA 3T5GA 1E9BA 1Q3TA 2H92A 3BFKA 1JR3D 1E1RD 2W2TA 3UANA 3Q7QA 3W3AA 1OXTA 1P62B 2Y8EA 2ZE8A 2NO9A 5KDDA 4Q9HA 4C0SA 4O2LA 3R8CA 2IXEA 4PANA 1E2QA 2QQ0A 4EJSB 1SVKA 1DAIA 2CL7X 1TL7C 3V9PA 4TZ0A 1W0KD 2IS6A 3VHLB 4AURA 1Q20A 3THYB 2G9NA 4DSNA 3FWYA 4IEEA 2WJJA 1ESNA 3OE7A 5FFMA 1OIWA 2ZUBA 5E7MA 1OW3B 4FI3C 5KDOA 1Z83A 2Z4RA 3WXMA 2E9SA 4UNNA 1E99A 1XBTA 221PA 1RYHA 4HLQB 4PHGA 3SYLA 3ADDA 4FINA 4Z1MD 1E96A 4IDOA 1N6KA 3QG5A 3KTAA 1XMSA 3EWSA 3H2YA 3GMTA 2H7VA 2CLCX 3LVQE 3KKOA 1W0JD 1R0XA 3VKWA 1KI1A 1OKKA 1MT0A 2GDJA 2XNSA 2V1UA 1RRFA 3HWSA 2FU5C 3NH6A 5DHFA 1W46A 3IUYA 5EZ5A 5CYPA 2ONJA 3RRZA 2Z0MA 4KVGA 1G5TA 2GJ9A 4DCSA 2GXAA 5BYJA 1UFQA 4L8GA 2IBMA 4LI0A 1JEDA 2FWRA 2PZEA 5G40A 1Z06A 2FGJA 5IHPA 2ZJAA 2IX3A 1P61B 4Q1BA 2BMEA 3LAWA 3MGCA 4B2LA 2DYKA 2C04A 1RZ3A 2F9MA 4BQSA 2J41A 2QGNA 4S35A 2WIAA 3THXA 2CL0X 1TF7A 2A7QA 3A1WA 4RCZA 4DCNA 4Y0AA 3IO5A 1VCMA 3VR2A 2JEOA 1MO5A 2QBYB 5TV2A 5JS8A 2WWXA 3UKDA 2D74A 1K6MA 3FE2A 1LB1B 4PSVA 4US1R 3OHMA 2BEJA 1DG3A 3PFIA 4D6PA 1KDPA 1XCGB 3WYFA 1F60A 4NMMA 1NI3A 1S1MA 4JL8A 3FMOB 3TUZC 3B9PA 4ITRC 4BASA 4BLPA 2AD1A 2IYSA 2QY9A 4PPNA 1SVMA 3OESA 5DYIA 1NN0A 4TLCA 4TL9A 4G0NA 3T1VA 2KE5A 2Q6TA 2GWHA 4FMDF 3RS4A 3THWA 3IILA 3I4LA 4IVQA 3IO3A 4L5BA 2JLWA 3EXAA 4OHYA 4LHXA 4N1AA 1Z2CA 1XDBA 3MWJA 2VHCA 2ZAMA 2ZSBA 4XWKA 1YE8A 3ZZUA 2WSMA 1QHGA 3RWMB 3VU9A 2KSQA 1Z5ZA 2ZS8A 5AUQA 2YJTD 4FMDB 2D4HA 2VTKA 3BORA 4MH0R 5AUPB 1G7TA 4QBFA 2AFHE 2IHYA 1UBFA 3OIVA 4UNQA 4ACAA 4Q4JA 2GXUA 3FVQA 4LPKA 1FFHA 3R9XA 2ZIAA 1XD8A 1VG8A 4HUQB 3M0EA 4QGAA 5IF9A 1R4AA 2IW3A 2J7KA 2L0XA 4JIMA 4CVNA 2BBOA 2GA8A 2RB4A 2WWYA 3TE6A 5EP4A 2ZVPX 2IF2A 1TNDA 2GF9A 2ZYWX 3W5JA 5FTLA 1NL3A 3FKQA 4D0LB 3ZQ6A 3C15C 1IY2A 1DTSA 3B78A 2BCGY 3EIHA 1ZNYA 5BN3A 4AKHA 1ZAKA 1OF1A 3DZ8A 4RJLA 4BLTA 3QPVA 2CDNA 3DDCA 3RANA 2XZOA 1Q1ZA 2GNOA 1RW4A 2MSEB 2QUZA 2LCFA 3PUWA 1VDZA 2J3EA 3Q5EA 2IXGA 1A4RA 3KXKA 3X1XA 1KHTA 3THOA 1IQPA 2ZRMA 3KXIA 5DIFA 5EXTA 1YZLA 3VR3A 1G8YA 721PA 2ZRHA 4XWAA 4YDSA 2PBRA 1GWNA 2OCBA 1JB1A 3CW2A 3WRXC 1NVVQ 2WSSA 5FTKA 3FHOA 2F1RA 3GCGA 3U4QB
chains in the Genus database with same CATH superfamily
