1AHIA

7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
255
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 96
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ahiA00
1NAIA 3ZGYA 2EJVA 1ZJZA 1PSDA 1DC5A 2JCVA 1K89A 3GHYA 3GT0A 1HDYA 3Q0EA 1WDMA 3DZBA 1OC4A 2Q3EA 3GRKA 1LEHA 3DFZA 1XSEA 5DCYA 3HHPA 1JDJA 2GPTA 2HRBA 3U4HA 1UUFA 2P91A 2GUGA 4BKQA 5G0WA 1A9ZA 2OZPA 3H9EO 2J3JA 4ALIA 2UVDA 2WD7A 4P4LA 1VL0A 2D1YA 1J5PA 5EQDA 4FBGA 1JVSA 4EGFA 4HADA 1P33A 4UEJA 2IZ0A 3BA1A 4J1SA 4OGWA 1LLCA 1B8UA 1Q7GA 4A5OA 1C0KA 3KEOA 2BFOA 4BNFA 2GZ3A 1H5QA 2GZ2A 3HNPA 4HFMA 3DTTA 2V6MA 3HN2A 2GN9A 2FR1A 3GG9A 5JS6A 3KBOA 3VOSA 1LSJA 5DOVA 1UXIA 5K9ZA 1PWZA 2J5RA 4TSKA 3PIDA 1ZMOA 2GLXA 3EDMA 1EVZA 4Y67A 1ML3A 1QLHA 4PG7A 3OJEA 4R3NA 3I1JA 3JD0A 2VOJA 1BW9A 3I5MA 3UCXA 3H65A 4WCFB 5ENDA 3MJVA 2JD2A 3HDYA 4WJZA 3STHA 4LW8A 1ENYA 3K6JA 4R1TA 1DIHA 5BNFA 1SPXA 1I8TA 1EUDA 1YJQA 5U1PA 4CR7A 5KCZA 3MJ4A 1JAYA 4U0JA 1ISFA 5BSFA 5AXCA 3KSDO 3ZN2A 4CM5A 1FDUA 4E5MA 4EBFA 1EBFA 2CY0A 3RKRA 3ASVA 1HDCA 4G5HA 5GMOA 1ZFNA 4RGBA 2EHDA 4OKNA 2WYWA 4DBZA 2Y05A 3IKVA 3KZVA 4M8SA 3EZLA 4ZQBA 3DZGA 1O89A 3DBHB 5IDYA 1NVMB 1SEVA 1OAAA 3AY7A 3ICCA 5DOZA 2C54A 4RPKA 3VDRA 1HTBA 4J1NA 1Q2XA 4Z0PA 3LSYA 2GDZA 4BKRA 5KTKA 1NAHA 3PLNA 1BXKA 4BO6A 2X58A 1GL3A 1E1LA 4I8XA 1PEDA 4R54A 3WGOA 3NTQA 3MJTA 4AJPA 5L4SA 4AJIA 4B79A 2NVBA 3NAQA 4MKZA 5BSHA 1E7RA 1X7GA 2VYNA 5B4TA 4I5GA 2RHRA 4ND4A 4PLTA 3VH1A 3PI7A 4DMMA 4A7PA 4WNCA 4D0RA 1YQGA 4L4RA 4NNJA 1TA4A 2WE8A 3VAZA 2HSDA 1IULA 4HP8A 1H6CA 3SBOA 1VKNA 2G0TA 4R69A 2DTEA 3WBBA 5EESA 1WDLA 4L73A 2QYSA 2H1SA 4BL5A 3ZH2A 4II3A 1IPFA 1E3IA 5HTOA 4C7JA 5JMPA 3ETEA 4QQRA 3LU1A 3VVBA 4MVJD 5A03A 2HMVA 2EP7A 1YKFA 5T64A 3D64A 4WKGA 1SB8A 2BFPA 4O5OA 5DNAA 3L9XA 4LN1A 4MP3A 1A5ZA 1C1XA 4WOKA 4BOYA 1IB6A 3HDHA 3L4BA 3NX4A 4R41A 2FZEA 2ZTUA 1OFGA 5G4KA 3VZSA 3PHJA 2DPHA 1TI7A 3WR5A 4ITUA 1DSSG 4XJTA 3TQHA 3CE6A 4B3IA 4BNIA 4OXNA 1E1NA 2ILTA 3DONA 1ULSA 1H2HA 5CPBA 1WWKA 5A04A 4NK4A 1ZXBA 2HK8A 2PTGA 4CQMA 4EI2A 3PDUA 2Q1WA 1HSZA 2P2SA 2PGLA 3WQRA 2NACA 3WDSA 1B0AA 1UXGA 1Z6ZA 2FHSA 3PYXA 1X14A 4XYEA 4A0SA 5JY6A 4I5FA 2A4KA 3WIDA 3RU9A 4EYEA 1V3VA 4FOSA 4R5MA 1LQTA 3R1IA 1I3MA 4UVHA 1LNQA 1ZMTA 3V2UA 3OF2A 3WYEA 4BKPA 5AXBA 4NJMA 2EF1A 3PQEA 1EE2A 2CSUA 4FS3A 4WGGA 1A27A 1R0KA 1EE9A 3LC1O 3VPHA 3PJGA 4XQGA 1G0NA 2QQ5A 3RJ9A 3WSWA 4HFRA 4PLHA 1KEPA 3CINA 2YFQA 3D3WB 4H7PA 5A05A 4BO0A 1CERA 3C1OA 4LRTB 4RVDA 1QSGA 2WTBA 4TVOA 4J9UE 4JN6B 1LX6A 4GSKA 4OSOA 3H9GA 1O0SA 3ONFA 3WBFA 1XA0A 3MCVA 2X5OA 3DQPA 4A2CA 3JQ8A 2CVQA 1A71A 1PU2A 3HB5X 4ND5A 1NPYA 4XJSA 4D3DA 5CDUA 2AQIA 4DIFA 2ZK7A 3VPFA 2EG9A 2ZB8A 3FNGA 4JNKA 3OETA 5IN5A 4LVUA 5ITVA 2VUTA 2D5CA 2DAPA 3JQFC 4ZN6A 2I3GA 1CEQA 4IPTA 3VTZA 2ZQZA 4FFLA 5DF1A 1DC4A 2X7HA 3QVWA 3VDQA 3EZYA 4L4SA 2GGSA 3NGLA 3S8MA 4JJIA 3JQ6A 4ZVVA 5ICSA 1BDBA 3BHIA 1DLIA 3RASA 1WVGA 2P4QA 2POQX 2PD4A 4Q3NA 1P74A 2PD3A 5FI3A 4BNKA 2EP5A 3LVFO 2EKPA 4C4OA 5BQFA 1LU9A 1Y1PA 5JYDA 3OIFA 2EERA 3O26A 2PFGA 3M2PA 3PJDA 2WD8A 1QKIA 1M6WA 3I4FA 2C82A 4JROA 3S2IA 2HK9A 4Z3KA 2BMAA 2Z95A 1I32A 2UUPA 4IMPA 3H9UA 4BGVA 5G4LA 3KYBA 2Y0CA 3PEFA 2I6TA 4IS2A 1HE5A 1ISHA 3AM5A 2EV9A 2P5UA 3JQ7B 2FPPA 5JDCC 3RU7A 1KEWA 1J49A 3IJPA 1GUFA 2Q2VA 3Q2KA 5AXDA 2W2LA 4LCJA 1GZ6A 4P4NA 2I67A 3I52A 4HKTA 2E49A 5BSEA 5LDHA 1B8PA 4Q39A 5L45A 2VHVA 1NTOA 2B4RO 1LDYA 1YH3A 2AW5A 5KNLA 1X1EA 3RQSA 1CWUA 4YJDA 2PZKA 4J16A 3F9IA 1PQUA 2FY8A 4AJEA 4R5HA 1PIWA 1SAYA 1ZSNA 2JHFA 4FIZA 3FN4A 4Z9FA 2EJWA 4CMEC 1HDGO 6ADHA 1K3TA 2HU2A 4KUHA 2UV8A 5JE8A 2Y0EA 1RM0A 1LDGA 3PGXA 3WYCA 1ZO8A 5DZSA 1QV7A 1VSUA 1MXHA 1P3DA 3ZI0A 3DAPA 4KWIA 1OOEA 5JAMA 3HDJA 4DQUA 4FFOA 1ZEJA 1GY8A 1J6UA 2YDXA 3JQ9C 2QIOA 1E6EA 3L9WA 4FCCA 3VH2A 4AL4A 4B7UA 2X9GA 4AJHA 1DHRA 3CZMA 3SX2A 3DBLA 4D0SA 3O8QA 3KV3O 1NPDA 2OMEA 4RPHA 4BMSA 4MDHA 4MVJE 2BI8A 1DRUA 3LYLA 3O4RA 4UUOA 4CL3A 1LXCA 1XHLA 1O6ZA 3WGQA 5KKCA 3DEYX 4IDDA 1ZZEA 5IFLA 1KIFA 2Y66A 2AEFA 4C7KA 3L6DA 1RYEA 1XLTA 1RKXA 4CMJA 4BS9A 4WPGA 3AJRA 1CETA 1DB3A 2RH8A 1R4MA 4FD3A 1HKUA 3FD8A 5A3JA 3ONEA 3WTCA 2BGMA 4J7CA 4A27A 3WGZA 3EK2A 1UDAA 1EDZA 2AEMA 3JYLA 1QYVA 1WZEA 1SOVA 2BGLA 1DOHA 4BNUA 3NJ8A 5K0ZA 3HJAA 4Q3DA 4TRJA 3KSUA 1PZGA 5I8ZA 1OMOA 3GUYA 3HB4X 1E6WA 1NVGA 3IL2A 2C2YA 1SEPA 1I2CA 5FF9A 1EQ2A 3LQFA 4XRRA 3ANLA 3TN7A 1Y8QB 3DO5A 2YQ5A 3NUGA 4HBGA 3T4EA 3ZWOA 3D4OA 3GH3A 3PYLA 3EC7A 3COSA 5DN9A 1K6IA 4TKLA 4WOJA 4EZBA 3JQGB 1H9AA 5EINA 2SCUA 4W7HA 1NM5A 3RBXA 1ISIA 2FR8A 3ZHZA 1YS4A 5TT0A 1ZEMA 3GNQA 1XGKA 4I08A 3FSRA 1VLLA 3OJFA 1CQJA 2EGHA 2P5YA 5DP2A 1ONOA 1YXMA 5MGBA 4BO7A 1BXGA 4Y6PA 5L53A 1FJHA 4CLRB 3FNFA 1O8CA 1PR9A 2WJPA 4CMGA 2FN7A 1EZ4A 1PGNA 1QRRA 4TQGA 4XIJA 1GCOA 5A9SB 4PG8A 1ADFA 2C7GA 2V7PA 3L0DA 1Y6JA 3BMOA 3WX0A 1VKOA 4KDFA 2DFVA 4PLPA 1JN0A 1AXEA 2CF6A 4JX8A 4XDZA 4TRNA 3ROMA 3WSVA 4INAA 1JWBB 3WG9A 1B26A 4CV0A 4E2ZA 5TX7A 3HWRA 4PRKA 3PZRA 4GMFA 4BB5A 5G0SA 2R6JA 4CM6A 2FRDA 2G5CA 3RJ5A 3U4IA 4HUJA 1T2FA 3OEWA 1N8KA 3OQBA 