1AHIA

7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ahiA00
3GZNB 1P3DA 1I3NA 3E18A 3PZRA 3WXBA 3RFXA 3JQ7A 5DP2A 5EJ2A 3SLGA 2X4GA 5ER9A 2FPIA 2XXJA 3AWDA 3L4SO 5U4QA 3MJEA 1RYDA 2B4RO 3DZKA 1QLJA 1R4MA 4NBWA 3IC5A 5A04A 1U3VA 4EYEA 3K9QO 2X8LA 3AOGA 4IS3A 3QLJA 3D3WB 3WTCA 5JCJD 3PFWO 4KZPA 1S6YA 3U09A 1T2EA 3L4BC 4PIVA 3PWZA 4AJKA 3K8ZA 4E2XA 2HRBA 3GPIA 1IL0A 4E4YA 4Z0TA 1Y1PA 4RPJA 3PDJA 1NR7A 2H9IA 2UYYA 4PGFA 1ZK1A 5LCXA 1ADFA 2Y66A 2Y99A 3AUAA 3L6DA 1XWFA 1W6UA 3DZBA 3OFSA 3PIIA 4JJIA 3NGLA 1TB4A 1X14A 4BKQA 4GKVA 1WPQA 4XEHA 1AE1A 3IOYA 3SLKA 5G4KB 4CM8B 1PJ2A 3EDMA 1F17A 3K73O 3JQEA 3U9LA 1LA2A 2I3GA 1LDMA 3T4XA 1TEHA 2P91A 4RVDA 3VTFA 4BGEA 4RGBA 3QP9A 4WLUA 3QVTA 1TXGA 3R1IA 3LC1O 1PGNA 1I33A 1NAIA 1X15A 2HMUA 2NNLD 3NT4A 1QSGA 4P38A 4CODB 5ITWA 4W4TA 5I7EA 5C7OO 1B3RA 4PLZA 3VZQA 3IIEA 5LDHA 4M86A 4AICA 3JQAA 2EERA 1ZCJA 3C7CB 1T2AA 3D3EA 1JVSA 3PWKA 3AUUA 4YAGA 3RUDA 3VZPA 5DCWA 3GY0A 4OXYA 3RWBA 2JCVA 1GYRA 3EZLA 2VNAA 3QY9A 3BMCB 1UAYA 2QZ9A 2VN8A 3WSWA 3CUKA 5L4SA 5FEUA 1HRDA 1VLLA 3DZFA 1Q7BA 1LJ8A 1E6EA 3AOEC 1Y8QA 4Y6PA 5C7IO 1TI7A 3ICPA 4RL6A 4MIYA 4P8RA 3GEGA 1MXFA 3H8VA 1DBVO 1I10A 2GD1O 4OIMA 2QIOA 2HMTA 5CG2A 5TT0A 1ZK2A 4L73A 1OFGA 5B4TA 1LQTA 1ZKMA 4WK6A 2W2LD 4BO3A 4G65A 2YFQA 3R0IA 5JDCA 2PKQP 3OICA 1YOVB 1RYEA 1KOLA 4YEDA 2W4QA 5JMWA 1ENOA 5L7WA 3D7LA 4HP8A 4BKOA 4NFYA 3F46A 4DPLA 3WG9A 4A0SA 3SEFA 5JC1A 1EVIA 3UXYA 3UAGA 1ENYA 1WZEA 2GZ3A 2JD2A 5AXBA 3TDKA 3PHGA 5JO0A 1DIRA 1KS9A 3TL2A 4QEDA 6ADHA 2ZK7A 1XSEA 4ZQGA 5DULA 4AJEA 4BL5A 3V5NA 3IUSA 4YRDA 1LDBA 3RKRA 1PGPA 1HZJA 4M49A 1WVGA 3H3FA 4ROSA 4YPOA 1R37A 4LRTB 3P5SA 1LUAA 4MKXA 3RC2A 4BGIA 3EMKA 1CDOA 3I9KA 2OO5A 4ZJUA 3E5RA 4LMRA 4J1SA 4XIJA 4CLOB 3SVTA 1E6WA 5ICSA 3NTRA 2QG4A 3M1AA 4AJ4A 5MDHA 2VOEA 3KYDA 2E6UX 3JQFA 3Q9NA 2GNAA 2CNBA 5H81A 4NBUA 5BT9A 3AY3A 1D8AA 5G0SA 2NTNA 3DL2A 4YT5A 5ES3A 5HRUA 3Q1LA 4MVJI 3ORFA 3MOGA 3UICA 2C2YA 1N1EA 3H5AA 1BRMA 1CWUA 3ZNOA 3N7UA 3ZHZA 4FC6A 2WD8A 3Q9UA 1T25A 2C07A 4BNHA 1KYQA 4K28A 5B4UA 3QVXA 1K0UA 5HWSA 2Q46A 1SOWA 1WLYA 1XQ1A 2DC1A 3DQPA 3IS3A 3ZWCA 2C5EA 1F0YA 1VSVA 1Q0LA 3HDJA 4JQCA 4Y8VA 3PYXA 2VOJA 1F12A 4MP3A 1WMBA 1GZ4A 1QMGA 1IB6A 3WNQA 2AHRA 1T4DA 3WGZA 2O4UX 1P77A 1V9LA 4DLBA 3JYNA 1EBFA 4EEXA 2P9CA 1Z7EA 2GSDA 2NUAA 2GN8A 1E3LA 1P1HA 3L0DA 1DAOA 1SB9A 2V6MA 3FBTA 4PVCA 2Y1EA 2HLPA 3EGOA 4MKRA 3F6YA 4D3FA 4TRMA 1H6CA 2Q4EA 3RI3A 4N5NA 3EK2A 3O38A 1M2WA 2EJWA 3AW9A 4BOYA 3T7CA 4M1QA 1NM5A 1R0SA 3ZU4A 2BF7A 2BRUA 4Q3AA 3AUTA 3H65A 3JQCA 3JYLA 3PYLA 5JBIA 4GQAA 4RCVA 1I8TA 4MVJF 4EZBA 3FWNA 1JKIA 1MC5A 1PJBA 3GA0A 4IDCA 2C7VA 3H9EO 1E3EA 1EK6A 4IDFA 2CVQA 1RM4A 3KSUA 1K6XA 3GR6A 2UVDA 4CUKA 3ZV6A 5BSHA 2CVOA 1GPJA 1ZEJA 4NNJA 2C29D 3L9WA 1LLCA 1ORRA 4Y67A 5DCUA 4GBJA 1QYWA 4O6VA 1X1TA 2ZQYA 4L74A 5L4LA 1CEQA 1NXQA 2F1KA 4G5HA 3RD5A 3NKLA 1DRWA 2H6EA 1DLJA 2OHXA 3NT5A 2VUUA 4YT2A 5TGDA 2X9GA 1R0KA 3UF0A 5A4DA 2YJZA 4R1UA 1BTOA 1H6DA 1KEUA 2OBNA 3TSCA 4HFNA 5IN4A 2RIRA 4YRBA 5A5FA 1ISJA 3FNGA 5C7LO 2FP4A 1LDGA 3PRJA 3WYCA 1SOVA 3ETGA 4CMJA 1PX0A 2GUGA 2CMDA 4Y6SA 4AJ1A 1NHWA 3DR3A 2HDHA 4MVJM 4BNFA 1EVJA 1P1IA 4AJPA 3MJSA 1LSSA 2LDXA 4A7PA 3JYQA 1W0CA 3GNQA 3IKTA 3BMOB 1HETA 1HF3A 2VNSA 2B5VA 2H1SA 4BO6A 3OQBA 2VZ8A 3GGPA 2YQ5A 1LC3A 1QV7A 1Q7GA 3GUYA 1JKFA 3CEAA 3RJ9A 4XRGA 5JAMA 1DLIA 4B4UA 3KM0A 4DGSA 3FD8A 4YT4A 1P1FA 2C2XA 2YQ4A 1H93A 5T67A 3T4EA 3JQBC 1NAHA 1YJ8A 2FPPA 3PLNA 2R2GA 3PWSA 1NX6A 1U5AA 5BNIA 1RM3A 2R00C 4H3VA 3EAGA 3DBRA 1FDUA 1WAMA 2PLAA 2YV1A 3E8XA 5ITVA 1LRLA 3JQAD 2JD0A 3O8QA 1Y7TA 3FTPA 5CEEA 5BNTA 1XLTA 5GMOA 3VKUA 3VVCA 2NVUA 1BW9B 3I1JA 4N54A 5KVSA 3P7MA 4E5PA 2E82A 1KC3A 4GMFA 4PRKA 1QYDA 2YDXA 3ENNA 1BXGB 2P9GA 2Q45A 4R3WA 2VRCD 3WMXA 4LMPA 4CR8A 5L7TA 1PQWA 3PIDA 3G1UA 3H5RA 4QT0A 3WWYA 3MTGA 3RFTA 5K9ZA 4YJGA 1ZZEA 1UXKA 4DLAA 3F1LA 4YAJA 3OMLA 2NWQA 3JQ9A 4URFA 5CAEA 1HE4A 4IJWA 5IDYA 2VHWA 3AI1A 2HAEA 1VL8A 1ZXLA 4MIEA 2HU2A 4NIMA 4WCFA 4AJLA 1C1DB 3VPFA 4KTVE 3LLVA 4J1QA 5DF1A 4E5YA 3VPHA 1LLQA 2VUTA 3RU7A 2VWGA 4IY1A 3EY4A 4L4XA 4AL4A 2NU6A 1EFKA 4II2A 5KVQA 3RVDA 4J2HA 5THKA 4XJTA 2Z1NA 2YHUA 4FJ1A 1C1XB 1DAPA 1E3WB 1HZZA 2Y93A 3VTZA 4GPD1 4XB1A 3TWOA 4FFMA 4BNNA 5CDUA 5A3JA 4BNUA 4NG5A 3D1LA 1MX3A 1NVMB 4MVJA 1ENZA 1M6WA 5EINA 4IZIA 2WYWA 3C3XA 1LDNA 4FOOA 5ENDA 3LF1A 4HKTA 4ALJA 4XGNA 4D42A 5I7SA 1SO8A 1GQ2A 3SBOA 4U7WA 2B36A 2W2KA 2ZCVA 3M2TA 1YBAA 3GT0A 4JNKA 4KTTE 3VH4A 3OJEA 2I67A 1NWCA 4LK3A 3DMTA 3SC6A 5GZ1A 1PGJA 1O0SA 3D4OA 4OSOA 4Z9XA 4DPKA 2VUSA 3NX4A 1I2CA 2I5PO 4E21A 2X58A 1Q0QA 1N7HA 1UJMA 1E7RA 2O7SA 4HUJA 2VHXA 4CLRB 2XAAA 5F1PA 1H9AA 1XELA 5AVOA 1P9LA 4EI2A 2I65A 3HE3A 4FJ0A 4BB5A 5HA5A 5FWNA 2WJPA 1RKXA 2P2SA 4GH5A 1PS0A 4KWIA 4M87A 3PXXA 1IULA 1H6BA 4CM4A 5CDTA 2GF2A 4IMPA 3KYCB 3PEFA 3EW7A 5L53A 4UUNA 5JW6A 4NJOA 3AM5A 4J1TA 2ZIZA 1K2WA 4OOEA 1T2FA 2PNFA 2CUKA 4LSWA 5IDWA 1U8XX 5DOVA 4WE3A 1DO8A 4OL9A 2NTJA 3PPIA 2VHVA 3KSZO 3G0OA 2C82A 3I9JA 2ZATA 4CMEA 4GKBA 2V65A 