2H16A

Structure of human adp-ribosylation factor-like 5 (arl5)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
149
Chain Sequence
QEHKVIIVGLDNAGKTTILYQFSMNEVVHTNVEEIVINNTRFLMWDIGWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human ADP-ribosylation factor-like 5 (ARL5)
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords ADP-ribosylation factor-like protein 5A
total genus 49
structure length 149
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h16A00
4KAXA 1A1VA 2CCJA 4WVFA 3THYA 4MYUA 1F5NA 1XPRA 4JLMA 4FN5A 3LW8A 5IF9A 2MSDB 2AHOA 5B57C 3AVYA 4LI0A 5DI9A 2RGCA 2WVJA 3RABA 2AXPA 1EFUA 2IEZA 2C95A 4V0ME 4MGYR 5EE1A 4QM6A 2YV5A 3AUXA 1ZD9A 2J41A 1GILA 1EFTA 5ANRB 2B6HA 3ZVNA 3IQWA 2O8FB 4H1VA 2AL7A 3PEWA 2X19A 1TL7C 1OH8A 4ZI2A 5CM8B 4M1TA 2W2VA 3EA5A 1KI8A 2VBCA 2VO1A 5TV2A 3GD7A 4LC0A 2JLWA 3H4MA 4ZKDA 1B23P 3GLGA 1FTNA 3KQHA 5LB2A 1GM5A 4M1WA 3WMFA 4URYR 5CIQA 4MDEA 4Q01A 1N6IA 1SXJE 4NCIA 4DDVA 2IWHA 3NHAA 4B76A 3VKWA 4ZDWA 4CT4B 1NRJB 2IEYA 2XITA 3OF5A 3ZVLA 3CX7A 4IVPA 3P27A 5AJWA 4IHQA 5KU1A 3BORA 4G1UC 2AFHE 4HB4A 4QL3A 1G18A 5P21A 4DWJA 4LBWA 4HUQA 3W90A 3QUSA 4QFMA 3FDIA 2JA1A 3FFBA 4TTQA 4A6PA 1KTVA 1YJ5A 2IK8A 1QHNA 4FXPA 4MRRA 2QEQA 3U3RA 4AURA 1KI4A 1OXXK 1WQ1R 1XP8A 4EIWA 4LGMA 4RFVA 3RS5A 5HPYB 3BXZA 1TU3A 3GMTA 3NC1C 2VP4A 4CEIA 5JRJA 2W58A 3T12A 2X2FA 4QJ5A 4GPTA 4RVCA 5DN6D 4DXAA 4LJAA 5AUPB 2WAXA 4US1R 4AIIA 3DL0A 1Z06A 2MSEB 3RS3A 3K0EA 2E1RA 1G8PA 1SZPA 2O52A 3P26A 1XTIA 1NY5A 2GRJA 2ZJOA 4V02A 3C41J 2CE2X 3GLIA 1SVOA 1IXZA 3OESA 4HAZA 2ZANA 3A8TA 3PEVA 3VAAA 1VHTA 3BK7A 2ZRLA 4ITRC 2H57A 3IIMA 2XZOA 4KXFB 2CJWA 1EWQA 1OJLA 1FNMA 3W3AA 4DHEA 1P4SA 5K8IA 3VHXA 3QKUA 1G7TA 3TGPA 2IYXA 3ADDA 1F60A 3K9NA 1U0JA 4Q4HB 1LF5A 3CWQA 2PBRA 5EXPA 4M2LA 3U44A 5FBQB 2YINC 2YNMA 4KSBA 4B3CA 3U3MA 1X1SA 3K70D 4LHXA 3CLVA 2XJ4A 3ND9A 1W2GA 3UG6A 1TF2A 3LBHA 4KFUA 2WJGA 3RYTC 3GP8A 1Z6YA 3I3SR 2F43B 4G5GA 1ZC4A 3EZ9A 1NIPA 1OXVA 1Q22A 1YZQA 3WMGA 2J1LA 1YZKA 3T1VA 1PUJA 4I1VA 4BLTA 3THXA 2OHFA 4CEJA 4FMBB 2KSQA 2ZRCA 1TTTA 2CCGA 3B1YA 5EE9A 1ZVQA 4B75A 4HAXA 3SR0A 4A6XA 4BGDA 3G0HA 2VLIA 3HPQA 5DLQC 1KY2A 1HA3A 2R6GA 1AKEA 2F3TA 4IDNA 2EYQA 3DDCA 2H18A 2WIBA 3K0FB 4HUTA 2A30A 4YXWA 1KMHB 4JBYA 4D6PA 4FIDA 5HKKA 4ABYA 2NQ2C 2ZS7A 4MDFA 3WYAA 3SI7A 2NO7A 3LA6A 4NDZA 3TR0A 3W9YA 1O3YA 1XD8A 2WOJA 2RGAA 2WSSA 3H2YA 5EUQB 4QHTA 4V0OA 1VMAA 4XVUA 2XOKD 4PZLA 4JS0A 4TLCA 2HJVA 1BKDR 3OE7D 1E9BA 3PUYA 3QEOA 1KK2A 2XXAA 4W5JA 3EX7C 2D74A 4DLRA 3SYNA 1RIFA 3ZH9B 4EJSA 1CRQA 1RVDA 5GVSA 1Z22A 5JEDA 2X1VA 1ZNZA 4XJXA 2ZR7A 1BS1A 1JJ7A 3AM1A 1DAEA 3TW8B 1SKQA 1G5PA 1AIPA 4NTZA 2ZE8A 3W34A 3WBJA 5GJWC 4ZI3A 4ESHA 1KO5A 4F93B 1SXJA 3CW2A 2OV2A 2PT5A 4DZZA 3REFA 1DAMA 2WSSD 4KFSA 4H1UA 4M0LA 3RS0A 5K8UA 3KZ1E 1UPTA 1PVOA 5FL7A 1G41A 4F4IA 3K09A 3OIUA 3PXGA 1GAJA 2X2EA 4B3XA 3PG5A 4JVNA 2F1HA 1NLYA 4EFNA 2WOOA 3GLFA 3CX8A 4HUQB 1RYFA 1MT0A 3K0AA 1COWA 3M6AA 4TMZA 2FNAA 4L15A 5KSPA 1XF9A 2CBZA 1NN5A 3CNLA 2ERXA 3P4XA 2OZEA 4DCTA 3KQUA 5TVKA 1NF3A 2GCOB 2YYZA 3RAPR 5KNCA 3K0CA 4IXNA 5TARA 4LZZA 1JXOA 1M7BA 1NMZA 4OHWA 1ANKA 3CPJB 3EPLA 1YU9A 3NKVA 1G3MA 2C8VA 2BBWA 1HV8A 1R6BX 1OYWA 2BHRA 1K5DA 2WWFA 1KKLA 2NZJA 1PLJA 4KV9A 4LX0A 1BIFA 2R62A 5JWHA 3AP2A 2H92A 5JSZA 2HT1A 4TL9A 1QRAA 2PL3A 3WMEA 2HLDA 3AEZA 1G3RA 1KO1A 3PEYA 1E2LA 1Q3HA 3FE2A 2DCUA 3AGQA 3WNDA 1W2HA 5FH9A 1ZUIA 5EE5B 1E0SA 5SZKB 3EZ7A 3DO6A 3U60B 3OIWA 3Q3JB 1MO3A 1P2VA 5KSOA 1E2NA 4JLKA 3QVUA 1JJVA 1IBRA 2BKUA 1OE0A 1WF3A 3PCRB 4ZKEA 1W4RA 4PHFA 3TBKA 1ZM4A 1UDXA 3K0FA 1XB2A 2Z83A 1I4LD 1VKJA 4A9AA 4NU0A 4KYUA 4LWZA 4TMVA 1W36D 4F4CA 1II8A 1RFLA 2P6NA 4WA7A 4OK3A 2C03A 1GUAA 5HKKD 1JALA 3CZPA 4LJ4A 1WMSA 3PFIA 5DIFA 3A1TA 5UKDA 4U7DA 3VNVA 1GNPA 3X1XA 1K5GA 3V4FA 5EXTA 1KI2A 5KHOC 2JLUA 4P4SA 3TSWA 2QGZA 3R9IA 3J81k 2J0SA 5M04A 3RC3A 1R0YA 3FHOA 4Q1EA 4Q66C 4Q48A 1LVGA 2REBA 4MYCA 4ZCIA 1FP6A 4NP6A 2QL6A 5FL3A 1G4AE 2AKYA 1W4BA 2IBMA 3AVOA 3CRQA 4IOKA 4DDUA 3L8ZA 2R65A 3K0CC 3SJZA 3QPUA 4M1SA 2N46A 3EZ2A 4OI4A 2GVZC 4EPVA 2CEAA 5JJKA 2A5GA 2QT0A 1N6HA 1T0HB 3RRYA 4ACBA 4BEJA 1F3OA 4K46A 2HT6A 1AZTA 1Z6AA 2P67A 3IEVA 1U9IA 5FBRB 2G0NA 3AVPA 2GEVA 5GJVC 2ZSDA 4O2LA 3SNHA 4D0GA 3U61B 1G3UA 1P62B 2ZRPA 1N2CE 1Z0KA 1IOZA 3THWA 1CR0A 5TMPA 1KKMA 1OFTA 1F48A 4KITB 3AKDA 3L0IB 3WNBA 2BV3A 3K70C 1QHGA 1ZJ6A 2XTNA 3NH9A 2WIAA 4GI7A 4UNSA 3EIQA 1W4CA 2W83A 3CWZA 3P20A 1MV5A 1G7RA 2AK3A 3QQ5A 2P0EA 4M4SA 4PC2A 2F9MA 4W5WA 4B43A 4D0LB 1R5OA 3SYLA 5L3VA 2FX3A 2WZQA 3FMFA 3R9XA 2ZI9A 2ONKA 5G41A 1JQJC 1DG3A 1U8YA 4HAYA 4AKEA 5EZ5A 1X8LA 4LCBA 4KO8A 3AH8A 4XVQA 4KLZA 2BMFA 1ESNA 4EQ6B 1Q1ZA 8OHMA 1M6NA 4IDOA 2L0XA 2YWGA 4ZDKA 4P4UA 2UVQA 3DM5A 4DJTA 2HF8A 3ADCA 