2H16A

Structure of human adp-ribosylation factor-like 5 (arl5)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
149
Chain Sequence
QEHKVIIVGLDNAGKTTILYQFSMNEVVHTNVEEIVINNTRFLMWDIGWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ADP-ribosylation factor-like protein 5A
publication title Structure of human ADP-ribosylation factor-like 5 (ARL5)
rcsb
source organism Homo sapiens
total genus 49
structure length 149
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h16A00
1IXSB 5FOWA 5JSZB 3X1ZA 4UNSA 4V02A 4RFSA 3GLIB 3PXGA 2CL7X 2PH1A 3MWLA 1YR8A 4TLEA 1ZCAA 1ZRHA 2XNDD 5DIFA 3BERA 4ARZB 1G7SA 1G3MA 3NIBA 5JZVA 3TR0A 2JEOA 1PV4A 1OHHA 5CJPA 5L3QB 3EA5A 4KFRA 4EFMA 2HDNB 2G3YA 5CK5A 2NMVA 2XOKA 1PLKA 1YR9A 3KKMA 3TLXA 2AKYA 3WP1B 1XJCA 1ZU4A 1II8B 2Z4SA 3Q3JB 1CXZA 4DLXA 1NG1A 3U2QA 2WPDA 1GVNB 1SXJD 1MRNA 4C30A 4US1R 2VHCA 2GJKA 1R0XA 4OBEA 1KO8A 3UXMA 3RWMB 5JRZA 1E2MA 3GEEA 3OE7D 5CLLA 2XX3A 4X8LA 1KIMA 3WY9A 3AF1A 3EXAA 1W48A 2EQBA 1U90A 2FSIA 4IHQA 2YKGA 1R5BA 4ZDIA 1TMKA 4AIIA 5F9FA 1RC8A 1XD9A 1ZUHA 1L7VC 2C9OA 2WKPA 4I1OA 2JJ1A 2VP5A 4I4LA 4RD3A 3WNCA 1DO0A 1KK1A 1YJ5A 1IBRA 4B75A 2QM8A 2KB0A 5EJEA 4Y0VA 1COWA 1EWRA 1N6OA 3REGA 3LRPA 2WJHA 3W8NA 1EWQA 2F43B 1ZD1A 1KI8A 1CR1A 3TUJC 1Q44A 1ELOA 1TEVA 4IJMA 3U7HB 4JL6A 4AKHA 3I92A 2QP4A 5L3SB 2FH5B 2I1VB 2BKEA 4EQ6B 1KZ7B 5KNBA 4EIWA 2A5JA 2PZGA 3P20A 4AYTA 2JGNA 5FH9A 1CR2A 3GLFB 2GEDA 1E9CA 2JJ8A 4PPQA 4UXJA 3AV0B 4UNPA 4JL5A 3ZDQA 4HDCA 4DWJA 4O3MA 3BIFA 1TL7C 2H1LA 3CH5A 3NDBB 5JJLA 2G77B 5JJKA 2GEUA 3VAAA 2QE7A 4B73A 4P0TA 2BMJA 1E9AA 2R8RA 4DB4A 4BZXA 2GWHA 1VG1A 2XGJA 4RVCA 4OI0A 1KK3A 3BS4A 2A5GA 1A5TA 4Q47A 3X1WA 2YWGA 1N3BA 4PC7A 5DI3B 1E9EA 3CF0A 1YRAA 2DR3A 3EARA 4EPTA 2CCJA 3E5HA 4NYMQ 1G18A 2AN9A 1IY0A 3HWSA 2J5XA 4CEIA 2GZAA 2JASA 2UZIR 1FOEB 2AKAB 2WSSD 3LLUA 1QBKC 1S9HA 2XZOA 4ZCLA 5B64A 2VO1A 1XU4A 3TQCA 1BMFA 4TSFA 4OJKA 2Y8EA 1ZUIA 4AKEA 3MWYW 3WMFA 1S0UA 1Z2AA 3W8RA 1SXJA 3N70A 5J47A 1ZAKA 2PEZA 4LYAA 1Z22A 4C2TA 2BC9A 1ZMXA 2ZJOA 3OE7A 4JBWA 4WZ6A 2GA8A 2ATVA 1UF9A 4GZMA 3FMOB 2JLWA 2ASEA 3NEYA 4N3NA 3T06B 2CCGA 1WA5A 3TMKA 1KGDA 1OXXK 1KO4A 2FPKA 3TH5A 2P3SA 2ZR0A 2QSZA 1Q1EA 5TXGA 2IXEA 4ERNA 1FW6A 2OAP1 1XTJA 4MYCA 2QP3A 3TNFA 3BFXA 4M1YA 1E99A 2A5FA 5EXPA 2O8CB 4GOXA 1ZIPA 2ZRFA 1KJZA 4JLNA 4B6EA 2P6RA 1KAGA 2J41A 3VFDA 1UBEA 1GP2A 4W5JA 4U7DA 1MO6A 5F3WB 3VU9A 3FHCB 4NU0A 4OYHA 4R2HA 1ODFA 3U3MA 3ZYCA 3SU8A 1RYHA 4I99A 3W5IA 4PAMA 1E98A 2W6ID 2F1IA 3C7KA 2QAJA 3ZIAD 2YWFA 1GL6A 5JMTA 1F6BA 1KO1A 4TYPA 4M1TA 2VA8A 2P5TB 2YJTD 2O8EB 1EESA 1CRQA 2QTVB 3HDTA 4CDGA 1OF1A 2BJWA 5CM8B 3SC3A 5FTMA 5DHFA 3B85A 4D82A 3OIWA 2CVHA 2IEYA 1TADA 3MG9A 4HZUB 2Z83A 3V4RA 3THXA 1NMZA 3EIEA 1XEWX 3F0TA 5KTYA 3B7GA 3DEFA 4IDOA 4MH0R 5GJBA 1HE8B 4B3FX 1GTVA 1X3SA 3VR3A 1HH4A 1KI6A 3L0OA 5CIQA 3T5GA 4QL3A 3A4MA 4KO8A 4V0ME 4I1SA 1E79D 1NBME 2Z5FA 4LYJA 1M7GA 1XZPA 3A4LA 2ANCA 3CWQA 4L5BA 3X1XA 2F55A 2B6HA 4TWZA 2AHOA 4D4LA 1Y63A 3CW2A 1EFRD 2Q6TA 3C14C 4IFEA 2IHYA 4CIDA 4TLAA 3QKSA 4A2QA 1H65A 1KYIA 3DOFA 1P2TA 1JJVA 1UKEA 1CP2A 3SE0A 4A1FA 4C0QC 1U8AA 4KFSA 4F7WA 2PZFA 3C5HA 1SZPA 2KWIA 2ZUCA 3DZDA 1Z63A 1NSTA 2ZUDA 1HT2E 2ZJAA 4OQXA 4EPVA 3CPEA 1OT3A 2ZRGA 4R98A 2FV8A 3TRFA 2BCGY 2C78A 4PHHA 4ZKDA 4R9UC 3TIFA 3GLIA 4GI7A 3SJZA 3I61A 4OHYA 1HA3A 1E9BA 5EUQB 3ZJYA 3QF4B 4ARZA 2MSEB 1M6NA 1X8LA 4NCJA 3PG5A 3KQKA 4Q9JA 1CJVC 1QG2A 2AFIE 3TQFA 1S8FA 1ZBDA 1KO5A 4X8OA 1ZD8A 1TTTA 3LY5A 3WXMA 3U4QB 3ZGXA 2YC2C 3KFVA 5SZJA 1IONA 1EFTA 5CDFE 1CJMA 2VQSA 4BASA 4O0MA 4EPWA 4HUTA 1C9KA 1SVWA 3TSWA 2V6JA 1J2JA 1MH1A 1W4RA 2IYYA 3K70B 4LC1A 3NH9A 4BFSA 4LHWA 1HEIA 4LRWA 5KSZA 3TR5A 1G8HA 3KXKA 5HR5A 2B7CA 2WWHA 1S1CA 2ONKA 1MV5A 1TX4B 1CKEA 3W6NA 1SQ5A 1DAHA 4B33A 1M1YE 3O8BA 3CRRA 3VX3A 3EASA 2GXAA 4LV5B 4DIDA 3ZIAA 4JLPA 4DZZA 4GL2A 1TUIA 1T3LA 1EGAA 1X1SA 2BBSA 2C2HA 2YOGA 3U60B 4LBZA 5TB5A 3AUYA 5EE3A 3K9HA 1GRQA 5IDVA 4DDTA 3IKJA 1DELA 3K0SA 2GJAA 3MSXA 3CRVA 4L15A 4TL6A 4HAXA 1UBGA 4AC9A 4BLRA 1AZSC 4ACAA 2GETA 3IQXA 1G1MA 3PITA 2XNSA 2ZYWX 5FOVA 4FCWA 4II7A 4A2WA 3EZFA 3ZZ0A 3I8XA 1RZ3A 4TLBA 5G41A 2C95A 2H16A 3EPKA 1PUJA 2DHRA 1A7JA 3OF5A 4P4SB 3LVRE 1OH8A 4EQ6A 1E79A 1KMQA 2HJGA 5ANRB 4OKSA 1W4BA 4OJQA 4M8NE 3R9XA 3AVXA 2R44A 3CUEF 1AS3A 4G3XA 4GOJA 3DZ8A 4LHVA 3O8RA 3GLFA 4R7ZA 3A1SA 2LKDA 3B78A 3CIOA 1DAEA 1EFRA 4P4UA 1DOAA 1A2KC 2PCLA 3HJNA 4MUAA 1E6CA 3U3RA 4TTRA 3QPVA 4Q4LA 4WW0A 5G40A 3SR0A 3GCGA 4I1VA 1N6KA 4TYWA 1UADA 1EX7A 3LXRA 3PFIA 3AGQA 4QJ5A 1R8QA 4J0QA 2XJ4A 2OG2A 3R20A 4LJ6A 3RRNA 3PUYA 3AVOA 2CL6X 1E2NA 3A1VA 721PA 1N5KA 3N2IA 1UDXA 2PT7A 3GJ4A 3HR8A 2DWQA 3V4FA 3K0AB 4EJSB 5J4LA 2I3BA 4GFDA 4F91B 4JLDA 2O8FB 5EP4A 2OUKA 3VTKA 4MUBA 1DG1G 4AI6A 3PEYA 3BD9A 2AX4A 4NCKA 1OPXA 3VR6A 2RCNA 1JBKA 5DN6D 1ZP6A 4XVRA 4RCZA 4FINA 4IVQA 4UXIA 2W2XA 4D0NA 3P4XA 1X8JA 4Q9IA 4PC3A 4G5RA 3J81k 1DAMA 1R8SA 3TUIC 2ZI5A 2H57A 3JVVA 3U7GA 2OBNA 2EWVA 3KKNA 4A0RA 2YVUA 5E7IA 1IJEA 1AZTA 4NTZA 4DDUA 2C9YA 2QI9C 4GOKA 4RSGA 2GILA 2NPIA 3BB3A 5C4GB 3HYTA 2JLZA 1TEXA 