2UAGA 4OL9A 4E31A 2YY7A 4Q3AA 2Q49A 4PVDA 4BB6A 4OYRA 3BAZA 3DMTC 3TOZA 1AHHA 1MV8A 2YZ7A 4KOAA 4WLFA 1U3VA 2B0JA 1I01A 2BH9A 3S2GA 2D59A 2H6EA 4MVJI 4DIBA 2QYTA 3ON5A 3PHGA 3MTGA 4E33A 4YJFB 3KLMX 2C7VA 4AJKA 4GI2A 4OOFA 3QWHA 4ALMA 4FQ8A 5JAZA 1AGNA 4ZQEA 4G2NA 4GLLA 4J49A 4GX1A 3Q9NA 1MP0A 4WLNA 4CLHA 1T4BA 1SC6A 3VH3A 1ZXLA 5KJFA 1DXYA 1NXQA 4ZQFA 2GCGA 3AU9A 4P4GA 1CYDA 3UHAA 3HE3A 3GHHA 3ULKA 1F8FA 1KY4A 5T57A 3K31A 4RF5A 2IYPA 1U3TA 2DPGA 5L7WA 3PWKA 5AQ1A 3H8VA 3B6ZA 2NVWA 5TRTA 3RFTA 2BD0A 1I3KA 2V65A 3FPCA 1UXKA 4RZIA 2GN4A 1E77A 3QWIA 3A06A 1PQWA 1PJSA 3TL3A 4Z0HO 4IJVA 4M89A 4D46A 2YDYA 1N92A 4PLWA 1CF2O 1PJ4A 3WOHA 5JAIA 4Q9NA 1GR0A 3FTNA 4YT5A 1RWBA 8ADHA 5L95A 1BMDA 3OQ1A 5H82A 4F6LA 2VUSA 1ZVMA 3B1FA 4CMIB 4CR8A 2NU6A 2DBQA 2PV7A 3HFSA 1TVEA 2EW8A 3JQFA 1XQ1A 1RYDA 1EMDA 1G6KA 2R2GA 2RAFA 3R0IA 4NIMA 5G2OA 1B3BA 2PH5A 2HRZA 4M54A 4AJ2A 4BNLA 4RPGA 1ZK0A 3TSCA 4L76A 3PDJA 4A26A 5DP1A 3FBTA 4CV1A 2RIRA 1M67A 1HLPA 2VRCD 2VZ0A 4NBTA 5HA5A 2VYVA 2O50A 3GGGA 4IZIA 3RUIA 3VKVA 4GVLA 4OHUA 2ZIZA 3W8EA 1VPDA 4JCOA 4UULA 4YJGA 5ER6A 2AXQA 4PZEA 7MDHA 3HUDA 1JKIA 3IMFA 4QSMA 1UXJA 2I3AA 2RCYA 4ID9A 2ZQYA 3LC2O 2C29D 1LDEA 4RJTA 3BMQA 2I9PA 2JCYA 1ZBQA 1YB4A 4PRLA 2WSBA 4J4BA 5JDCA 3I23A 5CDYA 3DOJA 3DR3A 3VC7A 1LDBA 3BMCA 3H9QA 3IJRA 3NDJA 5TF4A 3GVCA 3GMDA 1V35A 5TQVA 1Y8RA 2QRLA 4FJ1A 5L4LA 3I4CA 2X9NA 5DCUA 3RIHA 3INTA 2JJYA 1MB4A 1YOVB 4EW6A 1DFHA 2FPIA 3AOGA 3VZRA 3ZWWA 1EFLA 4E21A 3NT2A 5I9NA 1NHWA 1ENZA 2OP1A 4XKJA 2YUTA 4Y8VA 4H16A 4YJHA 4YQZA 1V9LA 3PP8A 1R37A 4U0KA 2O4CA 1U1IA 3ORFA 4Z3DA 4NDNE 4CLXA 4CMEA 3E18A 4ZQGA 4FN4A 4E2YA 3FR7A 1C0PA 3WB9A 1ZK3A 3RKUA 4F6CA 4LISA 2OOSA 2YQ4A 3JQAA 1WZIA 1Y7TA 3IQDB 3QW2A 4W6ZA 5TC4A 1E5QA 2PH3A 2ZJ1A 1O94A 5COQA 1IE3A 4DL9A 5TS3A 4RVSA 3JQ9A 1MFZA 3CUKA 1LC0A 1X1TA 1UZMA 3KB6A 3PQDA 3HZZA 4J9VA 5KVCA 3AWDA 3RAJA 4N18A 2JCXA 1R4NA 4XRGA 5H81A 2DBRA 2WE7A 1U4OA 2I65A 3QLJA 1XELA 2X0IA 3LZ6A 3CZRA 2VUUA 1FDWA 2H63A 1GYQA 4IZHA 2J3HA 3EGOA 3F6YA 1VM6A 4BNGA 1H6AA 1YWGO 3MWDB 4M1QA 1M2WA 3GN2A 2FOIA 3LDHA 3R3SA 4WLEA 5F3RA 1FXSA 5CP8A 5JDIA 1P1FA 3QJ5A 1PJBA 1XU7A 2QG4A 1NQ5A 4LSMA 4RDIA 1WXDA 1K6JA 2V6FA 4IINA 3FCOA 4CUKA 3ZWYA 3FTPA 2NV6A 4PZCA 1JQBA 2H5LA 4J3FA 4E5NA 2HDHA 2FSVA 2Y67A 2DFDA 4AJJA 4WCFA 1CDOA 5B1YA 1VL8A 3JD2A 3ST7A 3GUCA 2GF2A 4IJUA 4JQCA 3OBBA 1PR3A 3VZQA 2FWMX 2JFGA 4U7WA 4D42A 3NKLA 3DMYA 2Y68A 2ZYGA 1E7QA 1SB9A 5TJHA 2O3RA 2OGUA 1E7SA 3MJCA 5L40A 3ABIA 1I36A 4FW8A 2EEZA 3MZ0A 1HDRA 4FOOA 2BF7A 3NT4A 3M6IA 2YJZA 4MVJM 4NHEA 4OJNA 4CUZA 3K9QO 3ZWXA 1PZFA 3U62A 1EBUA 4MIEA 3KUXA 2HQ1A 4CLEA 3LT0A 3DBHA 1B15A 3T7CA 3NT5A 1HYEA 1X13A 4D41A 2B4QA 3KYDB 1IYZA 3V1TC 2XAAA 3DDNA 4JJGA 1DJNA 4IS3A 4LGVA 3JV7A 2X1HA 3H5RA 3NDIA 4CM9D 3WMXA 2PNFA 5L7TA 3UVEA 3C1TA 3G1TA 3TZHA 1GCUA 1VJTA 4YDRA 3AFNA 1LDMA 3ZZNA 2GRAA 5LCXA 3I6QA 4NPCA 5EN4A 3CKYA 1ZCJA 2W2KA 2XF8A 2Y0DA 3LLSA 4PG4A 5KVQA 1Z74A 4QO7A 3TFOA 2IZ1A 4MIYA 1U3UA 4ALNA 4YEDA 2O7QA 3CMCO 3W1VA 4CM8B 4DLBA 5KJEA 2DKNA 3GY0A 1GZ4A 3D0OA 3VHRA 3OJ0A 3ROQA 3RUDA 2HAEA 4TVBA 4ALJA 5EPOA 3DMTA 1H2BA 1A7KA 3ZHYA 5EL0A 4XIYA 3U4DA 1V0JA 3SJUA 1CIVA 3BIOA 3D5QA 3GF4A 1LJ8A 2VHXA 5JAQA 3LT1A 2AQKA 5KJCA 4PVCA 3ZNOA 1QYDA 1WMAA 1HZJA 2ZTLA 3K2EA 1PGOA 3I83A 3AY6A 1D1TA 3PLRA 3BMNB 4JXKA 4YRDA 3NDRA 4Z0TA 1GEGA 3L4SO 5JCJD 3CMMA 4DC0A 3KETA 4ZJUA 3BYZA 1VE9A 3ZU4A 3GEDA 1GDHA 1R12A 1Y9AA 2AQHA 2HK7A 1Q7BA 4I5DA 4MKRA 4EITA 1XU9A 1J0XO 1P1HA 3NJ4A 1Q7CA 1HE3A 4K6CA 4XYMA 2Y1DA 4NMHA 1YQDA 5ICMA 1B3RA 3G49A 5DBFA 4OXYA 3WYBA 2C5AA 3RBVA 3TPCA 3AUSA 1T24A 3AM4A 4HNGA 4B3HA 4B3JA 3TF5A 4ZRMA 3R3JA 4UUMA 1JW9B 1PJQA 1P1IA 5AOVA 2EXXA 2W4QA 4O0LA 2AQ8A 3Q11A 4ZRNA 4EEZA 3DZHA 3ITKA 4A10A 1OC2A 2VYND 2FMUA 1ZW1A 1N2SA 4K6FA 4URFA 1UAGA 4U5QA 1KC1A 4NBWA 2XOXA 4E6PA 1DJQA 3G0OA 4K26A 3D3WA 1R0LA 4AJ4A 5TT1A 2GO1A 1WNTA 3PVZA 5I7EA 2X8LA 1B2LA 3RC7A 2VWPA 3INGA 2H9IA 4CR6A 5DDIP 1GADO 3N58A 4JBIA 4EUFA 1PJTA 2CUKA 1E7MA 1PGJA 2LDXA 2DT5A 4I9NA 2DM6A 4XGKA 1F17A 4YA6A 1IUKA 5HS4A 3FPLA 4E3ZA 5IDXA 3G3EA 1MUUA 3U49A 4B8ZA 2PZMA 4NR0A 2ZB3A 4CM4A 4WK6A 2E6UX 4HX5A 4XQCA 5LDGA 1JU9A 4YT2A 4J91A 2HMWA 3RC2A 2F00A 5DBGA 4Q3CA 3CXRA 3GR6A 4CQMD 3L77A 1JVBA 1MC4A 4TRMA 4OM8A 2BI7A 3RROA 4GAEA 4BMVA 4XQEA 2EWMA 3ZV4A 2X6TA 4O59O 1DAPA 4WLVA 1ISMA 2YW9A 4IDFA 5KVSA 1KEUA 4FGWA 3MWEB 3A14A 3DAGA 3HG7A 4E13A 2TMDA 4E12A 4I9UA 4DBVO 1WMBA 1C3VA 1D7OA 2CZCA 2Q1TA 4ILKA 5IDQA 5JC1A 4CQMB 4DLLA 4XR9A 1U7HA 2NTJA 1AE1A 2XXBA 2JHGA 3GZ4A 3GVHA 4OIMA 2A35A 3FNHA 4OKIA 3JYOA 3KLPX 2HUNA 4EJMA 1ADGA 2E82A 1HZZA 2WYVA 4W99A 3DAFA 4RL6A 4M49A 3R6DA 5KJ6A 1Z45A 4CM3A 4E2WA 4M86A 2C59A 3ZV5A 4HFNA 4OAQA 3BXXA 4HNHA 1LRLA 4NG5A 3AUAA 4IJKA 1PS8A 1LSOA 3PTZA 4Y6SA 3GA0A 3S55A 4BV8A 3A9WA 2J5KA 4DMLA 4GH5A 3TWOA 4B4VA 4D45A 4JGBA 2JKVA 1E3WB 4UVEA 3DWFA 3NV9A 2VNSA 4KP7A 4DVJA 2HKIA 3INRA 1Q1NA 3ZU2A 1GUYA 3BTVA 1UP7A 2XXJA 3NTRA 1J4AA 4KMSA 4B7CA 1RM3A 1TB4A 3WJAA 1ULUA 1NPTO 1DO8A 3OICA 3VKUA 3JQ8B 4YRAA 