4Y0VA 1E1QD 5DSZA 4BE7B 2C9OA 1U8ZA 2QNRA 3SHWA 1E2KA 1E0JA 1T8TA 5DYIA 1I4DD 1NMXA 3NEJA 1Z29A 2BMEA 3CKLA 3LFUA 3PJRA 3TSOA 2O8DA 1XJQA 2GESA 1DTSA 1OH5A 1ZNXA 2GNOA 1ZD1A 2QGNA 2ZYWX 2VF8A 1XTQA 3N2EA 4C4PA 4GZMA 3QE0A 2DFLA 4DLVA 4US0R 3AUYA 4URWR 4CVNA 5KYKA 1N25A 3TUIC 1T91A 4YMUA 3GLIB 2O8FA 3EC2A 1Y63A 4QM7A 2WV9A 4P32A 4M9QA 4PHHA 1GVNB 1ZMXA 2FN4A 4BZXA 4B44A 1T4GA 3VR2A 2JLXA 2WKPA 1X1RA 3CO5A 1QF9A 4JLDA 2BEKA 1EG7A 3MUFA 3HJNA 5CK5A 2W00A 1SVWA 4HAWA 4P3YA 5L8VA 1XMJA 5BN5A 1G21E 1YR8A 1TF7A 2ZTSA 2ZRDA 1ZIPA 3N5CA 2D3WA 3B1XA 1Z0AA 2QN6A 2WJYA 4Q4JB 4R7ZA 2RHDA 5SZIA 2FA9A 5AJYA 4C0QC 5BYKA 1BYUA 2FFHA 3VX3A 1S9HA 4E07A 2GILA 4FI3C 4NKRA 4WBSA 5KPJA 2W6JA 1KO8A 4DEXA 2R6CA 3NG1A 5BW8A 1E9SA 4BEBA 2JATA 1BMFA 3B1ZA 3TJZA 4EPYA 2DR3A 2YC2C 2ZS8A 2CDNA 1FX0A 4DLUA 2ZRNA 4PPNA 4US2R 2QTVB 5KSYA 1N5IA 4LJ8A 3CNOA 2GZDA 1NVVR 4MITA 4DCVA 4E03A 2Z6VA 3K0SA 1JR3A 4OI1A 4FD2A 2ZRAA 3AF2A 4KVAA 3QG1A 3BBPA 4CEIB 3GPLA 4IFEA 4F92B 1JAIA 2F3RA 2WWGA 1G64A 3ZD6A 3SBEA 4JJZA 3VU9B 4I4LA 2GKSA 1XFAA 2V1UA 4M9SA 1M34E 4MA4A 5ELXA 5HR5A 1AZSC 3AF0A 1UBFA 4ZDJA 3I5XA 3EASA 1GKUB 3EIEA 4Q4JA 5F2EA 3QXHA 1II8B 3I92A 4IOJA 4TLAA 1KSJA 3RSLA 1EESA 1SHKA 1S3SA 1IN5A 3CIOA 3QI2A 4IFBA 1L8QA 3OFNA 1EWRA 1KK0A 2PX3A 3OZXA 4FCTA 4Q4AA 2IYUA 6Q21A 4TYWA 4TYQA 5L3RA 1T3LA 1IY1A 1JXMA 3LD9A 4OK5A 3OEHA 2ZXUA 1U81A 4Q7JB 5BXQC 1U9IC 3NBFA 3MAAC 1YRBA 3SC3A 4B74A 2H8KA 2ZQ5A 2XTMA 4IOMA 3QSYA 4OK6A 1KIMA 1N5JA 5FPHA 3CPEA 1PJRA 4RCZA 3CUEF 4HZUA 3K53A 4ASUD 3I8XA 2QE7A 2XNSA 1YR9A 4G01B 3Q72A 2ZJ5A 3Q8XB 4A82A 2F9LA 4XOIA 1T9HA 3I73A 1GOTA 5J47A 3NC0C 1A7JA 1MRNA 2CCKA 1LF0A 3CPHA 4GFDA 2A7QA 3DHWC 2ZAOA 2JIZA 2R9VA 1L2TA 4CRWB 3MFYA 4QNMA 3Q5DA 4OL0A 5DGXA 2YJTD 5F9HA 3GLHE 5FUWA 2O0HA 4TTPA 1PUIA 5FTLA 1XEWY 4TWZA 2BOVA 1NSTA 4QKQA 1UM8A 1U8AA 3EC1A 3IBGA 4G0NA 1KZ7B 4URVR 4KU4A 4F4JA 4NH0A 5DN6A 4DLWA 2V7QD 2IYSA 3EWAA 1CJUC 3KKOA 4Q00A 4QGAA 5CDFA 3B5JA 4KBGA 4HATA 4CEHA 2R6FA 3KQKA 4ERNA 2RB4A 2WPDA 3ZS8A 4TTRA 3ND8A 2JJ2D 4JKYA 1ZW6A 1Z0JA 4KLNA 5BN4A 1V5WA 5AR1A 5J4LA 1JEEA 3GJXC 3A6PC 4C30A 3K1JA 4V0MA 5FL7D 4LYFA 2J7PD 3CF2A 1I2MA 4D4JA 1FUKA 3ZZUA 1AM4D 3GCGA 2XSZD 4LY6A 3U44B 2BVNA 3U4QA 4PX9A 1CJVC 4I1UA 3I4LA 4BZQA 4MH0R 1P3JA 2EFEB 5C18A 3O47A 3L43A 2ATXA 4BECA 3O8RA 4AG5A 1RYHA 3OEEA 3BH0A 4RD1A 4V0NA 4B3GA 2ZROA 1SXJD 2SHKA 5KNBA 4PZYA 3VR6A 4HSEA 2BBTA 2ZRHA 1XD2B 5JMTA 1BYIA 3FKSA 3G5UA 1G8HA 1XRJA 4TMTA 3EPHA 3UPUA 4LSGA 2F55A 2XX3A 1FOEB 1S1CA 1U94A 5FTKA 3TUZC 3VKHA 4ESVA 4PPGA 2NO0A 1BH2A 2JJ2A 3TQFA 4PQYA 3LDAA 2VYFA 3BB1A 3OEED 1CJMA 2H16A 2PX0A 2FH5B 2HXYA 4MGKR 5FBLB 1CF4A 2A78A 3TR5A 4DLZA 4A4DA 2IYLD 4OQNA 3WRYC 3FOZA 3GLFB 4EQ6A 5CIWA 3K0AB 2DYKA 4TT3A 4JLBA 1TQ2A 2AR7A 2NPFA 1G19A 1CTQA 1GSIA 3VNUA 4NCHA 3D31A 3NWJA 2A9KA 3LV8A 4GOKA 4AY2A 1SVIA 2V55B 1JR3E 4UNNA 2JLYA 1VG9B 4C2TA 4NYJR 1COWD 4GNKA 4DC9A 3NEYA 4D26A 4IVQA 1H8EA 5G3ZA 5EP2A 2CK3D 4JZKA 2PT7A 3O8BA 2IX3A 4CT5A 2ZREA 2QRNA 5FI0B 1VCMA 3GFPA 4JT2A 3SOPA 221PA 2H5EA 4BFZA 3U7FB 4RKEA 1OLOA 4AYWA 5AJZA 2VP9A 2CNWA 4GT1A 4C9BA 3CRRA 1DPFA 2GF0A 3DM9B 4Q03A 1YR6A 1VCOA 1E6CA 2IWRA 2ODWA 4TZ0A 3SDZA 3WP1B 5DISB 4C0JA 4LV8B 2G0TA 4R98A 1UF9A 2QAGC 3UK6A 3FGNA 3GLFE 5LD2B 3CZQA 3RLFA 4EPRA 2EU8A 1HE8B 1U0HC 5EP3A 4GL2A 4II7A 2CJWB 1E2EA 3SE0A 2X77A 2NO9A 3ECCA 2VA8A 5AJVB 4LBYA 5TY0A 3L0PA 3MRSA 2ZU0C 4W7SA 4CGZA 4A0HA 4PC7A 1G291 3WY9A 4JIMA 2CLSA 1N6PA 2QP3A 1WBBA 4BLSA 1SQ5A 421PA 5SZJA 2BWJA 2CLDX 2FDCA 2QBYB 2GJSA 4AYXA 4D81A 1XPOA 4KCGA 2FOLA 1FW6A 1LV7A 2FFQA 3IIKA 1W1WA 2G77B 2FWRA 4YQFA 5J4HA 1ZD8A 3H0KA 4BQSA 5HZHA 4A36A 1H8HA 2CE7A 4W5HA 3I5YA 1N5KA 1NVWQ 4PPFA 3ZVRA 4H9GA 4M1MA 1DAKA 4B2PA 3TKLA 1TPZA 2AK2A 2GZAA 1XXHB 2VEDA 2C9CA 5G40A 2OCAA 1W47A 2IYYA 2ZJ8A 4L16A 4DDWA 2ANCA 2QE7D 1NVUQ 1RKBA 2FSIA 2IS6A 3IO5A 1DOAA 2DFTA 1KAGA 2P5TB 4ZV4A 1E4VA 3LLMA 5FTMA 2QI9C 1R7RA 2Q9CA 3D3QA 2N1BA 3LQRA 2R44A 1HY3A 4L8GA 4AD8A 1HTWA 5FUVA 3KKMA 1CR4A 2XJ9A 1KY3A 1QHHB 4EPXA 3ZD7A 1JR3D 2IHYA 5AUQA 1OSNA 2R6AA 5FUXA 2OUKA 1IN7A 2D2EA 2E9SA 2UZ3A 2KJQA 4Q1DA 4UKDA 4TYPA 3N70A 4S2EA 4QXAA 4JBWA 2WMOB 4NYMR 3B7GA 3AVVA 1AS2A 1ZU4A 1CU1A 1Z2CA 4IDHA 1OXUA 3VQTA 1II0A 2FU5C 2KE5A 2RH5A 2VP6A 3UANA 3KKNA 3PUZA 2GAOA 3TAHA 4IJMA 1OIVA 1HUQA 5CYOA 2E87A 4MKIA 4QJ3A 3BB4A 3B82A 3HP1A 4M1KA 1ZUHA 1R5NA 1TQDA 2F7SA 5JLJA 3FKSD 4JLVA 5E7MA 4ZCLA 3U7HB 2LCFA 1Q1QA 2VSXA 3LY5A 4ILEA 4I1OA 1AGRA 4RD6A 1MR3F 1RZ3A 3M1IA 2OCYC 2A3RA 4R71A 1E69A 1RJ9A 3P32A 1EFCA 1O87A 4IW3B 3ZGXA 4DIDA 3HYRA 4DVGA 2ZUDA 1ZM2A 4F7WA 3PIRA 4YMSA 4QGHA 2ZRIA 3SBDA 4MRPA 4EPWA 1J8YF 3NIBA 4MRSA 2BM0A 2GXUA 1GZSA 2IL1A 3IPXA 4DSUA 1FL9A 1FP7A 4EAQA 3KFVA 2QPOA 3C14C 2GDJA 1NG9A 3VTKA 3X1DA 