3NHAA 4KFTA 1CR4A 5AJVB 1G6HA 4CYMA 3LO5A 4FIDA 4YMWA 5J5CA 1YZTA 1ZM4A 5LBIA 2JATA 4ASUA 2GVZC 1LV7A 4XVQA 2ZSFA 3G82C 5JEEA 1Z0DA 4LI0A 1NSFA 2O8CA 2ORVA 1OYWA 4EPRA 1ZNYA 4D81A 3ICEA 2D74A 3IPXA 2XTZA 2IYVA 2QY9A 2RGNC 5E7MA 1KI2A 4ZI3A 1W46A 2ZRHA 3K70D 5DGXA 4U5XA 2QAGC 3PUVA 2ZRLA 1QVRA 2ZXUA 5KNCA 1RJ9A 1VKJA 1XXHB 1YR7A 4JMPA 5BWMA 3C16C 3UMRA 3UATA 5DI9A 4W5WA 4CRWB 1TUEA 2GZDA 2V8OA 1ZNXA 2VTKA 1XMSA 4B3BA 3CNOA 3U44B 2JLVA 4G5OA 3IBGA 1OXUA 3PUZA 4IRUB 4HZUA 1R2QA 1HT1E 4QOSA 5JLJA 1E0KA 4M22A 2QA5A 4LJ5A 1U0JA 1GL7A 1AKYA 1GUAA 1KDOA 2XXAB 4ZCMA 2IS1A 3NVAA 1NVXQ 3GJ0A 1CTQA 1G8GA 4HZIA 3FHTA 3W3AA 2Q0HA 4KU4A 4DUGD 1N2CE 4QRHA 4JVSB 4WZBE 1ZJ6A 4PAOA 2GJ8A 3M1IA 2R6AA 4IOJA 3VMFA 3WHLA 4EPXA 3VR1A 3GEIA 3QENA 1OXTA 5DN6A 1L4YA 3WBKA 1QDEA 2FOLA 1GDDA 4BGDA 2P6NA 3QNUA 4BE7B 3AVTA 3MUFA 5AWFC 2BM0A 4HATA 5DHAA 5J4KA 2FPLA 3CKLA 2ZE6A 3IO5A 4PSVA 4B35A 2NO7A 4CVNA 2TMKA 1Q57A 2ZTSA 2FEOA 2NO1A 3L82B 3QF7A 4M1KA 4RZUA 4Q1FA 4ZDKA 2VHQA 2QTHA 2ZU0C 3IHLA 1XFAA 5IF9A 2ORWA 4V0MA 1SXJE 4BRWA 2BOVA 2GJSA 1NBMA 2JLQA 2R6FA 2RGNA 3BH7A 3FDIA 1N6PA 1A4RA 3GD7A 1OH7A 2DFTA 2QAGA 3BAFA 1G4AE 2WJVA 3B8HA 3B1YA 3QEOA 4DT1B 3VNVA 2YHSA 1E2QA 4PX9A 3PJRA 1C4OA 2QT0A 3LBHA 4Q02A 4D26A 2P65A 3L2OB 3FTQA 3BH6A 3KX2A 1GOTA 4D4JA 4BLTA 5L3RA 4RFVA 2KSQA 4OI4A 5BXQC 4A15A 2FSFA 1IN7A 3UMFA 2BKUA 2LKCA 3L0IB 1H8ED 1BYIA 3UIEA 3I3SR 4DIEA 3A4NA 2BBOA 3AEZA 3A37A 2ZYTX 3FE2A 1OFTA 1UAAA 3RS3A 1CRPA 2ZYVX 2XITA 2IF2A 1GILA 2FJUA 2IF0A 1G3IA 1KDRA 3FVQA 1GNRA 2EYUA 4Q5IA 5EXXA 1XPUA 1FL9A 1K5DA 1E4YA 1UFQA 4DSNA 2IUUA 1GIAA 2WMNB 4UXHA 4IFBA 3NC0C 1AN0A 5KSYA 1CJUC 2FX3A 2QPAA 3IEVA 3IHWA 3HU3A 2ONJA 1OXSC 2ZPTX 3SHWA 1EXMA 5BYKA 3BWDD 4K81B 3FOZA 5FR2A 4A6PA 5IK2D 1MKYA 2ODWA 5FOXA 5JHHB 1T5LA 1ZM7A 5H70A 1QF9A 2JCSA 4QBGB 2QM7A 1V43A 2FPMA 2IYQA 2J7KA 2OILA 2QEQA 4NDZA 4TYQA 2J0UB 3NEJA 1ZC3A 3AP2A 3UKDA 1T91A 3CRMA 1CJKC 3NKVA 4PSAA 2QQ0A 4QHYA 4XWAA 5CITA 4TZ0A 3I8SA 4LUCA 4LBVA 1J8MF 2LWIA 1JR3D 2DFLA 4KVAA 2CLSA 2HEIA 3AVVA 3SN6A 2Q21A 2W58A 5C2JB 1FUKA 3HU2A 1QHYA 2NO6A 3K0AA 4I81A 4QC2A 4EJSA 1TQ2A 2AWNA 3W6PA 3EW9A 3BC1A 2DCUA 3MWKA 3CR7A 1E1QD 3ZVLA 3EX7C 2GNOA 3KTAB 2PMDA 4HAZA 1RPZA 1JJ7A 4HLCA 2V7QD 4XTRA 1F60A 3TKLA 4DJTA 3THWB 1D9XA 4Q4JB 1Z06A 4B3GA 4LJYA 5FBVB 2IYZA 4IVPA 3GLHE 2ZVQX 3VKWA 2J1LA 2O8DB 4KYUA 3B5JA 4LV8B 2QPOA 2IS4A 1QHIA 3G5UA 621PA 3H84A 4C7OB 1E2EA 3B82A 2V9PA 3QBTA 4BLOA 5B2ZA 1E9SA 1H8EA 1LW7A 3CR8A 3NDPA 2ZSAA 4M2LA 5HCIA 3EZ9A 4HDOB 1WB9A 2BCJQ 1KAOA 2W0SA 4OHZA 4NL4H 3RC3A 5KSPA 5AUOB 4K46A 4B3DA 4XWOA 2XAUA 1SVKA 2ZSBA 4V0NA 1GWNA 2QSYA 3WYFA 1US8A 1XJ0A 2IYLD 1DO2A 1XMIA 1I4TD 1KMHB 5B57C 1VTKA 3I73A 4BLQA 1QHHB 3QKRA 2IL1A 3W5JA 1KNQA 4A6XA 1YZNA 3BBPA 4IEEA 1IY2A 2CHQA 4BFWA 3A1TA 3LAWA 4TZ6A 3GLHB 5HE8A 5FPSA 2J0QA 4KLZA 2B8TA 2DFKB 3NH6A 1KHTA 4RY2A 1B0UA 2MSDB 5DH9A 1ZM9A 1U99A 2F7SA 5TV2A 1N0VC 4MRRA 2OT3B 4TL9A 1ZNZA 5E4FA 2FZ4A 4OQLA 3QXJA 4C0HA 4IDPA 3AVPA 2BVNA 4ZIRA 4KVGA 3VNUA 1FMJA 4KHZA 4E03A 3TSZA 1OW3B 4GMDA 1LS6A 4MITA 1KSHA 3NBZC 1AKEA 4B32A 1Z83A 3EAQA 4QGHA 1NKTA 2E9SA 4M1SA 1E9DA 4JKYA 1TPZA 3QG1A 2ZROA 4Q1BA 3GFOA 1T3SA 1U9IC 3R7WB 3GLFE 1Q3TA 1W2GA 2EFHB 2DFNA 3IIMA 1SXJC 3JZAA 4BECA 2PJRA 1IN5A 4HYYA 3DOEA 4JBXA 4R71A 1AIPA 5IT5A 2D2EA 4WOPA 5KYKA 2JLSA 1WE2A 2IWRA 2XXAA 1YRBA 3A8TA 2IEZA 3MJRA 5H8WA 4MGKR 1HY3A 2BDTA 4AG6A 3ZH9B 1B23P 4QGFA 1P73A 1LVGA 1J99A 4Q1DA 1L2TA 2UVQA 2ZJBA 1F2TB 3WP0A 1BS1A 2ZIAA 2BEJA 4FW9A 2VLIA 4DVGA 1Q1QA 1HTWA 4H9GA 1E1QA 1CEEA 4GZLA 3OEED 4B47A 1VIYA 2VHJA 1BKDR 3AGPA 4CW7A 5LD2B 4FWIB 1I2DA 3FWYA 4KJZA 5EP3A 1XEFA 2V7QA 4UQOA 5FL7D 4JLBA 1GFIA 1AQYA 2GF9A 3M4YA 1UJ2A 4D4MA 2IUTA 2J87A 2IS6A 5AJYA 4OI1A 1XCMA 2FFQA 3A58B 4Q4AA 1KTVA 1NIPA 2ZSEA 3PV0A 5GVSA 4HI0E 4N1AA 5JWHA 1OKKD 2ZEJA 2GXUA 4LJ8A 2ZREA 1K8RA 2O52A 4YQFA 2ZI4A 4YMVA 4PQRA 5JFGA 2HXYA 1E0SA 2VSOA 2ZRMA 5KPDA 4Q21A 1HUQA 1T4GA 3THYB 2RAPA 2DWPA 1DAFA 2CXXA 1S4QA 2ODNA 3DM5A 4PHTA 1JI0A 3UK6A 5TARA 3UG6A 1NLYA 2FA9A 2PX0A 3CPJB 3NWJA 2IS2A 5GJVC 2XNDA 4JL8A 1R6BX 2XTNA 4HDQB 3GLGB 4QKQA 5K8TA 2BMEA 4D2IA 2CNWD 1PUIA 2QQEA 3P26A 3T1OA 1MOZA 2A5YB 2IK8A 3GQBA 4IDQA 5EUMA 4Q19A 3ND8A 4E09A 2OZEA 1U9IA 1LY1A 3AUXA 4CGZA 1PJRA 2X1VA 3P1JA 1NP6A 3MGCA 2JLXA 4E22A 5SZIA 4F4JA 1AM4D 1W7AA 3RS0A 1S3SA 1UEIA 1P3JA 4A0GA 3OHMA 2ERXA 4C9BA 5GADl 1KKMA 1OH6A 1EG7A 3CH4B 3EZ2A 1FTSA 4MDEA 3SHFA 2G9NA 3ZD6A 4IOKA 5LDDC 3KJIA 2KE5A 2CMKA 4DCVA 3Q7QA 2RGGA 1IN6A 2RGBA 2VP0A 1VCIA 3S1AA 1U8ZA 2FSHA 2JJ2D 2IYTA 1N6LA 4PFSA 4QHSA 1T0JB 5L8VA 2R6CA 2ZI3A 2FMXA 3GJ6A 3WNDA 2OXRA 2GRJA 3F8TA 4C0AC 1Z6GA 3U61B 2J0UA 2HF9A 2YINC 1SGWA 1W0JD 1ZCBA 1CR0A 4LHXA 1NF3A 1SVLA 2IX3A 2GXQA 3OIUA 1OB5A 1NMYA 1VDZA 2O5VA 3K1JA 1GL9B 4CEJA 5IHPA 3KQLA 3LQQA 1N0WA 4PPGA 4Q1EA 1NN3A 1W4CA 4XSGA 1YZGA 3D31A 2CLCX 3ETLA 3BB1A 2PMKA 3P32A 2ANBA 2F3TA 1ESMA 4NPHA 2A2ZA 5GJWC 1NLZA 4URWR 5KDDA 2NZJA 3RSOA 1P5ZB 3AVWA 3SBEA 3SQXA 2XJ9A 4IOMA 1GNQA 2AD5A 1UBCA 4RZ3A 5F98A 2IYRA 2DWOA 1P7CA 3EPLA 3FKSD 5HZKA 4H1UA 1C1YA 5LPNA 