5B37A 3AW9A 4MVJF 3QQPA 3DHYA 4FSHA 5A02A 5HWSA 2X5KO 4UVIA 3M2TA 5I8WA 1NNUA 3HN7A 5B4UA 1E1MA 4MO2A 2O4UX 4ND2A 3ZNQA 4AJNA 3DBRB 3WGIA 3QIVA 5IAAA 2Y1OA 3W8DA 1AXGA 2Q1UA 4L8VA 2OP0A 1PQPA 1XYGA 2WYUA 5C7LO 1GUZA 2I76A 4QECA 1M75A 4BO1A 3QWAA 3I9LA 4MVJG 2OBYA 4BO8A 4FGSA 3F4BA 5BT9A 1NQAO 1DEHA 1LSSA 1TT5B 4KWHA 4Z9YA 1PJ2A 2JFFA 5CAEA 3RSHA 5G0TA 2JD1A 1BSVA 1CRWG 4IDCA 3H2SA 4IMRA 3UKOA 3SVTA 1PGQA 2GN8A 5IXSA 3K8ZA 1UDCA 5T6BA 3PIIA 2I99A 5KIAA 3Q6IA 2WM3A 4CQLB 4EDFA 1OBFO 1ZNQO 3CH6A 3Q9UA 3F5QA 3HDQA 4L9RA 4XR4A 3SXPA 1QR6A 1Y8QA 5CDSA 1LC3A 2WWRA 3Q2IA 5B12A 5I7VA 4MP6A 1E5LA 1JKFA 3NRCA 3MOIA 5DULA 1P9LA 1KYQA 4OO3A 5IDWA 2W8ZA 3U4CA 4GVXA 1A9YA 1ZJYA 3QSGA 2O23A 1HYGA 1WAMA 3JQGA 1DDOA 1Y5RA 3JSAA 2HO5A 2OFPA 3KVOA 3WMWA 1O5IA 5F1KA 4IDBA 1KVQA 5JDIC 3ZHXA 1PWXA 3GPIA 4NU6A 1FK8A 4PLVA 1BDMA 3B1JA 4RPLA 5L7YA 3SC4A 4CLRA 5JFOA 4G81A 5F1PA 4DQXA 4OXKA 4ZQHA 1E3JA 3T7EA 5U4QA 1PL8A 5A9SA 4D3FA 3GFBA 4DXHA 1YDWA 4WCFC 2ZTVA 5KKAA 3X2EA 1U7TA 3WJ7A 2AE1A 3MTJA 4WUVA 2O3TA 4F3YA 2CVOA 4RF3A 4ZD6A 1U5CA 4PCVA 1R66A 4DC1A 3QHAA 1PZEA 1GYPA 2X86A 4KDEA 1DIRA 4R1SA 5ILGA 3JD4A 1I0ZA 1F0YA 1PS9A 3KRTA 3E9NA 4ND3A 1NBOA 2C20A 1I3LA 4Q3EA 1DRWA 2FR0A 4XA8A 3F1KA 3RD5A 5A4DA 3I3OA 7ADHA 1NR7A 1EVIA 3LF1A 4CODB 2HMUA 4FJ0A 3AI3A 1Z75A 3NTOA 1P45A 4LRSB 4WE3A 4D79A 4P22A 5JO9A 2CDCA 4YJFA 5ES3A 3FWNA 4BO2A 5C5IA 1Z73A 1T1RA 3ETGA 3GAZA 1UDBA 4R68A 4BKUA 4LMRA 1GQ2A 4GGPA 3TZQA 1A7AA 1V8BA 2X9VA 2ZKLA 1BWSA 3DHNA 4FC6A 2HMSA 4MVJP 3RUFA 4BNYA 5TIIA 3GDOA 4BQPA 1C0LA 3PHIA 4HWKA 1BHSA 2HMTA 1XG5A 2DQ4A 1U2DA 4U8GA 4XDYA 3OA2A 3KO8A 1IZ0A 3WICA 3JD3A 3GEMA 4UUPA 3OJLA 1NVTA 4YT4A 2CD9A 3D4PA 4XD2A 5FYDA 2NQTA 2PGDA 3PRJA 2VTEA 3C1AA 3KYCA 4K28A 2JD0A 2OORA 3N74A 4MKXA 4NFSA 5K6AA 4RLHA 1IL0A 1N9GB 1HDXA 3RFXA 4CLOB 3MEQA 1VJ0A 1H0KA 1EUCA 2Y93A 1WLYA 2G17A 3AM3A 2PY6A 3PWZA 3ZW8A 3SJ7A 3QY9A 2NWQA 3DZJA 2GN6A 2AA3A 3ENKA 4JBGA 3ADOA 3E82A 2DUUA 4IM7A 2AEJA 1E6UA 4D43A 1D4FA 4QO8A 4GL4A 2Q4BA 4BUCA 4DLAA 1BGVA 1KEVA 4YWJA 3RUAA 3GVXA 3WGYA 4CMIA 1YBMA 3ZWCA 2X0NA 1Y9EA 4KTVE 4AJLA 5GZ3A 1MG0A 5L3ZA 4MP8A 2NQ8A 2HJRA 3ZWAA 1M66A 1GTMA 3W4IA 1NWHA 1KY5A 4DQVA 1P31A 5I9LA 4Q3BA 3W4KA 4IDEA 3ETDA 3IAHA 2X0RA 2ZATA 3IP3A 3UFXA 4UVDA 4D7AA 3S2FA 5IN4A 4QFCA 1VRWA 1IHYA 4R16A 3H3FA 4FPXA 1YJ8A 3CSDA 1ADCA 1I5RA 4WNIA 3UUWA 5BNIA 5EQFA 2R00A 2X22A 5A5FA 3JYPA 2Q50A 1MFPA 5C7IO 2AG8A 4GLOA 3RC9A 3JQBA 2CVZA 3OSUA 1U3WA 3H9JA 4UAGA 1H6DA 3F1LA 4ZICA 3PFWO 4IGEA 2YHIA 4TKMA 4BVAA 2O7SA 4R4JA 4HV4A 2PKRA 2WMDA 3RC1A 4BIIA 4FFNA 1SMKA 3UOGA 3A4VA 1DFIA 1T2DA 4GSLA 1ZH8A 1C14A 1N7GA 5J23A 2JL1A 5CEJA 1UXHA 1C0IA 2ZYAA 2VHZA 3ZW9A 2DTDA 3W6UA 4YYZA 3RWBA 4EUHA 3H5AA 3A1NA 3VPGA 1L7EA 3RFVA 1KERA 3WLFA 2VNAA 5T67A 4NK5A 3GZNB 1E0DA 1P77A 2B37A 2DVMA 2B35A 1GEEA 1PL7A 1JTVA 3QVXA 4R1UA 4N54A 5JO0A 5GZ6A 3E03A 4RORA 1M76A 5TGDA 1QV6A 1DIBA 2D5AA 2NVUA 5G0VA 2E37A 1L1FA 5JC8A 3H2ZA 1S7CA 3WGHA 4GWKA 1HYHA 4RVUA 5IG2A 2OBNA 3FRJA 4IGFA 2RBEA 3ZV6A 4GX2A 1VJ1A 1FDTA 4WEOA 3X2FA 4CL8A 3ZWVA 3VZPA 2VYVD 4RVHA 1GPDG 4CM1A 3EAGA 2Q46A 5TJ9A 2VTDA 1MGOA 3I6IA 3LLVA 4DWVA 3H5NA 1K2WA 1Z7EA 2D2IA 3K5PA 3RCBA 4RO0A 2X5JO 3DZIA 3M1LA 1T26A 1XWFA 3JQDA 2A94A 3KEQA 4NJOA 4S1VA 5A06A 1ORRA 1C1DB 1GV0A 5JY1A 2EGGA 2RHCA 4RQTA 3GG2A 4GKVA 3WGGA 2BRUA 5JSFA 1UP4A 3S1LA 3VTFA 3L07A 4OSPA 4BNHA 1XR3A 2VWQA 4DYVA 3D5TA 4K9DA 2Q4EA 1KVRA 1GQYA 2Z1MA 4PGFA 1HEUA 1U9JA 2AG5A 2P4HX 4RVFA 4JBHA 4UEOA 4L4XA 5T8KC 3QRWA 1V3UA 2BGKA 3GNTA 2B5VA 3TZKA 1G0OA 3IIEA 5FEUA 1KC3A 2RH4A 2O48X 1IOLA 1RPNA 1W73A 1LBEA 3E9QA 1O9BA 3G1UA 1NFQA 2HLPA 2P9GA 4BNJA 4E32A 3U0BA 1JAXA 2FZWA 2GYYA 1SBYA 2PK3A 3S2EA 1B8VA 2VHYA 4PG5A 3GDFA 2Y1FA 4GWGA 2EIHA 1Q0LA 2VT2A 4W82A 3ANMA 4CMBA 5F5LA 5TLSA 2V6BA 3P7MA 4J43A 5L4NA 4PFJA 4BKOA 4DRYA 2OHXA 1YE3A 2D0IA 1I10A 1LSUA 1ID1A 1Q0QA 4IBOA 1DHTA 4WECA 4IQGA 2X23A 4YTEA 3NYWA 4L0QA 3K96A 2IODA 3JQAD 4XB2A 4PLFA 1E1KA 2PKQO 1YGYA 4KQXA 5H83A 4IDGA 3RUHA 3SC6A 3D4NA 2YV3A 3D7LA 3WGTA 2QHXA 1LLQA 1KVTA 2NLOA 1SOWA 4AJOA 3KYDA 3WXBA 4AICA 5JNLA 3NEPX 1Z7BA 5IZ4A 2C07A 4BNZA 2VCYA 4B8WA 4AG3A 3A28A 4BQRA 3UGKA 4D3SA 1SCUA 1ZKMA 5IZCC 3V1UA 3DBVO 2BLLA 4TRRA 4BGUA 1EEHA 1LRKA 3HSKA 3JQAB 4E5KA 5CG1A 1DC6A 4GBJA 1DLJA 1NHGA 1ZSYA 1NP3A 4RZHA 3OECA 2FP4A 4MPDA 4RDHA 4E30A 5C3MA 1P1RA 3V1YA 4CM8A 4CMAA 4CM9A 1QXSA 1N1GA 1RM5A 1YBAA 2BFMA 3D1LA 4IQ8A 3SEFA 2Q45A 1B7GO 1E3EA 1R4NB 4GKBA 1I2ZA 5JW6A 4AJ1A 2IXAA 3OM9A 9LDBA 2BKAA 2Q99A 3CTMA 1UZNA 5AXAA 1JA9A 3Q1LA 2GZ1A 3PQFA 5ENVA 1R0SA 4ONEA 2NTVA 4E0BA 4ESOA 2O3SA 4ROSA 4G65A 2IDZA 1P1KA 4KZPA 3DB2A 1EK6A 3C7AA 5IXYA 1ZK2A 1JKJA 1UJMA 2QZ9A 4EJ6A 1WP4A 4BO4A 4W7IA 2E4AA 3BMNA 2VOEA 4JP2A 1HWYA 5ITWA 4TWRA 5HM8A 1K0UA 5COAA 1XKQA 2B36A 3DOOA 3PXXA 1EQUA 2B5WA 1MLDA 4HXYA 4PN3A 1U4SA 2IRWA 1W6UA 4X54A 1F8GA 1QMGA 5U9CA 3ENNA 1MC5A 3ANNA 2NU8A 5KVVA 4IDAA 1T1SA 4IQ0A 3JYQA 3BTOA 2WD7B 1XDWA 5FWNA 2J8ZA 4NFHA 5BNTA 2Z5LA 1HDZA 2PZJA 3P2YA 1X7HA 4DA9A 4KUEA 4FFRA 5JCJA 