4DUPA 3BTSA 4AVYA 5KIAA 5JYEA 4YACA 3VDRA 4J9VA 4QXMA 1LDYA 4BMVA 4E5NA 5THQA 3LVFO 1Z6ZA 2D2IA 4OQZA 3BMQA 3FHLA 3PGJA 1R15A 3GEMA 4GGPA 2DTEA 2EKQA 1KBZA 3ZU5A 1T1SA 4WGGA 5EQFA 3Q2IA 2PD4A 1C3VA 1NTOA 3WJ7A 2P5YA 4A2CA 3JQGB 4D7AA 4D3DA 2IZ1A 1F8GA 4BO1A 2YHIB 4ZHSA 2F00A 3PJDA 2W98A 4BO7A 1VJTA 1ZK3A 2AQIA 2CSUA 3OH8A 4I5FA 4XQ9A 4B7CA 2NACA 2QRLA 4GGOA 1KEVA 5F5NA 8LDHA 2VYVA 1PU2A 3NJ8A 4BNVA 1SB8A 4BB6A 4HBGA 2HCTA 2DBVO 1XDWA 1YVEI 1PQPA 3GAZA 1FMCA 1P33A 2CDCA 3GQVA 5IZCC 4GSLA 3NTOA 1EEHA 2WDZA 5H82A 4CM5A 1KVQA 2J5RA 3ASUA 1KVUA 1ZEMA 2GCGA 4R69A 2NADA 1T2CA 4JP2A 3CTMA 3DBLA 2I9PA 4IIUA 4WECA 1FXSA 3GRKA 3L9XA 2RCYA 4W7HA 4XR4A 1B7GO 3ZH2A 3FNHA 1R12A 1TT5B 4WNCA 1HDRA 4XR9A 3ZHBA 1P0CA 3ITDA 4CL8A 1L7DA 5KJFA 3VH1A 4ONEA 4IJUA 1XGKA 2GN9A 2WWRA 2WE7A 1PGQA 1ISIA 5EPOA 1I01A 3LU1A 5KOIA 3JTMA 2B69A 2NU8A 2PK3A 1Q2XA 5CEJA 5LC1A 4NJMB 3AY7A 1PZGA 4DQUA 1EK5A 2FOIA 4M54A 4XZ3A 2ZB8A 4YJHB 2ILTA 2O3RA 5CDGA 2EWMA 5EQDA 2VTEA 3OJFA 5T8KC 3DDNA 1ZVMA 1CYDA 3G49A 3WFJA 3ZNNA 3JQ8A 1HDZA 3S2FA 4BKRA 1ZNQO 5JYDA 5L45A 2J3HA 2EP7A 1O5IA 2RH8A 4I1IA 4RPHA 3TL3A 1J4AA 4NFHA 5B37A 2OBYA 4F46A 3TZCA 4YYZA 5DN9A 1PL7A 3GDOA 4EUHA 2VWPA 4FQ8A 2BFAA 4J1NA 5L4NA 4HFJA 1ONNA 4ILKA 1YB4A 2ET6A 4E3ZA 5TX7A 3GLQA 4FFOA 1DHTA 4K26A 1N92A 4RV9A 1DPGA 3S1LA 3CZMA 2ZTUA 3KEOA 3CIFA 1ZMTA 1SAYA 3PJGA 3I9MA 4UUOA 4YWJA 4UVHA 5ER6A 1N9GB 3P2YA 4J16A 4AJ2A 1K6IA 1U5CA 4XDYA 4IQGA 4TROA 5IFLA 3ZGYA 4IDAA 5T57A 2X0JA 4CMHA 2XXBA 3ONDA 4G81A 1PS8A 4IXWA 4RF2A 1CQJA 3FPLA 1Y8RA 4M89A 2I99A 3U4HA 1BSVA 4GLLA 3H9QA 2Q1TA 3PJFA 3WGYA 1B8VA 4CV2A 1E6UA 1YQGA 2G17A 3OBBA 1R6DA 2OP1A 1NVGA 4CV3A 1VC2A 1PL6A 1HDOA 1G1AA 2J3IA 3BZUA 5KNLA 4ZN6A 2JHGA 4ZA2A 4XYEA 1OC4A 4WLOA 4YXFA 4UAGA 3W8FA 2JFGA 1ZK0A 5JDCC 3ITKA 4TMFA 3C85A 1KETA 3FBGA 2BELA 1U1IA 3F4BA 4MINA 4D45A 4CM9A 4OMUA 1FF9A 2D0IA 3GPDG 1JDJA 3BMNA 5H83A 1XHLA 2PWZA 4XWYA 5KJ6A 2D8AA 5JO9A 1LX6A 2GGSA 2PR2A 3W6UA 5ICMA 1ULSA 3OM9A 4WJZA 4YB8A 4BNIA 4BUCA 3SC4A 4E0BA 3QSGA 4L76A 2X9VA 4HFRA 4EUEA 4RORA 5DT9A 3MJVA 3K2EA 2V7PA 1JTVA 4RVSA 5U9CA 2PD6A 3EZYA 3OIDA 3B20A 1MG0A 1LSOA 3I9NA 1E7QA 4JJGA 3ZWBA 5JNLA 1GV0A 1PSDA 1QYXA 4J7UA 1YB5A 5MGBA 3EVTA 1A7KA 3KLPX 1PTJA 1A72A 5EIOA 3RASA 1NPDA 2D5CA 4CMAA 1CERA 3RUAA 1YQDA 3D3WA 4QTZA 3H9JA 5T6BA 1U3TA 2EEZA 5JAQA 5AOVA 3VPGA 3QWAA 5I8ZA 5F3RA 2LDBA 5L7YA 4U8GA 4IDBA 3JQFC 3NEPX 2EF1A 1H2HA 4R3NA 4W9NA 3I83A 1JQBA 4FN4A 4Z9FA 3TNLA 3OA0A 4AG3A 1ZJYA 2BD0A 4UEOA 4EJMA 2PGJA 3DWFA 1U7HA 1WDMA 3WGTA 5G0UA 5F1OA 4NK5A 3GAFA 2Q2WA 1DRUA 3LT2A 1GYPA 3C24A 3DZJA 4YQZA 4KQXA 2EJVA 5F1KA 1IOLA 1GEEA 4FGSA 3ZNQA 5JPIA 1GV1A 2B35A 3EUWA 2OFPA 3HNPA 2AEMA 4QFCA 5IJZA 4OGWA 4J0FA 5JSFA 5L40A 2BGMA 4ND1A 1NR1A 3VC7A 2VYND 3WQSB 1WMAA 5G0TA 2B5WA 4B4VA 4TRNA 1R4NB 3I52A 1O8CA 5A1TA 5JXWA 4TKMA 1PJSA 4WCDA 4A27A 4NDNE 1J49A 3VZSA 2VZ0A 4BIIA 2NM0A 2FZWA 1YJQA 1V8BA 1X13A 1Z73A 5A06A 2VQ3A 3JQ7B 1UAGA 2NV6A 1HL3A 4PLWA 1DJQA 4GVXA 3A06A 3STHA 4BV8A 2X5KO 1R66A 1U4SA 1X1EA 1DC4A 2J8ZA 1R4MB 5G4LA 3JQDA 1ADCA 1C0IA 3JYPA 4YCAA 5AXAA 4BHTA 1WXDA 1EVZA 3WGGA 3FN4A 3H4VA 4DBVO 2DBRA 5EESA 3M6IA 2V6FA 3B70A 3GFGA 2VT3A 3CKYA 3IJPA 4BGUA 1E7YA 1LTHR 3I6QA 3HDYA 2ZTVA 4EEZA 1N1GA 3IKVA 2IE0A 4BO9A 1YDEA 2PZJA 3RQSA 2FY8A 3ONFA 1A5ZA 2NU9A 4KUEA 1MXHA 4PVDA 4UVDA 4B7UA 4DC1A 1ID1A 1VPDA 1MP0A 2V6BA 3GFBA 4QX6A 3WBFA 1BMDA 3NJ4A 1EBUA 1UXHA 3DAGA 3HSKA 5JCXA 2QYTA 4RDIA 3GRPA 7ADHA 1D1SA 3NUGA 3E9QA 4RVUA 4J7CA 4NQZA 5CHEA 3L6OO 3RC1A 1PS9A 5T64A 4YAIA 4J4TA 2YW9A 2D4AA 3VPXA 3FNFA 3GVXA 4HWKA 4BNWA 1EQUA 2Q2VA 4CUJA 5JAIA 1LQUA 4BMNA 4CLHA 2C59A 3COSA 4R9SA 3FCOA 3JQAB 4U0JA 3LQFA 3EYWA 4R16A 4JP3A 1RWBA 3W8EA 4BVAA 1N8KA 1NBOA 3HUDA 3RC9A 4J49A 3ZNPA 1VKNA 4IMRA 4P4LA 1WZIA 5KVVA 3WICA 1LLDA 4UUMA 3S2IA 2NVBA 1DFIA 4DMLA 2BI7A 4P4NA 4CLXA 1T2DA 2RH4A 1K89A 2OL4A 5B4VA 1Y8QB 2JAHA 4KUHA 4HFMA 2RHRA 4FFNA 4IQ0A 5IDQA 5T5QA 2QW8A 3RBXA 2O48X 1E1NA 4WLFA 5KCZA 1YBVA 3AJRA 3KV3O 3MCVA 1WW8A 1HE5A 3GMDA 4K6FA 2B4TO 2AQKA 3DAPA 3MZ0A 4YJFA 5I9MA 3AFNA 4PLGA 1DHRA 3ULKA 3ZHYA 4EITA 4KMSA 3UN1A 3K6JA 1E1MA 4R5MA 1X7HA 1VJ1A 1IE3A 2X0IA 1DJNA 1LLUA 2YY7A 3Q11A 2J6IA 3W8DA 1NFQA 3ZWAA 4HXYA 3TJRA 2D59A 2UAGA 3X2EA 4BQPA 2B37A 1IPEA 3KLMX 1YKFA 2JFHA 3PJEA 4FFLA 4F45A 1G6KA 4IJVA 2EIHA 2G82A 4IDGA 5COAA 1PJTA 3JQ9C 3KO8A 1YXMA 2Y0DA 1SMKA 3LC7O 4R68A 4WCFC 1N7GA 2P4HX 4NK4A 4NR0A 3CXRA 1DDOA 2O4CA 2ZYDA 2YDYA 1VRWA 5ENVA 3WGQA 4PLTA 4EGFA 4U6QA 2EW2A 4GAEA 5COQA 3IMFA 2O2SA 4FCCA 4FFPA 2PA3A 3ICCA 2WMDA 2Q50A 3NV9A 4XB2A 4OQYA 4FDAA 4OH1A 3KYDB 1VJ0A 4L4SA 4XQCA 3IDSA 3TFQA 4LN1A 3X2FA 5IDXA 4LVUA 2VCYA 1KY5A 3LYLA 4YRAA 4L4RA 3PGXA 5DBGA 3DFUA 3ADOA 2X9NA 3W4IA 2BHLA 4JXKA 1DIBA 1QYVA 1GTMA 4OSPA 4LCEA 1K6JA 1DB3A 1W8DA 4E33A 3P2OA 1I24A 1ULUA 3SX2A 1MFPA 4PFJA 4NH4A 1GPDG 2XOXA 3PK0A 2JFFA 1GCUA 1O89A 3UCFA 1IZ9A 1SEVA 3DMTC 4MKZA 4JK3A 5A9SA 3TF5A 3D5TA 4J4HA 1PQUA 2E48A 1DC3A 2ZYAA 4DREA 3RUCA 1J6UA 2NSDA 4W99A 3TFOA 1P44A 