1AHIA

7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ahiA00
4QT0A 1V3TA 3AOEC 3FTPA 2X7HA 1HTBA 1YBAA 3EYWA 5DCUA 1A71A 1U2DA 1U9JA 1J5PA 4XYMA 3Q9NA 2A35A 3TZCA 1PR3A 5A3VA 1H5QA 1ULUA 2D2IA 3BMQA 4J43A 4BNTA 4YT4A 4EW6A 1I2BA 4UVGA 1HE5A 3HN2A 1K0UA 4KTTE 3S2IA 2RHRA 3NJ8A 2VWHA 4ND5A 5AXCA 1IZ0A 3H7AA 4IM7A 3ZHYA 2YFQA 1DRWA 2Y1EA 4XB1A 1F06A 2EGGA 2IZZA 1X7DA 4PLPA 3ZWMA 1H94A 3KO8A 1T2DA 1L1FA 2QRJA 5CFZA 5KWEA 4ZRMA 3VKUA 5KCZA 1RWBA 2VRCA 1E3SA 3AW9A 5GZ1A 5JNLA 2ET6A 5C5IA 4NU5A 1GZ4A 3BXXA 4UUPA 3M1AA 3JYPA 3NYWA 4YAIA 3O26A 2E37A 2UVDA 2Y1OA 4CODB 4PRLA 1DFIA 3DZKA 3JQ9A 4J1TA 3JQDA 5KJ1A 2HCTA 3DFZA 1GV1A 3TWOA 4CUKA 5KOIA 3R3JA 2RBEA 3HDYA 3EUWA 1QLHA 3FNEA 4W82A 4B7XA 5CAEA 4Q3DA 2DC1A 1EUDA 1Y8QA 1CRWG 4C7JA 5JC1A 4KQXA 4E2ZA 4INAA 3GF4A 1T24A 1WLYA 3W4IA 1ENOA 1UH5A 5DF1A 1WVGA 3ZWPA 1KYQA 4GKVA 1PJSA 1B8PA 2P4HX 4L73A 1Y9AA 4UUMA 2Y0EA 3FF4A 3I1JA 3VH3A 4PZDA 4HX5A 4MVJE 2FPPA 1P45A 3JQAA 3RKRA 1CYDA 3FCOA 1EVZA 4E0BA 4CL8A 3KRTA 2JHGA 3NDJA 1B7GO 3RAJA 1P1KA 2D8AA 3ON5A 5FI3A 1T2EA 5F1KA 4M86A 2D4AA 1M6WA 3D4OA 2BHLA 4BO9A 1N8KA 1RM0A 3WQSB 2R6JA 1YVEI 4EUEA 4YT8A 2NVBA 1AHHA 1R4NB 3FPLA 3B20A 2VT2A 3G1TA 2J5RA 4NFHA 3AY7A 2FSSA 2YFHA 3PHHA 1LNQA 1WAMA 2J5KA 3RJ9A 3WMWA 4BO8A 2HDHA 2AHRA 1YL7A 4IDFA 5DP2A 3W4KA 4MVJI 5I8WA 1DC5A 2ZTUA 3EW7A 2WSBA 2HU2A 1Z82A 3VPFA 3VAZA 4BQPA 1ZKMA 1W4ZA 4OM8A 3OJLA 1XSEA 3Q0EA 1O5IA 2Y1FA 1HWYA 1PJLA 2OORA 4QECA 3O03A 5IZ4A 1B2LA 1HKUA 5A5FA 1PZEA 3BZUA 1NNUA 4CV0A 5THQA 3STHA 1M67A 3CEAA 3TNLA 1ISIA 4NBVA 2GPTA 4NJOA 2YUTA 4L4RA 4L9RA 4DBVO 2VZ8A 1SOWA 1GYRA 5CDUA 1RKXA 2VHXA 1GYPA 1ZNQO 3WBFA 1WDKA 5KJCA 2AEJA 5KJ6A 3R0IA 1YOVA 1LTHR 2OFPA 1X1TA 1X7HA 4Z3DA 4CQMA 1UDAA 1ZK2A 1DAOA 3DMTA 4H16A 4WUVA 3ZV4A 4LN1A 4L4XA 1Z45A 1NP3A 5L45A 3DBRA 1PZHA 3NV9A 1ZBQA 2RCYA 3G49A 4U6QA 4J4BA 1PS8A 4R5HA 5CDSA 2XF8A 3K73O 3MTJA 4H7PA 4R1NA 3EHEA 1RM4A 2Y93A 1XWFA 1PTJA 3DMYA 1HZJA 4CM8B 1GD1O 4Q3EA 1I33A 3RVDA 5C7LO 2Q50A 3NGXA 4H15A 2YY7A 1E0DA 1Y8QB 4RVFA 1ZCJA 1LXCA 4U0KA 2EP5A 1X0VA 3IJRA 3SBOA 5CHEA 4PG6A 1LJ8A 4RDHA 1ADGA 1C0IA 2PZMA 2DUUA 3I9MA 1NR1A 2VHYA 4KUGA 3WXBA 3H3JA 3HQ4O 3WOHA 1CDOA 2IXBA 3KV3O 3RROA 1UAYA 2VHZA 3ST7A 2DTXA 4ALKA 4BNJA 2O3RA 4J4TA 1U3TA 3K31A 1LLDA 3LF2A 3OEWA 1LDYA 3V5NA 4E33A 1LSJA 1OOEA 4YR9A 4RVHA 4WOKA 4JBGA 4BKPA 2EF1A 1O9BA 3FBGA 4BNFA 1HF3A 1KVRA 3ORFA 3PDJA 3GMDA 1LC3A 3D3EA 2GN8A 1UDCA 2PV7A 3CIFA 4HWKA 4ALMA 1AXEA 1A72A 4NI5A 4K6FA 3VTFA 9LDBA 2QZZA 3OEYA 4AICA 4D79A 4FR5A 2HSDA 4OSOA 2X22A 3L6EA 4I5EA 4YT5A 1HRDA 4PLTA 5DT9A 4E21A 4JP3A 4CV3A 1E7YA 5HM8A 4HP8A 3PQFA 3CSDA 3PJFA 3D4NA 2FPIA 4G81A 2QZ9A 2NWQA 1R0SA 2YQ5A 4ND2A 2BFPA 4XYGA 3D3WA 2O3UA 3EAGA 4Q39A 4CLDA 4PN3A 3FPCA 4PLVA 1BXKA 1LLCA 5G0VA 1JAYA 2I5PO 2XXJA 1ISJA 2FN7A 1YOVB 4J90A 3H65A 4PLWA 2QIOA 3K6JA 2H9IA 4ZQFA 3EVNA 4O0LA 1ZW1A 1JKJA 2E49A 3LYLA 4F3YA 1E3EA 4YA6A 1QR6A 2UAGA 3JD0A 2FMUA 6ADHA 2AG5A 5EMHA 3WMXA 4RPKA 1GL3A 2PZKA 4DPMA 2YHUA 5TRTA 2ZTMA 3GAZA 8LDHA 4M1QA 4ND3A 1DHRA 2O23A 1ZEMA 2VUSA 3QQPA 4P4GA 4E5NA 2H63A 3GLQA 1MP0A 5JCJD 3PZRA 4R41A 4BNUA 4CMEC 1QKIA 1Z73A 1HDRA 1SZJG 1AHIA 1NWHA 4TRNA 4IPTA 3PP8A 4NHEA 1TT5A 5IZCA 3SLKA 2ZB8A 4F6LA 5TJ9A 1Y1PA 1MA0A 4EJ6A 2Q46A 3Q2KA 4J7UA 3DMTC 1DLJA 1M6HA 2HMSA 4W99A 3TSCA 4IDBA 4Z9FA 2O7QA 1VKNA 3KXDA 4WLFA 5L4NA 1FJHA 3PJGA 2B83A 4A7PA 5T67A 3U09A 5L40A 1YS4A 1HSZA 4O5OA 2YHIA 1YRLA 3KYDB 5ER6A 2C29D 1EQUA 1O94A 1WNTA 4J6FA 1KVUA 4OIMA 5JPIA 2NU6A 4CQLB 1NAIA 3GGPA 2BMAA 4E6PA 5KVVA 3AUAA 3QWAA 2E48A 3NDRA 3UCFA 3OH8A 4M49A 4A26A 4BNKA 3LVFO 5KNLA 1N92A 3AI1A 3W6UA 1GADO 1EBUA 1QV7A 1ZK0A 4EI2A 3GVXA 3U3XA 5FF9A 2FP4A 3JQFC 4TROA 3K5PA 4R5MA 5A04A 4FC6A 5F5NA 5C3MA 5I9LA 2B36A 4JROA 3ADPA 4KMSA 5B37A 1O89A 1BWSA 1KEUA 3LZ6A 4IIUA 3V2UA 2OL4A 3MJEA 1HYHA 4XR9A 4CM5A 2VCYA 3KSDO 5DZSA 4PIVA 1E1LA 4EGFA 3N7UA 5CG1A 1NVGA 2Q1TA 3W8FA 3PQEA 5JCJA 4AG3A 2WTBA 3JQFA 3ZWCA 4AJPA 4RF2A 1UXGA 1HE3A 3GFBA 2VYND 5ILOA 4XKJA 1HT0A 3BMOB 3V8BA 4AJ4A 5JAIA 1OC2A 2PFGA 1LX6A 3ONEA 5KVQA 3WLEA 4ZICA 3BMNA 4FPXA 1P0FA 5THKA 2H5LA 1U3WA 4ZQEA 4XRGA 1Q0HA 1NQAO 4PLFA 1EUZA 4ONEA 4XGKA 1ONNA 2W2KB 4FW8A 3G79A 5EIOA 3WNQA 1QSGA 3GG9A 1ADCA 2RHCA 2YDYA 4CMJA 3MTGA 1VJTA 5C37A 4LW8A 3GGGA 4RVDA 3QWBA 4EITA 5I9MA 4DTIA 1EZ4A 5BNFA 4BV9A 2BGMA 1Y5MA 3PXXA 1RJWA 2YHIB 2GZ1A 2C20A 2ZCVA 1A7KA 3KVOA 3PTZA 4HBGA 2AXQA 2NTVA 1IPEA 3LC2O 3QWFA 3I9LA 2Q1UA 3AOGA 1R6DA 3BMCB 4JNKA 4HFMA 3AM5A 3ZWWA 2LDBA 4TRJA 1PJBA 1E7MA 1HYEA 1NFQA 1YQGA 2GDZA 4BNZA 4LSMA 1SMKA 1JLLA 4IY1A 4B79A 1GCUA 4P4LA 1B3RA 2IEDA 2IZ1A 3F9IA 3MJ4A 1K5HA 3V1YA 4LVUA 3HWRA 1PJ2A 2Q49A 5I8ZA 1PJ3A 3CH6A 5CPBA 1A9YA 1E6WA 4XGNA 5A02A 1DHTA 2X9GA 4UEJA 4YPOA 4WASA 1AGNA 1RYEA 4QTZA 5FYDA 4UREA 2PK3A 3NT4A 4GWGA 3D1LA 2BH9A 1QYDA 2Y67A 4LGVA 4TZTA 4RPLA 1NVMB 4BHTA 3CTMA 3U9LA 2PKQO 2AEMA 3GR6A 2VHWA 3EZYA 1LU9A 1E1KA 5EPOA 4BMSA 4R3WA 1LRJA 4IMRA 2E6UX 3BTUA 3WSWA 4IXTA 1R0KA 2GASA 5BT9A 3AU8A 2TMDA 5IG2A 3L6OO 