2W6JD 2RCNA 3AF3A 3HU3A 4JVMA 1RE0A 2OBMA 4IKEA 4O25A 4PAOA 4EKDA 4ZDIA 3FMPB 3BWDD 2ZRBA 3A1UA 1LS6A 2FZ4A 4Q47A 4LBZA 3L82B 1G6HA 1T3HA 2VQSA 2J0VA 4M8NE 2EQBA 1ZRHA 3K9HA 2QP4A 1G9XA 2HYDA 3ZIAD 1G7CA 2BIFA 2KBFA 1KHTA 3AVTA 1U2RA 4DCUA 3GLGE 5C4MA 3UMSA 3L0SA 4XWOA 4M22A 1QHIA 3LLUA 2V8OA 2ECKA 3P1JA 5BWMA 5JSZB 4A92A 1EFRD 3KX2A 3CH4B 4DSOA 5IK2D 2FMXA 2GXAA 2CVHA 2V1XA 1BO6A 3DZDA 4J0QA 3NBYC 3VR3A 4BUJA 1E0AA 1XMSA 4N0EA 4B73A 2OAP1 1ZIOA 3KXKA 4ARZB 5CITA 4URZR 2KI5A 5DHAA 4NZYA 5EE0A 1GNRA 2J0QA 2VP2A 1TU4A 4PSKA 5EQTA 3BAFA 4PR0A 4Q9HA 1SGWA 2C9YA 1D2MA 1YZGA 3SN6A 1B0UA 2AWNA 4A8JC 1DADA 3IUYA 3ASZA 4IEIA 1IQPA 1AK2A 1C1YA 5CYPA 1P72A 1Q57A 1DAGA 5JCPA 4DEYA 3TLXA 3H1TA 3OFND 2ZR0A 4FW9A 2IXEA 4PQRA 1P73A 4FMCB 1OIWA 2CHQA 1HURA 3T15A 3WBKA 1Z0IA 4TLBA 3ZVMA 2X8AA 4GDFA 4PHGA 1XU4A 1KSFX 2P6RA 4JLPA 2BC9A 3RVBA 2I1QA 2AD1A 2V6JA 4B2LA 2BBSA 2ZJYA 1E32A 2TMKA 2IC5A 4BZPA 3BOSA 4HLUC 1FFHA 1UBGA 3E2IA 1IJFA 2KWIA 2CXXA 3IHLA 3OIYA 4RD4A 3NBXX 3TW4A 4M53A 1T6NA 1X86B 3HU1A 4NPHA 3T61A 4BPBA 1FZQA 1E2IA 1OHHD 5F3WB 4AI6A 5K8LA 3SFZA 1G4UR 4P0TA 1FMJA 1UBEA 2C2HA 4GP7A 2QMOA 3E1SA 2QTHA 1UKVY 4AC9A 3TE6A 3EWSA 2VF7A 4E09A 4OJQA 4DB2A 2ZRFA 1N6NA 4K81B 2DHRA 2AKAB 1W36B 3ZZ0A 4DKXA 1X8KA 3WRXC 5EZ6B 1G6OA 5L3QA 2JDIA 3BC1A 1QHYA 3CR7A 2V6IA 3KXIA 1P2UA 2PZEA 1CP2A 2DWQA 1CJTC 1OIXA 1Q21A 3KXLA 4Q9JA 5G53C 2GEDA 1YZLA 3SJBA 5KNDA 3BIFA 1DO0A 4CIDA 1TAGA 2UZIR 1U0LA 1Z07A 2J3EA 1UFQA 2IXGA 1F2UA 1NY6A 3SYKA 4MUBA 4JL8A 3I32A 2QT1A 2ZRJA 2DWOA 1Z6GA 4LYJA 4RFSB 2WJJA 1OB2A 1C9KA 3C15C 4XVRA 2QQEA 4GMXA 2FPKA 4DUGD 2RGXA 3L0OA 2I1VB 1R5BA 3PR1A 4C0LA 2QZ4A 1DG1G 4OHVA 1U99A 3I62A 2ZI5A 4LYAA 4C7OB 2WWHA 1P6XA 4OHXA 2ZSEA 3ASYA 1SXJC 4NYIR 2WWYA 1J7KA 4B48A 4LHVA 1CR1A 2ZRGA 2EFGA 4X8MA 1ETUA 3SZRA 4HB0A 4JSTA 1DO2A 1GWNA 4WIAA 1D5CA 5CB6A 4DBLC 1CJKC 4EJSB 3MWYW 3EARA 1NJFA 1J99A 5LDDC 1KGDA 2QMHA 4XWAA 4DT1B 2ORIA 1IHUA 1K8RA 5FOXA 1AS3A 4Q7KA 4FWTA 2XAUA 3K9LA 4RZXA 5E7JA 4CEJB 4HZIA 3TVTA 4A0RA 1GTVA 5HE8A 1SXJB 3BE4A 4HLDA 2XEXA 4JBXA 1M74A 1GL6A 1XPUA 4HAVA 1IXRC 1VHLA 1F2TB 3ONWA 5JJIA 1WCV1 3AVWA 3UWOA 1OXSC 2YKGA 1PLKA 2VL7A 2CL6X 3QVVA 1E2FA 4LPKA 5FTNA 2XZPA 4PAQA 4Q4AB 2VIIA 2IYWA 4Q02A 1W0JA 2AFIE 2NIPA 1NBMA 2RGNA 5A5GA 4LJ9A 3SQXA 1X8JA 4BFUA 2YOFA 3IGFA 5LPNA 1NVVQ 3NHBA 3AP1A 1DE0A 3QXJA 1WA5A 1E2HA 3EW9A 3AV0B 2HJGA 2IF2A 1TX4B 5JWRA 1E79D 4MYTA 4Q19A 1G8YA 4B3DA 1JPJA 2HXSA 2JLSA 4DB4A 1RRPA 4B34A 2W0MA 4UXIA 1KI7A 3HWSA 3EG5A 2XOKA 5D3MA 1S3GA 5CM9C 2GJKA 3LW7A 3T1QA 4NONA 3VMFA 2YVUA 1IM2A 1HYQA 4YMVA 2IHBA 3N2IA 4RKFA 3SHFA 3A4LA 4AG6A 1FTSA 5JWOA 2OFOA 2WJIA 1RC8A 3NH6A 2CL0X 4I81A 2GETA 4DIEA 4D4MA 2ZUBA 5IRCD 3MJRA 5FBWB 1Z5ZA 1VCNA 1XJCA 2O5VA 3PQCA 2GTPA 3R8CA 2DFKB 3FMOB 4GZLA 4ON9A 5JRZA 4BFVA 1P5ZB 3QPWA 3KKPA 3EZ6A 4XSHA 1W5TA 5FPTA 1QVAA 4LDJA 4X8OA 4RD3A 2A5DA 5FPKA 2D4HA 1NLFA 1P7CA 2Q9AA 3AKYA 3GEHA 2JLZA 1ZUNB 4YC7A 2FPLA 3BS4A 1CLUA 5SZHB 2RGDA 1R0ZA 3W6NA 4B2IA 4D82A 3MSXA 1H65A 3ZJYA 4HLCA 2ZS9A 1D9XA 5JEEA 2OESA 2QSYA 4PC3A 2O8EB 5JI2E 1VG0B 1Z8FA 3KTAB 4GOJA 4RJLA 1RRCA 1E99A 1UDWA 4B47A 3F3YA 4TZ6A 1EXMA 2P5SA 2YWHA 1H8HD 3GJ5A 1NN0A 2BCGY 5DHFA 4KYIB 1T8UA 1UBCA 1VIAA 2OCBA 4JLAA 3AVQA 4HZUB 1KI1A 4LHZA 3IBYA 1UADA 1Z0DA 4R9UC 1LY1A 2CK3A 2F1RA 3BFXA 1LNZA 1MABB 2QAGA 1E1RD 3QXSA 4XD7D 4BLQA 5JBQA 1US8B 1F2UB 1G7SA 1E9EA 2GVDC 3AF4A 3KUCA 3C4JA 3VKGA 3TK1A 2FF7A 4PXAA 1HT1E 4EFLA 2NMVA 4HLQB 4QHYA 2NO6A 4LV5B 3EPKA 3QPVA 1R8QA 2WKQA 1XZQA 1XEXB 4FCWA 1IAQA 1CBUA 1XX6A 2A5JA 1ZP6A 2QMEA 3VX4A 5L3QB 2VHTA 1MO6A 3W5JA 4HDCA 5B58C 3TIFA 3TUJC 1QG4A 5AUNB 2DY1A 3A4MA 3KQLA 4C7OA 3A37A 3CR8A 3MD0A 3WXMA 2DPXA 1Y3AA 4PZZA 5AK0A 1D9ZA 1OF1A 1V43A 1WRBA 3LXXA 4BLPA 621PA 1CRPA 2VH5R 2YHSA 1JPNA 4LK2A 1UKZA 1E3MA 1KO4A 4M9XA 3LX5A 3T1TA 1Z6TA 5C4GB 3TSZA 1G20E 2C98A 2A5YB 3LNCA 1VECA 1KJYA 2QPAA 2FFBA 3A1VA 4G3XA 4XD7A 2DWPA 1KDOA 4A2PA 1IN8A 1AQYA 3I8SA 3RS2A 1MOZA 1A2KC 3X2SA 2ZM5A 2VHCA 1E79A 3AP3A 3F0TA 4URUR 3CF0A 1R10A 4WZBE 3X1ZA 4D2IA 2FEMA 1KSHA 1EFRA 2PCLA 3Q7QA 5FR2A 4PO1A 4IXMA 2WSMA 3CNNA 4LC1A 1F2TA 3GQBA 4JKIA 4KI0A 1P60A 2O0KA 5J4VA 3AGPA 1PLLA 2RAPA 4A1FA 5JZVA 4LJ7A 4PFSA 3K70B 4QG7A 1ESMA 1KJZA 2NPIA 4G5RA 1YZUA 1OH7A 4AKHA 3ZIAA 5C46F 4HDOB 3KQNA 2GJAA 2ZSBA 2P3SA 3A1SA 721PA 1M7HA 2FFAA 4LYHA 5CDFE 1GNQA 3WP0A 4A2WA 1JBKA 1YE8A 4HYYA 4Q18A 5DO9A 1WDTA 2J0UB 2IS1A 3W6OA 1XBTA 3VHLB 4TQUS 4OI0A 2QUZA 4NMMA 2OO7A 4Q21A 1KJWA 1KNQA 3L2OB 2F6RA 821PA 3AKCA 2WICA 3PV0A 2R6DA 1R0XA 3BFVA 2F1IA 5CK4A 3DMNA 2QA5A 2GK6A 1E4YA 4WZ6A 4TN1A 3HDTA 2ZYVX 1P2TA 1XXHA 3RNLA 2G88A 2GWHA 1DAHA 2YOHA 2LWIA 3KTAA 3Q85A 4NE2A 2W6ID 4HB2A 2MMGA 2I3BA 5FI1B 4Z51A 4ZIRA 2OLJA 2AXNA 3C7KA 