5CG1A 1OC2A 2Z5LA 4XRRA 3ROPA 2Y05A 1NYTA 4FFRA 4C7JA 1ONPA 3GN2A 4CLEA 3UH1A 1NQOA 1CIVA 2C5AA 3FWZA 4R1SA 1JU9A 4PLHA 1NVTA 1XIVA 3IUPA 3V8BA 3WWZA 2E37A 4BO5A 3RBZA 1P0FA 5A5EA 2AG8A 2FR8A 2BKAA 1A71A 4QECA 3E48A 4ZRMA 1H94A 1X0XA 4E13A 5JDIC 4B8WA 1T24A 1E77A 3BTOA 4QQRA 4RLHA 4CMEC 4GWKA 4PCVA 4UVGA 3I9OA 1HYGA 3DHEA 2BI8A 2J3KA 3N74A 4P4GA 1JAYA 1E5LA 1OI7A 2ZB7A 1UUFA 4CM7A 4CMCA 2HMSA 1ONOA 3VAZA 3ZV5A 3C8MA 3PQFA 3SJ7A 1UDAA 1MLDA 1Q0HA 2PKQO 4L8VA 1I36A 1NNUA 1CJCA 3RC7A 2WTBA 1G0NA 3U49A 3UCXA 3T7EA 3VDQA 4IDEA 2G0TA 4A5OA 3ZV3A 4C7KA 3LLSA 2GASA 4M8SA 3EC7A 4MP8A 4DIOA 3HFSA 2PKRA 4CUZA 4D0RA 4J3FA 1HWYA 3SJUA 1XG5A 1NPTO 1UZLA 3HN7A 5IN5A 4XJSA 2I3AA 4I9HA 5CFZA 2ZYGA 2IXAA 1EUCA 4O0LA 4I8XA 4NBTA 2H63A 4EJ6A 1V3VA 4R9RA 4BNGA 5BSGA 5EMHA 3CSDA 4RQTA 4DWVA 5TJHA 2O3SA 5AQ1A 2UUOA 2CF6A 1IZ0A 3MEQA 1I3MA 1PJ3A 3ANNA 3QQPA 1A9ZA 5AYVA 1AN9A 3KTDA 4DYVA 1DEHA 1PR9A 3MOIA 1Z7BA 3IJRA 1YB1A 2HK9A 3QW2A 4DLLA 3ZN2A 1KY4A 1IYZA 1ZO8A 5TJ9A 4RF4A 4CQMA 1HT0A 1PJ4A 2ZJ1A 3O9ZA 2HMWA 3ZHXA 1C14A 4DL9A 2QQ5A 4O1MA 2IEBA 2JKVA 2P5UA 5KJ1A 3F4LA 4WUVA 2Y0CA 3CMCO 2WD7A 3HJAA 4GX0A 4XYLA 5B1YA 2WM3A 4BMSA 4WLVA 3ASVA 3WFIA 1DSSG 3AFMA 3DEYX 4CJXA 2DVMA 2BFPA 1RM0A 4NHEA 4DIFA 5I8WA 1ZFNA 1AXGA 1A7AA 1CF2O 3U5TA 1XKQA 1O6ZA 5A9RA 2AEFA 2Q3EA 3O8QB 3QVOA 2NVUB 3ROKA 5G0VA 3PYMA 4O59O 5GZ6A 5EERA 3GK3A 3QJ5A 1V3UA 5ADHA 3CMMA 3IQDB 4HNGA 4QUKA 4GX5A 1HLPA 1B14A 3EHEA 1ADBA 3L07A 4B3JA 2QRJA 4Q3EA 1IUKA 1CETA 3PQDA 3S55A 3H2SA 4OM8A 4CQLA 4CR6A 2V6GA 2PGDA 4DVJA 4KOAA 2DUWA 1HEUA 2VHYA 4I9UA 4XGKA 3UFXA 5A02A 4YJGB 1BDMA 1GEGA 5DBFA 1EUDA 1EFLA 1S7CA 3PFFA 3CPSA 4TRJA 1JA9A 2Z1MA 1VI2A 4ZGWA 3U0BA 2NU7A 4G2NA 1GU7A 1PWZA 1U4OA 1QKIA 3GEDA 3ONEA 4HADA 5L95A 2Q99A 4WCFB 4I5DA 2ZB4A 1PL8A 1B26A 5CEFA 1EMDA 4D43A 1QORA 5J23A 3KVOA 4OKIA 3KETA 3GOHA 2O23A 3TZ6A 1IY8A 4R01A 1IHYA 4EUFA 2RHCA 1WDKA 2AQ8A 3TZHA 1B16A 3QWHA 3AM3A 4F6LA 3MWEB 2C20A 4N18A 3AUSA 4E5MA 1NP3A 3ZWNA 1E92A 4DQXA 1AUPA 1UP4A 5DCYA 2GN4A 3WQRA 4HV4A 4GX1A 1XYGA 2WSBA 3Q3CA 1BWSA 2HO5A 5BSFA 4UEKA 4JIGA 1OOEA 4P22A 4BKPA 4MVJH 2PY6A 3HDQA 3WIDA 5JCJA 2DBZA 5ILOA 2X5JO 2W2KB 4ALKA 2O3QA 3A4VA 1CQIA 2CF5A 3I9LA 4LSMA 1H0KA 1KIFA 3FR7A 1IPFA 1WWKA 1SNYA 4WKGA 4CMKA 1N5DA 8ADHA 3QA9A 1VM6A 1NFFA 1DC5A 3V2GA 4IUYA 1PZFA 1MC4A 2HUNA 1L7EA 4BNKA 5JY1A 4LCJA 5L9AA 2CDAA 4C4OA 2A9FA 1F06A 3W4JA 3FNEA 2X6TA 5BR7A 4PG5A 2O3JA 1DXYA 1DOHA 1LI4A 4ND3A 3ZDFA 3BTUA 5KKCA 1B3BA 1ZH8A 4RDHA 5BSEA 3F3SA 1OMOA 4E5KA 4B7XA 3V1YA 2OUIA 1B15A 4W9NC 3JCZA 3KOUA 4ZQHA 1JVBA 4BO8A 3VPSA 3PDUA 1V6AA 1Z74A 3ETEA 1N2SA 2YFHA 2A4KA 4NMHA 3R3JA 5ILGA 2AG5A 3FSRA 4WEOA 3V2UA 2WEKA 3GG9A 4PLCA 4OJNA 3BMQB 2JCXA 1YGYA 4XIYA 2G1UA 1YBMA 3E9MA 4PZEA 1RPNA 1P1RA 4XYGA 5COBA 4RVFA 3LT1A 4WLEA 3OF2A 4S3MA 1E7WA 4RPKA 1F14A 1SC6A 2D1YA 3DOJA 1LSUA 4XYMA 3ZWPA 4FSHA 2HK7A 3ROMA 1EVYA 4QO8A 3WTBA 4RZHA 4TRRA 3GN1A 2CY0A 3DZHA 2E4AA 5BNFA 3K96A 2IYOA 1ZJZA 2VT2A 1M76A 5KWEA 4A73A 3IP1A 2VRBA 3B1KA 3DBHA 1U2GA 4L9RA 5DNAA 1I3LA 3GHHA 2DLDA 2W2LA 2EKLA 3PHJA 4OKNA 3UUWA 4MVJG 4CM1A 1GQQA 3DTTA 3OEYA 4JN6B 1XU7A 2AA3A 3PHHA 5HS6A 2ZB3A 1G0OA 1VSUA 5DZSA 4E6PA 3WS7A 2PZKA 2DKNA 3PHLA 4PG8A 3DBLB 4ZU3A 3AU9A 4RPLA 3DAFA 4ZQFA 4OAQA 4CMIA 1KC1A 2UV8A 1A9YA 3S2GA 1I3KA 3FI9A 4GVLA 5L51A 3RJ5A 3JD1A 2AEJA 2WYUA 3DMYA 1HE2A 4E2ZA 3JSAA 3AI3A 3VH2A 2DBQA 1EDOA 2QYSA 3F47A 4IBOA 1ZBQA 2G5CA 3PHIA 3GHYA 5JC8A 3I3OA 3W4KA 4E2WA 3MJCA 3FPCA 3GNTA 1I32A 1T26A 1OZAA 3ON5A 4ITUA 4O5OA 4TKLA 4IM7A 4MO2A 1MB4A 4U6SA 3OHSX 2DAPA 3JD0A 1HXHA 3RBVA 4I9NA 4JBGA 2IODA 1GCOA 3PI7A 2FSVA 4ND2A 1YH3A 4DXHA 3DZIA 2W8ZA 3WJAA 3JQ8B 3K30A 2AE2A 1M6HA 1D7OA 3VOSA 1K5HA 3IP3A 4AFNA 2I6TA 2EGHA 2IRWA 3GGGA 2C7GA 3GNSA 1DFGA 2YZ7A 5L3ZA 2X23A 2GRAA 2IEDA 3NYWA 3A28A 1JN0A 1NQAO 3K92A 2NQTA 3WOHA 3OJOA 2QX7A 1DRVA 3KZVA 3KRTA 3OEWA 3KBOA 4I5GA 1PJQA 3AM4A 1O9BA 1NPYA 3GZNA 4MVJD 2Q1SA 1Y8RB 3DOCA 4RJTA 3V2HA 2Y68A 1E3SA 4E31A 3LT4A 4NBVA 1YL5A 5G2OA 5K0ZA 3L77A 4MVJE 4CV0A 2J3JA 4QFDA 1OBFO 1YONA 4WASA 4ND5A 3DONA 2PV7A 1Z75A 3CE6A 4HX5A 4TZTA 1M75A 3V1UA 3BHIA 1YDWA 1ZSYA 1ZXBA 5I7FA 1TT7A 2YUTA 4M55A 3TOXA 5IAAA 4WOJA 5KJEA 3ZWWA 2VWQA 3HDHA 2IDZA 1A4IA 3WSVA 3BMNB 1B8UA 4JGBA 1GY8A 3JD2A 4OYRA 5G4KA 4CM8A 1HDGO 4H16A 4RO0A 4B3IA 1NFRA 3G17A 4KDEA 3NDIA 2VZ9A 2FPGA 3LK7A 1RM5A 3RIHA 3WGIA 1H6AA 2OMEA 1UP7A 3JD4A 4KQWA 4D41A 2W90A 4A03A 1UH5A 1I5RA 2P68A 1U2DA 3TZQA 3WB9A 3GVHA 3W6ZA 1EQ2A 4R4JA 4JBIA 3WGOA 2FR0A 2GPTA 2PZLA 2GR9A 4NU6A 3ABIA 2HQ1A 4UUPA 3ZW8A 4BNTA 3K2BA 4FC7A 4ESOA 1LXCA 2FHSA 3QE3A 1V0JA 4E30A 4ZQBA 3BMCA 3I5MA 1FDWA 4LGVA 3L6EA 3QIVA 4D0SA 2Y67A 3R6DA 5FYDA 2BLLA 1PR3A 4PLPA 5A05A 3CH6A 3Q2KA 1GFSA 4PZCA 3BTVA 3MJTA 2Y1CA 5T8KA 4ZICA 1UR5A 3ROQA 3ZWMA 4MOWA 1U8FO 1WNTA 4Z6KA 4FIZA 1AGNA 2VYVD 5FF9A 5JLAA 3I23A 1A27A 3LC2O 4J6FA 5A3VA 4XA8A 2UDPA 1E1LA 1HSZA 1ISHA 3P19A 1D1TA 3RROA 1YOVA 2DTDA 1BVRA 1UXIA 1GUFA 2J5QA 3TOZA 1C0KA 1QLHA 3U3XA 1Y6JA 2JAPA 3UHAA 4O63O 