2JD1A 2P68A 3V1UA 4GI2A 4J49A 5K6AC 2CMDA 2GUGA 2O4UX 3D64A 5ICSA 2IZ0A 1C1DB 3TPCA 1B8VA 2AQIA 3GDOA 2IDZA 1E1NA 3EZLA 3OECA 1FDTA 1I10A 1TXGA 3QA9A 1LDBA 4ALJA 4E5KA 1OMOA 4JJGA 2FSVA 3ZHZA 5TSDA 5L4SA 2A94A 1K89A 4WECA 4BO1A 5MGBA 4BQRA 4LRSB 2OXIA 3L4SO 3TOZA 1GUYA 1JQBA 3WLFA 3WTBA 2WE8A 3PEFA 1AE1A 5JS6A 2D3TA 3U4DA 3GMSA 3VDRA 2X58A 3PJEA 1C0KA 2JL1A 5GZ6A 3D3WB 4E2YA 4WJZA 1QXSA 2NSDA 1NFRA 3GFGA 1YXMA 4TSKA 3PGXA 3QP9A 5A1TA 3WWZA 3G3EA 2VRBA 4RVSA 2HRZA 2AA3A 2WYWA 3ZH2A 4EBFA 5MDHA 1BDBA 4JGBA 3A4VA 4DYVA 1U8XX 1T26A 1XGKA 5FI5A 3QY9A 5EESA 2BFAA 2F1KA 2QG4A 3MJVA 3Q2IA 1ID1A 1HXHA 1T2FA 2W2KA 4R54A 3RUHA 4MVJF 4AL4A 1P1HA 4A03A 1SB8A 3RU7A 1XU7A 3OIDA 4ZU3A 4Y6SA 4ZN6A 5T6BA 3TDKA 4B8WA 1EFLA 4IQ0A 3WGQA 1DXYA 1ONPA 3B1JA 1TI7A 1PIWA 5U9CA 5AOVA 2VOJA 4YBZA 4BMNA 4GSKA 9LDTA 1MFZA 1ZSVA 4IINA 1YL5A 1ZVMA 3VKVA 5CDGA 3FR8A 5U1PA 1VKOA 4YQYA 3RU9A 1ZK3A 3VVCA 3K92A 4RF3A 4J9UE 3KZVA 1GY8A 4QUKA 1EMDA 3SC4A 3L77A 2BD0A 4QO7A 1LDGA 4RF4A 3S55A 4KTVE 4YJDA 2VYVA 4HFRA 3RKUA 1ZJYA 1A27A 3VZSA 3NUGA 2WE7A 3F4BA 3JQ8B 2Q45A 5DBFA 3DZGA 4Z3KA 2P9CA 4PG5A 2V6GA 3RWBA 1VI2A 5K0ZA 1K6JA 3ZGYA 1OC4A 3SLGA 4J0FA 1VC2A 1LRKA 2EKLA 4A10A 4G5HA 2PD6A 3GZNB 4NNJA 4E30A 4IXWA 4GX0A 3E18A 2DT5A 4B4UA 4MKRA 2FRDA 4RJTA 3ZI0A 4MVJH 1DC3A 2AE1A 3FSRA 4FJ1A 4AJNA 3AFNA 5HS4A 1WW8A 4FFLA 1U5AA 4M87A 1HDYA 1E6EA 3QVWA 2I9PA 2ZATA 3INRA 3M1LA 1HEUA 5JDCC 4KUEA 2Z1NA 4ZHSA 2P5YA 1VJ0A 1X14A 1IULA 1R12A 2BFOA 4XX0A 1JKFA 1C14A 1EBFA 1Z75A 5K6AA 1T4DA 3NDIA 1IPFA 2VRCD 3OMLA 2P4QA 4U5QA 5EJ2A 1KOLA 2J5QA 5DCWA 2AG8A 2PTGA 3JQ8A 1N9GA 5ITWA 5DN9A 1DJNA 3S2EA 3TQHA 2EEZA 5BNIA 3BMNB 3HDHA 4FOSA 4J9VA 4M8SA 4AJHA 1UZMA 3JQ6A 1GR0A 2D1YA 3ZV3A 1A4UA 3TL3A 4BS9A 2CF6A 6LDHA 1OBFO 4WLVA 3JYNA 1RYDA 2DFDA 4MIEA 2EV9A 2V6MA 3ZNPA 1XDWA 4OHUA 1E3LA 2B35A 1PQWA 1C0PA 3TZQA 4HV4A 3QWIA 4DXHA 3OFSA 4B7UA 3GVCA 1IY8A 1V3VA 5FWNA 3ITKA 5T5QA 4R1TA 3GRKA 3X2EA 3O8QA 2HMVA 1W0CA 1CEQA 4QFDA 1MB4A 4OL9A 4JK3A 3WIEA 5GMOA 4LK3A 1UP4A 3GN1A 5T8KA 4DC1A 1SNYA 1ULSA 3AK4A 3AUSA 4XB2A 2ILTA 4D42A 4DIFA 4ALLA 1E6UA 3N58A 1H93A 1Y7TA 1Q7CA 4KWHA 4AJOA 3V1TC 1C0LA 1FK8A 3ETGA 4BB6A 2GERA 4TKLA 5TX7A 1E7SA 4AJJA 5AYVA 4CQMD 4YAEA 2DU8A 2HKIA 2X8LA 5TF4A 4P4NA 4B8ZA 3UW3A 2AQ8A 3U4CA 4XQCA 2DPHA 3D0OA 3JQBC 3DHEA 4DQVA 3L6DA 3E8XA 4J0EA 1F8FA 3DOJA 3KSUA 2BLLA 2Y99A 5TNXA 4HKTA 3HG7A 3ROKA 1HETA 5DNAA 1GZ3A 2X5JO 3DWFA 3F47A 4HFJA 3I6QA 4RO0A 3C8MA 3ONFA 3NTRA 3JD3A 4GX5A 4FBGA 4WOJA 4N54A 1RM3A 3KUXA 3TN7A 4BNWA 1KEPA 3VPHA 3IOYA 3H5NA 4CLEA 1C1DA 1H6BA 3C1TA 4WLNA 3JTMA 3X2FA 4WPGA 1I01A 1TB4A 3COSA 4CPDA 3KEQA 4OQYA 2OOSA 3GZ4A 3DZBA 1S6YA 4YRDA 1BVRA 1JA9A 3FWNA 3CINA 4S1VA 4B7CA 4FFRA 3HZZA 1OAAA 2CY0A 4J3FA 3NT2A 4R9SA 2C82A 4D46A 1SB9A 1C3VA 3PGJA 4MJLA 4DC0A 3RC7A 4BMVA 3OSUA 3RASA 3RFTA 4Z6KA 4BO2A 1BTOA 4RGBA 1NASA 4JJIA 5EINA 3ANLA 2AE2A 3JQAD 5C7OO 4GH5A 1SEVA 1DIRA 4GQAA 1U1IA 3QHAA 4ZRNA 4CMHA 3Q6IA 2B37A 4J1SA 3DAFA 3IMFA 3JYLA 1NYTA 3P2YA 4Q3CA 4YDRA 1HLPA 4RPHA 1LDMA 1YH3A 3H6KA 1IZ9A 3OIGA 1YB4A 1IB6A 1KEVA 2O48X 3DQPA 4WEOA 1BVUA 2DBZA 3SX2A 2VUUA 2X0IA 2YZ7A 5I7EA 4RPGA 2RH4A 2EKQA 3WICA 4D44A 1E7RA 5F3RA 4CR8A 3Q11A 4XJSA 4BKQA 4FFMA 5ENVA 1PEDA 5BSGA 2VOEA 4BGEA 3KHUA 3WGZA 2GN6A 4WK6A 1QYWA 4WLEA 2Y0CA 1FMCA 3DR3A 1TA4A 2OUIA 4N5LA 1KVSA 2EW2A 4GX1A 8ADHA 3NX4A 4CR7A 1F14A 2V7PA 5JO0A 5F5LA 3PLRA 3AUUA 3E1KA 1E77A 5JMPA 4D3SA 4MVJA 4NG5A 5ENDA 1YONA 4AJ2A 3DHNA 4PVCA 2J3HA 5IZCC 2DFVA 1SOVA 4JXKA 4CM6A 4IDCA 3UXYA 7ADHA 1DEHA 2I3AA 1JTVA 4YEDA 4E5YA 3OA2A 3UGKA 1ZMOA 2PZJA 2V6FA 4IS2A 1BXGA 1LC0A 4IJUA 1DOHA 3E9QA 3NTOA 3FHLA 2X5OA 1XQ1A 2HAEA 4PCVA 2O4CA 4PZEA 5AXBA 3L07A 4AJKA 1NQ5A 4DUPA 4YAKA 2HQ1A 3D7LA 3LF1A 1A7AA 3CZRA 4FJ0A 3F1LA 4R4JA 1V3UA 3DBRB 3E03A 4W6ZA 1YKFA 3K8ZA 3EDMA 4DMLA 1VL6A 2VNAA 3B6ZA 4XQGA 3ZDFA 1ISMA 1JN0A 4YT2A 2PY6A 4OOFA 2UUPA 5L7TA 4PZCA 5CDYA 5ILGA 3U62A 1J4AA 3AJRA 1XELA 2Y05A 1BW9A 3RUFA 2ZB3A 1A9ZA 3S2GA 1OI7A 3FI9A 4BNLA 1HSOA 4XA8A 3GUCA 1U7TA 2DBVO 5LDGA 4CQLA 4BV8A 2HRBA 2IRWA 4OJNA 1UXHA 2ZYDA 3A28A 1FDSA 2JAHA 1IHYA 2BRUA 4BKOA 2OP0A 2E4AA 4PG7A 1YQXA 2ZB4A 1WDLA 1DB3A 1SEPA 4O63O 3FD8A 4PLGA 4CMIA 1ZIDA 3F46A 3HN7A 2JKVA 1CQIA 3OIFA 4DGSA 5FFFA 4CLHA 3CMCO 2E82A 3DONA 5TGDA 4N5MA 3TL2A 4L75A 4BNMA 4R1SA 4QEDA 1GPDG 1Z7EA 4Z0PA 4WCFB 4YJGB 4R9RA 4CM9A 1IE3A 3AM4A 2O2YA 1UXIA 3HADA 4BO6A 2X9NA 4RLSA 5IFLA 1J49A 3INTA 3WGOA 1ADFA 5DOVA 1T25A 5F21A 5JC8A 2NUAA 1W8DA 4OH1A 1J0XO 2OBNA 1QLJA 2O7SA 2GRAA 1R0LA 2CNBA 4FD3A 1JDJA 2C7VA 3DL2A 3RUIA 1U4OA 3GC6A 4U0JA 3UUWA 4ND4A 1T2AA 3GH3A 2I65A 4TVBA 3OETA 3TRIA 1ISFA 3UCEA 3O4RA 3C85A 1EEHA 2EW8A 4GAEA 3AY6A 3PIIA 1I32A 3KYCB 3TZHA 2WM3A 2BELA 4JCOA 4RF5A 3RBVA 1MX3A 2PH3A 1UZNA 4WLOA 2UDPA 4DIBA 2GF2A 4OXNA 4K1LA 4MO2A 3FNGA 5A9SA 2CDBA 2F00A 4Q3NA 1JVBA 4MOWA 5DBGA 1K6XA 4UEKA 4DREA 3PYLA 1CIVA 3K96A 4IZIA 1QMGA 2YDXA 1XA0A 2DAPA 4MKXA 2UYYA 4XDZA 4CM1A 3ADOA 2R00A 1MGOA 3L0DA 4YRAA 3HFGA 3ZNQA 1GDHA 2JCYA 