1QG4A

Canine gdp-ran f72y mutant
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
202
structure length
202
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKYGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineered mutants in the switch II loop of Ran define the contribution made by key residues to the interaction with nuclear transport factor 2 (NTF2) and the role of this interaction in nuclear protein import.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Gtpase
molecule keywords PROTEIN (RAN)
total genus 62
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qg4A00
4MQBA 1ETUA 4K81B 2I1VB 2IHBA 4JIMA 2ZS7A 2QTVB 2ZYVX 1YR8A 4HI0E 4EPYA 3OIYA 1NL3A 2P3SA 3QPWA 4JKYA 1OB5A 4J0QA 1SXJB 1DO0A 2ANBA 1KDPA 3NEJA 3CNLA 1UEJA 3KUDA 3FKQA 4POAA 1XDBA 4EPTA 2EFEB 3MD0A 4QFMA 2ZRCA 3IIKA 2GZHA 1NLFA 1RW4A 4RZXA 1Q20A 1QVRA 5EP4A 1LW7A 2EWWA 3EWAA 4LYJA 1IN6A 1QDEA 1JALA 1KSHA 2QP9X 5LBIA 2DPXA 1AA9A 2OG2A 1JJ7A 4TYNA 3KXIA 2Z4SA 5BQ5A 1M7GA 4FWIB 3R7WA 3KTAB 4C4PA 3PEUA 2ZJBA 2O8DA 1OFHA 1Q1QA 1XP8A 1DO2A 3P20A 3DL0A 4GP7A 3KXLA 2P6RA 4JZKA 5G53C 3GEHA 3QXJA 1VIAA 1KZ7B 2WPDD 2ONKA 5KUTA 1II8A 1NBMD 4UXIA 2GZDA 1EFHA 2G6BA 3IPXA 3BH6A 1VECA 2H17A 2ZUBA 5CYPA 1KSJA 2IF0A 4DLYA 2JEOA 4GL2A 3KB1A 2XOKA 3FOZA 2F3RA 2NO0A 3RHFA 1TQDA 4HB2A 3A1VA 2J0SA 3KDSE 3ZVMA 3ZZ0A 1VG9B 3SC3A 3AKYA 3QVUA 4YXWD 4HAWA 1EWRA 5TDHA 2O8FA 4CYMA 4V0LA 2XXAB 1KJZA 1VDZA 4BRWA 1DAMA 4UNQA 3VMFA 4IOKA 3C16C 1P6XA 5CYOA 5LDDC 3PVSA 1JEDA 1M7BA 2W83A 4BEJA 3QBVA 4CT5A 4QM6A 1PZNA 1E2NA 4M1KA 3AGQA 4M8NE 4Q7JB 4JLMA 4EFMA 1J2JA 3VU9A 4JYCA 2WSSD 4I81A 2A5JA 1DADA 4A0FA 2D4HA 3P4XA 2JLXA 5F9HA 1OIXA 1TU3A 3FGNA 5EXPA 1XF9A 2GCOA 3U44B 3QXHA 3RVBA 3WNDA 1P9RA 5LD2C 1IY1A 4JBWA 4M2LA 1L2TA 5C18A 2FFBA 4QBIA 3RS0A 3SZRA 2W2VA 4A82A 2G0TA 1IJFA 4AI6A 3LW7A 5GADl 4QBGB 1KJYA 2ZJZA 1W5SA 2GXUA 4WIAA 4ZIRB 5KTYA 3K0AA 2RAPA 3VR5A 3SBEA 1P75A 2E87A 4MRVA 4FW9A 1IAQA 4P0TA 3ADBA 1ZP6A 2V6IA 3VHLB 3ICQB 1QG2A 1AZSC 3CX6A 2RKOA 4WZ6A 2N42A 4A8JA 5AWFC 1E9SA 4AK9A 4WVFA 2SHKA 3HJNA 5AJYA 2FU5C 3X1YA 1VMAA 2ZSEA 2PJRA 3DKPA 2NPFA 3OHMA 4PQYA 1R4AA 1E9EA 3N70A 2GBLA 4XTRA 3NVAA 4WA7A 1CKEA 4OHVA 4DXAA 4B3DA 4N3NA 4F4JA 4YMSA 2KI5A 4OQXA 4FCTA 1TEXA 1S9HA 2G0NA 3IGFA 3KQHA 2V6JA 1SXJA 1PLKA 2ZSBA 3LWNA 4GDFA 5GVRA 2C03A 4DDVA 3U3MA 1R0WA 2C9CA 2QU8A 3QF7A 1G19A 2LWIA 6Q21A 4F91B 2YKGA 3OEED 1E2EA 3UWOA 1D2EA 2W6ID 3U2QA 4PFSA 5BYJA 2BIFA 4NCHA 1JR3D 3DM9B 1Z6GA 2PT7A 3QPUA 4URUR 1G21E 4II7A 2HT6A 1UAAA 5FBRB 3TR5A 1UM8A 2VF8A 1O87A 1W4CA 4EPWA 1PVOA 1NJGA 2G9NA 1MRSA 4Z51A 1FZQA 3BH0A 1CR4A 4JLNA 2CLDX 3R7WB 2QM7A 4XOIA 5FPKA 2OEPA 2RGGA 2ZRIA 2ZRPA 3SHWA 1BKDR 4CW7A 3CM0A 3EW9A 5FTLA 5TV2A 3GLIB 4HAYA 4GP6A 4H9GA 1W36D 3OIUA 2Q3MA 1VCNA 4L5BA 1GAJA 4D82A 3Q5EA 2OBMA 3VX3A 4RZ2A 2NOAA 4RKFA 1NN3A 2V1UA 3ADKA 3DMNA 1G9XA 5EJEA 5CM9C 3B82A 2FFHA 2JJ8A 3PEYA 2IL1A 5ELXA 4UNSA 3GJXC 3PITA 4HDQB 5DHAA 2IA5A 3EASA 2ZR7A 4ITRC 1KI9A 4Q1EA 2FZLA 2WICA 4PX9A 1G3IA 1LY1A 1G64A 3EIHA 1BOFA 3IHWA 1Q3HA 4HEJA 3LNCA 5KPJA 5EE3A 4JVSB 4BLOA 1GDDA 3BORA 3KKMA 4Q9LA 3TIFA 1L8QA 1R7RA 3CRMA 1ZBDA 3HU1A 4KVAA 5DN6A 1UADA 4OJKA 3M6AA 5EUMA 5H8WA 2IXGA 4C0AC 2IHYA 3BFKA 3K09C 3FHOA 3MG9A 3NBYC 3AGPA 1BIFA 1X6VA 2DFKB 4Z1MA 3RRYA 2P2LA 1Z06A 3NH9A 2XZOA 1YU9A 3QKRB 2ZE6A 2JLYA 1JR6A 3GD7A 1Z2AA 1CP2A 3AKCA 3BIFA 3KQKA 4V0ME 3K53A 1KTVA 2JJ2D 2F9MA 2YJTD 3SQXA 4EQ6B 5KOYA 4KSBA 4TYYA 1DE0A 2NO7A 2VH5R 1JXMA 2H57A 1ZM3A 4HYYA 1VHLA 4IDNA 4IDQA 4TLCA 5L8VA 4RD1A 2R6AA 4JSTA 4XH9B 5SZJA 2J45A 2OFWA 4TL6A 1E2QA 1H8ED 4LZZA 1YVDA 4P33A 1TNDA 4XD7D 1RE0A 2A5GA 4BUJA 4DCNA 3RSOA 1JQLB 1XTSA 2BBSA 4KFRA 2FEOA 5FOTA 1OHHA 3H84A 4ON9A 2AWNA 2ORWA 4TL7A 3HP1A 4AG6A 1NMXA 2ZUDA 4DDWA 1OH8A 4BE7B 2IS2A 1U81A 1R5NA 2FPLA 1TQ6A 3W5IA 5KHOC 3SE0A 4BLPA 3QSYA 1R5BA 4AYXA 1ZNZA 1AK2A 5FPHA 4A6PA 3MWJA 5JEDA 5JMTA 1Q1BA 2GEDA 3GP8A 2ZANA 4KAXA 3CF0A 2YNMA 4V02A 1RYFA 2XZPA 1JI0A 3T1TA 1RZ3A 2FX3A 2BMEA 2ZROA 4Q4AB 4XVUA 1VTKA 4PTLA 3RS4A 1I2MA 2VHCA 4ASUA 2CK3A 1M8PA 1S96A 4B3GA 3IBGA 1OIVA 3G5UA 2PX3A 3OIWA 4EJSB 2WWYA 1SQ5A 1YR6A 3KZ1E 4X8OA 4WAUA 4O25A 4A36A 1T3SA 3VR4A 1CULC 1GIAA 2CK3D 3TQFA 1YHNA 4PSKA 1MOZA 1YZTA 1Q1EA 1DG3A 1CJUC 3DZDA 2ATXA 4B6EA 2RGAA 1UBEA 3LV8A 1AQUA 4OJQA 1ZVQA 2NO6A 2A7QA 4NYJQ 1P3JA 2RCNA 4G5GA 5AK0A 3U3KA 1N2CE 4YMVA 2OLKA 4NE2A 4B43A 1KGDA 2REXB 4P31A 1T8UA 2MSCB 1R0YA 2VTKA 3EAQA 2EWVA 4MKHA 4Q5IA 1FL9A 4IDPA 4EAQA 2V1XA 3ASYA 4RSGA 4B71A 3LLMA 4DSNA 2RH5A 4BGDA 5F98A 1U99A 3SI7A 4Q19A 2QAGA 3AVOA 5EZ5A 4MKGA 1NBME 4TLEA 3ZZUA 4DLRA 3E5HA 3T61A 4A1FA 1S2MA 3PUVA 1SHZA 2WOJA 4B33A 2CHGA 1ZUIA 2ZPTX 4BLRA 3NEYA 2W2TA 3RRZA 1KJWA 4CF7A 1W4AA 2HDNB 1KZGB 1Z8FA 4ZKDA 3V00A 1W0JA 2F6RA 2B8WA 4FI3C 1VCMA 5FUVA 5TY0A 2WWIA 4GNKA 1P62B 2QSYA 1AJEA 2ERYA 3KUCA 3WHLA 2ZS9A 3AF4A 3I72A 4QBFA 1Q44A 4A2WA 1E2PA 2EFCB 1KI7A 1C9KA 4LBWA 1WBBA 1G8HA 1G7SA 5FOWA 2WSSA 1GRNA 1L4YA 4HB0A 3AF2A 4RZ3A 4DDUA 1FTSA 5HPYB 1Q3TA 1UBGA 1I4TD 3WRYC 4DIDA 2BKUA 2VYFA 1W4RA 1YZGA 2WKPA 1TADA 3S1AA 3SNHA 