1QG4A

Canine gdp-ran f72y mutant
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKYGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gtpase
molecule keywords PROTEIN (RAN)
publication title Engineered mutants in the switch II loop of Ran define the contribution made by key residues to the interaction with nuclear transport factor 2 (NTF2) and the role of this interaction in nuclear protein import.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qg4A00
3TVTA 1XMIA 5P21A 4OI0A 1UBGA 1QHXA 1N0WA 5AUPB 5JRZA 4PQYA 3EPLA 2B7BA 3PITA 1OXSC 1HE1C 1TNDA 3GEHA 4MYCA 4EDHA 1TQDA 1NVVR 2D06A 4JL8A 1OYYA 1JNYA 3AVPA 1X1SA 4V0NA 2BIFA 3WBJA 3GJ0A 2ZI5A 4YMSA 4IDQA 4PHGA 1UKVY 4PAQA 1R7RA 1G8FA 5EQTA 1Z0JA 3KQHA 3AF3A 1P61B 2CJWA 4TMWA 2QP3A 1G21E 2W0SA 3CR8A 2QPAA 3QKRA 4JKIA 4Q1EA 2WBLC 4KFSA 4LV6A 3AF1A 2O8CA 1MO3A 1Q1EA 3WRYC 4PSKA 4ARZA 4PXAA 3U7GA 4R9UC 1UJ2A 1CR0A 4B3BA 2EU8A 1CKEA 4Q4LA 2XNDD 3IPXA 1G3IA 1GILA 3QIAA 4HYYA 4AWXA 1Q1QA 2ZU6A 4HAXA 5SZJA 2O5VA 3TJZA 4QJ4A 4H1UA 1U99A 4LPKA 2AX4A 2JLVA 5TDHA 4Q7KA 4ABYA 3NC0C 4II7A 1WQ1R 4QNRA 1G4AE 4KJZA 3VR3A 4Z51A 4JLJA 3QPWA 4JSTA 4A8JB 1TAGA 2ZRHA 4B75A 3TW8B 2QRZA 3EPJA 1NY6A 4HUQB 4W5WA 4JT4A 2HV8A 2PMDA 4F4JA 5B30A 3SOPA 1NSTA 4Q1AA 1RVDA 4DCNA 3MG9A 5CIQA 2C8VA 2PZEA 3CBQA 3EZ7A 3VR1A 2QT1A 2J59A 4Z1MD 2OBMA 3EC1A 6Q21A 4JS0A 3GLIA 2W2XA 1KMHA 5F98A 4POAA 2IBMA 2OBLA 2FF7A 2WZQA 4A2PA 4DLUA 1VHTA 1NLYA 4LRWA 4G0NA 1LS6A 2AWNA 1FL9A 2ZSAA 5B64A 5HKKA 4GL2A 3MD0A 2ZUCA 4JL6A 1YZKA 3QQ5A 2ZJBA 1Z5ZA 4YDHB 1WBBA 2JIZD 3SJAA 3BH0A 4AURA 1SKYE 3BFVA 4NPHA 1UDXA 2GXQA 1T8UA 2Z5FA 2ZM5A 3THWB 4KLZA 4XIGS 1Z3IX 1G6HA 4TMXA 3EZ9A 2CL6X 3ASZA 4TSFD 5GJCA 2R6FA 3GLGE 3P20A 4TL8A 2IYRA 1GKUB 1ZINA 5C18A 2IUUA 4XWKA 4Z54A 3ZVMA 3K0AB 1G8PA 4Q1DA 2ORVA 2V8OA 4B35A 2SHKA 2ZRMA 4HB2A 3U44B 3TRFA 4M9QA 1HE8B 3T1TA 1W36C 1IN4A 1I4DD 3SI7A 4N0EA 3VKHA 2BJVA 2A5GA 3T1VA 1TL7C 4L4UA 4RKEA 2IC5A 2QUZA 4ZDIA 5FOTA 2ZE6A 4OQFA 4Q9LA 2F1RA 4XVUA 3WRXC 5B57C 1OH6A 2HJGA 2GZHA 3U5ZB 3REGA 1AGPA 1Q20A 4PAOA 1Q57A 2FZ4A 3CLVA 4FMBB 1E4YA 1G7RA 2AXNA 2VSXA 1TTTA 2CVFA 2FEMA 1JQLB 2PJZA 4NDZA 4EPRA 4W9MC 1XP8A 3QKSB 3X1ZA 5EXTA 4JLNA 4PC1A 1UBCA 3VQTA 4GP7A 2ASEA 2J5XA 3EARA 4C4PA 4C0JA 1II0A 5L8VA 1E9DA 3D31A 3T35A 2QM8A 2GEUA 3EC2A 4JLMA 1AM4D 1E0KA 1YVDA 2KSQA 2PJRA 1E9AA 3UG7A 4BLSA 3FMPB 2TMKA 3UATA 4HUQA 3A37A 5EP4A 1MRSA 3MAAC 5SZHB 3W5IA 1FPMA 4FMDB 4HLUC 2W6IA 3KKNA 5BW8A 1IN8A 4NCHA 2OCBA 4KCGA 2H7VA 4IOLA 2IW3A 3EAQA 1TF7A 2OBNA 1N3BA 3RAPR 1XEXB 1NP6A 3L8YA 4AD8A 2PH1A 2YJTD 2ZI4A 4MYUA 1NKSA 2A9KA 3GPLA 1HQYE 3KKMA 2Q9AA 5CM9C 1AS2A 1P9WA 4MUAA 1H8HD 4HDCA 2OZEA 4O25A 1QZXA 4NL4H 3ZDQA 3A36A 1DS6A 4Q7LA 2FDCA 1K5DA 3DM5A 2IYVA 2CK3D 1KO5A 2ZUDA 4ON9A 3RRNA 2F43B 4JLBA 5IK2D 4RZ3A 4Q7MB 4LYAA 4GBMA 2MMGA 2ZR7A 4BEJA 4DLXA 1G8YA 3KUDA 4IFBA 4LHZA 1BYIA 4M4SA 3HR7A 1OXTA 4PSVA 3IKJA 2NO7A 4I1UA 1N0UA 3CX7A 4WIAA 5FR2A 4BFTA 2BMEA 2XOKD 2JCSA 2WJHA 4I81A 3VMFA 4AI6A 2B6HA 1E2HA 3AQ4A 3K0AA 1RPZA 2QE7D 3QG1A 4OHZA 5CDFE 1Z06A 1HURA 4N0DA 4EJSC 1E1QD 1XD2A 3AM1A 3W3ZB 1E98A 2V7QD 3QEOA 3C16C 4MYTA 4M1MA 5IRCD 3FTQA 3MJHA 1OH7A 2DCUA 5ELXA 4DSNA 3GLGB 3QXHA 2Q0HA 1G18A 2A7QA 2NG1A 3B1WA 3QVVA 2VF8A 1RIFA 2IYWA 1N6KA 3OF5A 2RKOA 3W34A 2VO1A 2NO0A 4GDFA 1ZD8A 2ZRIA 1X1RA 4DUGD 1ZIOA 5LBIA 3I8XA 3OEEA 2GTPA 1KDOA 3OIUA 1YR8A 3RWMB 1I4LD 3B5JA 1XEFA 3IQXA 3B1ZA 1MR3F 3ZQ6A 4KAXA 1BOFA 4HAYA 3I3SR 1Z28A 5JSZB 4XVRA 3W6OA 1VMAA 1G5PA 2Z43A 4HAZA 3ZVRA 3K0SA 2XITA 1HT1E 3TE6A 2XZOA 1Z2CA 1UDWA 3BORA 4BEBA 1Z83A 4EPTA 3ZZTA 3ZJYA 1KO1A 4P32A 4D4KA 2O0KA 1E9CA 4M9XA 4NHOA 2P6RA 5JWRA 3Q7PA 1KO7A 1KSFX 5TMPA 2PEYA 3ZVLA 2J41A 2VF7A 3DZ8A 4DCVA 4B6EA 1R8QA 3AKCA 2HXYA 3L2OB 4J0QA 1DAIA 3W8NA 3G82C 4XSHA 3BH6A 2XTNA 4IVRA 1DE0A 2GDJA 5EE1A 3NBXX 4MH0R 4TMTA 2N1BA 4DDTA 4URZR 2QQ0A 4NBSA 4DEYA 3P26A 5IT5A 2C5LA 3D3QA 1EFCA 3C7KA 2HF8A 3CH4B 1QRAA 1Z6AA 1WMSA 3K9LA 5HTKA 4AKEA 1G16A 4W7SA 5C1BA 3A1TA 5JECA 4OHVA 4FWIB 3TR5A 2D4HA 4IHQA 1N5KA 4GZLA 3I5XA 1Z08A 2XNSA 1SXJE 2JJ2D 4BFWA 2F43A 1KY3A 2ZJZA 4LYJA 3TUZC 1KK2A 1PUJA 1ZNXA 5AR1A 2W2TA 3Q3JB 3ADBA 1NNEA 3AP3A 1L7VC 1RW4A 2V1XA 4GRAA 3PEUA 1P3JA 2VIIA 1ZW6A 3FVQA 2H57A 3LBNA 3FHCB 5DISB 2X19A 3ZS9A 4UQOA 4IOKA 1T5LA 5KUTA 2J1LA 1Q12A 3C14C 2BMDA 2RAPA 5GJWC 5SZIA 4LV5B 1P5ZB 4RCYA 1Q44A 4PC2A 1CU1A 3C41J 4FMDF 4C2UA 2V6IA 2YINC 4LX0A 3LD9A 1SGWA 2VHJA 4B3CA 2C98A 1U9IC 1O87A 2FSIA 3FKSA 3NWJA 3OIYA 1A5TA 4KYUA 1EX6A 3BERA 4BLQA 2GKSA 3WNDA 5FPKA 1NN5A 3IBGA 3EZ2A 4HB0A 3SBEA 2V1UA 4IOJA 5FTKA 1AZTA 4KFUA 4ZIRA 4IOMA 1GITA 1T91A 1TQ6A 4FMCB 3U3OA 1KI1A 1ZCAA 4UJ5A 4U7DA 2BM0A 1XJQA 3JZMA 4TLAA 3TSZA 2C77A 4PX9A 4W5JA 3IO5A 3CNNA 5JEDA 4C0QC 3U7HB 1GP2A 1VCOA 1YZLA 3PV0A 4JVSB 3P32A 4MKFA 3UMFA 4N3NA 1JPNA 2QMUA 3B6EA 4RVCA 3EPKA 2O8DB 2XAUA 4IEEA 2DFTA 1VG8A 3IUYA 1N5LA 2JJ8A 2Y8EA 4OI2A 4OK6A 1P73A 1U0LA 2EYUA 1Z0AA 1E2NA 1GOTA 1VG9B 3MWLA 4NYJR 3HU2A 3A58B 2ZJ2A 4Q5IA 1NIJA 1G1MA 5EXXA 2JLQA 4G5GA 3TLXA 4LHVA 1V43A 1ODFA 2F7SA 4F93B 3BXZA 