4C21A 1HMPA 2YFHA 1U0BB 1T6ZA 4L9AA 4AXXA 4LYDA 4XLZA 4U7PB 2PAAA 2VF7A 5E3HA 4TS4A 1J2RA 3O3MB 3MF4A 3OEHA 4JB0A 3WE7A 2G7ZA 1E1KA 3CJTA 5EJ5A 4LJ6A 3OY7A 3UC5A 1M9NA 4OXYA 4U9HS 2B21A 3QHAA 3QKIA 4OMFG 2H29A 5K2OA 4D3DA 1KYWA 4WECA 2Z2KA 4HDSB 5DYNA 1RXCA 1PEAA 2PKEA 4ETNA 1LSJA 2PX5A 4R2MA 5A2GA 2IEBA 2FX3A 3WG9A 1LVUA 2APJA 1E0KA 5DGCA 3K0EA 4MWSA 3CRMA 2FUKA 1OPRA 2JI8A 3O6VA 3TIGA 4DXDA 2Z43A 2ZXUA 4K2HA 2JHFA 1WB6A 1IULA 1N4DA 1J56A 1OX4B 3MQ4A 1KQGA 1WEKA 3HXLA 1W4ZA 4HP8A 3UMRA 4BFYA 2HUNA 3F5QA 2RGYA 2I1LA 4V0NA 1GDDA 2I9PA 2CD7A 4B2YA 3VKGA 1NG9A 4L78A 2DR2A 1EX6A 4OBBA 3WIVA 2Q0XA 1JR4A 4KMRA 2ZQ5A 5G0UA 3ZKWB 4DXHA 4MUJA 1JG1A 3CZ9A 4BIIA 4ZKEA 4B73A 3HRIA 3JASA 4QRDA 4X85A 2DWOA 3F4BA 4Y6RA 3RSCA 3OTQA 5DU2A 3UTDA 4D9FA 4N3NA 1NZFA 3ND8A 4IYJA 1KZGB 2QEQA 3SEQA 1L2TA 3AWDA 1GSOA 2KBEA 1UJCA 2VZ9A 4FGLA 5G0VA 4AO8A 4HEJA 1ZVJA 1M2OB 3Q0EA 1KO5A 4NI5A 2O5EA 2Q4EA 2RHDA 3IKJA 2EBUA 3E3LA 1AKRA 3OA2A 4UD6A 1Y89A 3SS7X 4BVFA 1PJZA 4E5UA 5JBQA 2DUJA 4K9OA 4YBRA 2O2GA 2QXUA 2BKXA 2DCUA 2P9HA 2VOEA 1WA5A 5AK4A 5F2KA 1ZPDA 2AF4C 4C07A 3ETDA 3LC2O 5LZ2A 3O92A 4L74A 2Q2VA 3R41A 1DJNA 1KOJA 4WOJA 4BQEA 4B7AA 2JFOA 4DZRA 1XD9A 3AJRA 4HAYA 1F5NA 1EZ4A 2CNKA 5I47A 3NIBA 1T8WA 4QREA 5JYBA 3BJMA 5JCJD 5HF8A 3GH3A 2OHIA 3Q7PA 4DLAA 1P6XA 5JVDA 4PZDA 3VDMA 1JBQA 2TYSB 4ZO9A 4TLAA 3NZEA 4X84A 4WGFA 3U3RA 3WIBA 3VZQA 2VWHA 4BL5A 1S8FA 2B4QA 4TMTA 4IGIA 3B5EA 4PSDA 3O1HB 5KTOA 1E3LA 3D7NA 1RCTE 5GOTA 4A92A 3BHNA 4C20A 4YDQA 2XUHA 3VPSA 3BICA 1TM5E 3KOWA 5JEDA 3GPBA 5K51A 3BJRA 1RPAA 1MO3A 1RFLA 3CLSC 5T4EA 1GNPA 2H2HA 3UENA 3U44A 1N5OX 1SZJG 2DM6A 4R69A 4WDRA 4RQTA 3GRYA 4KE7A 4FLEA 4HJRA 5CM9C 1U98A 2UXCB 2Y6VA 1I6MA 4DAEA 2XBMA 3GT0A 3EHDA 1I5OA 1PHPA 2XNJA 3OCWA 3R7AA 4FJ0A 3NDJA 2B7BA 5AUNB 1IXSB 4MKZA 5SZJA 5DF1A 3SQMA 1Z28A 5CH5A 1U3TA 3L79A 4TLBA 1X94A 1XZIA 2WP0A 1YS9A 1JFSA 4L57A 1V16A 1ZBQA 1OGJA 4DILA 4INPA 3U60B 3EXG1 3KT6A 4PPGA 1CY6A 3VI3B 1DWQA 4N3BA 5JZBA 3ELYA 3W8FA 4HVCA 4XM0A 2GCOA 2YV1A 4UKDA 3W6NA 4GOND 1OAOA 4NL4H 2Y2UA 1NBMA 3PSHA 1ZJYA 3G6WA 1SXJE 3JZMA 5EUQB 2XDWA 3MJTA 4JGGA 1MAUA 2GJSA 1RKQA 1SHZA 5B1HA 4BVKA 5AXAA 4ZVTA 2HEGA 2AFRA 1QS0A 2AC2A 4CHGA 3EGCA 3WMGA 5HUHA 1MO2A 1T1EA 4OTZA 1YR6A 1XNJA 1ECJA 5EJ2A 1P6UA 3V8NA 3A7EA 1KKUA 1JH8A 4NDNE 4H15A 1CD5A 2QM7A 4N18A 2RI0A 3RC8A 4GWGA 4QYIB 1QX3A 1P9WA 3NEJA 4YJGA 4YPVA 2FUCA 4JLJA 3B1ZA 2PWBA 2CB0A 2GCPA 3KYCA 1YUBA 2P9FA 5JD3A 3UT5B 1RWVA 1UPFA 1WM1A 5FPQA 3BS4A 3S29A 4XJSA 4ZCIA 2P2LA 5LM3A 3FPCA 2D6FA 1DIBA 1EX9A 2ZI4A 3MWKA 3O2JA 2RGAA 3JQAA 2H4JA 3HJGA 4KDEA 3PRYA 5E95A 3VC1A 4TUYB 1ST2A 1Z68A 2GBPA 4ZJYA 4ZV9A 4LFBB 1V47A 3QUCA 3ZHBA 1F9EA 3LYHA 1I80A 2HGSA 2NU7A 2PX0A 1G2QA 1N5IA 3CMCO 3O8BA 1SMKA 4FNOA 4JB3A 2IQ5A 5C1IA 4HB0A 1YRLA 2PDAA 