2HLDA 2R2AA 3A37A 1ZIOA 4R98A 1Z28A 1TQ2A 4GMDA 521PA 2CNWA 1QHNA 4BLQA 1F48A 1JEEA 2ZSFA 1EFTA 2B92A 3DPUA 2ANCA 2C9YA 4EJSC 1DOAA 4HAUA 3B78A 3HR8A 4PPNA 4DC9A 5KNCA 3B1ZA 2AXNA 1UBFA 1XCGB 4ZDWA 3SFZA 3ZVLA 2JA1A 3EIQA 4BZPA 1KO8A 2BCJQ 3FHCB 1JAHA 4Q4LA 2ZRJA 2C77A 3IKJA 3EPJA 3CIOA 2O8EB 3QPVA 1VYUA 1OPXA 4B2LA 3K09A 2O8BA 1RJ9A 1OYYA 2IK8A 4LY6A 4NYIQ 3TLXA 2ODNA 1GTVA 3P1JA 2CLCX 4DLTA 3EPKA 1WXQA 1E0KA 2VSFA 3NXSA 4KSCA 5DI3B 4MDFA 3BB3A 1T91A 2R6FA 3AUYA 5KSPA 4JLOA 1N6LA 4TTRA 2V7QA 1CJMA 4BLTA 2O8CA 2DHRA 1GILA 2WWHA 3Q5DA 5FUXA 5FI0B 4ASUD 1FOEB 5JLJA 1VCIA 2J59A 2Z6VA 1JR3A 5C46F 3Q72A 4JL8A 2EU8A 2NO9A 4DCSA 5AUOB 2QE7A 4CVNA 1NN1A 4QHYA 3ADDA 2IUUA 3PG5A 4KI0A 2PMKA 2QP4A 4FXPA 3ICEA 4M1SA 1A1VA 4DHEA 4KBGA 3IILA 3LRPA 4B3FX 4FWTA 2WOOA 1N3BA 3U3RA 2GCPA 4LJ6A 1A7JA 5DLQC 1G7RA 4QM7A 1E2HA 1KI2A 1XXHA 3CO5A 2NTYC 3Q85A 3WP0A 5HKKD 2O0HA 4AURA 2VSXA 4LC0A 4NTZA 2J7PA 2AXPA 4TMKA 1OW3B 4KODA 2IXFA 1IN4A 2CLSA 4AYTA 4PZZA 1RRCA 4OK6A 2PX0A 1XPUA 5EQTA 3EZ6A 2JLZA 2WJHA 5A4JA 1H65A 3AVVA 4CZ2A 4L16A 1HQCA 3W5JA 1G4AE 3F0TA 3OEHD 2DFNA 2AHOA 3ZJYA 4XSGA 2KBEA 3D6TB 5E95A 2BVNA 3TH5A 2BM1A 4YLGA 5E7IA 4PHHA 1FX0A 3KTAA 3THYA 2ZETA 4GT1A 2XNDA 2FPKA 4OK5A 4RFSA 4AKHA 2WAXA 1N5KA 2QY9A 2ZREA 3AH8A 2PMDA 1D6JA 4RZUA 3MSXA 5C4MA 1QHGA 1G7TA 2QUZA 1YJ5A 5KYKA 2BBWA 2EFHB 1US8B 1HH4A 2JIZD 3QEJA 1G8PA 4LOAA 3NHAA 1DEKA 2Q6TA 2R62A 4Q9JA 1LTQA 4Q1FA 4F38A 4Q1DA 5TB5A 1RYHA 2OXRA 1P2UA 1XZQA 2YZ2A 3ECCA 3I8SA 1SVIA 1TF7A 1OHHD 1NVXQ 4Z8YA 4A4DA 4QBHA 4AD8A 1IN8A 3KQNA 3L82B 2FPMA 2UZ3A 4XD7A 4A2QA 2JLQA 1W36C 3QBTA 5G3YA 3QJYA 2XOKD 2P6NA 4JKIA 1YR9A 1XD2A 5FTNA 1Z0AA 3FKSA 3ZD6A 3N2EA 4Q00A 2VRWA 1I4LD 5G41A 1QRAA 4DBLC 4OHWA 5AJVB 1OXXK 5L3RA 1NLZA 1R0XA 4O2LA 1GFIA 1E4YA 1HV8A 3NDPA 1KKMA 4B3BA 4NKRA 4M0LA 1G3QA 2X77A 2MMCA 3RDPA 4E07A 4NCNA 1DAEA 2W0MA 5E4FA 1FUUA 2R44A 3N2IA 2NIPA 5CB8A 1J8YF 3UKDA 2HEIA 2YWFA 4PAQA 4IOLA 5JJLA 1NVUQ 4BZXA 3HWSA 1SVWA 2KSQA 4U00A 2J7PD 4M9SA 1ZU4A 1DPFA 2YINC 2QI9C 3BFVA 2OM2A 4LV6A 4P4UA 2J87A 1N6KA 3K0AB 3LQQA 2O8CB 2WBLC 4CEHA 4RD4A 2RGEA 1GL6A 3D3QA 2LKDA 1N6IA 2PZEA 4Q1BA 1G17A 1GZSA 2ZYWX 3BK7A 3LX8A 2V3CC 2FZ4A 1B0UA 3A1WA 2LKCA 2VP6A 3AEZA 4M53A 2J9RA 2IS4A 3PFIA 1PV4A 1E9CA 1IN7A 4AG5A 1HYQA 5F9FA 2C04A 3CPJB 2GJSA 2HJGA 3GLHB 1MABB 4G5RA 4W5JA 4Q9HA 3SJZA 2Q9CA 4EFNA 1WDTA 1QBKC 1FP7A 1XXHB 2JATA 1FMLA 5AUNB 4KVGA 4OK3A 1OE0A 1U2RA 5B64A 3MMPA 5JWOA 4EIWA 1GKUB 2ZRLA 1EFUA 1H8HA 4LHYA 1DELA 1KO7A 3D7MA 2RHMA 3BAFA 4D0GA 3GLIE 1GNRA 4URYR 4URWR 4KLNA 5J47A 4RD3A 1O3YA 5AJZA 3CUEF 3T5DA 4M4SA 3EWSA 2VO1A 1W4BA 2IYRA 5SZKB 4HUTA 4IDHA 4BFZA 4JLAA 3ZGXA 4LUCA 3I32A 4PPFA 4ERNA 2P5TB 1P60A 2CVHA 1G6OA 2ODWA 4E5UA 4C7OA 1ZINA 4NCKA 2QSZA 4NCJA 3GJ4A 4JLVA 5EP2A 4UXJA 4EUNA 3AP1A 3T35A 1WRBA 1CS4C 3WBKA 1Z0DA 1R8QA 2WJYA 3IEUA 3JZMA 4OI4A 4UNPA 4L8GA 2QT1A 4KV9A 1JPNA 4HUQA 3AKDA 4FMDB 1JXOA 2BJVA 3AP3A 1W44A 3FE2A 4TQ9A 1OIWA 1ZCAA 1RFLA 1XTJA 3CPHA 5CLLA 4Z8XA 3AF0A 3EPLA 1XU4A 5JWHA 4IVQA 4UNNA 4YQFA 2RGCA 4PZLA 4GZMA 5DGXA 4B48A 4KITB 2J0VA 4URVR 1E32A 2H92A 2ZR0A 4KHZA 1AGPA 3OAAA 2EW1A 1Z6TA 3TW8B 4LHVA 2VEDA 2NPIA 4OL0A 3HR7A 1R6BX 1E1RD 3GLHE 2F1JA 2XTNA 5DO9A 2GJAA 4PO1A 5KO2A 1W7AA 3IEVA 1GWNA 3RANA 2JASA 1XXHE 1D2NA 3KJIA 4JT4A 5EXXA 1UPTA 3LH5A 3R9XA 2BC9A 1HURA 2QPAA 4RFVA 3A1SA 1S9DA 1XX6A 4PC3A 1UFQA 1XTQA 1LS6A 1NKSA 1CBUA 2B6HA 2VHJA 2Z0MA 4QRHA 3EARA 2B8TA 5FTMA 4IDOA 1XEXB 1IM2A 4IOJA 3B1XA 4C30A 4L9WA 1G5TA 1KY2A 1U98A 3WXMA 3UMFA 2ZI4A 4V0OA 5FPYA 3FFAA 5A0FA 5CJ2A 1XEWX 2IYUA 1Q12A 2WMNB 1UKYA 4AYWA 3G82C 1P61B 4YDSA 1X1RA 5FH9A 2FH5B 4FMBB 1XNJA 2BHRA 3C15C 4A92A 3EIEA 1NLYA 5L3QB 3AUXA 4NU0A 2GVZC 3GMTA 3RYTC 2NGRA 2B21A 2AKYA 2BMFA 3LBNA 2J1LA 4M1WA 2ZRMA 1SULA 2JLVA 3NBFA 4YONB 1TAGA 3X1DA 3I5XA 2XB2A 4EFLA 4XJXA 3B5JA 2LCFA 3QG5A 1N6RA 1G3UA 2QBYB 1CRQA 3CONA 3BBPA 1E6CA 3HDTA 4JBYA 3I62A 4OHYA 3B9QA 4M1TA 4WXRA 2WZQA 2D2EA 3GJ3A 4BZQA 5SZHB 4DDTA 3E1SA 3AKEA 5D3MA 1K5DA 4FN5A 5TARA 2C5LA 5E7JA 3NC0C 4M9XA 2V55B 4R2HA 3T5GA 3AVXA 2IEZA 1UJ2A 4KU4A 4R7ZA 2F1IA 3UIEA 4B73A 3WP1B 4TQAA 5FPSA 4AKGA 1A2BA 3GEEA 3QXCA 3QF4A 4D4LA 2ECKA 1MO3A 2J0UA 1OYWA 1BMFA 3BH7A 3WMGA 1OXSC 1JECA 3D31A 2I4IA 2RHDA 4XSHA 4A9AA 4AC9A 5CDFE 4GOJA 4PSAA 3SHFA 3FDIA 3ZDQA 4ZV4A 3A58B 3AF1A 4LI0A 4DLXA 4ESVA 2ZE7A 3T34A 5HCIA 2AK2A 2IYXA 121PA 1X3SA 1ZM4A 3O8CA 5IK2D 4G01B 1XWIA 2X2EA 3SR0A 4Q1CA 3R8FA 3KKPA 1FW6A 5FOVA 1DAFA 1MR3F 1L4UA 2V7QD 4FCVA 3I8XA 1TL7C 3Q7PA 4RCYA 4E03A 3CPEA 3HPRA 2QROA 5BWMA 3SU8A 5M04A 3I73A 2AKAB 1QZXA 3ADCA 2C95A 2GF0A 2UVQA 3AP2A 4A0RA 3LLUA 4RY2A 4NDZA 1E79D 3RWMB 2EFDB 3AVPA 3PV0A 2V54A 1UF9A 4LGMA 1T5IA 1N0VC 3JVUA 1W49A 4YC7A 5H68A 3WYGA 4LBZA 2OBNA 2YWHA 3LVRE 5JI2E 4DIEA 2GA8A 1KO1A 1M7HA 4MGZR 2RGBA 1ZYUA 2OILA 2RB4A 5IHPA 1ESMA 2R65A 2O8EA 2X2FA 2CL7X 2VLIA 4TQUS 2FOLA 3SS8A 1SKYE 5J5CA 1VG1A 2ZRGA 1FFHA 5FI1B 2CJWA 2IYZA 4HDOB 5SZIA 4XWOA 2CCKA 4OQMA 3DHWC 4UJ3A 3U7HB 1E0AA 2IYYA 4PO8A 5DYIA 1VCOA 4IKEA 5LB2A 1GSIA 1X8JA 4US2R 3SQWA 5CDFA 1M6NA 1GVNB 