4DPMA 4E12A 4EJ0A 4K6CA 4WOKA 3JYOA 1WDLA 3MTJA 3WQQA 3ZU2A 4B4WA 1I0ZA 3UOGA 1GZ6A 4J7XA 2ZCUA 1V3TA 2X0NA 3H2ZA 2IYPA 3I4FA 4Q3DA 3O26A 2DT5A 2FSSA 5F21A 4YJDA 1VE9A 4WNIA 4D79A 4KUGA 2A94A 4DRYA 4CV1A 2VRCA 3VH3A 1JWBB 3KXDA 4Y6RA 2HSDA 4PRLA 2DFVA 2BFOA 5K6AA 2FWMX 4D44A 1NQ5A 2P4QA 1UDCA 1H9BA 5AXCA 2Y1DA 3ETDA 5TQVA 4CLOA 2ZTLA 4AJNA 5TF4A 4BS9A 2JD1A 4CMBA 4Q39A 4KDFA 3GMSA 3RU9A 9LDTA 2A35A 2VTDA 4BQRA 3I4CA 2H5LA 4W6ZA 5TC4A 1A4UA 1FDVA 2X7HA 3E82A 4OXNA 4EBFA 1I30A 4IGEA 2OOSA 5TLSA 2B0JA 2DQ4A 1LRKA 1ZSNA 3MJ4A 2X1HA 5A03A 3QWIA 1FK8A 2B83A 1UXJA 3NDRA 5JE8A 1ENPA 3GVPA 3GDGA 2YV2A 1P1JA 1I2BA 3TZKA 3GVCA 4EW6A 2Y1GA 3QRWA 4CM6A 2HJSA 2CFCA 2PZMA 1KVSA 3PP8A 4F6CA 1X0VA 1ADGA 1L1FA 1Y5RA 2Q2QA 1E1KA 3BIOA 3LZ6A 4FPXA 1QG6A 4S1VA 5TSDA 3A14A 2DFDA 5TT1A 4ID9A 5C3MA 2BGKA 2EW8A 4PLFA 1B2LA 3ZZNA 3D4NA 3GGOA 1LDEA 2C0CA 4GL4A 4ZRNA 5HM8A 3PTZA 3UCEA 4AJIA 1B0AA 2ZKLA 2Z95A 1WP4A 4WEQA 5G0WA 1E0DA 3LT0A 2O3TA 1P74A 1XR3A 1YS4A 2X86A 4BKUA 4CM9D 1HE3A 4Q3NA 1E3IA 1Y81A 1GADO 5JS6A 4B3HA 4RF5A 1QP8A 4IINA 5I9LA 3L4BA 3ZW9A 3MWDB 4DQVA 4OXKA 3DB2A 4N5LA 4Y98A 3R3SA 2EV9A 2AXQA 1ZK4A 2Q1UA 4YT8A 3AU8A 1DC6A 3D5QA 4YJFB 4B4OA 4JBHA 1M67A 3CINA 4N7RA 5IXSA 4I08A 3FTNA 3UGKA 4CMGA 5IZ4A 1P31A 1E5QA 1D4FA 3HFGA 4LRSB 2OGUA 3E5MA 1YE3A 4IZHA 9LDBA 1UP6A 4YDRA 3G79A 5BQFA 1FDTA 1UZMA 4D3SA 4XQEA 1HKUA 4AJOA 4FB5A 3U4IA 1GYQA 5IG2A 2GYYA 4IPTA 2Y0EA 2CZCA 1B8PA 1X7GA 2FN7A 3F9IA 4U0KA 1U9JA 5LDGA 3BMOA 1JAXA 1QYCA 1I2ZA 3ZU3A 4YAKA 3DO5A 1YL7A 4Q3BA 5TNXA 3GH3A 3GC6A 4CL3A 1GDHA 2EXXA 3ANMA 1LNQA 4YQYA 3VKVA 1Q1NA 1JWAB 4U5QA 1O94A 1MA0A 6LDHA 3B1JA 1YO6A 4J2OA 4NBRA 2TMGA 3IAHA 3S2EA 3KEQA 4AJJA 1XEAA 4PG7A 1AHIA 3GZ4A 1KEPA 2GO1A 3D64A 1DIHA 3K5PA 2BH9A 2DUUA 3AOEA 4K1LA 3WDSA 5F5LA 2NLOA 3KYBA 4RF3A 4D46A 3NDJA 3BA1A 1GL3A 1NQTA 4PLVA 4BV9A 4MVJP 3DZGA 2YYYA 1BW9A 1X7DA 3NGXA 3TRIA 1GAEO 1HSOA 1F8FA 4YVFA 2JCYA 5A9SB 3G1TA 1BXZA 4R51A 3SXPA 2UUPA 1VKOA 3RFVA 3TQHA 1GD1O 1BXGA 3IL2A 1ZW1A 3FR8A 2ZJ0A 2G76A 4JCOA 3RUFA 4FJ2A 1ZUD1 3OP4A 4IS2A 4PN3A 5HS4A 4XKJA 1H2BA 2QZZA 4MJLA 3H9GA 1YQXA 2O3UA 3BHJA 4JJFA 5CP8A 5TIIA 4H15A 5JY6A 3F5QA 2B4QA 2BGLA 1W4ZA 3HG7A 1E7SA 2FZEA 3ADPA 3PVZA 3WLEA 1C1DA 3H7AA 2O2YA 3H5NA 3HWRA 4RVGA 4FD3A 4I5EA 1BVUA 3GF4A 4YBZA 2PGLA 3JQ6A 4BNZA 4GSKA 2JJYA 3AI2A 4XCVA 1MUUA 3HADA 4W82A 4YA6A 2O50A 4TVOA 1MGOA 1MFZA 5DP1A 2EP5A 3W1VA 4R41A 4BNMA 1C1XA 1E3WA 4KWHA 4J91A 3RCBA 2FR1A 1TLTA 2NQ8A 4NU5A 3C1AA 1EE2A 1R16A 1LC0A 3TPCA 3OIFA 4GI2A 4PG6A 3KUXA 4A10A 1KEWA 4W7IA 5CDSA 1ZIDA 5C5IA 3BXXA 2GDZA 3D0OA 1PIWA 4BNYA 1KERA 4DIBA 5TRTA 2SCUA 1U3WA 3AY6A 3WGHA 5IXYA 3GVIA 4J90A 3ANLA 1ZMOA 2X5OA 1Y9EA 2PH3A 1Z45A 5JAZA 2RAFA 4NFSA 3DBRB 4GMGA 4Y9DA 3OJLA 1MV8A 4OO3A 3TN7A 3N58A 3B6ZA 4MP6A 4JLWA 4DBZA 1HYHA 4CLRA 5B12A 4UEJA 4CM3A 3WBBA 4YR9A 3INGA 2IZ0A 1PZHA 2OZPA 2R6JA 3DC2A 2VHZA 2JL1A 4R1TA 3ZCXA 2I76A 3A1NA 3KYCA 5I9NA 4AJHA 5HTOA 4ALMA 1E7MA 4Q9NA 5GZ3A 1P45A 1BDBA 1ML3A 1BG6A 1PJLA 2NVWA 5GY7A 4IJKA 4B79A 1AHHA 3RUEA 5KVCA 4MIOA 1SEPA 4FBGA 4CQMB 3ZWYA 1Y9AA 1U7TA 4DC0A 2CD9A 2Q49A 1SPXA 3ZWOA 2AQHA 3OQ1A 3HHPA 3GG2A 1GUZA 2D5AA 2BMAA 2A92A 2Y1OA 2JHFA 2WD7B 3ZWVA 3NRCA 3QVWA 1T4BA 3K31A 3INTA 4BO0A 2EHDA 1HYEA 4PG4A 4RZIA 1J5PA 4IIVA 4X54A 4XX0A 5AXDA 2DU8A 1V35A 4Z0HO 1M66A 1GQYA 1HLDA 4Z3KA 4J4BA 3GUCA 3JQGA 4YTEA 5I7VA 4INAA 3V1TC 2YHIA 2HKIA 1Y5MA 5HBRA 1ISGA 4DYDA 1LRJA 4RVHA 5EN4A 3ST7A 1GZ3A 2P9EA 3DTYA 3RUIA 4EDFA 2ZTMA 2FMUA 3RSHA 1C0PA 3C1TA 1XCBA 4CQLB 2DTXA 1CRWG 5FFFA 3OA2A 1LU9A 1KVRA 1YRLA 2GERA 5CPFA 5JDIA 4ALLA 4L0QA 1GR0A 1SZJG 4RPGA 1GUYA 2NTVA 3DBVO 3QHAA 1NWHA 2OP0A 3WIEA 1TT5A 4TVBA 2PTGA 2WE8A 4DA9A 5JMPA 4CPDA 3UKOA 1XU9A 2TMDA 4RQUA 4BO2A 3BYZA 1JW9B 4MDHA 4CM4B 5KTKA 1W73A 4LVCA 2VYNA 3BHMA 3UVEA 3HZZA 3QWFA 1PGOA 1QXSA 1J0XO 1LBEA 3GDFA 1SBYA 1QRRA 2HJRA 1DFHA 4NJMA 4OOFA 5CPBA 3JQBA 1Z82A 2POQX 4R1NA 4OHUA 3INRA 4YJHA 2OXIA 2R00A 3OJ0A 3F1KA 1ISFA 2DM6A 4RLSA 4ZD6A 5TS3A 3U4CA 3ZI0A 3H3JA 1RJWA 4DMMA 4F3YA 2DPHA 3Q0EA 3O4RA 1ARZA 4XD2A 1TVEA 3D4PA 2WYVA 4NI5A 3E1KA 3LDHA 2GLXA 3C1OA 1PWXA 1SCUA 3WR5A 1E3JA 4CLDA 4NZ9A 4B8ZA 2EG9A 1PJCA 4H7PA 1EDZA 4NPCA 1N9GA 3O03A 1K3TA 4DTIA 1HDCA 4YAEA 1U28A 2X22A 3UW3A 4KP7A 4BO4A 3E6AA 1UXGA 1NASA 1YL6A 2IXBA 2X0RA 3QVSA 5DOZA 2D3TA 1QR6A 4R5HA 3PZBA 1ZSVA 4Z3DA 4HY3A 3U4DA 4MPDA 4FGWA 4TQGA 1EZ4A 3FRJA 4PZDA 5IF3A 2ZQZA 1ISMA 2C54A 4UVIA 1AXEA 3WYEA 3OQ6A 3NTQA 1D3AA 1IHXA 1H5QA 1T1RA 2PD3A 3C7DB 3WNVA 1FDSA 2CDBA 4UREA 1EE9A 3QWBA 2BFMA 3HN2A 3KB6A 2CVZA 5DBIA 2AMFA 2PH5A 1XA0A 4E2YA 4GWGA 2IZZA 4JROA 3LF2A 4XDZA 1U3UA 4J0EA 2I66A 5FI5A 4GX2A 3HB4X 3RKUA 1NHGA 1MG5A 1R0LA 4E32A 5KJCA 2EGGA 1LEHA 1OAAA 3JD3A 2YV3A 4N5MA 1Q7CA 1VL0A 3H9UA 5EL0A 4WLNA 1HDYA 3AK4A 4LISA 2GZ2A 2HRZA 4FR5A 5KKAA 3DBHB 1QV6A 3HB5X 3JV7A 4ALNA 4J43A 4CQMD 3DXFA 2Y1FA 3H6KA 2RBEA 1C0LA 4J9UE 1DIAA 4IXTA 3DFZA 4L75A 4PLYA 1YWGO 3VHRA 3M1LA 4UVEA 4ZQEA 3G3EA 3RUHA 4BNJA 4BNLA 3ZWXA 1JKJA 3EVNA 