5DI3B 4MGZR 3V00A 2ZYTX 1OFIA 4B3BA 2C04A 1AN0A 1LW7A 3ZZTA 4JYBA 2RKOA 1LTQA 2QG6A 1DAIA 1KMHA 4WXPA 5KOYA 1EFHA 5JI3E 2WHXA 2IUTA 4Q9IA 3IQXA 3LX8A 4JJKA 3T34A 3UATA 1G3IA 2QPTA 2WKRA 5D3MB 1ZU5A 5FUYA 2QM8A 2ZRKA 3AKEA 4TT3D 3TNFA 2Q3FA 1YHNA 3PVSA 2ODBA 4XTCS 1OFUX 1A2BA 1KMQA 2R8RA 3B85A 2RGGA 2ZJBA 2FV8A 4XIGS 1ZM7A 2O8BA 3THOA 3RANA 2QQ0A 1GG2A 1M7GA 2QROA 2ONJA 2IT1A 2EWWA 2KB0A 5CJ2A 3T5DA 4RSGA 2Q3HA 3WHLA 4WZAE 2DBYA 1Z0FA 3UKDA 2FZLA 4DLTA 4BFSA 4DDTA 5H70A 2AN9A 5KSZA 3GJ0A 4OJKA 2VHQA 4GMDA 2JIZD 4BASA 2ERYA 1XDBA 4K8OA 1S1MA 2G1JA 2XNDD 3DKVA 5B2ZA 4C0KA 2OG2A 2ASEA 1QZXA 2NG1A 3EZFA 1GFIA 4TMXA 2Z0MA 3CONA 4OHZA 2OCPA 2G83A 2J7KA 2GXSA 2XTZA 3CRMA 1UKYA 4UNPA 2ZE5A 4DSTA 3S1AB 4O0MA 2GHIA 4NCNA 2O0JA 1Q0UA 1W48A 3QKSA 2J7PA 4HEJA 3E70C 4RY2A 4YXWD 2C5LA 4GBMA 3JZMA 1HQCA 2Z43A 2CMKA 3JZAA 4G5OA 2VP5A 5GADl 2GJ9A 4B6EA 1DAFA 3U6KA 4R2IA 1AQUA 5AJXA 3BD9A 2IYRA 4KODA 2JASA 3QIAA 3ADKA 3KB1A 3W8NA 1CXZA 4TYNA 4HAUA 4IEEA 1ELOA 2JGNA 3QJYA 1IXSB 2PMDA 2J0UA 2QU8A 4U5XA 3KB2A 1T5IA 3IIJA 3X1YA 1L7VC 2HV8A 2N42A 5FTJA 3ZDQA 2BJWA 2OBNA 1NI3A 2Q6TA 2JEOA 3MLEA 2IXFA 1TNDA 3GFOA 4MQBA 1VDZA 3NVAA 2RGEA 3C8UA 4A8JB 4B6FA 3ZLJA 5E4FA 1P9RA 2QAJA 2ZE6A 4KHZA 4Z8XA 1Z63A 2OLKA 2ZI4A 2CNWD 2AD5A 3M4YA 1IONA 2MMCA 2OSBA 1A5TA 1G16A 3EA0A 4C2UA 1MH1A 1E94E 1NP6A 3VR4A 1PZNA 5J40A 1H8ED 1NN1A 2W2XA 1BMFD 4E22A 4RCYA 3PUXA 1NJGA 2Z4RA 4Z1MD 2A5FA 4RD0A 1UEIA 4YDHB 1W7AA 1RW4A 3CX6A 4PO8A 2HCBA 2B8TA 2GAAA 5JFGA 2IS2A 2BCJQ 5J4YA 1US8A 1ZCAA 1SKYB 4QJ4A 4JL6A 1KSGA 4OYHA 1JI0A 3TQCA 3LAWA 3QBVA 2GBLC 1S9DA 2QRZA 3QNUA 3TRFA 5F98A 2PLRA 3B60A 3QF4B 2OFWA 4FMDB 1NIJA 1CS4C 1OKKA 1J2JA 3IPYA 5EE3A 3V9PA 3RHFA 2G1KA 4MRVA 1VYUA 4GRAA 4M1OA 5IK2A 5TB5A 1G8GA 4QNRA 2VHJA 2ZVQX 5JHGB 3DPUA 1NBME 2ZU6A 4G5QA 2V4ZA 3KL4A 1VG1A 5HCNA 3C5CA 4JSYA 3LBNA 4X8HA 2IYTA 1ZNYA 4Q1FA 4UJ5A 2V9PA 5CJPA 5CB8A 1E96A 2IA5A 1YZTA 4TSFA 1T3SA 1KI9A 4FCVA 2D06A 2D2FA 1DVRA 3QG5A 2GEUA 1SVSA 1Z6XA 3R7WA 1N0VC 1S96A 1NG1A 2FSFA 1K6MA 3VU9A 4FMCF 1SKYE 5K8TA 3A36A 3LXRA 3T5GA 1IY0A 1S0UA 1WP9A 2XB4A 3LO5A 1VG8A 1HT2E 2ZE7A 4HB3A 4O2RA 2CVFA 2OM2A 2W0SA 5L3SB 1DELA 1CKEA 1X6VA 2EFDB 4QBIA 1Z08A 2BMDA 3EPJA 2O8EA 3ETLA 2ZUCA 5KDOA 1YZNA 4L9SA 1Q20A 2JLQA 1MKYA 1IJEA 4QRHA 3ZQ6A 1M8PA 3CF6R 2ZRMA 1TEVA 5B64A 3U4QB 1P2SA 4Q1CA 2VRWA 2WJHA 3F8TA 4YMTA 3ICQB 3KFXA 3LRPA 1JECA 4TL7A 3GFTA 3B13B 1QDEA 2ZJAA 2I4IA 2ZI7A 1C4OA 1MABA 3UIEA 3ZS9A 1KDTA 1EX7A 3KJEA 1E98A 5EUMA 2LKDA 3D8BA 2OT3B 3NBZC 4U02A 4R2HA 3BERA 3SJCA 2BJVA 3SU8A 5IHPA 4RFSA 1L4UA 5JHHB 2BMJA 3B1VA 3QBTA 4OQXA 3LWNA 4UNQA 5CLLA 1A4RA 2IUUA 2O8DB 3CRVA 1GDDA 4DCSA 1Q1BA 3ADBA 1JNYA 4JLNA 3R8FA 1Z3IX 3KJHA 2PEYA 5FOVA 2Q9BA 3B1WA 5IDVA 1XTKA 2P65A 1E9CA 3BJIC 3K8YA 3MGCA 3U7EB 1QHXA 2HF9A 2OILA 3DEFA 5FOWA 5LBIA 2ZIAA 3X1WA 4PTLA 3H86A 4B3FX 3GLIE 1XJ0A 1UEJA 4Q9LA 2OXCA 3QEJA 2IYZA 4RZUA 5HE9A 4ASUA 3SQWA 1XMVA 1KZGB 4M21A 4YMWA 3U6BA 3GEEA 1U90A 4D4LA 1E9FA 3U5ZB 2GA8A 4UXJA 4POAA 3GJ6A 3TVDA 3KUDA 1R2QA 3KJIA 5C2JB 1WXQA 4OHYA 3U7GA 3QOFA 1R4AA 1XNJA 3T06B 4C0BA 1N0WA 1D2EA 1MO5A 2FEOA 2D7CA 2REOA 1CEEA 1DS6A 5FOTA 1OPXA 4BFXA 3R20A 2H1LA 4B35A 1Z2AA 3AVXA 4L4UA 3FHTA 3RWMB 1W49A 4JYCA 1CR2A 3QKTA 2HYIC 4ZPXA 4LOAA 2NGRA 4NYJQ 3AB3A 1EK0A 1TADA 2RMKA 3B6EA 1FNNA 4P31A 5GJCA 2R2AA 3EXAA 4WOPA 5H8WA 4TMWA 4B33A 3GJ4A 121PA 3Q9LA 5GVRA 3O8DA 3IEUA 2DFNA 1XEFA 2QAGB 1IN6A 4WXRA 2OEPA 2GZHA 2NO1A 3IHWA 3L8YA 3R9WA 1AA9A 4LBVA 4BLRA 5JS7A 4AWXA 4Z1MA 1OXTA 4FMDF 4PPQA 3C16C 2WWWA 2C99A 1GP2A 2PLFA 4F38A 2PJRA 1VTKA 5EXXA 4M1YA 2J59A 1TMKA 1W44A 3DZ8A 3S1AA 2Z4SA 2VHUA 1E0KA 3CB4A 4MRNA 1D8TA 3RRMA 1G1MA 1A82A 1FX0B 1XTRA 1S2MA 3A1WA 4PO9A 4TL8A 1KO7A 2BEJA 1BOFA 4JL5A 1EX6A 1FUUA 4NYIQ 1E9AA 1UAAA 1VCIA 3PUWA 4IRUB 2HLDD 1HH4A 3D6TB 4PSVA 4LPSA 2QENA 1GITA 1NMYA 4ZIRB 5HCIA 3TAUA 4Q1AA 4ZCMA 3IDQA 5J4KA 4QC2A 4BFYA 1XD2A 1XEWX 2ZYUX 2GCPA 4JVSB 4KBFA 1QBKC 3T1OA 1N5LA 4BLOA 4Z8YA 2WAYA 2ZAMA 4RZ3A 4IOLA 3SJAA 5E95A 2V54A 3RS7A 3I72A 4NCJA 2EYUA 2WMNB 5BYJA 2IYQA 4Y0AA 2P2LA 5KUTA 4Z54A 3EIHA 5KO2A 3UWKA 4QGGA 1E2QA 1HE1C 3FTQA 3O8CA 1GL7A 4XTRA 4YLGA 2EWVA 3FWYA 2RGBA 3VFDA 4JLOA 1PV4A 1JAHA 1F6BA 1G5RA 1UKEA 3W3ZB 4OKSA 5TDHA 2B92A 1QHSA 1GKYA 1FMLA 2JJ8A 1FQKA 2ZPTX 3Q7PA 2FGJA 3GLHB 5C1BA 4EJSC 1N6RA 1NVXQ 1TEXA 4X8LA 5EXSA 5CLQA 3EAQA 2EVWX 4N1AA 2OFXA 1WB9A 3JVUA 1Q3TA 2YWFA 3PUVA 1SVKA 3SS8A 4A0FA 1E9DA 2FG5A 1E2JA 4C0AC 1S8FA 1DEKA 2BM1A 3R7WB 3GEIA 3U3KA 3TMKA 4DLYA 2ZETA 3Q5EA 4TMKA 2GCOA 4UNRA 2GCNA 1W4AA 1ZM3A 3BFKA 4D80A 4D4KA 4GSYA 5FPYA 4PC6A 1GKIA 5J5CA 1KAOA 4KFRA 1J8MF 4JMPA 1ZAKA 4KSCA 4ARZA 4A15A 4OQFA 4PHTA 2ZSAA 1X3SA 3UG7A 2FGKA 3QKRA 2YWEA 3QXCA 2AWOA 3UXMA 1UJ2A 5HTKA 5IT5A 