1Q1BA 3KTAA 2H18A 3BE4A 3QE0A 2Q3MA 2G6BA 1G8FA 1OXVA 1GSIA 1OJLA 4TTQA 5J4HA 2VP4A 4P3YA 2C96A 3AVUA 3PEVA 3HR7A 3R9IA 6Q21A 1Q1ZA 4JYBA 3QPUA 3IPYA 2OCPA 2J9RA 2GEVA 1VG0B 4KLNA 3RLFA 2VYFA 3SQWA 5GVRA 1XEXB 4Q01A 1Z6XA 2CNWA 2WSSA 3CPHA 4M9QA 2PT5A 1YZLA 3KDSE 2FG5A 4GMXA 5CIWA 5FTLA 1XD2A 3RDPA 4IOLA 5M04A 3DDCA 1JQLB 4JVLA 2Z0MA 5C18A 1TU3A 4F4IA 4ZV4A 2J7PD 3K0CC 3L8ZA 5CM9C 1II0A 3SS8A 3T61A 4JIMA 2XSZD 2QBYA 2I1QA 4US2R 2HCJB 1DPFA 4OQNA 2A30A 3K53A 4DC9A 3I4LA 3CX7A 5JSZA 2Q3HA 5JHGB 1FNMA 2FZLA 3LQRA 4LPKA 3HPQA 5J40A 3SZRA 821PA 2EVWX 2ERYA 4PXAA 2FWRA 3EPHA 2RGXA 3FMPB 2H5EA 1SVIA 5CJ2A 1KDTA 2GCPA 3GLHA 4B2IA 2MMCA 2V1UA 2CHVA 5L3QA 1FPMA 3CLVA 4O2LA 5SZKB 3PQCA 3NG1A 1WQ1R 4TMXA 2J0VA 4LJ9A 4JLKA 4KXFB 2VIIA 1MR3F 3BH0A 3T34A 3KL4A 1II8A 3L43A 3PUWA 3D6TB 1WBDA 5KUTA 2WWXA 3BK7A 3SYLA 3SBDA 1WXQA 4DRZA 5JWOA 4DCUA 1TAGA 4HUQB 5SZHB 1W2HA 3ASYA 3EIQA 3FMIA 1QHNA 1VIAA 4QJ3A 4B48A 2W6IA 4NCNA 4KCGA 1FZQA 4AWXA 3N2EA 1RRFA 1OFUX 1Z0FA 4GSYA 4JZKA 1U0HC 3R7WA 4MKIA 5KPJA 2OV2A 2ZITA 3KXIA 3C15C 2XB2A 2QPTA 2XEXA 4A8JB 1G3QA 3AH8A 4EAQA 1WBBA 2BMFA 3RYTC 1P72A 4POAA 4L8GA 2JA1A 4DHEA 1LTQA 1VG8A 2QMUA 2ZRNA 1P9WA 2ZJZA 1NN5A 4Q18A 4XH9B 4W5HA 4MDFA 2OE2A 2F1HA 2QG6A 3RS4A 4WBSA 1P9RA 2ZI6A 1DVRA 1OIVA 4XD7D 1KZGB 5A4JA 4F93B 2SHKA 3CM0A 1OIWA 2F43A 4N0EA 3E1SA 3K0EA 4IDNA 1UEJA 5FL3A 4HLDA 2ZS8A 3C4JA 5L3SA 5FI1B 2WIBA 1Z0JA 5G3ZA 3K0CA 3EG5A 4FMBB 4BFXA 1QHGA 2QGZA 2QU8A 5KOYA 1PZNA 1Q20A 2RGEA 3TE6A 5GJCA 4MYUA 1U2RA 2DY1A 3QQ5A 4D80A 4PO1A 4RD2A 2C9CA 1E0AA 1TF7A 3H1TA 1JEEA 5A5GA 4KI0A 5TY0A 1VMAA 1FX0B 5FTKA 5FPTA 2W2VA 4H1VA 4XJXA 1Z0IA 2C77A 5DLQC 3EZ6A 2IWHA 4GT1A 3THYA 2WBLC 3ONWA 4PC6A 4Y0AA 4CT4B 2F1JA 2HF8A 2HJVA 2CDNA 1NMXA 3M0EA 4OQMA 2GDJA 2NQ2C 3H2YA 1YHNA 4KAXA 1T8TA 4HB3A 3Q9LA 3AF0A 4HB4A 3CNLA 5DI3A 4RZ2A 2QMOA 4AURA 1CULC 5AR1A 2P67A 4TYNA 4OI2A 1ZIOA 4IXMA 1RVDA 3TAHA 3B9PA 4QM7A 4G5QA 5FUWA 3IEUA 4X8MA 1RRGA 3ZD7A 1KI4A 5FOTA 2A3RA 2CCKA 3AVQA 4NYJR 1RKBA 4P4TA 1P9NA 5HCNA 4RKFA 2KBEA 5DO9A 3VKGA 4LCBA 4MRSA 1RE0A 4S2EA 4YXWD 1KJYA 1OFIA 5G53C 4Q7LA 1XXHE 1VHTA 3L8YA 2IXGA 4Q7KA 1Z47A 2GXSA 4JLAA 3BXZA 4TMTA 1ONBA 4Q4HB 4HAYA 2D2FA 1YQTA 2WJYA 4O2RA 3X1YA 4DEYA 4Z8YA 2OCYC 3IILA 1CIPA 2EFDB 3OZXA 4QGGA 5JBQA 3OAAD 1W36B 1JR3E 1HURA 5J4YA 1BH2A 3Q85A 3MFYA 4M21A 2X2FA 2AXPA 2NPFA 4FWTA 4Q9KA 2FU5C 2YWEA 1T8UA 4LC0A 1EFHA 4WAUA 3MJHA 2V4ZA 4BFZA 1ZD9A 3B13B 5DISB 1NY6A 2N42A 2DBYA 2D06A 4RZXA 4PO8A 1L4UA 4AG5A 4Z54A 2EFEB 4MKGA 4RFSB 5FUXA 4DEXA 1G20E 1W47A 2CL0X 4E5UA 2CEAA 3CZQA 1IHUA 3QKTA 3X1DA 5HZHA 3W90A 3K09C 3K70C 3AKCA 1G5PA 1H8HD 2O8EA 1HV8A 4BEBA 3CONA 5FUYA 2FEMA 1JR6A 1I4LD 3KXLA 1RRPA 3LXXA 4PHFA 2V54A 5FPHA 2VF8A 4NCIA 2DYKA 1TQ4A 4CT5A 1MO5A 1MO3A 2PBRA 4LJ4A 3AB3A 3T1VA 4Q1CA 2KBFA 1SKYE 1SVMA 4ZDJA 3ASZA 3AVYA 1NVVR 1J8YF 2G0TA 1Z6TA 4JLOA 5AUPB 2ZE7A 4NKRA 3BOSA 1M7HA 3QVVA 4HLQB 4B76A 2B92A 4QBFA 4YLGA 2ZRDA 1A1VA 1M74A 2Q9BA 4BWYA 4NH0A 5P21A 3IGFA 3NBXX 2GZHA 1KNXA 3B2EA 4YDSA 1ZM2A 1JB1A 1M8PA 4NCHA 5DNYB 1XPOA 3CBQA 3GEHA 4LSGA 4RKEA 1R0WA 3LFUA 5FTJA 2BBWA 4M9XA 4FMDB 3K0FB 3TVDA 121PA 2RH5A 1JALA 3AQ4A 3DPUA 1XCGB 2ZR9A 2WTUA 5D3QA 2ORIA 2YOHA 4LHZA 1W0KD 1W4AA 3AKDA 4IEIA 3EC1A 1Z0KA 3UWOA 2JIZD 2CK3D 1ZUNB 3KJHA 2B21A 3HU1A 4Z51A 4YONB 1SKYB 2WVJA 2F9MA 4JVNA 3FPAA 4WXRA 1Z28A 4XSHA 1GM5A 1E2KA 1W1WA 3H86A 3QF4A 3MLEA 1II9A 1PLLA 2RGAA 1FQKA 5JRJA 1AS0A 4B2LA 5K8UA 1X86B 3GJ8A 4AYWA 4DSTA 1JECA 1WRBA 2GF0A 2AK2A 1UBFA 2YV5A 3U4QA 1UKVY 221PA 2OFXA 1BIFA 1NKSA 2GHIA 4DLTA 3OAAA 2GVDC 5FBLB 1GRRA 2CVFA 1R0ZA 5UKDA 4EJSC 3PEUA 3CF6R 3K09A 1G7CA 4DCNA 1E2FA 4FXPA 4HUQA 4BEJA 1NN1A 3BJIC 2F3RA 2HUPA 3IQWA 2WAYA 3RRYA 4XTCS 1D6JA 4UJ5A 2OEPA 4TT3D 2YWHA 2YZ2A 4W9MC 3MWJA 1ESNA 1LF5A 1RW4A 1VCOA 2JLYA 1P2SA 1GKUB 2AR7A 3KQUA 2OSBA 4TL7A 1XX6A 3H0KA 3UANA 5JS7A 2OO7A 2VPPA 3GJXC 4AK9A 4EDHA 2GBLC 1MT0A 4C0BA 1U94A 4D6PA 2JDID 3MD0A 3R9WA 3U3KA 4Q48A 3E2IA 3P27A 4TQAA 3SFZA 1W36D 3U3OA 1YZUA 1XMJA 3V9PA 4DDWA 4DKXA 2ZANA 2EW1A 3OEHD 4AKGA 1XMVA 3RAPR 1NNEA 1E2PA 1ZNWA 1CF4A 1E1RD 3ZVRA 4P4SA 2PLRA 2ZVPX 3CZPA 4DUGA 4Q9HA 1E2LA 4M1WA 1KSJA 4UJ3A 1OE0A 2QGNA 2NOAA 3LVQE 3BFKA 3Q7PA 3VKHA 2QZ4A 1S1MA 1SKQA 2ODBA 3L0SA 4LBYA 1V5WA 4JYCA 4C4PA 4LJ7A 1SHKA 1U98A 2R65A 1Z5ZA 4EFLA 3C5CA 4M9ZA 4ITRC 1QG4A 1EK0A 1MRSA 3ND9A 2XOKD 4N0DA 4OK5A 3IDQA 3DKVA 2FN4A 2WPDD 3I62A 4URYR 1W5TA 5KNDA 3VU9B 2X2EA 1I2MA 2JAQA 2HLDD 3LX8A 2HT6A 2O8FA 2X77A 4L16A 1G16A 1XB2A 4URUR 4E07A 3VR2A 2D7CA 5BN3A 4D4KA 4LDJA 5EXTA 1G8YA 2ZAMA 2WOJA 3OIVA 4XOIA 2H8KA 3O8CA 5HTKA 3BORA 1W5SA 1DS6A 2ZJ8A 3RC8A 4ESHA 2NGRA 1N5IA 3DVLA 4YDHB 3QSYA 5F9HA 3Q72A 2JJ1D 5LB4A 1O3YA 1T6NA 5JS8A 4RD0A 3W3ZB 3WRYC 1XTRA 3QXCA 3THXB 4IKEA 4BFYA 1WMSA 4DLRA 2I4IA 4PZLA 1Z2CA 2QORA 2GBLA 2ZR7A 4M9SA 1EFUA 1VCNA 4QNRA 3GJ5A 2O8BB 4TQ9A 1GZSA 4WA7A 1KI6B 1IQPA 2MMGA 2RGCA 3T1TA 1DAGA 3AF4A 2YYZA 3V00A 1W44A 1G291 3CB4A 1UPTA 1JQJC 2FGJA 4KFUA 4LY6A 4IXNA 1S2MA 4UNNA 1NLFA 4D0LB 2ZUBA 3DMNA 3SJBA 2VF7A 1ZVQA 2BEKA 4V03A 4D25A 2UZ3A 