3GLFB 3KJGA 5EUQB 4F93B 3IHLA 4M1OA 4DLZA 4B75A 4DT1A 4EPRA 2BKEA 4L4UA 3EZ7A 5KNBA 4KBFA 3EX7C 3V4FA 2AWOA 4Z54A 4BLSA 1E9FA 4EDHA 3LBIA 3IO5A 3E70C 4JBXA 3CX7A 2JLUA 5DHFA 3SEAA 4C2TA 1Z0FA 5FBLB 1Z3IX 2RGDA 4PC1A 2GAOA 3W8NA 3P32A 2C78A 2IUTA 1MT0A 3H4MA 5GJVC 1E9RA 5HKKA 4LPSA 2UKDA 2P0EA 1TUEA 4LJ4A 3CRRA 1JB1A 2F3TA 1GKYA 3I61A 3QIAA 1KI4A 4LC1A 2Z43A 2ZRDA 2EYQA 1QHHA 2V8OA 3Q3JB 2OO7A 3DDCA 1E2DA 1T9HA 1NVVQ 4FCWA 3CZQA 4UQOA 2HT1A 3QKSB 1A4RA 4HZUA 2MMGA 2ZI9A 2GHIA 2HXSA 5JJIA 3O8RA 1Z6XA 4F4IA 4HLDA 2CCGA 4TMXA 3T06B 1XMIA 4ZO4A 2FNAA 1FUKA 2C99A 4W7SA 4XTCS 5AJXA 3QQ5A 4QGFA 5H1YA 3FMIA 4BECA 3JVVA 4KYUA 3TMKA 1HQYE 2QPOA 4RFSB 1S0UA 1Z6YA 5JSZB 4JVMA 3TUZC 1FMJA 1EK0A 4D26A 2F9LA 2QM8A 2ZE8A 3V4RA 2VP0A 4QHSA 2O52A 1KDOA 2GF9A 1KYIA 2IXEA 3CF6R 3TGPA 1NN5A 4LHZA 3ZLJA 2ORVA 2I1QA 3KX2A 3CNOA 3B7GA 1J8MF 4PPGA 4PC2A 2IEYA 4QOSA 2F55A 2HJVA 1WMSA 1EWQA 1SKQA 3NBXX 1CJKC 2HCJB 4IEEA 4ACAA 2YOFA 4BRUA 4OKSA 4ESHA 2J46A 4CRWB 1U0HC 2FG5A 2BMDA 2C8VA 4LYHA 1F5NA 1KHTA 2OFXA 3CR8A 1YZQA 1E2LA 1FX0B 3QY0A 4FD2A 5EE5B 2Z83A 3I1FA 3THYB 1T3HA 1G41A 1ZCBA 2CEAA 2ASEA 421PA 4TSFA 2XJ9A 2XNSA 2IWHA 5L3VA 1OFIA 1VG0B 1US8A 4O2RA 3LY5A 2HV8A 3O8BA 1NSFA 3KQLA 3K8YA 2F1HA 4NONA 1FTNA 5HR5A 1T0HB 3R20A 2ZSDA 1XTKA 1UDWA 2QTFA 3BXZA 2Q3HA 1G7CA 4LJ8A 4TLDA 1GITA 1ZM9A 1XEWY 1G6HA 1ZD9A 2IW3A 2QMHA 2G77B 3H86A 3H1TA 3J81k 5BW8A 4C0JA 5KU1A 1W46A 1CF4A 1II8B 2CJWB 1NG9A 4MDEA 2A9KA 3L43A 4M21A 1K6MA 1Z29A 1MKYA 3L0IB 1J99A 2G88A 1COWA 2VSOA 5KDDA 4LJ9A 4B76A 3K70C 2W00A 1W2GA 3RRNA 1PLLA 1XCPA 1EX7A 4QJ4A 1CIPA 4CEHB 1KNXA 2HUPA 2O8FB 1NRJB 4IXNA 3DVLA 4ZI3A 1COWD 4Y0VA 1ZNXA 4JT2A 4CT4B 4IW3B 4W5WA 4AKIA 1DS6A 4US0R 1Q0UA 4P4SB 2ZI3A 4UXHA 4PHTA 1SGWA 2D74A 4DSTA 1F2UB 4YMTA 2P6UA 1S1CA 2Y8EA 3PUZA 3DOEA 1NVWQ 2ZJYA 1OJLA 1IJEA 1ZUNB 1XTRA 2NZJA 4U5XA 3CKLA 3UXMA 3X1WA 1MABA 4MGKR 3TSOA 4RD0A 4JS0A 2KBFA 1N5LA 1G5RA 2IYTA 1IY0A 1QF9A 1XRJA 2X1VA 4M22A 3ZZTA 4TYWA 4D81A 1KK1A 2Z4RA 3FPAA 4KJZA 3L8ZA 4I1VA 2JIZA 4TSFD 5FOSA 4LV5B 4B47A 3ND8A 2WJVA 2FSFA 3NWJA 5J4YA 3B60A 1II9A 2BDTA 4Q4JA 2Q9BA 1AM4D 4ZIRA 3GJ6A 1CJVC 1UKEA 3VKWA 2ZRBA 4YMWA 1P9WA 3CB4A 4HZIA 4NHOA 4M9ZA 3PJRA 1N6HA 3A36A 2NG1A 2GXAA 1W0KD 4W9MC 2PEZA 1YRBA 1KAOA 3CF2A 2QRZA 1W48A 4WW0A 1Z2CA 5TVKA 2QGNA 2WWXA 1GUAA 3B6EA 5EZ6B 2ZRKA 2D2FA 4HATA 4RKEA 4C9BA 4OYHA 1HE1C 5H70A 4OHZA 2OHFA 3OFND 3NDBB 2DBYA 3PEVA 3C7KA 4A8JC 3OESA 4HAVA 3QG1A 2JJ1D 1E9BA 1QHIA 1JPJA 2GEUA 3NH6A 3VNUA 4OQFA 821PA 2DWPA 4YDHB 3C14C 5JFGA 2CE2X 4Q1AA 2FGKA 3TE6A 4JLDA 2WM9B 3UANA 4D4JA 1E98A 2ZEJA 3E2IA 1NJFA 4LDJA 4DCUA 2FGJA 2Q9AA 1C1YA 2OCPA 4TYPA 5JCPA 4MH0R 4PQRA 1S3SA 3P26A 3EA0A 1CJTC 1H8EA 5CK5A 3VR2A 4TZ6A 3LDAA 4TZ0A 1E2MA 1ONBA 2OCYC 4IJMA 1UEIA 2G3YA 4UJ5A 3BB1A 3MJHA 4BFTA 4NP6A 5KSOA 2OUKA 2OFOA 2CNWD 4P4TA 2EFGA 1YR7A 4MKIA 1PLJA 3VR6A 2OLJA 3U4QA 4C7OB 1P2VA 2HLDD 4QGAA 3P27A 5CK4A 4AWXA 5JJKA 2ZRFA 1QHXA 3FVQA 4X8MA 2TMKA 2DFLA 2FWRA 1TMKA 2QQ0A 4HSEA 4DCTA 1A5TA 3WMEA 3LBHA 2AD5A 3AVTA 4BFXA 2WJIA 2GESA 2ZTSA 4CEIA 2AN9A 5EXTA 3OAAD 4D25A 5HCNA 2QP3A 2CL0X 4KYIB 1AZTA 4RD6A 1OT3A 4B44A 4D6PA 1HA3A 4JL5A 1FP6A 2IYQA 2WHXA 3A4MA 1Z5ZA 1MO4A 2G83A 4IFBA 4TN1A 4JSYA 5UKDA 3UG7A 4A2PA 3B8HA 4LCBA 4HLUA 5FL7D 3U6KA 3MUFA 1OLOA 2XSZD 3VR3A 3CX8A 4MRPA 4OQNA 2XITA 1ZJ6A 1YZNA 3BC1A 4XVQA 2F7SA 2PCLA 2KJQA 1AKYA 4M1MA 1LF0A 3FMPB 3RAPR 4AIIA 2PJZA 1OSNA 2OSBA 1Z08A 3LQRA 2A5DA 1OKKA 2FEMA 3GJ7A 5KSYA 1RRFA 2QZ4A 1ZC3A 4GSYA 4MRRA 3KB2A 1U0LA 2B7CA 4HLCA 2CHQA 1KDRA 4LSGA 4IVPA 3DEFA 3X1ZA 3M0EA 5P21A 5CJPA 3ZS8A 4W5HA 1N6PA 3KJHA 2OAP1 1YKSA 4QXAA 4TT3A 3N5CA 1QG4A 4DRZA 4GZLA 1P72A 2OZEA 3DKVA 4XWKA 2VA8A 3M4YA 5FTJA 1XMSA 3FHTA 3O47A 3QE0A 4Q4JB 4PO9A 3CH4B 2ATVA 5JS7A 2N46A 3GCGA 3SYNA 1EFRA 2XTZA 5CB6A 1Z22A 1FQKA 1OXTA 1OXUA 4OHXA 4QJ5A 5BN5A 3RC3A 2H16A 3DO6A 5FUWA 4NZYA 3AVUA 5C1BA 1Q21A 1DG1G 2CCJA 1KIMA 3QVVA 2YWGA 4A0GA 2FN4A 3BERA 1BMFD 1F2TA 1ZIPA 3QENA 2YVUA 4N0EA 5FPTA 1U9IA 4EPVA 4QC2A 1KO4A 1KSFX 4MRSA 4Y0AA 2ONJA 4OI2A 2DWQA 5EXSA 4PANA 1IY2A 2J0UB 5F3WB 2IYSA 1WA5A 4TMZA 3THOA 1YZLA 2GXSA 1QHSA 1V5WA 1OF1A 5B57C 2QAGC 3MJRA 4HB3A 5JBQA 2YC4C 4C2UA 4Q4AA 3W3ZB 3AVQA 5D3MB 1N25A 2G1JA 2P5SA 1SXJC 1YZKA 4QL3A 3RS2A 3K0CC 2WTUA 3ASZA 4JJKA 3BD9A 2W6JD 1GNPA 1DAKA 2WV9A 3GLFE 1SHKA 3A4LA 1GL9B 4A0HA 5KPDA 3MWKA 1CTQA 3GLGB 3LA6A 1G1MA 1M1YE 1G291 4MKFA 3VR1A 1YQTA 3K70B 4QKQA 4R2IA 3U4QB 1W0KA 4G3XA 1IOZA 2GKSA 1DARA 4IRUB 3GJ8A 4LPKA 5AR1A 3CH5A 1JBKA 1SKYB 1LS1A 4PAMA 1RC8A 2VPPA 1CR0A 1SVMA 1E2GA 3CNNA 2ZS8A 4GOXA 2P67A 4IHQA 1EFRD 2WIAA 5HE9A 1DBSA 4GRAA 4K8OA 5K8UA 1WB9A 2NMVA 4WXPA 1XD8A 2EQBA 2AK3A 2FDCA 4CIDA 3L0OA 3EZ9A 4KFSA 2D06A 1IBRA 2IYVA 3SN6A 5FTKA 2ZUCA 2QAJA 2QAGB 1KK0A 1DAHA 2XTMA 3U7FB 2IBMA 4QG7A 1ANKA 3TKLA 1Z83A 4C0BA 1G18A 2VL7A 1TX4B 5K8TA 4US1R 3VQTA 4RD2A 3W6OA 2WVJA 4MITA 1GP2A 2R6CA 1BO6A 2NZ8A 2GK6A 4M1YA 5HE8A 3BWDD 5CITA 3FWYA 3TK1A 2ERXA 1SVKA 1K8RA 4HAXA 4TTPA 5DIFA 5KDOA 4IFEA 2JDIA 2O0JA 4NYIR 1Q1ZA 2RMKA 3VFDA 1G3RA 2ZQ5A 3WMFA 3L0SA 4I1OA 