4AYTA 3A58B 5DNYB 5JJLA 5BQ5A 4AKGA 3ZQJA 4BRWA 2PZGA 2BDTA 4D25A 3THXB 3FMIA 2WJVA 1NL3A 3MMPA 2WWIA 4DLXA 3OE7A 2H7VA 4N3NA 2VTKA 3VR5A 1AJEA 2WPDD 3FHCB 3KKQA 4U00A 1OV4A 4V0LA 2ODEA 4UJ3A 1E1RA 1XCMA 3CM0A 4LV6A 5KDLA 2Q0HA 2G9NA 4JLJA 4ZO4A 2D7DA 2Y8EA 5B30A 1NN3A 4IDPA 4BFWA 1XZPA 1E9RA 4OBEA 2IUSA 1RRFA 4LRWA 1MO4A 3GJ8A 2ZR9A 4DLSA 3F5FA 4NBSA 2F1JA 1XMIA 3RWOA 2Z5FA 3U3OA 4OQMA 4V03A 1XXHE 3W6PA 1E2GA 2ZITA 2PMKA 3UMFA 4CDGA 1SHZA 1HQYE 1M2OB 1NSFA 2B8WA 2QP9X 2ZJZA 1KOFA 1ZBDA 1IY2A 4MKFA 1R8SA 1ZYUA 1ODFA 4OQLA 1RPZA 2IS4A 1I2DA 2ZEJA 1MRSA 2RGNC 3W8RA 2G3YA 4QBHA 4EFMA 3WNCA 3OAAA 1SULA 4NHOA 3RC8A 1GL9B 3LQQA 4UQOA 3FKQA 1LFDB 1GRRA 5E7IA 1II9A 3BGWA 4JVLA 3QENA 1XEXA 4MUAA 1I4TD 3B2EA 4S35A 5FR1A 1SVLA 3BH6A 4CZ2A 1G17A 1JB1A 4LUCA 2FPMA 2JCSA 2NTYC 1P61B 3LBIA 1YQTA 2CHVA 3RRZA 3T35A 2O8CA 2G6BA 3P4YA 2JDID 1AGPA 1N6LA 5DE3A 5TXGA 1OB5A 3IO3A 2O8BB 1Q1EA 2VSFA 3B9QA 1OW3B 2C78A 2F43A 3WYGA 1N6OA 2XNDA 3K09C 4KFTA 4UXHA 4Q7MB 1L4YA 1Q44A 5KTYA 4EDHA 1CIPA 3OAAD 3TH5A 2ORVA 1ZC3A 1NKSA 3DOEA 2ZJ2A 3OEHD 2ATVA 2PJZA 4GOXA 1S4QA 2ZVPX 2OE2A 4IVRA 1W5SA 5L3SA 2FSGA 2H17A 2PZFA 2FE4A 1TQ6A 5DYGA 1WBDA 4DRZA 4PAMA 3MWLA 3FB4A 3B8HA 4TQAA 2MSCB 4CW7A 4V0KA 4DT1A 2FSHA 1M1YE 3RRNA 3MCAA 2CL7X 4PSAA 4NL4H 4CF7A 2ZI3A 1TF5A 3MWJA 1GRQA 3THWB 2V3CC 2QBYA 4QBGB 5AUOB 4XH9B 1YRAA 1RRGA 2W6IA 3BRWD 4XSGA 4HI0E 1OH6A 3KJGA 4FWIB 3GLGB 2BBOA 2QMUA 4KVGA 1VYTA 2KBEA 2Q3MA 2B7CA 2Q21A 3E5HA 1ZM9A 1TQ4A 1EGAA 1E2DA 3REGA 2D62A 2XSZA 3FPAA 2HUPA 4KJZA 1E1QA 1KNXA 1NNEA 1DBSA 4Q7LA 2J5XA 4EPTA 2K5UA 1N0UA 3I1FA 4LHWA 5FBVB 4HLUA 2IW3A 1W0JD 3AVUA 4A2QA 2ZSFA 4ACAA 2GBLA 1KK1A 1KYIA 1W46A 1NKTA 2LKCA 4DUGA 3NXSA 4PQFA 2YOGA 3K9GA 5BN3A 1U98A 2NZ8A 1T5LA 2JJ1A 2EFHB 2ODNA 3FFAA 2QTFA 4FINA 1JQLB 3BH7A 4QGFA 5FOUA 4AK9A 1ZINA 5G3YA 2HCJB 2VP0A 1P9WA 3AQ4A 3THYB 4C0HA 1YKSA 4JT4A 5FOSA 3U2QA 2C96A 4DSNA 1LS1A 1G8FA 2EW1A 3NDPA 3HPRA 4AKIA 4TLEA 4A8JA 2ZI6A 1Z28A 4YONB 4P33A 4E5UA 1RJ9B 2HDNB 5LD2C 4MYHA 2O8CB 2B7BA 1QVRA 4W9MC 2PEZA 2QM7A 4L9WA 3IKJA 5FFMA 4IDQA 1FQJA 2WWXA 1XTSA 1KI6B 2IYVA 2RHMA 5DH9A 1J90A 5KDDA 3FYHA 1W36C 4YDSA 3QY0A 4BFTA 3LH5A 4BRUA 2JLRA 4WAUA 5E3HA 3PENA 1GIAA 4TSFD 4I1SA 4Q4LA 2J46A 3HR7A 4MKHA 1OT3A 2B21A 2HEIA 1D2NA 1E2PA 3OIVA 4I99A 4MKGA 1W0KD 3HYTA 4C3ZA 2XXAB 4QHSA 1VYVA 2ANBA 3M0EA 1J70A 1AS0A 1N6KA 1OFHA 3SEAA 2EFCB 4B71A 1P75A 1NBMD 2CLCX 3WYFA 3MJHA 2NOAA 5D3QA 3IILA 3LVQE 2J9RA 2J45A 3QKSB 2GJ8A 4G5SA 2C77A 1ONBA 2YZ2A 1OYYA 3GJ3A 4C0SA 4NYMQ 2FJUA 4O3MA 3MG9A 2DB3A 1SVMA 3QF7A 2VSOA 4M9ZA 2P6UA 2QSZA 3GJ7A 1R0WA 2WM9B 1CULC 1G5TA 4L5BA 3W5IA 3V4RA 3UMRA 3WHKA 4Q9KA 1XCPA 1OKKD 5AWFC 2V7QA 4QBFA 3JVVA 3NDBB 1Q12A 2YC4C 2WBLC 3PEUA 1HEIA 1DARA 4P4SB 4PC1A 5EJEA 4LJYA 2XB2A 3U3JA 3CRW1 4LHYA 4GP6A 4F91B 4HDQB 4OI2A 2JLVA 2CHGA 2UKDA 1VPLA 1JEDA 1GRNA 5KPDA 3FVQA 4QOSA 4Q5IA 2IF0A 1ZNWA 3LVRE 5JECA 4BWYA 1YR7A 5F9FA 3NTUA 5FPSA 4TL6A 3C5HA 3GLHA 4CYMA 3CH5A 4WW0A 1XD9A 4EUNA 1TUEA 5EP1A 2PH1A 2GXQA 3QXXA 4D0NA 2REXB 1E2MA 3MWKA 5HZKA 5JCZA 1XWIA 3BB3A 5DI3A 3DOFA 5LB4A 4P4TA 4MGIR 2JAQA 2QORA 2VPPA 2J87A 3A4NA 4Q1BA 4RZ2A 5GJBA 3KDSE 4Q4HA 2W2TA 1YVDA 5EP4A 2OAQ1 3B9PA 3OHMA 2BKEA 1JR6A 3SFVA 5H68A 4TLDA 3I61A 3QF4A 1KDRA 5JS8A 3D7MA 3DVLA 4URXR 3HU2A 4PANA 1P9NA 1XCGB 1D6JA 1FPMA 3QKRB 1AKYA 1KK3A 2GK7A 4LJ5A 2XGJA 4XWKA 1Z83A 3G82C 1QHHA 4TQ9A 4A0GA 4B32A 2A2ZA 1XTJA 1NLZA 1VIYA 2WTUA 4RD2A 2XZLA 5A4JA 3H84A 1IN4A 1TUIA 2OBLA 521PA 1W0KA 4N0DA 3RDPA 3HR8A 1KI6A 1LB1B 1QG2A 3B78A 5H1YA 4NCKA 1G3QA 1OHHA 1ZCBA 3RSOA 4LJ6A 4DCNA 1KDPA 3PITA 1T0JB 3DMDA 3RS4A 2AX4A 2OXRA 3VR1A 1KI3A 2ORWA 5A0FA 2QY9A 2JJ1D 3CBQA 3ICEA 1WE2A 4CEHB 3AF1A 3ZYCA 3DKPA 4TYYA 2PCJA 1N3BA 1Z47A 2GF9A
chains in the Genus database with same CATH superfamily
1RKUA 4XWYA 3PC4A 2YJ5A 1K3UB 3L0BA 4RX1A 2CCJA 3W78A 2WR8A 3Q3VA 1X7YB 1OFUA 4BXOA 4CTOA 4HY3A 2AHOA 3OE1A 2AXPA 4ZO8A 2IEZA 5BQFA 1NXPA 1JLHA 3MT0A 4QM6A 3I5UA 1ZD9A 2WWTA 4GU5A 5H4HA 1GILA 1NSYA 3QMWA 4QQNA 2FR0A 1FQWA 5CVVA 5JSKA 3C98A 4PF1A 3IQWA 5AKLA 1U02A 4ABTA 1W9MA 4DJDC 2NYAA 4V0SA 3UBTA 4P3KA 2X19A 4ZI2A 4P4GA 4FCCA 2JFPA 1VKZA 1ZMTA 1FSFA 2AG1A 5F21A 1BDJA 1Y9JA 3L9WA 4HRAA 3G85A 3A05A 3JQ7B 2P9QA 5EI5A 4G8JA 4Y9TA 1VJ5A 2VBCA 2NLOA 1U3CA 4IKOA 1IY9A 1HKUA 1UEXC 2YS6A 4E3ZA 1T0BA 3CHYA 1I7QB 1B23P 3GLGA 1FTNA 3KQHA 3V1NA 3GCDA 3QFHA 4U6SA 3VOBA 3I37X 5L7TA 1PJQA 4ALMA 1FFXA 4GX5A 2CMHA 3UT5A 3AMVA 4CE6A 3VKWA 4HT3B 4DV6B 3GUUA 3D2CA 3GZNA 3ZVLA 4RMHA 4QU9A 4L9AA 4B82A 4J8PA 4C22A 4FTWA 5BUCA 5KU1A 2X9GA 2UZAA 4G1UC 5P21A 5J43A 5L4LA 5L40A 4DWJA 4MTLA 2Z09A 4LDZA 3W90A 2GD2A 2IU6A 4I5GA 3UZUA 2YASA 3F96A 2G08A 3ILYA 1KTVA 4TVOA 1QNLA 4NFHA 5C8YA 3R09A 2L17A 