4MRNA 2R6GA 3ADBA 1EX6A 2OFWA 4ZKEA 2EWWA 2QTFA 4GBMA 4B2PA 1XTSA 1G21E 1IN4A 1U81A 2C99A 2QE7D 5EZ6B 4TMWA 2BHRA 2NTYC 2ODEA 4HAWA 1E1RA 3GJ3A 2Z4RA 1XXHA 4FN5A 5IK2A 5ELXA 1ZM3A 2FSGA 2R62A 5IRCD 1G3RA 4A82A 1P60A 4I1UA 4CZ2A 1KOFA 3CNNA 3KB2A 1E2JA 4Q00A 2QMEA 4S35A 2IYWA 3WHKA 1FNNA 5AUQA 1BYUA 1CBUA 2KI5A 3U44A 2VBCA 1LF0A 1NVWQ 1NY5A 2XZPA 2W00A 4B3CA 1XP8A 4KITB 2V55B 2WAXA 3U7EB 2GAAA 1BMFD 4EUNA 1AGRA 1JR3A 1O87A 4TSFD 1N25A 1YE8A 1BO6A 2QNRA 3OIYA 3QJYA 1VYVA 4L4UA 4LJAA 2ZRCA 3T5DA 3PCRB 1G17A 3QIAA 3TW4A 4UNRA 4QM6A 2G1JA 5FUVA 2WWIA 1PLJA 3OFND 4MKFA 2HLDA 3GMTA 3CRW1 1DAIA 2EFCB 3ZQ6A 2W83A 3SJCA 4G5SA 4MRVA 4G01B 2ZJ5A 3SJAA 2FDCA 4TMVA 1KY2A 4YC7A 1IOZA 1HYQA 2PLFA 3KZ1E 3I5XA 2EFGA 4KSCA 1SVOA 2ZI7A 3K0FA 1U0LA 3L0PA 1VCMA 4HAUA 4QBHA 4AY2A 1P6XA 1OLOA 3EA0A 4F92B 3U5ZB 2JLRA 4HB0A 1MABB 2C8VA 3GLGE 1NVUQ 2F6RA 5E95A 2O0HA 4BFVA 4DSOA 2G88A 2ZE8A 4LBWA 3FB4A 1N6RA 4PHGA 2B7BA 2VP2A 5DSZA 2F1RA 2A7QA 3KB1A 4IVRA 4G5GA 3RHFA 3B1VA 1E0JA 4TMZA 4LOAA 1Z08A 2GESA 5EE0A 2WICA 2ZRAA 2WOOA 4W7SA 2PL3A 1T5IA 3IIJA 1K5GA 2Q9AA 4KYIB 2IW3A 3BB4A 3T1QA 4ESVA 3C8UA 2P0EA 1BOFA 4MGIR 4BZQA 3MRSA 3RS2A 1GKIA 3PR1A 3KKQA 4LYHA 3CX6A 1N6IA 4DT1A 5EE1A 5EE9A 4B34A 2BWJA 3M6AA 3D7MA 4QNMA 3LX5A 1E2HA 4QGAA 4JLVA 1IM2A 1JPNA 3C41J 4QHTA 5BYJA 4AYXA 521PA 1G19A 4OQFA 4DLUA 3ZZUA 4BZPA 3I5YA 1TU4A 4JJKA 1G5TA 4AD8A 1VG9B 5EE5B 3TK1A 2FFAA 1ZINA 3UMSA 5JI2E 3PUXA 3UPUA 1N6HA 2FFHA 2N1BA 2VL7A 2ZRKA 4TLDA 1N5LA 4CEHB 3B1ZA 2QENA 1MO4A 4U00A 4ON9A 3VX4A 3AKEA 3DO6A 1XPRA 1WDTA 2WKQA 1R4AA 3EZ7A 3BRWD 3NXSA 3K9NA 1G7TA 4NYIQ 4TTPA 3AM1A 5JCZA 3NC1C 5JECA 1T9HA 1FQJA 4OHXA 1Z3IX 1NRJB 1HQCA 1KK0A 2P5SA 1CU1A 1YR6A 3LW7A 1QHXA 2VRWA 2GK7A 2ZRJA 3TUZC 5H68A 1OB2A 4YMSA 4RD6A 4F4CA 4NONA 421PA 1FUUA 1OIXA 4PTLA 4D0GA 4KSBA 2R9VA 3KQHA 1PVOA 3UG7A 5JJIA 4MA4A 2QN6A 3KJGA 3OFNA 1AA9A 3KJEA 1GAJA 1KI3A 2IC5A 2DB3A 3FKQA 4HSEA 5DYGA 2H7VA 4PO9A 4C0KA 1VHLA 1G9XA 2IBMA 4OK3A 3F3YA 3QXHA 3T12A 5BN4A 4A4DA 2ZRIA 4NYIR 2C5LA 3OEEA 4GP6A 1NJFA 5FTNA 2RMKA 3QXSA 4NYMR 3RANA 1AJEA 4IW3B 5FL7A 3SFVA 5CB6A 1E2IA 2YC4C 1M34E 1GNPA 4LX0A 3SDZA 4Q1AA 2WWFA 2G0NA 3Q8XB 3RRZA 5FBRB 3W6OA 5B58C 4RCYA 2ZETA 3B6EA 2P6UA 4QXAA 2IA5A 1OKKA 2CE2X 4GDFA 2FFBA 4L9WA 3HYRA 1RJ9B 2REOA 4JLMA 4LPSA 4PQYA 1WF3A 2RKOA 2X19A 5C46F 1KDPA 1VYUA 2O0JA 3W34A 1QVAA 1P62B 4TQUS 3I72A 2QT1A 4Q7JB 3FFAA 5FPKA 3LBNA 4ACBA 4MYTA 2BV3A 3CF2A 4F38A 4B3XA 3THWA 3I32A 4FMCB 5G3YA 4Q4JA 1Q0UA 3WNBA 2K5UA 4WVFA 5EZ5A 2GK6A 5JI3E 3BFVA 1DBSA 3U6BA 2O8DA 2Q9CA 1YKSA 4FI3C 5KDOA 1F3OA 2WKRA 1QHSA 1WP9A 4GPTA 1CLUA 1WCV1 2O0KA 2QL6A 4MGZR 4UNQA 4C7OA 1P2UA 1E3MA 2QP9X 4M4SA 3IIKA 5FBWB 4BUJA 4BLSA 5LD2C 2B8WA 2FGKA 3QVUA 2O8BA 1CJTC 2E87A 1UM8A 2HYDA 1G8PA 3REFA 4JT4A 2R6DA 2ZAOA 1XWIA 4V0LA 2OXCA 1M7BA 3GP8A 4BQSA 2ZS9A 3QBVA 4PAQA 4FCVA 5HKKD 2WSMA 5AJZA 2VEDA 2ZJ2A 1KMHA 1TF5A 3WRXC 3FYHA 1DEKA 1QHHA 4FMCF 3GFTA 2GKSA 2F9LA 3LLMA 3TGPA 1KK2A 4KODA 2RHDA 4OHWA 3RS7A 1E96A 1YU9A 4DSUA 1J70A 4JS0A 4Q9LA 3JZMA 4ZPXA 1IJFA 2VSFA 2JJ2A 3QUSA 4NBSA 3VQTA 1YZKA 5KHOC 3ZS8A 1XRJA 1DTSA 2PEYA 1LNZA 3O47A 5AUNB 1CS4C 1DG3A 4BRUA 4RD4A 3VR4A 3TJZA 1W0JA 2PZEA 2GCNA 2XZLA 5L3VA 3DHWC 5B30A 1ZYUA 2QAGB 3ZZTA 2D7DA 5CYPA 4XVUA 3LH5A 4G0NA 1KSFX 1XDBA 5JCPA 2PJZA 1VPLA 3WMEA 2OCAA 4DDVA 2ZYUX 2OLJA 4BPBA 4NHOA 1A82A 4JBYA 4LZZA 2BBTA 4BFUA 1TQ6A 1F2UB 4YMTA 3CRQA 5BQ5A 1JXOA 1L8QA 3D8BA 2D62A 4FD2A 5LB2A 2H92A 2REBA 1Z07A 1KI7A 5CLQA 1JAIA 4NZYA 4URVR 1W49A 4PZYA 1G7RA 4A2PA 1J90A 5DYIA 1F2TA 1R0YA 1JEDA 3AKYA 1IY1A 1Z6AA 1RYFA 1XF9A 3FKSA 2GCOB 5TDHA 2GJ9A 5D3MB 1E9RA 3CO5A 1D2NA 1DARA 1G6OA 2FNAA 2VP6A 2Z6VA 3KUCA 5BW8A 1NL3A 3T35A 4ASUD 2OCBA 4JT2A 1MABA 1FTNA 4Q03A 3RS5A 2E1RA 2C98A 3SI7A 4DCSA 2HXSA 3EC2A 3R8CA 3WYAA 4DLVA 3ZVMA 2HV8A 2WWYA 3WYGA 4Q7MB 4WZAE 4M0LA 3DM9B 5TMPA 4C0SA 1UKYA 2QMHA 2A78A 3DKPA 3HP1A 2ZQ5A 4NYJQ 1R5OA 1E9FA 3TW8B 2ZE5A 4O25A 2J59A 2J7PA 3QY0A 1NI3A 3SYKA 2XSZA 3ZS9A 4JSYA 5FR1A 1Q12A 2WZQA 4OHVA 2IXFA 4B6FA 3D3QA 5HKKA 2FE4A 1IAQA 4Z8XA 5EP2A 2QRNA 2XB4A 3IUYA 3SEAA 3AF3A 5K8IA 4NE2A 2ATXA 3K8YA 4M53A 4PC2A 2IHBA 8OHMA 1ZC4A 2ECKA 3LD9A 4LWZA 4AKIA 4PR0A 1KO7A 3NHBA 3EWSA 1HQYE 2AK3A 3GLGA 2W0MA 4EPYA 1U8YA 3MMPA 4JJZA 1G41A 3HPRA 2YNMA 4US0R 5FOUA 3R8FA 1IXZA 2BJVA 4PZZA 3N5CA 4OK6A 5E7JA 1X6VA 5AJXA 4CEHA 4GRAA 5FPYA 1R5NA 3PIRA 2AL7A 4DXAA 4V0KA 4OL0A 2J0SA 1IN8A 1AQUA 2CE7A 5JEDA 3H4MA 3IO3A 3JVUA 2OAQ1 5FI0B 1TQDA 1T0HB 1QRAA 1DAKA 4P33A 3VHLB 2CJWB 2OESA 3NTUA 3ICQB 3F5FA 2EYQA 1JNYA 4URXR 1HE1C 1XNJA 4FCTA 5AJWA 5KSOA 4X8HA 1IXRC 1RFLA 2HYIC 1JXMA 3SYNA 5HE9A 4GP7A 2IYXA 4HAVA 4LGMA 2QROA 2IYSA 1XCPA 3CWZA 4DBLC 1SULA 3X2SA 4ZI2A 2QUZA 5E3HA 2ZJYA 3RWOA 1LB1B 1T3HA 4MRPA 5HPYB 4P31A 2FF7A 1KI1A 2OBLA 2D3WA 4XD7A 1LFDB 4PC1A 1NVVQ 5C4MA 4WXPA 2WJIA 1GITA 1NBMD 1GG2A 2ZM5A 1FFHA 1X1RA 3CX8A 3A1UA 3W9YA 1US8B 2ZSDA 4JLJA 1EFCA 1KJWA 2J46A 2VP9A 3QKRB 2EU8A 3VHXA 1KY3A 4NMMA 2CLDX 4LYFA 2KJQA 3AF2A 4C3ZA 1F5NA 2Z43A 3KUDA 2WV9A 3O8DA 1NIJA 2G1KA 2XTMA 4PSKA 2NG1A 