1YJQA 4OXYA 5TS3A 1Y9EA 3E5RA 4UVIA 3CPSA 5CDTA 1YJ8A 5L4LA 2VWGA 4DMMA 4FOOA 4RL6A 1NX6A 3GOHA 4DVJA 4ZGWA 4PGFA 2SCUA 4GMGA 3HJAA 1XEAA 4HADA 1I3KA 2FPGA 3GEDA 4L8VA 4PLHA 3JV7A 5L7WA 5JMWA 4ZQGA 4RVUA 2PR2A 3HB4X 1U8FO 4FIZA 1PL8A 4LCJA 1EUCA 3OJ0A 4NJMA 4PLYA 1U28A 1ML3A 3EGOA 3PZBA 1NXQA 2NU9A 1M76A 3RUCA 1DIBA 1LSSA 3WR5A 3RC1A 2NVWA 3KTDA 4RQTA 1IUKA 2W2LA 1GFSA 2WMDA 3K2EA 1ZK4A 5I7FA 4LISA 4FB5A 4W7HA 3GAFA 2OO5A 4FC7A 4WCDA 3H5AA 1DRVA 3JQ7B 1Y81A 2AEFA 5B1YA 4R1UA 1LSUA 2CVZA 1CERA 1PGNA 2B4RO 3GHYA 5TLSA 1PZFA 1XIVA 2ZCUA 5G2OA 1KY5A 2W2LD 2G1UA 3VOSA 1PL7A 4DLLA 1NHGA 1PWXA 3WYCA 1OFGA 5BSHA 3ZZNA 1BDMA 2GN9A 4IZHA 1CETA 4K6CA 4FJ2A 3DEYX 2D5CA 1P9LA 3W1VA 2JCVA 3PK0A 1N9GB 3OJEA 1IHXA 2GLXA 3TJRA 2GYYA 2GCGA 5A3JA 3B1FA 3GUYA 4OGWA 4CQMB 5GZ3A 3NTQA 5TJHA 3DTTA 3GG2A 3GQVA 4ID9A 4N18A 1E5LA 3PWSA 3OM9A 3I9OA 1QP8A 4I5DA 3UFXA 5H83A 4B3HA 4HNGA 3MJCA 4IQ8A 3ROQA 5ES3A 5JBIA 5IN5A 3Q9UA 4GBJA 5A9SB 1VLLA 3CE6A 4BUCA 4UVHA 2Y1DA 3MJTA 1H9AA 4D41A 3MJSA 5C7IO 1LDNA 3IDSA 4XRRA 4MPDA 4J16A 4E5MA 1IYZA 4J2HA 2GR9A 4R16A 3I9KA 3SJUA 5JFOA 4GWKA 4UUOA 5AQ1A 3L9XA 2BGKA 5EL0A 5JYDA 1H6DA 2J6IA 4NBTA 4RDIA 2CVQA 4E12A 5G4LA 4HFNA 3ZCXA 4DQUA 3PVZA 1DJQA 4Y6PA 1HDCA 2PKRA 1KETA 1ZXLA 3GVPA 4KZPA 1BG6A 4XYEA 1ENPA 1I30A 1P1IA 1R37A 2EGHA 4E3ZA 4Q3BA 5BR7A 1PJQA 4O1MA 2V6BA 1MG5A 3TOXA 3PYMA 4ROSA 4Y98A 5BNTA 4KWIA 4ALNA 2GGSA 5KVSA 5L95A 4BO0A 4Y67A 2JJYA 1R66A 2X86A 4DLAA 1XU9A 2O3TA 3ZWYA 4II2A 1DIGA 1DPGA 4LMRA 4Z0TA 2J3JA 3KM0A 4ZVVA 1H6CA 2RAFA 1MFPA 2Q3EA 3BTOA 5L53A 2D59A 1CQJA 1YBMA 2QYSA 1E3JA 2EIHA 1ADBA 2VZ0A 3I3OA 3PJDA 3H2SA 3UICA 1ZH8A 4OAQA 1I3MA 4XCVA 2OGUA 3HB5X 2C7GA 4IJVA 4YXFA 1D7OA 3LT4A 1E7WA 3LQFA 3ZWVA 2A4KA 5KIAA 3QVSA 5G4KB 1N1EA 3C1OA 3JD2A 4WCFC 1SPXA 1CJCA 5KKAA 5EQDA 5A4DA 4QFCA 4XQEA 1GUFA 1NTOA 1MV8A 4NFSA 2VN8A 2FR1A 4BNVA 3NJ4A 3Q3CA 3IKVA 3G17A 3I6IA 3ZWOA 4I5GA 1Q0QA 1U7HA 4B3IA 2OMEA 3F5SA 5K9ZA 3FR7A 1XQ6A 1YDEA 2D0IA 1GU7A 3L4BC 4IUYA 5KJFA 3ETEA 3QIVA 2VWPA 1Y6JA 3D5TA 1HE2A 2GZ2A 2QW8A 3RD5A 4NH4A 3JYOA 3HNPA 3IQDB 3DDNA 3AOEA 1E5QA 3ITDA 2P5UA 3L4BA 3PQDA 3WS7A 4HNHA 1PU2A 2J3KA 2OHXA 3KYDA 3H9GA 2Q99A 1P33A 4EYEA 1P31A 2ZKLA 3ZWXA 1ZJZA 1E3WA 3P7MA 5DOZA 4IDGA 3ULKA 5IDXA 1ISGA 1QORA 1GPJA 4I9HA 2Y1GA 1X0XA 1I3LA 4W4TA 4WCFA 4OYRA 4CUJA 2O3QA 3AFMA 3A14A 2R2GA 1VL8A 3I23A 3D4PA 4RPJA 3SEFA 1D1SA 2I3GA 1ZXBA 2XPCA 4JJFA 1P1RA 2AW5A 3KEOA 3W4JA 4CM7A 1UP7A 3E9MA 1EVYA 1UUFA 2PZLA 4LRTB 1MG0A 4QXMA 4E2WA 1F0YA 3VZQA 2BI8A 2QRLA 1TT7A 4YJHB 1KVQA 3H9UA 1KIFA 5AXDA 1GYQA 3I52A 5GY7A 2NV6A 4QQRA 1HDZA 4YCAA 4GGPA 1KY4A 1ENZA 3KOUA 3RC2A 4ITUA 5HTOA 3MCVA 1A4IA 3AY3A 1DC6A 3ZV5A 2JD2A 1J6UA 2B5VA 4CLRB 2A92A 4NR0A 2JD0A 4XGIA 2RIRA 2X23A 4Q3AA 3GEMA 1SC6A 3C3XA 5IN4A 4E31A 1F17A 2NU8A 2VWQA 3RUDA 1V35A 2B69A 1C1XB 4FCCA 3GDFA 1JU9A 1MC4A 3M2TA 2NU7A 1YO6A 5HWSA 2BKAA 3DB2A 1QG6A 2C5AA 4Y6RA 1NM5A 4D45A 2BGLA 1GQQA 1U4SA 2DVMA 5G0UA 2JFGA 3SC6A 5IDWA 3WG9A 1R15A 1D1TA 2VYVD 5IF3A 4J7XA 4CMEA 5LCXA 4Z9XA 3LU1A 2DQ4A 4NJMB 2ZB7A 4NK5A 3ZWAA 2FZWA 1V0JA 1JAXA 3GNTA 1AXGA 3WTCA 3WYBA 1DFHA 4KQWA 4XDYA 2Q2WA 2YW9A 3PLNA 5G4KA 1B15A 1BXGB 1EE2A 3I9NA 4LVCA 3RUEA 4AJ1A 1H2HA 3HUDA 4E5PA 4WGGA 1WWKA 3WGTA 3UKOA 1DIAA 2VHVA 5TIIA 5ER9A 5CEJA 5L7YA 1TLTA 2WDZA 4BO5A 3C7DB 1LI4A 3AI2A 1H9BA 1HZZA 2PGDA 3JQEA 4NIMA 4IBOA 3H4VA 1PJCA 2YV3A 2POQX 3I9JA 3KSZO 3ABIA 2ZYGA 4FGSA 1M75A 1RPNA 3H9EO 3KBOA 1NQTA 3P19A 3VH1A 4YQZA 1S7CA 3P5SA 1UR5A 3IAHA 3ICCA 3S8MA 1ONOA 4ESOA 3BYZA 4I9UA 2W90A 4MDHA 3BHJA 1I5RA 3T7CA 5COAA 1L7DA 4K26A 1PZGA 2IE0A 2NVUB 2P9GA 4BNNA 2H1SA 3C7CB 2WYUA 1YE3A 2BF7A 3WBBA 4NK4A 5IJZA 4DPLA 2HK8A 4WNIA 2EJWA 3WIDA 1NPTO 4IDEA 1FDVA 4NFYA 2XOXA 4CM3A 2HMWA 4I08A 3PI7A 4E2XA 2C2YA 1YB5A 3BIOA 3M6IA 2C54A 4NPCA 1NBOA 2O3JA 3BMQB 3ETDA 2YV1A 3ANNA 5EERA 1PGPA 4EUFA 1ZUD1 4DIOA 3LLSA 1Q0LA 1DAPA 1Y8RB 4DQXA 1LLQA 5KJEA 4YJGA 4EJ0A 4CMAA 2IEBA 4WE3A 3GVIA 2C2XA 1PX0A 4YJHA 1Q2XA 4R3NA 3IP3A 3TZKA 3BHIA 5G0WA 3ZU3A 2B4TO 3A06A 1LSOA 1LBEA 2YYYA 3U5TA 1WP4A 2EERA 2WD7A 4E32A 1LQTA 2W8ZA 3H9JA 1DLIA 4MVJG 1ZSYA 2Y68A 1JWAB 4MVJM 1D8AA 5LC1A 4ND1A 4S3MA 3RUAA 4O59O 3TZ6A 1QRRA 4MVJP 4BNIA 3VZRA 2YJZA 5H81A 2I6TA 4X54A 4CLRA 3PPIA 3GY0A 4NMHA 3PHGA 2XXBA 1VPDA 1Y8RA 4W9NA 1VM6A 2Q1SA 4BNHA 1GQ2A 2Q4EA 1PL6A 3WNVA 1I0ZA 5KVCA 3AWDA 1XKQA 2G5CA 3H3FA 5JLAA 2AQHA 3QW2A 1NQOA 5B4VA 1U3UA 5JDIC 2UUOA 3BHMA 3PYXA 4CR6A 1JW9B 4MVJD 1AN9A 4FFNA 2C07A 3BA1A 3OQ1A 5T57A 3VDQA 1KS9A 4BGVA 1H6AA 1H0KA 3NRCA 4BGIA 4OQZA 1WDMA 4DLBA 4JLWA 1PQUA 4B3JA 4EEZA 4KOAA 3U0BA 2HK7A 5EQFA 3CKYA 1U2GA 3RFVA 2QRKA 1SO8A 1HL3A 1GAEO 1VSUA 1P77A 2DBQA 3JQ9C 1E1MA 4UULA 3PWKA 3QSGA 5A9RA 5JW6A 1UDBA 1ZFNA 3H8VA 3GN2A 2WYVA 1MLDA 3DHYA 4XWYA 3DZHA 2PLAA 2G76A 3NT5A 4GMFA 4PFJA 3DAGA 5TQVA 1HDGO 4OKNA 3VZPA 4CUZA 4W9NC 1PGJA 1P74A 2Q2QA 5A03A 4Y8VA 5G0TA 1YL6A 4GL4A 4XYBA 5I7VA 5JAQA 4I1IA 1QYCA 2EJVA 4RZHA 2NVUA 3WX0A 5B12A 4AJIA 5A05A 4MP3A 4AFNA 3DBHA 4JN6B 1EE9A 