1AHIA

7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ahiA00
3FNFA 1J0XO 4RDHA 2VOJA 4RPHA 8ADHA 3WOHA 5DNAA 1BW9A 2UVDA 3KTDA 3RWBA 3CINA 1RM5A 4NHEA 2FR8A 1X1TA 2CUKA 3OM9A 3WWYA 3ZWVA 5G4KB 3UF0A 4CMJA 3DOJA 4J1TA 2GCGA 2BGKA 4PLFA 1T1RA 4HFNA 1IL0A 2YHUA 3UKOA 1DHRA 1BXGA 1BW9B 3RBZA 3AK4A 2VYND 2RCYA 1IHYA 4OSOA 5FI3A 3TOZA 3H9EO 4ND4A 4U0JA 3FNGA 1Y8QA 4Y6PA 4YEDA 1MX3A 4ILKA 3ZHZA 3AOEC 1AXEA 1QSGA 3D4NA 3R6DA 2NADA 3TOXA 5JXWA 2Y0DA 4BB6A 2Y0CA 3PWZA 3W1VA 1BXGB 3R3JA 4HP8A 3DZIA 1DRWA 5JDIC 4UUPA 1NWHA 5TJHA 2CDBA 3JQFA 4B3JA 5A04A 5JLAA 5COQA 3H5AA 1Y8QB 3NT5A 4FJ0A 1ZIDA 2AQKA 1EVIA 4M1QA 4FN4A 2HMSA 4XQCA 3IJPA 3KYBA 3ZGYA 3RC2A 2GPTA 2GF2A 2J6IA 3QJ5A 4DC1A 5B4VA 1LRLA 2YHIB 2Z1NA 4TROA 4WOKA 4Z0HO 4FGWA 3KSZO 5A9TA 4E30A 4LK3A 3CE6A 4YAJA 3IC5A 4I8XA 1DIBA 1JN0A 3WGIA 2C0CA 4P4LA 1HETA 5DCUA 2FZWA 2O48X 2JFHA 3MTJA 1WZEA 2JJYA 4XDYA 2PZMA 1TT7A 1VJTA 3NV9A 3OIFA 4Z3DA 5CEFA 3ZNOA 2WTBA 4YB8A 3D3WB 3HUDA 4E2XA 4CQMD 3O26A 1N1GA 2HDHA 3AU9A 3Q0EA 4ALIA 4BO4A 4CLRA 2Q1SA 1UXKA 4IINA 5F1PA 3GVIA 3C7CB 4OL9A 5AOVA 3KYDA 3WBBA 5KJ1A 1ZK4A 4MPDA 1G6KA 5L3ZA 3G79A 5T8KC 3WJAA 1JWAB 4P22A 3U5TA 4K26A 1AHHA 1P1IA 5ER6A 2UAGA 4WCDA 5JY6A 1LC3A 5KNLA 2HRZA 2J3HA 3KEOA 3OETA 4YR9A 4Z0TA 3OEWA 4MINA 4P4GA 1MFZA 1PEDA 4CM4B 2B5WA 1PS0A 2BKAA 2VNAA 1YQGA 4DWVA 2GERA 1H0KA 2GD1O 2AQHA 3JTMA 2DC1A 3PZRA 4JIGA 5IZCA 4YVFA 5JPIA 3I1JA 3CH6A 1FDVA 3OJ0A 4EUEA 1PZEA 5EESA 1X7HA 5BQFA 3QV1A 1HDXA 2QYSA 4WLVA 4NNJA 1H6AA 1YOVA 3W6ZA 2C82A 5CDSA 4I9UA 1D4FA 4TMFA 2W2LA 3GZNA 3MOGA 4JP2A 3WR5A 4D79A 1Y8RA 3SVTA 2Q4EA 2IYPA 3GVXA 2HQ1A 2CSUA 2O3JA 3I9MA 1VI2A 3IMFA 4BOYA 2HRBA 1MGOA 1GUFA 3ZDFA 1IZ0A 1LLCA 2O2SA 1I30A 2EWMA 2GN8A 3UUWA 2I3GA 5KJCA 3DZBA 1DC6A 4QEDA 3AM3A 5A4DA 3WJ7A 1MA0A 1ULUA 5A05A 3UAGA 4R3WA 3G17A 1LUAA 4OAQA 3AI2A 2YUTA 2D2IA 4KOAA 3RFTA 2C7VA 3NTOA 4GAEA 1U2DA 3PJDA 2OO5A 2XXJA 3E18A 2O3QA 3WB9A 2QZZA 1P0FA 4BNKA 1ZH8A 1LI4A 3E9MA 4MDHA 1OFGA 4CM7A 4RQUA 1O89A 4A03A 1XEAA 3FWNA 1CQIA 1A7AA 1MP0A 1ISIA 2B4TO 1CEQA 1A9YA 5B4TA 2J5QA 4O59O 1TI7A 1M6WA 4DQXA 3DXFA 2GZ1A 3H5NA 4L0QA 2A35A 1KC3A 3IAHA 3H2ZA 4Z6KA 1B16A 4D42A 4NBUA 4ALMA 1VJ0A 3DTYA 3RD5A 3TJRA 4QFDA 4WLEA 3IOYA 1I01A 1I2CA 4HV4A 1ZFNA 2C5EA 4EJMA 1HYEA 4MJLA 1GPDG 4YCAA 4YJHB 4XA8A 1PQPA 4MIEA 1DRUA 5A03A 4WASA 1NFQA 4R9RA 4CLOA 3WQSB 4LSMA 1T1SA 4R1NA 3MEQA 1NBOA 3OQ1A 5LDHA 4R68A 2A92A 1F12A 2DM6A 4KQXA 1V6AA 1YBVA 1A5ZA 4R1SA 5G0VA 5TT0A 4JBGA 2IXAA 3RFXA 3TSCA 3U09A 4RORA 3GGPA 3ONFA 1I2BA 1ZJZA 4XB1A 3HDYA 5CPBA 1NVGA 4HFMA 1E3WB 2B4QA 1IPFA 4WK6A 1ZZEA 2J5RA 4G5HA 4ALNA 3T4XA 3VAZA 4LN1A 2J3IA 4Q3CA 1LC0A 4CM8A 4FR5A 1X14A 1Z45A 1U2GA 1XGKA 1NNUA 2BD0A 1CIVA 5GY7A 2IZ0A 1HZZA 3W8FA 3LT2A 1AGNA 3U3XA 1SC6A 3H9GA 1U7TA 3RIHA 1T2AA 4BHTA 3QE3A 4XRGA 1XU7A 4YRAA 1DC4A 3CEAA 3LF2A 5EJ2A 3ZV6A 3HHPA 1A7KA 1B8PA 2OP0A 4MVJA 3RUAA 4M54A 4YPOA 2GLXA 2HJRA 3DHEA 4UVDA 5DP2A 3V2UA 1B26A 3L07A 4JX8A 1E5QA 4RF3A 4R1UA 2ZQZA 5T64A 3WYEA 2E48A 4GQAA 2NVUA 4QT0A 4YT5A 5T67A 2PZKA 1E0DA 4RPLA 1ZK1A 4MKXA 4UEOA 4CMEA 4YT4A 3PIIA 3CTMA 4BO0A 4B4VA 4E5NA 3SXPA 4PIVA 3LK7A 4NI5A 1XDWA 1KIFA 4ZU3A 2NVUB 1LX6A 2OMEA 4JLWA 4ZGWA 5F21A 4DLBA 1NXQA 1LU9A 1ZEJA 4XQGA 4D44A 1C0LA 3T7EA 4AJIA 1C1DA 1UP7A 3CZMA 3H4VA 3EC7A 5TX7A 5T6BA 1HE2A 4JJGA 1CERA 3WX0A 1VKOA 4FJ1A 2Y93A 1I0ZA 2HMUA 1P9LA 1ONPA 1PJLA 4IY1A 2ET6A 3GRPA 3JQ7A 3OBBA 5CFZA 2JAPA 3K96A 1GAEO 5JCXA 3GEDA 3GR6A 4DLLA 5K6AC 1T24A 4E5MA 1Y9AA 2GN9A 5L95A 4IGEA 5A9SA 2I6TA 4CV3A 4WPGA 4J7CA 3RBVA 1DAPA 3DAGA 4TVOA 1Q0LA 4XKJA 2G0TA 4ALKA 4H16A 2RHRA 4YJGA 4CM6A 5G0UA 2ZJ0A 2WM3A 4CUZA 1U4OA 4E0BA 4KMSA 4C7JA 2PLAA 1ORRA 3FBGA 5F1OA 2PGJA 2VYVA 2AE2A 2HU2A 2PKQO 3MJVA 4BNYA 3I5MA 3IS3A 1N1EA 4RLSA 4QO8A 3LU1A 1BMDA 5A3VA 4OKIA 1PZGA 5JC8A 4XEHA 3M2PA 2EF1A 2PZLA 2H1SA 2P68A 3BMNA 3AUSA 4U6QA 5FI5A 2HLPA 4NBRA 3F4LA 1NP3A 4UULA 3TWOA 1IOLA 3DBLB 1SEPA 2FOIA 3AI1A 1ZSYA 4MOWA 3RASA 4LGVA 1KERA 1FMCA 1H2BA 3OA2A 5L53A 5L4SA 3JQAA 3I83A 3A06A 3BAZA 2I5PO 3G3EA 4JJIA 1B8VA 2JHGA 4QQRA 4Y8VA 4AJLA 1C14A 2J3KA 4XD2A 2VQ3A 4E21A 4PFJA 1E1KA 5ITWA 5IJZA 3K5PA 1WMAA 3RQSA 5G0TA 2OUIA 1F8GA 5CG2A 2Q4BA 3PDUA 1NR7A 4ND3A 3SLGA 1QR6A 4U5QA 1E7YA 2QRJA 4CM9A 1I5RA 3QP9A 4FFPA 4AL4A 3IP1A 4OXNA 4G65A 5A3JA 3X2EA 2O3RA 4FFNA 4RF2A 1T2DA 4HKTA 2NU8A 2CFCA 3V1YA 1M66A 4BUCA 3EZLA 1ISMA 3DMYA 3KLMX 4P8RA 3U4HA 1RYEA 5FEUA 2W90A 4WCFC 2JD0A 1R0LA 4PN3A 3K2BA 1JLLA 4BKUA 5IF3A 1LRKA 1NPDA 4II2A 1JA9A 1ZEMA 3ENNA 3PFWO 5H82A 4YRBA 1T4BA 3IUSA 3PHGA 1U5AA 5L7WA 3UN1A 3A9WA 2ZB7A 4ZICA 5IAAA 1BGVA 2O3SA 4OJNA 4XRRA 2IEBA 5TGDA 2GRAA 3GVHA 2ZYGA 5L7TA 4GVLA 1SOWA 2B4RO 3PGJA 1SAYA 3IJRA 5I7SA 3Q9UA 1KVTA 4WCFB 2BELA 3QWIA 1HYGA 3ZZNA 5HBRA 3PLNA 1HKUA 2DBRA 3W8DA 2CF6A 3K8ZA 3RUDA 4OM8A 2OZPA 1A9ZA 4MKRA 3WGQA 2V6FA 4UEKA 3GDFA 2NTVA 4TQGA 3GEMA 2PD6A 3AM4A 1PQUA 2DKNA 1L7DA 2HMTA 4ZQBA 3PXXA 4WGGA 1K2WA 2Y0EA 1BHSA 3JQ9C 3V1UA 2W8ZA 3AUAA 3RCBA 3VZSA 2Q45A 4L74A 4EYEA 2WJPA 