3ZVNA 4HB2A 4UKDA 1RRCA 2ZRBA 3A36A 3UWKA 4MQBA 4BLPA 4EKDA 4MGYR 4TN1A 1S3GA 5J4VA 2H17A 1XTKA 2WM9B 3THOA 3TVTA 4A0FA 4DLYA 4U02A 1Z6YA 3TBKA 3AP3A 4C2UA 4A8JC 2PX3A 4ZIRB 3LDAA 3FFBA 3TAUA 4TLCA 3GJ7A 2AWOA 1KSGA 2OLKA 4TMKA 4A36A 1D8TA 4BFTA 4M1OA 4C0LA 2VH5R 1AS2A 3PEWA 4WIAA 1XEXA 1GKYA 3QEJA 4HLUC 2VSXA 1DE0A 5A0FA 1E2DA 4R2IA 3EWAA 4LK2A 3Q5EA 4ZDWA 4ABYA 1ZW6A 2X8AA 4Z1MD 1Z8FA 1E69A 2A5DA 2NIPA 1DADA 3I1FA 1S9DA 5AK0A 1LS1A 2W2TA 2NO9A 3PVSA 1N6NA 4YXWA 5KU1A 2C04A 2IT1A 1G4UR 1SHZA 3LW8A 1ETUA 2GAOA 4QBIA 5CK4A 1E32A 1Z29A 2D4HA 5H1YA 2RGDA 4TL8A 1AK2A 2W6JD 1NG9A 2NZ8A 1QZXA 1N0UA 1TNDA 4P32A 3RVBA 1ANKA 1E4VA 3LA6A 4FMDF 1GRNA 1YVDA 3B9QA 1Z0AA 2CHGA 2AFHE 3QOFA 2PCJA 3A1WA 2WIAA 3FHOA 3RRMA 2NO0A 3LNCA 3B1WA 3TSOA 2WHXA 3ADKA 4Q4AB 4PPNA 3ECCA 3RABA 3SNHA 3ZLJA 4IDHA 5BN5A 2P2LA 3ADCA 3LBIA 3GPLA 2J45A 2AD1A 1YZQA 4ZCIA 1TF2A 1D5CA 1OH5A 3NBYC 4GNKA 2LCFA 4L9SA 1E94E 4C0JA 1Y3AA 1UDWA 3EPJA 2JLUA 5KO2A 1D2MA 2WWWA 4CF7A 4RJLA 2VHTA 3KKOA 3U3JA 1D9ZA 1UKZA 4URZR 1OSNA 1A2BA 2OHFA 2BM1A 1Q21A 4RD1A 3QG5A 3T15A 1OYYA 5TVKA 3KFXA 4A8JA 1XTQA 4DLZA 1R7RA 4DB2A 1H8HA 3QXXA 5K8LA 4CEIB 3B60A 1F2UA 5CB8A 4G1UC 1P61B 2GTPA 4DLSA 4PPFA 4KBFA 2J3EA 1Q22A 3A6PC 3G0HA 2ZU6A 4HEJA 5EP1A 1VYTA 3MAAC 1P4SA 2N46A 4HLUA 3EIHA 2GCOA 2ZS7A 4TYYA 4PQFA 1SXJB 5D3MA 3B1XA 4MKHA 4EFNA 1XZQA 2IUSA 1SVSA 4Q66C 5EXSA 1VECA 1NJGA 3Q5DA 3BGWA 1S96A 3DMDA 4K8OA 1W36C 1FP7A 3VR5A 4YMUA 1D2EA 3P4YA 1JPJA 4ILEA 3QKUA 5CDFA 3KQNA 2WWGA 1OHHD 1N5JA 2REXB 4QFMA 1FX0A 4NP6A 1W0KA 3DL0A 3AP1A 3WBJA 5C1BA 5KDLA 3S1AB 2A9KA 2R2AA 4ZO4A 1KI9A 4Z1MA 2JIZA 2CK3A 3OESA 1F48A 3K9GA 2V3CC 3QPWA 3ZQJA 1XD8A 2V6IA 4A92A 1G3UA 3LWNA 4MYHA 1JAHA 2OBMA 4A9AA 4XWKA 1Q3HA 2L0XA 4LHYA 1E2GA 5DE3A 1AGPA 1R10A 4B44A 1XTIA 3SOPA 1XJQA 2W6JA 4CEJB 3E70C 1G5RA 5FBQB 2AXNA 5F2EA 2RB4A 2C03A 5FFMA 4A0HA 1NN0A 2WJJA 4XIGS 2G83A 4DCTA 3RSLA 3GFPA 2ZI9A 5JWRA 2BMDA 2VHUA 4B43A 1COWD 1M2OB 4QG7A 2Q3FA 3QI2A 3RNLA 5CYOA 3ADDA 2OFOA 1KKLA 4B74A 2CJWA 2YOFA 3GLIE 1P2VA 5EQTA 4TT3A 1XBTA 5FOSA 1FP6A 1G64A 2RHMA 2CBZA 4Q4HA 2IYUA 3U7FB 4KBGA 1OV4A 1FMLA 2QRZA 2UKDA 4JSTA 4PANA 2WMOB 1RIFA 2V1XA 3MCAA 4JKIA 4V0OA 2BIFA 4DLWA 2JDIA 3U6KA 2MSCB 1X8KA 3QKSB 1XD2B 1I4DD 2WJGA 4KV9A 3PENA 3NBFA 4M1MA 1P75A 3WMGA 1J7KA 3FMFA 1ZU5A 3KKPA 3OEHA 2HCBA 4B71A 1K6MA 2HT1A 2OM2A 3K9LA 3FGNA 2DPXA 4JVMA 4QJ4A 2QBYB 1OFHA 2ZRPA 1XEWY 3IBYA 4LV6A 3LV8A
chains in the Genus database with same CATH superfamily
2CXTA 1IXSB 3NTLA 4XDYA 5JSZB 1EUDB 3X1ZA 4UNSA 1YI0A 4V02A 3PXGA 2CL7X 2PH1A 4F56A 1J56A 1I7NA 1X1BA 4E6EA 2NVUA 2XNDD 3KL2A 1EUZA 1FTWA 2GI4A 4P92A 5A9RA 1ORWA 2K87A 4P82A 1ZNQO 3KZOA 2GO7A 3EBOA 1ILEA 1M0WA 4GX2A 4Y7DA 5JZVA 4YRLA 3QV2A 5CVEA 3MLAA 4PXYA 2B1GA 2IP1A 4XYMA 1OHHA 3X2FA 1ZXXA 3EDYA 1U4SA 2P0AA 4YGXB 3EEYA 4FYJA 4KFRA 2HDNB 2XDWA 2XCIA 1WDLA 4BCDA 2PRJA 4FHEA 2FZCA 4HN4B 2XOKA 5JXHA 1YR9A 3KKMA 2NMVA 2AKYA 2C42A 1ZU4A 3IEPA 1UH5A 4TM7A 5TLSA 3U2QA 2WPDA 2YXDA 1IQ0A 1SXJD 4L95C 4C30A 5I4IA 3Q10A 2OPBA 3HHEA 3ZNPA 3UXMA 2CFSA 2W6PA 4J3NA 3LT0A 4R9VA 3EXHC 5DOZA 5CLLA 2QVXX 3LWBA 1R6DA 1VLLA 4BP3A 3G2PA 4AN4A 3G3EA 4WLNA 3VNAA 1CY0A 3DB2A 1B73A 4F3NA 4OUKX 2RKBA 2AW5A 1U90A 4U2CA 5BVGB 2FSIA 2H2WA 2RH9B 4IHQA 1YTUA 5F33A 5FNVF 1P5RA 5DLEA 2ZB2A 1LTHR 3L7DA 4L76A 3VSEA 3AFIA 1L7VC 2C9OA 2WKPA 4G26A 4I1OA 1GPMA 1VLQA 4G8CA 5AW9A 2ZUTA 3DWGA 1DBVO 1DO0A 1GD1O 1KK1A 1QE0A 4B75A 3FXAA 2KB0A 4F4DA 4LDRA 3M70A 2JKVA 2NVOA 1COWA 2ZB3A 1ZUNA 2HO5A 5JVDB 2BI8A 4OX9B 3W8NA 1R50A 3BG5A 3ADOA 3O74A 2NZ2A 4H4EA 1T5DX 3VOTA 3FZQA 4LJSA 3ZLUA 2UUAB 2XMGA 5CA0B 4FS8A 1PQPA 4KL8S 1IBMB 4IJMA 3RUHA 1A4XA 4E14A 3QELB 3I92A 4OB6A 1EX1A 5L3SB 2FH5B 2I1VB 4O2BF 1CUXA 4G5XA 3AILA 3TS1A 4Z5XA 5LDHA 5TEWA 3WGMA 5CAEA 2PTGA 4WMLA 2C1EA 2BUCA 1XMXA 3KR9A 3LT4A 4WA8A 1YV9A 4KO4S 5HWSA 1SOAA 5BW5A 3AV0B 3M6FA 4UNPA 2QTBA 2CMFA 3WBBA 1QYXA 4PNEA 3ODPA 4F8EA 2R4UA 4P3OA 4O3MA 1VHJA 3K0KA 4LXGA 1XG5A 2IXAA 4OATA 3UUFA 4FYMA 4JBHA 1W6UA 1C7ZA 1QO7A 2G77B 2C1ZA 1IVNA 5EKTA 5ILQA 5CEEA 1C1DB 1IHXA 4HDMB 3E2PA 2PUHA 3U0VA 4OI0A 5CMLA 3NCHA 1HORA 4LOKA 1KU6A 2HPHA 2FPPA 3AI3A 3GG9A 1MIOA 1XL1A 4TM8A 1N3BA 2G82A 4PC7A 5E7QA 3VVCA 5C7IO 4MWZA 2IZOA 4MZDA 1YRAA 3C6MA 3EK2A 3VYRB 4EPTA 1PR0A 2BM8A 2W11A 2XWBF 2AN9A 1IY0A 3IUSA 1JJBA 2JASA 3UUWA 5BQ3A 3V4OA 2AKAB 1I0IA 1MOPA 2CLEB 3LLUA 4G0QA 4HYEA 4CQLA 2BP7B 2P2ZA 1S9HA 3HBAA 4MPDA 4ZCLA 1UWCA 2A9OA 1LPMA 1TXGA 1JU9A 3DQQA 4WXYB 1XU4A 5CHYA 1BMFA 2AC7A 1ECLA 1LH0A 2DQ4A 2Y8EA 3G5TA 7GPBA 1ZUIA 5JYCA 1C30B 2C2GA 3BMNB 1S0UA 1QP4A 1Z2AA 2EAUA 1P39A 2VXCA 2WHQA 4JP5A 3U1VA 3WZLA 4EWLA 3N70A 3AU9A 2HTFA 3PHIA 1T9GS 4MHOA 4ZVSA 2IXBA 2J67A 5GOTA 1ZMXA 4JBWA 4WZ6A 4P54A 4CUJA 3UN1A 3FDJA 1UF9A 3AEKA 2JLWA 1J06A 2FXIA 3F4BA 3LNTA 4JJ8A 4EYGA 4H77A 2AZDA 4KN9S 1NVMB 3WGQA 3FUUA 2PFKA 3CNHA 1DPGA 2YICA 3MHPA 2I55A 4PLCA 3TH5A 3U16A 4KR6A 1IFXA 3STHA 4MDYA 4L8VA 1ZA1A 3RKRA 2IXEA 2GS9A 1U7TA 2HC9A 4P58A 1X1AA 2IU4A 3ZX5A 5BSFA 1DNPA 3BFXA 2OV3A 4XX0A 3AUTA 5AR1A 4C06A 3H2JA 2RC6A 3INGA 