3EVNA 4RLSA 4PG6A 3UICA 3E1KA 2IEDA 2XPCA 3GPDG 1R16A 1T25A 3FF4A 4KTTE 5F21A 2TMGA 1X7DA 4I5EA 3K92A 2ZCUA 1D8AA 1N7HA 3ZU3A 5EIOA 5ADHA 2YYYA 5ER9A 5EMHA 2DBVO 3DHEA 4O63O 1FF9A 1RJWA 2JFHA 3GNSA 1D3AA 1G1AA 1UZLA 2HCTA 1VSVA 1XQ6A 3ASUA 4MVJA 4OMUA 2Y1CA 3WNVA 1B16A 2VZ9A 2D8AA 4CUJA 5JLAA 4QXMA 1BW9B 1NQTA 1ZSVA 3EYWA 3OFSA 3RI3A 3UAGA 3UCFA 4A73A 4J4TA 1PJCA 3EY4A 5AVOA 3AUTA 1YL7A 5F1OA 3GVIA 4NI5A 4F45A 5IJZA 2W2KB 1Q0HA 1JLLA 1QYWA 2OXIA 4FB5A 3TDKA 1ADBA 1NFRA 2V6GA 3MOGA 4BV9A 1NWCA 4AVYA 4J7XA 4PLZA 4Z9XA 4YAGA 1O95A 3W4JA 3WNQA 3ZU5A 3IUPA 4YB8A 1ZK4A 5THQA 2CMDA 2LDBA 3AUUA 2NU7A 4JJFA 4R3WA 1LQUA 1DFGA 3DL2A 1GQQA 2W90A 3ONDA 1U2GA 3GRPA 4BGEA 1HF3A 4R9RA 1VC2A 4F46A 3EW7A 4W4TA 2VZ8A 5K6AC 3DXFA 1GV1A 4LMPA 1W4ZA 1XIVA 4XEHA 3C85A 3GAFA 1UP6A 4N5LA 1ZK1A 1LDNA 1KBZA 1E7WA 3F4LA 3FHLA 4XCVA 3ZV3A 3RUCA 2AMFA 3WQQA 3KM0A 4FR5A 4J7UA 4DIOA 1GYRA 3ROKA 5JPIA 3AOEA 4XYLA 1PJLA 4NBUA 1OI7A 4BGIA 2I66A 2VWHA 1QORA 2NTNA 2YV2A 1JWAB 4MINA 3JQCA 4BMNA 5KOIA 2J5QA 4CM7A 1EUZA 3TZ6A 2F1KA 2I5PO 4RCVA 4YBZA 4RVGA 1ARZA 2PD6A 4DGSA 5EERA 2UDPA 2NUAA 4CLDA 4A03A 3GGPA 2ZB7A 3SLKA 1C1XB 1U8XX 5JXWA 3MJSA 4UVGA 2DU8A 2R00C 3H6KA 3I9OA 3OP4A 2O3UA 4Y98A 5G4KB 5CEFA 1LRJA 1UR5A 5LC1A 4DYDA 5A9RA 4MOWA 3QA9A 4NBVA 4WLOA 1FDSA 4GX5A 2JAPA 1V6AA 1A4UA 1DAOA 1F12A 1BXZA 2FSSA 3JQ7A 3JQBC 3UF0A 4YPOA 2WEKA 1RM4A 1E3WA 1SNYA 4RPJA 5B4VA 1I33A 3VPSA 3QP9A 1H6BA 1T4DA 2PR2A 3Q3CA 1YVEI 1TEHA 4BHTA 3E48A 3UCEA 3N7UA 1FMCA 1A72A 4E5YA 4BO9A 3FR8A 3QWFA 4XX0A 4ZU3A 3OA0A 4QX6A 5TNXA 1X0VA 3PJFA 3OH8A 3ZWNA 1IHXA 5T8KA 1YL6A 4N5NA 3B1KA 4HY3A 3DBRA 4N7RA 4UREA 4OOEA 4WEQA 3AU8A 4MJLA 4I1IA 3WQSB 1MG5A 2Y1GA 4XWYA 4FC7A 3LK7A 1X0XA 4NJMB 1DBVO 4QEDA 9LDTA 1VI2A 2O3JA 1H94A 1ONNA 3D3EA 4CM4B 2EKLA 1TT5A 3M1AA 4YCAA 1ISGA 2VN8A 1SZJG 3LC7O 4N5MA 4NFYA 4PZDA 2IXBA 1WPQA 4MVJH 4DUPA 1DPGA 1V3TA 1TT7A 3B70A 5GZ1A 4CQLA 5F5NA 4DPKA 3EUWA 4PLGA 4TZTA 4WLUA 1U28A 3ZNNA 2DUWA 3WWZA 4CPDA 1OZAA 4DPMA 4ZA2A 3JQEA 1QLJA 1SO8A 4R9SA 4W9NC 5MDHA 4DPLA 3JCZA 3EHEA 2GERA 1YDEA 3WFIA 1BVUA 3PGJA 3G79A 5BR7A 3E8XA 4R1NA 3UXYA 2IYOA 1IPEA 1L7DA 1P1JA 1PS0A 2NNLD 5IZCA 4CV3A 1CQIA 3ZWMA 4KQWA 3AY3A 3QVOA 3GGOA 4BO5A 1HL3A 4J90A 4JIGA 3H4VA 5I9MA 1F14A 5ILOA 3V8BA 1YRLA 4K1LA 1UAYA 2W2LD 1HDOA 4YT8A 2BHLA 2P9CA 5A5EA 3F47A 4LSWA 3WIEA 4P8RA 3BZUA 2J3IA 3SLGA 3GC6A 3HADA 3U9LA 2IE0A 4ND1A 3C3XA 1XCBA 4BNVA 1U5AA 1A4IA 3B20A 3TNLA 4RF4A 4II2A 2G82A 3O9ZA 3DFUA 1I3NA 3FI9A 1NYTA 2ZTMA 2IEBA 3AK4A 3IDSA 1NR1A 5CHEA 4HFJA 2PLAA 2UUOA 4M87A 1YO6A 3RUEA 4L75A 4I9HA 4QT0A 1HRDA 3V2GA 2AE2A 2JAHA 4H15A 2IZZA 4YACA 3TFQA 3PPIA 3GLQA 4IJWA 4CMCA 2E48A 4L74A 1N1EA 3HQ4O 1B14A 4J6FA 3NGXA 1CJCA 5FI5A 3I9KA 1AHIA 3CEAA 4B4OA 1GZ3A 1HE2A 2C2XA 4BNWA 2QRKA 2QW8A 3K2BA 3F5SA 1T2AA 5TSDA 4AFNA 2O2YA 2VRBA 5EJ2A 1Y5MA 4U6SA 4YXFA 4E2XA 3UW3A 8LDHA 3WS7A 3DOCA 3L6OO 1PGPA 1YB1A 2GSDA 3GQVA 5CEEA 1MA0A 3JD1A 3KOUA 5DCWA 3E6AA 2EKQA 4XQ9A 1DIAA 3AI1A 1ENPA 2EW2A 4TMFA 5JBIA 3BTUA 4FFPA 5JCXA 1LTHR 1IY8A 3GOHA 5CDGA 3V5NA 4GPD1 1MXFA 2HJSA 3QV1A 4GGOA 2CFCA 4JK3A 4BNNA 4D44A 3AFMA 4GX0A 2Y1EA 3DBLB 3O8QB 1LI4A 4XGNA 2B4TO 4MIOA 1WDKA 3ROPA 3K30A 4PLYA 1BVRA 2C5EA 2ZJ0A 1E3SA 1N9GA 4CLOA 5JMWA 3GMSA 1YBVA 2NM0A 1QYXA 1D1SA 1IZ9A 3QWBA 5DBIA 5CFZA 1R4MB 3W8FA 2DLDA 3P5SA 2A92A 3UN1A 3OQ6A 4FDAA 1GAEO 5HRUA 1P0CA 1S6YA 3BTSA 2X4GA 4R51A 3ADPA 1T2EA 5C7OO 3QE3A 1HT0A 5HBRA 5DT9A 2YV1A 2NSDA 4YR9A 5L9AA 3TOXA 3TZCA 1PZHA 3OJOA 4BNMA 5L51A 5CG2A 2J3KA 3E5RA 1H93A 3PHLA 3P2OA 4LCEA 3H3JA 4J2HA 4ZHSA 3PK0A 3VPXA 2NU9A 3KSZO 4DTIA 2O2SA 3GN1A 1H9BA 4JP3A 3FWZA 1ISJA 4YVFA 4XYBA 2AHRA 2YHUA 3VVCA 4J0EA 1N5DA 3JTMA 3HFGA 4OQYA 2B69A 1AUPA 1HLDA 1DRVA 2A9FA 3F46A 5A1TA 3DZFA 2DC1A 4OH1A 2PWZA 1BRMA 3EVTA 2Y99A 3C8MA 3KTDA 1DC3A 1HXHA 4IXTA 3ITDA 3PYMA 4O6VA 1BXGB 1R6DA 5AYVA 1I2BA 3GVPA 3WLEA 1EVJA 4RF2A 3DZKA 4NU5A 1K6XA 1Y81A 4WCDA 4YAEA 4M55A 4O1MA 3I9JA 3IP1A 4E5PA 3TJRA 2PGJA 3WFJA 2NADA 4GQAA 3BMOB 3K73O 3PJEA 2OUIA 1UH5A 3ZWBA 4WASA 4YQYA 4H3VA 1HE4A 5FFFA 4Z6KA 2VT3A 1KVUA 5T5QA 1T2CA 1EVYA 2QRJA 1K5HA 1X15A 4LVCA 3IOYA 3GZNA 1MX3A 3OHSX 2QZZA 5A9TA 3E5MA 3TRIA 3GFGA 1YL5A 2WDZA 5A3VA 2VRCA 1W0CA 4KUGA 3ZCXA 3W6ZA 4NQZA 2UYYA 1GPJA 1DIGA 3KYCB 3LT2A 2D3TA 4P38A 1GFSA 3MJEA 3IKTA 5IF3A 5CPFA 3C24A 3P19A 4TROA 1NASA 1P0FA 2Q2WA 3ICPA 3G17A 3ZNPA 1I24A 1WW8A 1FDVA 4XYGA 4EJ0A 2DBZA 1YOVA 4B4UA 3C7DB 2FPGA 4J0FA 5KWEA 3L4BC 4BO3A 4JLWA 3PHHA 3UH1A 1ONPA 2G76A 3TL2A 5JYEA 4RV9A 3FNEA 2B83A 1I30A 2W98A 1YB5A 1YQXA 2CNBA 3OEYA 3PWSA 4GMGA 3KXDA 4YRBA 1XEAA 4OQZA 1LLUA 3H7AA 3IUSA 3QVTA 3AOEC 4CMKA 3AI2A 1C1DA 5GY7A 3OIDA 2J6IA 3C7CB 1BG6A 1HETA 1PX0A 4IIVA 1U8FO 2Q1SA 3E9MA 3DC2A 1GU7A 4J1TA 4B4WA 1KETA 1NQOA 1ZIDA 2Z1NA 3T4XA 3WWYA 4LK3A 1EDOA 3ZHBA 4IXWA 2ET6A 5I7SA 3L6EA 5KJ1A 5I7FA 4CMHA 3WTBA 3PZBA 2OL4A 1HSOA 4EUEA 3U3XA 3BHJA 3I9NA 3F3SA 4FJ2A 2O3QA 1VL6A 2CDBA 3I9MA 1KS9A 4W9NA 3RBZA 1BTOA 1QP8A 2ZCVA 1YONA 2DTXA 3CIFA 3DTYA 2Q2QA 2YHIB 2ZB4A 