5HZKA 3F8TA 2C96A 4R9UC 4IOMA 4V0MA 3NTUA 4BFVA 1Z47A 4DEXA 2E9SA 3RSLA 5D3QA 1ODFA 4LJ5A 1B23P 3AV0B 3DM5A 2BM0A 2NQ2C 3LO5A 2KE5A 4G5SA 5JHGB 2ZI6A 4NBSA 1T6NA 1T3LA 4FMCB 5JECA 5IT5A 2PEYA 1Y3AA 1CU1A 2W6JA 5DSZA 3TQCA 4C0HA 1VIYA 3QKTA 3IBYA 3AQ4A 3GLFA 4CGZA 3A1TA 2FJUA 4O0MA 2IT1A 3TVTA 2ZJ2A 1G5PA 3RWOA 3MRSA 1P9NA 4TLBA 2QMUA 3BOSA 4HZUB 4S35A 5JZVA 3W6PA 2JAQA 2KWIA 3W90A 1U8YA 2HF8A 4F4CA 2O5VA 1F2TB 1EXMA 5JEEA 5E3HA 3VKGA 3K9GA 1NP6A 4B2PA 3GLGE 1W47A 1U94A 1Z0IA 4KFTA 1EG7A 4TL8A 2JLRA 3FMOB 1RJ9B 4B6FA 2F43B 1SZPA 5JSZA 1J90A 3IQWA 2ZE5A 2MSEB 1Z63A 2GJ9A 2WJJA 3I3SR 3GFOA 2JJ1A 2C2HA 1MO5A 5CIQA 5GJBA 3THXB 1ZM2A 2H7VA 2ZIAA 3ZIAA 2VP9A 3EPHA 2YOGA 5K8IA 3SFVA 4DLVA 3K9NA 1X8LA 1IONA 1ZC4A 3QKSA 5J4HA 1NMZA 1XJQA 1KAGA 1TTTA 3K0CA 1WF3A 1S8FA 4JVNA 5KNDA 2R9VA 4V0NA 3D8BA 3A6PC 4JLKA 3IIJA 3VHXA 3ONWA 2BV3A 2DCUA 2EYUA 4RVCA 2H8KA 4MYHA 4ZKEA 1OH6A 4JJZA 4D4MA 4BFYA 4MGIR 4GOKA 3CBQA 1JJVA 2OE2A 2A30A 1WCV1 1M74A 2HYIC 3IUYA 1C4OA 1RVDA 3B13B 1XTIA 3C5CA 3MWYW 1AS2A 1G4UR 3V9PA 3MAAC 3TW4A 3BS4A 1OH5A 3C4JA 1XZPA 2R6GA 4OQLA 4PC7A 4ZDKA 1OV4A 4KO8A 1V43A 3VAAA 1FNNA 1S3GA 2DR3A 3OEEA 3PEWA 3I92A 1XMJA 2JDID 4UKDA 1KKLA 4LWZA 3LX5A 4Q7KA 3ZVNA 1RPZA 2QENA 2D7DA 5GJWC 3A1UA 1CXZA 2ZYTX 1D8TA 1Z07A 1JAIA 4BQSA 3AF3A 4Q66C 3K0FB 1GRQA 1WBDA 2XSZA 2O0KA 3SJAA 3WBJA 3A8TA 4PQFA 4PAOA 2IYWA 1K5GA 1D9XA 5C4GB 3LD9A 3SBDA 2FSHA 2YYZA 3UMSA 3ZVRA 3ZQJA 3Q8XB 1OH7A 4MA4A 1JNYA 4IXMA 1IHUA 2AL7A 1I4DD 1NI3A 2ZU6A 1LF5A 4DB4A 2PH1A 2ZAMA 1CEEA 5L3SA 1P2SA 1W0JD 5BYKA 721PA 4I4LA 4LJYA 2XAUA 4V0KA 4F92B 4O3MA 1CLUA 3SJBA 1BYIA 3CWQA 3F3YA 5DNYB 3QI2A 1KI3A 5CIWA 1LNZA 1TEVA 3W34A 3U3OA 1XJ0A 1AKEA 2FSGA 1T4GA 4ZCMA 5AUQA 1HTWA 2CHVA 2W58A 2R6DA 4Q01A 2Z5FA 4DZZA 5JS8A 4ZCLA 4S2EA 5GVSA 3AVYA 1KMHB 4P3YA 3TR0A 1E2IA 3IPYA 1YZUA 2PZGA 2QQEA 5EE1A 4Q48A 3G0HA 2FV8A 2JLWA 1R10A 1NSTA 3KKOA 4JLPA 1YE8A 4PPQA 2QNRA 4BFUA 2ZRAA 1E2JA 5G3ZA 1CRPA 4DWJA 1P4SA 1HEIA 1I2DA 4XVRA 4C0LA 1QVAA 4H1VA 3FTQA 1E94E 3K9HA 4LX0A 3L2OB 2IF2A 4V03A 3UG6A 3X1XA 1XBTA 5EP1A 1ZNYA 4KLZA 1N6NA 5FOUA 4WZBE 3U5ZB 5JI3E 3K0EA 3OFNA 2PZFA 2HYDA 2GJ8A 3TSZA 1P5ZB 1KI6B 1GG2A 2NO1A 1T0JB 3MWLA 2JCSA 1VYVA 4TLAA 3B1VA 2Q3FA 1MRNA 2ODEA 5J4LA 4A6XA 1N6OA 4HAZA 1M2OB 3WYAA 1AN0A 4B3XA 2BMJA 2J41A 1D5CA 4F7WA 3KXKA 2QGZA 2RGNC 2BCGY 2XNDD 1NBMA 221PA 1G8FA 1BS1A 4QNRA 3U3JA 2GAAA 4URXR 5BN4A 3F5FA 4OBEA 3OIVA 4L9SA 3EC2A 1GKIA 2GDJA 1X1SA 1SXJE 5ANRB 4AY2A 1LVGA 4FMCF 3MFYA 2BOVA 2CVFA 2GETA 1NIJA 1TF5A 4OI1A 2V4ZA 4LJAA 1SXJD 1ZW6A 3I5YA 5LD2B 3VX4A 4MYTA 4DSOA 3CWZA 1N5JA 1LFDB 1F6BA 2DFTA 2OCAA 1E1QD 2YWEA 3BFXA 3UWKA 4BEBA 4PSVA 4B3CA 2CL6X 1RRPA 1R2QA 1HT1E 1AS0A 5FR2A 3QEOA 1E99A 3GLHA 3U6BA 4E09A 2WSMA 5F2EA 4ZDIA 2X19A 2O8DB 4ILEA 2PCJA 2IS6A 1GRRA 1N0UA 2IUSA 2QE7D 2VQSA 3M1IA 1UBCA 4YMUA 2W0SA 1NVVR 4C0QC 2OXCA 1KSGA 1AS3A 1DAIA 4DLSA 4LV8B 5K8LA 2ZI7A 4CEIB 4TMVA 1KY3A 2OESA 4LHWA 2FSIA 4BWYA 1X86B 2WKQA 2WKRA 4Q18A 2CMKA 4LYFA 5KDLA 3EC1A 1ZUHA 2MSDB 4ACBA 2AD1A 3EG5A 3LVQE 2ORIA 1YRAA 2OV2A 1E1RA 1UKVY 1E0JA 1XD2B 4NYJR 4XWAA 2XGJA 2HCBA 1KI1A 1G16A 3QOFA 2VBCA 1R5OA 3OE7A 4Q9IA 4MYUA 4Z1MD 1F3OA 1G3MA 2G1KA 1ZM7A 1IQPA 3FB4A 5TMPA 3THWA 1E4VA 2GK7A 3BJIC 5L3SB 4I1UA 4DJTA 2YHSA 3GEIA 2AR7A 1EX6A 4LYAA 5JCZA 2PL3A 2PLFA 5AUPB 2OAQ1 1NNEA 1ELOA 4C0SA 2FE4A 2R8RA 2QMOA 3C8UA 4D0LB 2VF7A 2WIBA 4JVLA 3WY9A 5JWRA 4TMWA 2FA9A 2VHTA 3VU9B 1II0A 2BEKA 1EFCA 3FKSD 3MGCA 4D2IA 5J4KA 1DVRA 1RRGA 1G20E 2GRJA 1VYTA 1OXVA 1ZAKA 5IF9A 4Q4HB 3BGWA 3VTKA 2XB4A 5AJWA 2L0XA 2XJ4A 1KMQA 4K46A 1GL7A 3JZAA 2J3EA 3PIRA 3PXGA 4Q02A 5LPNA 5DISB 2CE7A 4PXAA 2ZJ8A 1NIPA 4C3ZA 4NMMA 3OZXA 3IQXA 1KNQA 2PLRA 4I1SA 5FL7A 5FUYA 4NYMR 3TUIC 3VNVA 4D4KA 4B35A 1W2HA 4G5QA 5DE3A 4GPTA 3R9IA 1E2FA 2OCBA 2GVDC 2WWWA 3T15A 4L15A 4A15A 1Q57A 1RIFA 3Q7QA 3DOFA 2GWHA 3FYHA 5BN3A 3T12A 1G8GA 2D7CA 5B58C 1TF2A 3KFXA 4TMTA 2QN6A 2GCOB 3U44A 3NC1C 1KO5A 1MH1A 4B34A 1J7KA 2GBLC 2QPTA 2C98A 4DSUA 1ZD8A 2ZRHA 1PUJA 4I99A 5DN6D 3K70D 5IK2A 2ZVQX 1TU4A 5E7MA 2BWJA 2GXQA 3AM1A 3RS3A 1E3MA 1X8KA 3WNBA 4DLWA 1XEXA 3GJ5A 1U0JA 1XPOA 3KQUA 1R0ZA 3CW2A 3PR1A 2BBOA 1BH2A 3L0PA 2WMOB 4A8JB 1NMYA 1E69A 3ND9A 3NBZC 1SVOA 2DYKA 1JR3E 3H0KA 1M34E 1A82A 1N0WA 2ZJ5A 3AVWA 1J70A 3T1OA 4RJLA 4BASA 5L3QA 2XZLA 3LW8A 4FINA 3SOPA 3HYRA 3PQCA 1Q22A 2ZAOA 4GBMA 4JL6A 5G40A 1EGAA 2JLSA 2RGNA 3ZH9B 4KXFB 4XIGS 1W5TA 3LAWA 3UATA 1F60A 1VKJA 5IDVA 2GZAA 1OFUX 1D2MA 2ZJAA 3HU2A 4ZI2A 2DY1A 3GLIA 1P2TA 3B1WA 1LV7A 2V9PA 2YC2C 2VIIA 1NY6A 2ZJOA 3TBKA 5IRCD 3W9YA 4MUAA 2HF9A 3GJ0A 1ZU5A 4HUQB 4GFDA 4WBSA 2ZYUX 1XD9A 4JLJA 4KFUA 3UPUA 3WYFA 1NN0A 3RS5A 3UK6A 1Z0JA 4U7DA 3Q9LA 2W6IA 1IXRC 3CLVA 1S1MA 2ZRNA 4NH0A 5JRZA 3GLGA 2JGNA 3B2EA 3P4YA 4C0KA 3QKUA 1MO6A 1NF3A 5CM8B 3THWB 3GPLA 2AFHE 4LK2A 2E1RA 3AB3A 3IDQA 3MCAA 4LJ7A 4CEJB 4ZCIA 1VG8A 5C2JB 4BPBA 4URZR 2FFAA 3NHBA 3VKHA 3FMFA 2ZXUA 2H5EA 1SVLA 2Q0HA 1WQ1R 4HLQB 3WNCA 4KCGA 3TNFA 4FMDF 1NKTA 2IWRA 2D3WA 4EPXA 1XJCA 1T5LA 3RRMA 3PCRB 1VHTA 1ZMXA 3K9LA 4HDCA 2BJWA 3NG1A 5KSZA 1Z6AA 