4QGHA 1FFHA 5FOWA 2MMCA 4KFRA 1U8ZA 2EFCB 3AVUA 2ZSBA 4HZIA 1OFIA 3VHLB 2VHCA 1SVOA 1ZM7A 2GJ8A 3KFXA 2CCJA 2F55A 4LZZA 4MKHA 4BQSA 4DC9A 4JLOA 3B9QA 2F3RA 4LI0A 3SU8A 3U61B 4OQXA 3FB4A 5EP3A 2R6GA 4S35A 4C0SA 2HCJB 2G0TA 3SE0A 3VR4A 1N6PA 3VU9A 5KPJA 3MFYA 3GJ3A 4AKGA 2FN4A 4YXWA 2EQBA 3L43A 3A1UA 1SXJB 3V00A 1KGDA 1D9ZA 1UBEA 1NI3A 1DAHA 4KV9A 3DM9B 4NYJQ 3PEVA 2GZAA 4R98A 4A92A 4MYHA 4X8MA 1N6IA 1XTRA 4PZYA 1JI0A 4XD7A 5FH9A 1FP7A 4JLKA 4DHEA 1SZPA 3K70B 1X6VA 2V4ZA 3KQLA 4ESHA 4TLCA 1R5OA 1Z2AA 2BHRA 2J46A 2RHMA 1N6HA 3A4NA 1ZUHA 3HPQA 2D2EA 3F3YA 4MKIA 3WBKA 2FG5A 2OAQ1 1GRNA 1LW7A 5EUQB 5CDFA 4D26A 3M6AA 3H84A 1IJEA 3BB1A 4TL9A 1ZNYA 3T06B 2KI5A 2VP4A 3MMPA 1WCV1 3SQWA 2BBWA 3TKLA 3KDSE 2ERYA 2R6DA 3D6TB 4QOSA 1PLKA 4Q9JA 5HE8A 2QAGC 2NZ8A 2VPPA 3SHWA 5L3QB 5L3SA 1OIVA 3A6PC 2BOVA 2NO1A 2GCOB 4QNMA 2JLRA 4MRVA 1W2HA 4EUNA 4LYHA 1RRGA 4G5RA 1NVUQ 1KZ7B 4PQRA 4B32A 4TYNA 1ZU4A 4IW3B 221PA 3MCAA 1D9XA 2CHQA 4B73A 1XPUA 4HLDA 2IXGA 4A4DA 1DG3A 1E2JA 3CF6R 5DYGA 4B33A 3FYHA 2CBZA 3I8SA 3NG1A 3SFZA 3UWOA 1OKKA 3I61A 2W6ID 3VX4A 5HPYB 4HATA 1KI6A 3PVSA 4JJKA 4NKRA 4UNNA 5E4FA 1M34E 1JXMA 2B8WA 4YMUA 4GMXA 1XPRA 2JLSA 3QXSA 4I99A 3T1QA 1G3QA 5C46F 2DWQA 1F5NA 3AV0B 2O8BB 4ZDWA 3DPUA 1UADA 3VHXA 3GLFE 2C04A 1FMLA 2IF2A 4A0FA 4NH0A 4DBLC 1E9RA 1KZGB 1GZSA 1XMJA 2G77B 1RZ3A 2Z4RA 1TU4A 4LJ8A 2IEYA 5AJXA 3SZRA 1W2GA 2OUKA 1S1CA 1EXMA 2F6RA 2F1JA 5HZHA 5HCNA 1NG9A 1LNZA 5CYOA 4PC3A 3PUZA 1WDTA 2GNOA 4CF7A 4FMCF 4M22A 5CK4A 2QI9C 2VQSA 4B2IA 1GL6A 2FPKA 1ZUIA 4JBXA 2ODWA 3DMNA 3THOA 4MGIR 3HR8A 3IDQA 2JDIA 2WAXA 3TUIC 4A36A 3OAAA 4HB3A 2C2HA 3FHOA 1C1YA 2FSFA 3HYTA 4XVQA 1OHHA 3PFIA 5CIWA 1S3SA 4IKEA 4G3XA 1NJFA 1A2KC 5JWOA 1ZD1A 4DIDA 1Q0UA 2ERXA 4Q4JB 4AK9A 2GILA 1II8B 3ZD7A 5CLQA 5JI3E 2IYSA 3NIBA 1YR6A 3IGFA 4ITRC 4UNPA 5K8TA 1IBRA 3TAHA 4Q9IA 4ZKDA 2E1RA 2NZJA 3OEED 2ZJAA 4HUTA 2QAJA 4FCWA 4B3GA 2FU5C 2P67A 4V03A 1KK1A 2VSOA 4JLPA 3CNOA 3ZS8A 2DHRA 1OXVA 1UKYA 1VKJA 1MO4A 3WNBA 2ORWA 3RLFA 1KHTA 2X2EA 3PENA 1T0HB 3BH7A 3ZYCA 2CL7X 1N25A 3AKDA 1GTVA 2IUTA 2OM2A 2JLYA 4YC7A 5CM8B 1TPZA 4PO9A 4D0LB 1P60A 1W49A 1ZNZA 3Q72A 1EESA 1DO0A 2J0UB 2Q3HA 4MGZR 5DI9A 5EUMA 1UAAA 2WAYA 2GEVA 5FPYA 3LFUA 1RJ9B 1XTJA 2D2FA 2Z4SA 4JLDA 4MGYR 2ZTSA 5EZ5A 4CRWB 5BN5A 1XBTA 4BLTA 1KDTA 4D4LA 5JS7A 2HT1A 3AVWA 3THXB 3BFKA 1CEEA 4LDJA 1OXUA 4G5SA 3WYGA 1RRCA 3MWJA 1KJYA 3QXXA 2JGNA 4ZI3A 1N6LA 4HI0E 4PZLA 5BXQC 1KY2A 4TYYA 2CEAA 3K0EA 2LKDA 4DB4A 1E2FA 2H17A 3FKQA 1R0ZA 1D5CA 3WMGA 1VCIA 3RS3A 1W36B 2DFLA 1AQUA 3U4QB 5DI3A 4IDPA 1NBMA 3MWYW 4IDHA 4B48A 4IJMA 3O8BA 121PA 1GNQA 1N6RA 1QVRA 3PR1A 2IYTA 1U8YA 1FX0A 2YC2C 3QG5A 4PC7A 1TX4B 4QJ3A 3P27A 2ZITA 2CNWA 4URWR 4B71A 5E7IA 2NO9A 1SHZA 3HJNA 4EFNA 3GLFB 1A82A 3ADDA 4AG5A 4OJQA 1HTWA 2P2LA 3LLMA 1AZSC 1IM2A 1E99A 1G3UA 1KKMA 2WM9B 2Q6TA 4NCIA 4OYHA 4MKGA 2IYXA 621PA 3SN6A 4UXIA 4JLAA 5IF9A 3BB4A 1NN3A 2XJ9A 4H9GA 1OB2A 2ANBA 1COWD 3KQNA 3I1FA 2YV5A 4UNQA 2GVDC 1P2TA 4PSAA 2ZQ5A 5AUNB 2ZRLA 1YE8A 4Q4JA 1YRBA 1E0AA 3TSWA 2ZRCA 4QRHA 3FKSD 1NVVQ 1V5WA 2HCBA 2QMEA 1GKIA 4URYR 1JAHA 4TZ0A 5TB5A 4MRPA 5F9FA 2YZ2A 1Z8FA 4RD4A 2PT7A 3O8RA 3OIVA 2H92A 3IILA 1FQJA 1I2DA 2Q21A 3AUYA 5CYPA 4V0OA 1KJWA 3NBFA 1WXQA 2DBYA 2RGNC 3RS0A 2IYYA 4FCTA 2ZEJA 4KFTA 2KBFA 3KFVA 4RZUA 4DSUA 3CX6A 1JR3A 2ONJA 3QOFA 4D82A 4DCTA 2J0SA 2J0UA 1EFUA 2CLCX 1UFQA 2V6JA 3JVVA 4TLBA 5FI0B 2YWFA 3R7WA 1E2DA 3CWQA 1XJCA 1RJ9A 4YMWA 3KJGA 4B6FA 5HZKA 1EX7A 3LAWA 4LK2A 2PLRA 3H2YA 2WKPA 4OL0A 3RRMA 1J99A 4FXPA 3TSOA 5KDDA 4O2RA 2WJIA 1KSHA 1CJKC 3LW8A 1Q21A 3OFNA 2B21A 3DO6A 5D3MB 3KKPA 3EA0A 3KXKA 3EWSA 2ZYTX 4XWOA 2GJSA 1ELOA 2X8AA 3K0CA 3LO5A 5A0FA 3IHWA 1NSFA 3K0FB 4NYIR 1VYTA 4QGAA 5DN6A 4B76A 4EJSB 2GF9A 1MV5A 3F5FA 1XCMA 1E0JA 3LWNA 3U4QA 3LXXA 4KBFA 4RJLA 3DMDA 3N70A 5C4GB 5DYIA 4A0HA 1XPOA 1OIWA 3C4JA 4QC2A 1G41A 2IYUA 3VKGA 2VP5A 4TWZA 2FPMA 4QXAA 2GEDA 2YOFA 1H8EA 2WJJA 2IYZA 4DLZA 2RMKA 2Z6VA 3NDPA 1T9HA 5JZVA 1VG1A 2GJ9A 2ZYWX 2QSZA 1WB9A 2O8EB 1IJFA 3HWSA 2PX0A 1E2LA 2ONKA 4NMMA 1DVRA 3L0IB 3CPJB 4JYCA 2VP9A 4NU0A 2QMOA 2YWEA 1OXXK 2QL6A 3GCGA 3GJXC 3IIJA 1M6NA 5FUYA 3WP0A 1P7CA 1W0JD 3BIFA 4OI4A 1GRRA 4UJ3A 2L0XA 2JEOA 2WOOA 3I5YA 2I1QA 2C9CA 2QMHA 4NP6A 1J7KA 4E03A 1SKQA 4BFUA 5FOUA 4HAUA 3QEJA 1FP6A 5DHAA 4ZDKA 1GAJA 1LV7A 2AN9A 3ZGXA 3OHMA 4LJ7A 1RRPA 2ZPTX 4A8JA 2HF9A 1CJTC 2GETA 1XB2A 5AWFC 1NMYA 4WA7A 4C3ZA 2AFIE 3CH5A 5LB4A 4QFMA 2F9LA 3QF4B 3CONA 4F91B 2JJ1D 1Z07A 1G19A 2ZRJA 4OHWA 4BPBA 1KK3A 1Z0DA 4RY2A 5LPNA 1E2EA 4L8GA 3G0HA 4BASA 1ZU5A 4HDQB 5EP1A 3AF4A 5DO9A 4E22A 1TQ2A 2A5FA 5G53C 4C2TA 5G40A 2OV2A 4MDFA 3M4YA 5BWMA 3EXAA 2IS4A 3AH8A 3K9NA 3K53A 1T3LA 4JBYA 4JVMA 2XB2A 3AVQA 2D7CA 1J90A 2GCPA 4R2HA 4TMVA 2I3BA 3LV8A 3THWA 2ANCA 4UKDA 3K0FA 1LF0A 1CR4A 1E69A 2C96A 2BBTA 1WF3A 1ZM4A 2FFQA 3K1JA 3VFDA 4DT1B 3DEFA 4V0MA 4AKHA 4LJAA 1G8HA 3IBYA 5FBVB 2BM1A 3VNVA 1JEDA 3TK1A 1SKYB 1OJLA 2ZYVX 3EIHA 2XSZA 1F3OA 1U0HC 2VA8A 2ZR0A 3LLUA 5G3ZA 3CRW1 3U44A 3HU3A 5EJEA 2OESA 1SVWA 1AQYA 1SVIA 3ND8A 1E2MA 4DKXA 1RC8A 