5BPHA 1OH7A 1SC3A 4PRZA 4AJ1A 2RHCA 1C7JA 3WICA 5MGBA 5EMMA 2LDXA 1FP7A 2JHGA 3RIXA 3JPYA 5D5PA 4GXQA 5M34A 2CMGA 4OY3A 5E2BA 3TZHA 2BFWA 1HTWA 1OXVA 3AKEA 2VG8A 3FNBA 2IF0A 3E1KA 3OCZA 4Y2QA 2CNDA 3R7SA 1UBSB 5B7NA 4EZIA 4LBVA 3MTDA 2GJKA 1T26A 2IUFA 3DC7A 5KDLA 3TH5A 3WBKA 3NGMA 5C7OO 4BCCA 1E1NA 4RD3A 3U7QB 2YN4A 3T1QA 3IODA 4B17A 1N2EA 3MTAA 1K06A 3CVVA 1UBGA 3UK2A 3GZJA 5FWYA 3OE5A 5F33A 5KBYA 2E3JA 2NO7A 3KXLA 1RJGA 4RVFA 4LF8B 3P96A 4EAAA 1YTUA 1C1DA 3KQWA 3KOZA 5FAKA 3I5MA 5DEOA 4J0CA 2VZ0A 4B3CA 3V1KA 4XVUA 4J2TA 1IOVA 4XARA 2KLHA 5J4HA 2GSWA 3OKCA 3EZ9A 3T94A 2JA1A 4J9UE 3BGSA 5I7EA 4NESA 3KU4A 4WXHA 4O2RA 1FNNA 4DMUB 1GY8A 2ASVA 5TGDA 1OFUA 1YRAA 1TZMA 3NBFA 3RW9A 4ZYLA 3CPEA 1D03A 1U2PA 1W5TA 4OP3A 4WNCA 1CR4A 1V96A 1N2BA 3I62A 4AX4A 1E2MA 3CH5A 1I3MA 2VHZA 3BEDA 4AJHA 2C97A 4WXEA 3GXBA 2AOUB 1C1YA 5JO9A 5JLJA 2JCBA 3NWJA 1F9AA 3SOPA 2AJBA 2P41A 1R5OA 1SD2A 4IGFA 5F76A 3V1LA 4FNMA 5U1PA 2G28A 4LE2A 2H00A 1RQ2A 5D5HA 5EUCA 2B7CA 1XNHA 2JLUA 3K2EA 3DBVO 4B84A 4QM6A 5JYDA 2M32A 5BWLA 2HA6A 5SICE 2Y99A 5SZKB 3GCDA 4E6PA 2P79A 4KFCA 1Z29A 5F23A 3ELDA 3G2QA 2J31A 2PYDA 1WF6A 4KMSA 3VJRA 5LU9A 2V7GA 1JG7A 3W7AA 3S0JA 4LFCB 3S2GA 4BJ5A 2E85A 3H99A 2NQ2C 5JSQA 3SP1A 4PCUA 4BQQA 1VA4A 2OHGA 3HRHA 1PS9A 1P7PA 1K8YB 3AEUA 3LYAA 3N05A 4MWTA 5FPPA 5H0IA 1T0BA 5K3CA 5AHXA 4LJ4A 2GBLA 3O91A 2WF5A 3EVFA 4HFRA 4WKCA 4P0PB 4RWZA 2YN0A 4R7TA 1E8NA 1FOEB 2HA0A 2NP7A 2A9OA 1J8VA 2HEIA 2ISQA 1NE2A 3JQRA 4HEQA 4BQOA 4EKNB 4ZFNA 5KTYA 1ZHFA 4ETMA 4G0VA 1E1CB 3TBKA 5D3QA 3N7UA 2XH8A 4PFJA 3RE1A 1G8GA 4Q7JB 4U2KA 3ZS8A 1I2BA 5FDFA 4DGSA 3ZTYA 2CXSA 2IU0A 3DDSA 4CIDA 4UTRA 3BHMA 3PXXA 5IUKC 3SJBA 1FMJA 4MR8B 4BV3A 1D2MA 2BM8A 4BNUA 4LYAA 4ENPA 1IBKB 2D2FA 2BP7B 3A4LA 3K35A 5CFQA 2XV1A 2GN0A 1XZGA 1ZI9A 1P9NA 3L77A 5JFGA 3CW8X 5E4YA 3TW6A 4E2FA 1I4TD 2BM0A 2CLKB 2FG6C 1SOVA 2QN2A 1VGRA 3EPPA 5JC1A 3W5BA 1WBBA 4Y9DA 3RBVA 3W3AH 2NSYA 2UV8A 5FOUA 3QUBA 4XVHA 1MZVA 4EDFA 1FS5A 5TPWA 5IKMA 3AESB 1DAHA 2NSHA 4FR2A 4TWAA 2CFIA 1Q91A 1WHSA 3QXSA 5FKJA 3T4EA 4YASA 1M6YA 2WWVD 3DZIA 2Q5QA 5KHLB 3COJA 1AKEA 1S2MA 1EJBA 2RHBA 3HFGA 3UV7A 5LQMA 3LQQA 1HSZA 4KWIA 2KM1A 4C30A 1B1AA 2ZUUA 1CQZA 1UXJA 3H7AA 1LPNA 2I6TA 3HKCA 4M55A 2EP7A 4Q3OA 4EPRA 2JLYA 1XQ1A 3KYIB 3RHSA 1RSZA 1UBUS 2I3AA 2J5QA 1K7CA 3E1SA 3PF8A 4MAMA 3B3QA 1SUBA 2DGDA 4NY1A 4QT0A 1Z4QA 4ZOLA 2VZ8A 2Q6OA 5J47A 2BTQB 3CG0A 5DLDA 2ANBA 2EKLA 1ZHHA 3F97A 3CNLA 3U0BA 1EXDA 1PV2A 3G5UA 5JARA 