4Q4HA 1SVSA 3QKRA 4IEIA 4JYBA 4ABYA 2A2ZA 4PR0A 2N1BA 4P32A 2QTHA 1XPRA 4NCIA 5FBWB 5FBQB 1R8SA 1TPZA 4RCZA 1N5IA 3B1YA 2P65A 4X8LA 2ZM5A 2QL6A 2BBTA 2UZIR 1HUQA 3FFBA 3R8CA 5FBVB 4DLUA 1T8TA 3C41J 4DUGA 2A5FA 2GTPA 1Y63A 3IO3A 5FFMA 1P73A 621PA 3CR7A 3L8YA 2WPDA 3DZ8A 3U60B 4TWZA 2H18A 4IVRA 3OE7D 1XEFA 4ZPXA 2JJ2A 1FNMA 4D0NA 3K0SA 2H1LA 4X8HA 4TYQA 4U02A 3O8DA 4QGHA 4B32A 3QXXA 1S4QA 2J7KA 5FL3A 3EA5A 4ARZA 2XX3A 3A4NA 4JLBA 2J0QA 1XB2A 2A3RA 3RLFA 3RC8A 3REFA 3ZS9A 1PJRA 1KOFA 4EQ6A 1EESA 4LHXA 1E2KA 1RKBA 1IXSB 3GFPA 2QBYA 2IX3A 1IXZA 1UDXA 2QRNA 1E96A 3EZ2A 4NL4H 3SYLA 3LFUA 5EE9A 1CR2A 3B85A 3QUSA 3RABA 4ZDJA 3DMDA 5HTKA 4QNMA 4Q7LA 5JHHB 3KL4A 5LB4A 2OBLA 1U8ZA 2W2XA 4B2IA 1NY5A 4MGYR 4G5OA 5EE0A 2Q21A 4DEYA 1L7VC 3CRVA 3BRWD 2C9OA 4PZYA 3SYKA 4HB4A 4CDGA 1Z0KA 1GNQA 4BFSA 1HT2E 1LB1B 4TTQA 5GJCA 2PBRA 3RS7A 3RNLA 2I3BA 3PUWA 2QMEA 4FIDA 4DKXA 2ZU0C 3QF4B 1E9DA 5DH9A 2GJKA 3HPQA 1NG1A 3HU3A 2B7BA 2F43A 3NKVA 3T1QA 3B9PA 4D80A 1ZD1A 1H8HD 1TUIA 3CRQA 4GI7A 2KB0A 3TJZA 2BEJA 4GMXA 3THXA 4E22A 2EVWX 2K5UA 2X8AA 4UNRA 1AGRA 3CRW1 3X2SA 4Q7MB 4G1UC 2GEVA 3PUXA 4DVGA 2ZITA 4N1AA 2IC5A 4NPHA 3ZYCA 4BFWA 5J4VA 2HXYA 3GQBA 4EJSA 1E9AA 4AKEA 1WP9A 2AX4A 2PT5A 2ODBA 1A2KC 1ZRHA 5B2ZA 5HZHA 1OB2A 3BB4A 4MUBA 1PUIA 1XMVA 2ZSAA 4Q47A 2QORA 3MLEA 3U61B 1OKKD 2F1RA 3KKQA 3LXXA 4Q03A 4R71A 4LBVA 5J40A 1KDTA 4OI0A 3ETLA 2WAYA 4CEJA 4MRNA 2REOA 2ZVPX 3PENA 1UKZA 3HYTA 4HLUC 2REBA 3REGA 3IIMA 4LRWA 3UMRA 2DB3A 3BE4A 4EKDA 2YV5A 4Q21A 2WWGA 1DAGA 2CDNA 1U8AA 4PHFA 3C5HA 3TVDA 3WRXC 3ZQ6A 2A5YB 2QEQA 3W8RA 2AFIE 2QT0A 4G0NA 1GM5A 3SDZA 2FF7A 5B30A 3OF5A 2GILA 5JRJA 1VPLA 3K0FA 3NIBA 1KI8A 4JMPA 1IN5A 3S1AB 1XCMA 1ESNA 3CZPA 1JQJC 2ZI5A 4N0DA 4TT3D 4WZAE 4DB2A 4NYMQ 5A5GA 1AIPA 1HE8B 3K1JA 1WE2A 5CLQA 4DT1B 2XXAA 1TQ4A 3H2YA 4M9QA 4DUGD 3ZD7A 5FOXA 3EZFA 4DCVA 1KK2A 3KKNA 1W36B 2D62A 2GNOA 2GCNA 1AQYA 1CR1A 1W1WA 4LBYA 2VP5A 1GOTA 2YOHA 2IS1A 2QG6A 3TAUA 2RGXA 4ARZB 2VP4A 2CBZA 3EXAA 3TRFA 5EP3A 2FFQA 4TL9A 3GFTA 3LXRA 1QHYA 4WOPA 1P7CA 3TAHA 1G8YA 1E0SA 4MYCA 2O8BB 3KJEA 4YXWA 2ZR9A 3U7EB 1ZNWA 1QHHB 2VHUA 3W3AA 1KMHA 5DI3A 5DYGA 2WJGA 1FQJA 1U90A 8OHMA 2VP2A 3U7GA 2A78A 3R9WA 2IYLD 5TXGA 3SJCA 1E1QA 3TSWA 1BYUA 2XEXA 1KK3A 2VHQA 1HY3A 3TUJC 2DWOA 5BXQC 2J5XA 3I4LA 3OEHA 1E79A 3QNUA 4H1UA 1MV5A 3T1VA 4PHGA 5FR1A 4QJ3A 4Q9KA 2OT3B 1DTSA 2FMXA 3QXSA 2WWFA 4P4SA 3W6NA 1D9ZA 1F2UA 1XFAA 1FPMA 4PC6A 1OFTA 1U9IC 4QHTA 3KFVA 3ZIAD 3WHKA 1KI6A 3PUYA 4QGGA 4B74A 2QA5A 5DI9A 2CXXA
chains in the Genus database with same CATH superfamily
4MQBA 5AVVA 4UEWA 3CE9A 1FU7A 3DMTC 2QTVB 2ZYVX 3NLLA 3QZUA 4XQ0A 3AEQB 4HN2A 5BSKA 1V11A 1PTJA 1YR8A 2ZG6A 5IJZA 3KE9A 4UBOA 1NL3A 4GMKA 5DX0A 1M6YA 1KJIA 3Q40A 1BN7A 4JKYA 3SKVA 1OB5A 3SFTA 1RT9A 2VATA 1QHEA 3TLGB 2H52A 1SXJB 4PNHA 5FRDA 1U0BB 6CHYA 2JIRA 2EFEB 3DDWA 3IJRA 2IOQA 3MD0A 4QARA 5JCOA 3WGLA 5ED4A 2C8JA 5B7QA 3HM9A 4I8IA 3B9RA 1GJRA 4J76A 3AR6A 1B16A 4ZVKA 3C74A 1Y8CA 1NLFA 3EXFB 4RZXA 2NUAA 1Q20A 1JAXA 5REQA 3P2MA 1G2PA 4R0VA 1R6TA 4LYJA 1JALA 1KSHA 2MWMA 4ZHQA 4LS3A 1WJGA 4YR9A 4KZPA 3WE7A 5GONF 1L4KA 4G1FA 4OXXA 1XV5A 4WCVA 1U9CA 5THXA 2AVNA 2QN8A 1P0MA 3RBXA 2BPOA 5F1KA 4F4FA 5C8DA 2RIRA 1ONPA 3ESZA 1T8RA 5HX7A 2QJWA 1VKOA 3LHDA 4RTMA 1BD4A 4MDHA 3VNQA 1BX3A 3F6SA 1OFHA 1QYCA 3NNDA 1Q1QA 2X40A 1ZRMA 2P6RA 1G6Q1 4AWBA 3QXJA 2Z5VA 1V6CA 5FWAA 3IALA 2W90A 5FJIA 3A6EA 2Q7XA 4CUJA 1U2DC 3DGFC 1RIIA 5G1PA 1NBMD 2GOYA 3DJYA 4UXIA 5GOZA 4FLFA 3D2LA 2G6BA 4KMRA 1R0RE 3T5PA 1YNSA 3EMDA 3BH6A 4XFJA 3WYDA 5JJ5A 5CYPA 2JEOA 4GL2A 4YCDA 2XOKA 4YBZA 1ISFA 1K88A 1N3IA 2A3NA 1TQDA 4BP3A 3ZHRA 4D92A 3U19A 2J0SA 4MV5A 5B1HA 4BNGA 3SC3A 2HD4A 1ODSA 4W8OA 2OG1A 2OC4A 3I83A 4HAWA 5AO9A 2O8FA 1XU7A 1MQ8B 3ACCA 1VDZA 1WMFA 3CLTC 4GSKA 4DR6B 2EKZA 1G5IA 5BR8B 3C16C 1A77A 4AJNA 3P0IA 3E3OA 1JZQA 3RFXA 3PVSA 1JEDA 1OX6A 5JAHA 2XBMA 3QBVA 3GG9A 4PAGA 4CT5A 2DQSA 4NZMA 2JFVA 4YWHA 4GQBA 1HOXA 4EFMA 4XYBA 2ATCA 3F9RA 5HGJA 4ZGGA 4HADA 2BFNA 3R5XA 4G41A 2I22A 1QFYA 4J0EA 4CBVA 3VNAA 1QYRA 3QVMA 1MAWA 2YVAA 3LU1A 3UT5A 1NUAA 1TU3A 5EXPA 3GA5A 3SAJA 2VDMB 3JVIA 3OFSA 3FVVA 4TV8B 4UBIA 1ZH8A 1M8JA 1IY1A 3PFWO 2FKAA 4MW4A 5CT5A 5A7FA 5LD2C 1JIKA 3TZHA 1GKLA 2LTAA 2CXNA 4FJ1A 1I80A 1JF8A 2ZRQA 3LW7A 4ENRA 3JR3A 4QFCA 4RPGA 5GADl 1T2CA 3OQBA 1DBVO 2ZJZA 3UOWA 1NNUA 1PI3A 1XTPA 2Y1XA 1CQJA 3DMGA 3KAKA 3NAZA 3TSAA 4ZIRB 2GTHA 1CUHA 4DGQA 4JHXA 3T3NA 3H4VA 4L95C 4OQEA 3SLRA 2PUFA 2C8LA 2C4VA 3CZAA 4N9QA 4BHTA 4WY2A 3QITA 4P0TA 3ADBA 4X3PA 3IAHA 3O3CA 4WK6A 1UAGA 3FYUB 3C6YA 3KLMX 4JJ7A 4JUCA 4UTOA 3O8OA 4Y1GA 4AZ0B 2RKOA 4WZ6A 2N42A 4O4JA 1OAOA 1H1TA 1QO9A 2GN9A 4WVFA 3BBLA 2E3JA 1PK8A 4X7BA 3I9KA 3KTDA 2GPAA 2ZSEA 3X1YA 5CVTA 2PJRA 3OHMA 1J2YA 4Q0MA 1QYDA 2NLOA 3NUZA 1XT6A 2XWPA 3BMQB 1OD6A 3BKWA 2QV7A 1GUZA 1YHZA 2Y93A 2ZYGA 2IU4A 3P4UA 1N2ZA 3PFKA 2WYIA 4N3NA 4WNAA 5YASA 4OQXA 2X5OA 1EEXB 2YRFA 3ENQA 4R1MA 1IZ8A 1DO8A 1U8CB 3F6EX 4OHBA 3QE3A 3G1UA 4AECA 2ZUEA 3FR8A 5K03A 3ZGVA 2DTEA 3KQHA 4LGCA 3R3WA 2V6JA 1WOMA 2ZSBA 4GI1A 3LWNA 4GWKA 3F6CA 3VYTB 