1NW9B 3GA0A 1ZIPA 1T2DA 2PGXA 2ZRFA 2GEFA 4B6EA 3OKFA 1K8ZB 3VFDA 1PGQA 3WDSA 1EGHA 4U7DA 2Z2IA 2PN1A 2M6RA 2UUOA 1IQRA 3VU9A 3PX2A 4GM4A 4UU1A 5DWQA 1RPJA 2C3MA 3DEJA 5D5HA 1L1FA 2VQ3A 1EVQA 1FQWA 4I99A 4ZO9A 4EF5A 2F1IA 3S29A 1BNCA 3C7KA 3MSCA 4R1NA 2QAJA 5DCLA 2YWFA 1MUUA 2DE0X 4GPD1 1CY8A 1KO1A 2IFTA 2IYFA 4N47A 2R1VA 4MV6A 3GY0A 5HVNA 4L22A 3R7SA 1AXGA 4CU2A 4X1IA 3K15A 4Y1RB 4MCAA 3CE6A 3DE4X 4LJKA 3TL6A 3LFHA 3WLFA 2BJWA 3IT1A 3ZDZB 1ZQ1A 2B8NA 1OLUB 2O1WA 3CVOA 3ENVA 3L8FA 1PJQA 1UDCA 3RSFA 3THXA 3MG9A 3DEAA 2Z83A 5K7SA 2HF7A 2QY6A 3F0TA 5CVUA 2PT6A 3GXBA 3OHSX 4S12A 2B6NA 3DEFA 1TYAE 4JB2A 3P2IA 4B2YA 5GJBA 1Q83A 4YJGB 4DQUA 1GTVA 1N36B 1X3SA 2VBIA 1DC7A 2GZRA 4P3NA 1M10A 1T6BY 1YR1A 3IQEA 3OZAA 1YH3A 2JGDB 4GM0A 4K0RA 1Z7EA 3W4KA 1DFGA 1ENPA 1I30A 2X1HA 3K2BA 4R8RA 1L5FA 5G0UA 1E79D 2EHDA 5BPHA 1E6LA 1N3YA 2F55A 2O07A 3X1XA 5EIBC 3N0TA 4DCOA 2GD6A 2B6HA 2REQA 4PBSA 3GAZA 4TWZA 4D4LA 5A2GA 3HLTA 2CD7A 2Q6TA 2GSWA 4IFEA 2KLBA 4OBWA 5I9NA 1DT3A 2QT9A 4CIDA 5JSFA 5A0TA 1MB4A 4A2QA 2IW1A 2Y1CA 3CZ4A 1KYIA 3DOFA 1P2TA 1VXOA 4RVSA 1CP2A 3TLGA 4A1FA 2ISQA 3H5LA 2ID4A 3FYUB 5JXIA 4X71A 1ISIA 2VDRB 6YASA 2ZUDA 1LSUA 4JNKA 4OQXA 3W5SA 5AICA 4BTVA 3UY4A 1JG2A 4WTOA 4ESEA 3RJ5A 2FV8A 1O89A 2BCGY 4PHHA 2JD1A 1NW5A 5F3DA 4KMOA 4QYIA 3TIFA 3GLIA 2XCSB 4IG9A 4P53A 3WOHA 3I61A 1KBZA 1V1JA 1E9BA 3PF8A 3K7EA 5EUQB 5SYNA 1W76A 2Q5OA 3F7OA 3QVOA 3KCNA 3TDKA 5IAKA 3H5NA 2BR4A 2B37A 3IC5A 4PRKA 1RYMA 5HS4A 4LFBB 5HP4A 5DRYA 3DAPA 5FNVA 3E23A 3ZKWA 3HN6A 1TYCA 1S8FA 1ZBDA 4X8OA 4ZRMA 2OC9A 4KIJA 1PFQA 5CG1A 3JQ9A 1K75A 1FP4B 3ONNA 3WXMA 3U4QB 3ZGXA 2YC2C 4D9GA 3KSZO 4FEYA 3VVBA 5SZJA 1E1DA 1H5UA 1T8RA 3RBVA 3D0RA 1P19A 4G67A 4O0MA 2HA0A 3WHPA 2IUFA 4CM9D 3AEUB 4EPWA 5F23A 4RTRA 3TSWA 3ZHTA 4WERA 1J2JA 2P6OA 2FPIA 2IYYA 2WLSA 3IELA 5DN9A 5E0OA 4B17A 4F04A 3NH9A 4BO7A 1RAGA 4BFSA 4Z4FA 4M89A 1JYFA 1OBVA 1FBNA 4E5MA 3D2AA 1NHGA 1CKEA 2VXOA 4B33A 1DAHA 5D2CA 1SPBS 1M1YE 3O8BA 1N2OA 5BR4A 3UMYA 4ARSA 2GXAA 5EKUA 1JXAA 2XXJA 1WUHS 4PX5A 3UPDA 5FNZA 1KQGA 2PJDA 2JFGA 2YOGA 1TZMA 3WYDA 2C2HA 1XVTA 5LP6F 3C7CB 3U60B 3BZUA 4JAVC 4D79A 4ZVKA 1ZLXA 1GRQA 1UKCA 3D2CA 2B3DA 4DDTA 5LU9A 2R5FA 5TPWB 1EH5A 3IKJA 3K0SA 3GNQA 1RLIA 2QW1A 4F5ZA 3CCFA 2J33A 3GV0A 2Y0EA 3CRVA 3FVWA 3GUYA 1N0HA 4HAXA 4TL6A 1UBGA 2CDRA 4MVJF 4X41A 4Y67A 3N3AC 1G1MA 2I2CA 2HIHA 3UPTA 4FCWA 1CQIB 1SQ6A 3BRQA 5IT4A 2CC2A 2F4NA 3KEGA 5CG2A 5AI9A 5D01A 4I4TB 3EPKA 2M1ZA 1OYOA 4QQRA 2DHRA 1A7JA 1JSCA 4Q7QA 3KEFA 4MV5A 1KMQA 2HJGA 3NP7A 4OJQA 1VPDA 4M8NE 3L02A 3AVXA 5AKKA 1U5AA 3LGSA 4LE2A 4BQNA 4G3XA 1EFVA 3HJFA 1VRVA 2C8JA 3WB0A 4R7ZA 3A1SA 2LKDA 3AW8A 4DBZA 5MGBA 1DAEA 2P3QA 4I4IA 3M5WA 2Z30A 2VEOA 2XMRA 1O6CA 4RLQA 2C4HA 2IVZA 3GCGA 1N6KA 2IV7A 1UADA 4P34A 2P9ZA 1JHAA 3AGQA 1J2TA 1R8QA 3ESZA 3I5MA 4J0QA 4J0DA 3EGCA 5IUJC 3RSSA 4LZAA 5G1PA 1KEPA 1OX6A 4RFLA 1M54A 3R6WA 1UDAA 4WUVA 3A1VA 1UAGA 1J4AA 4WNCA 1N5KA 1RYNA 3SSOA 2WJ3A 5MFPA 5H02A 5GONB 3BIOA 3OPXA 3WGZA 3HR8A 2WV7A 4M8LA 3RPEA 1FTGA 2QSUA 3DOCA 3FETA 4JITA 4EJSB 4DUZB 2IIQA 2OUKA 3UV7A 1E3QA 4MUBA 4EG7A 2GM9A 2XUHA 4DIFA 3H2ZA 3IXQA 1OPXA 2ONYA 3NOOA 1ZIDA 2FLVA 2Z5GA 2JGLA 4I1RA 4I9HA 4FINA 1GHTA 1QAOA 3KR2A 2MR5A 2QF7A 3OT1A 2O2DA 3ZQUA 5LC1A 2Y1DA 1U63A 4ALJA 1UWKA 3JAWA 4PC3A 1PCXA 3DP7A 4QUEA 3WICA 2QL9A 3TUIC 3JVVA 3WA7A 2OBNA 3H2GA 4NY1A 3R9KA 1QS0B 4DR5B 3AC0A 1IJEA 3GH3A 1FP2A 5BSVA 4NBRA 1EAMA 2QI9C 4DAOA 5K01A 3PDWA 2NPIA 2FWJA 1QIIA 1FXWF 3BB3A 3EGWA 4GSLA 5BO5A 3ZUGA 4FSDA 4BP1A 5E2AA 1V4NA 2HAEA 4E5NA 1WZ2A 2AMVA 4QDZA 1A7AA 1A88A 4YRBA 4YMWA 1HE4A 2VWHA 5D3KA 3UTDA 1ZM4A 4KAFA 3MPUA 5INTA 1SUCA 3W8EA 1C3XA 4YRKA 1YC5A 3LK7A 4U9IS 3E22B 3SF8A 4FHCA 5KQRA 2O8CA 1LJLA 4YP0A 4H7IA 2VG8A 4UFOA 1HL7A 1R6AA 1V6CA 2WD8A 3MJSA 5ARDA 5FBKA 3IPXA 1NVFA 1XQWA 1Y4AE 1OZAA 2IYVA 4OHMA 2PA0A 2C4MA 5DGXA 4NIMA 2BD0A 3F47A 4O4HB 1JFFA 1QVRA 4LZPA 1TYDE 4PLZA 2JBWA 1Q14A 1RJ9A 1VSTA 1XXHB 1YS6A 3KUUA 7MDHA 3T3DA 1WS6A 3Q98A 3UATA 4W5WA 1VMKA 4YAKA 5FWYB 5K0CA 3W5DA 5JMWA 1JSXA 4RETA 1Z88A 1C9DB 4IXWA 1TUEA 5E6SA 4EHAA 2RI1A 4B4KA 1MQSA 4HG2A 5T4EA 4CKBB 1GRCA 2V8OA 1KDYA 2PNJA 2IUEA 3OMXA 1XMSA 3PQ8A 3CNOA 4UHDA 5HHTA 3HP4A 4KFCA 4HFMA 3O3OB 2I6QA 1OXUA 3BYZA 3QUTA 1IRIA 4IRUB 4QOSA 4WRRA 5JLJA 5EKSA 1XCBA 2PUTA 1F20A 4LXYA 2PGIA 5D8DA 3HXLA 4F6CA 5C81A 3W4JA 4WLEA 5J59A 3IIEA 4C1NA 2IS1A 2NU8B 1DLIA 4HY3A 3M2TA 3BWYA 1K8XB 1CTQA 5EMMA 4ZC8A 5AW6A 5GTDA 3EQ6A 4GR9A 3FHTA 3WSVA 3FKJA 4Y2TA 1NZDA 4JEIA 1GY8A 1RHRA 1ZJ6A 5HBGA 4PAOA 4I6EA 5JOQA 2GJ8A 5A1TA 2QJTA 3RAJA 1NXVA 5BSHA 1NQAO 1B3RA 2O48X 4UAUA 3VR1A 3GEIA 3ITKA 3QENA 3AY6A 3N28A 2ZT5A 2HCTA 1L4YA 3QA3E 4MAAA 4C0WA 2AQKA 2PYDA 1G8KA 1R9NA 3GA5A 3X2EA 3Q8MA 2NWQA 4XR9A 1TYBE 2ZYDA 2QLFA 3NHFA 3TNDA 4QOEA 1KEUA 1UFRA 4XD2A 4F5YA 3AVTA 4QASA 5I5EA 2LTAA 1DL5A 1E6KA 3OFJA 3IO5A 3OPNA 4PSVA 3VU0A 2NO7A 5LA6F 2TMKA 1Q57A 2ZTSA 2ZULA 3VZRA 2PMWB 1S2LA 3CGWA 5JDCA 1XU9A 5JQWA 1U9JA 2D0DA 3IAS6 4IUBS 5KNDD 4RZUA 3G59A 3IPLA 2PNFA 4XWYA 5IF9A 1CW2B 2FK7A 3RODA 2IPAB 4V0MA 2B9VA 