1Z7BA 3P2OA 2EWMA 3E48A 3F4LA 1TEHA 3QLJA 3T4XA 4CL3A 4EZBA 4JBIA 5JYEA 1E92A 2B0JA 4U7WA 5DCYA 4YACA 1I8TA 3MOIA 2I67A 1Z6ZA 5TT1A 2VTEA 1HDXA 2WJPA 3MWDB 4E4YA 1IOLA 2I66A 3JSAA 3PIDA 4YB8A 4J7CA 5CEFA 1MXFA 2PWZA 4CMBA 2EG9A 1G0NA 2V65A 3H5RA 3I4CA 4H3VA 4EDFA 1XYGA 4CJXA 5KTKA 2VT3A 2JAPA 2GD1O 2PH5A 4YJFA 4P8RA 4UVDA 4CMGA 1E3WB 3IUSA 1LQUA 4N5NA 4CM8A 3OHSX 3I83A 1P0CA 4OXKA 2I76A 4ILKA 3TFQA 1T1RA 4JX8A 3GZNA 4G65A 3I4FA 4XIYA 5LDHA 1GEEA 1UP6A 1Y5RA 3HDQA 3CXRA 4ZQBA 2Y0DA 4WEQA 2NTNA 5DBIA 5AVOA 3H2ZA 1ARZA 3EY4A 3GNSA 1LDEA 1JVSA 3LT2A 7MDHA 2ZJ1A 2QQ5A 3RCBA 4AVYA 3MOGA 1V9LA 2DPGA 2DKNA 3VC7A 4LSWA 3S2FA 3WQRA 3FN4A 1UXKA 3VH2A 4CM4B 3UHAA 3LLVA 3V2HA 1YDWA 1I36A 3JCZA 3ZU5A 4TRMA 1N2SA 4MKZA 1EVJA 1SBYA 3OF2A 3BMCA 4TKMA 1NR7A 4BOYA 1ZMTA 4BO3A 1KC3A 4G2NA 4ZJUA 1ORRA 1ZEJA 4GLLA 1BMDA 1GZ6A 3DBLA 1G6KA 5AXAA 4C4OA 1HDOA 3ASVA 1GQYA 3ZHBA 1YQDA 1JWBB 2Q4BA 3LC7O 5T64A 2FOIA 2VUTA 3AUTA 1FXSA 3QV1A 3WFJA 1LRLA 4YYZA 4RLHA 3W8DA 2NLOA 3ZW8A 3KB6A 1NHWA 1UJMA 3IL2A 1BHSA 4M89A 3JYQA 3PFFA 4XQ9A 1OZAA 4JP2A 5B4UA 3CUKA 1VL0A 4M54A 3GVHA 3OA0A 1U5CA 4XYLA 1B14A 4RZIA 1LLUA 3WGHA 3AM3A 3TFOA 2DLDA 2AQKA 4BO4A 1O95A 1YGYA 3IS3A 3OQBA 4D0SA 2Q2VA 4FFPA 4IS3A 5HRUA 1V6AA 1GCOA 2P2SA 4C7KA 1W6UA 1FF9A 4CMIB 2NNLD 4WLUA 4BVAA 4GSLA 5IXSA 4L76A 3H9QA 3PDUA 4R01A 1DBVO 1ZO8A 2GO1A 5HS6A 2C0CA 2QHXA 3FBTA 2CDCA 1DRUA 5CP8A 1U3VA 2Z95A 4OO3A 4DBZA 1P44A 2W4QA 3GDGA 3VVBA 2X0RA 3KYBA 4I5FA 2HO5A 3JD1A 4BKUA 1E7QA 1PJTA 4GKBA 4NDNE 4I9NA 5CG2A 2NQ8A 3T4EA 2W98A 4NU6A 4YAJA 2VZ9A 4CV2A 1K6IA 1MUUA 3WFIA 4TRRA 3DBVO 1I2CA 3E6AA 2IYOA 4I8XA 2ZYAA 4GGOA 4NZ9A 2UV8A 3IUPA 3RBZA 3VPSA 4IJWA 3UF0A 1DC4A 3O8QB 4PVDA 4W7IA 5CPFA 3DTYA 3DZIA 4UEOA 4TMFA 4YVFA 2FY8A 3DOCA 3HFSA 5G0SA 3FNHA 3JQAB 4MP6A 4XD2A 3IKTA 3ZN2A 2RH8A 4LMPA 4DRYA 1Q1NA 2PKQP 5JSFA 1YB1A 2B5WA 3K2BA 1BRMA 1DFGA 3V2GA 1N7HA 4TVOA 4ALIA 4QX6A 2ZJ0A 4YAGA 3BAZA 1X15A 1KEWA 2AMFA 4BGUA 2C59A 4YTEA 4D7AA 3UOGA 5IAAA 2IXAA 2HK9A 5FEUA 4JIGA 5JAMA 3JQBA 3FNFA 4NQZA 2FR0A 3WQQA 1H2BA 4WNCA 3QE3A 1EFKA 1F12A 1KC1A 1L7EA 2EXXA 2VTDA 3LK7A 3MWEB 1YBVA 5IDYA 3DZFA 3FWZA 1GUZA 4DPKA 3RBXA 2WD7B 4BO7A 4EUHA 1R4NA 3ANMA 3N74A 5COQA 1F8GA 2FHSA 2BFMA 4MIOA 1T4BA 2LDXA 4OOEA 2ZQYA 3WDSA 3HSKA 4F46A 1A5ZA 4CM4A 3ZNNA 5JAZA 1I3NA 3INGA 1D3AA 2ZK7A 5JCXA 3SXPA 1EK6A 4D0RA 4A0SA 3E5MA 3UVEA 4AJLA 4MP8A 1BXZA 2X0NA 4J2OA 2GNAA 5TC4A 3K9QO 4U8GA 4K28A 1WZEA 1NPDA 1JKIA 5L3ZA 5I9NA 1ZZEA 3G0OA 4BNXA 3PHIA 3JQCA 3EK2A 2ZTVA 2NQTA 3BMOA 3DO5A 5JO9A 4DL9A 3LC1O 4PLZA 5KKCA 4IGFA 3DZJA 1PGOA 1QYVA 3R1IA 2HJSA 4PG4A 1XG5A 1ENYA 1K3TA 4GLOA 4CMKA 1PQPA 5L9AA 2WD8A 1B0AA 1HLDA 2PD4A 2X9VA 3HHPA 3F3SA 4IMPA 3ZW9A 2FWMX 5IXYA 4F45A 4A2CA 2G0TA 2PA3A 4GVXA 1M2WA 3KLMX 3QWHA 1EDZA 4ZA2A 3DXFA 2Z1MA 4MIYA 3JQ7A 3GPDG 2H6EA 4Z9YA 3E9NA 3RQSA 2FZEA 4EJMA 3QVTA 1P3DA 1VSVA 3B70A 3DBHB 3MZ0A 5H82A 4YJFB 2PGLA 3IJPA 3G1UA 1C1XA 1PWZA 2TMGA 1R16A 4RVGA 1P1FA 3QVOA 3UN1A 3PRJA 4KDFA 3GRPA 5IDQA 1SCUA 1KBZA 2X4GA 4KP7A 1GTMA 3L9WA 3WGGA 4EEXA 4MINA 2DM6A 3C24A 3C1AA 4J91A 1CF2O 1QYXA 3OICA 1Q7BA 2DBRA 1PGQA 4YRBA 3ZWBA 3K30A 4DYDA 1O8CA 4J1NA 4CM9D 3PHJA 3ZWNA 2EHDA 2R00C 4K9DA 2O2SA 3FRJA 2CSUA 5COBA 1M66A 1WZIA 4FSHA 1GV0A 2XAAA 4D3FA 3RIHA 2DTEA 5BSEA 3WWYA 1HYGA 4RORA 3IIEA 5T8KC 3B1KA 3R3SA 5A06A 4A73A 2Q1WA 1XLTA 4GPD1 3VPGA 3ZV6A 1EQ2A 2BI7A 1EDOA 3CMMA 3VHRA 1BGVA 2G82A 2J8ZA 3QVXA 3RI3A 2NACA 1VRWA 3SVTA 4RV9A 3C7AA 4XR4A 3DAPA 2X6TA 4KUHA 4NBRA 3UCXA 4J1QA 2Y1CA 1G1AA 4CLOA 2CFCA 1EVIA 4M55A 3QJ5A 4GVLA 4JBHA 3M2PA 1VJ1A 4TQGA 1FDUA 1WPQA 4O6VA 1MC5A 1O0SA 2YV2A 2J3IA 4R51A 1D4FA 2GN4A 1EK5A 2WWRA 4UVEA 4TWRA 1NFFA 5U4QA 3DBLB 5JY1A 1UAGA 3NEPX 5DP1A 3U4HA 1QV6A 3DFUA 3ROMA 4B4OA 1TT5B 4URFA 4BNGA 1CWUA 1RM5A 3MEQA 3OBBA 1I2ZA 1ZK1A 1B8UA 3LDHA 4J4HA 4DA9A 4B4WA 4E13A 3GK3A 1PR9A 5B4TA 3OP4A 1HE4A 1V8BA 3BTVA 4Q9NA 3R6DA 4L4SA 2NTJA 2GZ3A 1R4MA 5F1OA 4IIVA 5F1PA 3OJFA 3W8EA 4A27A 1KERA 5HBRA 3D5QA 4YWJA 4BNYA 3ZU2A 1XHLA 1NPYA 2JCXA 3RSHA 3ZU4A 4HUJA 4NBUA 3JQGA 5A5EA 3I5MA 3GGOA 1GEGA 4QSMA 3KETA 1UXJA 1T2CA 2B4QA 3LT1A 3OJOA 4GX2A 4OKIA 3U4IA 4WKGA 3Q1LA 4CLXA 5ADHA 3BTSA 1WXDA 2ZQZA 2QYTA 1WMBA 1NVTA 2G17A 1IL0A 1T1SA 3RJ5A 5J23A 3VPXA 1G0OA 4RQUA 5JY6A 5A9TA 4LCEA 1N5DA 2OBYA 2O50A 2GSDA 4XIJA 3PFWO 3WSVA 3PWZA 2CF5A 1KVTA 2CVOA 1B16A 3GEGA 3WGIA 3LT0A 4PG8A 3ICPA 3HDJA 4RCVA 2O3SA 2EP7A 1Z74A 4D3DA 4JQCA 1UZLA 2CZCA 1R4MB 4R69A 1O6ZA 3ROPA 3U49A 2EKPA 3GNQA 2PGJA 4N7RA 2HUNA 3JD4A 1P1JA 3S1LA 3EMKA 5BQFA 3QRWA 4BIIA 4HY3A 2HLPA 1NWCA 1WMAA 1VE9A 3FTNA 1PJ4A 3NKLA 3O38A 4QO8A 4XJTA 2JHFA 3ASUA 5JDCA 3HE3A 3LSYA 4HXYA 4P22A 3UAGA 4D43A 1N7GA 3ENNA 1PS9A 4Y9DA 1DO8A 3A1NA 5BSFA 4FQ8A 3GPIA 4Z0HO 1BW9B 1X1EA 3VTZA 4DWVA 4U6SA 3WB9A 1ZSNA 1MXHA 4B4VA 4L0QA 1E3IA 3KLPX 3ENKA 3T7EA 3GHHA 3F6YA 2X5KO 1AUPA 1B26A 4UUNA 1K2WA 5DULA 5JXWA 1BSVA 2VYNA 2ZTLA 3CZMA 4CLOB 5L51A 4BL5A 1B3BA 2FR8A 1ISHA 3VH4A 2HJRA 3EVTA 3ONDA 3AI3A 4R68A 2HMTA 4A5OA 3UH1A 