4FFMA 2PZLA 5C37A 2QX7A 3GK3A 4CJXA 1R15A 5CDTA 1E3LA 4QUKA 4J2OA 4DREA 3FBGA 1E92A 1LLDA 3V2HA 3CPSA 1EFKA 2BFAA 4UEKA 4PIVA 4Y9DA 5BSGA 4IUYA 4XB1A 2VHWA 4NBRA 1LUAA 1F06A 4J4HA 2GR9A 4B7XA 3EMKA 4J1QA 4QTZA 6LDHA 3U09A 4YJGB 2P9EA 3LF2A 3IC5A 4BNXA 5THKA 1TLTA 2VQ3A 2BELA 2GASA 1P44A 4TZKA 4YAKA 5G0UA 3VH4A 3JYNA 1M6HA 2VWGA 4BNTA 4NZ9A 3BMQB 1ENOA 1W8DA 1GD1O 1KVSA 1PJ3A 3BHMA 3OIGA 3OMLA 2CDAA 4IY1A 2G1UA 1KOLA 1E7YA 3O03A 2NVUB 3BMCB 1QYCA 2PKQP 1Z82A 3O38A 1EK5A 4CV2A 1Y8RB 4ALKA 4EEXA 3ZWPA 1NX6A 1TXGA 3GDGA 1PTJA 2PA3A 4ALLA 1AN9A 2YFHA 3PFFA 2CF5A 3QVSA 2D4AA 4QFDA 5COBA 4R01A 2ZYDA 4YAIA 1ZUD1 4UUNA 4ZGWA 4RQUA 4S3MA 4U6QA 3U5TA 5HS6A 3KHUA 3GEGA 4XZ3A 3IS3A 2C0CA 4YJHB 4YAJA 4PLCA 4E4YA 2OO5A 1NFFA 4Y6RA 1LA2A 4NH4A 2X0JA 1QG6A 3ZDFA 2GNAA 2GD1O 3LT4A 4IIUA 1PL6A 2P68A 4XGIA 3RVDA
chains in the Genus database with same CATH superfamily
4M9UA 3ID6C 4LMAA 3ZGYA 2EJVA 3NHJA 4FFBA 3KZOA 3OFNA 5TQ2B 3WLMA 1BFKA 5HMLA 4YHBA 1ZUHA 3JYHA 1ZWKA 1K89A 4ESHA 4EY8A 1C0EA 2IYNA 4GXNA 1J8VA 3GT0A 4G67A 1USIA 1E1RD 4UNQA 4P6VF 4X94A 3ZKWB 4DV4B 1O57A 4KWEA 4M98A 1U0LA 1RADA 2FH5B 1TUEA 2PKXA 4LPSA 1OC4A 1ILEA 2HSEA 2Q3EA 2GXQA 1IVYA 1CP3A 2YBDA 3GRKA 3OPYB 3DFZA 1GTZA 1XSEA 4MW4A 2GPTA 4A8TA 2C2KA 4UCWA 5EYPB 1PX2A 1ZWLA 2GKSA 2GUGA 5JZ9A 1RT9A 2NO5A 2AOVA 4GMDA 5K45A 4DA6A 2OZPA 2FP3A 1KI8A 2JFUA 4FCWA 4P4LA 1H5UA 2ZXUA 2VQDA 4N8DA 1P0QA 4JR1A 3IQZA 4FP9A 3BHNA 4EGFA 4HADA 5HKAA 3CW2A 1X8KA 1OA1A 4PW0A 4J1SA 1XTPA 1P7ZA 1NN0A 2H4XA 2BFOA 4ARZA 2GZ3A 1X7ZB 4BNFA 5HKLA 4YO8A 3DTTA 5FUBA 4QRDA 1XVIA 4E94A 1DL5A 4TL9A 1BU5A 1Y6RA 2HXSA 1UQRA 2ZJ6A 2ZUBA 1T4MA 3ASZA 1LZLA 1W9MA 4K9NA 4LF7B 1PVOA 3OLZA 4AMUA 5PNTA 4KVAA 2GCPA 1L7OA 4OGLA 2ZAIA 2BMJA 4FMPA 2ORYA 2J5RA 4TSKA 1ZOOA 2GLXA 3EDMA 5EE1A 1ML3A 1QLHA 2QLLA 1N2BA 3O4VA 4PNEA 3UTCA 2X5XA 1D6SA 3HVKA 3L7MA 4RH0A 5EUMA 9ATCA 2VOJA 1UMDA 4WZAA 5EXPA 5K20A 4Q34A 4ACAA 3W6PA 3AM1A 4RU1A 1BMFA 3MJVA 3VVMA 1U3CA 3STHA 3URKA 4IFIA 4OU4A 3EWAA 4R1TA 1KXZA 4L8FA 5CVEA 1TU3A 1YD7A 5U1PA 5J58A 1DI0A 2P78A 1N5OX 2NVOA 3Q2OA 4U0JA 5EMHA 3STVA 2AOXA 2UKDA 1GGEA 4N0PA 3P2MA 5AXCA 1FDUA 1FUEA 2J9FB 1W46A 2GFHA 3KJEA 3QFRA 5T4BA 4M38A 3U13A 4IGAA 3RKRA 1OPXA 1XLVA 2GXSA 2CVHA 4V0QA 2VSOA 2V97A 3ASVA 1HDCA 1DAMA 2PT6A 4G5HA 1Z8DA 2Q0HA 3KUUA 2GHTA 3M4ZA 3NBAA 3QMWA 4NBKA 5A4FS 1NVBA 4YGYA 4OK3A 4DBZA 1D0SA 2VXOA 5JZSA 5KTNA 3EZLA 2RGDA 3D6FA 4ZQBA 5EKUA 1L5QA 5DPMA 3J7AC 1O89A 1Z16A 3ESYA 3ICCA 3D3JA 2RGNC 3I2JA 1I5EA 1N2CB 3OJWA 1HT3A 4PAWA 5EZQA 4Z0PA 4F5ZA 3QM1A 1NN1A 3IEIA 5KTKA 3AF0A 4CF4A 2WZDA 1CZNA 3RANA 1KI6B 2R1VA 1WF3A 1UBEA 2X58A 4WA7A 2CK3D 3R2JA 4I8XA 4X8MA 3SC2A 4AQ7A 3THXA 3U44B 4R54A 4A8JA 1XB2A 3IP5A 3QGMA 4UMEA 4AJPA 2QT1A 4AJIA 1JKJB 1WZUA 1R64A 4B79A 3NAQA 2CEAA 2QLTA 5AKHA 1AU9A 4WWHA 3FGNA 1X7GA 1OKKD 5E8RA 3ND5A 5F4ZA 5HX7A 2RHRA 4HDSA 2B92A 3T1OA 3ETNA 3GLFE 4G0UA 4EF4A 4C4SA 5IXJA 3PI7A 1T5SA 4DMMA 1QGUA 3TZLA 1G8HA 2QP4A 4K9OA 1TA4A 2WWFA 4ZARA 3T5MA 4B3XA 3IDFA 5CXUA 2OZLA 2QN1A 3E2PA 5BUSA 1H6CA 3IMCA 4A9AA 1SVIA 1FFCA 4X6YA 4JENA 4FDLA 2DTEA 3C43A 3RRBA 3DQZA 2FPUA 4P7BA 1I7NA 2QYSA 3D8HA 4RMIA 3ZH2A 5K8LA 4I1SA 2FZCA 3AB7A 3H2IA 2ZUDA 2Q2OA 1LF0A 1NXPA 4PF1A 2Y3IA 5H68A 4C7JA 4DV2B 2BP7A 4MVJD 4HT3B 5A03A 1CS4C 4ZANA 5F3WB 1WCWA 4ZXFA 3LP6A 5L3QB 2UUAB 1ILWA 4WKGA 2B8TA 2HADA 5DNAA 4D3XA 3L9XA 2J3QA 1VLVA 1CUCA 1JQEA 1W94A 2WDPA 2PSSA 3HDHA 4ZTUB 3NX4A 1M2HA 3MUFA 3QUCA 1KI9A 4W1QA 3DT6A 3UGTA 2JATA 3PGVA 4KFSA 2BV3A 4A0QA 3KOWA 1JIXA 4JHXA 4P54A 4BEVA 3RRYA 4ENRA 4HDNA 4MWGA 1DSSG 4U9UA 2D2FA 4XJTA 4AI6A 2QW1A 1P0IA 2IHBA 5FL3A 3PEEA 4WA8A 3EZ2A 3W6OA 3EARA 4B9AA 2OO7A 3BE8A 3LUAA 4OXNA 3VX4A 5JD4A 2LW7A 3QOFA 1ULSA 4F7WA 1CRLA 1H2HA 4ZFNA 4MAMA 1SHJA 1MJGM 3DXYA 4LRXA 4BJ5A 2VC2B 5DWQA 2ZBQA 1H1DA 3G0IA 4GP9A 2LPMA 1HSZA 3EZFA 2PUEA 2OHJA 4S1WA 3THWB 1B0AA 2FHSA 4OQEA 4KBFA 3O4HA 4U39A 1QPBA 4XYEA 4ZYYA 3AXTA 2FFJA 3DPSA 2R65A 2VSQA 2NAPA 4UD6A 3WKBA 3KC2A 2ANBA 2Q3DA 1MDBA 2GILA 2VG8A 2WP8J 4I5FA 4JP5A 4KPGA 2WPDD 3W2GA 1JWLA 3MJFA 4FKBA 1V3VA 4FOSA 3RU9A 4B80A 1W4CA 2JLSA 4IMIB 1U8TA 3B7GA 1TKBA 1CEEA 2F8MA 3C6MA 3V2UA 3OF2A 3R9KA 3PUVA 3HNRA 3QPUA 4IGKA 4WXMA 1O1YA 5D86A 3KVRA 2JH3A 2XR1A 3PQEA 1Y6QA 1KAEA 2NU7B 1K8XB 2JGDB 4FS3A 4EEKA 1A27A 4TUYA 1R0KA 3ZY6A 4AP9A 4S0XA 3B12A 1QFJA 3PJGA 2QN2A 4XQGA 2QQ5A 3RJ9A 3WSWA 3WWEA 1G2IA 4U7PB 4X1IB 4F2GA 1MO5A 4B3BA 1V47A 3ABOB 2CCGA 4QGAA 4IDPA 1CERA 2H2IA 4UBLA 2BT4A 3BIJA 1T8TA 1LX6A 2W37A 3V4FA 4HDKB 3ONFA 3WLAA 4XOUA 2FK8A 3WBFA 3DNPA 3U7QB 3K0CC 3EG5A 3IEXA 3U48A 4DDWA 2CVQA 1XZHA 4MB2A 3UKDA 4ND5A 3ZHVA 3OP1A 1NPYA 5L6MB 2AT1A 3PFKA 4PNPA 1C30B 2H4FA 3V80A 1FTGA 4H7FA 1J22A 3G2NA 3AF6A 4MS3B 4U5XA 1LQ2A 2EC5A 1OHHD 2HIHA 2VUTA 2X4DA 4BC1A 2ZI3A 2II6A 1TEZA 2ZQZA 4X85A 3MWLA 3QTLA 3CT6A 3R24A 4M9ZA 3EZYA 3T06B 4M1SA 4EUSA 5E6RA 2LVBA 3JQ6A 3GFTA 3MMSA 3W5DA 1BDBA 3T7TA 4KN9S 1JG3A 1K6MA 3MSCA 4M76B 4C03A 1DTEA 3BHIA 1Z68A 1WVGA 1P4SA 4H7DA 1X2BA 4TV8B 4D9BA 2C84A 5FPYA 