2CD9A 1PJQA 4M8SA 4RGBA 1ADCA 4Y9DA 4RL6A 3KB6A 1QXSA 1DDOA 2HJSA 5CEJA 3IQDB 3RKUA 4YYZA 2RHCA 1DIAA 3SEFA 2Q46A 3FSRA 3ANLA 1UAYA 1X1EA 2DTEA 3ULKA 4WNIA 3SX2A 1VC2A 4OYRA 3CMMA 3HADA 4Y6SA 4CLEA 1GV1A 3N74A 5TNXA 1GYRA 5LC1A 3IP3A 4BO7A 1LEHA 3RUHA 1DLIA 3A14A 4NZ9A 1SB9A 1ULSA 1Y7TA 3Q2KA 4PZCA 1HF3A 4DPLA 2V6GA 3OQBA 4E32A 4AJJA 4NJMA 3EGOA 3UHAA 4M49A 4YJDA 3D64A 4RV9A 2P9EA 2J3JA 2FHSA 2YFHA 1ZVMA 1ZK2A 1XELA 1V0JA 1UJMA 3FWZA 5G0SA 1P45A 3TZKA 3WICA 4IJVA 3DEYX 2NU7A 1KEWA 1WPQA 1O95A 1X15A 1HL3A 4GLOA 1NQOA 1ENYA 2AEFA 4G81A 3FBTA 4MVJG 1TLTA 3DMTC 2BGMA 2PH5A 1QLJA 1PL7A 2FY8A 3FRJA 1EVYA 1LJ8A 4BO5A 3B6ZA 1T26A 4HXYA 2Y66A 2H9IA 4UAGA 3F3SA 1DIHA 2OBYA 5MDHA 2EGGA 2VWGA 3S8MA 3NGXA 1TVEA 1PJ4A 2DPHA 2VRCD 5EN4A 1XHLA 1B0AA 2LDBA 4L75A 3TDKA 3PTZA 4AVYA 4CUJA 4CUKA 3ASUA 4YA6A 4M86A 4J4HA 3BMCB 1A4IA 3OECA 1E5LA 1JKFA 3GUCA 3QSGA 4R3NA 4AJOA 2C59A 2EKPA 2BI7A 2W2LD 3UICA 1ZK3A 4ITUA 1YKFA 4LVCA 2CF5A 4B4WA 2YDXA 1B2LA 1V3UA 4KTTE 4W6ZA 3ZCXA 5G4LA 1YDEA 3EMKA 4CPDA 1YVEI 4RQTA 4PLWA 2I66A 1TT5B 2TMDA 3LLSA 3UVEA 1QYVA 2VTEA 4IUYA 1U8XX 4CM3A 3RUCA 3E48A 1B3BA 4ONEA 3OP4A 3N7UA 3TPCA 1WWKA 2RBEA 1U3UA 5ICSA 1QG6A 5JS6A 5CAEA 4TZKA 4FOSA 1WVGA 3ONDA 4RVSA 4AICA 4XGIA 3QWBA 3I6QA 4IS2A 2Q1WA 1D3AA 3ZHBA 3RJ9A 4BGIA 1K6XA 1S7CA 4IGFA 5AVOA 4RVFA 5ENVA 3WTCA 3RUIA 4FFLA 3VH3A 1UP4A 3JQEA 3AM5A 3NT4A 3KRTA 2IE0A 1NFRA 4J3FA 4WLUA 2D1YA 3GG9A 4XR9A 1BDMA 2VHWA 2EJVA 4PLVA 3BHIA 3S55A 4EUFA 3WTBA 3QWAA 3AOGA 1E7RA 1LNQA 2WD7A 1ZUD1 3OQ6A 4YDRA 2Q99A 2Y1OA 3HZZA 4TSKA 5IDWA 2ZIZA 1T4DA 2PD3A 3GGGA 1XQ6A 1YL5A 2JKVA 3WIDA 4IDCA 2BRUA 1UZMA 5C5IA 1DB3A 2YQ4A 3O8QA 4W4TA 1F0YA 1P31A 3FPLA 2C2XA 2QG4A 5TS3A 4YXFA 2FMUA 3WGTA 1EEHA 1PJTA 2WD7B 1E1LA 3ADOA 1IUKA 4EI2A 1K6IA 2DUUA 1NHGA 4OGWA 5IFLA 3HDJA 3VVBA 4YJFA 3MCVA 5COBA 4BQPA 4KUGA 4IQ8A 4Q3NA 1IZ9A 1H93A 2YV3A 3HE3A 4JJFA 3VHRA 4LW8A 1VSVA 3LZ6A 2QQ5A 3L6OO 1ADBA 1K3TA 2Y68A 4YJFB 1AHIA 4YAIA 1EVJA 1JTVA 2XPCA 4CLHA 2EHDA 5JO9A 2Y67A 4BNNA 3NDJA 2HSDA 3SLKA 3H2SA 3A28A 3PQFA 3DL2A 4IZIA 2B0JA 3H3JA 5H81A 4JQCA 4KWIA 5DOVA 1A4UA 1D1SA 1VJ1A 3NEPX 4FFRA 1Z82A 4MIYA 4IJUA 2FP4A 1PQWA 4E5PA 4A26A 3LVFO 4H7PA 4I5GA 5CDGA 3NDIA 3KYCB 3WGYA 2Q50A 3FN4A 5BNIA 4ZJUA 2VWHA 4BGUA 3QLJA 4MVJD 4PLPA 3PQEA 4X54A 2H5LA 2PKRA 2OBNA 2PD4A 1GQYA 2X0JA 1NVMB 1I33A 2FPIA 1E3LA 1QV7A 4E31A 3UH1A 1RM4A 2YFQA 5IN5A 1MXFA 3AOEA 1UXGA 2YHIA 4ESOA 3BTVA 1XLTA 2NACA 5I9NA 5JYDA 2UUOA 4AJHA 2X5OA 4CMHA 4AJPA 1E6WA 1Y9EA 4NQZA 4DBVO 9LDTA 5IG2A 4ZQFA 4EGFA 5JDIA 2Q1UA 5KWEA 5JAMA 3M1AA 3ROQA 3KVOA 4J90A 1KVUA 1PSDA 2BFAA 1OI7A 1U5CA 3RKRA 3D3WA 2NTJA 1MLDA 3ZU5A 3VKUA 4GSKA 4BKOA 4JXKA 4TRRA 1L1FA 3C85A 1DAOA 4XCVA 1FXSA 1GZ4A 2NU6A 3DQPA 3GMSA 4IDBA 2VWPA 1ISHA 1H9BA 1KYQA 5EMHA 4W7HA 1WDLA 2O7SA 1C0PA 1I24A 1VLLA 4CL3A 4CM4A 2YYYA 4DVJA 1XSEA 3ZW8A 3INRA 1EBFA 4LCJA 5L40A 4QO7A 4YT8A 3GFGA 3H5RA 2Q2VA 1AN9A 1WDKA 3QIVA 1DJNA 3CKYA 3FD8A 3WLEA 4Z9YA 5T8KA 3OJOA 3JD4A 4Z3KA 1U3WA 4MP6A 1R4NB 2VOEA 3WQQA 5THQA 2I9PA 3ZI0A 1LQTA 1U28A 1U3VA 4N5MA 1E3JA 4E2ZA 3JQBC 3JD2A 4TKLA 5T5QA 4II3A 2PFGA 3DAFA 3FI9A 3M2TA 3BHJA 4JNKA 5HS6A 3NGLA 3DZFA 4F45A 2Y1GA 3ZWYA 3GG2A 1U9JA 4NFSA 3RAJA 2VZ9A 3WYBA 1Q7CA 3JQAD 4GGPA 1YWGO 4EZBA 2FR0A 1ISGA 5CPFA 2G1UA 3VC7A 3EW7A 4E13A 1SCUA 1J5PA 1YRLA 5L9AA 5KVSA 1E3IA 3WQRA 1H6CA 3ETDA 4A2CA 3K73O 4CMGA 4FW8A 1HE5A 5BR7A 3MWDB 4XB2A 1H6DA 3AJRA 4JGBA 4NG5A 3DOOA 3O4RA 2NLOA 1QKIA 1W8DA 3VDRA 4OXKA 4LISA 1LLQA 1JVBA 2ZTMA 2DFVA 3KOUA 1LLDA 3GH3A 2WDZA 3NAQA 3NYWA 4RPGA 4YQZA 5TC4A 2X1HA 1GZ3A 3JYPA 4AG3A 3H65A 2O50A 4P38A 3N58A 4ZRMA 3F4BA 4PG4A 4GX2A 2C7GA 3VDQA 3AFMA 2D5CA 4PCVA 5IDQA 4CMKA 1ONNA 5CHEA 4Z0PA 1R0SA 4GL4A 3E03A 1CDOA 3PJGA 1I3MA 1ZKMA 2ZCUA 4L73A 4RVUA 3RROA 3F9IA 4KWHA 2VUSA 1QRRA 3DR3A 3W4KA 3WLFA 3I9JA 4DA9A 2DT5A 3EYWA 4RPKA 3S2IA 4WJZA 3HDQA 2WD8A 4YJHA 3PPIA 3FR8A 5F3RA 3ZV5A 4A7PA 4L76A 4GKVA 4Q39A 2ZYAA 2YV2A 4BNIA 5ADHA 4N18A 1MV8A 3C7AA 1SPXA 1HE3A 3IUPA 6ADHA 2VHXA 4BV9A 2HK8A 2BI8A 4J16A 4EW6A 4ZN6A 4BIIA 1OAAA 3CSDA 2EERA 3OSUA 4D3FA 1GDHA 4IQ0A 5L51A 3KETA 2J5KA 1E3WA 1HE4A 1N2SA 3PZBA 1GZ6A 3GHHA 2JFGA 1SBYA 3F46A 5GZ1A 1AUPA 1GADO 3FTNA 3K30A 3S2FA 3W8EA 4B8WA 5DOZA 4ZQGA 2CMDA 2YW9A 3Q1LA 5CG1A 5GMOA 1EZ4A 1TXGA 3DOCA 1SOVA 4IM7A 3RBXA 3GVCA 1PZHA 2E82A 4BKRA 4XGKA 3NDRA 3B1JA 1JKIA 2XOXA 1DFGA 4LMRA 2QRLA 3AY3A 2G76A 2WE7A 1KEUA 4IJKA 4DBZA 4E33A 2NWQA 5JAIA 3NX4A 4UVIA 4J4TA 5U1PA 3SC4A 2PGDA 3EY4A 4WEOA 1GCUA 4INAA 4IDEA 2OGUA 3AI3A 3LSYA 1HEUA 3GPDG 2Q1TA 5C7OO 3JQ6A 2ZATA 3ITDA 4Y67A 4BNTA 5KJ6A 4BGVA 3L4BC 2IEDA 1ZNQO 4CQLB 1BVRA 1JU9A 3T7CA 4E2YA 1LBEA 2B83A 4J1SA 3I9KA 1J49A 1KEVA 2X6TA 3KEQA 4FC6A 2FZEA 5TJ9A 2C54A 1N8KA 3A4VA 1Y5MA 3DZJA 3U4CA 1Y6JA 1A71A 2VYNA 3ASVA 3JSAA 4CM5A 1F17A 1ZXBA 3HG7A 3TZ6A 3O03A 2ZKLA 4KUEA 2Q2QA 4W9NC 4EITA 1VKNA 2D3TA 2DTXA 2CVZA 3D0OA 3HFGA 4R51A 2AW5A 4TKMA 1OC2A 3HFSA 2E6UX 2X58A 3K6JA 5TIIA 1QORA 4IBOA 2HCTA 2X0NA 3O38A 3EHEA 3VH2A 3JQGA 