1IY9A 4EUKA 4TMFA 2BM8A 4DDVA 1O7JA 2Z4TA 1V8ZA 3RT7A 4W9NC 1OBCA 4G1BA 4QREA 3UWOA 1O96B 2JCGA 3HH8A 1Z38A 1Y5RA 1JZTA 4PFSA 5BYJA 4EJMA 5LMCA 5FWXA 1CQIA 4NCHA 1ZL2A 4RTOA 3QPUA 3UXYA 4FJ0A 1UBKS 4JUFA 4AY6A 2UYCA 4UFOA 3U17A 3ZLTA 4OREX 4XQGA 2VF8A 3I1YA 5ADUS 3FAKA 1PVOA 4TRJA 1MRSA 5A9RA 2J9FB 2NADA 1FZQA 3Q2KA 1CR4A 2NACA 3WGYA 3E6AA 4JLNA 4AXXA 3HXOA 3LYHA 4HFJA 2QTNA 2ROQA 3HCEA 3WOVA 1WDLA 2BFOA 2JFGA 3IBTA 3INNA 1XFDA 2UVPB 2ZRIA 2ZRPA 4JA2A 4K2HA 4RV4A 1DKRA 1A9RA 5L95A 4ABTA 1C1XA 3FTNA 3OJLA 1F7UA 1D2HA 1NXQA 2VN8A 1F2DA 4TRNA 4RIFA 4L5BA 4CKWB 4IILA 1GAJA 3KPUA 1IZZA 4D82A 2OBMA 4FP9A 2N1MA 1DBRA 2H0QA 3P2KA 2V1UA 2OXEA 3QHQA 4HF7A 1G9XA 1A98A 1B2RA 5CM9C 3QX7A 5F77A 1UR5A 5AVOA 3V8VA 2EEZA 2FFHA 4DR4B 2VJBA 2IL1A 2Z2ZA 3WLKX 4GI2A 3PEYA 2VJPA 4QDOA 1KFCB 1AN9A 1TM7E 1EZZA 2IA5A 3OT5A 1N7GA 5IG2A 1DJNA 4AO7A 4JGIA 3OQVA 1B8OA 1G3IA 1K1EA 5JJBA 5IKPA 2AN4A 4DCPA 1G64A 1NLUA 5F1OA 1BOFA 1NBIA 3CC8A 2GD1O 5EE3A 1OILA 4JVSB 4ZCPA 5EC8A 3ZCPA 3D1VA 3NT2A 3WK8A 2C2ZA 3CRMA 1FEZA 3BSSA 3EE6A 3BE5A 3SF8B 1SC1A 4A73A 4QXQA 1ORVA 4O8CA 1IUKA 4C0AC 4UE6A 3BFKA 3NIDB 1JG6A 4K26A 3CGWA 2P9EA 5INTA 4N49A 4YCBA 3ZCVA 2P2LA 1Z06A 3NH9A 2OZPA 2XZOA 4LY0A 1N9ZA 1L1EA 2VJOA 3GD7A 4G0ZA 3H0EA 4U1RA 2O5RA 1N2SA 1O9HA 3GNSA 3KZOA 3RVQA 3HUUA 5TT1A 3TOXA 4II2A 5NULA 3KQKA 1EUDB 3CH7A 3I34X 2Y66A 3DA8A 2F9MA 4FE3A 1EUCA 4RHEA 3T5MA 2EBFX 2X8WA 1S02A 4GM0A 4MS4B 1BW9A 1DE0A 2VH5R 2VT6A 2ZWPA 2Q0XA 4G0YA 4QXMA 4IDNA 4J29A 4JBIA 4CKBB 4FEAA 2AF3C 2WAAA 5K4HA 3DFMA 1U4NA 1S7CA 2RAFA 4MRMA 1IPHA 2DLDA 2DHQA 2Z1DA 1E2QA 1H8ED 2DZDA 4H0FA 2RHCA 2VYVA 4XD7D 1RI5A 3VI3B 4EGQA 1RE0A 1REQA 2YFKA 1JV2B 2NNWB 1JQLB 1W52X 4AQDA 1U7DA 1H2RS 1KWGA 3H84A 1OGIA 3KEQA 1PWXA 3I4CA 4UVIA 4OB6A 4D9HA 1YK0A 3IAEA 1XYVA 2G80A 4TL7A 4EKIA 2I71A 3KZCA 2XBLA 3Q88A 3FNGA 3IVMA 1TCCA 4AG6A 2BAGA 1Y8QA 4KQFA 3R7BA 5JSQA 2ZUDA 5ARCA 2H2DA 5HF6A 4RF3A 4K9DA 2DLCX 2P35A 3W5IA 1RCUA 4XDZA 5CHEA 4AT1A 1F5SA 4IDFA 1SD2A 4U7PB 5FPHA 2A1IA 3PKJA 3K9CA 3O5AA 1OLXB 3MWJA 5K0LA 4A6PA 5JMTA 1H3EA 4U6SA 5I3ZA 1UMDA 3BVPA 4KXYA 1CR6A 4PR3A 4DLRA 4KAXA 4ZD6A 1PJTA 2YNMA 3KYCA 4KXUA 1RYFA 1UEXC 4Y2PA 4CF4A 1R6UA 3CW9A 1NGSA 4POOA 1B8PA 1ZMTA 2HO5A 1I2MA 4I19A 3RS4A 4UTPA 2MDTA 5D00A 3FY4A 2FWMX 1BHO1 2J09A 2ZJ4A 3IBGA 3S7TA 5CDGA 2J6BA 6NULA 4JI5B 1YR6A 2D0OB 1A9ZA 4XEUA 4NNOA 3OSUA 2EIXA 3LVBA 4K6MA 4A36A 3VR4A 1CULC 1OAAA 2C5BA 3TQFA 1OZHA 5KJFA 2DMRA 3HMQA 1F38A 5KCMA 1J9EA 3UBTA 1MOZA 1Q1EA 4NHEA 1DG3A 4C2AA 1UBLS 3E8MA 3UA4A 3QPAA 2BFCB 4ZA2A 3FOEC 1AQUA 1ZVQA 2VFAA 2C2YA 2HNKA 3GW8A 4NYJQ 3KYIB 5CH5A 4EBBA 4U3JA 4G5GA 4O0LA 2DR0A 4EG5A 2ZULA 5K3DA 4BTLA 5TIIA 4NE2A 5CJJA 2V9CA 1BVUA 3EXG2 3LA8A 1KGDA 5FTJA 2DFVA 2HWYA 2MSCB 3WMXA 1WU7A 4MKHA 3Q8KA 4FYWA 3ASYA 3P2YA 4ZU1X 3LLMA 4KJXA 2W2NA 2GVNA 1U2SA 3K20A 4WXYB 4F3RA 4L9AA 2B5VA 2HSGA 1WVMA 3AVOA 3KJXA 4L6IA 4U2KA 2OV8A 5JC8A 1FFBA 5JR3A 3R6WA 2JRCA 3HBLA 4EARA 1NBME 2D54A 4TLEA 3ZZUA 3E5HA 2QTBA 3CJRA 1S2MA 4CUKA 4BO8A 1OVGA 1OZGA 2FJPA 1SHZA 2GZ3A 2Y1KA 4HQ0A 5DWDA 4DG8A 3EEOA 1KAQA 2PV7A 3RAFC 9ABPA 3NEYA 2BLNA 1JEAA 1Z16A 3IAM6 2FDRA 4CF7A 1P6QA 1W4AA 2OYSA 3F4LA 2HDNB 1PT6A 4ER7A 4ZKDA 2PSSA 2ZKIA 3T9FA 2V7PA 4TKUA 1SCQA 1SUWA 5FUVA 4FOTA 1UANA 5TY0A 2WWIA 1DJQA 4GNKA 5JSYA 2YL2A 1ZVVA 1YMQA 2ERYA 4ENQA 5IAJA 3KUCA 4EECA 3RVSA 1JQKA 4IG4A 1KI7A 2BEWA 3D0KA 5ALJA 1QQBA 1HDEA 1NR5A 4Q12A 5I9SA 4MO9A 5FOWA 3KQWA 4IZHA 4QEDA 3ZKWB 4C4SA 1DHTA 3K1YA 3BXPA 4EG4A 1FTSA 3O8QA 4PM4A 2XKJE 5HPYB 1UBGA 3NV7A 1V2HE 3MQFA 3FBGA 4MVJG 2VR1A 1Y7TA 4ILKA 2FWIA 1TADA 2AFHB 2R2AA 2FPIA 3B20A 3PPYA 1E89A 4XUDA 1EGHA 3WGIA 1DQNA 2PUAA 4O02B 3TRHA 1LQ2A 4LQDA 3VPFA 1WPGA 2VNHA 1DC6A 4HWRA 4LTDA 3G6WA 3WBBA 3GNQA 3JYNA 3DW1X 1A8UA 1ZJJA 5BV7A 3DPUA 1RI4A 2RK4A 3GT0A 4XPZA 5JFOA 2FPGB 4PPNA 5JNLA 1CC1S 3HR8A 4L4ZA 4UM5A 1T9KA 5C51B 4DC9A 3NHKA 4I3GA 4E94A 3Q6MA 4YALA 3SNKA 4I55A 1UBFA 4OX9B 1XCGB 3MTIA 3EIQA 1Y3IA 4ER3A 4QDUA 5HJEA 1TKRA 4BNVA 1SNYA 3FHCB 3PVZA 4L6AA 2ZRJA 2C77A 3IKJA 3WGGA 4JJ8A 4Z7NB 1QRRA 2Z3WA 1HF3A 4IYJA 4M49A 4MQEA 3VNSA 1VYUA 3EPJA 3DE6X 2G63A 3HY6A 3K09A 3G0OA 4P7GA 2P78A 2O2ZA 3CUTA 1WY5A 3TLXA 2ODNA 1M9NA 3P1JA 2CLCX 4BMVA 4NOMA 1NI4A 3BB3A 4MA5A 1EBBA 3DZHA 1NF2A 3UNXA 1T91A 2Q27A 2ZUVA 4CV0A 3AUYA 5COAA 3RYHB 5AVKA 3KLNA 4TTRA 3RROA 4N12A 3KBOA 1YSCA 1CUSA 2D3TA 1QIDA 5AK5A 3BZUA 4K3VA 4KRXA 5TS2A 2OB1A 5ITVA 1TMGE 3OM0A 1FSZA 3VPSA 2DHRA 5BSVA 3IJPA 1GILA 3VH1A 2O2JA 3H42B 1VM6A 2H4JA 3CW8X 1Y9AA 4YEDA 3O82A 3SGLA 1UBJS 1XLUA 1NVTA 1QGOA 1QLWA 1O95A 4HDKA 2PXXA 3TXYA 5LXTF 4JL8A 4KL8S 1YDFA 4DCSA 1QAOA 4WMLA 2HW8A 2QE7A 2HR1A 3ZR4B 5MGBA 1E7SA 1A5ZA 4FBLA 4JC4A 5AOBA 5FWNA 4P7FA 1LLDA 2QP4A 3DYIA 4KN9S 2WUDA 3F1LA 4XFKA 4RPCA 4DHEA 1FFDA 3WGZA 4KBGA 3VZSA 3IILA 3LRPA 4BMYA 5FEUA 3OIGA 3P71T 2WOOA 1UDCA 1AB5A 2GM3A 3GBPA 2GCPA 1GHTA 5KJ1A 1A7JA 3MXTA 3E7XA 3OJ0A 1KI2A 1PHPA 2AMJA 1H9AA 2D1FA 4D4IA 4N0QA 3V7YA 3HCFA 5A4IS 2NAPA 4NTZA 2I9KA 2P1RA 1J09A 2PLWA 1PD1A 3HA7A 3K6SB 4KODA 2IXBA 5HKLA 1IN4A 3F96A 1PG2A 3W1EA 4PZZA 