1E4YA 3HYNA 5EZ5A 5FI3A 1RYYA 3KDSE 2I7VA 2O9JA 4Q24A 2EL7A 3GGSA 5BQFA 2WTXA 2B1RA 3PE6A 1JBEA 3BFKA 1WX1A 1Y1PA 3QKRB 3P9IA 4KE8A 2BM0A 2WABA 3M2PA 2PH1A 1GILA 2IOFA 3B13B 4MWBA 2ODAA 4UM7A 5I3ZA 2HK9A 1ZMXA 2Z95A 2FMIA 3ESZA 3R3HA 2I6GA 4IMPA 4ZOBA 4M9QA 1W4LA 4WXHA 4BGVA 4BX8A 2I6TA 4X61A 1HE5A 3NOXA 1ISHA 4KG7A 3DTVA 4QIHA 3ZTYA 3A32A 3EMBA 3IUEA 5JDCC 3RU7A 5DN6D 5HKKD 1J49A 1T34A 1FS6A 1CF4A 2W2LA 5KTOA 5KAPA 1PUIA 4M3NA 2W43A 2J0UA 4Q16A 3WGNA 1D9ZA 4HCJA 3CISA 3QXSA 3WYNA 1NTOA 2B4RO 2AW5A 3RYFA 5KNLA 1X1EA 2JANA 3BQMB 4IH4A 1IEWA 1LK7A 4YJDA 2QQFA 2HYDA 2NN3C 2FY8A 3NASA 5ICEA 5EWLB 1VLHA 2H3EA 1EAYA 3FYHA 5CU7A 3IP8A 2R6DA 1IK6A 1XTKA 1IXKA 2X1LA 2XXAB 2I8LA 4UU8A 1HDGO 2V4ZA 4CMEC 6ADHA 1KMHB 4QM7A 1PSWA 1NG1A 2BGRA 5EUBA 2I2FA 1EA7A 4MR7B 3RGWS 2R8ZA 3PGXA 1PG5A 3WYCA 4BYMA 1J33A 4CI9A 1QV7A 5IM4A 1ZD4A 3ZI0A 8AT1A 1OOEA 3HDJA 3GMIA 4DQUA 2V74B 1P4JA 3WGUA 1QVAA 1KH3A 3FKSA 2YWFA 3QUAA 1X7WB 1JPNA 1XI2A 3SSNA 2QIOA 4AJ9A 1LVHA 1ZL2A 2WU3A 3BE4A 1EX1A 3L9WA 5TMDA 4Z53A 3REQA 1LNSA 2PX8A 3WKDA 4O1HA 2WWGA 1X1DA 4FSXA 1HEIA 4B7UA 1J2RA 2R97A 3CZMA 4JOCA 4DT1A 4D0SA 1JYSA 4KKVA 4DCNA 2OMEA 4BMSA 5CVTA 3PWTA 3O4RA 4FEGA 4HVLA 2ZIWB 1VCHA 3GGCA 1O6ZA 3WGQA 4EGAA 4IDDA 2R66A 2GZSA 4Y2YA 5IFLA 4BZWA 4R8LA 3KU1A 1M0EA 1X9IA 3L6DA 2KB0A 1AC5A 1RKXA 1XDUA 2G0NA 4CMJA 4N5DA 4OHWA 2XE4A 3Q5DA 4BS9A 4WPGA 5JARA 5FPHA 4DXAA 5A3JA 4RENA 3FD8A 4IHQA 3WTCA 1GLNA 4J7CA 3HB9A 4ZK6A 2ZJOA 4C7OA 4B9EA 2XUPA 2PT5A 3CZPA 2AEMA 3H1EA 4AYTA 3RS7A 1M8PA 2XECA 5KHAA 2VDVE 2QSYA 3LQRA 4JBLA 1W35A 1USUA 1ULBA 3L79A 5C7YA 5K0ZA 4G5QA 3WIVA 4MRVA 2J87A 1UBUS 2J7PA 3N2IA 1K4KA 3L0BA 5CVVA 1PZGA 5ABPA 3K8QA 4ETNA 1HURA 1Z2CA 4G56A 2XWPA 3L8MA 4JEUA 4OEHA 4DLPA 1NVGA 1OTHA 2C2YA 1SEPA 1I2CA 4RHEA 5FF9A 5BWNA 4BASA 5C5EA 1U11A 3I62A 1K88A 3RRJA 4GEGA 4RK7A 5AT1A 2J5BA 3P9SA 1QNFA 2P6UA 3ANLA 3FAZA 1Y8QB 4X63A 5B36A 2W42A 1H23A 3VR5D 1XNGA 2BMDA 3JATB 4I6GA 4NYIR 3GJ8A 2PFSA 3NQ41 1V16B 3D4OA 3GH3A 3PYLA 5FP0A 4A2PA 1AM4D 4TKLA 1R5NA 4X8LA 3MGKA 4OHOA 4TTJA 4WOJA 2VTVA 3KQSA 5E2IA 1EKXA 2CCJA 3NDBB 1JR3A 2QTWB 4O33A 2BKXA 3TBKA 1XZNA 2YIJA 1H9AA 5KB3A 2H4ZA 2SCUA 2C5FA 1KAGA 3MT0A 3E3NA 2FR8A 1ZNWA 1HG0A 1YS4A 1BQ4A 1XKTA 1SURA 2VI5A 4ICIA 5D3MB 1OTYA 1DU4A 2WBLC 2DZDA 1N0WA 2YIDA 3Q7SA 5DX1A 2X0EA 4I08A 1VLLA 4JJ4A 2RJNA 1P7CA 2HM7A 3E1SA 3HMQA 3H2YA 3LP5A 2FLKA 5BSVA 4RPIA 1D7AA 3FNFA 1TZCA 2JLAA 5HIIA 5DMHA 4CMGA 1BX1A 1SFRA 3W79A 4NICA 3V32A 5HKBA 1QRRA 1T9GS 4XIJA 1GCOA 3QYAA 2L17A 3BKXA 4UHKA 5LZ8A 5A9SB 1V95A 1JQJC 1ADFA 1G21B 2G28A 2PKYX 4HI0E 3RVLA 4BTEA 3DLBA 1BWRA 3DKVA 3PNOA 4H31A 1NNLA 1MGPA 1WCV1 1YRAA 1Y6JA 2GEVA 4KDFA 2QVXX 3NPAA 4Z2YA 3LPLA 4JEIA 1RZUA 4JWKA 1W4RA 2JIQA 5J59A 3G85A 2IITA 1CY0A 2GD2A 3CCCA 4HMOA 1IVNA 4RESA 3D2BA 2XCTB 3EVDA 1GCAA 2VH2A 3TW6A 1KQNA 3V7UA 1JWBB 1AKNA 1RWPA 4CV0A 5TX7A 1IOVA 2REBA 3HWRA 4PRKA 2BMWA 3PZRA 8ATCA 5FBQB 3W3AA 4JI7B 1MRZA 5FPQA 3NHSA 3DLIA 2JGJA 4L5BA 5GINE 2C9YA 1SIBE 4E31A 4RV5A 5EHQA 4Q3AA 2XTMA 1OV6A 2AD5A 4P7JA 4G8CA 4YP5A 3NYQA 4MUAA 5AI9A 1XNQB 1AHHA 1MV8A 2WIKA 4KOAA 4U00A 2B0JA 4WLFA 1I01A 2BH9A 4FQ5A 2D59A 1N9KA 2P2YA 4KFTA 1NVXQ 2ZU6A 4WY2A 4INOA 4CKZA 4GECA 2CJFA 2QYTA 1CRZA 2V3VA 4E33A 4M0UA 2CYBA 4YP0A 4O4JB 3TS1A 2I2WA 4MVCA 4WKCA 5F4BA 4AJKA 3AL0C 4GI2A 3PNPA 5B3AA 3K9WA 2XGJA 1T1GA 3IMEA 2GN0A 2PRJA 5EJGA 4QAQA 3RRXA 5JAZA 1J24A 3S99A 3BS4A 1W0KA 3BZWA 3BCSA 4IIJA 4DJTA 2POCA 2E4VA 4GLLA 3EPRA 3CUTA 5HK9A 4GX1A 1TYZA 4WLNA 4BVJA 1F8UA 4CLHA 4D1YA 3QIAA 4IILA 4D4GA 1XVTA 2IIBA 1DXYA 3QX7A 3G8DA 4MDYA 3EPPA 4ZQFA 1FYXA 2GCGA 3ULKA 2WUEA 3UHAA 2TMKA 3BL6A 3E61A 4JQSA 1RXUA 1UDXA 1KMCA 1FMJA 5T57A 3WRWA 5E6SB 2ONYA 2XWBF 4MQBA 5AFSA 2D00A 5KSYA 4GBMA 1U3TA 3NM5A 1N0VC 2BR3A 3TKYA 5CD1A 3CUSA 5AQ1A 2NVWA 1TUGA 1K68A 4COOA 3A9SA 3L3BA 3QJGA 5DX8A 4ZI7B 4LJRA 2W6ID 1MNAA 3FA2A 4CT4B 1TTHA 3A06A 3P45A 4LZPA 3TL3A 4XPIA 3FLAA 4GQIA 1M8JA 3HZOA 3TQSA 3L7YA 1N92A 4PLWA 1FE8A 1Q20A 1PJ4A 4CG3A 4D46A 4D74A 4D8XA 3QELA 3U4GA 4M36A 1V5GA 1GR0A 1KTVA 1YZTA 2P1DA 3EAFA 3N05A 3H99A 1RWBA 4U2BA 4YT5A 4HUTA 1I13A 3HY3A 5L95A 2AOTA 2IEIA 3KPUA 3OQ1A 1EA5A 3OWHA 1J9EA 5CT6A 3UXMA 2VUSA 3WRYC 3LC0A 1AT1A 4CMIB 2HRRA 1NNSA 2NU6A 2DBQA 5DTJA 4D2IA 4FHZA 1L1QA 3U9SA 2EW8A 3HUFA 3TBFA 1EMDA 1G6KA 1P75A 2Z58A 4NIMA 4RA9B 4XVRA 1B3BA 3ZCVA 4C4YA 3HBLA 2HRZA 4AJ2A 1GO2A 3GEBA 4XCXA 2PBZA 1Z7GA 4L76A 1S2GA 3TLJA 2AXPA 2ZSAA 5DP1A 4A26A 2Z57A 3NGMA 2RIRA 3MJHA 1HLPA 2VRCD 3RHZA 1T6XA 3GB9A 3V9AA 2QNRA 2J3DA 2F3RA 4I9GA 2IKSA 4GVLA 4OHUA 1N78A 5AICA 5KTRA 3AKCA 1QGYA 1U9ZA 3S28A 2I8CA 2HGZA 4PHGA 1DO2A 5AVVA 4GKKB 3N76A 1RRCA 4PZEA 3T5CA 7MDHA 3GLFA 3IMFA 3RAPR 1K5DA 4OJMX 1UXJA 4Y2JA 4K87A 3TDMA 2FU5C 1TA9A 2D1TA 3LC2O 2C29D 4KE7A 4RJTA 1BOFA 5EEGA 3ZE0B 1RYNA 1OYOA 1ZBQA 1YB4A 4JKYA 5KNCD 3RVBA 1FTYA 3HR4A 5D6NA 3TD6A 3EIEA 1Z28A 4W63A 4EVQA 5HRCA 1I4WA 4FM9A 2M32A 1BKDR 5AESA 5CDYA 2JI8A 1GL9B 5F7ZA 2ZSKA 3A6EA 3NDJA 3KQWA 2XUIA 3IJRA 1FQWA 4REOA 1V8ZA 2QTVB 