4R1TA 5AXCA 3BA1A 4K9DA 1H94A 3FPCA 3QVSA 4BNXA 4N5NA 2X0IA 4J7UA 4CR6A 5HS4A 3VTZA 1ZW1A 1UZLA 2H63A 2NM0A 3GDGA 4NIMA 5BNFA 5FF9A 5I9LA 2PY6A 4XYGA 4A5OA 3F47A 3G49A 5K6AA 4CR8A 4CV0A 4I1IA 5TRTA 4E4YA 1U3TA 3JQGB 3U4IA 2BGLA 1O9BA 2GYYA 5CEEA 2EP5A 2QX7A 4XGNA 5JY1A 4KZPA 4PRKA 1SO8A 3QQPA 2OOSA 5LCXA 2IODA 5A02A 5F5NA 2E49A 4CQMA 1A27A 3ON5A 5FFFA 3DBLA 1ADFA 2QW8A 1SEVA 1Y1PA 2PNFA 1YDWA 4G2NA 5IXSA 4XWYA 4A0SA 1VPDA 2GN4A 1ENPA 4BB5A 1LSJA 4DC0A 3WXBA 4BNUA 3SC6A 4BV8A 3E9NA 1CETA 3MTGA 4HWKA 4IPTA 3RC9A 3TQHA 3ZHXA 4CQMB 4J4BA 1NX6A 3KSUA 2O3UA 2Q3EA 4E5KA 3Q6IA 1M6HA 5TLSA 3IKTA 1E3SA 4U7WA 1P1KA 1KVQA 3LT0A 3WFJA 3S1LA 4PG5A 1W6UA 3D7LA 5EL0A 2DTDA 3ZWAA 3Q9NA 4BO8A 4RZHA 5ILGA 4YQYA 4O6VA 3PK0A 4GVXA 1QYDA 1LA2A 3H9QA 3QVWA 3Q11A 5THKA 3CUKA 3AY7A 1FK8A 2DUWA 4TRNA 3GK3A 2YZ7A 1GEEA 3CPSA 1EDZA 3I9OA 4BVAA 4R5MA 2R00C 4LRSB 4BKQA 5HA5A 4Z9XA 1RYDA 1YL6A 2QRKA 2VHZA 4EJ0A 5JCJA 4L9RA 1C3VA 4I5DA 3HB4X 4UEJA 2NV6A 2YDYA 3GVPA 2H6EA 5TT1A 5L7YA 4DIBA 2Q2WA 1UH5A 2AE1A 3INTA 4FIZA 4PLHA 5J23A 4ZQHA 1N5DA 3PI7A 1AE1A 4WCFA 1UXHA 3NJ4A 1HDZA 4GBJA 1TEHA 2OORA 1I3NA 1T2EA 2VT2A 1EK5A 2JCYA 3ROMA 3JYOA 2W2KB 1PJSA 2GSDA 5HM8A 1CRWG 1DC3A 3EVTA 2DU8A 4L4RA 1P1RA 3C7DB 2GASA 4WLFA 1KVRA 4J9VA 5LDGA 4WECA 4MVJE 3B1FA 5L4LA 5K9ZA 3UGKA 2HUNA 2DBZA 2PK3A 1ARZA 3PYXA 3ZWBA 5EQFA 1J6UA 1YJ8A 3GEGA 4JK3A 4XYLA 2WYUA 3AUTA 2AQ8A 5DCYA 2AHRA 1E77A 2FSVA 3F5QA 1HSZA 4WNCA 3C3XA 2VTDA 1N92A 4BS9A 4MIOA 1E7MA 4NBWA 4HADA 5BSEA 5JC1A 4TRMA 4J0FA 4J49A 4BNGA 2ZB4A 3V2GA 1UZNA 4PGFA 3DZKA 1N9GB 2OFPA 3CMCO 1EDOA 3WGZA 4NMHA 2NTNA 4RLHA 5H83A 2DBVO 1CJCA 3ITKA 1YE3A 3KBOA 5FWNA 1F14A 4J1NA 3IKVA 1SZJG 3BHMA 5K0ZA 3DBRB 4PZDA 4RPJA 4B3HA 3HN7A 4XX0A 5JDCA 1YQXA 3S2EA 5IDYA 5KJEA 1PGJA 4J2OA 4S3MA 2E37A 2PTGA 3PJFA 1G0NA 1DBVO 4GI2A 4CLXA 4KP7A 4AJ1A 4DIFA 3HQ4O 4IXWA 1P0CA 4ND5A 2OP1A 1M76A 2X9VA 4OO3A 1LQUA 1QV6A 1XQ1A 4L4XA 3G1TA 2B5VA 2X9GA 1CQJA 1FDUA 1U7HA 2GGSA 1V9LA 2RH4A 1TA4A 2I3AA 2D4AA 3VPXA 3PWKA 4PVDA 4B7UA 1PGPA 2WWRA 1HLPA 4RF4A 2RIRA 4JBIA 1ONOA 5IN4A 4OOEA 3WSVA 4J7XA 4IDDA 4C4OA 3DC2A 4IJWA 1BTOA 4AFNA 3LLVA 5C3MA 5A5EA 5ES3A 3JQDA 4FPXA 3PEFA 4JBHA 3RC1A 4KUHA 3ZWCA 3ANNA 4FOOA 4R4JA 2Y1FA 3WNVA 2YQ5A 2HKIA 3DMTA 4YAKA 1M75A 1WW8A 3BMCA 4GKBA 3I4FA 2O23A 2RAFA 1JVSA 3Q3CA 3DFZA 1JWBB 4J1QA 4R69A 5JW6A 1IHXA 2WE8A 5CDUA 1TT5A 4YTEA 3VZPA 4R01A 4AJEA 3OHSX 4PLYA 2WYVA 2JCXA 1ZBQA 2EIHA 2FPPA 3JYLA 3L77A 4BNFA 3GC6A 3I4CA 4E2WA 2TMGA 5BSGA 4N7RA 5U9CA 3GF4A 3JD0A 3P2OA 3BMOB 4JN6B 3QA9A 3GMDA 4DRYA 1HLDA 2P5YA 4J43A 2FR1A 1GQ2A 4PLZA 3PLRA 4QECA 5JAQA 1Z74A 3VH1A 4LCEA 2WEKA 2IRWA 2Y99A 4NK4A 1EBUA 4GH5A 2OHXA 3B70A 5KKAA 4R41A 1KS9A 7ADHA 3GAZA 1OOEA 4Q3AA 1RJWA 2JL1A 4HFJA 2V7PA 3G0OA 1N7HA 3GNSA 3UW3A 4F6LA 3HB5X 3PRJA 4J91A 1MG0A 1PGOA 1PZFA 1NHWA 2NQ8A 3OFSA 4H15A 4PVCA 5L4NA 1E7WA 2C2YA 3VH4A 3C1OA 1FDWA 4DMLA 2B36A 1I10A 2CNBA 1PR9A 5IXYA 3ETGA 4NU5A 4E3ZA 5KOIA 2ZK7A 4E6PA 2Z1MA 3ZU2A 1DPGA 3GNTA 5GZ3A 1MC5A 2HK7A 1LDMA 1KETA 1YS4A 1HDGO 2AG8A 2Z5LA 3NJ8A 4JROA 3GPIA 4W82A 3OEYA 4E5YA 4ZVVA 3ZWPA 1HXHA 5F1KA 3LC2O 4PLTA 1DIRA 2VHYA 3DHNA 3PYMA 2O4UX 3WYCA 2Y1EA 4LVUA 2POQX 1NYTA 1QP8A 1MXHA 2NUAA 1CF2O 2DLDA 4D46A 1DSSG 1U1IA 5CP8A 2HO5A 1YBAA 4K6FA 4J0EA 1DIGA 3H6KA 3W6UA 3KXDA 3FTPA 4BKPA 1Q0HA 1QLHA 2UDPA 3P19A 3GRKA 4B79A 3U4DA 5HRUA 4EBFA 4GX1A 1NR1A 3NUGA 2A94A 2EGHA 4XIYA 1G0OA 4FD3A 1EE9A 2X4GA 3RU9A 3WFIA 3FCOA 1V8BA 3DWFA 1UR5A 4MP3A 3OJLA 4MVJH 2BFMA 4IZHA 2E4AA 5AXBA 3HN2A 5I9MA 3VVCA 2DQ4A 4FJ2A 4NK5A 4FBGA 5KTKA 1PJ3A 4L8VA 3F1LA 2ILTA 4HFRA 2PV7A 3WGOA 3JD1A 1GFSA 3L9WA 1GUYA 2GDZA 3QWHA 2X5KO 3P7MA 5I8ZA 1R16A 5FYDA 1Z7BA 2AA3A 3PFFA 4QFCA 5TF4A 2VWQA 1E1NA 3PWSA 3V8BA 7MDHA 1P74A 3KYCA 1UP6A 4HY3A 3V5NA 3DHYA 1BRMA 3RJ5A 4CMBA 3E9QA 3ZWMA 2BLLA 5TQVA 4O0LA 4BO1A 2CVQA 1QMGA 4EUHA 1K89A 4A10A 3DTTA 3E82A 2DAPA 1PL6A 5ITVA 1BDBA 1GUZA 1KVSA 2JD1A 4M55A 2EEZA 2HAEA 3PHJA 3FNHA 2AXQA 3FHLA 1W73A 5BSFA 1O94A 1RKXA 4OQYA 3GZ4A 3DONA 3E1KA 1U4SA 3ZH2A 3AY6A 3JYQA 3RSHA 1YJQA 2YJZA 1R15A 3HDHA 1KEPA 2X9NA 3A1NA 4KDFA 3BZUA 3AUUA 4JP3A 4BMNA 3G1UA 3LT1A 4U8GA 4XJTA 2I99A 2R6JA 5AQ1A 1PWXA 3F6YA 4I08A 2X86A 3OIDA 4MVJF 3GY0A 1T2CA 1KC1A 3LQFA 4Q9NA 4D3SA 5KJFA 4O5OA 2JHFA 3OMLA 3JQFC 5JSFA 5B12A 3M6IA 1EMDA 5ENDA 1NTOA 1P33A 2X5JO 1LDEA 4N5LA 1I36A 5JAZA 1EUZA 2PKQP 4TVBA 4CMAA 1OMOA 3MOIA 4CMIA 5KVQA 2QHXA 3BYZA 2NSDA 1R6DA 1PWZA 1E3EA 4KQWA 5B1YA 2X22A 1R4NA 1NASA 4XJSA 4DL9A 1NQ5A 2IZ1A 5EERA 4Y98A 5EPOA 2VRBA 2CY0A 1GYQA 1Z6ZA 2XXBA 3C8MA 1DO8A 4LSWA 3UFXA 4CMIB 4FDAA 4FGSA 1UDAA 1ZMOA 1MC4A 3RFVA 2FRDA 4RF5A 4D43A 3TZHA 4I5EA 3TZQA 3AFNA 1H5QA 2I67A 1LSOA 2VYVD 3LC1O 3B20A 3NT2A 4AJ2A 5DBGA 3TFQA 4OOFA 2XF8A 4FC7A 4YBZA 3RUEA 1EVZA 2VUTA 4HBGA 3I23A 5A1TA 5L45A 2P9GA 1R12A 3JQBA 1O0SA 5DBFA 4RVHA 1H2HA 1K5HA 5A9RA 3WS7A 4XZ3A 2V6BA 1NVTA 4F3YA 1I3KA 1DHTA 4DGSA 3I3OA 3I9NA 4CLRB 4UUOA 3JD3A 1UDCA 3KYDB 2O3TA 3BIOA 5BSHA 4UREA 3F1KA 5IZCC 1YB5A 2RH8A 