4UULA 1HTBA 2J5KA 3LSYA 4CMIB 3VZRA 3A9WA 3M2PA 5K6AC 3VVBA 2VWHA 3BAZA 1KVTA 2DPGA 4R54A 5JFOA 1PZEA 2EKPA 3NAQA 2XF8A 4CR7A 2AW5A 3Q6IA 4XGIA 1UDBA 4XQGA 3NT2A 3WMWA 2HMVA 4TZKA 4BNXA 3WLFA 4K9DA 3PLRA 4ZVVA 1VL6A 2Q4BA 3ZV4A 3FF4A 4IGFA 3I6IA 3WYBA 1PEDA 2QHXA 4Q3CA 4FS3A 3QV1A 3OSUA 2GZ1A 3C7AA 1XQ6A 1BHSA 1P1KA 1TA4A 3WX0A 4BGVA 3HQ4O 3E9NA 3DHNA 3PQEA 4FOSA 3S8MA 1HDXA 4ND4A 3DHYA 2E49A 4HNHA 3U62A 3KHUA 4GLOA 4Z9YA 4IDDA 4II3A 4Z0PA 1BXKA 2QRKA 2PFGA 3E03A 3KSDO 4TWRA 3B1FA 5DDIP 4A26A 1EUZA 4ALIA 5A9TA 5C37A 3OETA 3ENKA 4JX8A 5FI3A 2GN6A 4QO7A 1DIGA 2AE1A 1BGVA 3CZRA 3OECA 2Q1WA 5CDYA 2XPCA 1FJHA 2O7QA 1O95A 2FRDA 4FW8A 3RAJA 5IZCA 2HK8A 1JLLA 4QSMA 4IQ8A 2OORA 1R4NA 3OIGA 7MDHA 3F5SA 1UZNA 3DOOA 4LW8A 4TSKA 4WPGA 4XYBA 1LSJA 5U1PA
chains in the Genus database with same CATH superfamily
4BP9A 1BKYA 2AOUB 1P3DA 1OBHA 2GA9A 2JFUA 4RVNA 4I2NA 4MI3A 2W83A 3FUTA 3QE4A 5EXSA 3S6JA 1NI5A 3EGVA 3KZMA 3SLGA 3VNRA 4CKXA 4GMXA 5U4QA 2J45A 2BY4A 3N8DA 2GJSA 2COEA 2PS1A 1DE0A 1V7ZA 4IGAA 4LDAA 4EUKA 1X8LA 3FCEA 4FE7A 4FT2A 4EYEA 4LJ4A 4DANA 4BMYA 2J0EA 3HVHA 1DBSA 4UQPA 5A9RA 4N8DA 1LV7A 3VX3A 1DQPA 1L5GB 4EUNA 4MROA 2X9QA 4H6XA 3UGTA 3IOCA 3L4BC 4PIVA 3PWZA 5EY5B 4A8JB 2IP2A 1JIUA 2HRBA 1HO3A 2M6SA 1XQYA 1ZGAA 2BEWB 3A6JA 3GPIA 1RBYA 4QXQA 5DO9A 5ARCA 4XCQA 2BTEA 5ALLA 3PDJA 3RSLA 2JI4A 1NR7A 2H9IA 2MTBA 1ZK1A 5EJFA 3FOWA 3JWEA 3NHKA 4PXSA 1YF3A 5LR6A 3LL4A 3R7BA 3GFTA 1YFLA 1D6NA 1C2YA 1W6UA 4GOXA 2IY9A 3PIIA 2IYQA 1TB4A 3LY5A 4BKQA 4JXZA 1UT6A 4V1CA 1OFTA 3EDMA 1MBZA 1RWXA 5B5SA 1EK0A 1NURA 2I3GA 3T4XA 4YAUA 2FMKA 3L5KA 3SC2A 2FEXA 2QVBA 4BGEA 3V4ZA 5DB4A 2R68A 5HSGA 1T0JB 3EFBA 1JSLA 3HNRA 1MQSA 2HRDA 2RH9B 3LC1O 1RYNA 2HMUA 3M82A 3PHBE 3NT4A 2IUEA 4EFDA 1SBTA 1PBNA 3G7UA 1TF5A 1XD9A 2N42A 5C7OO 1YQUA 5EWJA 1JKXA 3UMMA 4PLZA 2NX2A 3V8EA 2WW8A 2ZYHA 3C5CA 3K6KA 4EP1A 3ILYA 2RGWA 3VR5D 1F4VA 5K4HA 3NW9A 3AUUA 1KH1A 4LCBA 5DCWA 1Z4NA 5AM4A 2IZ7A 1T36A 1OUMA 3RWBA 2YJ3A 3UMBA 5JH7B 2P6RA 2GFIA 3MXTA 2TECE 3EZLA 4U00A 4JP1A 1U31A 4NCKA 3P5BA 4NCAA 3HBAA 2ZULA 4XI9A 2VN8A 4FDMA 4GHWA 3TVDA 5HHTA 2XE4A 5FEUA 2F1IA 3DZFA 1KJWA 3IA7A 5I4CA 3D0KA 3P9YA 4LNHA 3KHSA 2OYRA 1N3BA 2B2NA 3GFOA 3MMNA 4ZHQF 3OTWA 2NT3A 4JT4A 1G6HA 2IYXA 4HGYA 4KBYA 5J63A 3ZCRA 5CA1F 3H8VA 2GD1O 1MAHA 3G9TA 4HWOA 1YQTA 2IHNA 2O2GA 1EGQA 1LQTA 2GCOA 3IQFA 1HPLA 1GCAA 2E5WA 5AK6A 2IGTA 3HB0A 5JDCA 1T6NA 3CLTD 4WINA 4MQMA 3REGA 3ZDXB 4L22A 4YEDA 3EEFA 1UOOA 5LLTA 1F7VA 4TPKA 5A2QA 4G86A 3UB4A 2AJDA 2PHZA 4HP8A 2QTWB 3SYRA 1PG0A 3WG9A 5JC1A 3WC4A 1EVIA 1L4FA 3C41J 2PMEA 1E2PA 1W7AA 2PZFA 2OFWA 4PCUA 4L9SA 3KR2A 1UMCB 1UJCA 1QVAA 1H65A 2WF6A 1DIRA 3MJRA 4L9WA 3STTA 3IAEA 5A02A 1NDUA 4CU2A 4AJEA 2QJWA 3E61A 1NT4A 3ELYA 2PLNA 1DRKA 5CK5A 4B83A 4BL5A 1P17A 3PB3A 3MXOA 5DU2A 3WWEA 1OR8A 5I01A 3H3FA 3HI6A 4DR3B 4DMKA 4Z0NA 2HPAA 3HM2A 4KO1S 3TMYA 4DV4B 3P5SA 1YDHA 2V3VA 4MO9A 4PQFA 1X19A 4RV5A 5DT2A 2P5SA 1N5MA 1CNMA 4XM2A 1G1MA 1CHDA 2QWXA 4WZAE 4X66B 4RJLA 3OUUA 4FS8A 2FHPA 2OO5A 4TLCA 2AFRA 3E5RA 2DLCX 3C97A 4J1SA 4OJTA 3ESAA 3SVTA 5F7JA 4M3NA 2QLBA 3HKDB 3CWQA 1J23A 2CNBA 3F2IA 5BT9A 3GAMA 2GFQA 4OJMX 1P0IA 1FNDA 2IU0A 4PWZA 3DL2A 4QWWA 4J3NA 3GUZA 5ES3A 3Q1LA 1Z0SA 3Q72A 3ORFA 2HHJA 3ZD8A 2IPOA 2C2YA 3H5AA 3FWYA 3ZNOA 3KQQA 3ZHZA 1BCSB 4M1WA 2WHPB 2G07A 4NAUA 1KYQA 2ZIXB 3H4IA 4B3XA 5B4UA 3ZE6A 5G1OA 1DT5A 1QQ6A 2PLWA 3DCIA 4Q3KA 3DQPA 1L5NA 2C5EA 5A7GA 2EDCA 5JSHA 5DK4A 1F5NA 2J3EA 1GGVA 1ETUA 2XTAA 3QMWA 1ZCAA 1L5RA 2KQUA 4WK2B 2A0YA 4YIHA 3FFAA 4PANA 1AQ6A 2I6XA 4KPUA 3OZFA 4KQCA 2AHRA 3REFA 1T4DA 1ZA2A 2V1XA 1NF9A 1W0KD 4IR7A 3JYNA 1EBFA 1KFKB 1JFLA 2HEIA 2XT6A 4EEXA 1FL9A 1Z7EA 1RNLA 3N76A 3TZBA 1J07A 3JWPA 4PX2A 2O8EB 2V6MA 1SB9A 3FBTA 4PVCA 2Y1EA 5B30A 1YU9A 3F6YA 2I1VB 2JFNA 3M5PA 4TRMA 1H6CA 3MMXA 3RI3A 2RBGA 4N5NA 3KC2A 4CG2A 2DHEA 2WHEA 2EJWA 4C05A 5FHRA 3EEOA 3FDJA 2PMKA 3ZU4A 3CUWA 3KCQA 5ALFA 4TKVA 4Q3AA 3JQCA 1DI0A 3KEGA 4DF3A 3LPAA 4HQLA 1IWBB 3O2QB 4PHCA 1Z4JA 5BYKA 4QYMA 1N5KA 3TLZA 1I8TA 3K1JA 4MVJF 4OB8A 4HQOA 3FWNA 2VJQA 4KX5A 2YIDA 1F8YA 4YV1A 2C58A 1P5FA 1LPBB 2RKOA 3H9EO 2X76A 3FPJA 1E3EA 4HH0A 4KFSA 1PQYA 1Q57A 1OIVA 1RM4A 2HMYB 2XGGA 3G6KA 2I2XB 4FOTA 4JP5A 5BSHA 4O3MA 2PUJA 3R09A 4HMPA 1BWQA 2W58A 2P2CA 3M6VA 5DCUA 2ZR0A 3G0GA 4U2GA 2C57A 2G63A 3RIGA 3GO4A 2WWVD 5L4LA 3RD5A 3NKLA 1PK7A 2H6EA 1DLJA 5GVRA 4L4YA 4UBIA 5I8PA 1V7PC 4GVPA 3UQYS 4ZHQA 3AVOA 5FL7A 2VUUA 2H4ZA 5TGDA 3LJKA 5CA1A 5ALRA 2DYKA 1R0KA 1RACA 1TZBA 4B74A 1KK3A 1H6DA 1ULAA 4R1UA 1KEUA 2OBNA 3HB7A 3CRQA 1C7EA 2RIRA 2WNHA 5DW0A 4MYDA 1N0UA 5AIAA 5EHZA 1CR1A 5C7LO 4YXWD 1KE2A 4QG3A 1LDGA 3PRJA 4FK8A 1XEXB 2R7MA 4QDUA 1S8NA 2CMDA 2PT7A 3PSAA 3OZSA 4EF5A 2RE8A 3JZMA 1NQUA 4I55B 4F72A 4HRXA 4BECA 3PA8A 2IHUA 4KXFB 1WXGA 3AHCA 1GAQA 3M6XA 4TWZA 4HTAA 2AI2A 1S8AA 3K0AA 1GSAA 1H22A 1ZL2A 3QUSA 3IPCA 2PZGA 2GBLA 1R0RE 4MMXB 3JYQA 5HF8A 2QZ4A 2R11A 3UHOA 1RHMA 3DHWC 3A4MA 1HF3A 5LNK1 2FEKA 621PA 5LQRA 3H13A 3IPRA 3VPAA 5IU6A 4Y3UA 