2YZGA 4BP8A 3MUEA 3FM9A 4G37A 3CRVA 4AT1A 3ADBA 1Y8RA 5L4LA 3PX2A 4FJ1A 2GZHA 3I4CA 3P1JA 3I04A 4TXJA 3NS7A 4Y9UA 3PKIA 2WM2A 2FPIA 1HI9A 2JLXA 1U7XA 4LDQA 3MS2A 2PZEA 3B9BA 4E21A 1P19A 3WAGA 2WAAA 1XDSA 2XQVA 4ZQCB 2YV5A 5FFNA 1RXIA 4YO7A 1M7HA 2FPWA 4U0KA 4HWTA 3W7VA 2OQIA 3ORFA 2Z0MA 4NDNE 3PUYA 2G9VA 5ITSA 2O8BB 5A4IS 1UF9A 1W88B 3GU3A 4CZ2A 1A0OA 1QFYA 2PMFA 1ZU4A 3HTXA 2X13A 4DZRA 1Y8CA 2AKAB 2FMXA 3BH6A 2RAVA 2YQ4A 5BVHB 3JQAA 5JNRA 3AEUB 3MGAA 4W6ZA 3SS9X 5TC4A 3ZKWA 1E5QA 2PH3A 2ZJ1A 2NTYC 4MKFA 2C04A 4X7MA 4UOQA 5COQA 4G5OA 4A6DA 5TS3A 3N2KB 3FJOA 4RVSA 4K2HA 3OPYA 3SPXA 5GPBA 2Q6KA 1M5UA 1LC0A 5EYPA 1XFAA 2DFLA 1OW3B 2Q9AA 2N75A 4ZCLA 5KVCA 4UASA 1WE2A 5FNVB 1JG4A 2A5LA 3N70A 4JUBA 2A67A 4K9MA 3TB4A 3PI6A 3I2IA 2JCXA 2CD7A 4N18A 4XRGA 2WU4A 2UUCB 2DBRA 2HMAA 3QLJA 3UAXA 4MQ5A 3CLUD 3CZRA 4GZ3A 2H63A 1OXVA 1P4AA 3TIFA 1QGAA 4GOKA 1YWGO 3MWDB 2PE5A 3C45A 1L7MA 1VLQA 4GMHA 3GN2A 2FOIA 4KIUA 4J75A 4NCIA 3V33A 5IEBA 1FXSA 1L5OA 1YUNA 1RHQA 2PV0A 2A4MA 1XZEA 3KYIB 2JVKA 3M0EA 3BGDA 5AHWA 2FYTA 1F60A 1P1FA 1L4HA 4GGMX 5CDFE 1TPZA 3QJ5A 1XU7A 1XZCA 2JBAB 4CE6A 1H9CA 1KS2A 1WXDA 1RQXA 2DF8A 3ZWYA 3FTPA 4XSGA 2KX7A 4DV7B 2H5LA 1MTZA 2FSVA 1KSFX 2ZSHA 4MA5A 4P2GA 5CGQB 4AJJA 4GBGA 4N9QA 3HXTA 3UNXA 1T8SA 2B1IA 3GUCA 2GF2A 4QD3A 2QUIA 1UKCA 4IJUA 3SX0A 3OBBA 1X87A 5PGMA 2MR5A 3Q41A 4D42A 2P6RA 1KBOA 5B58C 3K70C 1U0RA 5TJHA 2O3RA 2OGUA 2R8RA 3SFVA 1E4VA 4NBLA 3TTSA 1FIUA 1FMFA 3MZ0A 5DO9A 5JAPA 4FOOA 3R23A 3R4CA 3G9QA 4GPIB 4PBRA 3A4MA 2C8JA 2FE4A 3A4YA 4OJNA 2OLEA 3K9QO 4NXNB 2HY7A 3ZWXA 1PZFA 2FWJA 3MJRA 3U62A 1OFUA 4L78A 3PX7A 2WF9A 5A0TA 3MIZA 4CLEA 1L5KA 2BTQB 2PPVA 4JI0B 3BFPA 1E0SA 3NT5A 3T7CA 3OZUA 1N2CA 1HYEA 3CVVA 3D2AA 1FDIA 3C6XA 2QEQA 3C4VA 4ETIA 4TQUS 1O97D 2XNCA 2CXSA 3V1TC 2XAAA 3DDNA 3O82A 3R3YA 4JJGA 4UDNA 1KI6A 1OUMA 2SHKA 3H1AA 1U2TA 4IFEA 2EQBA 2WT4A 3NDIA 1AQIA 4LGVA 4MUHA 3WMXA 2JLYA 1W2GA 4TS3A 3C1TA 3VZCA 4M99A 1VJTA 1D2AA 2PXCA 5IULC 1SCUB 1YCDA 5J63A 5JZVA 1HH4A 1GQRA 5LCXA 3LTNC 3I6QA 5AIAA 4HDRB 1ZVJA 3CW9A 4H77A 4P35A 3A3OA 1FQJA 3FPSA 3JXEA 4PGMA 1I7SB 1MOZA 3W5AA 3OZDA 4PN7A 4X7RA 2DUMA 4TV9F 5AW2A 3CVWA 1U3UA 4ALNA 2D1FA 3L7JA 1LTQA 1UK9A 4DLBA 4JP1A 3DEJA 3H8WA 1N57A 1E61A 1GZ4A 3CF0A 3NBZC 3BF7A 4B09A 1I2MA 3AY0A 3FUTA 3A6KA 3LWNA 3ROQA 3RUDA 2CXRA 3AIIA 5EPOA 4EI7A 1FC0A 3OIUA 1F0KA 3DMTA 3VVLA 1NDQA 1U6KA 3L41A 5EL0A 1BYUA 1EP3B 5L3QA 1TAQA 3U4DA 1L5SA 3SS7X 2Y0BA 4RHCA 1O5TA 2XMBA 3CONA 3BIOA 4M9SA 4OKSA 4XIIA 3BRCA 4XW2A 3D5QA 4G9BA 2QF7A 5A6SB 3RGGA 1E1CB 5JAQA 3TG2A 3LT1A 2AQKA 3DDUA 5KJCA 4PVCA 1MRSA 4IHJB 1LF5A 4RV4A 4F3CA 2GZRA 1W5FA 3FRIA 4RY8A 4XUGB 1CJVC 4LJ6A 1UEIA 2CNWD 3I83A 1BA3A 1D1TA 4KFUA 5ISMA 2MOKA 4P3XA 4Z0TA 3CBQA 3FSJX 1KXJA 3L4SO 4H0CA 1WKVA 1WXHA 4G85A 5EE9A 5C8XA 1KL7A 1SU4A 3KSBC 1VE9A 4RZUA 3ZU4A 5LZ9A 2AQHA 1NUSA 1VP3A 2ZBGA 1Q7BA 3KZKA 3NVDA 4MKRA 5ICCA 4KQ2A 1J0XO 5JZOA 4ZC1A 1UQTA 3THWA 1Z5GA 1JDSA 4ASUA 3LQYA 4KR6A 3PC3A 4K6KA 4BRUA 4YJ2A 1UBOS 3HYSA 2CUZA 4NMHA 1CYEA 5IT0A 4OQNA 1E2EA 3HEMA 1Z18A 4D9IA 3SQMA 3AERB 2R96A 2JFOA 3LPMA 2JFZA 2RHHA 3P32A 2YZMA 4FOLA 4MWSA 4PHCA 5JD3A 3V34A 3QSYA 1TJ5A 1M2EA 1QZXA 2Q6VA 4FILA 3HXQA 1T24A 4B3HA 1S4MA 4B3JA 3BB1A 4PS1A 3QPAA 1B00A 5B2FA 1SQFA 5KNDA 2Z6VA 4J8PA 5AVKA 3RVOA 4K8OA 2W4QA 1RPZA 2JGDA 1IMOA 2AQ8A 2E4XA 4DNQA 1QZZA 1VGQA 3DZHA 1WS6A 3PPYA 5SZIA 5KYWB 2XB9A 2OCGA 3HCRA 5CVDA 4D3YA 1ORIA 2GRUA 1OLXA 3E7DA 3AHHA 1XAJA 2XV1A 5IC5A 3RJMA 1IZZA 1EK0A 4X1IA 4E6PA 5JFGA 4DHEA 1GZVA 1XWWA 3G0OA 3OZSA 3V00A 4FCTA 4WXRA 3N07A 4TTVA 4AJ4A 4C0QC 1M5RA 4B74A 4BLUA 1GIAA 5ALWA 3PVZA 4HDKA 2QTNA 3HDGA 5JFTA 3U7QA 4DQ0A 3FY4A 2BGGA 1OZGA 2VWPA 3LHSA 3A1DA 1ZA1A 4DV1B 2C8KA 1C30A 4PCUA 1IFXA 1TPYA 3ETHA 3ERCA 4J0IA 1ISSA 1VZ3A 2C78A 1T0IA 1GADO 3NHRA 1Z88A 1GPYA 2SECE 2YOGA 3I01M 4MS3A 1KE2A 1KYZA 1PJTA 2CUKA 5C4GB 1SQ5A 1YRWA 2ZSBA 1ZJ6A 4II7A 5TMBA 2FX3A 1F17A 3L4JA 1IUKA 3AEQB 2GLTA 3B6EA 3KPWA 5HS4A 3FBWA 1UK6A 3KT0A 3G3EA 2I6XA 4BUJA 5IYZB 2PZMA 3M9WA 4E88A 1PW7A 3EDQA 1CXZA 2E6UX 1MDFA 3C98A 1M1YB 3CGGA 4XQCA 5F9HA 1U9IA 1MHPA 4C2TA 1DT3A 1E2QA 5IDVA 2W83A 1MMFB 3E3AA 4UQLA 2QP9X 1SXIA 1XXLA 3CXRA 2VPPA 3PQ6A 4LCBA 4ZVRA 3IEMA 3GR6A 4CQMD 3QKRA 4U7DA 2OHOA 1JVBA 4TRMA 3I5YA 3B38A 2V7GA 2BBWA 4UMVA 5LU8A 3AEXA 1YBFA 1DARA 2QJOA 5EIWA 2ZIVB 1JECA 5GV7A 3IV9A 5CB0A 2JLWA 2YW9A 5HUQA 3N6VA 4FLFA 4E08A 1BEEA 1BMTA 4FGWA 2I1WA 3A14A 1XTQA 3MWEB 3DAGA 4ZZ2A 4KC0A 5F9FA 4E13A 1QOZA 2TMDA 3LLMA 5CUQA 4B7ZA 4DCMA 5CA0F 1L4UA 4MS4B 1G5QA 5GAJA 4DBVO 1WMBA 1P4GA 3TX6A 4BBJA 5JC1A 1PDVA 2SKCA 2PVPA 4JFRA 1C8BA 1XDBA 2XXBA 4WNYA 5C1OA 2HNAA 4F38A 3GZ4A 4TVKA 3GVHA 4OIMA 4OKIA 2ZRBA 1WXXA 2FTKE 2C3YA 3KLPX 2VYQA 4YY3B 1KOFA 1B6GA 1YUBA 3R7AA 2E82A 4IFBA 1VE1A 1M34B 4W99A 3K1ZA 2P9YA 3AZQA 3DPUA 2XMZA 4M49A 1Z4MA 2QMEA 3D1VA 5EWLA 5BSTA 4XSHA 4K3VA 4CM3A 1N5KA 4FI3C 4G2TA 5KJ6A 1Y9JA 2QLFA 4OAQA 1LRLA 4J29A 4EQ6A 2QMUA 4ZO8A 1KMHA 5C52B 3AUAA 3CV3A 4CXMA 4JB0A 3F8WA 1RRFA 3HJFA 4NYJR 1XTBA 