3GUYA 3PVZA 4J2HA 4XR4A 1R37A 5DP1A 2WMDA 2X23A 4D45A 2F00A 1HT0A 3E5RA 3IDSA 4UUNA 4PLCA 2NVWA 1NPTO 4GGOA 2VRCA 2EJWA 1E7SA 4FFOA 4LRTB 4B7CA 1NFFA 3GT0A 3VZRA 4DYDA 2HMVA 2PA3A 1G1AA 1XA0A 2VHVA 3L9XA 4XIJA 3WGGA 4CM9D 2NU9A 2EKLA 4M89A 1YB4A 3DBVO 3DFUA 1PGQA 1PS8A 1JDJA 1Y5RA 3RVDA 3ZWOA 4CM1A 3VKVA 2EXXA 2PWZA 1I3LA 4FSHA 5JCJD 1PL8A 1GYPA 4ZQEA 3GFBA 3SBOA 2P2SA 1RM3A 4BNJA 3ORFA 1YOVB 4PZEA 1SNYA 5AYVA 3H7AA 3H3FA 3ADPA 3GZNB 4BL5A 5CDYA 1Y8RB 1E1MA 3BTOA 1D7OA 3VPSA 1GU7A 4O1MA 5I7VA 1OZAA 3VZQA 1PGNA 2AG5A 3UCFA 1PJCA 4TWRA 1NWCA 3D3EA 4RDIA 4S1VA 3NTRA 4RO0A 1NM5A 2NVBA 3BTSA 2WSBA 1V3VA 1Z7EA 4Z9FA 4MO2A 2VN8A 4ALJA 3GA0A 1GEGA 1V35A 1X0XA 2VUUA 3ZU4A 3AU8A 3FNEA 4FS3A 1EE2A 1DJQA 4URFA 4IQGA 3WWZA 4QSMA 2JFFA 4FFMA 4K28A 3OICA 4AJNA 1IE3A 3ENKA 3ETEA 1HDRA 4UVGA 3DZHA 3HJAA 3ANMA 3PP8A 1P1HA 2BFOA 3B1KA 2W98A 4IDFA 3D4OA 5BT9A 5C7IO 1O5IA 1F8FA 4OQZA 1QYWA 2GNAA 4D41A 5KIAA 5EIOA 1ZK0A 1DFIA 3ROKA 2DPGA 4XQEA 4IIVA 4ND2A 5DCWA 1VL8A 2DBQA 3JCZA 4NFHA 1Q2XA 4YAGA 5C7LO 4WEQA 3TNLA 4JCOA 2VNSA 3TZCA 4QTZA 3EUWA 2EP7A 3VTFA 2G82A 2R2GA 1LRJA 2B35A 4U0KA 1WXDA 3OF2A 4GX0A 4OIMA 2CDAA 3WNQA 4CQLA 4CV2A 4YT2A 3DB2A 3CZRA 1RPNA 1ISJA 5JYEA 1B7GO 1XCBA 1UXJA 2ZTVA 3GAFA 6LDHA 1C1XA 1YH3A 4IS3A 2EW8A 2P4QA 1ZO8A 4CLOB 3MJEA 2BH9A 1DLJA 2SCUA 3KSDO 3I6IA 5JMWA 4MKZA 1UAGA 1ML3A 3ZN2A 3L4BA 3BTUA 4NBTA 1BXZA 4BMSA 4DTIA 5HWSA 2CDCA 1C1XB 1ENOA 1R66A 3GLQA 1ID1A 1I32A 3K9QO 3SJ7A 5IDXA 1B8UA 4CM8B 2JD2A 4Q3BA 4EEZA 4RVGA 2F1KA 5DDIP 1JW9B 4AJKA 2X8LA 3H8VA 1M2WA 1X13A 1N7GA 1W0CA 3ZNQA 4NBVA 1HTBA 2EV9A 2P5UA 4IIUA 2YY7A 1ZSNA 4CMEC 5DT9A 4DPKA 1SMKA 4W9NA 3V2HA 4GPD1 2IZZA 1Q1NA 1ADGA 5JMPA 2WYWA 4OXYA 1EFKA 5AXAA 4PRLA 1HWYA 3ZWNA 1P1FA 3PDJA 1HDCA 1D1TA 3Q2IA 3F5SA 3GQVA 2JCVA 4NH4A 4UVHA 3GHYA 1BWSA 3UXYA 3ICCA 1Q0QA 5MGBA 2PGLA 3UCEA 2I65A 1LSUA 1I2ZA 3U49A 4CMCA 1F06A 1GPJA 3NRCA 3EZYA 3JV7A 4ND1A 2X0RA 5GZ6A 2V6MA 1IB6A 4QX6A 1GQQA 2AEJA 3OIGA 5TSDA 3D5TA 4BO3A 4BGEA 2GR9A 3BMQA 2C20A 4YRDA 3ZV4A 2W4QA 4B3IA 3O9ZA 1E6EA 5A06A 3WDSA 2CVOA 4MP8A 4IDGA 4I9HA 1DXYA 2GO1A 1SB8A 1C1DB 3QVOA 4GLLA 3GNQA 5JE8A 3D5QA 3KUXA 1NAIA 3ICPA 3BMQB 1HZJA 3MJTA 2NNLD 3LT4A 4OHUA 3JQ7B 1WMBA 5JNLA 3PHIA 4QXMA 3L4SO 3NTQA 3R1IA 1Y81A 2VCYA 4AJ4A 3ZHYA 4FB5A 1JAYA 3OJEA 4B7XA 2P4HX 5G0WA 4CR7A 5A9SB 1OC4A 3E5MA 3RUFA 3STHA 2BHLA 3U62A 3LC7O 4YJGB 1GD1O 2EG9A 3JYNA 2O2YA 4R5HA 4Y6RA 1HDOA 1P77A 2GUGA 1BXKA 3KV3O 3L6EA 4E12A 2LDXA 1BVUA 2PH3A 3UCXA 4DPMA 2AEMA 1HDYA 2FWMX 3K92A 4BNVA 4BNWA 1GY8A 1Q7BA 3BMNB 4ID9A 4WE3A 4D0RA 3TF5A 1GCOA 1UUFA 2GN6A 3DBHA 2R00A 3OA0A 4KTVE 3VPHA 1FDSA 2W2KA 1H9AA 3BXXA 1LTHR 4IMPA 1PJBA 3JQAB 4GMGA 2DFDA 1KBZA 1GV0A 1KOLA 3I9LA 4GWKA 4KDEA 5ILOA 3PYLA 3QWFA 3W4JA 1P1JA 4ZHSA 2ZB3A 3D4PA 4I9NA 1DEHA 2P9CA 3K2EA 3ONEA 2FSSA 3H9JA 5ER9A 3DBHB 2ZCVA 3MJSA 4RCVA 4WKGA 4EJ6A 2PZJA 3JQCA 4D3DA 1PIWA 1IULA 1EQ2A 1WZIA 4CJXA 4BMVA 5ICMA 2I76A 4XYBA 2GZ2A 4A73A 4DQVA 5DULA 1GTMA 1C0IA 3T4EA 2BMAA 1YBMA 2EW2A 4U6SA 3FR7A 3ZV3A 4D7AA 1L7EA 1VSUA 1BG6A 2XAAA 2CZCA 3WMWA 2EKQA 5A5FA 5C37A 4PLGA 4QUKA 4TZTA 1NQTA 3QHAA 4GMFA 4BNZA 4PG8A 1D8AA 4K1LA 1HYHA 1YGYA 3L6DA 4YACA 5CDTA 1X7GA 2IYOA 1O6ZA 5I8WA 5G2OA 1N9GA 3H9UA 3PIDA 5JBIA 3INGA 1IYZA 3DAPA 3TRIA 1JQBA 1W4ZA 3WBFA 1U8FO 2C5AA 4GWGA 5KVVA 1YB1A 2UUPA 3DBRA 4EEXA 5EINA 2A9FA 3WIEA 3COSA 4CV1A 1ZSVA 1PU2A 4W99A 4NR0A 3GN1A 3VOSA 3JQ9A 4HX5A 4R16A 1EUDA 3KO8A 1K0UA 3PQDA 2B69A 3MJCA 1IPEA 1TB4A 1XIVA 4H3VA 2QYTA 1MB4A 3NKLA 4F6CA 4R54A 4DQUA 1R0KA 2Q49A 2YV1A 2VT3A 2VZ8A 3WG9A 2BF7A 3I52A 2IDZA 5DF1A 1T2FA 1K6JA 3U9LA 4BNHA 1JKJA 4I5FA 4TRJA 2DVMA 3WMXA 3C1TA 1EFLA 2QZ9A 1BSVA 2IXBA 3EVNA 3VPGA 3R3SA 4D0SA 4ZA2A 4BNMA 4DMMA 4B8ZA 1PS9A 5U4QA 3WSWA 1PX0A 4CLDA 4Q3EA 5JDCC 3KZVA 3QRWA 3GDOA 3ZU3A 1PTJA 1LLUA 2G17A 4MVJM 5HTOA 3OJFA 1QYCA 3EDMA 4DREA 4FQ8A 4BNLA 1LDGA 3U0BA 2Z95A 1HSOA 4GX5A 4XDZA 4NU6A 5COAA 3ABIA 1ZXLA 4RZIA 2A4KA 3QVTA 4HUJA 4PG6A 3MJ4A 3C1AA 1Z73A 4NDNE 4DXHA 2C29D 4Q3DA 1S6YA 1WLYA 3D1LA 3GOHA 3JQ8A 2V65A 4NJOA 2HK9A 1XWFA 4W7IA 3DO5A 4DYVA 5DN9A 1RM0A 3DDNA 4J9UE 3LDHA 4GSLA 1PJ2A 1XKQA 3FF4A 1YQDA 1FF9A 1YL7A 4OKNA 1LDYA 2Y1DA 1ZCJA 4J6FA 2G5CA 3JQ8B 3HNPA 1WDMA 4M87A 2AQIA 4UVEA 2D5AA 4NJMB 1V3TA 1CYDA 3OH8A 3QY9A 1ZMTA 1ISFA 1Z75A 2VZ0A 1MFPA 5T57A 3VPFA 3BMOA 2ZJ1A 1RWBA 2D8AA 2C07A 3HWRA 4NFYA 2GZ3A 5EQDA 1QYXA 2UYYA 2X7HA 4RJTA 1H6BA 3LYLA 1X0VA 4A27A 1ENZA 2OXIA 3SJUA 4B4UA 1X7DA 4CL8A 1YO6A 3PHHA 3ZNPA 3ST7A 4BQRA 3LF1A 3PGXA 3KHUA 4P4NA 3RI3A 5DBIA 1WNTA 4L4SA 4OSPA 3C24A 1B14A 4HNGA 5BNTA 1KY5A 1NAHA 2PR2A 1T25A 1ZJYA 4UUMA 4WLNA 5KKCA 3GN2A 1PR3A 5IZ4A 3TL3A 2FPGA 3TL2A 1VL0A 4DIOA 5I7FA 4ALLA 5KVCA 1DRVA 1I8TA 3MWEB 1EK6A 8LDHA 4CODB 2P91A 2ZQYA 4WOJA 1VM6A 4XYMA 2ZB8A 1DC5A 3GGOA 1XU9A 4HNHA 5I7EA 4BO2A 1E6UA 1WP4A 2Y1CA 3P2YA 3ZNNA 1Q7GA 1GR0A 3EAGA 4FCCA 3M1LA 5DZSA 4PG7A 4B4OA 3PHLA 2O4CA 4WUVA 3W4IA 1AXGA 1R4MA 3HSKA 3KLPX 1EQUA 1M67A 4R9SA 4N54A 5B4UA 4WLOA 2JAHA 1B15A 