4AJEA 1LUAA 4L74A 5JE8A 4FGWA 4CV1A 3ZHXA 3ZNOA 4CMCA 2CDAA 5DDIP 2VQ3A 2VNSA 1PS0A 2PNFA 4FDAA 4BB5A 2NM0A 2JFFA 4F6CA 3JQGB 1N1GA 2P9EA 3DC2A 3TF5A 4ZD6A 5TT0A 3GT0A 3IP1A 2Y66A 1I24A 4KDEA 3O9ZA 1Q7GA 1X13A 3RC9A 4OSPA 2C5EA 1LA2A 4XZ3A 4BKRA 5JDIA 1TVEA 5CEEA 3NGLA 4IJKA 3SJ7A 3F5QA 2X0JA 4XEHA 4P38A 1YWGO 3IC5A 1SAYA 2HMUA 3DOOA 3W6ZA 3WJ7A 2IODA 3NAQA 2I99A 5EN4A 3PHLA 3WYEA 2X1HA 2NADA 2OP1A 1NAHA 1W73A 2PD3A 2QX7A 3WGYA 2WEKA 2DTDA 1DSSG 2YQ4A 5ICMA 5I7SA 3RFXA 4IGEA 4FFOA 1DIHA 2DUWA 3EC7A 3KYCA 4FN4A 2A9FA 4IQGA 3OQ6A 3A9WA 2D5AA 2Z5LA 4IDDA 4ZQHA 1X7GA 2OZPA 4FS3A 4UAGA 1DDOA 3F1KA 1XCBA 4PRKA 4TZKA 3WJAA 1PSDA 3AU9A 2CUKA 2ZIZA 1XR3A 2JFHA 3GA0A 2P91A 4OMUA 4PLCA 1FDWA 2IYPA 3E82A 2CD9A 4II3A 1LEHA 5ITVA 4IDAA 4NBWA 5HA5A
chains in the Genus database with same CATH superfamily
3KCQA 5U4XA 4PAMA 1NLZA 1H65A 2X7HA 1HTBA 1NRWA 4RD4A 1A71A 4HRAA 1KDYA 2RBGA 3RSFA 1K4KA 1AZLA 4DQLA 1PR3A 1GNVA 1GXSA 4ZOQI 1H5QA 3DGEC 3IIMA 1HOTA 4ER0A 2VJNA 2BCGY 4J43A 3QPVA 3JASB 4NFLA 1I2BA 4UVGA 5ALOA 4EW6A 3PLAE 4NPAA 4G0MA 3IDOA 4RK1A 1Z4MA 1IDOA 1HE5A 2XHZA 4UBKA 1VI5A 5FOQA 2GFHA 4G56A 2VK1A 3S2IA 5K0SA 1J0DA 1F9AA 1GQSA 2B61A 3EA0A 3O5AA 4NMLA 1YZUA 4FGKA 1P73A 2RHRA 3NJ8A 3V7FA 2IUTA 4ND5A 2C4WA 1IZ0A 3QFRA 5H02A 4KSCA 2WRZA 1DTWB 1XJ5A 4M8LA 2YFQA 3F90A 1CUEA 4ISCA 1SZPA 4JVOA 5EXSA 3HA7A 4RJIA 5CCEA 2QRJA 2IH4A 2ISQA 4KH1A 1IK4A 5KCZA 1RWBA 1VE5A 1E3SA 2R5FA 4JP8A 1PG2A 1EU1A 5GZ1A 3HWX1 4NENB 2XA1A 1SU6A 2Q9BA 5C5IA 4INJA 3T6KA 4D9FA 2VAXA 1MO3A 1XCPA 3JYPA 3NYWA 2CCGA 2FEOA 3O26A 2ONJA 4X61A 2CFOA 5BSMA 3VKFA 1DEXA 2ODPA 2J3MA 1SK9A 3ZKAA 2Y4OA 2O8BA 3JQDA 5KJ1A 2HCTA 5FBWB 2XW6A 1N2XA 3TWOA 1KI7A 3H05A 4BFUA 3GT7A 3V1MA 1EM6A 3PI6A 1UQRA 1A9QA 5DK4A 3TAUA 1EUQA 3I0MA 3EDYA 4AWXA 4R1QA 4DCSA 2V7QA 4KW7A 5CAEA 4Q3DA 3SF0A 1EUDA 2QTAA 3FKJA 1CRWG 4JUCA 4C7JA 3FOFC 4IRXA 2QN2A 1U9CA 3HLYA 1F5SA 1UPCA 5DRYA 1EVEA 1W49A 3W4IA 4C4AA 3O3CA 4IV0A 4EK9A 4YUAA 1UH5A 5BN1A 1DZ3A 1QK4A 3ZWPA 2A2ZA 1XZLA 1PEKE 3EEBA 3K9HA 4G5FA 4QXRA 4QTUB 1P5FA 3BJMA 2FYTA 2Y0EA 3LHDA 4RZ2A 2VSFA 3TQFA 1NJ5A 3X43A 1J90A 4L4UA 1KZ4A 4MJ3A 5K51A 2W5UA 3MRSA 2VJCA 3FCOA 3AEKB 3QUSA 4TL6A 3RKRA 3E61A 3BRWD 4GM0A 4UU1A 2HL6A 1B7GO 2KSQA 2O59A 4CCWA 1R27A 2D8AA 3ZIDA 3STYA 4KBYA 4FWBA 5FI3A 3UT5A 3LCJA 5AKGA 4WESB 2Y1KA 4KK3A 2VEDA 2D4AA 1GNLA 4RH1A 2XQFA 2BBWA 2BR4A 1UPXA 1RM0A 3G2LA 4BO9A 4ZT2A 3L7YA 3NBXX 4M1OA 2E7ZA 2R6JA 3KQHA 3Q87B 2SHKA 4HX9A 4OQPA 3GLFE 1J07A 1J7JA 1SC3A 1TCAA 1O08A 2GAOA 1L4LA 5E0KB 1L5RA 3AY7A 1OASA 1NJ8A 1E9BA 3BK1A 4IIEA 1C9KA 2FJ0A 2YFHA 3PHHA 4AZVA 1P60A 1SKUA 1E5XA 2J5KA 1TTTA 3RJ9A 3WMWA 4POAA 4BO8A 2HDHA 2AHRA 4A23A 4QICA 3X1MA 4PZAA 2IKSA 5I8WA 4P3YA 1RT9A 4R05A 1BH6A 2HU2A 1Q83A 4L6AA 5AHXA 4B76A 3O8RA 1YGPA 2XTAA 1UIRA 4HAVA 4AXBA 2WV7A 5EFZA 4OM8A 4XWKA 1XSEA 3Q0EA 1SUDA 3KXLA 1H5UA 4I6GA 2C83A 1RKUA 5CR9A 2OORA 3DL0A 1G1MA 1FP6A 1ORTA 3O03A 4I99A 4ZZ2A 5IZ4A 1B2LA 4X91A 5A5FA 3GDHA 1PZEA 3PUVA 5BW4A 3GJRA 2P2YA 1QFJA 5E6SA 3ZXUB 3MSXA 1GU0A 1WOMA 2G1JA 2EEPA 2ZE7A 2D00A 3U7JA 4ZCRA 3QNWA 4NJOA 4JI6B 4L4RA 4L9RA 2VZ8A 3FETA 2VHXA 3G5TA 4AQYB 2GJ4A 5IYZB 2QY6A 3R0IA 2FZVA 2OFPA 2XB4A 1U6KA 1X1TA 3S70A 1X7HA 4UAJA 4KAAA 2F3PA 1R0YA 3H1BA 1DAOA 2VHCA 3DMTA 4CRWB 4D0LB 2O2CA 4ID3A 3KZCA 5EJ7A 3K8YA 2WAYA 2PBRA 4L4XA 4NYIQ 3OMXA 1US8B 2CBGA 2WZBA 4QOJA 1RI2A 1ZBQA 2OYSA 1A8QA 2BV3A 4IOKA 4OSEA 5CVDA 1XTJA 4U6QA 4AROA 3WSTA 1A8SA 4J4BA 2HWXA 3VHQA 2NSYA 2GA8A 3LJKA 4R5HA 5CDSA 2XF8A 4H7PA 4NONA 2MMGA 4HS4A 2GXQA 2Y93A 1J8YF 4BU1A 1P7ZA 1XWFA 1YACA 2XWQA 3HDTA 3I32A 3B8EA 2QM7A 3EJWA 2VUHB 5JS1A 5DM60 3EWIA 1H8ED 1GD1O 1MVOA 2RKOA 4CM8B 3ZQJA 5C7LO 1Z2DA 3KXKA 3WB1A 1Y8QB 1C3OB 1SKMA 2GK4A 4Y7DA 3BIXA 1ZCJA 3GLGA 4L3OA 1I9GA 4PG6A 4RDHA 1C0IA 5EIBD 2BKUA 2F2TA 3P0HA 4C1NA 3CGWA 5DASA 4DIMA 2PZMA 2JW5A 1WL8A 1FFYA 3Q7PA 3TCKA 4F85A 4MWEA 2WYOA 1S3IA 3HQ4O 3Q7SA 4MB6A 5SYNA 3WOHA 4AY6A 3B89A 3ILHA 3NV7A 1UAYA 2OBFA 4Q4HA 3ST7A 4B3DA 4MW5A 3K1YA 1U3TA 4J4TA 3NXKA 3ZZ1A 1CZKA 1QVWA 4X7BA 3LF2A 4E33A 1LDYA 1LSJA 3O4GA 3HP1A 2X13A 1CHNA 3F5MA 4WOKA 4JBGA 3ROXA 4BTLA 3QU9A 2EF1A 3HRKA 3FBGA 3T1VA 2NYUA 1HF3A 3JQQA 1UJ2A 2RI1A 2G1KA 1CY6A 3I8SA 3GMDA 4TMXA 1WUYA 3TLCA 1WETA 3LX8A 1FPQA 2O52A 3L4EA 4HWKA 5DXJA 1KMHB 5TPWB 5JIBA 1WXEA 3KUKA 1DQYA 4LDQA 2YASA 1A72A 1OA1A 2FMTA 3QU7A 1IQ0A 2IHKA 2IYZA 2XIJA 3OEYA 3O4HA 4GC9A 5ESRA 3VI4B 4AZ0A 3UPUA 4N8DA 4OHXA 2HJHA 5EMJA 4QXPA 4A8JC 1HRDA 1RWVA 2QRHA 4I9GA 5DT9A 3UK6A 1REQB 4HUTA 3VX4A 5BWNA 5CA1F 1E7YA 1I6KA 4I8DA 4ZOBA 3PJFA 3K9NA 2VHEA 2AOTB 3JVVA 4ZWNA 4CFSA 1TM2A 3MJFA 1EPUA 2BFPA 1T8YA 1RPTA 3A1WA 1UODA 2EDAA 5JALA 1G3QA 1W93A 3KP1A 3C5WP 4PN3A 1T3GA 4IOMA 4EUKA 1U1DA 2IOYA 5G0VA 2DQYA 2QYOA 2I5PO 1JL3A 2XXJA 4DZZA 2H4WA 3GROA 3V7UA 1YOVB 5C46F 1BA3A 2NZ8A 5FTLA 2ZSDA 2F3QA 2GEBA 2JC3A 2XTMA 3K9WA 1Y34E 2VDLB 4MV8A 5TEWA 3BKWA 1XEWX 2H9IA 2OHVA 4OV6B 2XZDA 4FVTA 5JMOA 4I1UA 4NAVA 3IE1A 2E49A 4XI9A 4B09A 3LYLA 2UAGA 3JD0A 