2V7VA 3E2IA 2C4UA 4UZFA 3USCS 3D8RA 3JZIA 2C61A 1XMPA 1I8TA 2W2KA 1SA0B 1FFBA 3KLOA 4US2R 1ES9A 3H19A 1XTKA 4CM1A 4IQ8A 1QQ7A 2O1XA 2XF2A 3CV3A 3ZN2A 4K3UA 1C1XA 2VBCA 3FMFA 1LA2A 5DSZA 4BOYA 2QYSA 3W8NA 2QVCA 3ZXSA 4E5VA 4XTRA 2OV1A 2XOKD 1TLFA 2XXAA 1Y3HA 5HJEA 2RI1A 5I7OA 1V26A 4U6QA 1P17A 3F8WA 3AX6A 2C4NA 1E9DA 1FPMA 5ALYA 5GJCA 4CEHB 1A2KC 2D2IA 4HPXB 2Q6IA 1O97C 4L4RA 4U2FA 4ZCPA 4C6RA 4Z4HA 2IYAA 3GX1A 3VVMA 3LBHA 1LBQA 3UQYS 3A1CA 4JROA 4AS1A 2OPBA 3BDVA 4IH4A 4JJ7A 2KPOA 3J81k 1IK6A 2G0TA 4BS9A 4JY7A 4QUHA 3P71T 4G6ZA 3B9BA 2GPJA 1N6IA 1NFRA 3OTGA 2WJHA 5A3JA 5LKRA 4HUQA 2XWQA 4ZVKA 2QW1A 5C4GB 3DPSA 3EA5A 2IYRA 3NKVA 1T43A 2J5BA 3FCUB 3OQOA 3SC4A 5KREA 4P4NA 2VQSA 1L6IA 3SS9X 3IUEA 3KYBA 5DXJA 3IS3A 5CBKA 4RQBA 4EIWA 3P9PA 1XPUA 3WLJA 4KN6A 2I99A 3L7LA 4UFNA 4EPWA 3AFHA 1UPBA 4KV7A 4PFSA 4R98A 3G89A 3WKBA 2HQBA 4UXHA 2AFIE 3BD8A 2FMHA 1NW3A 1X2EA 2HA7A 2RCYA 3ILVA 4W8GA 5EQTA 4FE7A 2CCJA 5AR1A 5CCDA 1NP6A 4LRXA 3SIWA 4G9BA 1GM5A 1I1NA 2G5GX 1R8YA 1GR1A 1Q44A 3BC1A 5B6PA 3OM1A 1SUWA 1RYBA 1DO8A 2BI7A 2UDPA 4QVKA 4AWBA 3KJHA 1UDCA 1U5BA 2FE4A 1KGDA 2R6DA 3CY6A 3NOQA 4XAQA 3PR2B 5DULA 4Q48A 3WGGA 4CM9A 4D98A 3UUEA 4D9JA 4EA9A 2C54A 5LLSA 3GNQA 1F0NA 2QTAA 3EJWA 2Y71A 3VX3A 2PN1A 2E82A 4R0MA 3CLSD 4RVHA 1Q7TA 5HKOA 1X8XA 2IXAA 1FVXA 3NHFA 2CDRA 4J43A 1CP2A 2WNIA 1IG3A 4V2UA 2JZCA 4C4OA 1QH0A 3VO1A 4ZQHA 1NI5A 3B3FA 2AQ8A 2OFFA 1YOVB 3PUJA 1QZZA 1LW7A 4PXAA 1BFUA 2Y2VA 4BNJA 1RBQA 3TLBA 1RWPA 1HE1C 2IEDA 3IUNA 1WU7A 4EYOA 4OFWA 4ENRA 4JEIA 1EVKA 1OBFO 2LVBA 1MT3A 4K1LA 1QBKC 4RCZA 4ARBA 5BSKA 1GLVA 1TPZA 1WG8A 4JC8A 4ZV4A 4I4CA 4EFNA 1XMQB 2W6JD 3U3KA 2CXUA 1T9HA 4QFCA 5L7YA 2KYRA 1XZMA 3IULA 1IY0A 1X1RA 1UJ6A 5CT8A 5EQFA 3N59A 4X6LA 4CM6A 5BMVF 1ZFNA 3AKDA 4R9UC 4OQLA 5ALRA 1T8YA 3UNXA 3OOJA 4HDSA 3ESCA 2AUMA 3H1PA 3D7RA 4F4DA 2IIPA 2Z6AA 1V11B 4XDGA 2PH7A 1OLOA 3ZZNA 2DG2A 5I8PA 4KV9A 1AX9A 4J7UA 5K09A 2IPLA 4QAJA 1ZNXA 3OKAA 3ZD9A 5JD4A 4LY6A 4GPIB 4B31A 4G8CA 3A04A 3I6MA 5DHPA 1GR0A 1QE0A 1OX4A 3AUUA 3LS2A 4DCOA 5BMVB 2HJVA 3RREA 5HUQA 2ZDGA 5CB4F 3SVZA 3WZ2A 2QE7A 3R23A 2XX3A 3EGXB 2NU8B 1Z7YA 1U3WA 2CYAA 1ABEA 1LSOA 3CCCA 4HTFB 4IDFA 3ZZ1A 1XTIA 1X3LA 1WWKA 3IIKA 4QD3A 4K9SA 1MJGM 1YZ3A 3QXCA 5TMBA 1Z34A 1QDUA 1NXSA 2HPVA 1GUDA 2M1ZA 2I2AA 3ZKWA 5FIUA 2WV9A 3Q3CA 4W4TA 2J6IA 2DPMA 1QVWA 3JAWB 3KKKA 4LXGA 3TTTA 1XROA 2WJAA 2XA1A 3JZDA 3K9WA 1N32B 2Q49A 3ZDZB 1DRVA 4ZQBA 2WYOA 1FX1A 2B94A 3HJNA 4ZC1A 1PZEA 3C3JA 