1JAXA 1E7QA 1LXCA 2HMWA 2ZTUA 1EUCA 1OBFO 3CIFA 1XYGA 3IL2A 2BFPA 1R4MB 4NPCA 5F5LA 1XG5A 4BO6A 3P5SA 2AMFA 2J8ZA 1LDNA 2ZTLA 4IXTA 3TFOA 3RU7A 1WAMA 3E8XA 1YXMA 1A72A 1C0KA 1GL3A 3IIEA 4C7KA 1HRDA 3R0IA 3ZW9A 3RC7A 4K6CA 3DZGA 5AXDA 3UOGA 1NPYA 1P44A 1FJHA 2O7QA 3V1TC 3S2GA 1DFHA 4IMRA 3AWDA 4MVJP 1LSSA 2QIOA 4MVJI 4BO9A 1NQAO 1IY8A 3ZWXA 4DLAA 1CWUA 9LDBA 3CXRA 3KM0A 5JFOA 4ROSA 2NQTA 4XYEA 1YONA 3L0DA 2FN7A 4IDAA 1DOHA 1MG5A 3QW2A 3MZ0A 4YAEA 4OMUA 2D0IA 3EK2A 5B37A 4RVDA 1FDTA 1VE9A 4LMPA 1O8CA 1P3DA 3PJEA 2UV8A 4YWJA 5KCZA 3WGHA 2ZYDA 4F46A 2B37A 4DUPA 4ZRNA 1VL6A 3O8QB 4ZD6A 2Y05A 1MUUA 1KY4A 1UXIA 1VRWA 3QVXA 4XQ9A 4O63O 1J4AA 1B3RA 2OL4A 3ROPA 3TN7A 3X2FA 3ZWWA 1LDBA 1E92A 3K31A 5JO0A 4EDFA 1XR3A 3AW9A 3E6AA 5G4KA 1UDBA 4OH1A 2D59A
chains in the Genus database with same CATH superfamily
1J0XO 3EDRA 4YRIA 3FYTA 4CGZA 3F7NA 4B3BA 3PRHA 5CM8B 1BW9A 1G20A 1YIAA 1JDUA 2UVDA 4B2IA 4H60A 2BN4A 2AHOA 2F9FA 2LP4Y 4CCSA 4EENA 4CZ2A 1QG2A 1X1TA 4X6LA 3UF0A 1RRCA 1TOAA 2BGKA 3P0IA 1VOTA 1IL0A 3MJFA 3TQSA 3UKOA 1G291 5LP1A 3CE9A 3M9LA 4Q93A 3AK4A 4FFWA 2OFWA 5FI3A 4BJHB 5GINE 5JQGB 5LZ4A 4ND4A 1AUQA 1Y8QA 3ISTA 4LRXA 4CDGA 1RAGA 1TYDE 2A3RA 1OREA 1AXEA 3AOEC 2P27A 3UNXA 1K7YA 1T5LA 1GHTA 1XLTC 3PQ8A 4N6OA 1G2PA 5JXWA 1S3GA 2Y0DA 4C07A 4HEJA 2OPHA 3ETNA 1I13A 1Z29A 3DZIA 1DRWA 3IVRA 4WVFA 3GO4A 1Y8CA 4EA9A 3IAS1 1D2AA 4MW1A 2V7GA 5REQA 4PPYA 4JLVA 3DP9A 3DHWC 1JHUA 2K2WA 1LTQA 3BWYA 3H5AA 4Y0VA 2CXSA 2HHHB 2YXLA 1OBHA 1JHPA 4FN4A 2HMSA 2IF0A 3G02A 3ZGYA 2YZNA 2GF2A 2J6IA 2OD9A 4C4AA 5KOHA 4QJBA 2O7RA 5A9TA 3KSZO 4E30A 1RAHA 1C50A 1TDJA 3IC5A 4YAJA 1RC0A 1FDOA 3ZJ5A 1D4ZA 4I8XA 1DIBA 3MWGA 5LZ9A 2JHAA 3WGIA 2C0CA 3LPCA 1HETA 5ALJA 2O48X 4BLWA 4LY3A 1MO4A 3EDOA 4N12A 1HM5A 2ZREA 4DEYA 3O8BA 1OXXK 2JG3A 3PT5A 4EY7A 1I51A 1TT7A 4Z3DA 3URKA 4MR7B 5CEFA 1JPUA 3U56A 2O0LA 1GTSA 1Z25A 5EZ5A 4KQ6A 2CB0A 2FEPA 1AXRA 3O26A 3Q0EA 4WDQA 5DNWA 4DZZA 3KKLA 4P35A 4EH1A 4HEA6 5F1PA 2XVZA 4AUKA 4OL9A 4D4IA 5LMZA 4UAJA 4BATA 5KJ1A 4MPDA 4M7PA 1G6KA 1GQRA 1Q1EA 1S01A 2I2WA 3OBIA 4RY0A 4TTQA 2ZT8A 1SVNA 2GDJA 1DVRA 1YZKA 5T8KC 4JI3B 3EXEB 4FDVA 4GNKA 2QBYB 1XFAA 2ZJBA 4RM3A 5ER6A 1CJVC 5K8TA 2DPXA 3HJUA 3KIPA 3KQNA 5JY6A 4ZDIA 4B4DA 3ESDA 1LC3A 3EMVA 3WK4A 1D2NA 2F3RA 3OETA 4NCKA 4OX9B 1P73A 4Z0TA 4EY6A 1D6SA 4AWAA 3BX1A 3N8GA 1VI6A 2W8BB 3G8AA 4LTNA 5KTSA 5LXTA 2MR5A 2ORED 1B73A 4H0FA 3Q5GA 2Q0HA 2VNAA 2ZAGA 4KH1A 3A2LA 4IOLA 5CFMA 3PU6A 4S1OA 1G4AE 1B4DA 1EE1A 1OT5A 4JIGA 2A14A 4DLYA 1NI5A 4MUNA 1GPWB 4CEJB 2FWNA 3VZCA 4AY4A 1PZEA 2JGKA 3L7MA 1YS2X 4FMDB 4PCAA 1X7HA 4NAVA 4PNPA 4PNZA 5BQFA 5HGXA 2X5NA 3RB8A 3F71A 1R18A 1ZL0A 2BFDB 1U98A 1H2WA 3WISA 3FRIA 1CS0B 4A4DA 1J21A 2SKCA 3KOOA 3P5BA 3D4IA 1T35A 1ZJ5A 221PA 4QTTB 4TMFA 4ZDKA 2K7FA 2VJOA 3AJDA 2P7IA 1OBOA 3I2YX 3CLVA 4B7AA 4NCHA 2GBIA 1BD3A 2GEKA 1Y8RA 1YRQA 1JU4A 2GZAA 3CKLA 3GD5A 5FR2A 3WR5A 3QXJA 3ZV7A 1I6LA 3SVTA 4LTDA 3SHFA 2Q4EA 3HO8A 4ETWA 2HTEA 2X1MA 3B5JA 3OPNA 2NO7A 1IZZA 4IGIA 3V1NA 2ALJA 4K9RA 1F0KA 1GUFA 2RI1A 3R0VA 5E1BA 6REQB 2O2SA 5DMXA 1G7CA 1GPBA 2QGFA 4QQKA 4U7GA 3WLAA 1H05A 5FPKA 2GN8A 2XBUA 4I1OA 3IFSA 5AHWA 1JAHA 5KJCA 2AR7A 3QG5A 4AO8A 1JR3A 3AVOA 2WM8A 3PUJA 4QUBA 1P2GA 4UEWA 5IS2A 3H2YA 4B73A 4CDNA 4W8GA 1S0UA 1ULUA 2GD2A 1BIFA 5K4GA 1SIOA 4FCWA 4OAQA 1XMOB 3L7JA 2B6HA 2XMGA 3FZEA 3B1XA 5EJ9A 1JX6A 4KX3A 3CLRC 3IAM1 3DEAA 1R00A 1FUKA 3AEQB 4NCJA 1KFJB 2BCGY 3OOHA 3WYAA 2XXJA 3E18A 2YWRA 2UUCB 1M1ZA 5ALDA 1ECLA 2IYAA 4TQ9A 2WAAA 3TH5A 1VKHA 2QE7D 1JGTA 4ZP1A 3E9MA 5NULA 3OU7A 3TLYA 2V1UA 2JK1A 4BFTA 1O89A 3ADKA 4FFDA 1I6MA 2IITA 4JP8A 1CQIA 1A7AA 3BDVA 1ISIA 2CB9A 5F4BA 521PA 2Q7DA 1CEQA 4UDXX 4XIIA 1J00A 1USVA 1C9EA 4JI8B 4O59O 1AZLA 5KU7A 3DXFA 2GZ1A 2PT6A 2WKRA 2A9KA 2QU7A 5K4HA 1Z5NA 3EOBI 4RZ2A 4TKVB 3IESA 5TDHA 4B0OA 4EY4A 4ALMA 3MJRA 2B78A 1P19A 3L4EA 4HO1X 1NIPA 4HSGA 4QD3A 3HBMA 3TJRA 2P40A 4RUKA 3NXSA 4HV4A 2C5EA 4LF4B 3KCNA 4YJHB 4XA8A 4MIEA 2OGSA 4H7KA 4PPGA 5PNTA 2DRIA 1MQ8B 1Z0DA 3E53A 4R9RA 3NASA 4XLTA 4WKBA 1J42A 4M9RA 1W7AA 4UTOA 1IHOA 2ACVA 2VDPB 3D6AA 4G0NA 5LDHA 3H5OA 4KI7A 2DM6A 4R1SA 3IILA 1A5ZA 2ANCA 3ZHUA 4C88A 4JBGA 5AUNB 1S96A 2Q6VA 4RORA 3AETA 4PNHA 3WDMA 3I5UA 2QPAA 3FPAA 1KYXA 1ZRHA 3HN6A 3FZGA 3C1UA 4HF7A 4HFMA 3URMA 2QMUA 2H4FA 2B4QA 3EX7C 2H5IA 4KPGA 4I8DA 5DU2A 2XNKA 5CK4A 2Q0XA 3T4XA 3VAZA 2XMDA 2J3IA 2N42A 3WLKX 4TV8A 1H1LA 5HDQA 2GN0A 2ZJFA 4CM8A 4DV0B 3E15A 1RQ7A 4L9WA 3MYYA 5CLIA 5KTMA 1XGKA 3CG4A 2BD0A 3KWFA 4RLQA 4XWOA 3Q8LA 1XZCA 3W8FA 3O5AA 1YDFA 1CP2A 3VBEA 4WN3A 4HEHA 1J8QA 1MC8A 3UHJA 2A9PA 1KK1A 1U7TA 2O7NA 3RIHA 1RXSA 4QICA 1T2AA 1PZNA 4UJ3A 3WLOA 2IQ5A 3HCOA 3QE3A 1XU7A 4MW0A 1S9DA 2XTMA 4RTLA 1Q1ZA 2OP0A 4MVJA 3I39X 1X3LA 1XTBA 3LX4A 1IK6A 1LH0A 4RXUA 1XVVA 4YPOA 4DDUA 1S3FA 1XC7A 4UVDA 1YAHA 4J76A 3RREA 3V2UA 2B0CA 4DIMA 3N76A 1SCQA 2JLAA 4JSYA 2A8YA 3NV7A 3R77A 4MKGA 5EWLB 1Z4OA 3GEHA 1Z08A 2UYOA 5T64A 3WYEA 4AKSA 2Z9CA 5JASA 4CIVA 2KMLA 3DFFA 1DJLA 3B9BA 2PZKA 4YT5A 