4OI2A 5FOQA 2DFKB 3PTZA 4G4SP 4QUBA 4Y6SA 1UC9A 1UWKA 4ZEOA 3WZ2A 3ZE9A 1OQAA 3S55A 2J9GA 1R0RE 5I5GA 3H6GA 4FZVA 4DMLA 4B4VA 4JGBA 2JKVA 3QU7A 3DWFA 3NV9A 3ZXIA 3RRFA 4QBHA 4OXRA 3MRSA 1T9KA 2HKIA 1OD6A 3K4PA 1ZKDA 2VQEB 4CQNA 3MAAC 7REQB 1UP7A 4RTQA 4XX0B 2ZTSA 5IAJA 1ZD5A 1PR4A 3QPBA 5ALEA 2BUAA 3OICA 3VKUA 2QTAA 4MVJF 3WE7A 3V4LA 9ABPA 1M8GA 3DHYA 3OE7D 4D57A 2X5KO 2JI6A 1OA0A 3LL7A 4KXNA 2NAFA 1NNUA 2GWHA 4DUGD 4ENSA 1E1MA 1FXWF 1PFQA 1XCOA 2E4ZA 2O4UX 4MO2A 4UOZA 3WGIA 1KOGA 1DZ3A 2XTAA 4YX9A 4L8VA 2FWAA 2O7RA 3K15A 4EK9A 4CIAA 2O8NA 4V03A 1XAIA 2C03A 2R4QA 4I8DA 3ABQB 2VEOA 4QECA 2JCGA 3U31A 4EO4A 2VP0A 4PSUA 2YHAA 1SXHA 1JFLA 4MVJG 2XADA 2J3LA 2PLNA 2QPTA 1O6CA 3HP7A 3I3SR 1GKUB 1Z8FA 2PKWA 4JKIA 4PQFA 1DEHA 1GG5A 1LSSA 3GFVA 3R7NA 3RTGA 3VGJA 4Z9YA 4QOSA 3B6MA 1Y1TA 4C3UA 5G0TA 1GPKA 3UXEA 2HPZA 1EK1A 3MGCA 4OPMA 1BD4A 1QH8B 4RSHA 4M0MA 4V0SA 2GN8A 4R40A 3VFDA 4Y7CA 1W30A 1HLFA 3LY5A 2F1HA 5GONB 3BB3A 4L8WB 4TTAA 3WDKA 5CBPB 1ZNQO 1SQ6A 2QY9A 2YWGA 3Q9UA 4HAXA 5EXDA 5JALA 2X8JB 2ZXFA 1Y8QA 4Q02A 2EZTA 4FD2A 4EO7A 2WWRA 3PFHA 5B12A 3SYKA 2CFRA 3JATA 4MP6A 2NO7A 3NXKA 5ALTA 3MOIA 4CU5A 1V16A 3VU8A 3G0DA 4OO3A 3IKLA 4GVXA 4ENVA 1UFQA 1M8KA 3EIFA 4CKCB 2O23A 5JBNA 3A3YA 5I7HA 1Y5RA 1ZGCA 2HO5A 3F9RA 5D3MA 1Z29A 2XQIA 3EHDA 2XMCA 5F1KA 1EJ0A 4C3VA 1OV4A 1AK2A 2PO7A 3P9CA 4JVLA 3GWZA 3QTTA 4ZEMA 5HHTA 1SHZA 4CBVA 3WDLA 2GKGA 5EMKA 3H4MA 1KKLA 2RMKA 2WSIA 4PLVA 1BDMA 1A8SA 4C0HA 1WULS 5L7YA 3L1IA 4YPVA 2OA0A 3Q3GE 5JFOA 1IQPA 4OXKA 4ZQHA 3VDNB 1R6XA 2ESRA 2M6LA 3WSTA 2CNOA 4AXBA 1DJPA 1VPVA 3OQPA 5A9SA 4D3FA 1G21A 4DEYA 4HUQB 4PPQA 1M1YE 4BU1A 1FFEA 2AUMA 2B98A 1D0IA 2HRDA 3AESA 3K0FA 4WCFC 3RT7A 3X2EA 2W5UA 1PTKA 1U7TA 3OQOA 4G4GA 3ONVA 4ER0A 3MTJA 4WUVA 2XE8A 1P9WA 3AXSA 3CVXA 4KMOA 3G5AA 2WQ6A 2CVOA 4RF3A 1OBVA 4ZD6A 1VMEA 2SBTA 1AN0A 3LPCA 3FOBA 4ZCPA 1R66A 3NAGA 2PAAA 5FBHA 3OCYA 5JD6A 4O3MA 4PGGA 2L82A 1DIRA 1O97C 2GZMA 5ILGA 3VZDA 1SM4A 1PR2A 1GG8A 1XXHA 4HAIA 4BBPA 2ZU0C 5DYNA 1TJ3A 1PS9A 2G4CA 1ZONA 1NY5A 4YRGA 5LN1A 3ESCA 4K1XA 3HCNA 5J2UF 5AKIA 2GS9A 5IKXA 2OBFA 4CIDA 1A8UA 4Q3EA 1B43A 4XA8A 4R3UC 3F1KA 4UM9D 1MORA 7ADHA 1NR7A 3RDPA 3LF1A 5EGSA 2CLLB 2JAUA 1JG6A 3UWOA 2IL1A 4CODB 4DLZA 2XMPA 1JLKA 4LRSB 4EGCB 5JAOA 1TJYA 3HJNA 5AM2A 3HYCA 5DRTA 4P22A 5BMVF 3TRKA 5HW0A 3DA8A 3NG1A 3WHLA 2YWHA 4O4JA 4BO2A 5C5IA 2XB6A 5F5XA 3HM2A 5JWHA 3BXZA 3ETGA 3BWVA 1M34E 4BMCA 3QKWA 4EABA 2QD5A 3S7ZA 3P0FA 4P0TA 1WR8A 1A7AA 1EVQA 3L0PA 2IV7A 3VU0A 2VDWB 1BWSA 4WKOA 2ZJAA 3DHNA 2HMSA 2QUKA 2O8FB 3A1TA 3CWZA 1CJBA 4G1BA 4UXIA 2WJYA 2HA2A 1P61B 5A5DA 4BQPA 1P5ZB 1WMDA 3QVUA 1BHSA 3CF2A 2DQ4A 4XDYA 3JVUA 2EOAA 3OA2A 4OHPA 3VJKA 2ZM6B 4HEJA 4NDZA 1IWOA 4Y2HA 1YI8A 3F71A 3OJLA 1B6SA 2Z2KA 1DTSA 5E6SA 2CD9A 2KSQA 2RK4A 4TWIA 4HAYA 1KZ4A 3PRJA 2P27A 3VTKA 3TI9A 5FDFA 3E9YA 4DKJA 4HLUA 1EESA 3IBFA 2OORA 4TN1A 1H4TA 2ZT6A 3O8DA 4J94A 4ZKEA 4NFSA 4RJIA 4CFZA 1V4BA 4OHRA 4ZI7A 1WJGA 1U63A 4CLOB 4FLMA 1HDXA 1JNYA 1KR2A 1VJ0A 1X77A 2Y93A 4Z1MD 3KQKA 3B6KA 4R2JA 1XCJA 2GN6A 2AA3A 1Y9ZA 3K6SB 4COKA 2FJ0A 2OM2A 4IM7A 4PYMA 2PSDA 1PZMA 4QO8A 3OT4A 1NSTA 4DLRA 1VHWA 4MYRA 4BUCA 2ZZMA 3FDXA 2EZ4A 2BSXA 2V7BA 1BGVA 1E1QD 4CF5A 3DWGA 1FB5A 3M1YA 2OK7A 3WGYA 1Z5WA 1YBMA 4CMIA 1DWUA 3AP1A 2DPYA 2X0NA 2XUKA 3G6KA 2RB5A 3TOSA 3ZDZB 1W87A 4LJYA 4KTVE 4AJLA 5GZ3A 1I4DD 4RA9A 4UDYX 1U0GA 2DHDA 3ZJYA 1FMTA 2YXLA 3ZWAA 1JIIA 2JFWA 4H27A 4JDPA 4PS0A 5GVRA 1FFXA 4QU8A 1Q84A 3A9VA 1Q21A 2Z08A 3ETDA 3IAHA 3LBNA 3MMPA 5FL7D 4AMVA 4D7AA 4M21A 1G42A 1ZH4A 2V45A 2VS1A 5K6TA 1EJ6A 2C8LA 4CCSA 4DY4A 1IHPA 4R16A 1J56A 1RPAA 4PONA 5HFAA 1IQUA 5EE0A 4FPXA 1YJ8A 3CSDA 3O75A 5K3CA 3WWPA 2YJ5A 5IAOA 2JAXA 3DR5A 4NBSA 4F5EA 4YRMA 5KWJA 1QFXA 3KZMA 3QLUC 4QASA 1XEFA 2Q50A 2IEYA 2YN2A 1QJCA 3TK1A 5C7IO 2P65A 1BE0A 4EY7A 2OKGA 4GLOA 3RC9A 1ECFA 3GELA 3UGQA 5C80A 3JQBA 1TUBB 3OSUA 4RMGA 1U3WA 5GM2A 3G5LA 5IM5A 1CUYA 2O57A 3L93A 3NHFA 1PQYA 3PUZA 4WHMA 3TNDA 4Z1OA 2QTVA 4M7RA 3HA2A 4BVAA 4RDXA 3U37A 4L8LA 3THSA 2JGKA 2W2XA 3UG6A 2E18A 4O02B 4I55F 4LHXA 4BMXA 1QTRA 1SMKA 3UOGA 3GT4A 5AJXA 3LBIA 1T2DA 1MOPA 5IVDA 3ZY5A 1XBTA 4KXQA 5ALNA 2Q5FA 2AX3A 2F59A 1NUAA 3L7AA 3BULA 3JQRA 4U7HA 1ES9A 4O1IA 3VUEA 3ZW9A 2DTDA 4HZGA 5E1BA 2ADMA 3AKDA 4LI0A 4LXGA 3RWBA 4JYCA 5GJBA 3H5AA 4JJKA 2L69A 3WGKA 3OTOB 5EP4A 4EGQA 2H4YA 3WLFA 1DX6A 4KSBA 1K6EA 1QIKA 1MTOA 1A88A 2WFMA 1VKHA 4MIKA 2WHYA 1P77A 2O8BA 2B37A 1W88A 2DFPA 1IDOA 2HPAA 2OVBA 3AJAA 1GEEA 3DOUA 3NM6B 3OTWA 3VNSA 1KEZA 2ZREA 3C6QA 1V2HE 4XI9A 4OK6A 4LNHA 4EFMA 2VAPA 1QV6A 1DIBA 3GRRA 5IAGA 4TYNA 3TUIC 2FK7A 2YXEA 5JJIA 3K0EA 1IJFA 1WLSA 3NDPA 3CNEA 721PA 3H2ZA 3RF7A 4LTDA 3BWCA 4FKZA 2FXVA 3N2KA 3BE6A 4MW6A 4RW0A 5EI5A 2PUDA 1HYHA 3QA3E 3TTTA 5LYJB 2OBNA 1QO0A 1NR5A 2CXUA 2XCQA 3JWHA 3MINB 1I9CA 4LWOA 4UBJA 5JAHA 4OMDA 3QX3A 1CULC 2FPGB 3DBOB 1QOPB 1VJ1A 3IBGA 3HCFA 3EXG1 4M8LA 3U3OA 4YXWA 1Y48E 3VZPA 3ZLTA 4P33A 4CM1A 4HPJB 4TZ6A 3O8RA 3SQWA 1YZNA 2VTDA 4N0EA 2G0AA 3EAQA 4RTSA 1AJEA 2D2IA