2O8EA 3BOSA 5TY0A 4YLGA 2QA5A 5K8IA 1IONA 4MDEA 4QG7A 3EX7C 1OB5A 4LGMA 1OYWA 4HSEA 3KUCA 2A30A 4NZYA 5EE0A 4PO8A 1DBSA 3RDPA 4D2IA 4ZCIA 2VTKA 4LBYA 4KITB 4BFXA 1CJUC 1JALA 1KAOA 3V4RA 1B23P 2WJVA 1OFUX 1AN0A 3TR0A 1OHHD 3Q5DA 3EG5A 1M2OB 1LB1B 1UF9A 2QT0A 3VR2A 2CE2X 3QKSA 2AD5A 4Q4HB 2BVNA 2GBLA 3PUYA 1GL7A 5F9HA 3K09C 1OFTA 3CF2A 4IVPA 1Z0FA 3QKUA 2R65A 4KI0A 1XX6A 4B2PA 4TLEA 4Q4AB 5DNYB 2OHFA 3NH9A 2W00A 4ZPXA 4CEIB 1Q22A 4W5HA 5A5GA 2REOA 5FPHA 3PG5A 1KNXA 2QZ4A 2RGXA 4PAMA 5H70A 3JZAA 2Z83A 5JHGB 2QGNA 2WSSA 4C0BA 3DKPA 5JFGA 4ASUA 2ZU0C 4LBWA 2R8RA 1TMKA 2WMOB 2IWRA 2ZE5A 2EW1A 5KYKA 1W0KA 1XEXA 1AK2A 3E70C 2XTMA 1ZVQA 2QTFA 4ZKEA 5E7MA 3VR6A 2QROA 3I32A 1MKYA 3KJHA 3LX5A 4YMTA 1RRFA 1XXHE 4KSCA 3LY5A 3QVUA 3BJIC 5KO2A 1OW3B 1R8SA 2FV8A 2DWOA 4Q47A 3TQCA 1S8FA 3BBPA 2YWHA 4S2EA 2R6AA 4NYMR 4DCSA 2ZVQX 4JL5A 4QBIA 1WE2A 1KSJA 2ZJOA 1EFRA 3ADCA 3N2EA 1E2QA 4HEJA 2C9YA 1CS4C 4DT1A 3KQUA 1G8GA 4JZKA 4B34A 3U6KA 4URUR 2ZJYA 3A4MA 3IEVA 2DB3A 3R9XA 1NBMD 2XZPA 5J4HA 1LTQA 5FBWB 1EFTA 4PQFA 2WIAA 4CW7A 1YZTA 2HT6A 3I73A 2WVJA 2J9RA 4DJTA 1U94A 2YWGA 2RH5A 3L82B 3AKYA 3RS5A 1PUIA 4B74A 3GLGA 2CNWD 4MITA 3R8CA 3LVRE 1US8B 2QSYA 3NEJA 2QAGB 3BFXA 3TW4A 4D0GA 3GEIA 2MSDB 4Q00A 5FTJA 3SYNA 1MH1A 5KNBA 3R20A 3PCRB 1E2GA 2Q3MA 3EIQA 4LBZA 3P1JA 2P6UA 4PZZA 5TV2A 2YYZA 2ZI3A 3I92A 4FI3C 3JVUA 4Q01A 5D3QA 4DB2A 1IY0A 3SBDA 1D2MA 2BDTA 1NJGA 2D62A 3UG6A 2IS2A 4L15A 2DFKB 1VECA 1E32A 3K8YA 5DE3A 3LA6A 3HU1A 4BZQA 4CEHB 1DO2A 4B47A 5DH9A 3AEZA 1E96A 5JSZA 1L4YA 3U3JA 2GF0A 1QHSA 3P4YA 5AJYA 821PA 2V9PA 2WIBA 4QBFA 5KHOC 1ZCBA 3SEAA 3C8UA 2XXAB 5EP2A 4LYFA 4Q4AA 1F60A 2C9OA 2NO6A 4QBGB 2GESA 1W5SA 1P4SA 2HUPA 5FUXA 1CR2A 3RHFA 4E09A 2QG6A 1BYUA 1D2NA 4YONB 5FTNA 4A0GA 2D7DA 2FJUA 4B44A 2ZI6A 2NOAA 3ND9A 5FBLB 4M9ZA 4FWTA 2J3EA 521PA 4GOXA 3L0OA 2HDNB 5J4LA 3EWAA 4RFSB 1UKZA 4BFYA 4XJXA 1XZPA 2CXXA 3UANA 2AR7A 3R9WA 1OH8A 3PUWA 3LQQA 1R4AA 1Q1ZA 1U98A 4TYPA 2EVWX 2ZS7A 4KHZA 1BKDR 2OG2A 2ZRFA 3KZ1E 4O0MA 4U02A 1DTSA 2AXPA 5HCIA 2OT3B 4A9AA 4EPVA 1AKYA 4PPGA 1OIXA 1Z22A 2HYDA 5HKKD 4BLPA 2OXRA 4TMKA 4DLSA 4RD3A 5FOVA 3TAUA 2IT1A 5E95A 1KKLA 3W5JA 2EWWA 2VSFA 4F92B 1FTNA 3OFND 421PA 2C95A 1DADA 2YC4C 3TUJC 2WMNB 4Q9HA 1DPFA 3V4FA 2PL3A 1XXHB 2V54A 1E1RA 3AP1A 3GFTA 4M1KA 4LUCA 4Q19A 1IXRC 1O3YA 2W0MA 5CJ2A 4Z8YA 5K8LA 4TSFA 1D8TA 2N46A 3AF2A 4DEXA 4AY2A 4V0KA 3W6NA 1FNMA 1VIYA 3PEYA 2VP6A 2WKQA 2FZLA 4LC0A 4JJZA 3EIEA 4WZBE 2OCAA 1RYHA 2WV9A 1GUAA 3CW2A 1QF9A 1ZIPA 2QORA 4BFZA 4E07A 1E2IA 2RGAA 5FPTA 3Q7QA 2I4IA 1NL3A 3SNHA 1IY2A 4IEIA 1GFIA 1G17A 1GWNA 4MGKR 3UPUA 3FHTA 3B8HA 1HA3A 3QPVA 4G01B 2PEZA 4OBEA 4BGDA 1E9EA 1AKEA 4LJ4A 2CHVA 4L9WA 4R71A 1NY5A 3QY0A 4TL6A 5FFMA 5KSYA 3WYFA 3J81k 1G5RA 2W6JA 5EZ6B 1P9NA 3DDCA 1MRNA 2ZREA 2O8FB 2XXAA 4JKYA 4JYBA 4A6XA 4AG6A 3T5GA 5EXPA 1T3HA 4TMZA 2X2FA 1PV4A 3TGPA 4GMDA 2OCYC 4KVGA 2O8DA 3QXCA 3DKVA 2NMVA 1NN0A 1TF2A 5GADl 4ERNA 2CDNA 2R2AA 2RHDA 2NPIA 2ODBA 1BIFA 3LH5A 2ATVA 3EA5A 4JBWA 3HPRA 4PHHA 4UNSA 3FFBA 3ICEA 2UZ3A 1QBKC 4TT3A 2ZI7A 1XF9A 3BRWD 1OF1A 2IX3A 4M1OA 3RYTC 4A2QA 1CRPA 1L4UA 3CZPA 1G3MA 3NXSA 3SDZA 2GK6A 5KSOA 1S3GA 4Q02A 4DWJA 2A3RA 3RS7A 1S4QA 4PFSA 3CWZA 1R0YA 2WPDA 3X1YA 5B58C 2QPTA 3ZH9B 5DGXA 5JWHA 4AC9A 1P9RA 1H8HA 3UIEA 1G6OA 1QHYA 3D7MA 4C0KA 1AJEA 3KTAB 2RGEA 1BMFA 1XCPA 1XTSA 5L3VA 4L9SA 4GOJA 3B60A 4JIMA 4TTPA 3PQCA 4U00A 1XJ0A 1XTKA 2HLDA 1F2UB 2G6BA 4GP6A 4Y0AA 1Q3TA 5IK2A 3BS4A 2C99A 2XTZA 2ODEA 2CLDX 3PUXA 3T61A 2RGCA 1EFHA 5JJKA 2KBEA 1YHNA 3SHFA 2ZSFA 1IAQA 3FWYA 3NBYC 4JT2A 3SYLA 1SXJA 3ZZUA 4ACBA 3BE4A 4GI7A 3AUXA 1ZM2A 3NEYA 2X77A 4IVQA 2J7KA 3U3MA 4TQAA 2XSZD 1FNNA 2QE7A 3KL4A 3PUVA 1IN5A 2WWYA 4LJ5A 5CK5A 2OEPA 2FSGA 1SVMA 1KOFA 3I4LA 1T6NA 4YDSA 1E1QA 1R2QA 1M8PA 4GPTA 2UZIR 3MJRA 3X1WA 4BRWA 2GXAA 2EYQA 2DPXA 4WW0A 4CDGA 3BGWA 4MA4A 4P4UA 1QHNA 1BO6A 2ZYUX 4BZPA 3M0EA 4Q66C 2YOGA 3QKRB 2VH5R 1WRBA 1HY3A 3K9GA 3LQRA 4DUGA 2Z0MA 3E1SA 3B2EA 1S9HA 2F1HA 2WSMA 2XX3A 3NBZC 5CB6A 4ARZB 1U90A 1CBUA 2R6CA 3GEEA 4HLQB 2GCOA 3K9HA 3GJ7A 5JRJA 2CCGA 2GCNA 3LBHA 4PPFA 5JCZA 2C78A 3Q8XB 1II9A 3AVXA 5KNCA 1SVLA 5BQ5A 3A1SA 2Q9BA 1VYVA 4CT4B 4WAUA 5TXGA 2D74A 5KPDA 4RD1A 2JATA 3CKLA 2W2VA 3CIOA 1LY1A 4M1WA 3B78A 2QTVB 5KDOA 4BFVA 1DAGA 4JVLA 1W4CA 4DZZA 4LJYA 4X8OA 5FBRB 1JEEA 4QM6A 5DSZA 2GVZC 5FBQB 4ASUD 3GJ5A 3CRQA 4HB4A 3THYB 2J0QA 2EFGA 3CRMA 1P6XA 4KSBA 1E3MA 4B2LA 2N42A 4G5QA 1KAGA 1N0VC 2CE7A 3U7FB 1ZRHA 3ECCA 1W0KD 2LCFA 3ETLA 3LDAA 3VX3A 5JJIA 3WYAA 4BWYA 1KMHB 3GFPA 3IIMA 2O8BA 3AF0A 3IO3A 2IEZA 3QPUA 4A6PA 2ZRGA 1FUKA 2OE2A 4TYQA 3W6PA 1PLJA 4A82A 1HH4A 4KODA 2GA8A 4F4CA 4MQBA 4OI1A 2ZS9A 3TVDA 4F4IA 1EWRA 1YQTA 3FMIA 4Q1FA 1R10A 4LCBA 4RD0A 1W5TA 3T5DA 4EKDA 3RC8A 1SQ5A 2B8TA 5JHHB 5KDLA 4GFDA 1ZMXA 5LD2C 1F2UA 1MO6A 2WKRA 1FUUA 2ZROA 1EK0A 5FUVA 1AIPA 1ANKA 4I1OA 5GVRA 3RS4A 3CZQA 2FNAA 2FSHA 1GRQA 2W58A 5FOXA 4WXPA 3VNUA 1LVGA 4IFEA 4EPWA 3E5HA 1KYIA 1E0SA 2FFHA 2WWHA 3CNLA 2BV3A 2QPOA 2KJQA 2OFWA 3MUFA 4TTRA 3VTKA 2FE4A 5EXSA 4ZO4A 1G7CA 1IN6A 