5L8VA 1SCAA 5HNKA 4M9ZA 1XQXA 2A0FA 1ISGA 2PLRA 4RSRA 1M2OA 3PEEA 4Z0HO 3WJ7A 3R44A 4RK1A 1YS6A 1FQWA 2R1UA 1ENYA 4A7PA 2O8EB 3CEJA 4FCVA 4K9MA 2OHXA 1QV7A 3FX2A 1U0LA 4J0EA 3RUPA 2G07A 3BQNB 1GHTA 2GWRA 3WGTA 3BGOS 3C5WP 3UJPA 3AYXB 2VNAA 3B1YA 1V8OA 1TX4B 1CZKA 2RH9B 1FFDA 4OVKA 1MAAA 1Q0UA 1NN3A 1Z6XA 4MITA 4YP0A 4C22A 2EFYA 3W5DA 4B3GA 5J58A 1PZMA 3SEZA 5I01A 3G2IA 1V48A 1BQ4A 3CZPA 4DM4A 3C45A 4Z7OB 3ZE2B 1A5BB 3O7WA 3UK6A 2PX6A 2GCIA 4QNMA 4AY3A 1KI8A 1JR2A 2JGAA 1CUEA 5JG7A 1D2NA 2Q3MA 3FDFA 1KQFA 4KR0A 3ZIUA 2PUCA 4AT1A 5K0NA 3W1EA 2IYNA 1K5PA 1JJVA 1ZK3A 6AT1A 1V5WA 1JQLB 3OZBA 4HYYA 1N6RA 2XECA 2WIJA 2ID8A 1NTRA 1D9XA 4NFYA 4I2NA 1P60A 3W6UA 4GGMX 3DLAA 4DLTA 2BMVA 2EW8A 2UZ0A 4K87A 4TL6A 1JXQA 4V03A 1SEVA 2JARA 1EMDA 3GEIA 4X95A 3ZHSA 2EX0A 4ZYWA 2VP4A 3OY2A 3WBBA 4UTZA 1TKRA 2HO5A 5E1BA 3HNOA 3T7EA 2MSWA 3TOCA 1KARA 3EZFA 3CVOA 3L01A 2Q2QA 4RWEA 2V6FA 2VYFA 4L0CA 4MUHA 2OMEA 4XGQA 4TKZA 3CPJB 3O1IC 4WY2A 3VOAA 4KBGA 4B79A 3GWZA 3ZCUA 3IA2A 1U7UA 3UMYA 1JHXA 1QFJA 3H1TA 3KNZA 4LSMA 4V0RA 3WKCA 4TSKA 2IEGA 4E1BA 2BSXA 4NF2A 4EUSA 1CUZA 1ONBA 1YBHA 2AC4A 1RBZA 3GBPA 2HQOA 2QN9A 4IDDA 4HR7A 4K05A 3A6JA 1AZSC 1GFZA 3X43A 2XQGA 3MEQA 4P7FA 4RGYA 1UZAA 3NHAA 3WL6A 4RJJA 5GM2A 2DU8A 4I36A 2J0EA 4YT4A 1E5XA 1YJCA 1VRCA 2IIVA 4CKZA 1N5KA 3H9EO 2ZDHA 2WHEA 1DAPA 5EKTA 4IJ6A 4O0MA 5C1BA 1JSCA 2CMDA 3FYHA 4GUAA 5H1YA 5IJWA 1W4RA 4TQUS 3OM9A 3KLPX 2JB9A 4MJLA 1T5DX 2BJVA 2RH4A 3FNFA 3ORQA 3G59A 3TR0A 4HY3A 1TO2E 5D85A 3QITA 1RAHA 3ZG6A 5K5EA 2P40A 4BUJA 4EF6A 2V6JA 3JYLA 4QYIA 1I1OA 3N53A 2WUDA 4MRNA 1XZNA 1KMQA 3UGKA 2QRLA 3P2EA 1KZHA 3UT5A 3AHFA 2H31A 3SAJA 2EX4A 5ENVA 4MRVA 5AQEA 2PT6A 2GD2A 2XRYA 4YCAA 4BX8A 4PSCA 2XT9A 4TUYA 2CL6X 3NBMA 3FRJA 4BMOB 2B36A 3RJ5A 2ACVA 4OL9A 5CIWA 4U6SA 3QMVA 2C2BA 5ENDA 1PJ3A 1NVWQ 1TIKA 2WWWA 4RNDB 5A5DA 3F96A 3DTTA 2RFLA 2HA3A 4X5OA 1DAGA 5FPHA 1K0UA 4KAAA 4FE3A 3QVUA 3RUFA 2GYYA 4YXWA 2VSQA 1WB5A 2XTAA 3K8QA 4YRDA 2FQYA 2O3JA 1TVMA 4F1JA 3L1UA 1M2WA 2V7WA 4I5GA 1MFZA 3GEEA 2PRIA 2X2OA 3AUXA 3W8DA 3LNTA 1NUAA 3BWVA 1THTA 3JATB 3IYLW 4P4SB 1LNSA 4AXBA 1Z4NA 1UKEA 1X77A 3LMKA 1H5UA 4RCYA 5JE8A 3U7QA 4WL0A 4BKOA 4HNVA 2JH8A 1AJEA 4XVCA 1BOOA 2IVZA 2XRMA 4RKYA 1IQ0A 4TTVA 3B5IA 1RMQA 2V6GA 1W2GA 2X0EA 1DIGA 3WR5A 3GGSA 4AWXA 1K89A 2NUBA 4H7PA 3KBBA 4HGOA 1EINA 3I01M 1LLQA 2YMLA 3HWWA 4WRRA 2OFOA 3PXGA 1EG2A 1DMSA 1RHRA 3DMHA 4MW0A 5LQNA 4M1TA 1DC4A 3L4KA 4Q93A 3A25A 3ZI0A 2CBGA 4EHBA 