5HFJA 3NLLA 3HWX1 1W4RA 4QYIB 5HIIA 2CFRA 5MFPA 4YCSA 4IIYA 2O8EA 1IOZA 3RC8A 5BV2P 3SHQA 5ALUA 1I7PA 4HZUB 1W85B 3LK7A 1H2FA 2ORVA 1KIFA 2PUVA 4WOBA 5CDFE 4MITA 1JIQA 2OMEA 3LM8A 3ADDA 3QU5A 1AN0A 4HWRA 3I01M 5DRYA 4A3SA 1SURA 4PHHA 4RGYA 1RU3A 2H2FA 4WZBB 4AZWA 3RTGA 1C1DA 2AXPA 3CZMA 3ABQB 4JWKA 5TX7A 1M0SA 3WWCA 4IRXA 1E2FA 4Y6GB 4F5EA 3TZEA 3WX0A 3V9AA 3PEYA 4FJ1A 2Y93A 1XMXA 2HMUA 1P9LA 4BEJA 1XVAA 1UDWA 1DCMA 2V9ZA 2XUAA 3OMWA 3V8EA 5FAXA 4BVHA 4AI6A 3HA7A 2PXHA 1M6YA 5JSYA 3X1MA 2OCGA 5BR4A 5C7YA 3N75A 3JAMA 3QBVA 1CRPA 5JJIA 4B84A 1GAEO 3K9HA 5TB5A 5AW0A 4DR1B 3MSCA 3EOAI 1MQSA 1JA0A 4TMKA 3OKCA 3FMVA 1X92A 1KJ8A 2V3VA 1BWRA 3V3KA 2Y9PB 2X6QA 5EHXA 4O4LF 5A9SA 3AEUA 4L8YA 4CV3A 4WPGA 2V7VA 4Y2QA 1NKVA 1U81A 2IYSA 1Q0LA 1TUBB 2JIOA 5HK8A 3KT8A 2RHRA 3LPLA 3TMYA 1HR0B 4CM6A 1G9TA 1DT3A 4X94A 3ZJVA 3FBWA 3X1DA 1Q19A 3MCWA 3MNFA 2FLWA 2RHLA 4CUZA 4E0BA 1UT5A 1Z4KA 4D9BA 1HBJA 3BSSA 1UADA 4QBFA 4BNYA 1RWQA 1FLNA 2DR3A 3AL2A 3HK2A 5D5HA 1IEVA 1EB9A 2WVGA 2O2HA 3LUDA 3LU1A 2RGYA 2ZIWB 4OKIA 1HORA 4XEHA 3GCXA 3GIWA 2PZLA 3V3TA 2H1SA 4M1MA 2P68A 2IDKA 4OHBA 5L6MB 3AB3A 3J7TA 4BQSA 1NSFA 2HLPA 4JLDA 4KMRA 3GU3A 4M46A 1J24A 4BX3A 4J8PA 3RO7A 4PTYA 5HFAA 3DBLB 3AI1A 2LNDA 4LGVA 4PCLA 4CXMA 1KMNA 4FXOA 4IIGA 5L53A 1MT0A 2VYFA 5DI3A 2ERYA 3MF4A 1G2OA 1XB2A 4B6JA 3ROGA 3LQ4A 1DDGA 2WWGA 4M8KA 1G3IA 3G3EA 4JJIA 1NXOA 1SIUA 5AOBA 4GIBA 3VC2A 3NHSA 1V39A 3LGSA 1T8PA 3NM5A 1FFCA 2WKPA 1T8WA 1Q44A 3E2IA 3EIQA 4GO1A 4FGJA 1IUNA 4KLRA 4C0XA 5LP6F 4RMHA 2X0KA 1BDHA 2NAPA 5AK6A 3DQZA 1BO6A 2VP4A 1FFBA 4H3SA 4OUDB 1WKBA 5EUCA 1C2TA 2HA5A 2G9NA 3PGMA 1CG6A 1F8GA 5CG2A 3T5AA 3WQBA 3M83A 1JQEA 4FYWA 1G8KA 4KR0A 3A9TA 4HBZA 4K9SA 3SLGA 1M34E 4PBRA 1Z0KA 4EECA 1UPCA 4ZPXA 1CBUA 4RTMA 4PIPA 3Q6MA 3QPCA 4H7EA 3JAWA 3KR9A 5IJ9A 2BVNA 5IUKC 1X9IA 1PG2A 2IIPA 3W7VA 2VF5X 4W63A 5CT9A 1Y1LA 1C5KA 2I7XA 3HZHA 4G65A 3SR0A 1EWVA 4HB3A 3KT3A 3HS3A 1SUCA 1TFRA 2YYSA 3NBAA 1JALA 2J9GA 4FFNA 4Q1VA 2Z4TA 3KAKA 1XD9A 3C6BA 4EVRA 1ZCAA 4BUCA 2GNPA 3DMYA 4P4TA 2NNWB 3U4HA 1XA3A 1QVRA 3DE4X 1Y1KE 1QAMA 4HMPA 3FCXA 2RONA 1SK8A 1DARA 3K8QA 5GZ1A 3UEOA 1KTIA 1C30B 2ZUCA 2XUOA 4N1AA 3UXEA 5IF3A 4LZAA 2BFEB 3A37A 3I2GA 3SQOA 1PFWA 1FJXA 1EIWA 1ULHA 1ZEMA 3ENNA 3HRIA 3KSMA 3L1UA 5H82A 3AVUA 1NL3A 2OZKA 1YZUA 3UN1A 4OKSA 2Q0SA 1WTAA 2CD7A 4NYMR 3W7AA 3ZLJA 3GPBA 3FETA 2CLOB 2GRAA 5HXAA 2ZYGA 5L7TA 4IRMA 4WACA 3IJEB 1Q17A 3ERCA 5LIRA 3Q9UA 5KMGA 1KVTA 1HYGA 3REQA 3U4AA 3FM9A 5EE3A 1T1GA 1Z6QA 4XVRA 3PLNA 1F2TB 4G37A 4BY9E 3K05A 4DB2A 4Q1DA 2VL7A 3K8ZA 1NBEA 3ELDA 2Y8EA 3OX3A 2OZPA 4RLFA 2QRGA 4AKHA 4PO8A 4F9TA 4MQUA 1N2ZA 4UEKA 5D6OA 5KQRA 3OVMA 3GDFA 1KHTA 2F1OA 3G7NA 3GEMA 4FQ7A 2PD6A 4MGHA 4YIKA 5E38A 5B1DA 3ZTTA 4D92A 3OZSA 4KR7A 1NXPA 1PQUA 1ECCA 3PXUA 1L7DA 5DN6D 3PFHA 3PXXA 5JH7B 1MO3A 3ZE0B 2OGTA 1CIPA 1CRZA 2B3TA 1RJ9A 5B58T 3A8TA 1UM9B 3RCBA 3EVFA 3NPMA 4AMBA 5D8DA 1E3DA 3HXQA 3U61B 1PJQA 1O6CA 3ILSA 1E2KA 2R8PA 2P9QA 4P6VF 5E8RA 2JAQA 4H0NA 4RL6A 2C8KA 4KXYA 2Z5VA 1QV9A 1S9HA 4HVTA 3IQZA 3L8HA 1DDOA 3DE0X 1Y34E 4JLOA 4Y6LA 1KI9A 3UJDA 4F9EA 3IQDB 2FSGA 4HDSA 2RHCA 2V55B 1DIAA 3RG2A 3DW1X 1A8HA 1UZAA 1Z68A 3UJ7A 4QBHA 4Y2VA 2AL7A 2IYEA 421PA 1TLLA 1E79A 4AAYA 1LFAA 3CQ9A 4WNIA 4CLEA 3OTOB 3CMMA 3HADA 4BMPB 1GV1A 4EHBA 1TU4A 5LC1A 1JS1X 2A1UB 1LEHA 3RUHA 2AWNA 1O6GA 3IA7A 1SB9A 3FVVA 3TLZA 2P6MA 1UMDA 3F6CA 4GXNA 3B53X 1GZHB 4X6UA 4BNDB 4LDZA 1UEXC 3VR0A 5IPFA 2V6GA 2I8CA 2AOXA 1KMHA 3IHTA 3LUJA 2VH1A 4AJJA 1RBYA 4JYAB 2QRMA 2EW1A 1ETUA 1UFOA 4B76A 4RV9A 3KK0A 1F1JA 2QRPA 2P9EA 4LJ7A 2I3DA 3FGPA 3AFOA 1OAOC 1XELA 4RMJA 1BS9A 4D74A 4UCQA 3FWZA 5FLKA 3TZKA 2YVAA 1SFRA 1XZGA 3OZVA 1WPQA 3RV4A 2VUIB 1FRFS 2PQMA 3RIGA 5H3LA 2AEFA 2FTKE 4KQ1A 5AWFC 4TKZA 1ST3A 1N5RA 1DBWA 3DMTC 2PMKA 2PH5A 4A16A 1R8YA 2PS9A 2YS6A 3LUFA 1PL7A 2GZDA 1FFHA 3VOAA 4DUGA 2D6FA 1EVYA 1JR4A 3SSAA 4LZNA 3IDAA 3B6ZA 5IM4A 4BPRA 4K8OA 1U8CB 5JJ5A 4OXXA 3VYTB 1RPAA 1FQOA 4NV3A 5CVEA 4EABA 1VCMA 2HSJA 2OBYA 4MVYA 2ESRA 3IQHX 1E9DA 2A1TS 2EGGA 3F5FA 1KH3A 1TK2A 3NGXA 3OZFA 1IOWA 1TVEA 4DLXA 4GS5A 1NMSA 2VRCD 8GPBA 3NBFA 1B0AA 3EA4A 3TDKA 2RHBA 3AINA 3D6JA 3ASUA 2KW5A 5DYTA 2OESA 1I3OA 3BMCB 2NSLA 1A4IA 1DUSA 1FVHA 3QSGA 4KCGA 2W2LD 3AHCA 6NULA 1JHOA 2CYBA 4ITUA 2WZCA 2GARA 4FYIA 3BEDA 1U5BB 3ORYA 1EJBA 1Q1AA 1F2UA 4FMPA 2REQB 3VTZA 4O4LB 3NUQA 1WO8A 4RIIA 3O9VA 3WY9A 1E20A 1JUDA 5A4JA 3P8ZA 2G4CA 3VTAA 1TT5B 3LLSA 5IVDA 1OVMA 1QYVA 2VTEA 1R2QA 3PFCA 4LWZA 3T9DA 4CM3A 1IY0A 3E48A 3IDZA 2P2ZA 3C6YA 1ONBA 4NNPA 1X38A 3D6TB 1EM8B 4S0XA 1ZICA 2PJZA 3KAJA 5C18A 1Z2OX 1Y8AA 2CHEA 4RJKA 4KLCA 3ZIAA 3TPCA 1CUDA 3TMKA 5ADVA 1CY2A 1WWKA 3TECE 4LF9B 2RBEA 2O6HA 5F5XA 2P41A 4AXXA 4X3PA 5JS6A 1H0SA 1MRNA 1P6QA 2OECA 2VYCA 3RRXA 3VAYA 2QWXA 1BMFA 2EKZA 3DM9B 2QRUA 4FOSA 4HNAB 4LGMA 4F2DA 1JKMA 4KDRA 1BCSB 4Z7JA 3GW8A 1TQ8A 3QWBA 2Q1WA 3IIKA 1AK2A 1CUAA 1BNCA 2OCIA 4PZUA 4X63A 5CA1A 4D3ZA 1OX5A 4Q3KA 5AVOA 2LV8A 4L78A 5AKZA 3RKSA 2QJRA 1E2JA 4I8IA 2DFLA 