2AKYA 1Z47A 1K6MA 4ESVA 2E87A 2V55B 4XH9B 2IS6A 3B1VA 1S96A 2ZVPX 3UWKA 1KK0A 2NQ2C 1KI9A 2EFHB 4M8NE 4QGGA 1II8A 3QE0A 5BN3A 2R62A 2RGNA 4K81B 4LOAA 4M21A 2P65A 3T12A 1Z63A 1IN7A 1QHIA 1UM8A 2WWIA 2ZUBA 4YMVA 4IXNA 2JLUA 4DVGA 3OE7A 2BCGY 4BFSA 1QG4A 3ZZ0A 2C03A 3U2QA 4RFVA 2PCJA 4M9SA 1QG2A 3TIFA 3B1XA 2XGJA 2IHYA 2FA9A 3R8FA 3PJRA 2GXSA 1K5GA 1YZNA 3KKOA 5JJLA 4UNRA 1R0XA 3RWOA 4NTZA 4O3MA 4TQ9A 1Q3HA 1OLOA 3QBVA 4QHYA 3HP1A 1L8QA 2FX3A 1NIPA 2QTHA 1M1YE 1J8YF 3I62A 3RABA 2H8KA 3KXLA 3U3RA 4H1VA 4M1YA 3H4MA 3THYA 3THXA 2QN6A 2AK2A 4CVNA 2FEOA 2H16A 5L3RA 1E2KA 1F6BA 2GJKA 4LHXA 3ZIAA 4BRUA 5DIFA 2A5JA 1DAEA 2G9NA 1OFHA 1N5IA 3AGQA 3AB3A 1WP9A 2NTYC 4M1TA 4L5BA 1TEVA 4BLRA 3MLEA 2WWFA 3X2SA 2LWIA 4R7ZA 5AK0A 3DHWC 2FH5B 2P0EA 1ZM3A 4D4MA 2CLSA 1ZC3A 3LBIA 3GFOA 4GOKA 2AL7A 1VPLA 4B3DA 5GVSA 2ZRAA 5HE9A 4EFMA 3LX8A 4IDNA 1BH2A 1OV4A 2QP4A 1CULC 4C9BA 3GD7A 3E2IA 1SVSA 1MO5A 2HEIA 3RRYA 3ZQJA 4B43A 1C9KA 1ZJ6A 3TMKA 1XWIA 1OH5A 4UXJA 2DY1A 1E1RD 3GLFA 1XTIA 1T3SA 4F7WA 3IIKA 3O8DA 2XB4A 4E5UA 3ICQB 4C30A 4YXWD 2DR3A 3A4LA 4ZV4A 1JXOA 1NVWQ 2ZRNA 2KE5A 3QBTA 2JAQA 4XD7D 2A2ZA 3FFAA 3K0CC 2E9SA 1U2RA 2PLFA 4NYIQ 1WBDA 1J70A 1XD2B 1YJ5A 2IL1A 4WZAE 3AVYA 2F9MA 3T34A 1LFDB 5EE3A 721PA 2ZR9A 2GRJA 1M74A 4LC1A 2GXUA 4HLUA 2NGRA 1W4AA 2GJAA 5FR1A 1XD8A 2OAP1 2OFXA 5KOYA 1PJRA 1T4GA 1ZP6A 2HJVA 2QENA 5KSZA 2PX3A 1TADA 4P4SB 3F0TA 2IK8A 2MSEB 1ESMA 1TUIA 1E6CA 1J8MF 1W4BA 2UKDA 2WJGA 1F2TB 1Z6YA 3WNCA 4B3FX 3I72A 4AIIA 3KJEA 3F8TA 2W6JD 3AVOA 4EQ6B 1TU3A 2VHTA 3CRRA 2VHUA 3EPHA 4EFLA 3BK7A 4WOPA 2A5YB 3ADKA 2IUSA 1UPTA 1X8KA 4Q9KA 1GG2A 4K46A 4CYMA 1ETUA 3T15A 2EFDB 2ZSEA 2AD1A 3CX8A 1G64A 1VTKA 4LSGA 3GLHE 1T0JB 5ANRB 1WA5A 1E4VA 4V0LA 2FWRA 2WHXA 4A2WA 2A5DA 3HDTA 1A2BA 4N1AA 5FL7A 1OKKD 3W3AA 4KBGA 2VRWA 3EZFA 5J4YA 2JLZA 3U6BA 1F48A 2WWWA 3B9PA 3MRSA 4TT3D 5JLJA 5D3MA 1KI4A 3DZDA 2FGJA 2ZRKA 5JBQA 8OHMA 1KI2A 2A78A 2QM7A 4PANA 4I1SA 5KSPA 3RNLA 2JLXA 3VKWA 5BN4A 2QRNA 1R5BA 2WJYA 4A8JC 1RFLA 1W44A 4Q18A 5B2ZA 3LRPA 3AP2A 4EJSA 2WPDD 2OLJA 2PMKA 4US2R 3Q5EA 1NLFA 1IHUA 3H86A 1E9SA 4BZXA 5AUOB 1KDRA 1Z6GA 4I1VA 1HUQA 3QNUA 3W8RA 1C4OA 2F3TA 4DCUA 4PTLA 2IHBA 4Y0VA 1BMFD 4Q1CA 4CZ2A 4DIEA 5C4MA 3QSYA 3LXRA 1FTSA 4OHXA 3P4XA 4RKFA 4XWAA 4D81A 5FTMA 2HLDD 2UVQA 4M53A 1HEIA 5K8UA 5LB2A 2KB0A 3G5UA 1JECA 2REBA 1CLUA 5TARA 2VHQA 4QM7A 1D2EA 3BD9A 3TQFA 3SJCA 1SXJD 1CJMA 3FPAA 5FTLA 1KTVA 3SFVA 1XMVA 3UXMA 2JDID 3ONWA 4URVR 3K09A 5F2EA 1GNRA 3FMOB 3DVLA 3OAAD 4DLYA 4QBHA 3PIRA 3K70D 4M2LA 3LNCA 2BEKA 5CJPA 2BWJA 3W90A 4OHYA 2FGKA 4KO8A 1KJZA 3DL0A 3OEHA 4UXHA 3X1DA 3VR5A 4LHYA 2NPFA 1JR6A 4OK3A 1ZNWA 1GDDA 4FW9A 1KIMA 4L16A 1XFAA 4QKQA 1SHKA 4PHFA 3WHLA 4QGFA 4P4SA 3RRZA 2V3CC 4EPYA 4DLTA 1F2TA 1S9DA 2VEDA 4EQ6A 2BBOA 2G83A 2R9VA 1A7JA 4PPQA 3BWDD 4M1SA 2J7PA 2OCPA 2ZRBA 2O52A 3SC3A 1GM5A 2QBYB 4OKSA 4ZIRB 5E3HA 3QXJA 4V02A 4AKIA 3KJIA 1LS1A 2Q9CA 3QF4A 1CRQA 1VDZA 2RGGA 2WICA 3WMFA 3AKEA 1S1MA 2XEXA 4Q48A 1RYFA 4JVNA 2DWPA 1XMSA 2PCLA 1Z6XA 3GJ6A 1JJVA 1ZM9A 1W7AA 2NIPA 2BBSA 1U8AA 1E2PA 2ATXA 4D6PA 1AS0A 2BJWA 3IEUA 5LDDC 4DDVA 2GBLC 1ZBDA 3NDBB 1W1WA 4HZUB 4PC6A 3MSXA 3CR7A 4AYTA 1PVOA 2J0VA 3FGNA 4ZDJA 1ZAKA 1YU9A 5JCPA 1KO4A 3D8BA 1GNPA 4BUJA 1HYQA 1E79A 1JPJA 3EW9A 3AVTA 2GAAA 1G3RA 2YHSA 1GVNB 3GLHB 4M0LA 3RVBA 3KB2A 4DLRA 1X8LA 1R6BX 4CEJB 4OK5A 1S0UA 2MSCB 2G0NA 1JB1A 5G3YA 3X1XA 1DAFA 5SZKB 1JAIA 3RSLA 3S1AB 4AYWA 4RZ2A 4CGZA 2AK3A 4JMPA 2GHIA 1G291 2HXSA 4G1UC 2VBCA 1NMXA 2BEJA 3KX2A 4HAWA 3QKTA 1U9IA 3WXMA 1GL9B 3PXGA 1AA9A 1SVKA 1P62B 2CMKA 2QY9A 4IXMA 5DLQC 1VHLA 1SULA 2JASA 4G5OA 1P2SA 1YZUA 4P0TA 3TNFA 4NONA 1IQPA 4TZ6A 1HV8A 1BS1A 2ODNA 1YRAA 2H5EA 4XTCS 1XNJA 4O2LA 3CPEA 3KB1A 2IYLD 2OO7A 3R9IA 1I4TD 1Z0IA 2ZRPA 3UMRA 1DARA 1UBFA 1JQJC 4GNKA 3VU9B 3FOZA 1KI7A 4NYMQ 1W47A 1R5NA 3WP1B 1KI3A 1VCMA 2PZGA 1CR1A 5H68A 3TBKA 1COWA 3SJBA 1G7SA 3ZVNA 2AKAB 3GP8A 4XTRA 2XNDA 1U0JA 4Q4HA 4WXRA 4LHWA 2VL7A 4ZCMA 2WWXA 1VYUA 4B3XA 1AGRA 4EAQA 2DYKA 5JMTA 1NRJB 1RKBA 3CB4A 1MOZA 2XJ4A 4CEIA 3PEWA 3AVVA 3NHAA 1CTQA 2QGZA 3NH6A 3FMFA 2WOJA 3UKDA 3GJ8A 1Z6TA 3NC1C 3OE7D 2IA5A 2O0HA 2ZI9A 4D80A 3BC1A 5H8WA 5L3SB 1DAMA 2QBYA 3GJ4A 4RD2A 4A15A 4HDOB 1I2MA 2ZIAA 5FOSA 2OSBA 1PLLA 3C15C 3LW7A 4RSGA 4F38A 1N6OA 4FCVA 4DLWA 1N5JA 1JR3D 5EE9A 4LJ6A 2R44A 4Z1MA 1P75A 2RCNA 4LWZA 5GJBA 4BE7B 2QP9X 4CIDA 3H1TA 4KU4A 2IS1A 1VCNA 3KKQA 1DAKA 2OLKA 2YOHA 4LY6A 2VP0A 2YNMA 5FUWA 4EIWA 1G4UR 2CHGA 2ZANA 1EG7A 2OILA 4TQUS 4U5XA 4HZUA 4MRRA 1PZNA 1T8TA 4OQNA 1KMQA 4PR0A 2D3WA 3QJYA 4DSTA 3TH5A 2ZS8A 3ZIAD 4URXR 3KQKA 4AYXA 1UKEA 2QU8A 3CF0A 2AFHE 2AHOA 1GIAA 4KXFB 2WTUA 3GLHA 4CT5A 2JIZA 1KI6B 1KSGA 1CF4A 3REFA 1NBME 4CEJA 1W46A 4NE2A 5AJWA 1MABB 2GWHA 3NVAA 1E9BA 3IQWA 1GSIA 3MGCA 5DN6D 4LPSA 1IXZA 3WHKA 2RGDA 2Q3FA 4HLCA 1KNQA 5AUQA 5TVKA 1W36D 1IOZA 2HYIC 3S1AA 2ZJ8A 5BYKA 2IYQA 3NKVA 1E94E 4Q7JB 1OE0A 1X8JA 3QUSA 5CLLA 1XD9A 5JS8A 2GAOA 3GMTA 1ESNA 2VYFA 1NF3A 1H8ED 1XCGB 1JBKA 1XU4A 4C7OB 2ZAOA 4XSGA 1US8A 3A1VA 3BAFA 4WVFA 4C0HA 2QAGA 1QHGA 