2AG6A 4WCVA 3K94A 3DLAA 3OFSA 1QGYA 1JU9A 2PMEA 4PONA 1OXXK 1WQ1R 1JSZA 1TYAE 2HHJA 2V65A 1U7XA 5BVGB 1TVEA 1ZKDA 4RIHA 1TGYA 2UVPA 1HXHA 4V3BA 3HDJA 1N8SA 4IGAA 4JLUA 4QJ5A 3ZWPA 2O5RA 3E9EA 3ZDFA 4OUKX 3HL0A 2Z58A 3CO0S 4G97A 4DV0B 1IFXA 2WMDA 1PZXA 1UJNA 1XKXA 3AOEA 4LJAA 1DXHA 4FHEA 4JCCA 5A3SA 2YVLA 2BSXA 1RJDA 5A4KA 1ZK3A 4TZTA 2JHFA 5IBPA 1JR4A 2CE2X 1U5BB 2PLWA 1X2EA 2ZANA 2A58A 4IG9A 4CM3A 1E5XA 2CYBA 1U7HA 4CM4A 1QG6A 1M2VB 3BK7A 2ZRLA 1L4EA 2EERA 5CM2Z 3OP1A 1YRHA 2XZOA 2ZDHA 2QJWA 3H5IA 3LUJA 1EWQA 3W2IA 1P4SA 4DHEA 4DDHA 3ZU6A 3R3ZA 5K8IA 3VHXA 1P45A 4DNPA 1UFRA 1F0YA 4OATA 1UK9A 1YAHA 2Z3WA 1F60A 1GPJA 1Y7HA 2B30A 1ZQ9A 3C7TA 3OLWA 4Q4HB 4UMFA 5KHAA 4F8JA 4DIOA 1XHLA 1M1XB 3CZAA 1IXKA 1MEJA 2CLMB 2YNMA 3CB2A 4KSBA 3PXCX 4B3CA 4BMSA 4ZQIA 1X1SA 2X7JA 4EVIA 2Q1TA 4RA9B 3CLVA 1W25A 1R8JA 5JAIA 2O7SA 1T26A 4KFUA 4TWJA 3RYTC 1Z6YA 3I3SR 2F43B 4JJGA 2VK1A 1YB6A 5CT6A 1A4XA 1NIPA 1P74A 1PK8A 2K2WA 3D6VA 3GVIA 3EQ9A 3RI3A 4D0SA 1J21A 5EZYB 5KYUB 3I6IA 5DTMA 2VKQA 3BA1A 1M83A 4Q3OA 1V47A 2OHFA 1MAVA 3EMVA 2ZRCA 3EQ8A 3E3LA 5EE9A 4KQMA 5ERGB 3OM8A 2D5BA 4B75A 2QVXX 2LW7A 5DLQC 3CKMA 4RZIA 3QEMB 1K7XB 3RWBA 1AKEA 3E22A 3FPSA 1Z7GA 2EYQA 2WLTA 3UQYS 3ZHOA 5GZ3A 5JD5A 1XZDA 1JVNA 2VJMB 2VZ0A 2WIBA 5ICSA 1GRCA 1L7BA 1U6IA 2QLJA 4YXWA 3TGWA 3WIDA 2M6LA 4BE9A 1YSCA 3BVPA 3I9V1 3LL7A 3EVCA 2Y1LA 1QFZA 3KAJA 3UENA 3SI7A 1HDZA 5EWLA 2QSJA 3WZLA 1RE1A 1E66A 1RZUA 1M67A 4PQEA 1CJBA 1L4MA 4EY5A 1O3YA 1XD8A 2BJHA 4FZ3A 4ZC8A 2I34A 3WK6A 2WOJA 1VE9A 2I78A 2RGAA 1QDLB 5EUQB 4ZT5A 2NN3C 1UBOS 2C4VA 2MSKA 3HSYA 4MWZA 3IURA 1Y9ZA 2XOKD 4PZLA 4RV9A 3TOSA 4TWAA 3IEMA 4TLCA 4X66B 1Y6RA 4HGQA 4X6XA 5EZYA 1TT7A 4DJJA 3PUYA 4UE2A 2IH2A 1KK2A 3U0VA 1G9TA 4B7UA 3H11B 4W5JA 3K8ZA 1ZCFA 2XXAA 2QL5A 2VXOA 2PUJA 3BREA 2D3TA 2Z8YM 4PG6A 4JX9A 4JSRA 1OAKA 5BQOA 4CIWA 1Z4OA 3QWFA 5GVSA 1WXIA 1SQFA 2QRMA 5JEDA 1KEEA 2X1VA 1ZNZA 3N8GA 2QVZX 5EIBC 2DG2A 3AM1A 2BONA 4COKA 1DAEA 1YGYA 4RVUA 1EK1A 5KU7A 3DVSX 3E5RA 3WBJA 4ZI3A 4WCFC 3ODGA 3BRQA 5GJWC 4X62B 2VJPA 4O3FA 2GFHA 1PGPA 3VYRB 3X44A 3HYNA 3A2KA 4F93B 1AKUA 4R68A 1SXJA 3VBEA 1YGPA 2FSUA 1FVHA 4JDUA 4N39A 5IM4F 5CIYA 4M0LA 3UUGA 4D74A 1LDGA 1PVOA 1SEPA 1DDGA 4HWGA 5CLFA 4QXOA 6REQB 4S1VA 5F2OA 3L6RA 5CLGA 2X2EA 2V98A 1YL7A 4QREA 2O6HA 1VE5A 2PVCA 3GRPA 1PF7E 4GWGA 1CUHA 2OB1A 5DRYA 3GLFA 4KIGA 3SLKA 1KL7A 4K87A 4X95A 4TMZA 1CUEA 1VBFA 1WW3A 2N3ZA 1JDZA 1M5UA 1OCEA 1XF9A 2OZLA 2VHYA 1NN5A 3B52X 4L15A 4MWBA 3M1AA 3U80A 3TTYA 4EKEA 1AN9A 4KQ9A 3HCEA 1QH8B 5U4QA 4JUBA 3DHVA 4WRRA 3INTA 1NF3A 3AY6A 4E88A 1E3TA 2PS0A 3D8TA 2WF5A 3EJWA 5KNCA 4IXNA 3S70A 4LZZA 5D6NA 3F90A 4EUKA 2YHIB 2O5CA 4YI5A 4C4TA 1W6RA 1CETA 2OA0A 3BTSA 3NKVA 3R7FA 1MIOA 2BBWA 1RJFA 1H2EA 3GMIA 1OYWA 4BQRA 1GPNA 2VSQA 3GNLA 1K5DA 4HMQA 2NO5A 4BEVA 2ZIUB 3DGEC 2QLTA 4O2AF 3O0TA 3MB8A 4YP9A 4F2HA 4KH1A 2R62A 2ATEA 5DNCA 4GMHA 2VRCA 4R7GA 2HSEA 3Q9SA 3A04A 2X1HA 3VH4A 5LKAA 2PWAA 1V25A 2ZR8A 2L2QA 1G3RA 4O4HA 2F9FA 3PEYA 1XZJA 3AGQA 1N5DA 2IYEA 3AUJB 1MEEA 5FH9A 1ENZA 3V2IA 1BW9A 5SZKB 1MD9A 2QW0X 3U60B 3OIWA 1VJDA 4H2DA 1P2VA 3F9IA 5KSOA 1E2NA 3IV9A 1IHXA 3EXHB 4JLKA 4LNUB 1NHWA 1NXXA 3GQVA 2UVPB 4J0GA 4L0MA 1W4RA 2HGZA 3A6HA 3SY8A 2C2XA 1R8XA 2HB6A 3HA7A 1I4LD 1E58A 1VKJA 3K0FA 2YY7A 1IHYA 4ZOLA 4LWZA 4IAOA 2R84A 1UBSB 1MEOA 5MDHA 4WA7A 3AR7A 3VI4B 4DYHA 4OYLA 4YV1A 1JE1A 1GUAA 3LRTA 3LQ2A 1NQUA 4Q7QA 3C6YA 3KVYA 3LPLA 5FNVF 1O4WA 1SUIA 2UUAB 3X1XA 3W1WA 3EEOA 1K5GA 2JLUA 5KHOC 1AGXA 1Q16A 3TSWA 2PANA 5C8XA 2QGZA 4U7TB 1C7QA 4OH1A 3R9IA 5M04A 3B48A 3P2MA 4Q66C 1HE4A 1LVGA 3H4TA 1DX4A 1L3IA 4AUEA 4KREA 1FP6A 3P71T 2AKYA 2ETVA 2IUFA 4KKVA 1W4BA 2IY8A 4IOKA 1ARZA 1PG0A 2GN4A 3QU2A 1IZ8A 3GEGA 3KZMA 1KAHA 1SR8A 3M5WA 1BQEA 3NTRA 1VL5A 3QPUA 4RO0A 3UGTA 1GL3A 5JH7B 2N46A 4QFBA 4KK3A 1TT5B 1JJFA 4KN6A 5CA0F 3KD3A 2JFHA 4KXXA 3TSAA 3TOCA 1U2EA 3NBKA 4ZRNA 1H0SA 1TYDE 4HDAA 4ADSG 3DWFA 1RP1A 1YJAA 3PJGA 1UP4A 1Z6AA 2P67A 1I4OA 1I1OA 1U9IA 5AI4A 3DXZA 4OB8A 3LZDA 2RE8A 1TMYA 1BHSA 5FBRB 2Y4OA 5JY1A 4PG4A 5G1OA 3ZHZA 3WIUA 5IJXA 4EB3A 3SNHA 4QECA 1G3UA 1P62B 2ZRPA 4KR9A 1ZA1A 1ZHHA 3ZJVA 4A73A 1X7WB 1THTA 1K6JA 4BU1A 1WXDA 4WLUA 2X6QA 3KJNA 4KITB 3MHTA 1A1SA 16PKA 4OXIA 2UYCA 2I8CA 3L0IB 3WNBA 1RP7A 4HNRA 4Q3BA 4U6NA 2PBFA 1YB2A 1VXRA 5DX8A 4TKZA 2VSYA 5A2QA 1D07A 2BM9A 2BELA 4LW8A 1YK1A 1PR5A 4HV4A 1MV5A 2OHOA 3FCYA 3UCEA 1GZ5A 2F9MA 1RMQA 4Q34A 4U3JA 1F8GA 4UEJA 4GBED 2FX3A 5L3VA 1TT5A 1ULTA 1DG3A 1U8YA 4KEAA 4CWAA 4Z9YA 1M2OA 1RAAA 2XY4A 2HTFA 3C6BA 4LZPA 1PW5A 3AH8A 4KO8A 1P2FA 4J0IA 4XVQA 1ESNA 5KQPA 3SZUA 1PNVA 4AJHA 1M6NA 8OHMA 2YWGA 4P4UA 2WG1A 4N9QA 1B6RA 1LI4A 4ETMA 4EI7A 2ORYA 1QCZA 2EZ4A 3JZDA 3RFCA 5ICMA 3ADCA 2QS9A 4JOQA 3V42A 5H4GA 