1OGYA 3LXXA 2FMUA 4G9EA 2YY5A 2AG5A 5I7AA 3WMXA 5KTNA 6ADHA 4A6DA 1GL3A 1TJ5A 1WB9A 4JLSA 1DCKA 5KTOA 1ODKA 2YHUA 2OV1A 8LDHA 4S12A 2V98A 5AVKA 3ILSA 4QYXA 1VIYA 1ZEMA 2WWHA 4P4GA 4UQLA 4P3PA 3IP7A 1DQPA 1MOSA 2ZRBA 1E9AA 3GLQA 1WV1A 2BTQA 4P3OA 4R41A 2GKOA 1QO9A 3DKRA 3MGAA 2V7EA 4JI1B 5AUPB 1F4PA 2GYUA 4OHCA 4EPVA 3FBWA 1PUIA 3WK8A 2X4DA 1COWA 3PP8A 2A67A 4R2MA 1NTRA 2GBIA 3AMVA 4V0OA 4NZZA 2ZGVA 1Q7TA 5DMHA 3GFFA 5C51B 2ZB8A 1YFKA 4GR5A 4MKGA 4DY6A 5KWIA 2Q46A 1E8DA 1V5IA 1W9MA 2VPZA 1M6HA 2HMSA 2WAXA 2ODTX 4H9GA 4B47A 2D1SA 1UBHS 3DQQA 4B73A 1DPFA 3C3YA 1Z3IX 1X7YB 3KXDA 1GRNA 4QYSA 5L4NA 1UK8A 2CNDA 5GV8A 3PJGA 5GTDA 4LF9B 3NM4A 1L1EA 1JILA 3U09A 5L40A 3LGAA 3NHAA 1YS4A 3OX1A 4RENA 3FDJA 4OJTA 2YHIA 2YFYA 2HF2A 2C29D 2GTHA 2YWXA 4QL3A 3TTWA 4ZMRA 1WNTA 4N6OA 3BDVA 1KVUA 1TQ8A 1Z39A 1KXZA 1NXWA 1QE5A 2DY1A 2BEKA 1H3NA 2NU6A 3DBIA 3KVNA 5REQA 4JZYA 1IM2A 4PSKA 1GG5A 3GGPA 3EBLA 4UE6A 5DYTA 4E6PA 5F2NA 5KVVA 2IS1A 3P9ZA 5K7SA 3AUAA 3UCFA 5SZJA 4N49A 3RS9A 1YU6A 4M49A 3WRVA 4BNKA 3DT6A 2ZROA 2RDMA 4OGLA 1V25A 5KNLA 4HH1A 3FHTA 3V42A 1DUIA 1EDBA 1W9HA 1WPRA 3K32A 4M9QA 2HN9A 4L51A 3OM0A 1EBUA 1QV7A 1KZHA 3ESZA 1KHHA 3AF0A 1A9XA 2RGNA 3GVXA 3PPYA 1KR5A 4RZ3A 3K5PA 1PUJA 1Z2OX 4KQIA 5AW8A 2JLZA 2VT6A 5F5NA 1XMQB 2IYLD 5G41A 2EZTA 3OZVA 4O8ZA 3DPSA 1L7XA 1BWSA 1O89A 4HZUB 4IIUA 2QQ0A 4TLCA 2ID8A 2XUFA 3MJEA 2PSHA 4CM5A 3KQTA 1L3BA 2B7LA 4OHPA 4ZMBA 5I4KA 2WHPA 3O3OB 3SSNA 3VR4D 5K2MA 5MF6A 1JJFA 2GZDA 3MWYW 4DT1A 1JDBB 4FZJA 5JCJA 2L17A 4AG3A 1H0SA 1XNRB 3DUFA 4DV5B 2FMXA 3TSOA 2BFBA 2YWHA 2IOFK 3QU5A 4W5WA 3GFBA 5ILOA 2FCRA 3RVRA 3PA6A 4PPQA 1S7GA 2PFGA 3F8WA 3MB8A 5A6SB 5I7OA 3JRNA 1ECPA 1DAFA 3WLEA 3BMNA 1RAFA 1JHAA 5A5VA 4L5CA 2PLRA 1SUAA 2VNJA 5THKA 5WRFA 1U3WA 1S5PA 4AYWA 1HEIA 1Q0HA 2E55A 2PMKA 4W5JA 1GNRA 4Y30A 5D2CA 4G4IA 1IQRA 1JHQA 4JX9A 3W77A 1X7WB 3OCCA 2CNKA 3G79A 5EIOA 2PMFA 4YPFA 3F5DA 1QSGA 1XDGA 1HBJA 1PSWA 4JR0A 3R74A 3A25A 3STWA 4JXZA 1SHUX 1VJTA 4FYVA 5EUQB 3THXA 3QWBA 1GA1A 1KS2A 1VCMA 3Q10A 4GD3Q 4KYVA 1IG0A 4MX8A 4V2UA 5E3JA 1TIKA 2RKBA 1B76A 5I9MA 2D3WA 4TN5A 3OF5A 2JRCA 4HYEA 5EE0A 1Y5MA 3E22B 1XZMA 2YHIB 5F4BA 1K7EB 5ICFA 5AM2A 5BMOA 5DEOA 2R65A 3M3DA 1UPTA 1IPEA 3QWFA 4X8OA 2XMBA 3UJDA 4P1ZA 1R6DA 3VR2D 4JNKA 1E62A 4J75A 2DCUA 2HCFA 1VE7A 4RKRA 5JJLA 2W83A 2QZ4A 2ZS7A 3V9PA 2CK3A 4DUGA 1GN8A 4C7OB 3E4DA 2QTTA 2PX2A 4PIPA 4ZAZA 3WRYC 4BNZA 5HZGA 4LNAA 1SMKA 4IY1A 4UASA 3GBSA 4QPDA 1ZJ6A 3PPVA 1D2RA 2IZ1A 2PYDA 3F9IA 5EJ6A 1VHTA 3DVQX 5SYMA 1X94A 3HWRA 3VR2A 2RAPA 3VR5A 5CPBA 3N8KA 3LFUA 5LQDA 2UYOA 2B1IA 1A9YA 5IHPA 2NUAB 2FPRA 3OCWA 4LDPA 4WASA 1AK9A 4H3KB 1RYEA 3B3AA 1OA0A 4AUMA 2PXHA 5F2EA 2F3RA 1NVWQ 1R6TA 3BFJA 3DFKA 2GDJA 4EYOA 3E27A 4TZTA 4RPLA 3T1YB 5ICEA 1FW8A 1LB1B 2PTHA 4OFBA 1G3IA 5K3SA 4BHTA 2J3LA 1K2VN 3GT4A 2PKQO 3U9LA 3USES 2AEMA 4JI5B 2IFTA 1LU9A 3HVKA 4W1PA 4TS1A 1JA1A 1KO7A 4DDWA 2EQBA 4GF5A 4Q9HA 5DTJA 4BAZA 1RYFA 3WWCA 1LRJA 5AI4A 1ORVA 4M3NA 2R3SA 2E6UX 2OFWA 3BTUA 5E2BA 4IXTA 4ZVQA 4BJ3A 1XZAA 2FDRA 2ZDGA 2CXHA 2JD1A 4TSFA 4GI2A 5EVJA 3V1UA 1CUAA 2GUGA 1JMKC 3HR8A 4C21A 4ZCTA 3O84A 1XO1A 1WB4A 3GDOA 5IBQA 2CMHA 1AO3A 4IFEA 4JC8A 4ND8B 1QVVA 2PA0A 4Q4AB 4P3KA 1DRKA 5FNVA 4E5KA 1YVRA 2CLOB 1C9DB 3Q7QA 4U2EA 1XPRA 2AMVA 2ZITA 4FS8A 3M82A 4H35A 4LXGA 3SDSA 4UDYX 1QHHB 1S4MA 4WECA 4AZ0B 4BQEA 4M1YA 4NSNA 5MGBA 1V45E 1FXWA 2GBGA 5H70A 3TOZA 2B1QA 3G0BA 5A4AA 5AKLA 4FZRA 1UJNA 3JRWA 3IMCA 4AP5A 4M7WA 2DB3A 4Z7JA 5SZIA 1AE1A 4DYHA 1MB3A 2JL1A 5GZ6A 4RSRA 1U94A 4PSVA 1J9ZA 4DIKA 4TSKA 2AFRA 5A1TA 1N7JA 3DVLA 5DGIA 4Q1BA 4PYRA 3G3EA 4XSGA 5MDHA 2PSDA 4FNMA 1CX9B 1BKYA 3GW8A 3A4VA 3KOXA 4EO4A 4AG5A 2GPJA 2PV0A 2QG4A 4HGRA 4J07A 3Q2IA 1FP2A 4EA8A 3FWPA 4JLAA 3IPCA 4MVJF 4V3BA 3SIRA 2C8KA 2OXEA 1SB8A 3CLSD 3MINA 3OM8A 3R3VA 4FGLA 4K8OA 4C0KA 2NUPA 3VYSB 1RZVA 5JZSA 3ELBA 4FT4A 4OI2A 3HCAA 5T6BA 3OKAA 1BKDR 1OFTA 4HR7A 2EX0A 3TDKA 1EFLA 1GHTA 3C15C 3GFRA 5U9CA 2V4UA 4M0FA 3HCBA 2VOJA 4YBZA 3TD9A 4P58A 4BMNA 3HWSA 1ZVMA 1YIAA 1KMQA 1JHOA 1P4AA 3IOMA 1OSNA 3W5DA 1TKBA 5EIWA 3RU9A 2GHTA 4Y0AA 3T1QA 4B3XA 1ZK3A 3UMSA 3VVCA 3K92A 4MXDA 2KQUA 3IEIA 4X5OA 1U63A 2DFTA 4J9UE 3RRFA 3KZVA 4MMXB 1X1BA 2I2FA 2M6KA 3SC4A 4EKDA 5KQLA 2LKDA 3HY6A 1CSEE 1WCV1 4P92A 1QF6A 9MHTA 4CEJA 4RF4A 3U44B 5KX5B 4KTVE 4MTCA 2VP9A 3VZSA 2WE7A 2FGKA 3F4BA 5ADUS 4WNAA 1L7NA 4CT0A 3VX3A 5LP6B 2QPTA 3VUFA 1EZ1A 4PG5A 2OV4A 3FCCA 3W78A 5GJBA 1VI2A 1XZCA 2WB4A 4MV7A 5BT8A 1JU3A 4LZZA 2F59A 3ZGYA 5CFPA 3SLGA 4J0FA 3LCUA 4ZOEA 4ACBA 3TG2A 4NNJA 2OA0A 1KOFA 2O57A 2UYQA 4IXWA 4E30A 5HKBA 1EHCA 3E18A 5KC8A 4P36A 2CXXA 3NWJA 4HXFB 3LCRA 4JUFA 3GA7A 4GP9A 5K45A 3OTOB 3QLUC 1DC3A 3DLCA 1NBIA 3OE1A 3AFNA 2X4LA 2D74A 4PAWA 1X80A 4PYLA 4DZTA 3VKHA 5KX5A 1U5AA 2Z8YM 4AN0A 5LVAA 1BHO1 4YP5A 1R8XA 2FQYA 2IHVA 2WFAA 4BP8A 2X42A 4MPJA 5BV1A 3L7AA 1HEUA 1CQXA 5JDCC 1FZTA 4D9KA 2Z1NA 4MCJA 3KOZA 1X14A 2QDXA 1YS2X 4F11A 1R12A 3NU1A 5DEIA 5E8JA 4ARIA 2W2TA 3KQKA 1MEEA 4F86A 1FFCA 3RS5A 1Z75A 