4KVAA 3L0SA 3MWKA 1TQ4A 2ZXUA 5BYJA 5KTYA 4OQLA 3C5CA 2B7CA 3OZXA 5J4KA 1CJVC 3L0PA 5FL3A 1XDBA 4RD6A 2CVHA 2IF0A 1NMZA 2OFOA 3M1IA 3SR0A 3OIWA 1FZQA 1G9XA 5J47A 4LBVA 1B0UA 1XEWX 2ORIA 4MRSA 1XZQA 3NTUA 5AJVB 1YR7A 4LV8B 3EASA 2H1LA 4TYWA 2VP2A 1VG0B 1W0JA 4WZ6A 4CEHA 1E9FA 2P6NA 2F1IA 5J4VA 2FOLA 1IXSB 2EWVA 1YR9A 2ZE8A 3T1OA 2G1JA 2H18A 2P5TB 1OSNA 1NKTA 3N2IA 5J5CA 4GZMA 5C2JB 5CITA 2RB4A 1TUEA 1T5IA 4PPNA 2O0JA 3RS2A 2I1VB 4YQFA 2ZRDA 2B92A 2BMFA 4BLOA 2XZLA 1RE0A 3O8CA 1TEXA 1QDEA 1YKSA 4QHTA 3Q85A 1JR3E 3GLIE 1H65A 1HQCA 4MUBA 2ECKA 1L2TA 2P3SA 5KU1A 4TLDA 2ZSDA 5FI1B 4RFSA 4BECA 4D0NA 2J45A 2OXCA 2YKGA 1FOEB 1DG1G 3DOFA 1ZC4A 4ILEA 4Q21A 3GQBA 2JJ1A 1FW6A 3O47A 3B85A 1FQKA 1Z0KA 2ZAMA 4IRUB 3OESA 2GK7A 4US0R 3RSOA 3SJZA 3ZD6A 4P4TA 3B7GA 2PBRA 4DRZA 2ZJ5A 1ZD9A 5EE5B 5LD2B 4D25A 2KWIA 1Z29A 5FL7D 5L3QA 4C0LA 1JJ7A 1Q1BA 1VIAA 3LVQE 1QHHB 4MRNA 4A1FA 4NCKA 3HYRA 5DHFA 3VAAA 2JLWA 4ACAA 1LF5A 1OPXA 3U7EB 3BB3A 2CK3A 4PO1A 4NCNA 1MABA 1DELA 1XXHA 2FFAA 4GSYA 3L8ZA 5JI2E 2QQEA 1KO8A 5CB8A 2PZFA 3UMSA 3Q9LA 2QNRA 3SQXA 4KLNA 1K8RA 3B1YA 3FDIA 4RZXA 4XOIA 1QVAA 1IY1A 2AWOA 2YVUA 4DXAA 5IDVA 5H1YA 4QL3A 4C0AC 2XOKA 3N5CA 4FINA 5DI3B 1W48A 2ZE7A 3A8TA 4KYIB 2REXB 3H0KA 4OJKA 1N2CE 4TL7A 3QENA 2QEQA 5GJVC 1CXZA 4C7OA 1J2JA 1NN1A 3CRVA 5KNDA 4D4JA 1DOAA 2V7QA 1NLZA 2G1KA 1X3SA 5UKDA 4DDWA 3IHLA 1P72A 2ZETA 1FX0B 3ASYA 1G7TA 2W83A 5FPSA 5M04A 4R2IA 2IWHA 2CJWB 1M7BA 4I4LA 2JA1A 4K8OA 3W9YA 2G88A 5F3WB 1G5TA 1CIPA 1TF5A 3UK6A 4JSYA 4PHTA 1EWQA 4IDOA 3C5HA 2O8CB 3RC3A 2FMXA 4GT1A 3NHBA 1U81A 1DEKA 1S2MA 4FIDA 1YZQA 2GZDA 4QJ5A 1Y3AA 4TTQA 3U60B 2CCKA 4DLVA 2O8FA 3OEHD 1SXJC 2DFNA 4TN1A 2J87A 1NVXQ 5J40A 3AGPA 5A4JA 4Q03A 2EFEB 3RANA 2FPLA 2G3YA 4Q1BA 4NCJA 2WWGA 1EGAA 5JEEA 1ZYUA 3K70C 4OQMA 1KI8A 3IPYA 4JLVA 3CUEF 2BCJQ 2CL0X 2PT5A 3V9PA 1X86B 1P2UA 1M7HA 2J7PD 1MT0A 4FD2A 4HAVA 2WSSD 2BKUA 1A4RA 2LKCA 4US1R 5IHPA 4A0RA 5HR5A 3B82A 2FFBA 1G20E 3SYKA 1KDPA 4LJ9A 4P3YA 2VLIA 3SS8A 1Y63A 1A1VA 2RGBA 1ONBA 1OT3A 2X1VA 1HT2E 3GLIB 1AS3A 2K5UA 3CPHA 1M7GA 1NG1A 3WY9A 2BKEA 4P31A 3U3KA 2IXEA 1FMJA 3R7WB 3A1WA 4X8LA 1UEIA 3QF7A 1QHHA 1W4RA 1XEWY 4ZCLA 3KTAA 1XTQA 1P2VA 4WBSA 3QI2A 4EPXA 3DOEA 3EZ6A 2IXFA 4V0ME 1XRJA 4Z8XA 2P5SA 1N6NA 4RCZA 3WMEA 4DDUA 5E7JA 1E79D 5G41A 4ZI2A 4FN5A 1GKYA 2JJ2A 2BC9A 3FE2A 3CM0A 4P33A 1EFRD 1YZGA 1ZUNB 4QHSA 1D6JA 2BMJA 1CP2A 1UEJA 3ZLJA 4DSOA 3CO5A 4X8HA 3KXIA 3B13B 5AJZA 1R0WA
chains in the Genus database with same CATH superfamily
1XMIA 5P21A 4L2IA 3EDYA 3DE7X 1UBGA 1QHXA 2JFVA 3NKLA 2P35A 3Q7RA 3IMCA 3DMTC 2CT8A 3EPLA 3P45A 3L4BA 3I9V1 4GVPA 1PBTA 1OXSC 4UEQA 4JXXA 4ZV7A 4PRLA 4FHDA 3IDOA 3SDBA 3H3JA 1Z4JA 4QECA 3IMKA 2YN4A 3I5AA 2BIFA 3GJ0A 1QHEA 1L3IA 2DERA 4I1IA 1CUDA 3VR3D 4BE9A 5B1EA 2QTTA 3T0FA 2V7VA 3IC5A 4YBZA 1T4DA 3UAYA 2QP3A 5EEHA 4P6VF 1A77A 4TGLA 5KNBD 1RZRD 3E8XA 3JQEA 4DA8A 1YCHA 2QPAA 3QKRA 3SC6A 3LOQA 2I67A 5SY9A 2PVSA 1I1QB 1AB5A 1MO3A 2WUWE 1DCKA 1EVLA 1LI5A 5LZ5A 3NIDB 1U7PA 4FJ1A 1ECPA 3HB9A 3TOXA 4U1RA 3PVCA 2QRLA 1CR0A 4EEKA 4ZRDA 1Q0PA 5A0TA 2XNDD 3QYJA 4KXYA 5ABPA 4EVQA 1DKOA 2JHGA 3IPXA 3RSSA 1HETA 2V0GA 3UMGA 1YVUA 4KN6A 2PX2A 2NTVA 2ZU6A 2JLVA 3EIOA 2HSWA 1C29B 1E3TA 1ZZGA 3V32A 3N5KA 3Q87B 4L7QA 2AV6A 4M0PA 1ZGBA 4Q7KA 4QEDA 3QE9Y 2GRAA 3SOZA 2BY4A 3GRVA 2X22A 3HG7A 3G2IA 4KQCA 4IIXA 4XJVA 1GAEO 4Z51A 4JLJA 2XDAA 4YTEA 5AW4A 1NX6A 4QFDA 2Q2NA 3IULA 3K5IA 1KP2A 5F33A 1MJNA 4KAJA 3TCKA 2QRZA 4A8JB 1ZJZA 2V8BA 4HUQB 2P0AA 4JT4A 4YEDA 3BCHA 3H97A 2P30A 4MR9A 2J3IA 3SOPA 3VR5H 1NSTA 1OYVA 4DCNA 1T2NA 4MMYB 3W2EA 4ENSA 1CUEA 1YASA 2D8AA 2P9EA 2Y66A 1ZCJA 4ICIA 1KJQA 2QRQA 4TYMA 2QT1A 1J4AA 3ZWWA 2OBMA 4M0EA 2PRJA 3GLIA 3KZVA 2VDOB 4M0UA 4IZ6A 2E37A 2BTQB 2IBMA 3KT8A 2FF7A 3PXEA 3DP9A 1RU3A 4MRAA 1T36B 2YWXA 1VHTA 4MUIA 3WL6A 4AJIA 2WUFA 3JYNA 4RK0A 5F77A 4GI1A 2ZSAA 1O9GA 5B64A 3R7LA 3LXUX 3VMMA 4R81A 3SIPA 4LECA 4QBKA 5AVYA 5LMZA 1D2CA 4B40A 3DNFA 2NV0A 4B0OA 5FD8A 1WBBA 5E6UB 2JGIA 2FPUA 4YMHA 1UDXA 2GXQA 1FXSA 1T8UA 2Z5FA 3M6VA 3WQRA 5CDTA 1FC0A 5ADHA 2V7WA 1C8VB 4N0PA 3ZJVA 5IXYA 1G6HA 4TMXA 3AETB 5DZSA 4A91A 1YR3A 4COOA 4QD3A 5GJCA 3O2QB 5BW5A 1VL8A 3GLGE 2EL9A 4AJEA 3OPVA 1GKUB 1U02A 2XHZA 4IUBS 4DA7A 1SUWA 5AVUA 4X84A 2IUUA 5LKAA 5ITZB 3C85A 1H9AA 2FSPA 2L18A 4EHNA 9MHTA 3LBFA 4DMRA 3QU5A 4FNGA 4MGHA 5IJXA 1VPTA 2CC2A 3DAFA 3I42A 1U3WA 4IZOA 4EKIA 3T1TA 5EMMA 3SI7A 2Z30A 3OM0A 1KAEA 2BJVA 5BQXA 3ZXXA 1TL7C 1R6AA 2AI1A 4RKEA 1CQJA 4F45A 1BRMA 3E9DA 4MQLA 3HA5A 4LXUA 4RKYA 4ZDIA 2PIAA 4G9GA 4OQFA 3P9IA 1RZUA 2XGGA 4BNJA 4Z4QA 3NHFA 5ED4A 3HN6A 2ZB4A 1LH0A 4EYQA 3TD2A 2I7XA 2A0YA 1JWLA 2Q3LA 1ADGA 4GM1A 1Q57A 4XQEA 1O94A 2FZ4A 2HKIA 1T34A 1N5DA 2VSXA 4CM4B 3RF7A 2CVFA 3A70A 3T5TA 1SUEA 3C6KA 4E2XA 4LFCB 1PWHA 2J3LA 5JFTA 4TS1A 1SBTA 4R2WA 3JRWA 3QKSB 3F6SA 3X1ZA 5A9SA 1LDGA 3G2OA 5B3JA 2XV1A 3E3AA 2QF7A 1NXQA 4RHCA 5FTWA 1DKUA 3EC2A 4JLMA 1WSWA 13PKA 2R7NA 5DP1A 2YBEA 4UZSA 4G5HA 2WUGA 1OD6A 2HADA 1P77A 2D5CA 4GMGA 5CA0A 5TR9A 2MOKA 2F1OA 3SHQA 3FMPB 3H6GA 4MVJM 3UK7A 5INTA 