1ZVQA 2B8WA 3DMNA 3GGPA 3ED1A 1JKFA 2CW5A 3CYFA 3TBKA 4B4UA 1AKUA 3CLSC 3KM0A 2ARKA 1FP1D 3A6EA 1RE1A 2V98A 4P7GA 4DWWA 4YT4A 2IHTA 3ZJTA 4YP1A 1P1FA 4F06A 1QWOA 2RK4A 3EOZA 3TVTA 3DTNA 1BQ4A 4I9GA 5IAKA 2NSYA 3PWSA 2YWBA 3RRBA 1E58A 4G4GA 5BNIA 1U5AA 3WV4A 4P2GA 3W3AD 4BQIA 1NU8A 3DBRA 4ODIA 3WYDA 1HTTA 4D46A 1N2GA 2APJA 2DSNA 3GU3A 5DI9A 1P5JA 1XXHA 2VJPA 3Q6NA 3EXHA 1F2VA 3JQAD 1FLNA 3H4MA 2HREA 5C8DA 1XLTA 4QNRA 3I1JA 3KAKA 5KVSA 2CC2A 1FLDA 4QYIA 2OEPA 1NDQA 3TQCA 1GUAA 2XODA 1R9MA 2NPFA 1CS0A 2X8AA 4U5XA 3N70A 4DCNA 3A2LA 5M2QA 2I78A 5B53A 2ZBUA 3NNDA 1T4CB 3G1UA 4QT0A 3C7TA 3MTGA 3RFTA 3FOAA 2G71A 1W34A 1N8TA 1G8YA 4BMPB 1DJLA 4LE1A 1UXKA 1JQ5A 5AMXA 2JW5A 4AYWA 4EYOA 4XVRA 2LTAA 1TX4B 3G9XA 5E38A 3CUEF 4JI5B 3RFFA 5BSVA 2AFHB 2WSSD 4CRWB 1HLFA 2XF2A 3VPFA 3RTEA 1JNYA 3EH1A 4NY1A 4COOA 1LPNA 3FTCA 5DLYA 3TRFA 3L2OB 4GRAA 2JIOA 2XYRA 4BFUA 4G0OA 1DO0A 4BJ3A 2D13A 2IVZA 4I14A 1SOAA 6YASA 4J2HA 3G23A 1TQHA 2Z1NA 4RD2A 3G2KA 3I04A 1C1XB 1DAPA 1E3WB 1FFBA 1NZFA 5I9SA 4XB1A 3TWOA 4KO8A 3ZWKA 4BNNA 2GHQA 2C5GA 1R0XA 1O9GA 2QVCA 5ALUA 4ESEA 1IG3A 4ZEVA 3D1LA 1MX3A 4TVKA 4EYGA 3AIKA 5AIBA 5IKEA 1ZW6A 4MVJA 3UK6A 3UPUA 2PJUA 1N0HA 1NMZA 1U8CB 2XOKD 1JEQB 1X1RA 2H18A 2WYWA 3WRVA 1NW7A 4LNUB 1RD4A 2C3UA 2BW0A 4XGNA 5FWXA 1SBIA 3FDZB 4LF4B 4RM2A 5KTSA 3SBOA 1TKBA 4YUYA 3E23A 1QV9A 3NOQA 1VMAA 3O4GA 1DDGA 1R1DA 5EE0A 2QTGA 5LDDC 1NWCA 1COWA 5TB5A 3U1BA 4GECA 4YCSA 4EW3A 3C4JA 4MVYA 1V1RA 3GJ4A 4MR9A 3H6HA 1E2GA 4RWEA 1Q0QA 3VJMA 1N2IA 1N7HA 3PIRA 2NOAA 5WRFA 3U1VA 1NOJA 4HUJA 1YT5A 2O2JA 2PUAA 1HKHA 5IVIA 4HATA 3KOMA 5FTLA 3HE3A 5EZYF 5LQDA 2O8DA 1RQPA 2LKCA 2BFCA 2F90A 5E6RA 5KYWA 4U2EA 2P65A 4KWIA 4M87A 4Q7KA 1DVRA 1FDIA 2J9YB 2RAUA 4Y2RA 4CM4A 4IMPA 4D0NA 2J0UB 1EJ0A 4EY6A 3N3BC 2Q5OA 2ZKIA 3A1UA 3EWSA 3PEFA 5KOYA 2HWYA 4OLAA 4NJOA 4EB6A 1QG4A 2IYSA 2ZWVA 4J1TA 1Q91A 4I4TF 4BFSA 4UZEA 1V4BA 1L4BA 2UKDA 5DOVA 3UMSA 2PS0A 1EUDB 4OL9A 3PRKE 3PPIA 3MERA 2OXRA 2CCKA 1M8GA 1JAHA 2ZR7A 3UMGA 4B3GA 3WRYA 5KIAA 3BFPA 1ZLYA 5LOVF 3VDRA 2A9VA 1CY7A 4NHOA 5IC6A 4E5NA 3U60B 3EPLA 3LVFO 4IOLA 1Z6ZA 4OQZA 4NCIA 4BJ1A 2CJFA 2JAUA 3O90A 2DTEA 1JTEA 1KBZA 2I4OA 4XDHA 3H6GA 3ZU5A 4DDWA 1QH0A 1D0VA 1KNQA 2EFYA 2ZM5A 3CH4B 3Q2IA 2PD4A 4A2CA 2RGUA 2WIGA 4D9FA 4JI4B 2YR0A 2ZSAA 1G9TA 3DFKA 4HGNA 3RT1A 2F00A 1YFJA 2O5VA 2BAGA 2FMHA 3L1HA 3C3MA 1EZ1A 2W98A 4LJ9A 1L5HB 3O8CA 3BGVA 4I5FA 4XD7D 3AKCA 4M9XA 2RJOA 4EW1A 4RS3A 4GGOA 4TV9F 5DRTA 5F5NA 2UVPB 2VYVA 1PU2A 4KIGA 2ATIA 8LDHA 3BK1A 1VHQA 1UBOS 2A14A 3QVMA 5EFOA 1XDWA 2HIHA 4JT8A 3OAAD 1PQPA 3CZCA 3GAZA 1Q84A 1P33A 1VCIA 1GRRA 3U3RA 4EZIA 3GQVA 3NTOA 1EEHA 5BSKA 2YWFA 5LXTF 4CM5A 2PT6A 1MTZA 3IA2A 5AM1A 2GCGA 2NADA 1T2CA 3CTMA 2I9PA 4IIUA 4LYFA 1AA9A 4EL0A 4G0PA 3QQ5A 1VG8A 1Z18A 4PYIA 5I7UA 1V5WA 1R27A 2RCYA 4TLLB 1UF9A 1B7GO 2M1XA 2WJHA 4W9MC 2BZ0A 4XR9A 4WNCA 2O1WA 3GT4A 1YA8A 3IBTA 5G53C 1GTL1 5PGMA 3L84A 4LHEA 3KQLA 1U7DA 3V6MA 4CL8A 3W5AA 2QTNA 4G5SA 1E2LA 2PT5A 4HVLA 4JVMA 4BFXA 1M7HA 2GN9A 2D5IA 1YASA 3F2VA 2JJQA 3SMQA 2OSVA 3EUEA 1S0UA 1I01A 1E9EA 4L8GA 3DJYA 3LU1A 2M2IA 5KOIA 3CUSA 5AKJA 3JTMA 3FOFC 2PK3A 5TPZD 5CEJA 4M0DA 5CR9A 1J5XA 3I12A 1PZGA 3UG7A 5CXSA 1GIAA 1EM8B 4RAQA 2ILTA 3WDKA 4AQDA 4JLSA 5HUHA 1RSZA 4BQSA 3AHFA 3CZAA 4GXQA 4HVCA 4E88A 4C43A 2R79A 1PZMA 3G49A 2OXTA 1M2NA 3ZNNA 1AOXA 1RDFA 1BQEA 1TRHA 2EP7A 5KSWB 3CRZA 3TL3A 4IMJB 3E3MA 2KLHA 4G9BA 4ZANA 4REQA 1VIVA 4RHEA 4FQ8A 4LXTA 1RJGA 1E2QA 1BOFA 3PNPA 4P83A 5TX7A 3JVIA 4FFOA 2J32A 4K26A 3OCXA 2OVBA 4TTPA 2PJRA 5F98A 1Y1QA 2ZTUA 3B6MA 3C4QA 3I9MA 1E2MA 1D03A 4UUOA 4YWJA 1UBRS 3MMSA 4BZQA 4DQLA 1ZCZA 4UVHA 5ER6A 2BSXA 4YALA 4ATNA 2WJ3A 1KI1A 3V33A 1FX0A 3B7GA 4KV9A 4IQGA 3DDWA 3ZGYA 4IDAA 1Z2OX 4KN8A 5IFLA 2AUMA 4G0NA 1WXXA 1U3DA 1Y3DE 2AMJA 3MWJA 2XXBA 3ONDA 5HNKA 4X65B 2UXCB 4N3BA 4G81A 3KV1A 5EZYA 1PV1A 4LG1A 4PSDA 2WF7A 3EOAI 1OLUB 2ISSD 3F3KA 4OHFA 1XA4A 4YCNA 1QC5A 3RC8A 3GEIA 4IH9A 2C2HA 2XT0A 1XQ9A 1QP0A 3WHIA 4DMRA 1OAKA 1MZVA 5CB4F 1P6QA 1RPAA 2X8WA 4QOFA 1QTIA 3CBGA 1Y9ZA 4I4TA 4UJ5A 4B09A 1YQGA 3SK0A 4DIMA 1PW7A 2OP1A 1CU1A 2XCUA 5FFMA 2HX1A 6REQB 1PL6A 1WSBA 2NPOA 2ZVJA 3P97A 4MPTA 1WULS 2P4UA 4OMFG 2J3IA 3QPWA 3MELA 4L2IB 1L4GA 5JSZB 3V3TA 5AW2A 4I2VA 4EY8A 5LQAA 3HC7A 2GHTA 3Q4GA 4I46A 3W9YA 1IHUA 3L5OA 3W8FA 1N3LA 2JFGA 1ZK0A 1JR3A 3PG5A 3QXHA 3ITKA 4I1RA 4TMFA 3VMMA 3ZHSA 4F2WA 2BELA 1U1IA 2HFJA 3ENWA 4J0KA 4WKBA 2QP3A 3E4DA 3Q9LA 5B3LA 1ZRNA 2VDQB 2AEEA 1SVMA 1FF9A 2D0IA 2QVLA 3LKZA 2RHBA 1XHLA 1NBME 4XWYA 10MHA 2HA6A 3UA3A 4DSNA 5KJ6A 4FUQA 2D8AA 2FPMA 1LX6A 1SIUA 2GGSA 2LR0A 2PR2A 3DM5A 3OE1A 4HS4A 1KAHA 3OM9A 1CD5A 4WJZA 4X71A 3ZE7A 2JKYA 4E0BA 1Z7WA 2KE5A 3SR3A 4F4JA 4L76A 1T8YA 1UIRA 2E5FA 3HR4A 1U8EA 2RI0A 1FTQA 2AD5A 1Z6GA 2V7PA 3K2EA 4AF8A 4HLNA 3AF1A 3GLGA 3RSSA 3UMVA 5B2EA 1RI5A 3EULA 4TV9A 1LSOA 4JJGA 4BFVA 1MRNA 3PQCA 2QSJA 5ESDA 1ORHA 1E1CB 2CFRA 2UZ1B 4BWFB 3IULA 5CVEA 4DLXA 5CJ2A 1PL0A 5MGBA 1Y4SA 5LXTA 5IT9A 3EVTA 1A7KA 3KLPX 1KGSA 