1ZIXA 1PF7E 3EG5A 3MF4A 2OBBA 3NVAA 4LDZA 3NDIA 3ELDA 4YJ2B 1VL1A 1X77A 3T41A 5C1OA 5K6AA 3ZDCA 2JAOA 3IT1A 1Q84A 3CRNA 5J2UA 1IBMB 3ZXIA 4AQ7A 1ULTA 2WJVA 4HEJA 2GD0A 5IK2D 3RV4A 3RK4A 2DUNA 2J5QA 4KQMA 3DO6A 2EGUA 4G5YA 2WHRA 4JOQA 2YOGA 1DAEA 4XDHA 3OCYA 5CNMA 1EFCA 2P5TB 5ITWA 5GPBA 3S2EA 1FC0A 3SZUA 1XAJA 3CN7A 4C5AA 4XJVA 5BNIA 4JI7B 3JALB 2BHNA 3DZDA 4QELA 3RK1A 2B82A 4YFYA 2L0XA 5E3IA 1G64A 2D1YA 3TL3A 1KAHA 1ZI9A 1OBFO 1RYDA 3X1XA 2EV9A 3LIIA 2G80A 3Q5GA 4V24A 3HXLA 3PKJA 1PV1A 3TZQA 1PQWA 4DN6A 4Q1FA 4DXHA 1E0AA 3OFSA 3FVRA 4B7UA 3EDRA 5EI5A 4ZI3A 5HKLA 5T5QA 4O8CA 3GGSA 3I5AA 1S96A 4DM4A 1EP9A 1X8KA 1KZ7B 3OJXA 1XVIA 2F9LA 4M0EA 4YRNA 3O8QA 3L06A 1HURA 1P2VA 1PG0A 1VDZA 3PEUA 5CT8A 1H8EA 1MB4A 3VJLA 5KTSA 3F5FA 5FOTA 1E2NA 2HOQA 2A7QA 2O1EA 4JOCA 3U1VA 2H59A 3ZZMA 4F9GA 2CHQA 3I8XA 5ANRB 1AY0A 3IVMA 4XB2A 3ROGA 4DIFA 4D42A 2ILTA 4E3WA 1QK5A 2Z3VA 5DHSA 1E6UA 4K3UA 5CT4A 3VHLB 2UZ4A 1O97D 5DWQA 2C8JA 3EFOA 3IP9A 3NNNA 1SKYB 5ECDA 3ETGA 3CR7A 3RIYA 2Z6UA 4PHFA 4TKUA 3SJBA 4LS3A 3N8GA 4X20B 5AYVA 1Z8DA 4YRFA 2FW9A 1FLNA 2X8LA 4P4NA 1HKHA 1G3MA 1U9IA 3ENWA 1RYYA 4QDUA 3RYFA 2EOAA 1EHIA 2GAIA 4OPMA 2BBTA 1TE2A 3AEXA 2CJXA 3JQBC 1ZICA 4EW3A 3M0EA 1L5QA 4FWTA 2P69A 3GPCA 4KPUA 1CUDA 4HKTA 3TLAA 3OVMA 3ROKA 4KR2A 1HETA 4Q7QA 4G3XA 3TKYA 5E9WA 1EFRA 2ETVA 5CLJA 4C1BA 3NTRA 3JD3A 5B58C 1A3CA 1LNSA 5CB4A 1N2ZA 3R75A 4GX5A 4PU0A 4PZZA 3DKVA 2GLUA 1NP6A 1T9AA 3KUXA 4GOLD 3TR0A 3WL8A 1N8SA 1U1GA 1RI1A 2RHBA 1KYYA 3EXHC 2GB4A 3H5NA 3K1JA 1ZS9A 5DTQA 3DEJA 1E98A 1JXAA 4B71A 4K5QA 2RB4A 1R6UA 4WLNA 4EY7A 5GADl 3D7KA 4C76A 1H4SA 1L7AA 1KU6A 1QK3A 2Q5JA 3G2QA 4WPGA 5CYGA 2HZBA 1I01A 1TB4A 3COSA 3EPPA 3W3AA 1AB6A 1THZA 3RF7A 1IRXA 2OOSA 1U8EA 2R8YA 5BUZA 3ER8A 2PKXA 1QJ4A 4YJ2F 1NSFA 2HTFA 1SUPA 2DJ5A 3DV0B 4XVUA 1PUXA 3U4QA 3F73A 5LPNA 3SG0A 1ZJ4A 3G7NA 3JAWA 3NT2A 4J3FA 5A5DA 3UJ8A 4UTNA 2HHAA 1ZOSA 1JDTA 1HRKA 2VP6A 3B85A 1QANA 1HDIA 1FU8A 5ALNA 1BCSB 2IL1A 2VT7A 3C6YA 3D8UA 4CKEA 3OESA 3ZH9B 1BE8A 4Z6KA 5EINA 1NASA 4JH0A 1WPXA 2PZFA 3CUYA 1D5WA 4PN7A 5C7OO 2CN1A 2OBXA 4N6NA 3PD1A 2AFIA 1L5MA 4GQAA 2XZTA 4OK5A 5LA6F 3WAJA 1L4EA 3Q1KA 4DWJA 2IXTA 4CMHA 4OLHA 4BCCA 3THXB 1WVMA 1JG6A 1QGZA 3FOCA 3GCWA 2IU4A 4PZUA 5FPQA 3R9KA 5DSZA 4RPHA 5JPCA 3VNVA 3CNLA 4AWAA 1J2JA 1YH3A 2AOWA 2MIIA 3H6KA 3MMNA 2F43B 1LPAB 4U7PB 2X7XA 1U2GC 3G8DA 1IB6A 1KEVA 3DQPA 3SX2A 3EGIA 3W7BA 2QPLA 3UJPA 1O4WA 2QGNA 2X0IA 2YZ7A 4RPGA 4YDSA 3DT9A 4D4MA 5C1DA 1YA6A 1ZJWA 1ZA1A 4D44A 5F3RA 2DWQA 3L8MA 3Q11A 4V0ME 3LPAA 4XJSA 3PFGA 4BKQA 4XVRA 1PEDA 4NZYA 1S9HA 5BSGA 4JELA 3EISA 1CZNA 1PFWA 3KHUA 5KYNA 3AIIA 2V7XA 5DWVA 1W1UA 1GN9A 1LV8A 3BD9A 4G01B 5EHZA 2J33A 3K09C 3JARB 2GYVA 2V7PA 4ZEXA 5JO0A 2JH8A 1QVRA 3M4YA 1DBWA 2W4IA 3UPDA 1KBQA 2FWNA 5CFOA 5GIOE 1A9OA 4P98A 1ZN8A 3PLRA 3RE1A 5JZ9A 5K20A 2PE5A 2AJTA 4MVJA 4R1MA 4AJ2A 3DHNA 3NIWA 1NVUQ 3FYUA 1BOOA 4Z4HA 5IZCC 1AUVA 1TYDE 3BN3A 4S1PA 4IDCA 4XWOA 1PNQA 3FGOA 2CUTA 4JI0B 4AECA 3VNUA 4UUAA 3VVMA 4MGEA 2PZJA 4TT3A 1ZRMA 4B6RA 2UZ3A 4HDNA 4DJEC 1DOHA 2P7HA 4ZV7A 5F77A 2KS6A 2OM6A 1NBHA 3GEBA 5AXBA 4AJKA 1NQ5A 3U7GA 3Q88A 3G13A 4Q48A 3NIDB 2AKEA 4MV9A 3CZRA 3LPNA 1E1QD 4RTLA 2BKXA 4CN9A 2WQ7A 4WXYB 5TQ0B 3W5BA 2FRDC 1V3UA 3E03A 3HKDA 3OX2A 1B6TA 4W6ZA 2FA9A 1BCRA 3FKSD 3N1UA 3OIYA 4LY9A 1YKFA 3K8ZA 4RJJA 4X44A 3QY0A 3TUZC 5JSZA 3B6ZA 4XQGA 4B7ZA 3I5YA 2OZKA 4EB8A 2QT9A 4YT2A 2PY6A 4OOFA 5HQ3A 1XEXB 4MI3A 5HK9A 4RK7A 1SURA 4FHZA 1HR0B 3TO5A 3J81A 1J1UA 1IN7A 3A2LA 2JCGA 3B5IA 4K05A 3FMVA 1BW9A 4Y9RA 3RUFA 1J8QA 1XXHE 4DM3A 1ORWA 1OI7A 2PANA 4OM7A 3E2MA 5D84A 5DBOA 1OXXK 1NULA 1IPHA 2P0AA 4IFBA 1SRRA 2DBVO 2DX7A 4NARA 3CVVA 4D9GA 1TDJA 3LDAA 3B6JA 4JKIA 3DA8A 2HRBA 3TTYA 4BV8A 3L1IA 4JJZA 1JQEA 4PWZA 5IJ0B 3G2KA 1FDSA 1P81A 2PQ6A 3CUEF 3N2LA 1U7XA 2XMRA 1Z0JA 3P0JA 2E4AA 3PVCA 5I5GA 2FW6A 4CHTA 4ZU1X 1A9TA 2PUHA 3KJGA 4UBMA 1ECFA 4LYGA 1DB3A 3WHIA 4AY2A 3FD8A 1DTSA 1QF9A 1ZIDA 3F46A 4KX3A 2IIBA 1F38A 4EA7A 4LWZA 1TQDA 4N12A 4CLHA 4QJ3A 3UWMA 1K1EA 1AU9A 2EU8A 2KBEA 2L2QA 3A1DA 1CVRA 4LRQA 3ES9A 1U90A 4N5MA 2V45A 3PUWA 4L75A 3TL2A 3FZNA 4QEDA 1GPDG 5TF0A 3BMXA 1ZVVA 4ICIA 4RH0A 4WCFB 5EP3A 1JRLA 4P9NA 4CM9A 4MV5A 4BO6A 4G5GA 3MIIA 5IFLA 2Q27A 3EVZA 1Z5UA 3ORYA 4H60A 3WGOA 4DV6B 1X1SA 4DLRA 3ABQB 5AVYA 3UJAA 2FK7A 2OGWA 2J4FA 4ZCQA 3CZ9A 2JGJA 2F17A 5C1BA 4FIDA 4EPTA 3SIXA 1ZVKA 3PQCA 3WK7A 3ZGVA 3KEMA 1Z8FA 4JSRA 1PHPA 3OLQA 1LTKA 1FSZA 1BFDA 1WOYA 2JHAA 3KUUA 3DL2A 1V4NA 4A1FA 1LPSA 1M72A 4M9XA 4OQDA 5DX1A 1SU4A 3TSZA 4BJ6A 4EX7A 1T2AA 3OETA 4R83A 4GKAA 4KMRA 4BFSA 2QI9C 1Y5LA 4BQNA 2IBTA 3QXHA 5FWDA 1OGIA 3ODGA 4D2IA 1N6NA 2EARA 5BN5B 3PIIA 2QN8A 2V0CA 3CLVA 3FWKA 4D8TA 3CKLA 2WM3A 2BELA 3RBVA 1MX3A 5FQNA 2I2AA 1GPLA 3KKNA 2AOVA 3QOWA 4YRJA 2C98A 1J22A 2BBSA 5LXTB 3KXIA 1F7UA 1DO0A 2XCTB 1FRZA 2QU8A 3B48A 3K70C 3K4QA 2HTEA 3WOVA 4POOA 1KFBB 1QIGA 2AOTA 2H18A 4D3YA 2UVPB 1VYUA 2QE6A 3K0AB 4UEKA 4DREA 1CIVA 1R0RE 2XKJE 1QMGA 2Q6LA 4CCSA 3HJFA 2P7IA 4M8IA 3WI7A 