5LL6P 5COAA 1A7UA 3MAAC 5SZHB 2FN7A 3VOBA 4FP9A 1KZ1A 4FMDB 2W5UA 4LXGA 3VYWA 4I50A 2X8WA 2EZTA 4JB8A 2IW1A 4I2VA 4UAVA 1XMXA 3EAQA 1L6IA 3N2YA 1KERA 4HFMA 1TF7A 1UKBA 1P4JA 3JQGB 5CFMA 1TIKA 1MEJA 5JS1A 3CH7A 1XALA 2YV4A 4HBGA 4HDAA 2EL7A 1ZXXA 2O3TA 3O8OB 1HG0A 3RYCA 4MYUA 4MI3A 1NKSA 3CQ9A 3OZDA 1SEVA 4F7DA 2W42A 5IKMA 1J2TA 1HQYE 2VVTA 4JCOA 5BR4A 2YUTA 4DCJA 1U2GA 1H8HD 2HY7A 4W4TA 4WN9B 2Q2QA 2LXNA 4HDCA 4NL4H 4Z6KA 5ECDA 1K8QA 1MAHA 3R23A 4CKXA 1DS6A 2Q46A 5EHQA 2P7HA 4QUHA 1RPNA 1XNHA 2OXFA 1MP0A 2J67A 2CK3D 3DM5A 1V2GA 1ZWKA 4LNUA 5JV5A 1NDUA 2F43B 3HXTA 2OVFA 1UBTS 2D54A 3EEQA 4Q7MB 4LYAA 1PSDA 3VUEA 3ZHRA 1I6KA 2ZR7A 4DLXA 1WUIS 4R8MA 5D87A 3GHHA 2CLKB 1HDCA 1G8YA 2BSQA 1YQWA 1QR6A 4M4SA 2CJYA 3HR7A 1DX4A 2PTHA 1G42A 2PZMA 3IR5A 4PSVA 3CX7A 5IM5A 5IDWA 3D3WA 4G4SO 2I3DA 5FR2A 2BMEA 4Q16A 2E5WA 1E3LA 4RBNA 4YFYA 2X6TA 3GDHA 3RG2A 3RHSA 3FVWA 1EB9A 1AO0A 2ZUFA 3OFSA 4CUJA 4K8RB 1HURA 5BUSA 4F9FA 4EJSC 1E1QD 3AM1A 3WL8A 3N58A 2V7QD 4M1MA 3KJQA 3R9KA 2NNLD 3I0MA 4EUFA 3PE4A 5IRCD 1WZNA 2DCUA 2LNDA 1PDOA 2JIBA 1L8XA 1CUSA 2FRXA 4AUMA 4EY3A 5DNWA 4WXMA 4Y18A 5BV2P 1RIFA 2IYWA 4K9LA 1U3TA 4KMRA 5EFOA 4C4RA 4RV4A 4MJLA 2P4EA 2H4WA 3QPAA 1FY2A 3EXHA 4ZT7A 1DIGA 1X1BA 2NXCA 1L4BA 5DGTA 2F9FA 3JARB 1NI4A 1OMOA 5E6SB 1HL3A 5LBIA 2ZXFA 3SR4A 4E2ZA 3QHQA 4K86A 3U4MA 4YNBA 1JJFA 3ZWYA 1A2QA 1BMTA 3C3YA 4KAXA 1K86A 1XZNA 5K45A 1GADO 2ZIXA 1QU3A 1CRWG 5IC6A 1T15A 1N2JA 1TZJA 3H9GA 2RBGA 2XYVA 1EXDA 4PIVA 3OTGA 5CFLA 1EU1A 1QIIA 2PKEA 2XITA 3H83A 3HCFA 1CX9B 5JOQA 2RH4A 2XA9A 3GG2A 1AKWA 1Z83A 3D2BA 3ZZTA 1KBQA 4BB6A 3N0WA 3PZRA 3ZJYA 3CF4G 2P6RA 1FSSA 1I30A 3G13A 3UN1A 4GSLA 3EPPA 3DGFC 1N8NA 4D9KA 2DR0A 1T6XA 2PD6A 5FB3A 3ZVLA 3HB4X 4M6WA 1HKHA 1DP4A 2EF1A 3I2YX 2HXYA 3CLRD 1NBIA 3B5IA 2I6UA 5DWDA 3COPA 2P6MA 3G82C 2XTNA 1G5QA 2Z98A 1P29A 2C7GA 5EE1A 3NBXX 1ONNA 1YQDA 5HOQA 2N1BA 4ZN6A 1H2RS 5CVUA 3ZHTA 3OLWA 3TCXB 4BAUA 4DEYA 5K09A 2YIDA 3P26A 2HF8A 4I6EA 4F6CA 4G0ZA 1Z6AA 5JARA 5HTKA 1PNRA 5LXTA 1G16A 3IERA 2O1XA 5C1BA 3BD8A 3TPFA 4OHVA 1V1RA 1ATIA 3T5BA 3ELDA 5EJ8A 1Y8QB 1DQNA 3D3JA 2EGUA 1QOPB 4AJNA 4ZO7A 1VE3A 4KXQA 4MQ4A 1SC9A 1M1NB 3ANYB 1MVNA 5LMNB 1SXJE 4DM4A 2TMYA 3DOJA 5DULA 1OILA 5LP6F 4JJ7A 1I1OA 5CT8A 2NQTA 4LYJA 5HK8A 1C1DB 3TUZC 3PWZA 4LXTA 3SEZA 3ZLVA 4QUDA 4RTKA 3HWWA 4KX5A 2E4ZA 3MF4A 2JEZA 3OY7A 3SIWA 1QH8B 2IIPA 4NXNB 1P1HA 2EJUA 4GRAA 2K4MA 3HWX1 3PEUA 4QFCA 3PIDA 3SLGA 4AF7A 2XCLA 1GTJ1 3FHCB 1PHRA 1L4MA 4KOEC 3ZS9A 4UQOA 3NTLA 4K3VA 1JYEA 2H7XA 4E4TA 4UCWA 4OGWA 1YCGA 1P2DA 4Z4GA 1D3AA 2QM0A 1LLQA 1IZ9A 2QRVA 2R79A 2OHXA 3AXTA 3GJRA 3OLVA 3EGDB 1JKJA 1IK6A 3FZGA 4LVNA 4LV5B 4NMWA 4WESB 4PC2A 5ES4B 4M8LA 2AQ8A 1GQFA 2FPGB 4RY8A 4TM8A 4EY8A 1JEYB 4C2UA 1YVPA 3F74A 3H2ZA 4HNGA 5DTEA 3LD9A 2P6OA 4GX1A 2AN3A 2GN8A 1Y4SA 2C3PA 4KPGA 4X7PA 5AK3A 1U9IC 3OVMA 2FSIA 3ESXA 1OX6A 1A5TA 1F2VA 3INRA 4KYUA 3BERA 4WZAA 2ZUEA 1MJFA 1UH5A 2C2WA 3E1GA 3GFRA 1NN5A 1SO8A 2DZDA 2GD2A 2GM9A 3EZ2A 2R3SA 3L41A 3OE5A 5KNDH 2V1UA 2X2PA 5LXTF 4KFUA 1EUZA 1D2GA 2ORYA 2XKBA 3L6BA 1NBAA 4MB6A 5CRIA 2SICE 3LCJA 3OH8A 3JQAD 4D99A 4D96A 1IQ0A 1NW6A 4PX9A 4YQZA 4DG9A 4W5JA 2BGNA 1Y98A 3FDZA 4ATNA 2ABWA 1GP2A 1PQ4A 3PEEA 1WV1A 1EDEA 1G2PA 1DC8A 2VK8A 1F9AA 4ALMA 1JPNA 2QMUA 2ZULA 3B6EA 3PJEA 2HHCA 4RVCA 2DMRA 2O1WA 2IUYA 2XAUA 3EPKA 3WWOA 1UXKA 2IU3A 1ZFNA 4GM4A 5F7JA 1VG8A 4XGIA 1QH1B 1RBMA 2IDJA 1I7PA 2JJ8A 4DS3A 4KPUB 4OI2A 2JAUA 4UW9A 1P73A 1VLHA 2EYUA 1OLUB 4EMSA 1Z0AA 4W1QA 3ESBA 3IRVA 5C9ZA 4BO6A 2XUKA 3GH1A 4UCXA 3EWIA 5AOCA 3W5VA 5DX0A 3COZA 2VI5A 2J5RA 1NIJA 3WL3A 1ISHA 2VNHA 5EXXA 2PQMA 3OCUA 2OCLA 2J5BA 3S5JA 5K6TA 3BWMA 1JL3A 1XZFA 1HX7A 3BXZA 3REQA 3ZQKA 1FFHA 1G55A 1U8ZA 5HDQA 4DA4A 2PKWA 2SECE 5LQSA 3VHXB 2ZFUA 4HYQA 4BMNA 1FUEA 1R00A 3TN7A 1X7DA 1BAPA 2V7XA 2NV6A 3JATB 1OFIA 4IAOA 2ZIEA 2VHCA 3D2AA 1SVOA 1Z9BA 2QQGA 5EMLA 4C2BA 4GIBA 4TXLA 5CNKA 3KFXA 1WMAA 2FMUA 2V5AA 2NXJA 1NJ6A 1A7AA 1VL1A 3HZRA 3OY2A 3B9QA 2F3RA 1WD5A 2XMBA 3WLTA 3HXLA 1LDEA 2NTJA 4IWNA 5JAUA 4OQXA 3U61B 3LTNC 3H1AA 4ZOLF 4S35A 1XKQA 2G0TA 2G1AA 2YQ4A 3O73A 2EATA 1XQ6A 2OECA 3G2LA 3VR4A 4A3SA 3W9UA 1IYZA 3GJ3A 3MFYA 3AR6A 3V00A 1UBNA 5HQTA 5B3AA 1PN3A 1TI7A 3GMSA 5A5DA 1VP9A 3O83A 2PUGA 3TNLA 1M66A 2A14A 3DZGA 1E3WA 1SKAA 1JLMA 1GZ5A 1RADA 1NBEA 2HBQA 2VSQA 1SXGA 1U9CA 1ZOLA 3CGGA 4JLKA 4NQRA 3PHIA 4FE7A 4AJ1A 3O3CA 2A5LA 5T6MA 4BVGA 4DHEA 4FR2A 4OSPA 1PYGA 4DJAA 1IBMB 1TVEA 4ZAXA 2BHRA 2J46A 2Q3DA 4Z4FA 1ZUHA 1E6UA 4BKPA 1Y80A 4YA6A 3ELUA 5JSHA 2FG5A 3KQTA 1DRKA 4D9GA 4RQUA 4XM2A 3W5BA 4GUAA 1QYWA 4DV6B 2IP4A 4IP0A 3PXUA 3M6AA 2B25A 1UBRS 1RLMA 4QUAA 3T06B 3ZIDA 1Y7HA 3EEOA 5F12A 1E1CB 2OGZA 5H81A 2YMPA 2CZQA 5K0ZA 1WCV1 3TKLA 4RPCA 3D6TB 1PLKA 5HE8A 1E6EA 2HQSA 1PFKA 2QAGC 3DBVO 1OX5A 3I05A 3KKLA 3HGTA 4FZRA 4HVTA 3WDLA 3N2KA 1BCSA 1EGMB 2WIGA 5FFNA 4K9QA 3URMA 2GCOB 4BAZA 2JFPA 2ADOA 1W2HA 5CA1B 1EFKA 4IXDA 4KVFA 4MEBA 1FMFA 4G5RA 4PQRA 2OYCA 4UTPA 4CKWA 2FPOA 1HTTA 1SUAA 1ESCA 1EH5A 3WGNA 4DJJA 1ADCA 1T8PA 4S1NA 2IXGA 3FRIA 3ZBPA 5A06A 2JCBA 