1PTJA 3K1TA 3Q0IA 3RASA 4F7DA 1CERA 1WL8A 3B3JA 5H70A 1LS6A 4QTZA 1KR5A 4DEYA 2ACEA 3VVLA 2ANBA 3VYWA 4PY2A 5T6BA 1U3TA 1U0SY 4YWHA 4I9FA 1G4AE 5K0LA 5T41A 3T06B 2B20A 2R751 3LUAA 4PQYA 4IDBA 1YC2A 1XB2A 3JQFC 3PV0A 3LPMA 4UBOA 2FQQA 1MOQA 3KLOA 1RVV1 3ZGOA 4BZWA 4EWLA 1P4AA 2Y2UA 1C9DB 2ODQA 4W9NA 2JLCA 4IDHA 1WUHS 1XVVA 3BJZA 1E1YA 2BGJA 2ZSKA 1E9CA 1TGYA 2CVHA 2VBIA 4S12A 3WYGA 1J33A 3VBCA 2JG3A 2W6ZA 4UEOA 5HEKA 5TMBA 4CNBA 3WGTA 2KJQA 3X1MA 2YV4A 5F1OA 2G0NA 2Q2WA 2XE8A 1UPFA 3HJUA 3LT2A 4HDNB 1GYPA 2OV1A 1SC4A 1WF3A 4JLKA 3LGXA 4F3RA 3NYQA 3ZLJA 2X1LA 3M9LA 4QATA 5K99A 2H1LA 1AH2A 3REQA 5JPIA 1GV1A 3FE2A 1C9EA 1JJFA 1SCIA 1SD2A 2V4ZA 3GELA 1E2EA 2D4HA 1PWHA 2HF9A 2Q7OE 2AX4A 4J0FA 3RSGA 4I6EA 4LY6A 1RLMA 1Q74A 2GK3A 4NWIA 2VYND 3WQSB 4ZCMA 4NJEA 4XWKA 5G0TA 5TMEA 5GM1A 1OROA 2CBGA 5KX5B 1QRTA 5CXXA 1NM5C 4TKMA 3EA5A 2R4UA 4HXFB 3QNWA 3AETA 4A27A 3U4MA 3AT1A 1J49A 3R3HA 4X1IB 3U5ZB 5FDFA 4Q4DA 4RA9B 1RFLA 1YJQA 2G8LA 1JE1A 5J58A 1Z73A 1CNEA 1ZU5A 3I53A 2V5VA 2VQ3A 4QE3A 3JQ7B 2NV6A 1HL3A 4KQHA 4D96A 3RG2A 1W2GA 2FPIB 3G2HA 3LQ4A 3UC5A 4BV8A 2J8ZA 1R4MB 2QN8A 3KQTA 5BO5A 4EPVA 1ICIA 2ONKA 5DMXA 2ZSJA 3QLUC 1KI6A 3RWOA 4FYXA 3ZE2B 1FU8A 4JUDX 4YCAA 3SFZA 3BE5A 4IIXA 1EVZA 1GZVA 1UPBA 4X9XA 4FGJA 2HA0A 3H4VA 4HPJB 4BB0A 4Y7DA 5CB4A 1OD6A 1R0CA 3BCSA 2ZR9A 2F48A 5D6NA 4PAMA 3LHKA 2V6FA 1XLUA 4IH1A 2VT3A 4U3JB 1YS6A 4DLPA 2X40A 3AEUA 1E7YA 1GQFA 1LTHR 1NYRA 3HDYA 3OC6A 4FBMA 4BGUA 1B74A 4YO7A 4YMUA 5LMNB 4BAGA 1OJLA 4FOPA 2IS1A 3AVWA 1YDEA 3RQSA 2XMSA 3ONFA 5AVKA 4B7UA 3OWXA 4IIGA 1C9JA 3LO5A 3TLGB 4JNCA 4DC1A 5KEIA 3LXMA 1ID1A 4MYUA 5AKXA 1SBQA 3W04A 1ULBA 2V6BA 4NESA 3U7RA 2M6RA 1XZAA 5FPSA 4MS4B 3VXKA 4ACBA 3WBFA 3URKA 1HEYA 4YC7A 1W46A 2PRIA 2VJKA 1M1YB 3NJ4A 1CVRA 3TZLA 4D4HA 4AY2A 4A92A 1P7ZA 3GYGA 2CMFA 1RPZA 1D1SA 3FTQA 4HDSA 4J7CA 4DLKA 2ZE7A 3EGIA 5KQPA 5A0FA 3VQTA 3ER6A 1CEEA 1L7RA 1PS9A 4TYQA 5A5DA 2XB2A 4N6NA 2BM0A 3VPXA 1DV1A 3FNFA 3FOEC 2BDTA 3FOCA 3N2KA 4DQ0A 3EQZA 5L6LB 3F5FA 1P91A 1SWWA 2H17A 2WG2A 4CLHA 2RB4A 3HBLA 3DB1A 4LE2A 3UYLA 1M6EX 4F2GA 4CEHB 1TADA 3FDXA 1VSTA 4U2KA 4R9SA 1WE2A 3FCOA 5JXIA 4RK6A 4H9GA 3LQFA 4Q3LA 3CUYA 2AHOA 1CUWA 4GP9A 3RQIA 3ZXYA 4JP3A 4BVAA 5A7FA 1IQ0A 5J5CA 2VPTA 1UOQA 4R1OA 1IM5A 3EXAA 3C74A 4YDSA 1K06A 3HLTA 1IVYA 4IMRA 4QGGA 5K3CA 1WU8A 3CTPA 2RARA 3LUPA 4Z2YA 1U0GA 2GILA 4BXOB 1Y0BA 2NZ8A 4M4SA 1OILA 3WICA 1TF2A 5KOHB 5IARA 1CKEA 3VJKA 1P0QA 1II8A 3ZQKA 4RFSA 4DMLA 5AW9A 2BI7A 5K0CA 2NO6A 4CLXA 3ZQ4A 2RH4A 3R9IA 1Y8QB 3QVLA 2RHDA 4HFMA 4EG8A 3MWDA 4FFNA 1SIBE 4EHFA 3PLAE 3LD9A 1RWPA 4G9GA 3TAUA 2LWIA 1CP2A 3A2KA 4JQOA 3QI7A 4JSYA 4Z4CA 1E4EA 2FWPA 1MX5A 3J7TA 4RY2A 2W2VA 2XECA 2O5RA 2B4TO 2AQKA 4K6FA 3MZ0A 4HZUB 3W8NA 2WM9B 1KA9H 3R5HA 2BYTA 1Y1KE 1PR0A 2FPLA 4KMSA 4RZXA 4R5MA 4US1R 2F1HA 1IE3A 3CNEA 1P73A 3NHAA 1LLUA 2YY7A 3Q11A 2MCFA 5CH8A 2GD6A 2CNNA 1YMQA 2JJ8A 3RK0A 1IWPB 1P61B 2D59A 3TJRA 4D9CA 1YRYE 2ST1A 3E8SA 3K4PA 3E0XA 2OPHA 3BXZA 3THXA 4DWOA 3KLMX 1M2VB 3ZVRA 3SXUB 5JSQA 2W6JA 4IJVA 5TE9A 3B3FA 4C0XA 3U56A 1N5IA 1KU0A 4EVQA 2JGAA 3CBQA 1KJYA 5BQOA 5AKYA 1R5NA 3ANYB 3JQ9C 1L4MA 1D9ZA 1V7QA 2HLDA 2Y0DA 3AEZA 2P4HX 3E3AA 4L6CA 4NK4A 3GB9A 5EMNA 5CA0B 5B64A 5IVDA 4C4AA 2AVDA 2CT8A 3F6SA 1H0HA 3V97A 3VPDA 5ENVA 3N8IA 1CE8A 4G41A 4HRAA 2PUTA 4KXLA 3WGQA 3BB3A 3NI2A 5LNK6 5COQA 3VYRB 4KNYA 2EYUA 2O2SA 4MUGA 3USCS 1IIRA 1ZN2A 1SHTX 3N2NA 3W05A 3W9UA 1HZZC 4R8LA 3MMPA 1J0EA 1PFGA 1UANA 3Q7EA 5E2BA 2WMDA 2Q50A 2XQIA 4FYMA 4IP0A 3GGCA 3NNNA 4FDAA 1PDOA 3RIYA 1IJEA 4GBMA 3QKWA 5IDXA 2X8BA 3MILA 1CUUA 5AW6A 2OKGA 4L4RA 1BDJA 4NS1A 4REOA 2KWIA 3DL4A 4GL2A 2BHLA 4JXKA 1DIBA 2A5GA 2PSDA 4OSPA 2AB0A 1CIPA 4QRDA 5BN1A 1DB3A 2GF9A 3NYIA 2YZ2A 4M8KA 1XX6A 1ULUA 4BMZA 3SX2A 4PFJA 4NH4A 2NO4A 4L15A 1KBOA 1U8TA 4D4LA 3LBIA 4C29A 1O95D 4JFRA 4DLYA 3UCFA 5KYNA 2JJ1D 4PO1A 1SQGA 3DMTC 1MV5A 2K2QB 4JK3A 4PQGA 5A9SA 2WTNA 4IG9A 4OAOA 4ZC1A 5K3EA 3Q41A 4IDPA 3AHHA 2RBKA 5DXFA 1J6UA 1GG9A 2NSDA 3DDOA 3MWYW 2HBRA 4PPFA 1P44A 1WXEA 2BONA 2Z5LA 5KYUA 1K5PA 5CG1A 1GXSB 4NAVA 1TC2A 1V48A 4Y9TA 4H1UA 3ROPA 1ONPA 4E09A 3H1GA 4UU8A 2DCMA 4CLEA 3UH0A 4AO8A 2C5AA 1CIVA 3WL8A 1QQ7A 3FWZA 3CF2A 2Z08A 4R1SA 1YD7A 4NARA 3L6RA 4E51A 1YZVA 1YOBA 1XIVA 3CWZA 4KVAA 4U02A 1WHTB 1G7SA 2CXRA 4QXAA 2CV2A 2QEQA 2AG8A 4NMWA 3AP3A 4KPFC 4WFIA 1GZ7A 2FF7A 1ZAYA 2JZOA 1QK3A 2JIZA 5AW8A 5EZQA 2CKDA 1TZKA 3RVOA 3VO8A 4R40A 4ZT6A 1GPWB 3QVGB 4A8PA 1KY3A 4RLHA 2ORWA 1SK9A 1W25A 1XRSB 2YMPA 3DEIA 3OKCA 1QO0A 3I9OA 3FTEA 2D2FA 1WKCA 2EZ4A 2JIPA 3AHIA 2P3OA 2AOTA 3SVZA 1JAYA 3ED5A 3QEMB 4KYVA 3V4SA 2ZB7A 2XMCA 1QZ3A 4M1ZA 4S2UA 4XVQA 4CM7A 2WIBA 3KJEA 4IGIA 4QBTA 1DTWB 1XRQA 3D8HA 4RCYA 1ONOA 1OAOC 3K94A 1X1BA 1WF6A 3G2QA 4F9TA 3KUDA 3PQFA 1Z06A 2AC4A 1TIBA 2PKQO 5E9WA 1NRIA 1TM1E 3QBTA 5FX2A 3CLRC 2CYAA 1G0NA 1WUKS 5FR2A 3IXMA 3PR2B 4IDEA 3UCXA 5ES4B 2WNIA 2FG6C 1OZHA 1HEIA 1VMKA 4ZDWA 3ZV3A 1LW6E 1OZ0A 3D43A 5JRDS 1XDSA 2JLYA 3Q8XB 4M8SA 1QX3A 3EC7A 1I94B 3QYJA 4IHAA 