1SM4A 3OCZA 4HBZA 1G21B 3OQNA 2IY9A 3KLBA 4PBSA 5DSZA 1M6EX 1E2KA 3M6IA 1E0JA 4QO8A 5DGDA 3NHSA 1NMXA 3CCBA 3ABSB 4EYQA 1W88A 3FBTA 2UYQA 1LWOA 1FBNA 2BMEA 4N3BA 3G2IA 3ZCPA 4IO0A 2O8DA 1XJQA 2GESA 5K9ZA 4DPKA 4Y2XA 2GNOA 4ZYXA 2QGNA 1KPHA 2ZYWX 3EY4A 1XTQA 4EI2A 3FNBA 1GYPA 1O9BA 1ITZA 2ZSIA 5EHZA 4DABA 1Q74A 1T0IA 1GUZA 1O97C 3AUYA 2GEKA 3A1EA 5ES4B 2WRZA 2Z2KA 3TUIC 2O8FA 1QRDA 3OTHA 2Z1NA 1B6GA 1K4YA 4FS3A 1V5FA 3FPLA 2FN4A 1O0BA 1QH1A 1TYZA 3I05A 2VTBA 2JLXA 3PLRA 1QF9A 4OYYA 3MIZA 4DCOA 2DKOA 3RFUA 1RXSA 2XF2A 1W35A 2OZLB 4X60A 4O4HB 1JIUA 2C92A 1MFZA 2Q5QA 2ZTSA 3OZFA 2Y99A 2ZRDA 3K6KA 3N5CA 1QIKA 4QOFA 5HW0A 3BCRA 3RT1A 2D3WA 1WD5A 3P9CA 4Q4JB 3TMAA 1YVEI 5A0TA 1ISIA 4XGIA 5AJYA 4X0EA 2FFHA 10MHA 1I0IA 4TMYA 1S9HA 1ZI9A 2PKRA 4FOPA 3O5AA 4Y2GA 5KPJA 1NULA 1SQGA 4QOEA 2W6JA 2GN9A 1ESEA 3WGUA 1GZ4A 5TPZD 3RC2A 1UKAA 5THXA 3KEFA 1T13A 4BEBA 4ZYUA 4EPYA 2OGUA 2PZMA 2AXQA 3DZJA 1FX0A 1ZGZA 1WU8A 4US2R 2GMWA 1RMYA 1N5IA 4LJ8A 3CNOA 4MKZA 4BX3A 4DCVA 2H7XA 2G63A 2H08A 2HIGA 2W2LA 4PG7A 2GZSA 4W1SA 4QU0A 1WXGA 4ZU1X 5C5DA 2YJ3A 2YZNA 1QIEA 2BUAA 2FN7A 2J3IA 3C8ZA 3Q1LA 3GRRA 3QG1A 4C4RA 3HJAA 2F3RA 2QN2A 4J4HA 3K7EA 3PTLA 1UXJA 2QVGA 4I4LA 2OYCA 1VSVA 2GKSA 3HB9A 4NARA 1M34E 5ELXA 3HA2A 3VPDA 3E05A 4O29A 4ARUA 3COVA 4MPDA 1AZSC 5BQ3A 5HR5A 4G09A 1UBFA 5EPOA 5CH5A 3I5XA 4Q4JA 2C2MA 2BI8A 1B16A 1II8B 1UKBA 2UZ0A 3I92A 1Z0UA 4N0QA 4YAFA 5FLYA 3BEOA 2BPOA 4R05A 3SZGA 4CV0A 4RK7A 1KSJA 1YOVB 3MGKA 1QDUA 4IDFA 2J85A 3QI2A 4IFBA 4JUAA 1EWRA 1UP6A 2PX3A 4FCTA 4PLYA 1UMBA 1O95A 2IYUA 4X24A 4KL8S 5EJ6A 1JE0A 4NV0A 4OK5A 4EMUA 1CQPA 3P97A 2FQQA 4Q7JB 1U9IC 3NBFA 1T1RA 2FEAA 3SC3A 2IEBA 4B74A 1PFYA 1I4EB 2H8KA 2WHYA 5DCLA 1V4NA 2R4UA 3FNGA 3L02A 1VPEA 4IOMA 3DC7A 5K3SA 1PRYA 1RQGA 2C7PA 2R48A 2VFAA 4RVFA 1DQZA 1RAGA 3EBLA 5CMLA 5CEEA 1AA6A 2FPIB 3KL2A 2YJ6A 5FJJA 3M34A 3VDMA 3CUEF 4HZUA 3B3JA 4ASUD 3I8XA 2Y6VA 5IUNC 2CMFA 4P84A 4ZGWA 1YR9A 3Q3CA 1R0RE 1TK3A 1Y89A 2PSFA 2I71A 3Q72A 3Q8XB 5IU6A 3W5VA 1KH3A 3OY2A 1T9HA 2PYIA 4YNBA 2JL1A 3WOVA 5B7GA 2VPQA 5ENZA 2CCKA 5J47A 3CPHA 5BYAA 3DHWC 4M0MA 5IM4A 5JVDA 4Y18A 4RADA 1PEDA 4PY2A 1WZUA 4NBWA 2ACEA 5DTQA 5F35A 5AKXA 1R3DA 3AFOA 4D0RA 4BX8A 4YCMA 1EHCA 2JI6A 5FUWA 3DMRA 1Y80A 3GZNB 3PQEA 4EHDA 4TTPA 1PUIA 3AIMA 1VJ0A 3LP6A 3JQRA 4OCZA 3CSUA 1ZJZA 4UAGA 2R11A 2QVCA 1UM8A 1GUDA 3DA8A 2QUIA 3GFVA 3IBGA 4GP9A 3WE7A 4L74A 3LBAA 5CFNA 1KA9H 1KZ7B 3AU9A 4V1CA 4FYXA 4B83A 1QRUA 3DFFA 2PFKA 2L42A 4I6EA 3N8KA 5DN6A 1H9AA 1MAAA 4Y6LA 2IYSA 3EWAA 1AKWA 3NYIA 1Z2NX 2O3UA 4KBGA 1NFRA 4CEHA 5E6RA 1NLUA 3E23A 3UKJA 1DIAA 1BCRA 1P91A 1P9OA 2Y1GA 1P2GA 4IBOA 5CA0A 4JFRA 1NRIA 2CXRA 3MOSA 4Q9NA 3UK2A 4DWVA 5BN4A 5EMLA 1ZH8A 3D4PA 3DYVA 1JEEA 1HG1A 3LCUA 3OQ1A 4F1WA 1D4OA 4Q05A 2I9PA 3EDYA 3PFWO 1F1JA 1O96A 3TFQA 4Q16A 2Q7OE 2JW5A 2J7PD 3CF2A 2DBQA 1FUKA 5E4TA 2FSVA 3LC2O 3PWSA 4PX9A 4UMEA 1DKMA 4U2GA 3PJEA 1E3DA 2Z04A 3KD2A 3I4LA 4XIFA 3B12A 4D3SA 5C18A 2YH2A 4V1CI 1QTRA 3I9FA 2ZSJA 1IUPA 3GRFA 1EUDB 4RD1A 4B3GA 3HKEA 2ZROA 4X00A 4KGZA 1HDRA 3VZDA 1CIVA 2GZRA 2PO7A 3DNFA 3JZFA 3JZIA 4PZYA 4X6LA 4ZGGA 2FVXA 2ZRHA 5JMWA 1XD2B 3GDFA 3VYUB 3LFHA 4KLCA 3G5UA 3IQEA 1Q0QA 2EF0A 3UPUA 1FXWA 4P92A 1WHSB 2XX3A 5LYYA 1CUDA 3F6CA 3VKHA 4JP5A 2JJ2A 2YBEA 3HMKA 3LDAA 3LVBA 4RDHA 3C85A 3OEED 1CVRA 4KUGA 4BGVA 3ZJUA 4P08A 4MVJA 2HXYA 4MGKR 5AI5A 3ZE9A 1NBEA 1CF4A 3TR5A 2I2CA 4EM6A 1QPZA 2YDYA 4JXJA 2VUTA 2I3AA 3D1JA 3QVLA 1J5XA 4OQNA 2AVNA 5JH7F 3ZXIA 3K0AB 1M8GA 2WUEA 4JLBA 1TZCA 4GZ5A 4N82A 1G19A 3V8EA 1CTQA 5K8JB 4XJVA 1GSIA 3O7WA 4NCHA 4R1LA 4ZWNA 4HNVA 2A9KA 4NEHB 3Q8LA 3DBLA 3LV8A 1O7JA 2C5AA 4UNNA 3CNHA 2AG5A 1A69A 3O6VA 4C2TA 2H51A 4N5DA 4A03A 3JATB 4DC9A 4ANFA 4D26A 4HG2A 4V0RA 2V6BA 3ICOA 3OLQA 3MRTA 2BEUB 2PT7A 3O8BA 1PT5A 2PZBA 3D4BA 1ZMRA 2DFDA 2QRNA 4H7HA 4EX7A 1SK8A 4JP3A 2C97A 4O8ZA 5KNCH 4KDFA 4AYWA 3Q8KA 1FFXB 4HN9A 3ENWA 4C9BA 3HR4A 2GF0A 2JNWA 1RXYA 5T7BA 3A0RB 4CETA 4HKTA 4R83A 2YFHA 2IWRA 5I9IA 1X15A 4P2GA 1J25A 2WYVA 3I4FA 2Y0EA 1QE3A 1C4WA 1J9EA 1MO2A 4WLNA 3WP1B 2PMBA 4YPVA 3IUPA 3FTCA 3PIIA 4LGYA 3FSGA 5KKAA 4BVEA 5HUJA 2QAGC 2ZSUA 4YYZA 3FGNA 4AJ2A 3GLFE 1P7YA 2EU8A 4ID3A 1PE0A 5B3JC 4GL2A 1Z73A 3QPBA 5C1OA 1E2EA 4MV7A 4LG1A 1SG9A 3ECCA 4J7XA 5AJVB 2BMWA 1JDUA 2B1QA 3W5HA 5I7RA 3CVXA 1RXVA 4G85A 4DR7B 4PZUA 3WHLA 2C3YA 1TZJA 4CGZA 2IW1A 3ANMA 3W9UA 2B1RA 5JAHA 2CFOA 1MUUA 4D9CA 2E49A 3H1PA 4JIMA 2C88A 4M8IA 4RM3A 4RTKA 2HD4A 4YRBA 3MBIA 4BLSA 1CJCA 2C0QA 1VGQA 2C57A 2BWJA 3B38A 3UW1A 2BGWA 2QBYB 1PW7A 5IJ9A 4ZEOA 5EN4A 1LV7A 4QUEA 7YASA 3VKVA 2I4OA 4YQFA 1AURA 2F1KA 1CY1A 1T6ZA 3OQPA 1EDDA 3URKA 1ZD8A 2N9UA 3D8RA 4BQSA 3WOHA 4A36A 1TUBB 1NZJA 4HDKA 5A3QA 3ZLTA 4JCOA 4M1MA 4CR6A 1UPXA 3S27A 4B2PA 