4KWIA 4EZBA 4BRWA 3FCSB 3ZJTA 4FFVA 4ARUA 4TVBA 1A4UA 1BE8A 2QR5A 2CFTA 3OE5A 3PQ5A 4U3JB 1AUVA 4KUHA 2Q4BA 2V7PA 3QEOA 5DGHA 4DT1B 3BMOB 4KXLA 2DZDA 3PA6A 1RLJA 3OA0A 2Z1NA 3NOQA 3ZJ5A 4Q02A 2QT0A 3PJRA 2IZ0A 3KNZA 1P74A 1NAHA 4WHMA 1GEGA 5CGZA 4Z0TA 2PL1A 2BGWA 2XNKA 3Q9SA 1E4EB 2P9QA 5ALFA 3BH6A 4F5EA 3OLYA 2QUHA 1O5IA 2ZP1A 1LD3A 3H5WA 2KSQA 1Z4PX 4OI4A 4D92A 1XRNA 2WTXA 5BSWA 4YP1A 3DV0A 1DRKA 1V7QA 3UMFA 5JNWA 2JARA 1BQ3A 2LKCA 3DLCA 2R4TA 1H8ED 1K3FA 3MYRA 2QAIA 3RIYA 1DKMA 4ZD6A 4WNYA 1SBYA 3L7OA 2CUNA 3EZLA 5JBNA 1QQTA 1QCCA 5DM1A 1OD6A 1RM4A 5DIZA 4RY9A 2CXHA 4FTWA 3ONVA 1KFEB 2FJUA 1Y3HA 1JDPA 3BTSA 4C4OA 2BKLA 3EEFA 2JGMA 3VVLA 2WG2A 5FYDA 4Q5IA 5K5EA 4DR3B 2M6SA 1T43A 1L7MA 3N58A 3OQIA 2FP4A 1A98A 4TS1A 3RRXA 2B25A 1CUDA 4EA6A 1JWLA 2E4ZA 5E2IA 2FK8A 2VJCA 3M83A 4IFBA 2WT9A 3JPWA 3B6KA 2D5AA 2QXYA 4D96A 1OTYA 1P17A 2OHJA 4E46A 1ONOA 2V7BA 3CJQA 4IIHA 4ZEWA 4DVJA 1BG6A 1WNFA 3HU3A 4IEFB 3JSXA 2CLIB 3N3BC 4PVDA 2GYVA 5K0EA 3IEKA 1KP2A 3NU1A 4GKAA 9LDBA 1NF2A 3FOZA 2VHVA 3WIEA 4YUAA 1GZ5A 2MINA 3VDRA 2Z5VA 3BXOA 3UOAB 1T5LA 2AZXA 1W88B 2AZ4A 2H2GA 3W0LB 1NXPA 1IXYA 4PLPA 2QM7A 4YJ2A 1EA5A 4I19A 4JP1A 1V43A 2J7KA 2IYQA 2QEQA 2Z3WA 5IJXA 1JLMA 3D0QA 1IJBA 2P1ZA 2PX5A 5ALIA 1ZC3A 4G84A 3I4CA 1CJKC 4PSAA 3WLKX 2R8XA 3SICE 5CITA 4L5AA 4MCHA 1ZJ4A 1TJNA 1TEZA 1CYDA 2BM9A 1KYYA 1QDLB 1WSBA 1Z34A 3ME5A 4E88A 2FQQA 1FVFA 2NPOA 3PDIB 3U4CA 4YCLA 1I1HA 3QBJA 3O4HA 4WOBA 4WNAA 3TQHA 1YS7A 2P35A 3LDGA 4LXTA 3JASB 2HEIA 2R7AA 4MRMA 3ZCRA 1FYWA 3ZCPA 3H8SA 1APBA 1GPH1 1FUKA 2GBFA 1IVYA 3DKIA 4DWOA 4AVYA 4ZZ1A 4GMFA 1FXWA 2NO6A 3K0AA 3K6KA 4I81A 2PQ0A 2AWNA 2HMTA 1Z75A 2FCAA 5EEHA 3MWKA 3EMBA 3EX7C 3JX9A 2FFJA 2GNOA 3KQTA 2PMDA 2WFZA 3KTAB 3JCZA 4G09A 5EUBA 3SX2A 2PUEA 3TTXA 3PYMA 3EF3A 4AF6A 1JJ7A 3NW9A 4NJOA 3TW6A 3TKLA 2V7QD 1F60A 1AZLA 3QGMA 4G0OA 4BV2A 5LWHA 1T2EA 4MUXA 4JC0A 3KALA 1P7PA 3IMEA 4F21A 4EYKA 1M6HA 3GLHE 5B3KA 4J75A 1HLDA 1XTVA 2C8KA 4JQCA 2AG5A 1TFUA 2J1LA 3VU1A 4HEA6 3VZPA 3V9AA 3VGPA 1JEAA 1KKUA 3G5UA 4F1WA 3PC8C 3H84A 5E38A 4DV1B 4DANA 2II6A 4HGOA 4QUAA 1QWOA 3SG0A 4DV5B 1MX1A 4M2LA 3AI2A 3EZ9A 5T41A 4G9BA 1P4JA 1VLJA 2W37A 3DAOA 3O1LA 4ALLA 4IQ0A 2ZUEA 3QQPA 2RHCA 2WABA 3UJ9A 3L8EA 1RCUA 4WCVA 2GT1A 1GNLA 3AR5A 3BMXA 2E82A 1US8A 1VLZA 1XTPA 3NONA 1ZUD1 2IYLD 4AJNA 2QNBA 2W6NA 4HP8A 3T9FA 1GLNA 1VTKA 3X43A 1Y37A 3H6KA 3M49A 1FDIA 3QKRA 2IL1A 2ZBPA 3CYFA 4YMGA 1KNQA 4A6XA 4IEEA 4ECAA 2CHQA 3LAWA 3MT9A 3D1VA 2F17A 2OV8A 3BQ9A 1ZFNA 2B8TA 2DFKB 1GA6A 3DDNA 4G0UA 4TTIA 2Y6VA 1R15A 3PDJA 5ICMA 3CEMA 4WJZA 1RNLA 3OP1A 1G0NA 2F7SA 3DLIA 5LYJA 5TV2A 3GZNA 2OT3B 3AFGA 1ZNZA 3L46A 5E4FA 1Z4LA 2Z4TA 5K3BA 1X2BA 2OECA 5IN5A 1C9YA 2ISCA 1SRQA 5JYDA 4OQLA 3HA5A 4X66B 2EDCA 2F48A 3ACCA 4DIUA 1SB9A 4ZGBA 4PXSA 4IDPA 3T6KA 4ZIRA 4A91A 3FOFC 4XIYA 3OETA 4E03A 1QK5A 3RV3A 3UMMA 1LS6A 2ZYGA 1KSHA 1Y6QA 2BRUA 2G9RA 1QZZA 3DZJA 2OHVA 1Z83A 3E0XA 3C1UA 2IDMA 3RV4A 3WLAA 2H1HA 2NU6B 1X80B 1IHPA 3JD4A 2Q5FA 1L9XA 3QEMA 2O2ZA 5C0OE 1A5BB 1C0PA 5AIAA 5I3ZA 2C7OA 2VNAA 1EFDN 3OQJA 1VKRA 1I10A 4AY5A 4DJJA 1W2GA 1FE8A 3IIMA 3JZAA 1IN5A 4HYYA 5KYUB 3C6KA 5AHXA 5KYKA 1TYZA 2IWRA 4PZEA 4D9IA 5FA5A 2XXAA 1YRBA 1GEEA 1ZVJA 4DV6B 2IEZA 4W82A 3R41A 5H8WA 1HY3A 3P0EA 1B23P 3ZH9B 1GAXA 2C07A 1LVGA 4EVIA 4RNCA 5DHTA 1UMCB 3IR5A 2UVQA 3ZW7A 4HRAA 1JAXA 1F2TB 3H0CA 1G38A 4F3YA 1PTJA 1RKQA 2ZIAA 3FB1A 4N8EA 5A9TA 1FMTA 2AOWA 4DVGA 5J2UF 1V7PC 3D3EA 1CEEA 4W6QA 3SOZA 1M2GA 2OGTA 2BAGA 2JHFA 3H99A 1DTWB 3KT8A 3L1JA 4KJZA 5LD2B 2BPOA 2BE7A 1ISMA 2GF9A 1WY7A 4KPGA 4X3CA 1ULAA 1E1LA 4G5HA 3FUTA 4AW9A 2BEVA 1DGQA 4D4MA 3LC0A 1IWPB 3DVRX 2J87A 3B3QA 3C98A 3J81A 2AXQA 2IS6A 1VJ1A 4O4IB 4WY2A 4OI1A 5FH9A 2HIMA 4B5LA 1DBIA 3OQVA 4YJHA 4W7IA 1KTVA 1NIPA 1X7ZA 3PV0A 4OYLA 2XA1A 2Q6KA 1Z5GA 3CC8A 4J16C 3R40A 1OKKD 2XD4A 3R3UA 4CKCB 4LJ8A 5JNUA 4YMVA 2ZI4A 2JRLA 3ODGA 3Q88A 1ZMOA 2ZRMA 4MR8B 4YACA 3ZXIA 5KPDA 2BZSA 4O2AA 1NZFA 1T4GA 4Q21A 3THYB 1BAPA 1U28A 1DAFA 4E4RA 1S4QA 3OD5A 5L4SA 2AF4C 2DTDA 2YUIA 3C3PA 3BMQB 3DM5A 4FFPA 4IIJB 4PHTA 1T2CA 5DBIA 4MV7A 3T99A 1JI0A 3UK6A 2QLTA 3WWCA 4BLUA 3AESA 3ET5A 4QO8A 5C5DA 3CPJB 3NWJA 3AR9A 4EG5A 2HB6A 3FZGA 2XNDA 1VKZA 4YN3A 5FULA 2YS6A 5IUNC 1L7DA 4P08A 1AHNA 2V4UA 1CVIA 1R6BX 5I9LA 4IX9A 4ZHQF 1DFIA 1Y8ZA 2RBGA 5DM2A 2NNWB 3K72B 4D2IA 2CNWD 1FTQA 2A84A 1VA5A 2HGZA 3H9EO 4AS3A 4DYVA 3EH1A 1PUIA 1T26A 1DT5A 2QQEA 2QJRA 1AO3A 3T1OA 1I32A 1MOZA 2YJZA 5E8RA 3ON5A 2AEJA 1XZGA 1UC9A 1RWKA 2W2PA 4YR9A 1PJRA 4JHLA 3RQSA 1IDOA 3MGCA 1HMPA 3TTWA 3ZDRA 1JE1A 3CVXA 2JZOA 5SZIA 1QCYA 1VKOA 3NUQA 3N8GA 4ID3A 3F71A 3JW8A 4X5OA 1P3JA 1JH9A 1A5SB 1XLTA 2YZGA 3N74A 2B2CA 4QDXA 2L18A 4AULA 3OPQA 1JDVA 1T0BA 2V58A 1YZ3A 3DH0A 1SCAA 4RULA 1U0TA 3SHFA 2G9NA 3H9QA 4QU5A 4D9BA 5LDDC 2VXYA 1RWNA 1X1QA 2KE5A 3NVMB 1L8OA 3Q7QA 4ZYWA 1HRDA 3AJDA 5ED0A 1QR2A 3KPVA 4XXHA 1VCIA 4M55A 1JZQA 3N2KA 4GUAA 4WCDA 1KP3A 3MAJA 4NBTA 3GI1A 1N6LA 1JA1A 2PGNA 3G2QA 4PFSA 7MHTA 5D85A 2VPIA 1UIMA 1F1JA 2F3QA 2J3HA 2FMXA 2ZI3A 3C6XA 4NMLA 4QDKA 2OXRA 3TZEA 2GRJA 4I9UA 