1SXJB 1NBAA 4RA6A 1Q0TA 2WICA 4H08A 2PKRA 1NVUQ 1V41E 4WBNF 3LM8A 5E7JA 1CG6A 1HWYA 4J3FA 4RTMA 2OGTA 3G13A 3V7WA 1U8ZA 1XMVA 3BIWA 4MS3B 3NAMA 2I3AA 3OUTA 5EXPA 3W2GA 3BWMA 1PI3A 2PKEA 3HHEA 3OCVA 4NOKA 1IK4A 5CXQA 5JEEA 1EUCA 3WNZA 3CG0A 3QHPA 4I8XA 2XB8A 5A2GA 2WD9A 3LUKA 4R9RA 3PNQA 1W5AA 3O4VA 3DJFA 1BA2A 3RVQA 5BSGA 3AVQA 1I4TD 5AQ1A 3CSDA 2BC9A 2XY4A 5EUMA 1WVIA 1ZIXA 2CF6A 2UUOA 1XEWX 3VRHA 5BWCA 2A58A 2V5UA 1NI4A 3GMIA 1CVIA 1VPEA 4MB6A 5J4LA 1G38A 2QN2A 3FB4A 1BZYA 4LRQA 4WN9B 3EXIA 4BMCA 1DEHA 2WT8A 4V0LA 3ADKA 2XIQA 3IJRA 4MRVA 3FHJA 1KDPA 1XZKA 2ADMA 2WFZA 5FPTA 2PEYA 2I8AA 3GJ5A 3UK2A 3U16A 1ZO8A 5IH3A 3LQQA 3QKRB 4AMUA 3GLUA 1KO1A 5IABA 4CQMA 3ZY5A 4PHGA 5JLJA 1GFIA 4U7HA 2ZJ1A 5EMLA 4CYMA 1KNXA 4JYCA 4BQQA 4HSGA 4O1MA 2IEBA 2ZUEA 5KJ1A 4WUVA 1OIXA 3CMCO 2WD7A 1CX9B 2EQ5A 1X74A 2R85A 1N1DA 3HJAA 4GRIA 3I4LA 2WM3A 5B1YA 2FPPB 4FDVA 1EG2A 3SBXA 5BWOA 1GHTA 3CRVA 4V39A 3S40A 3AFMA 3WFIA 5BR1A 4ZDIA 4CJXA 5C8VA 4A0QA 4B9EA 2C04A 4YUVA 1DP4A 5I8WA 2O1SA 2VZEA 3PPWA 4J6EA 1ZFNA 3ZX5A 4B80A 4ZAFA 2XUPA 1Z5PA 1UOEA 4HRVA 4RESA 3PTAA 1CF2O 4MTCA 3U5TA 1DAGA 3R2JA 1C3XA 3AINA 3D59A 1KZ6A 5FPPA 2VA8A 3M3PA 4II7A 1D1PA 2A9KA 2NVUB 1CSEE 3PUKA 3ROKA 4EY5A 5IYZA 4EM6A 2XVYA 5DYYA 1ULZA 1HNNA 3UW1A 5ADHA 1RZRD 1VPVA 3MQ2A 2CLHB 3EVEA 1G8PA 4XWTA 3DZDA 4Y1RB 5C0OE 4HSEA 1PR2A 1SXHA 1E0KA 2JGJA 1VBMA 1RWWA 2QRJA 3EFOA 1AO0A 3KT0A 3PQDA 4AKSA 2VQEB 3ZPXA 2CB9A 1EFPA 4LJRA 1HEUA 4XWOA 4XGKA 2BHTA 1C9MA 1R0YA 2AI1A 5DBFA 3PFFA 4UEWA 4F9EA 5ALGA 4K9PA 2CYCA 1R2QA 2HA2A 2H16A 3BOSA 1KQNA 1U4OA 4HHEA 3V8VA 4D9JA 1RYBA 2AN4A 5L95A 1Y7LA 1RI4A 3K09A 4KODA 3T1YB 1I2AA 4I5DA 2OVFA 4GR4A 5J1SB 1NV8A 1PL8A 3ZJ4A 2I6FA 3OOYA 2Q3BA 4ZOLB 4D43A 2QR5A 5J23A 2NU6B 2J9FA 3GOHA 1BHJA 1QRDA 1U1CA 4AMVA 1IY8A 1PYOA 1UMKA 1Q0ZA 3LCUA 3KD2A 1CR0A 1UWCA 2O14A 3KUCA 3N39C 2AQ8A 3RF6A 1PUXA 1YKGA 5IMBA 3AM3A 1HFKA 3LTEA 3AUXA 2AJTA 1XHFA 1Q77A 1WJGA 2DECA 1F6BA 1E92A 4RIFA 1NE7A 1EP1B 4FWTA 3GJXC 1U3CA 3GCWA 3NHJA 3M6WA 3MRXA 4GX1A 4QAQA 5AJTA 1XYGA 4Y2YA 1C7QA 2OZVA 3PQ2A 5FNVF 5BSFA 1JDVA 1KMHA 3Q3VA 2A9QA 3ZZ0A 1OOEA 3ROFA 4MVJH 2R6CA 5JCJA 2W2KB 3F4KA 2SECE 3L0BA 1HT3A 4Q1DA 2G6BA 1V3QE 2CHEA 2QRZA 3GI1A 4JQYA 3I9LA 3F3MA 5CB8A 5KTNA 4V24A 3FCUB 4JCCA 1PT5A 2FB9A 3KQWA 1BROA 3UB2A 4CMKA 1YBHA 4WBNA 3DMFA 3GFVA 3U48A 3WRXC 8ADHA 1K5GA 2NUBA 2IPLA 3B38A 1CUHA 5FUMA 1QBKC 2HUNA 4P81A 1VXRA 1S89A 2CDAA 4C4OA 1L4YA 2A9FA 1F06A 2QL9A 5FLXA 2C5HA 5SV2A 4KBGA 5AK5A 5BR7A 5LP1A 4KFUA 2O3JA 1EVEA 3A1TA 2D1QA 2PFKA 4IFIA 4FZ5A 1S2NA 1LI4A 4MDEA 1TLLA 3WHPA 3ZDFA 5DM4A 1B3BA 3BJEA 1E59A 2FEAA 3FOZA 1NXSA 1TUBA 4JR0A 2F9LA 4MNTA 2HXYA 3NHSA 1FMTA 3TB6A 3K0EA 3KOUA 4JLJA 3L06A 1AUQA 4DV0B 1AZTA 2WM2A 2VH2A 2ZUTA 2KB0A 3FYDA 1N2SA 2ZW9A 2A4KA 4OGFA 3R3JA 4A6PA 3FSRA 1KXJA 5C52B 3Q3JB 2VAWA 3CCCA 4JP8A 4MWBA 4TVSA 2H7VA 2Q3JA 3HKBB 4WRRA 4L8YA 4RVOA 4RY8A 4YUZA 4M0CA 1YACA 2ROQA 2ZQ5A 4WFJA 4ON9A 4S3MA 4WLEA 3KKKA 1APBA 2H0QA 1H85A 2DWUA 3IQHX 1LSUA 5K3FB 3SS7X 1XTRA 3AR5A 3HCOA 5FBVB 4HDKB 2NTEA 3PBKA 5FTMA 1EVYA 4QO8A 3WTBA 3MSCA 3X1DA 3R7WB 4OXIA 4ZCSA 5BNFA 1U2RA 4EEKA 1T91A 1YR9A 2HWUA 4L50A 5AJUA 5KWEA 2VJAA 3MOSA 3S2SA 3IP1A 1QH8A 2CCGA 2MSWA 2ZU0C 3B1KA 4CTJA 2YZGA 2PLFA 5BV7A 2PA0A 3GHHA 1CF4A 2W2LA 1SUSA 5KNCD 5B7PA 2FYTA 3M81A 2JK0A 2ZSBA 3LZCA 1XU7A 4JN6B 5BYAA 2ZB3A 1VSUA 3ICVA 5AKKA 4DMGA 1Z22A 2BOVA 3Q3HA 2DKNA 4JT2A 1RIIA 2WKRA 2ZR8A 3N75A 3TQFA 1J2RA 3ZS8A 1Q5PA 4COKA 2D1TA 1CY1A 1Z2DA 4LRUA 3WO1A 4DQDA 3UNXA 3QW4B 3QGMA 4DJDC 1S5PA 4DS3A 2UV8A 1E2IA 2DHQA 5ECWA 2JFYA 1QHEA 2CBXA 2VDMB 5I51A 5L51A 3YASA 2DB3A 1A50B 3F67A 2AEJA 2CEAA 2WYUA 4HLUC 4LFCB 5HZMA 2ACWA 1PUIA 1ANKA 4FGLA 3JSAA 2K5UA 3NOOA 4XH9B 2YNMA 3O6VA 3V42A 1P18A 4ARVA 1FIUA 2JDIA 1JSXA 1M6YA 1ZBQA 3NO4A 2G5CA 3OU6A 1QRAA 3GHYA 3IBSA 1Q2UA 2XADA 3BBPA 1XO1A 3HUFA 3JZIA 4GOND 1JPJA 3CUVA 1I32A 3GNTA 5FPQA 1OZAA 4O5OA 4MQBA 3S44A 3U61B 4TKLA 5DVZA 3I0ZA 2F3RA 5IWAB 3GBPA 5EKSA 4C6TA 1MB4A 4B6JA 3JD0A 4CKBB 4CN9A 3AQIA 4MR7A 3GPCA 3LVBA 4F60A 1SBCA 2BBSA 2MMGA 2MINA 3K5IA 2A78A 3TZEA 1CUFA 3ZHTA 2IYAA 3LQYA 4BVHA 5DM0A 1JHAA 3DFFA 3JQ8B 2MT9A 1TUEA 5CLHA 4JJZA 5DYNA 4C3OB 4IH4A 3IUQA 1HG0A 4BTVA 3D6FA 3GRZA 1K5HA 3NP9A 5CUQA 4BP3A 2AR9A 3WGMA 5JNTA 3H86A 1QHNA 4P3OA 5FNVA 4ESHA 2I6TA 5KTYA 4FYKA 1BE1A 4F84A 1DAEA 4UE6A 2A9OA 2DETA 1RZ3A 4QHTA 2BKUA 4H7EA 2X23A 3MYYA 2DR3A 3KTAB 2D3WA 3V1MA 1CDZA 3ICQB 3ZW7A 5D7BA 4Z4FA 3SR0A 4CIYA 1G5TA 1JN0A 1V5FA 1NQAO 1XMXA 1Y1LA 2NQTA 2PX6A 3K92A 4KE7A 5ALPA 2UUCB 3GBVA 3OEWA 4YMSA 1PFQA 3VOTA 2O2XA 3KBOA 1RKQA 5KO2A 5EMJA 1MW9X 1ZDMA 3AM4A 4JBLA 4I7EA 2M98A 1BXRB 4UTRA 1LZLA 1IN6A 3S7ZA 4E46A 3LIIA 2Q1SA 2REXB 4RE6A 4TS4A 5K3AA 1QHHA 1ZH6A 1ZD2P 2HGZA 1FVXA 2R86A 4DCSA 4Z4GA 2Y68A 3IMKA 4NBVA 1YL5A 4JI2B 4QHSA 2PG3A 1JKJB 1RRPA 4R98A 2J3JA 2VDRB 3QELA 5JTTA 3DP9A 1TQDA 4UAUA 4F4UA 3HEBA 1UBHS 3CLVA 4WASA 3W06A 5FULA 4QUAA 3BB4A 3T61A 3K70D 3DONA 3NATA 4E07A 3W5DA 2COKA 4KCGA 5JNWA 5D5QA 4JWKA