5CAEB 3R7LA 3C6XA 1KZHA 2J9RA 1YRBA 1KR5A 5KTTA 1NFRA 4F9FA 5F7OA 4FKZA 1MIHA 2GH1A 3CR3C 4QUIA 1EXNA 5H68A 3VDNB 1V5FA 1QRTA 1KRWA 3O3OB 5A5VA 1Z63A 2HBYA 1SU7A 1IBKB 1W4LA 3AOGA 3TW8B 1LNQA 2WD7A 1NATA 2P1ZA 2QMOA 2Y1OA 3M3PA 5EQTA 1T4DA 4QLAA 3DKRA 4TTRA 3OWXA 1C3EA 3UMGA 1QFMA 1Z2AA 3VISA 4EG7A 2D54A 2YOGA 3EWIA 3OQIB 3WIDA 2VF7A 4IDCA 1PO7A 1UZMA 3WYFA 3M6WA 1XJ5A 1BEZA 2WFMA 5DSZA 2W00A 2C2XA 2QG4A 2ZUDA 5FTJA 4DCPA 1K8YB 1W46A 3CURA 1T6XA 1PR4A 2A78A 2WJ4A 4OSEA 4ZAYA 2JF0A 1JFVA 3QYAA 1RQNA 5EXPA 1K6IA 2DUUA 3V6MA 5SYNA 2AVNA 4OGWA 4LGCA 2CXUA 3FOEC 2PXCA 2F90A 2N3ZA 4WD3A 2UVQA 2XMBA 3SBDA 3R7FA 4M9ZA 5KEIA 1IZ9A 1QK3A 4DWWA 4W5HA 5F77A 3VHRA 4CI9A 1WMSA 5K2OA 1VSVA 3T5DA 1AD2A 5ALNA 2QSZA 4N41A 2P78A 2QQ5A 4JBLA 1YIOA 2KM1A 1E2QA 3B6JA 1NUAA 4YJFB 4QJ4A 2Q3JA 5FORA 3RJMA 1CNMA 3AR5A 3MQ2A 4HCJA 2EHDA 5JO9A 3SLKA 3H2GA 1UEIA 1V71A 1DEKA 2W6OA 3DMHA 5H3CA 1Q14A 3DL2A 3E3MA 1FNDA 1KRXA 5JQGA 1BFKA 2WJVA 4KGZA 1OXMA 1S4QA 3NFRA 1ZA1A 4O29A 2B1IA 4JQCA 1XTTA 4V0MA 3TM5A 1CUSA 1PR1A 4XUCA 5CB4B 1Z82A 2HPZA 4RETA 4XPIB 2KI5A 2QY6A 3IAS6 4Y2XA 5GV8A 3RWOA 3MCTA 2PLRA 4QGGA 1PQWA 2QXUA 3LVFO 3V9PA 4H7PA 5TMEA 2ZWMA 1ZH4A 1IM5A 3KYCB 4MWTA 1Q6YA 2Q50A 3LK6A 3WGYA 5IUNC 3CLHA 2H1VA 1L2TA 1Q20A 3NAGA 3MTQA 2QTFA 3MMNA 1AC5A 2RGAA 4FT4A 1M1YE 1MH1A 1M0EA 1XXHE 2PSSA 2X0JA 4BV2A 3EUAA 1I33A 4OVKA 1E3LA 4LC9A 1BD4A 3JZAA 1JTFA 2JH8A 4UW9A 1MXFA 5IKMA 2RKBA 1UXGA 3TEFA 4OBWA 4P54A 4ESOA 5C80A 4OQNA 5I9NA 2NACA 1WUKS 2UUOA 3C3MA 4CEIB 1W5TA 2FWRA 4QPCA 4AS2A 4Y7CA 1E6WA 1Y9EA 2QNRA 4MKFA 2BGNA 1G21E 5JDIA 1X1QA 3SDSA 1E58A 3BH0A 5E8JA 4IV8A 1JJVA 4TSFD 4J90A 3EG9B 1GM5A 1OI7A 4YR7A 1M6NA 4CN9A 3ZHTA 3G5UA 1K5GA 1OHHA 3D8RA 3RTCA 1MLDA 1RC1A 3UMFA 3ZU5A 1UM8A 2EGUA 3I9V6 1VLMA 3VSAA 2GWHA 3DXYA 1JSZA 4J0QA 1Y8ZA 3F9CA 3BGDA 1L1FA 4HQ0A 1JBEA 4ROTA 1D6MA 3K20A 2AZMA 4K3UA 2QBYA 3EXEA 1FXSA 1GZ4A 1PHRA 2B4KA 3N6VA 4C03A 2NU6A 1W9HA 3DTVB 3GMSA 3I01A 2W6JD 1Z6GA 4G09A 4IDBA 5LN1A 5K0TA 2QR3A 2ZFUA 3A7EA 5IKXA 3CV3A 4MYTA 4DJJA 1KYQA 2MMCA 5EMHA 3AVYA 1QHIA 2QN7A 3GBSA 5K8VA 2WU1A 1Q7EA 2O7SA 3JASA 4KIUA 1VLLA 2XE8A 2H0RA 1NRJB 2YYYA 2ZRAA 3ZW8A 3INRA 1EBFA 3G2NA 1QK4A 1DJNA 2E4XA 3WLEA 5TEWA 3Q4GA 4AIIA 5IF9A 3JD4A 4Z3KA 1JSXA 4RYLA 1U3WA 1ES9A 1GCAA 3S99A 4MP6A 4CEJA 1R4NB 5ERXA 1EVKA 5THQA 2GFQA 1GGNA 3ZI0A 3Q3EA 1U28A 3HVRA 2ON6A 3H6HA 1HURA 4N5MA 4Z9XA 1CS0A 1ZD2P 1M6VB 3T3GA 3ZDEA 5KYYA 3IEVA 3A0RB 4J6EA 3W5VA 2ODNA 2W2MA 3NHKA 4II3A 2PKCA 4FZ3A 3U7IA 4QBGB 4MO9A 3MD0A 1GWNA 2R1VB 5EYPB 4ZO7A 3PC8A 1PW5A 2CC2A 1MU0A 1NN0A 3FDXA 4FYPA 4TYPA 4F45A 3RYIB 3ZWYA 1TJ4A 2JJQA 2ZVPX 4I7EA 5IP5A 2YNMC 4NZMA 3E58A 4LVOA 1Q7CA 3JQAD 2D13A 4HB4A 4M0EA 1C8LA 1UJ5A 3TLCA 6REQA 2GPAA 4AQYB 4Y1FA 1W36B 1D04A 2Z58A 3VC7A 1CZUA 2FFAA 4BVKA 4UXHA 1J5PA 1YRLA 3R76A 1H8HD 4WK0B 2QA5A 2DG2A 2P75A 1F1BA 3LSTA 1CUUA 3IAM6 4QPNA 4TTVA 2J3LA 3ETDA 4QIHA 4CMGA 1LBQA 4DW8A 2FG6C 1NP7A 3MLBA 1P2DA 1JSRA 1CR2A 1H1TA 1U0RA 3AJRA 4R0NA 1FNBA 5B6IA 4XB6B 3AEQA 3O4RA 1KXJA 2MSKA 4ZOCA 1JHMA 2CYAA 1W8DA 3C70A 4EMBA 1UINA 4OXKA 2BTQB 1LLQA 1P4GA 2ZTMA 5DTJA 3LBNA 1L8XA 3EY9A 4Q21A 3NYWA 4RPGA 4LOAA 1V25A 2W42A 2E6KA 1Z33A 3A04A 4RU1A 2RGBA 2EJTA 2H1CA 3JYPA 4AG3A 1Y9ZA 1CUFA 4P38A 3KYIB 4DR3B 2JFQA 2YV4A 3O93A 1VB3A 4CKCA 3F4BA 3FYCA 4PG4A 1VIYA 2ZRQA 4P33A 3AFMA 3E81A 3FYUC 5CUQA 5EEHA 4CYMA 3MBIA 2Z6VA 1L5VA 2M6SA 3ED5A 3DS8A 3QUQA 2XWBF 3EXHC 4NONA 4PCVA 3OLCX 1G20E 2CWDA 5CHEA 1UOPA 1JPVA 4ZU6X 4GL4A 2DULA 4Z0PA 4ACBA 3P96A 3A2KA 4L73A 2X41A 2IEGA 1QB8A 3IMGA 3MYRA 1ZJJA 3F9IA 2HF8A 4OXIA 5ECWA 3I1FA 2WWYA 2QSJA 3P2EA 3QE4A 1Y3BE 4YAUA 3HABA 4MYHA 5EMKA 4ABTA 3R9WA 2O19A 2ZSJA 3AF1A 3P52A 2OO5C 1GG5A 1OF1A 4MW6A 2PVSA 2WYOA 3FPFA 4YJHA 2Z5GA 1CHNA 3FR8A 5SZHB 3V4PB 4UU1A 3VO8A 4L76A 1WS6A 1U9IC 2P6NA 3RSFA 2QYHA 3G2QA 4YP1A 4BNIA 2CXOA 1WUTA 1UAAA 3E0XA 2SHKA 3IUPA 1QMPA 1DAGA 1Z07A 3WGMA 6ADHA 2VHXA 4JMLA 4J16A 4M1WA 1UKYA 4Y2JA 3N8HA 4RA9B 1SPBS 1OAAA 5K8JB 2XWSA 3AYZB 3C3WA 3OSUA 1QAOA 4ZT4A 4D3FA 1ACJA 3IOCA 4BTLA 1NW5A 3WK9A 2JGEA 2J5KA 3TKAA 1S4MA 1QQTA 4RVNA 3ZHVA 1FP7A 4B9AA 3CF0A 2OT3B 3ER8A 2Q1YA 2QL6A 3TIGA 1L3IA 3BFKA 1L5LA 1CY6A 4JBNA 2HRQA 4X1YB 3HBFA 1RLOA 3MA0A 3E8MA 2DE0X 3FTNA 1ZD9A 2FW7A 3A1FA 3S2FA 1U0FA 1VRCA 1L7BA 3SF8B 2G5GX 5SY4A 3DEFA 2ONZA 5SICE 1TXGA 2KPOA 2VHUA 4JIMA 4TWZA 2VKQA 2FRXA 1SOVA 1PG5A 3W6OA 3NRJA 1RI4A 1PNQA 3BH6A 1PZHA 4DQLA 3HH8A 1XO1A 2X4LA 4GMHA 2R5NA 1ACLA 4OQLA 1SKYE 1CW2B 4RHFA 1JKIA 2AR9A 2DYKA 2W2OA 1DFGA 4C7VA 1VPLA 2QRLA 3D0RA 4A6EA 2G76A 2WE7A 2A5GA 5JNVA 1CU1A 3NHPA 2NWQA 5KQSA 2ZJ7A 5KZMB 4ARIA 5K03A 5FB3A 3U4GA 3QFTA 2E4YA 2P9BA 4J4TA 2D2VA 2C78A 1HV8A 2OSBA 1KS2A 5MF6A 3MS4A 5EHZA 4O4IF 1GCUA 4INAA 4LDQA 1HTTA 2C7QA 1PWHA 1ULAA 3M6XA 4G86A 1HDEA 2C2ZA 4KN8A 5KHOC 2R6FA 5LOVF 2ZATA 4L95C 3ITDA 4HDNB 2ETVA 2QM8A 1K3FA 4QYIA 1Y37A 4CKEA 3LBFA 4BMZA 5AKEA 1ZNQO 3TNDA 4UUQA 4CQLB 1BVRA 1JU9A 3KQSA 2Z43A 4HZUA 4KVFA 5EE1A 3WC4A 2ZUTA 4E2YA 2WW8A 3IGFA 1LBEA 