2XYPA 5HZGA 3T5DA 3BF7A 3ORFA 3HZZA 1V41E 3SM9A 3D6VA 4MKFA 1ID1A 4PYMA 1T9DA 1KQ3A 1VIMA 2DF8A 3FVRA 3LO5A 4G41A 4R1TA 1T2EA 1TYBE 1QCZA 2H48A 1IY9A 3C16C 3FA2A 3PITA 4PLFA 5FF9A 3P9KA 3TNJA 4DNFA 1E2PA 3SBOA 3FHCB 1WOYA 3MJEA 4WK4B 4AD8A 1W35A 2G9QA 3WLAA 4B81A 5I9IA 4GI5A 2GZRA 1L7EA 2AOUA 4KFUA 3O4JA 1G7CA 3VDQA 3K71B 3SIPA 5DM70 2CLHB 2PU5A 1YL5A 1O97D 2UYCA 1CQIA 4OBEA 1YNSA 3GZNB 1P4GA 2VZLA 1XVLA 4LY0A 3IC5A 1SZDA 3A05A 3IPXA 1JZSA 2F6RA 2EQAA 1CUHA 2DWPA 2YFKA 1I36A 3X44A 3LY8A 1EFRD 3FNQA 4AY2A 5AJZA 2FR8A 3BM5A 4GDMA 1Y7TA 2H0AA 1P5RA 1UT8A 3NNDA 3QTTA 2GHIA 4UXIA 5T8KC 3CNHA 4I66A 4ZHQF 3G85A 2A67A 2BM1A 2XCOA 4BNFA 3I53A 2HYDA 2JDIA 4O4IF 1NYRA 2PS3A 3L8YA 4XGNA 4JJ4A 2Z9BA 4AKSA 3QV1A 4JV5B 4UNPA 1JR6A 3AILA 2H4FA 3HCPA 2E21A 2V8BA 1E2EA 3PPYA 3ESBA 2DUMA 3D3JA 3L7KA 3LF2A 4W1PA 2GVZC 3AVXA 5F9MA 3VSDA 1B26A 4YRSA 1JIIA 3ICOA 5DVZA 3S4YA 3E15A 4P3XA 4P4GA 4YRZA 1ILEA 1P44A 2XCSB 3I2FA 1IXKA 4JA0A 4QYWA 1RJ9B 4ZHQB 3PU6A 4K0RA 3G23A 1E1CA 2Y1XA 3CINA 1RKBA 1M5TA 1O03A 1U5AA 1GOTA 3EEYA 4O4IB 4RK5A 1WDWB 3FY4A 2PV7A 4BO7A 3KJZA 4BV8A 5ILGA 3DBRB 1MFPA 1EP2B 2G9VA 1YKSA 1TJ3A 2G36A 2A9FA 4MR8A 2W6IA 5C53B 3NXKA 4OQYA 2X1MA 2XKJE 2J4FA 4HN4B 2BP7A 4P83A 5F7OA 4X6UA 2ZI9A 2XDQB 3UUGA 4DQUA 1L4UA 3ABQB 3OVMA 2QVYX 5KYNA 2W48A 3PEWA 2C4WA 2PBZA 1C7FA 3ZUPA 1JIVA 4GL2A 5C3MA 3GRKA 5JNSA 4DR4B 4ZJZA 3JWIA 4LRYA 4WCVA 3VU1A 5B7GA 3HY3A 4BE4A 1BVUA 1ZWKA 1ZVQA 3WYNA 3A6DA 2O0MA 4JHLA 3AESA 4QYTA 5IP5A 4BFXA 3DPUA 5DTEA 3Q11A 1HWYA 2G0NA 1NNUA 1Q77A 1XQVA 2Y77A 4H2DA 1V5EA 4JITA 1OC4A 1MA0A 3OKPA 3Q2IA 5GGYA 2DSNA 2I87A 2Z2JA 1ICEA 3TI9A 1E5DA 3FCSB 4RKRA 1E4VA 1JLMA 1E2BA 1RAIA 1TAHA 1XRJA 2IHTA 2Z1MA 3EYAA 4GLJA 1U1CA 2DFNA 4LX0A 3T1OA 3EN0A 4KLRA 4XVRA 4ZKDA 1WRBA 3FOEC 2O8DB 3FETA 2AH5A 3EY9A 3G79A 1M34B 1ODLA 4GP6A 3T0FA 5BYBA 1UOPA 2YV5A 3DQPA 3MMXA 4ZU3A 2GD1O 4ZP1A 1HOTA 2BTQA 1TCBA 3E5RA 3HO6A 3RIYA 2WFMA 1MC8A 1UFVA 1CZRA 2H4YA 3IUSA 3C97A 3ROQA 2GH1A 3BB3A 3F6RA 2WB4A 3L7YA 3TGPA 3I39X 1G5FA 2OM6A 1SA0A 3M6IA 1VLHA 3O2QB 3E9CA 4BNDB 3ROEA 2UUOA 1GQ2A 4GYWA 3LLVA 5EN4A 2BE9A 1BU8A 1HL7A 4X1OA 3R6TA 1CKEA 5LC1A 2ERYA 1FDRA 1XRSB 2NXCA 5CHYA 1ZRSA 5LP6F 4D4JA 1P1HA 4CEHA 3UWMA 3TLGB 3H5RA 5ALMA 2OE2A 3DAHA 3W0LB 2OBBA 4IV8A 2X6RA 3CKYA 1NJ6A 4TYMA 1FFWA 3EY4A 1OV6A 1R4MB 2C5HA 1Q19A 5KNDH 3NDRA 4UFOA 2CVQA 3KOUA 5LLTA 2ANCA 4BX0A 2D0IA 3DH0A 2WWGA 5FUMA 3EC7A 4KXXA 4FQ8A 4CF3A 1NMYA 2P6OA 1DC3A 1BFKA 4IZHA 5TF4A 