3ENKA 1IBSA 5JPCA 3GXBA 1NJ8A 1SBQA 3RWBA 3ORQA 3QUAA 5BXQC 4MUJA 5CD1A 1E6KA 3FYHA 1CUHA 3SFZA 3OBIA 1JQDA 4BDSA 3MMNA 3PP8A 4MRMB 4MUNA 2W6ID 3PL1A 2X0IA 4ZEXA 4BKQA 2JVJA 3I61A 5EIHA 4MP3A 4CNQA 1E3DA 3HCWA 4JT8A 2ADMA 2HHJA 1D0IA 3AB7A 1JA1A 2TRSB 4BUCA 1ZSVA 4MS3B 3N6XA 3LOUA 3TZLA 3R6GA 3PFHA 4JJKA 4UNNA 4YMUA 1M34E 1XHEA 4BX3A 1BU8A 4I99A 3ROFA 4ND3A 2D5IA 5JPIA 3OWOA 3WIVA 3RC1A 2IELA 3HH8A 3JQ9C 4TS9A 4OM7A 3MLAA 1UJMA 1J8FA 1N7IA 4ZDWA 5KX5B 2WAMA 4INJA 4FGSA 5CH3A 5EL0A 5J63A 3RIGA 2C04A 3E23A 5DXJA 5T4EA 1Q6ZA 5THXA 3PC8A 1EXVA 4DBLC 2O23A 5EKUA 4W7IA 3IAUA 3V1TC 1MGPA 3C3PA 1RZ3A 3UT5B 1P45A 2Y68A 1YU6A 4Q37A 1X1TA 1W2GA 5IU6A 2WG1A 3LDGA 1M2HA 5T64A 1U1EA 4EHDA 4RF3A 4CIXA 4DCGA 1KZ4A 5J2UF 1YIOA 5HCNA 1M0SA 4BMDA 3KWFA 1LNZA 4N03A 5CYOA 2XIJA 3SC4A 4CF7A 3OC0A 3O1LA 2ZUTA 3ANNA 5AHRA 5FAXA 3UC5A 3E6AA 4E5SA 1KJ8A 2IPMA 3E9ZA 3TZ6A 4E5KA 4R1OA 4U6NA 4MGIR 2A58A 3L46A 2JDIA 4N3AA 4PCLA 4ZVPA 1TYDE 2W2MA 3BTVA 3DD5A 3T7AA 3EFHA 2XWQA 4B3HA 1PR2A 2NO4A 2VDQB 3QU4A 3G0BA 4WH0A 4X7RA 5IULC 1VPWA 3OAAA 4JJ6A 3T5CA 2MINB 3AEYA 1TZCA 3FHOA 1PU2A 2FSFA 4GBGA 3ZJ4A 1OHHA 5CJJA 4AF6A 3D7NA 1NDQA 3HYNA 3IOBA 2GM5A 2XNJA 5EUBA 5KVQA 1NJFA 3ILVA 3EG9A 4NY1A 3AKZA 4OLAA 3UGKA 2ERXA 1E6LA 4AK9A 3D6JA 3FUTA 3KHUA 2GPYA 1Q17A 2IYSA 5IVDA 3TKAA 4FMPA 3RKUA 4ZU1X 4Q34A 3WLRA 4ZKDA 5I47A 4DV2B 4WCFC 1FJ2A 1VP3A 1XCLA 4J3FA 4L57A 4TVSA 5A3RA 5KREA 4JOCA 3AESA 4RO0A 1KK1A 1XTBA 3PYLA 4WFJA 4N7RA 4RULA 3UK1A 1F17A 3BKXA 3RLFA 5CW1A 3NHSA 5JO9A 3FTFA 4XJSA 4J16C 3AKDA 1UINA 3DEYX 2IUTA 1XLVA 3C3KA 2QW1A 4Z0PA 3AHJA 4G5XA 4K6CA 4MS1B 4YC7A 1A69A 2CJFA 4ZQEA 1P60A 3V8MA 2HK8A 3VPSA 1WX1A 1DO0A 3OEYA 2ICAA 2RIRA 5DI9A 5EUMA 1U3UA 2YMQA 1QANA 4TRNA 1T0BA 1X0XA 1XZLA 1FLNA 1EVZA 3I64A 3O95A 4PONA 2A88A 3EY4A 4OX9Y 1XTJA 1DDGA 2Z4SA 4TT8A 1CHNA 2F4NA 1XBTA 3BXFA 1H4QA 3IURA 1W4ZA 1NUPA 1VKHA 1WCIA 2QPLA 2WYVA 3CG0A 4L73A 4OIFA 5CVDA 5K9ZA 1T1RA 1Z15A 4DHWA 3THXB 1QQBA 3QFRA 1NOIA 4WJLA 3HVUA 2R66A 1Y9ZA 1SU8A 4BXOB 4XFDA 1FRQA 3QXXA 2JGNA 3E05A 3T5AA 4HI0E 4PZLA 4IIDA 5D7NA 3AM5A 3PNYA 5TS2A 5HF9A 4Y6PA 1FLVA 2CEAA 2CZCA 4RPGA 3WQQA 3KPJA 4B6PA 4CQMA 4A23A 4TYYA 1WXFA 5L7YA 3MK31 5CB8A 4YECA 4A10A 1XN4A 3CLRC 1D5CA 3B7WA 1IUNA 1UBLS 4O1IA 4OBBA 5TPWA 4J0GA 3QE4A 3RC8A 2O0MA 3SQOA 2AJCA 2HMAA 4XYMA 4B48A 5LYYA 5BSHA 2WM8A 2MSLA 1VSVA 3O8BA 2HIHA 4JWKA 1DC3A 4I1PA 4PYJA 2D0PB 1B3RA 1R9MA 1G5IA 2OCXA 4OUKX 5EIAA 1XLTC 3DMYA 2C2XA 4B71A 3HJNA 1IU9A 1DEHA 3KBOA 4MVJA 4OJQA 4AG5A 2ETXA 2H63A 3OZIA 1HTWA 2ZIUB 4BCBA 2VG8A 2J3KA 2WM9B 4HQFA 1N2CB 1ODKA 3UUFA 2Q6TA 4OYHA 2B4QA 2H9YA 4MKGA 4CF6A 5BNZA 3P5SA 5BWOA 4LW8A 4UXIA 4ND5A 1U0NA 2R2GA 4E7PA 1DXOA 1Y33E 3DWFA 4OH1A 1FVXA 3KR0A 4V0QA 4PGAA 2QUHA 3I1FA 2CD7A 2ZQ5A 1BFKA 1UPCA 3OU6A 4DCCA 3OSUA 3S8MA 3K0KA 2RK6A 3ZNQA 2J9FA 1ONSA 3G5TA 3OKAA 5HBGA 1XDDA 1GXSB 5LQJA 1V11B 2QTAA 3O9MA 2CV1A 2HR1A 4QRHA 3PHJA 1V5WA 5CCEA 4EW3A 2NVWA 3WAJA 3CW8X 2FUG1 2ZTUA 5TB5A 3X1JA 3AJ9A 3E58A 5FKJA 6REQB 5L53A 1UDRA 3MB5A 4BJ3A 4ENVA 2XB8A 4RD4A 2PT7A 4YV0A 4J6FA 3H0EA 3O8RA 3PA8A 3AUYA 2ZWPA 3T95A 2P7IA 1SIUA 1PK8A 4KV7A 4XIJA 1OGYA 4ZV9A 5EWLA 1HL7A 2RGNC 3FAKA 3GRPA 3H8VA 4DILA 4R1UA 3U09A 4UU8A 3OJEA 4KFTA 5A3VA 3TW6A 4DSUA 2R68A 3GA7A 3LRTA 1QO0A 1QG0A 2IH2A 3H9JA 2C7PA 1DAPA 2CLCX 1L5GB 4ARIA 1VL5A 3ABZA 4QT0A 2H1CA 3GZ4A 3M6FA 1AE1A 1JSRA 3U7QB 1XJCA 3KJGA 1O08A 3NHPA 1EX7A 3LAWA 3HUEA 4LK2A 4CCWA 4EGAA 1P6UA 1UM9B 5J2TA 1HSZA 1SXPA 2PS3A 2WKPA 4OL0A 3ZWBA 4BOYA 3RRMA 1B7GO 5K3EA 1WPGA 4FXPA 4UTXA 1ZI9A 3SPXA 3ER6A 2JI7A 1CJKC 3LW8A 4UU1A 3OFNA 3D43A 4CTOA 1SZJG 4DV7B 2ZKLA 3ICPA 5DHSA 3QVXA 3SJUA 2W2PA 3EA0A 3GELA 2GDZA 1O2DA 2ZYTX 3QUCA 4MV7A 4ZU3A 3MWFA 3VPFA 1ELOA 4XWOA 1N1MA 3WK8A 1PGQA 1SMKA 5DXAA 2Y1LA 1BX3A 4NYIR 5CHYA 2XMCA 5F3DA 3CKMA 4GPBA 4HDMB 3NBUA 4O4IB 4EJSB 1MV5A 4G1BA 4KQ6A 4IH1A 2V58A 1CLEA 1E0JA 4BO3A 1NDHA 2VH1A 3U4QA 3NPAA 4IJQA 2VXBA 1GGHA 2ZT7A 3EHDA 4GLLA 4AMYA 4B6GA 4U9IS 4XA8A 5AIAA 4RABA 5CXXA 3BJZA 2IPAB 4O33A 1NBWB 2NP6A 1QCYA 1UZUA 3G7NA 1PR9A 2YOFA 4J0EA 2IYZA 1E1NA 2I87A 1T9HA 2CXHA 5JZVA 1Y8RA 1H5QA 2X2OA 2NZWA 3GI1A 3KLOA 3MIIA 3O0DA 3VJKA 3DNPA 3RUCA 1CUZA 2B61A 3HWSA 3MERA 4FGUA 1FP2A 2F90A 3IQFA 4JP5A 3T7DA 1D8AA 4DYVA 4M7WA 2OZPA 2JAOA 5AJUA 1EP3B 4JYCA 4I55B 3MGAA 3QUTA 4X00A 5GONB 1RS0A 2ID8A 3OHPA 3IIJA 3PDHA 1EI9A 3VTAA 1OA1A 1P7CA 3BIFA 4HNAA 4OI4A 4I3GA 1QDLB 4M8SA 2VDJA 4XWYA 1T2FA 2GGSA 4MLPA 2WQ7A 2YFHA 4XQ0A 3COYA 5B6PA 2Q9UA 2JEOA 1OBHA 2WOOA 3A0UA 4YAWA 1FP4A 1M8JA 4RJKA 1DC5A 5LM3A 1VIDA 2GPWA 4OHPA 3ZCUA 4HBZA 3F4KA 1J7KA 4I4TF 4Y2RA 2HSEA 5FOUA 4LMRA 3UUEA 4I9HA 5DHAA 2A8YA 2PUBA 1R27A 4XPZA 4ZDKA 1XO1A 1PVVA 2OHIA 2DHCA 5I9NA 5CT5A 3ZGXA 2BGUA 4QZVA 3CH6A 2W93A 4XWTA 4A8JA 1XRNA 4EZBA 4ZCSA 3JQ6A 4WA7A 4C3ZA 1GLGA 1S2NA 3CH5A 1JU9A 1DWUA 4B87A 5LB4A 3B3JA 4RKWA 2AH5A 2HO5A 4U7FA 3U62A 3QF4B 5GWXA 1FBNA 4ZALA 2JJ1D 2VJKA 2BKAA 4GXQA 3RAJA 3F1KA 3TOCA 4PSCA 1G19A 2O4CA 4Q0MA 1Q0HA 4BPBA 4FOPA 4JDPA 3IR7A 1T36A 4CMKA 4RY2A 3CUWA 1ZU5A 3N0TA 4DMMA 