4FEEA 3OX1A 1NURA 2HF9A 4XFJA 1M2WA 3GJRA 3IOYA 1CR0A 1KAMA 1FTYA 3OIUA 2D1SA 1OB5A 1NMYA 2WLTA 4OXQA 3K1JA 1NNUA 2YJ4A 1QGOA 4X94A 4LJRA 1BX3A 3S5UA 3UQZA 3LQQA 1N0WA 1YZGA 2GMWA 1MJFA 5IC4A 3TQSA 4MW5A 4E7PA 2P9HA 3GGSA 1T36B 3FRIA 4PGGA 1GKKA 4RZIA 3IIIA 1GAWA 2XY4A 4MI1A 4TGLA 3S1SA 3R0JA 4ND2A 5AVOA 3DLHA 1OUMA 3P5SA 1F8XA 2OCGA 1K5PA 2R4QA 2HQ1A 2RE8A 3AVWA 4KQMA 2PO5A 3DQZA 3KOYA 3LUKA 3AJ8A 1GNQA 4XDZA 1CP3A 1WKCA 2Z1DA 5LLTA 2VZ8A 1RMQA 3PQEA 1PFVA 3NIWA 3TTSA 3KYDA 4OCZA 1U3FA 3FSEA 3BL6A 3ABQB 1Q1BA 4GW3A 4FDTA 4FOOA 3RUFA 3BE4A 1MOQA 2SCUB 3ZVKA 2G6BA 4TVOA 1OXVA 1GSIA 4ZYXA 5J4HA 4ARCA 3AVUA 3RU7A 1JJIA 2RHWA 5JAZA 1HNXB 2FKNA 6Q21A 3DHYA 3UWDA 1P4RA 4BMDA 4FIZA 1N92A 1BMTA 4KLNA 2EFJA 3SQWA 3IV6A 1J8VA 1WZEA 2N47A 3E9CA 1L4FA 2EEZA 4GMXA 5AKGA 2QW0X 5FTLA 4CCYB 4XYBA 1HG0A 3PA8A 5CLIA 5DNEA 4LK3A 1UBJS 5KYGA 1JQLB 3EGXA 1OFVA 1O94C 1VDMA 2R1TB 3O82A 5C18A 3ISVA 1TU3A 3DZGA 4MVJE 1UPCA 4F4IA 1QSGA 2WU3A 3K0CC 3L8ZA 5CM9C 3GUCA 4LRTB 2O2HA 2XKAA 3VH2A 3T7TA 1PW7A 2NSYA 3H9CA 1CERA 1Q0LA 2A30A 2ACEA 3CX7A 1FNMA 3FNGA 3GHYA 5BQFA 5G0SA 3KHUA 4INPA 1CUFA 1NQUA 1NXQA 2IITA 9ATCA 1PK8A 2KHZA 3D2BA 4KWHA 2EGUA 4AJKA 3KOUA 1S2NA 3AERB 3IAAA 5DMHA 2VJOA 3KC2A 1A97A 1X2EA 4GPAA 1M1XB 4KK4A 4OP3A 4KREA 4EYSA 4H15A 1LC3A 1RHMA 2PPLA 1HX7A 3UGQA 3MMSA 4IJUA 1FPMA 2BHLA 2QMQA 1TO1E 4BO5A 1N8KA 1CF9A 1WQ1R 4TMXA 1Q6YA 2BFPA 4LJ9A 1XO1A 4JLKA 1DCKA 4AWBA 5U9CA 3VR4H 2NQTA 2R8ZA 2XMDA 3BCSA 1DX9A 3T5PA 3VPCA 1QQAA 3D6TB 1CLEA 3I6IA 5AD1A 3VMMA 1LX6A 1Y9AA 3G8BA 3SBDA 4AN0A 3TCNA 4R0MA 5J2UA 3JWJA 4DCUA 5AVQA 1EDEA 5SZHB 3ZBQA 3ASYA 3EIQA 3ZDEA 3CXRA 3I39X 1FVOA 1I6LA 4B48A 3GNLA 5ARCA 4LE0A 3V4VB 4NCNA 4ALIA 1IU9A 5JIBA 5DK4A 4MSUA 5K8JB 4BO3A 1RRFA 2I2WA 4E5SA 4JZKA 4RORA 5NLLA 1FSSA 3KKLA 1E9VA 3PP8A 1PZEA 3U37A 3U9TA 1N9KA 1YOVA 2NXNA 2QPTA 2XEXA 1G3QA 1VL2A 3PT9A 3RYTC 2O8NA 2JFNA 4D6YA 4ER0A 4L8GA 3CG4A 4K6KA 4ZCPA 1U3VA 1VG8A 2ZRNA 1WO8A 2PX8A 1ZIYA 1ZH8A 3GQVA 4FHFA 3T38A 4S1OA 2HQBA 2OE2A 3P9SA 4PO3X 3ZHSA 1OIVA 3O4VA 3OOHA 1KZGB 1Y8QA 2Y27A 4F93B 2SHKA 3UYKA 1NQVA 2CLHB 2F43A 4MDHA 2P8JA 2FJ0A 2PD6A 4KQHA 3MUNA 4P4NA 5AJHA 3ZWKA 1DEOA 2PUGA 1J0DA 4CKWA 3CZAA 2ZBRA 3CNBA 5CA1B 4HWSA 2AOTA 2LE0A 4Y2PA 3ZE8A 3LOUA 5G3ZA 3EG5A 1XLUA 1L5HA 1QHGA 2QGZA 1GGVA 4DPKA 5FWAA 1Q20A 1W34A 2NZXA 4FGWA 4M1ZA 4MYUA 2QN3A 4JUIA 4ZHQA 1RHKA 2DY1A 4PO1A 4PIPA 4JB8A 2CD9A 5BWOA 1O58A 1U6KA 2QN2A 1XCJA 5JV5A 5K3DA 5A5GA 1TTQB 1NLMA 2GCEA 2ZG6A 1VMAA 1BEEA 2PYZA 5TY0A 1PNOA 1CVRA 1YWGO 2B99A 4RA9B 1YDGA 4GXTA 3ZJ4A 3C6BA 3H2SA 1A69A 1KZYC 2W90A 1ACMA 1XLWA 5EIAA 1N8TA 3GLRA 4FEGA 4PC6A 4F8JA 2HF8A 3M3HA 2GGSA 4OQMA 1WUTA 2WYIA 1XCOA 3VPGA 3FNBA 3ZE6A 1XHFA 3DXFA 1RZVA 4HB3A 5LMCA 5IDXA 2Z8YM 4FGLA 1NULA 2AE2A 2QR2A 5EFZA 3ANYB 2QMOA 1D7OA 5F4ZA 4UFNA 2ZUSA 3COSA 2P67A 4H3KB 3FPBA 3LLVA 1NU8A 4HDRA 4MEJA 4WESB 5AOAA 1WZIA 5K3FA 2JC3A 4IXMA 2W8BA 3KZVA 3W77A 1TA9A 3SEZA 4KO1S 5JAUA 1RVDA 1KS2A 5DTJA 4ZYVA 3NT5A 3GFRA 1J0BA 4WXMA 5T67A 1KPGA 1N2IA 3SSAA 1YB4A 1M75A 1SFRA 1E3WA 1Y42X 1UZUA 2CMHA 2BE9A 4CM9A 1RKBA 3IFSA 1C3EA 4Z7QB 1GTRA 4J4TA 3ZI4A 1ITZA 1EXDA 1RWBA 2CHEA 3GPDG 1KJYA 2BGMA 1L9KA 2E21A 3HA2A 2HBQA 1VHTA 1Y1KE 1H94A 3LP6A 5KOJB 3LIIA 5LQJA 2R97A 1QFYA 2FWPA 2H4HA 3PC4A 5ALSA 2P0YA 4OU4A 4Q4HB 1PSDA 1V2HE 1U3DA 3EVCA 5DX0A 2QYOA 2BF7A 4HAYA 1TZBA 1CETA 2Z98A 2WJYA 4O2RA 4ZAXA 2P9FA 4DEYA 2OCYC 2PRZA 4LRXA 2I2DA 1EEHA 4TUYF 5CFMA 2BZ1A 3OCJA 1HO3A 5I47A 5GIPE 5JBQA 4ZTUB 3ZY4A 1JR3E 3GGPA 1W36B 4UTXA 1D09A 1RVV1 2B94A 2NUPA 3Q85A 4M21A 4ND5A 2PGDA 4NFLA 4PLFA 4Q9KA 4ONEA 4FWTA 2FU5C 3LIPA 3OQHA 4DMUB 5TEVA 1LA2A 1G59A 4RY0A 1E89A 3ZWQA 2PL9A 2LVBA 2LGJA 2V4ZA 3B13B 4QPZA 5H83A 2D06A 3VNRA 5AI5A 1ND6A 5IAEA 3ZZ1A 2R8OA 5G1OA 1B74A 3THSA 2I22A 3TRJA 1GA4A 1Z56C 4DEXA 5LQRA 2CL0X 4GLOA 2NVUB 4DC0A 3G5AA 5AH0A 4FYIA 2XAAA 1J42A 5HZHA 1JEJA 4OMFG 1A7UA 4RS4A 3K70C 4MEAA 2XGJA 2PSFA 2SKEA 4BEBA 3FWZA 2ZAIA 5I01A 1M5UA 4MUMA 3LY8A 1JR6A 1I4LD 1XAGA 3OCCA 3WZMA 3DDZX 3LXXA 3VO8A 4Z4IA 3KPUA 1LDNA 1OPRA 4B84A 1UFOA 1SELA 2Q3LA 4R2JA 2EIHA 2ZDQA 1KDVA 3H75A 3WLIA 2WVAA 2QG4A 1TMGE 3AB3A 1SKYE 1SVMA 2ZFUA 4ILKA 3AVYA 4EY5A 3IV7A 2G0TA 1Z6TA 1O97D 2C2MA 2ZW9A 4J07A 3UICA 4ZN6A 4BNYA 3K1TA 3BOSA 1M7HA 4QPCA 1AKVA 4P81A 2D5IA 3ORYA 4NH0A 3A1CA 2P4EA 2HADA 4MW6A 4E21A 1KNXA 3B2EA 4DHWA 1YCHA 4RKEA 1G20B 2XUKA 4NBVA 2AZMA 1AQNA 3LFUA 1LQ2A 1J0AA 4MQEB 3K0FB 3TVDA 5AW2A 3BSYA 3FPEA 3GW8A 3F46A 3AQ4A 3ZLVA 1P9OA 2WAAA 5C5EA 1XCGB 2HWXA 3H7IA 2X7XA 4HEQA 2ORIA 4YECA 4LHZA 3VYWA 4JEUA 1W0KD 1W4AA 5LXTF 1ORRA 3TIXB 4EFDA 4REOA 1ZUNB 3PFFA 4YQZA 3HU1A 1JXQA 5EJ4A 4FZ5A 2WVJA 4JLUA 4EEZA 2H2AA 2V0NA 2V7XA 3R0XA 2WUEA 1Z28A 2BGIA 3GFFA 2X9VA 4XSHA 1OLXB 1SHJA 4BO8A 3MOGA 3MLEA 4XJVA 2X0JA 5C32A 5AQ1A 2VRCD 3OTQA 3VR2D 4QSMA 3OCXA 4F86A 1Q0QA 5CAEB 3IVAA 2IHUA 3LS2A 2GAFA 1JECA 2Q5QA 3KKZA 1FJ2A 3HADA 3D54D 2GF0A 2AK2A 3FOWA 1Y7IA 3BHJA 2JFUA 2XDAA 4D41A 2OFXA 4QAQA 3GJZA 4MIYA 2UYGA 2GHIA 1XZ8A 3OAAA 3STVA 2GVDC 2CVFA 2WINI 4EKIA 5CBKA 2ZIXA 1ADGA 2EL9A 3ZHUA