5ERGB 3JRWA 2HJRA 1E9RA 4IDCA 3HU3A 3REQB 2I2WA 2R8YA 3AL2A 3D7KA 5DE3A 4DV1B 2R60A 2X77A 3OEED 3MQFA 2DP4E 3AKYA 5KC8A 3LLUA 1VGVA 2ECPA 1Z13A 3MGAA 4G2TA 1UC9A 4HYQA 4MUKA 5F12A 2Y0BA 4CIVA 1GV0A 1LV7A 1QAOA 3DWFA 4S2UA 3RBXA 2Z08A 3U1TA 4MB2A 1T3HA 3KT8A 3OLZA 2VP3A 4BBJA 1IJBA 3ON5A 2JGNA 3TLAA 2WPNA 3ZY4A 3DAOA 4YMVA 2GPWA 4DKJA 1KAEA 5B64A 2ODNA 3AUSA 2ZIWB 5C31A 2PRKA 4GMXA 1BJRE 1VG0B 3WP0A 4QDZA 4R51A 3TZEA 1ABBA 3TLZA 3UH0A 2AQIA 1NJ2A 3S3TA 4JLPA 3KKMA 3T5AA 1T6YA 2GARA 4C0LA 1JXAA 2QTBA 2YUTA 5AI5A 4FN5A 3H5AA 1EFHA 2VHJA 1GPYA 4PGAA 3C3DA 1VJ1A 1YRHA 5ECGC 4KAJA 4Q66C 1WDLA 1WKVA 1RIFA 3OWOA 2CLIB 4Q9KA 5CK4A 5DOVA 4MYTA 3RKSA 2CNWA 1F20A 1BROA 3HXPA 1OU0A 1S3GA 2R5WA 3R4CA 4BP3A 1RAGA 5CDSA 2RKBA 2PGNA 5AM3A 3C2QA 1WY7A 1WIWA 1Z82A 2XMGA 3MYRA 1X0VA 1UJNA 1YOVA 2F1HA 3NTUA 4EPYA 1U81A 1E89A 1NMQA 4F6CA 3BMCB 3RJTA 1Y4UA 2PMBA 3P0HA 4DCMA 4L7QA 1V9LA 4NAHA 4BNZA 1YCDA 1YULA 5ADUS 4PS0A 5JAHA 5KJ6A 1XGKA 4LF6B 2F4VB 2NVWA 3NI2A 3CUWA 5DW3A 1JV2B 1YE5A 4FEAA 4IIJB 4UOEA 2O0HA 2C4KA 5UKDA 4B46A 2H1LA 4J07A 3CE9A 1PV4A 3KB8A 3AHEA 3M2TA 2B9EA 3U3MA 3AEKB 1OTXA 1GL7A 1Y1KE 2QN8A 2YWGA 3M70A 4Q1EA 3TNYA 2WD9A 1MPXA 1MX9A 1XXHE 4I5FA 1K4KA 3NJ8A 4JT8A 1NX9A 2EBWA 2I66A 4RD0A 4Y7CA 2HQRA 3WL4A 5F7ZA 2CJYA 1BDBA 5G4KB 2E55A 3EASA 3MT9A 1N9KA 1P5FA 5TS2A 1PZFA 1ZMRA 1WULS 1V11A 2CXPA 3ILXA 4RH3A 2W6NA 1WBJB 1X7YB 5AQ1A 3PQDA 1EWRA 1JPJA 4NONA 3ZWYA 1GTL1 1NLFA 3ZWBA 4FEYA 3ND9A 4UTXA 3CQ9A 4RKWA 1ML4A 1YK0A 2GKOA 1EK6A 3HFRA 3TVTA 2YXNA 3CSDA 1G9XA 1YJAA 1MW9X 3PRHA 3QU5A 2O3QA 3A4NA 2AB0A 2EIXA 4I6JA 2CF5A 3S70A 5BMVA 3Q40A 3TIFA 1VPTA 1RXEA 3EGXA 1V4NA 4FPXA 2PNJA 2NU8A 4HTFA 1WTCA 5H68A 2I6UA 2WAMA 1PFKA 2YV2A 4UE6A 5BSVA 2OHFA 3RFXA 4NEQA 4CWAA 3JQ9C 2A5DA 3K9QO 2NZXA 1PYDA 1OZ0A 2BEWB 2C20A 3JAWA 3X2FA 1CJUC 4V0OA 4NFLA 2F67A 4UCXA 3LC1O 1GVHA 2HDHA 3LSTA 4L8FA 4YRJA 1SBNE 3W7BA 3M7IA 2OFWA 3ZHTA 1ZL0A 2JLSA 2RG1A 3OFNA 4GBED 3ZDQA 5BQ5A 1QH1B 5GZ1A 1T0IA 2P62A 4LNAA 5FI1B 1WVMA 4B48A 1M66A 1V43A 4R71A 5KS2A 2O8EA 1YDEA 3T7TA 2VPYA 3KQPA 4AVYA 2QUKA 4E2XA 3G2JA 5AXDA 3WJAA 4E3ZA 5A4DA 1N2JA 4OJNA 4FWTA 4WASA 4FUQA 4GXRA 2ZWPA 3C7TA 4NJMB 4F4JA 2XSZA 4OQMA 2OCGA 2EW1A 2AFIB 3NU1A 4URUR 4MGYR 5IKPA 1MZPA 2C9MA 3QA9A 1SXIA 2DLNA 4X63A 3LRPA 4EAQA 2YFYA 2B2NA 3MWLA 3WQRA 3PEFA 5TGTA 1J2TA 1PL7A 5ALQA 4PYRA 1VIDA 5CBPB 2BGIA 1IAVA 4GIBA 1VKHA 1ZS9A 4LDNA 1QC5B 4XDYA 5L4NA 2WVJA 3GN1A 2JI9A 4EKDA 5L6MB 1KP3A 3EEIA 1O6BA 