1TYEB 1YJ8A 2AH5A 3HN6A 4NU6A 2PX0A 2CL5A 5EQTA 4Z6KA 1C3OA 2XE6A 5A4JA 3GGJA 1BMTA 3KSZO 1OBOA 2YN4A 2XGMA 4GYKA 3UJBA 2FAXA 3VAZA 1HTBA 1ECPA 2EZUA 4N3CA 4BNWA 3VZQA 2FUEA 1HQCA 2FZWA 2NU6B 3F0TA 1UC4B 3L0CA 2DFNA 3NAGA 1RWQA 2AHOA 5I9BA 2Q2VA 5A3VA 3TXXA 3ZJYA 1F8XA 2JLBA 1HMPA 2XT9A 2BVNA 3C4VA 4GZ5A 3VA7A 3GT4A 3I6YA 4QASA 4AJPA 4BU1A 5JAIA 4OBWA 4OHUA 2FPKA 4IMJB 2WAXA 3JQ9C 4YNBA 4BRSA 2ORED 5C4MA 4ENPA 1J0AA 1SY7A 1E3WA 2G4LA 1G7TA 4QXOA 5CA1B 3EXEB 1Q0RA 3DE5X 4F45A 1HH4A 4H4EA 5CDTA 2X1MA 5IYZA 1KYYA 1G8PA 4ZEXA 3VNBA 3NHAA 5KKNB 2Q6TA 5DNEA 3EF0A 4V2IA 5ESXA 2BELA 1ILWA 4QPZA 4F38A 5TB5A 1A9QA 3FPGA 2OXRA 2J6CA 1H3NA 4K6OA 1XZQA 3ECCA 5FQOA 1SVIA 3GEBA 1IULA 1NVXQ 5DPMA 3W8DA 2V3WA 3KQNA 3FNRA 1A3CA 1UPUA 3GP3A 4D9EA 4PLZA 4EZIA 2JCYA 4XD7A 3OFVA 4UHKA 3KTOA 1W36C 1S2DA 1T15A 3LFTA 4B2YA 2FR8C 3CLUC 3UMJA 2NZ2A 1ICEA 4E4RA 3L1KA 2Q5QA 4JKIA 1YR9A 1F06A 1K8YB 1XD2A 4X62B 4BCDA 1EGQA 3R0IA 4CI9A 4HXEB 3GAZA 3PQEA 4PRYA 1FX1A 1I10A 2XWJI 3UYKA 3VPDA 3OOYA 1B6GA 4A8TA 4RKRA 2NP6A 1I4LD 1TT5A 2B4YA 1MQ9A 1FDWA 4YJHB 4GC9A 1KF0A 5CA0F 3KCNA 4O2LA 1HV8A 1ODKA 5IAGA 3WGNA 1KKMA 1VE9A 3KZKA 4B3BA 4NKRA 4ZEMA 2OPBA 2VTDA 4M0LA 2JFFA 1YDEA 4I50F 2W9XA 4O4HB 1BE8A 4IQGA 2QUBA 2MMCA 1IM8A 4WASA 1I51A 1YB1A 1I7NA 1DAEA 3BTUA 4L5JA 1FUUA 4LXXA 2FW8A 3R23A 5KS2A 5KVVA 4WFJA 2QVBA 2WJ3A 1J8YF 3UKDA 2HEIA 5JJLA 3DPSA 4BZXA 3A1DA 2AEFA 5IBRA 2P9TA 4YGXB 5AXDA 5DASA 1J1UA 2WF6A 3LUHA 4U9HS 5T8KA 2R5WA 1O8BA 2OL4A 1KMIY 2XMGA 4LV6A 4P4UA 5F2KA 5B5SA 3OO1A 4S0XA 3WLOA 2H00A 3EVAA 2WSBA 4I0WB 3AXSA 3RTBA 3GO4A 2YJ4A 3NT4A 1VQ1A 1OLSA 2RGEA 2IPAB 3PGA1 3PHJA 4D9JA 4EBFA 3D0QA 3LX8A 1RAEA 3BK7A 2L2QA 4UU1A 3CZRA 3WQSB 5ES4B 2KS6A 2YV2A 4OSPA 1B0UA 3A1WA 5EMMA 1M6VB 4M53A 5C1OA 5TC4A 3AILA 2UYHA 1JE0A 1YASA 5KYVA 4AG5A 1HYQA 1RYNA 2PXAA 5C34B 2GZSA 3OKFA 3V8RA 4RHTA 1XNQB 3H9CA 2B1RA 2YQ4A 1POXA 1RKXA 3QPCA 2C61A 2HJGA 2YHIA 5K3AA 1MABB 1NJ6A 2YS7A 4G5RA 3SJZA 4AMZA 1TE2A 1T35A 1PYGA 4WNYA 5ERXA 4F46A 3OC6A 4MS3A 1DINA 2I3ZA 2WYVA 1OWNA 2IZ5A 4DMKA 1RZRA 1T2VA 3PIIA 4ZQEA 4NNPA 1H05A 1CEQA 4F8EA 3R40A 1OE0A 5B64A 3VSCA 4QUDA 1LX6A 3E58A 3HO8A 3PXDA 3KDPA 4CM9D 4MP3A 5JYBA 3AEKA 3ET5A 5T5QA 4CV1A 3LUCA 4LVNA 3R9KA 5I9LA 3EUEA 3ISJA 1RMTA 5B3LA 3BAFA 4PPYA 4QUEA 3GLIE 5KWJA 5FLEX 4EENA 5AYVA 3TI7A 3PNBA 3HXTA 1L6IA 4RV9A 1X9IA 3PHHA 3BFPA 3R0VA 3LM8A 1H5NA 1CZOA 3IODA 1V39A 4BFZA 4F8YA 1F9AA 3SICE 3I32A 1EWVA 3FPJA 1WMDA 5EQJB 4X9XA 3RIXA 5I7FA 1XQ9A 1A0OA 1Z4MA 1ZOOA 4EUFA 3PDWA 4J2TA 1GQYA 4PPFA 5EKDA 4PYJA 2P5TB 3M2TA 3OZEA 2DX7A 1G4HA 3FN4A 4HEA6 4LYGA 3DMTA 1NHGA 3P2JA 4RVGA 2DTDA 1YCDA 2X14A 5DGIA 4TVSA 3D7RA 5MHTA 2VRBA 3W9SA 1EE9A 4NCKA 4RAQA 5A02A 1UQUA 5CXXA 3CTPA 2VF5X 3NVKI 1U8TA 2XHZA 5CXUA 3WGMA 2C7QA 3AHCA 1U3TA 5E0KB 3AP1A 3JD2A 4Z3KA 1WRBA 2BSQA 4DWOA 4UNPA 4OXKA 1RWNA 1YQDA 4KV9A 2VTBB 4X6UA 4KLRA 1JXOA 2F17A 3AP3A 5DSTA 1YUNA 3V1KA 5KEIA 1E5VA 1NMEA 5FT9A 3SZ3A 2ACKA 1ZCAA 1LPSA 4KNVA 4Z8XA 3EPLA 2Q1TA 5CFZA 4U0KA 2B4QA 5CW2A 3JQ8B 1I4EB 2R6HA 2PUVA 4UNNA 4XGIA 3GEDA 2RGCA 3GDWA 4PZLA 5DGXA 1WQ3A 5KKCA 1D7AA 1K5PA 4QU0A 3KB8A 3HCPA 2ZR0A 4MARA 2GX6A 5FWYB 4G0UA 3N9IA 3TW8B 4S1NA 3M5WA 5KJCA 4LHVA 3RTAA 1CUXA 1H5QA 5JZSA 3D2AA 3HR7A 1DBQA 1R6BX 3OJCA 4FC6A 4DREA 4Y6OA 4ARSA 3Q0IA 2F1JA 2G5TA 3MCWA 1DQRA 2VZ8A 4LFCB 5M7EA 1J2RA 3IEVA 1ZG3A 3DLHA 1Z2EA 1YONA 3VJLA 3KJIA 2XYGA 3DBHA 5E1OA 1E60A 1BD3A 1P0FA 2GBPA 3COPA 1NXVA 3HL4A 4FI3F 2HQSA 4IIEA 1XX6A 1DTWA 4G8DA 4LMAA 3VDRA 4BKUA 1XTQA 2C00A 5CLHA 4CCAA 2FPOA 1CBUA 1Y3CE 1Z5VA 4K7JA 1N92A 4U7GA 1CB0A 2VHJA 2Z0MA 3B53X 3P2OA 4GL4A 4L5CA 4WKOA 5EEHA 3T3MB 2JAOA 3B1XA 3PBKA 4C30A 1P1RA 1RWKA 1NVGA 4RULA 2EERA 2D5AA 3UMFA 4V0OA 2BFDB 1JFFA 1MZPA 4JB3A 2OHIA 1A9YA 4FUTA 4I9HA 5A0FA 2AUTA 2COUA 1I7DA 1XALA 2FXIA 2VJMB 2R86A 2IYUA 2XUDA 4QE3A 3ROGA 1PWZA 1UKYA 4AYWA 3OEWA 4YDSA 1VIDA 3BK1A 3K9WA 4YO7A 3UJPA 4EG1A 1UC8A 4IL5A 1T9BA 2FH5B 1A7KA 1VBFA 3K92A 1MJNA 2BHRA 3C15C 3UWSA 1X39A 2P2ZA 3N2LA 5BW6B 2H7CA 4J3NA 5HTOA 4NU0A 2GVZC 2FEAA 3IP5A 2I0FA 5FB3A 3ZGLA 2WHPA 4J3FA 3JRNA 3AERB 3P9PA 2YS6A 3NBFA 4D5GA 2Q3CA 1TCVA 1J0DA 2HKIA 2A59A 2QJRA 4KQCA 2AQ8A 2GBGA 2D1SA 2HA2A 3K2QA 4KDRA 4EFLA 4L4XA 4ID9A 1SC6A 4OV6B 3TSYA 3RFUA 5HVNA 2VCYA 2ZSJA 3EEFA 3RF7A 1VRVA 1E6CA 1SQGA 4OXRA 3ZCTA 1VRWA 4CDNA 1RPAA 3B9QA 1B0ZA 3OJFA 2HZBA 2D2EA 2V74B 4DDTA 2DUMA 2G25A 4BRZA 8MHTA 4X24A 3Q9UA 2I6FA 2ECFA 3NC0C 1ZGZA 2OCIA 2Y0DA 4ZFNA 4ZGBA 5JCJD 3QMPA 2E7ZA 3GFGA 4CTNA 2FW1A 2F90A 3AFMA 3AVXA 1JDVA 2WT9A 1H93A 1YB6A 4YRPA 4REQB 5CGZA 2CUTA 2Q8PA 5FPSA 3NYQA 2FEXA 3KQPA 2HRQA 5FADA 1P0CA 3SC4A 2ECKA 1IHXA 3ORYA 4RVOA 1OYWA 2XLCA 3BH7A 3TFWA 2UXCB 3A1NA 1V3VA 5K0NA 1YS2X 2B78A 1J42A 3V48A 1EZ4A 4UAJA 2BKAA 4YP1A 1AMUA 4OXQA 2GPYA 4ZV4A 3A58B 1PJLA 1QGUB 3EHDA 3IVAA 3FPFA 1Q7GA 4LI0A 4LOJA 3KWLA 4DLXA 1ECJA 4QQ8A 4J6EA 2IQIA 2AK2A 1PKXA 4ZU3A 121PA 2ZIZA 1OFUA 2VTVA 4EY5A 1DC5A 3UJ3X 3DE0X 3DE4X 1ZA1A 5T8KC 3KKPA 2B7LA 1FW6A 1DAFA 1TCAA 3RVRA 1NSYA 2V7QD 2IY7A 3Q7PA 4P1ZA 3HPRA 5BWMA 2VZ9A 2ZSHA 3I73A 2AKAB 