3RTAA 4HRYA 4J0DA 4J1SA 3WKCA 2AS0A 3ESBA 4CL0A 3I9KA 3A4NA 4OHFA 4D4GA 3MWJA 1A76A 2OM6A 2X6TA 3R2JA 2LCQA 3ZBUA 4K86A 3L5OA 4ANFA 5K3EA 3UWOA 3ZXIA 2CMFA 3O21A 2O5EA 1IWPB 3SYLA 4WZBA 5FPHA 2WC1A 1D4AA 5LQAA 2NPIA 4AU1A 3U4CA 1KAHA 3OZBA 2ZT5A 2E85A 4DS3A 1K2VN 3JSAA 4AZ0B 2QTVB 3IMKA 3GFOA 5DRTA 1O95D 1MPXA 2WTXA 3R6GA 4WZAB 1LK7A 3CHYA 2YJ5A 2Q3MA 3EMDA 2Q2QA 3GJ4A 1R0XA 1S2OA 4W9NC 5HEKA 2D3TA 1AY0A 2DTXA 3D0OA 4R51A 1Y1QA 3E22A 4UOEA 4G4JA 5BOSB 1V2GA 1HG1A 3HFSA 4OD0A 3I6ZA 1N77A 1NW9B 5BY2A 4FYVA 4DSAA 4LI0A 5TIIA 4OATA 4PWZA 4UHCA 4B3CA 1SVWA 4JMPA 1IJBA 1IY1A 1CJTC 1N8TA 4E11A 2O8CB 4PXSA 4W8OA 4XWWA 2E87A 2FJ0A 4BLUA 4QOIA 2CXNA 4R1TA 1XAIA 2VFAA 2V0CA 4B3MB 3AR6A 4K9DA 1H94A 4EZIA 1MPTA 3YASA 1MDFA 5I9TA 5FWYB 1SUAA 2C83A 2DECA 3EGWA 5K3BA 5C51B 3IKTA 1NN3A 5HBGA 1TADA 1WZCA 1Q77A 2NM0A 3WVNA 1OX6A 2OLEA 4XYGA 2FPKA 5EKDA 5TGZA 4NRDA 3F47A 3G49A 5K6AA 1JR3E 3JQGB 4PBSA 3IEPA 4UBKA 3WJ1A 3HM2A 1QR2A 4Q48A 1OKKA 2JGNA 3K9BA 4MRPA 1VXRA 3CNOA 5JY1A 2PUEA 1E94E 4ZVTA 4EB3A 2IOQA 3KFVA 2AN3A 3DEKA 4AURA 3QQPA 5DV9A 5A02A 4BYGA 1Z5GA 1WM1A 2DCMA 4HL6A 2DF8A 2I3ZA 3DBLA 5FFFA 2LCIA 2XHEA 2IFTA 3DMFA 5EZYB 2I54A 2A88A 2BI4A 4XWKA 2WJZB 3LCVB 3M6AA 2AB0A 4OX9Y 2PNFA 2OILA 1N2CA 4YPVA 3CNNA 4XWYA 1PRYA 3OIYA 3RGGA 4EHIA 1ENPA 2QTHA 3I2KA 3ONWA 1ECGA 5LIPA 4BNUA 1MT3A 2GJKA 4RKRA 2FZ5A 1Z6AA 1E1QD 3E9NA 3ZX4A 4IPTA 3MTGA 4HWKA 4XARA 1J0AA 1EX6A 2GYWA 4W7SA 5CYFA 2GKOA 4ARUA 1M54A 1E1RD 2GBLC 2Q3EA 4OUDA 2IHVA 3Q6IA 3FPKA 2OZEA 4TSRA 4E5KA 2A3NA 4DHWA 1E3SA 2RGXA 5A4IS 2ZS8A 4BMYA 2G36A 1HT3A 2CUTA 3EULA 1GZ7A 3M6MD 3PCRB 2OB1A 3WFJA 2EJCA 2PKXA 5GONF 1GR1A 2FMXA 3PHBE 3SYTA 2DTDA 4H31A 2Z2KA 3ZWAA 3Q9NA 4A0HA 4YUXA 2P69A 3EGCA 3QVGA 4TTSA 3T5GA 4BO8A 4DG9A 2C42A 1QIEA 1QYDA 3DE7X 3IT0A 3OY2A 3QVWA 4DGQA 3VR2D 3WMFA 4A2WA 4RD4A 1FK8A 3NUZA 1SG0A 1SBHA 4TRNA 3ZXUB 1E2BA 1FFYA 1V6CA 3VNAA 2XJ4A 2TSYB 4M0FA 4GVPA 2AN4A 2B3DA 1AS0A 1EDZA 3M6FA 4FEYA 5KAPA 5BN5A 1OILA 5H7XA 2L19A 2YC4C 3C7TA 1V47A 3UATA 1C30A 5GPBA 5HA5A 4B6RA 4D99A 1VGRA 1UMCB 1ZRSA 2WQZA 4HLCA 4RD2A 1G5QA 2BFEA 4QWWA 1YL6A 4RFLA 4X92A 2VHZA 1Z7WA 5B5SA 2H65A 1XRPA 3NTLA 2YDYA 4H1UA 1XRNA 3U7JA 2H6EA 3OTWA 3FTDA 2Q41A 5A3SA 2B82A 5L7YA 2H07A 2QVZX 1YQWA 2ZJ8A 2P3QA 3FJYA 1CUHA 4M0DA 4DIBA 1FB5A 1TEZA 2AJTA 1L5RA 2Z8XA 1C1YA 3W5HA 1UXHA 3NJ4A 1XRQA 4HN9A 1E6CA 1JNYA 2JAXA 2OORA 2JCYA 1F2TA 1MRZA 3JYOA 1N9ZA 1ZBDA 2ZRDA 3H8WA 4QUDA 3KHKA 3NW9A 4GI3A 1CRWG 2VXBA 1KARA 5JAHA 2DU8A 3A4TA 4L4RA 1UBLS 4V0NA 3MTIA 1Z6PA 5A0VA 1J33A 5LDGA 1L8QA 4JDUA 2JARA 4MVJE 3BB3A 4PAOA 4BE7B 4EGAA 5K9ZA 3UGKA 2HUNA 1Z5PA 5EWMB 1SCIA 1H3FA 5JH7A 4JK3A 4XYLA 3CJTA 4HNSA 3ASZA 1F51E 1RSZA 2AI2A 1E77A 4W5OA 2FSVA 1UM9A 2JEOA 4A8PA 4TX1A 3LPMA 5F12A 5C4GB 2V0NA 3C3XA 4HPWA 2FEKA 1N92A 2C3OA 2W4IA 1R9GA 1UXOA 3EBLA 3PUWA 3R9KA 2W93A 3TZLA 1Z5WA 2V4UA 4MIOA 2AJDA 3N9IA 6AT1A 5JC1A 4JODA 1L7VC 1W8IA 1EVQA 2W2TA 3F3KA 4TRMA 5E1DA 5HGJA 4YI3A 4I1RA 4BNGA 4UPDA 3H5TA 2FZVA 2Z5FA 4PGFA 5I4IA 3UAWA 1N9GB 3IV9A 3UQYS 4N49A 1WXIA 3C3KA 4LHEA 2NTNA 2VDLB 4RLHA 3A1CA 4QC2A 2M6KA 4DILA 2QROA 4WOPA 5A62A 2WF5A 2FB9A 3U3MA 3Q85A 4AWXA 2WSSA 5KNCH 4IQFA 3AR8A 4MI1A 3QTBA 2WFLB 2A1UA 3A4IA 3W3AA 1W88B 4M38A 1AU9A 3LP8A 4B3HA 3S2EA 2ID8A 5JDCA 2VP2A 2PTGA 4MWSA 2CBGA 4CLXA 4CTKA 4AJ1A 2DH6A 1UIRA 2QORA 2ZVQX 1YCGA 3LDAA 3PE3A 4NARA 5E1OA 4BNDA 1OB5A 4HZIA 3X43A 5EC8A 2OP1A 1M76A 5GADl 1LQ2A 2X9VA 2O14A 4OO3A 1LQUA 1QV6A 1XQ1A 4Q1FA 4ZJZA 3G1TA 2B5VA 1O5TA 2X9GA 3BH7A 1LS6A 2NN3C 1U7HA 3AGQA 3KC2A 5EJ8A 3CEJA 3D3NA 1TX4B 2OXRA 4O4IB 3PG5A 2ZZMA 4PE5B 1TAQA 1X1BA 3ME5A 3HC7A 3O4HA 3K0SA 2WU0A 2JHCA 2JJ1A 3H13A 3ILVA 1FP4B 1TA4A 1XXLA 3WNZA 1LTKA 5HFNA 2AOWA 4LE1A 1VBNA 2JJ8A 3ZHRA 3AM1A 2D4AA 3MGAA 4MUJA 3VPXA 2JA1A 1GPAA 1JRLA 4PANA 4PVDA 5AM4A 2PMCA 3WLSA 1PGPA 4C6TB 1HLPA 4QVGA 3PGKA 3GFFA 1NVXQ 3SS9X 4IFTA 1UC4B 2YCLA 1Q83A 1AGYA 1BA2A 1SCDA 1XZPA 2AI3A 1XDDA 2ONKA 2H51A 4L0MA 3KUDA 3N2NA 4IDDA 3IB3A 3AUJB 1DWOA 3K6SB 3DC2A 4PZDA 3KB8A 1U0GA 3AF3A 5DFAA 4JBHA 3ESQA 3GGDA 3RC1A 4GI7A 5LQCA 4XWGA 3ND5A 4ZXPA 4EQZA 1PUJA 4N01A 4R4JA 3WNBA 3M0EA 4PYOA 4AY3A 2FMTA 1KK3A 3SR3A 4AQ7A 5DO9A 4EHDA 4YCCA 5JSZB 3FCCA 4ITRC 3BMCA 2IH5A 3K0CC 3G2IA 4PAWA 3HWSA 4LWOA 1BCRB 4K6MA 3ZY6A 2RAFA 4FYYA 4JUIA 1DTSA 1A5BB 1DDIA 1COWA 3GQBB 3Q3CA 2LWIA 2X42A 2ADOA 4FZVA 4PQYA 2PUHA 2REQA 1JWBB 4O4LA 2OG1A 3SN6A 4R69A 1JTEA 4HH3C 1IHXA 4KMMA 4QBTA 3SZLA 3UY4A 2DQYA 5JW6A 3ROXA 1E89A 2CDNA 2W5UA 1X8KA 3V46A 1K75A 3ZVLA 3ZKWB 4CWAA 1TT5A 1F38A 4PZLA 4YTEA 1PQYA 5J5VA 2WYVA 2O57A 3E4DA 1ZBQA 3QUCA 3L77A 3OIUA 4BNFA 1A77A 5BNWA 1EM8A 3I4CA 4LZWA 1ZMBA 4N7RA 3DMRA 5JAOA 1GZDA 3WI7A 4JUFA 2IZOA 4FBMA 4LOIA 1E2EA 3QA9A 4JN6B 4L51A 2G67A 1K6EA 1ZI8A 2H8KA 3TQIA 4PIMA 1XDGA 2A9RA 2P67A 1ZOPA 2YJ6A 4HNAA 4YMSA 3RUPA 5CBPB 2IRWA 5LDDC 3VR5H 1NN5A 3FKSD 3RK0A 2OHXA 3W79A 2PQ2A 3A11A 2FMKA 4EB0A 4MA0A 4F1WA 4EYKA 2YBEA 2XRFA 1J8FA 2A67A 5KNBH 1XZNA 4F6RA 1Z0AA 3VRHA 1N7HA 4CKWA 3GNSA