3QYJA 4AIRA 3OFKA 3GVPA 4A8JB 2O9JA 3RFFA 4DLBA 5I9NA 2GVNA 1LLCA 3S2ZA 1VBMA 3T6KA 3WDLA 1E6LA 2PBLA 1TD1A 4XJVA 1AGXA 1DC6A 2BELA 3TZ6A 3THSA 1Y0BA 1FS4A 1UKVY 1K1EA 1OA0A 2BDUA 2EATA 1J0XO 2P30A 3PL1A 3N0WA 4TL8A 2ZTVA 1DKPA 1L7BA 4UCWA 4KQWA 3T7SA 4EFMA 4ENUA 5HKKD 1F6DA 3V34A 5FL3A 2GPSA 4K9NA 2YWCA 3AHCA 4PIPA 1KS2A 1XZEA 3C6ZA 1FL9A 3QTLA 1YU9A 2RGUA 3PI7A 3L82B 4QASA 3PBKA 4GPAA 4Z2AA 2IU6A 1TVEA 3TF5A 4JI0B 4XM1A 4PC2A 4GOXA 4TGLA 3F98A 5KVAA 3OZWA 1M7GA 1T34A 2PXXA 4BV9A 1A82A 1U2SA 1Y9AA 2VKTA 3DHYA 4KGXA 4R9VA 4WJLA 6YASA 3U19A 4RK7A 1JQAA 4G0ZA 2VQEB 3CUUA 4BLOA 1X3SA 2REXB 5TT0A 3FSJX 1PN3A 1H23A 4BKUA 1RRMA 1F38A 1ZSYA 2DEUA 1H0RA 1DC5A 1P2UA 2QI9C 1UOOA 2VK1A 3PLAE 3U7IA 1CF4A 4P33A 3RYCB 4HV4A 3L4SO 3JYHA 2B4KA 3AWIA 3KR9A 2V7QA 5T4HA 4BFVA 1X92A 3M5PA 2OCPA 4JC0A 4EGQA 4JBWA 1SHKA 1UPUA 1KI4A 1AB5A 3EPKA 1PKXA 2QX8A 4N5DA 4PSAA 3OX4A 2GETA 2CYBA 3OBBA 1J70A 1QDEA 4JNKA 1XPJA 1ANKA 2JJYA 2QPOA 3IP6A 5DWDA 4KX5A 5BN5B 3Q8XB 2WWFA 2KBFA 1II8B 3F3YA 1UBLS 5H9VA 2ZAIA 3BSYA 3TS1A 3QJ5A 3BULA 1AURA 2NO5A 1JXOA 2DWCA 3IQGX 3QOXA 5BVGB 2QX6A 4LZJA 3ZGOA 1EK1A 1ZONA 2I6SA 3HBJA 4G2NA 2N75A 5T4FA 2JK0A 4CM4B 4MI6A 4EDHA 1LSUA 1OFIA 2DKNA 3H18A 3LRTA 2Y4NA 4JWKA 2Q4RA 4R5HA 4EOGA 5A5EA 1QMPA 2QTZA 1IEWA 4KYIB 3K2IA 2CK3A 4A2QA 4HK4A 1M1YE 3CFYA 2VUUA 4LXYA 4Y1GA 3U2QA 1NUPA 1N77A 4C2UA 2FFHA 5AOCA 3W1WA 2OGWA 3BCRA 121PA 3I9LA 3VZBA 2EC5A 2I4NA 3QXGA 2R8PA 1F2TB 4MMYB 1J97A 2IV3A 4IDQA 3C3YA 3QVKA 1BDJA 4ZVRA 1ZESA 2Z8YA 2C8VA 4RS4A 3WZLA 1C9NA 5BR4A 1OHHD 2WU0A 4RANA 1Y5MA 4X7MA 5F52A 4GH5A 3CN9A 4HRVA 5CVTA 1HSOA 2WD8A 2ZVJA 4MPJA 2XB2A 1MH1A 3DDWA 3OCYA 5TMEA 3TSZA 3KEMA 3KDSE 4K40A 4AB1A 2FN3A 2VHEA 2CCGA 2G1KA 3ZCVA 4UM8B 2IJGX 2V0NA 3EZNA 1M2FA 3P9SA 2BV3A 3SE7A 2VT7A 3JATA 2P9BA 2XHEA 2X5NA 3Q9LA 4KTVE 2W2VA 4P4SA 4ZQEA 1DKMA 4ER6A 2YYSA 3KQSA 4JLDA 4LAFA 2EJVA 1QLWA 5BW4A 2FPIB 1P0QA 3CT4A 4B0PA 4Q9JA 5M04A 2RMKA 2R8OA 5A4FS 3QEOA 2JI4A 5IJZA 1NLYA 1PF7E 5DGHA 2J07A 4HLNA 2L19A 3HDHA 1RLTA 2BRUA 5TT1A 3BSSA 5EWJB 3E3AA 1DKLA 1GPUA 3MB8A 1C8KA 2JLCA 4BRZA 3R9WA 1HPLA 2W37A 3L1VA 4Q1FA 3KEFA 4MIOA 4DRZA 4Z51A 2VT3A 4UAUA 4URFA 5TQVA 4G86A 2HMAA 3JQBC 3H4TA 3JD1A 4A8TA 5BV0A 4GG1A 4Y2YA 2R66A 4KN9S 2R8EA 3UAZA 4QPZA 3GGDA 3PX3A 1CQWA 1ACJA 2ZJ3A 3PXDA 4U0KA 1LRKA 4DV7B 3RTDA 5EJ8A 8MHTA 1CEQA 4C87A 5F4ZA 5F5LA 3F9CA 3HA5A 4B80A 4DUGD 1D4OA 4ZVMA 2OL4A 4IV0A 4ZDJA 4X41A 2C7BA 1NQUA 1OA1A 3JQ8B 4U7HA 1G8FA 1UQRA