5D7BA 3AF4A 2IFTA 5ALTA 5IT9A 1G20A 4E22A 1N4DA 4HQ0A 5G53C 1L4EA 2V6GA 4YACA 1SVUA 4C2TA 2OV2A 4P4GA 4XFKA 4MDFA 5B7GA 1HTBA 3WGOA 4WBNA 3QE3A 2D7CA 4YR9A 4J2OA 3D6VA 2GCPA 4MUMA 4KR6A 4JEMA 4TMVA 4HOYA 4FYJA 3WOVA 4PVCA 5LOVB 4KR3A 4Q6BA 4AT1A 3K0FA 3Q2OA 3SX2A 1LF0A 2RKWA 1R6XA 4O2BB 1JHDA 4BO8A 5L45A 3IAAA 1ZM4A 2XA1A 3OQ1A 5ICSA 1IB6A 2VAVA 3K1JA 3W77A 4DT1B 1QU2A 3IS3A 1DBRA 1AX9A 2HK9A 1G8HA 2PZBA 5JJ5A 5DYTA 2NQ8A 1Z35A 5ITZA 4JA0A 1YZ3A 3LUFA 1OJLA 3JD1A 3AY3A 2XSZA 1BDBA 1F3OA 1QJCA 1R1DA 3H4VA 4WFKA 1UXIA 2GYYA 2EKBA 1DL5A 1VSTA 3HU3A 1K97A 3LHDA 3ZWKA 1XZMA 2P8SA 1AQYA 1IDN1 3QX7A 3EF3A 4W99A 1WKBA 1QOQB 2GZ2A 5AK5A 5ADUS 1TGVA 3FIJA 4HUJA 4GXNA 1Q14A 2WE7A 1NC3A 2P4UA 4GG1A 4JT9A 4K28A 2OFFA 1YVRA 4U2GA 1OB5A 4LGMA 3G9ZA 4QIHA 5EE0A 1HPLA 2R11A 3CVVA 2OSVA 3MCZA 4M9UA 1LQ2A 3RDPA 3LYUA 2EJVA 2VTKA 4LBYA 3WNZA 1CVIA 1NRWA 4RK6A 3W2TA 1W52X 3LXMA 3ME5A 4B7CA 4BFXA 2VJDA 1JIKA 2PKQP 3PA6A 1JX6A 3V4RA 2V96A 1JP7A 3FJOA 4HJXA 4PZUA 2VFAA 1M2EA 2V3VA 4B6SA 1CQPA 3MJTA 4GVLA 4FBLA 4CM4A 4DF3A 3L3BA 4AF8A 2QT0A 4NCBA 4DNXA 4QSHA 3PJDA 4GKAA 3QKSA 4Q4HB 2GBLA 3FPLA 4P8RA 4J7CA 3VR4H 1X7HA 1PNOA 3K09C 1N1DA 2BHTA 1G1AA 4JGBA 5EIWA 1F0YA 1Z0FA 2R65A 4FB4A 1MZVA 4TLEA 1ORDA 3KT3A 5K3OA 1QCDA 2OHFA 1NYRA 2OKCA 4J0CA 2FG7C 2ODAA 5JYDA 3DO5A 4WASA 3CZCA 4RLFA 1SQGA 3LUHA 3G1UA 3WQHA 5A5GA 3CCCA 4FQ5A 4CEIB 2REOA 4JP1A 3EF1A 3OZAA 1KNXA 1V0JA 1KE2A 2RGXA 2Q5IA 3FPKA 3JZAA 4JP8A 4MWGA 3SG0A 2AG1A 4C7JA 2VP3A 3DFUA 3ENVA 2WNIA 3RD5A 1QP7A 1NHGA 4EW2A 3M6LA 4O2AF 1ULZA 4CIVA 3FOBA 4ABTA 2COKA 1TMKA 3ENQA 2YYAA 3I2IA 2C94A 1EINA 2AFRA 1CQIB 1LLCA 2X9NA 3JQGA 4MUEA 3I2FA 4NZMA 4ALNA 4UUOA 2M9MA 1W0KA 2CKMA 2PH7A 1A88A 1Y9JA 2B99A 3O4VA 1XF1A 2E4VA 2XTMA 3DCYA 1ZVQA 2QTFA 4PICA 1U3DA 4PYNA 4XSVA 5T8KC 2Q3JA 2FSVC 3OU2A 1LX6A 4ANFA 4ZJPA 5CB4B 5KYNA 3BRSA 2AFIB 1K4KA 1N5RA 3LX5A 2JCXA 1XXHE 7YASA 5JSUA 3QVKA 4WN9A 1KOJA 4WKBA 1MXHA 2G5PA 3QVUA 2DBQA 2O54A 3C3BA 5KO2A 1XZGA 2Q8QA 3PFFA 2ZUWA 1QRTA 1NVAA 3ICOA 5IBCA 4PLTA 4Q47A 5K8CA 2DEUA 2NP7A 4GSKA 4S2EA 2ASVA 2H52A 2YWHA 1DCMA 2Z08A 4G4SP 2ZVQX 3ZV4A 4DCSA 1U2PA 3IUEA 4EJ0A 4C14A 1A3CA 4JL5A 3QKIA 1WE2A 1KSJA 2ZJOA 3PFGA 3WA6A 5BP7A 1EFRA 3O26A 4KGDA 2FZ5A 1UJ6A 2VZ8A 1QLHA 1E2QA 1L5VA 1BJTA 4WY8A 2M6LA 4ECEA 4H27A 1ZOOA 5G4KA 2VF4X 5KWIA 4EPYA 5KBYA 3U6KA 4RWZA 3F6YA 2Q3BA 3LDFA 2V5VA 3IEVA 2B36A 4KIFA 2CHUA 3EEFA 3KFLA 4J1TC 3ZNNA 4Z7NB 1FNSA 3LQFA 3P9RA 5J4HA 4D8VA 5FBWB 1EFTA 4IDDA 5FOQA 4LF6B 4LOJA 4Q3KA 4DV0B 2J9RA 3ZE0B 4JC4A 2B20A 3MTIA 3BK1A 5AVRA 2ZYDA 5FPPA 3SM9A 5CT4A 3BYZA 2OV1A 1ODJA 3GFVA 5PGMA 3I4FA 1PUIA 2I4LA 2BZSA 2JH3A 3RS5A 4MITA 3EK2A 4B74A 3VJRA 2QSYA 1XVTA 1MJ5A 2QAGB 4YJ3B 4I5GA 3QV2A 4R3UC 2MSDB 4IGAA 2C2GA 3RYHA 4EG0A 3UBTA 2BDUA 2FRDC 2HFKA 2QX8A 3R20A 3R5JA 1TC2A 4IWXA 5E6SA 1TOAA 3CNQS 1NXWA 2YRXA 4FI3C 3JVUA 1IY0A 2AFVA 3G0CA 1Q7RA 2G1UA 4CM5A 2IS2A 4L15A 5KC8A 5JD6A 2DQ4A 1QZTA 2R8ZA 5JCOA 1EDZA 4HK4A 3K32A 2GZ3A 3L0DA 3ORHA 3S2EA 3UHAA 1E66A 3JWEA 4N3CA 1J0DA 5HK9A 1QNFA 4KE6A 2WJZB 1U6KA 4Z9AA 4N9WA 4RZHA 3G8CA 1UZMA 3VO9A 1QHSA 4TUYB 2IH5A 2Z9CA 3KE8A 3P97A 2AHRA 2JHAA 4MVYA 2BFDA 1CUFA 4MIYA 3SEAA 3C8UA 4DMHA 5KJFA 4LYFA 1MAWA 2C9OA 2MIIA 2NO6A 4BU1A 4IJ6A 5A4IS 2Z2YA 4Z7QB 3CW9A 4WFIA 4IVNA 1GYRA 5FUXA 5GZ3A 4E09A 6ABPA 2QG6A 1ZUWA 1A4XA 3PDCA 1H2AS 1URPA 2AOUB 3TECE 2GPJA 4A0GA 1K5HA 1EVYA 4PN7A 2NOAA 3ND9A 4CHTA 4M9ZA 4FWTA 2A0UA 2J3EA 4GOXA 1WCWA 1JLKA 4KN5A 2HDNB 5J4LA 4R2MA 3EWAA 1A0OA 1JTEA 1QTIA 2IXTA 3S5UA 4BFYA 3B3GA 4L5IA 5G1OA 2HTEA 2GZSA 2ZWIA 4EI8A 3R9WA 5F2OA 3PUWA 1IBLB 2C0CA 2Q8PA 3ZH2A 1Q1ZA 1MCZA 2EVWX 4F0JA 3NBKA 1FA9A 4AMVA 2HBRA 4U02A 3VYVA 4ZQIA 4DM3A 5BWLA 3TRHA 5HCIA 1IG0A 5T7BA 2CWWA 2OT3B 5DM0A 4WVLA 4EPVA 3OKPA 1TO2E 2ZIZA 3SIXA 4ESOA 5KTKA 5FJJA 1V8BA 2HRCA 1Y8QA 1GNTA 3FRJA 5DNEA 5L3QB 5LVAA 2OXRA 3DBOB 3H5OA 3NJ4A 1Z37A 2PUHA 3FNEA 4BQRA 1M1NA 5E95A 5JYBA 2JH9A 2VSFA 1VKRA 3LPMA 1XDSA 2OB1A 2Q6LA 3OJOA 1ODCA 3WAGA 1M2NA 1QO9A 1DADA 4QA9A 3UWPA 3COJA 4Q3AA 3TUJC 2FX2A 1X70A 2WMNB 2AW5A 4Q9HA 4I5EA 1KR2A 3AEXA 4OTZA 4PFJA 3QM1A 2H4YA 3GY0A 3ZJ5A 1FRZA 2VKTA 3A05A 4GLJA 4M1KA 3VDMA 4LUCA 3V1MA 4M3NA 4Q19A 1RKQA 1MX9A 3HUFA 4OHRA 4TTVA 3TM4A 4TSFA 2H11A 1E6WA 2O2GA 4AJHA 3PNSA 4V0KA 4D9JA 4LSZA 4A73A 2FUNB 1GPJA 1UMKA 2J30A 1NTRA 3ER8A 4WUTA 3PEYA 2VP6A 2WKQA 2CMGA 2FZLA 2G4VA 3HJFA 3UMJA 1V16A 2RHHA 3EGDA 1O8BA 3CXRA 3EVGA 2ATCA 3CW2A 3KYIB 4WCFB 2O57A 4WESA 3H5NA 3KS9A 1IPEA 1JEYA 1FTYA 2D0IA 2O3UA 3P71T 4ZEVA 4C4OA 2ECPA 2SKDA 1CUVA 2IEAA 2REQB 2I4IA 4DJFC 4K2AA 1NL3A 1IY2A 1A5SB 3L7NA 3N8IA 3SS7X 5L9AA 1JIUA 4F5DA 2AGVA 3MEQA 4MTCA 5EY5B 5LDHA 5LQDA 2ILTA 4BGDA 2PO5A 4ZI7F 1AKEA 2NU8B 3E9YA 2NT4A 4L9WA 4R71A 3GT3A 1Z2PX 2Y1OA 3EVAA 3ISVA 2VNJA 5FO0A 4Q7QA 1WXIA 2Q3CA 5IMBA 3T5PA 2B6NA 1L4LA 2W6JA 3DMGA 3FCAA 3M4JA 3PB3A 2VDNB 4KWTA 5JAIA 1SG0A 1MRNA 5D00A 2FW7A 1U8CB 3E9QA 4LS3A 5AO9A 1ZGGA 1HDYA 3SX0A 4BX9A 2Z3VA 1ZIDA 4LAFA 2WYIA 1YQQA 1DKLA 5EXPA 1XELA 4EY6A 3FCYA 3TL3A 3TI7A 1D4AA 2IXBA 4MARA 1JSZA 2JFZA 3ZHVA