3TVDA 1TFUA 3AH8A 4DNOA 1O6GA 1TUBB 2IYUA 3HFGA 1GDHA 4M0MA 5EJ4A 5TS3A 2HQOA 3IB3A 4ZVUA 3CPSA 4RK0A 1P2DA 2VWGA 4FE4A 1QZ3A 2N47A 3KQYA 4YNBA 1WDWB 4MRRA 3HP7A 3GOHA 1XC7A 4KN9S 4JLJA 3HJAA 1XEAA 1EI9A 4L8VA 4H31A 2BFDB 2EYUA 4O4HF 1G20B 3BE6A 4LC1A 3MCZA 2B34A 1GTG1 3FPAA 4RVUA 4HYTA 5TMPA 3T3OA 4NZPA 5KPJA 4RVOA 2WWTA 4MI6A 1W6RA 1I1QB 2PQ2A 4LX8A 2IS6A 1EUCA 4PLYA 4DJFC 3IV6A 1NXQA 4N3BA 4UTRA 3KPWA 3UH0A 1Z28A 2E4WA 2GJSA 1US8A 3VZCA 3RC1A 2NVWA 3RRYA 4DSOA 3UMGA 5L6LB 1IUKA 4KI7A 1JSXA 2W2LA 2WMDA 2CLHB 3DMDA 3OE4A 3RK0A 2FE4A 4RE6A 1TJPB 1RI5A 3RS2A 4BVJA 1U0HC 3GAFA 5FNVF 4C7VA 5A4JA 3LO5A 4MVYA 5I4BA 4OHWA 3JQ7B 5ETJA 4ESVA 2IUEA 1GRCA 4QHTA 2IA5A 5LMNB 1H23A 1CERA 3U0VA 5CA1B 3EULA 3CWCA 2XVYA 5ECGC 4YALA 1TYZA 3HA3A 2WAAA 1Y8ZA 2ZPUA 1SUSA 4QUIA 2W2LD 3DMGA 3PC4A 2VF8A 2V5AA 3NS7A 5KDDA 1A8UA 1KI6A 4HK4A 1NHGA 4D97A 4LFBB 2CW5A 5BSHA 1OFGA 5ABPA 3SE7A 4IZHA 4LY3A 3OWXA 1GZDA 4KR9A 1RIFA 3NVMB 3UAYA 3DEYX 2D5CA 1JIXA 3W1VA 2I7CA 1F7VA 1FYVA 4NEHB 4BJ5A 3S68A 1M6VB 1CLUA 1N9GB 2ZVQX 3OJEA 1Z4QA 4UCXA 4EI8A 2GYYA 4K9QA 4QYMA 3PEYA 1VIDA 2Q5HA 1R6XA 1TF7A 2OESA 3THRA 4C3UA 3FPSA 2B8EA 4Z0NA 1ABFA 3VV2A 4CI9A 2ZU6A 2ZWVA 4N18A 2VVTA 3OOWA 3ZKWB 1K8ZB 3PQ8A 521PA 3I9OA 4HPWA 3ZHUA 4W5TA 1ND6A 3UFXA 4OHFA 4P82A 1J1ZA 3C4QA 3CZPA 3MJCA 3TH5A 3GPLA 3KOWA 1A8IA 1Z63A 4IQ8A 3N8HA 5E9AA 4QDTA 1EIWA 4CT4B 3TW8B 3ZJ5A 1H9AA 1DXHA 1CY2A 1RW4A 2BGUA 5DTIA 5TDHA 4ZYXA 2X41A 2VYCA 3ZTYA 5HMLA 4A6EA 2CEKA 1LDNA 3RU2A 1L7OA 1VGVA 3FDXA 5BYKA 4MPDA 1UAAA 1TC2A 1R5NA 4R16A 1FYWA 4OU5A 3SKYA 2R79A 1SCNE 4J0IA 1I13A 2FW1A 4GWKA 4OMFG 2QM3A 5AQ1A 1H6DA 5CM9C 2B99A 2HF9A 5C4GB 7MHTA 5IANA 5SYAA 3C6BA 4HFNA 4IEIA 3ZCXA 1DJOA 1DINA 3ZV7A 5FO1A 5M5BA 4MUYA 4OA8A 2PXXA 1PW7A 5MN4A 1W30A 1Y1RA 3C5VA 2PKRA 1ZXLA 1WUKS 3OCZA 1J24A 1F8YA 3U3OA 5EG5A 4YONB 1ENPA 5AW2A 1GFZA 4UD2A 5HJ5A 1WBDA 2QZJA 3Q4GA 4U2DA 1D2GA 1P1IA 1L8AA 1R37A 2X5XA 3E7FA 3L2OB 4Q01A 4E3ZA 4AX8A 4FHCA 5HEKA 1KJYA 1PJQA 2FW8A 4CNBA 1GGNA 1ODLA 1OU0A 2FDXA 1RHMA 4OJMX 3TOXA 2JCBA 5B58T 3PYMA 3ET4A 3S1AB 4GXQA 1E2FA 3RS7A 1VKRA 5CITA 4WUTA 2HRQA 2FWAA 1ETHA 2AUMA 2COKA 2GGSA 2QAJA 1QQ5A 4MMYB 3T5BA 4BO0A 2YCBA 5KOYA 4UM7A 3LQ4A 1R66A 1REQA 2O3TA 1EX1A 2G3YA 5K0GA 3KFLA 3KQVA 3TRFA 1DPGA 3OLXA 4LMRA 5E95A 5BWCA 3DLHA 1BS9A 2ANBA 3LUGA 4IIBA 4MS4B 3BTOA 4GS5A 4LTNA 2D59A 3V7NA 4DLNA 1LGYA 4KRFA 1PKEA 1XD2A 2V6IA 5LJLA 3ZD6A 3ZWDA 2I2BA 2VZ0A 3BS4A 3CZ4A 3EEYA 1L5FA 3I3OA 4TYYA 3UICA 4YCNA 3FUCA 4BYGA 4B87A 1AG9A 1ELOA 2BM9A 2C7GA 3B78A 3EQ8A 1FJ2A 4IJVA 2LE0A 4ER3A 1D7OA 4MICA 4QXQA 5CAEB 2NAFA 1P0IA 1DTEA 5B36A 4OYYA 2NO6A 3TVTA 1JHZA 1ECGA 2Q3DA 3AVPA 1HT3A 1FJGB 1OREA 3JD2A 3ZHQA 1TEXA 2ZP1A 3QVLA 4ENPA 3N86A 5JRZA 4E5VA 4RHUA 5GONA 4JT9A 2O8BB 4BS9A 4XQEA 2J9RA 2IC5A 3KTAB 5HQ3B 5A6VA 4OLBA 2XZOA 1OWLA 2FP3A 2OV6A 3BWBA 3V4OA 1QHNA 2WG0A 3ID6C 1JHVA 1YIDA 2DULA 4LV8B 3JVDA 5K9ZA 5LYJF 1EB9A 5EHGA 1MQSA 1TEVA 1YR6A 4K6HA 1YDEA 3FWYA 4JXXA 2D0IA 1VOTA 1D6NA 2ZEJA 3DBOB 3HBMA 3L4BC 4PYNA 5BWBA 1AN0A 2CHEA 4I1RA 3H4IA 1WKVA 3M6XA 2H1OA 4Q19A 4FLMA 4WK4B 1M34E 1Y6JA 1HE2A 3P26A 5DCLA 2QX4A 2YMLA 1NJSA 2QW8A 1XPJA 1U0EA 1GFWA 4NH4A 1SJ9A 4YGXB 4HDMB 2JI6A 4C08A 4C89A 3GAMA 1MVLA 1E5QA 1B6GA 3AKDA 3L4BA 4QBHA 3BWCA 4X8MA 2C5LA 5HGJA 4AZ3B 2G9NA 3PQDA 2EWVA 2WBLC 3GEEA 3HUEA 1TZJA 3DTNA 3I53A 3OT4A 4Y1EA 3F2IA 2GAAA 3G89A 4Z86A 2GQ0A 2FFBA 3CIOA 1FQOA 4PSUA 1RRCA 1SG9A 3NHBA 4I50B 4LYFA 4TT3D 3VMFA 3P7MA 5DOZA 3ZWXA 1NX9A 4A2WA 5JI3E 2WVGA 3LTEA 1QORA 1HUQA 2WY2D 2Y1GA 5BYJA 3VSBA 2MSWA 1I14A 1EJ6A 1I3LA 1X0XA 3L5KA 1ZDMA 4WCFA 5IKMA 1M7HA 3AFMA 3AF1A 3F3YA 3KQWA 1EQAA 2BKVA 2R2GA 3D4PA 3I23A 2QUHA 4ZYZA 2O8DA 1D1SA 2ZPTX 3KD3A 4JJFA 1ZXBA 2MCFA 3THYA 3W4JA 2W6NA 1XEXA 3RKSA 3FFWA 1C7RA 3C70A 4QXMA 1F0YA 4L0DA 4BX0A 1CRPA 1J2YA 2GF9A 5D3ZA 2P4SA 4B3BA 4EYGA 2H1LA 1P1CA 2XDYA 4UTOA 4AMZA 3A6HA 3I52A 1NDHA 1W87A 4KAXA 2NV6A 4MQEB 4PX2A 2HRRA 3B12A 4ZO9A 4LC9A 3HU1A 2WINI 2K5UA 3VO8A 4HB2A 3W1EA 1FU7A 1Z7WA 4O1IA 1QOQB 1IC6A 1A4IA 1OI4A 2G9VA 4JDPA 1JJ7A 1K4YA 1G21B 1Q1BA 2YVQA 4N82A 4PYKA 3GP5A 1RQXA 3ESAA 2PH1A 4G6ZA 1GTJ1 1KYVA 4NR0A 4UNQA 3SK0A 4F96A 5LFAA 2XBMA 5CIYA 4Q3AA 4MKFA 3P71T 4NATA 1M5RA 1VG8A 1Y1SA 5FUWA 1FTGA 3B6EA 3QHQA 4EHFA 3RUDA 2VDPB 3M6UA 1M2HA 3FVQA 2XUDA 1T6XA 3HGTA 3O8NA 1JFFA 5E38A 2QX9A 4QKQA 2XCSB 2R97A 2WFMA 1MC4A 1T8UA 3L7OA 2NU7A 1Y1QA 1J2RA 1YO6A 1VMDA 1WX1A 2WIDA 3ETLA 4G4SO 2BKAA 3SMVA 3DB2A 2C5AA 4DDKA 3F4KA 3TSWA 4XAQA 3PEEA 4AN1A 5IT9A 1R00A 3Q8KA 2B6NA 3SC6A 2RBKA 3WLKX 3ETJA 5IXJA 1D1TA 4O2LA 3PF9A 1ZA2A 2VYVD 5IF3A 1Z8HA 4Z4GA 4MCHA 1DQZA 4G09A 3UHPA 1XMIA 4ZT6A 1XDBA 3NIBA 1SXPA 4ITRC 1RLUA 2A9JA 5FV4A 2DQ4A 2LNDA 4X7MA 4WBNF 4EL5A 3AM1A 2FZWA 2ST1A 3WKCA 1U0GA 1QGOA 4NJEA 4M8KA 3PLNA 2YW9A 3R7DA 5BN4B 3S28A 1B15A 1BXGB 5LLDA 2Z5VA 3Q9LA 3SS8A 3WHPA 1H2HA 4QQNA 1IBRA 4KLRA 3WGTA 4ND7A 3TCXB 2FV8A 2G83A 2VHVA 1DP4A 3K0EA 5CYFA 4D57A 1JI0A 1NUTA 3C3WA 4AMBA 4HRYA 3UK2A 3O4VA 3UV7A 1UL1X 4NQ