3RT9A 5DK6A 1XUOA 3EGXB 5CG2A 2GF0A 5HYVA 3AP2A 1RYEA 1DUIA 2D59A 4A0RA 3DAPA 4RY2A 1X7XB 4JJAA 1CF2O 1LBTA 3QY9A 1E77A 2VJDA 3S6JA 4AF7A 4W5QA 3NVMB 5JQGA 3V8MA 1A96A 3VVCA 3AR9A 2I03A 2APJA 2MR5A 1AKTA 4LGMA 3ZWKA 1N0VC 4PX3A 1W49A 4YC7A 3ZY2A 3EUWA 1O5IA 2VAVA 5JI2E 4K9RA 1J24A 1SD1A 3GFBA 2Y68A 2IJGX 4RJTA 5JTTA 2GA8A 5JE8A 3VOTA 5K2OA 4QPPA 1PZFA 4XM1A 3A4VA 3D3WB 3RU3A 1VL6A 2GFHA 2OILA 4PNPA 4MPRA 1PW5A 2Q5IA 5K6AC 2R65A 2O8EA 3NHRA 4PYMA 2JFBA 1D4FA 1NXWA 3E7DA 4KTTE 4N48A 5GV7A 2IXAA 3IXQA 3AIKA 1WSBA 1EIZA 2HHAA 5GTDA 3K5IA 4DAEA 1HDZA 2ZRGA 3ZKAA 1FFHA 2Q2QA 4MR8B 2WF9A 3EVDA 5ED0A 2CJWA 4FYMA 4B4VA 3ACDA 5T67A 1P5JA 2CCKA 3I9V1 3DHWC 1E0AA 1JKFA 3T1YB 1FP4A 3AIOA 4G4SO 1VCOA 5DYIA 4F60A 4US2R 4N5MA 2UXDB 1V37A 3IQDB 1RRMA 4F93B 4Y30A 1AMNA 4RGVA 3LF1A 3ECSA 5EIBC 3UUWA 4HYTA 2CVQA 5KNBA 3MHPA 4YCNA 4IHKA 3OA2A 5IDYA 1TCBA 4BLSA 2BEVB 3KC2A 3KKKA 4EDHA 2C5AA 2P9QA 3HACA 3RJ9A 3LY9A 3E0XA 1WAMA 1D7OA 3DOCA 1Y82A 4HOYA 4S0ZA 4DJEC 4EW6A 3F5QA 1U5CA 3U9LA 1J25A 1Z5NA 4C2TA 2PPVA 1SUDA 1K6IA 4X97A 1CUZA 2XRFA 4CM9A 5IJ9A 4A8PA 1W6RA 1PFWA 2CXOA 2JGKA 4KOEC 1PGQA 1MT0A 3H4MA 4FIZA 5IXSA 4MUXA 2P9GA 2ZYAA 1H2ZA 2C20A 2UKDA 3FDXA 2P0EA 1YA8A 4CIVA 3CRRA 2B9EA 1CF9A 4BUZA 4UTXA 1TIBA 4QDKA 3I61A 1SOAA 5ICFA 3TLYA 4LHSA 1BXKA 3VU0A 4FFPA 4XKJA 2J31A 2PSDA 3QEAZ 1G20A 2QUHA 5AOVA 1NE2A 1T2FA 4N6NA 2OO7A 3IDFA 1ADJA 2WVHA 1Z4NA 4AROA 1E2DA 4I08A 4UC0A 2R60A 4UULA 2Y4NA 2Y3IA 4FCWA 2P8SA 3CZQA 4M0MA 5CVUA 1T1JA 5BSMA 5BQ3A 2QW8A 1ST2A 3PI6A 4PGAA 5MFZA 5HNKA 1Y6ZA 5ICMA 2CZQA 3ENVA 3U4QB 3M6FA 1Z25A 1XQXA 2ZI9A 2ZYIA 5FA8A 2R11A 4D42A 2WIFA 2YIMA 4F3NA 5JJIA 4CM1A 5EIFA 2QKYA 4CCWA 1AD2A 2C82A 4TMXA 3MTBA 1P1JA 1XMIA 3L07A 3RSSA 5BT9A 4R2JA 3OBBA 4UCFA 4XTCS 3MCUA 1QVVA 1U0OC 5TQ0B 2CHUA 2ZB2A 3C7CB 2PGJA 4EHHA 1WNTA 3ELUA 1PX0A 2I6SA 2YNMC 4Z2YA 3N2KB 3V1UA 1QYXA 1S0UA 3PCTA 5JSZB 4YWJA 3SVTA 2P7HA 1EK0A 1E3SA 2HN9A 5G1NA 2QVCA 3CLSC 4IF4A 4JR2A 5CT6A 3V4RA 3JW8A 3HV2A 5JANA 4KWIA 1Q92A 2GF9A 2IXEA 4HMOA 1NN5A 5WRFA 4P2BA 5AW2A 4GBJA 1EFAA 2XDWA 4N65A 1V25A 3ANLA 5ALRA 5JTUA 1J8MF 1URPA 4OLBA 4PPGA 2PH5A 2IEYA 3LF2A 2C9ZA 1WV1A 1BNCA 1WMSA 2HPAA 1BEZA 2JCXA 1CJKC 2O3RA 3EQ9A 3ITEA 2YOFA 4HPWA 4RANA 2QIPA 2J46A 3C3PA 4ESHA 1MOQA 3OSZA 2P0YA 3KP1A 4TTIA 1RZRD 1OI7A 2BMDA 2PLNA 2JGDB 2VXCA 4LYHA 4NJEB 1F5NA 1KHTA 3TR6A 3ZU6A 3KHKA 2Q6VA 3CR8A 3QUQA 4OD0A 3QY0A 4EW1A 2JBAB 3LDGA 4DMLA 3THYB 1G41A 1NFQA 1U6IA 1DFIA 2CEAA 4LSWA 5IMSA 2BFPA 2W6OA 5COBA 5AM0A 3DL7A 4QTXA 3RH0A 1KYXA 2DSTA 3RSHA 1S2NA 4HC4A 3STUA 4O2RA 1J23A 1HGXA 3MJTA 3HTXA 3PEEA 4YRZA 4F1KA 2B3TA 2CKMA 4M36A 1O08A 3DWGA 5ESWA 3RUDA 4XX0B 4BQOA 4KQEA 2QTFA 2D2IA 4OIFA 2FPRA 4GQAA 3EEQA 3G8BA 3N2NA 3S2FA 3SEQA 3DEKA 2WYOA 3TYXA 2IW3A 1CDOA 1JLRA 2G77B 4RO0A 4KI7A 5AXCA 1EX9A 2X9VA 3I2IA 1RHUA 3ESXA 4C0JA 1KEEB 1GG9A 3SD7A 1YRYE 3MVEA 5EIHA 5J5AA 4KXMA 5IFKA 5JY6A 5I51A 3FUUA 3RQSA 4HVCA 1MKYA 2D8AA 5G4LA 1ZN8A 5GZ6A 4DN6A 7YASA 5BWCA 4NS1A 2VSOA 4RHXA 1V5GA 4WOBA 3U1TA 5KYTA 4LJ9A 2VYQA 1U1FA 2W00A 3UPDA 1XCPA 3I28A 2AJTA 1HO3A 3EF3A 4XVHA 4HEHA 4GC5A 5LDGA 3HA2A 1ECBA 1EX7A 2JAUA 4B45A 1KNXA 3ZV3A 5AW6A 4CEHB 1NRJB 5AI8A 2PX5A 4MW0A 4F9EA 1UPXA 1COWD 2OCGA 1PR6A 5JZMA 1QZZA 3INYA 3TTXA 2CFCA 1TFUA 5LUBA 2CDRA 4MK4A 4C05A 1AURA 4YJ3A 2R1ZA 3KAPA 1QOZA 4NR0A 1SGWA 4N5HX 4WTOA 1JQEA 4R01A 1S1CA 4DJAA 2ID8A 3ET4A 3V4OA 3AETB 1NVWQ 1OJLA 1N57A 4MQFB 1JG1A 4FPXA 2NZJA 3EH2A 2E37A 2TRSB 5CBPA 3X1WA 1T4CA 3W06A 2XE7A 3NJ4A 4JS0A 3RYFB 1THZA 3G8AA 3VU8A 1N5LA 2X3UA 4HS4A 3PS9A 1IY0A 3B1JA 5AKJA 1Y9EA 4B3IA 1XQ1A 4CF3A 4DIFA 4TKVA 1KK1A 3LS2A 4KJZA 4KYTA 1M2OA 1V5IA 1WXGA 3L8ZA 3ZQUA 4FE7A 4BKRA 5BN4A 3IEKA 5K4AA 5JALA 3EDOA 3IOYA 5EYPA 1XKXA 3QMVA 1IWOA 2FSFA 3NWJA 5B3JA 5C32A 3O83A 3EK2A 1KEVA 4EWLA 3GJ6A 4NBKA 1UKEA 2VJAA 2ZRBA 3A3OA 3I0NA 1GZ7A 1P9WA 4HZIA 5AHWA 3WQRA 4FKBA 5K45A 3N7UA 4CL2A 4RZIA 4P4NA 4BFCA 4HXYA 2A67A 1Z8DA 1LBEA 2VPZA 2WTEA 3B8EA 3C24A 4EHLA 4EY8A 1PTKA 4W9MC 4LXUA 3ZDAA 5MGNA 3K5HA 1XL1A 3CF2A 4NMHA 1W48A 1LLQA 3A05A 4F4DA 4UUAA 4JBHA 2QGNA 3KSDO 1GA4A 5EZ6B 2XXBA 4MW7A 4D98A 2VPIA 2CFIA 2JEYA 2ZBGA 3O2QB 5A4FS 5BORA 4ITVA 1Y9JA 2WMYA 4C9BA 4PNEA 2C5EA 3LIIA 4V3CA 4AMYA 1I3CA 2M2IA 5CXQA 5IXYA 3ZNPA 1E5QA 1UP4A 4KXNA 3HKCB 3OESA 1YA6A 1P9OA 3SIWA 1L7EA 3QG1A 1EHYA 1CUGA 1AGYA 1TDJA 3IB3A 2HMAA 4MEJA 821PA 1TAQA 1XAIA 4YREA 3G5TA 1BVHA 1HL3A 2CE2X 4Q1AA 2AQHA 2FGKA 3B48A 3TE6A 1B73A 4JENA 1GADO 1ENYA 2ZEJA 5LR6A 2QGFA 3PKIA 3MPUA 3K2BA 4GR4A 5DP2A 3KQQA 1C1YA 3L5KA 3EQZA 4DCUA 4TYPA 2WKWA 5JCPA 3EHEA 4MH0R 1F8UA 5T41A 1OZFA 1U3FA 1H8EA 2GTIA 2HWWA 5FWXB 2B35A 1ZHFA 3F71A 1AF7A 3KPJA 3MNFA 4JNKA 4EHDA 3ZBPA 3EIXA 4CM6A 3RTEA 1O77A 4A5SA 3BB1A 4WFKA 2AX3A 4BFTA 4NP6A 5AI6A 1DZIA 2TSYB 3R7SA 4ZK6A 3ABOB 2EFGA 4WBNA 3K35A 1LWOA 2NZXA 1QUEA 3QLUC 1O54A 4L73A 5J2TB 2NTNA 1JJIA 4Y98A 3P27A 2O2GA 2PMFA 4QTYA 4OA5A 2VAPA 5JZ9A 5JJKA 4X8MA 3H05A 3BRQA 1GDTA 2OZVA 5BQOA 4BWVA 3UV6A 4UDXX 3DAYA 1R8YA 1V35A 2ZTSA 3DUFA 4PZ9A 5G0VA 1ZR4A 4CEIA 4IHJF 5EXTA 4RX1A 4B81A 3OAAD