3OCUA 1H9CA 1JG6A 4N03A 3VPSA 1VKRA 1N7JA 2X0RA 4CIBA 1W47A 4DDWA 4IIBA 2JGMA 4JT9A 1FSZA 1TW2A 3HBNA 3WGGA 2R1UA 2FSIA 2IS6A 3IO5A 1JEYA 3ZG6A 1ZRSA 3ONDA 2VUIB 3D6NB 5K7SA 3R24A 1DXOA 4I4TA 4G0WA 2FPSA 2GWRA 1JEQB 2NXEA 4CU5A 3LQRA 1PWHA 5BN3B 3D3QA 2R44A 1HY3A 4KG7A 1PQUA 1HTWA 5FUVA 1ZJJA 3JWJA 1FFCA 1Y8QB 3KKMA 1FP1D 1I3OA 3ZD7A 1QLJA 1JR3D 4CLDA 3TIIA 3OPQA 4E2YA 4RIFA 2R6AA 2UAGA 1GTRA 1E1CA 1XN4A 4UCFA 3ZBUA 5J2UF 3HY6A 1JHMA 2J9GA 1FTGA 3TB6A 2PIAA 3OJEA 4JC4A 4QXAA 4KH0A 3HO1A 1A8IA 3B2QA 2IV2X 1KEUA 4HFJA 3B7GA 1JBEA 5JAMA 5JYDA 1CU1A 1Z2CA 1E4EA 1W96A 1OXUA 3ER8A 1II0A 2YV1A 2RH5A 1PDVA 3RGGA 2A94A 1PVDA 3K35A 4NBRA 1Q1NA 3GGOA 2P2YA 5L7YA 1OY1A 3PUZA 3TAHA 1YH3A 5C5EA 3D7RA 5D8DA 2DC1A 3HKBA 1NI5A 1HUQA 1GARA 5B4UA 2JZCA 3KQSA 5BR1A 3HP1A 1R5NA 5CBPA 2VNSA 3I8OA 1GT91 2EARA 4JLVA 4W7HA 5DXAA 4ZCLA 3U7HB 1L7PA 5T3YA 1MC4A 2YVQA 3GU3A 1IQUA 3WC4A 3NHWA 1RZ3A 4P86A 1CQZA 2VJAA 5GPBA 3U9TA 4URFA 3WGNA 2DP4E 5COQA 4YCAA 2G72A 3P32A 2G06A 4N6OA 2JC3A 5B2EA 4P7BA 4DIDA 4IW3B 2PV0A 2IPXA 1H2RS 2B25A 3O82A 3PIRA 4HO1X 3EGVA 4Q3EA 4EITA 3EFEA 4TSKA 4QXPA 4ZT6A 4MRSA 4RL6A 5EYPA 2BM0A 1W1IA 4DSUA 3ETCA 1NZFA 2OG1A 3THRA 3VTKA 3OQMA 2A8YA 1KS9A 1NVKA 2RCNA 2WT4A 2OBMA 1IJBA 1MTZA 3AF3A 3HU3A 3PNBA 4RVDA 4CQMA 4EKDA 4ZTZB 1P0FA 1Z5NA 2ZFUA 2FUNB 2YQ5A 1G6HA 1T3HA 3QELA 2J0VA 5T6BA 1GPH1 3HUTA 3OF3A 4QSMA 5JPCA 1Q91A 3G59A 3H8WA 5I6DA 2HYDA 3FGPA 4QDUA 3UKOA 5LQJA 4J75A 1QWOA 2BIFA 2KBFA 1FDVA 3ABQB 1KHTA 2IPNA 2GVNA 1Z45A 1AB5A 3W7AA 3G9QA 3IOEA 3JRWA 1VI5A 1XRQA 3O4FA 4W63A 2VXCA 4DCUA 5LLTA 1GVHA 3MXTA 1U3VA 2NV2B 4CU2A 4RY0A 3LLUA 5LFAA 4WN9A 5JSZB 4A92A 1U7WA 4BNMA 4OQEA 2WW8A 4C21A 5ECGC 2OZKA 2CVHA 4LZOA 5TMBA 2QD5A 1JV2B 1Z17A 1JYSA 3BTUA 3DZDA 3QH4A 4J0QA 5DN9A 4B73A 1E0AA 2RHOA 3KXKA 1DC7A 4XB1A 4WK2B 4RHTA 4F71A 1JHQA 3F5MA 1KAEA 4FFVA 1NDQA 4PINA 5A3VA 3CZMA 1J20A 1NP3A 3K9BA 3DB2A 4ZAWA 2G1AA 1IRXA 1EPUA 4PR0A 3BGSA 4QOIA 2WIKA 3SN6A 1B0UA 2IEDA 2XW6A 3B9RA 4A8JC 1DADA 4F60A 3IELA 3O4VA 1B0ZA 3OP4A 4Y6QA 4G0VA 1QCDA 5JCPA 1I30A 4CM5A 1MX1A 3TSCA 2C7OA 1DKLA 1JFTA 4WASA 1E1LA 4AJOA 4LXTA 4UDYX 3ED5A 1X1EA 3KR0A 5KTRA 1BWQA 1G2QA 4PQRA 2RIPA 1P73A 3RPEA 2J5KA 3L0YA 3O1HB 4B8WA 2CSXA 4C87A 3L0ZA 2XVZA 2M1ZA 1AUOA 1E7RA 1WTAA 1Z0IA 2FSVC 3QA3E 2H1VA 4UAUA 4W8GA 3WQHA 3C3MA 4GIBA 1FYFA 2XKKA 3ZR4B 3RVBA 1WBJB 2B35A 2V6JA 4UATA 4B2LA 3DE1X 4LF7B 1E32A 3KVRA 2BL4A 3OIYA 3A70A 3NBXX 1A9RA 1SBCA 2H4HA 1YR3A 2XLBA 4NHEA 3HU1A 3DG9A 3T61A 3WLOA 2VTBB 1UWCA 5KTOA 1QE0A 4GRIA 4BTVA 3A6GA 4OUDA 4CI0B 2XTJA 5F3WB 4LYYA 3W77A 1YJCA 1MGPA 3DW3X 2LUOA 4AJIA 5K8LA 1UBEA 4FXOA 2C2HA 1SXGA 2I6UA 2ZYGA 3RTAA 5IYZB 2PKYX 3U4CA 3EWSA 2A9QA 2VF7A 3PFNA 4AICA 2O2CA 2QNIA 3PGVA 4RHUA 5AVSA 4RM2A 3WGHA 5ITZA 2AJTA 1ZESA 3KJZA 3ZQ4A 3EE6A 4UEKA 2AKAB 5IKXA 1N1GA 5CW1A 1R6VA 3V2UA 4DKXA 1JHAA 1UJBA 2NSHA 5B53A 1ONSA 1GPAA 2Z57A 4II3A 2OBYA 5T4HA 3WWEA 3UAWA 4LQDA 4OX9B 4MTCA 2BGRA 3KSZO 1HSOA 1AHHA 2Q1UA 4GXTA 4NULA 4R8SA 4J7AA 1I0LA 1OLXA 2XYPA 4WESA 1OIXA 1Q21A 5AW0A 2PR7A 2GEDA 1YZLA 3MTBA 4ISCA 3ENQA 5ESWA 3SJBA 5IJ0A 5KNDA 5LOVF 4INPA 4FHFA 1AXGA 1S3FA 2V3VA 4ZO9A 5KNCD 4X54A 3VU8A 1N78A 3S2UA 4YO8A 3JAWB 5I51A 3E2MA 3FTNA 2FRXA 3KZCA 4CM6A 2HRZA 3I32A 1I4WA 2ZRJA 4YIKA 5JZBA 3R0VA 3CS3A 5DM70 4NG5A 4RFSB 3QLTA 3S7TA 2QQEA 3E3AA 2FPKA 4PZPA 2NM0A 4L6AA 4F4DA 1M54A 2LPMA 1XCLA 1H1DA 1NQTA 2COKA 1R5BA 2A4MA 2AGVA 2VVTA 2NU8A 2QZ4A 3EFOB 1O95C 2AVDA 2ZI5A 2J3DA 4KQEA 1QP0A 4OHXA 1A8SA 1U9CA 4U7HA 3RIGA 2WWYA 1EVJA 1CUVA 1R6AA 3D4LA 3MWEB 5A1TA 1PHRA 4B48A 1W6UA 2ZRGA 2BFWA 4XR4A 1TEZA 4X8MA 1ETUA 1TTPB 3OZSA 3ZHRA 3SZRA 1GWNA 4WIAA 2OQVA 1D5CA 3WR5A 1GNVA 4DBLC 4EJSB 4DGSA 4MA0A 3T3EA 5BP7A 2DQYA 7AT1A 4X20B 4EGFA 1J99A 3QTLA 1NWHA 1KGDA 4AWBA 5I4BA 1M73E 4BTEA 3G2LA 2H1WA 3SS9X 4LGCA 1K8RA 1PD1A 1EFKA 3IVGA 1AS3A 4X3OA 4FWTA 1VP3A 2XAUA 4RZXA 2WIDA 2W8BA 3IVMA 4HZIA 4NI5A 4PGMA 2LBPA 4A0RA 1GTVA 2RHLA 1F2DA 2GPJA 1MX9A 3QKWA 4FVTA 4JHXA 4ECAA 4EYSA 4AF8A 2C2GA 5J2UA 2AEEA 3L4EA 1GL6A 4MK4A 1LJ8A 1GZUA 4ZAFA 4Q0MA 1ZJWA 1WCV1 2YWBA 2VT2A 4DF3A 4CPDA 1PGNA 1YXMA 3ANSA 1MRZA 2BHLA 2CL6X 2VL7A 3LXMA 3PGLA 3I12A 4L0QA 1GCOA 1P5RA 2HA3A 4LPKA 3C6XA 2YWCA 5AKEA 3DS8A 1HLPA 1RAIA 1XTZA 2GLXA 1H1TA 1TJYA 3DOOA 3OIGA 3NR2A 4HL6A 4XIIA 2GSWA 2PT6A 3A3OA 3V1LA 4CKEA 4JGBA 2VHZA 4O2BF 5CUQA 1X8JA 4BB9A 2QRUA 1NUTA 4LXUA 3A7DA 1NVVQ 4U8GA 1ML4A 3PHHA 4CLEA 3EQ7A 3EF3A 4OGGA 2FSPA 3H5WA 5BUQA 1ZDMA 1DE0A 3QITA 3SX0A 4FQ8A 5KOJB 5EJFA 2WZCA 3EW9A 3SXPA 3AV0B 4MX8A 2IF2A 1WOYA 2C0PA 5JWRA 5TRTA 4MYTA 4Q19A 2FRDC 4RF3A 4E31A 3WRXA 3VNRA 1G8YA 2Z8YA 3WFJA 3HJUA 1PT7A 4D41A 1G38A 2Z5GA 1Y4AE 4Y1RB 4CIXA 1JPJA 4U39A 1GLGA 3ELUA 3R3XA 1FVXA 1RRPA 2CF6A 4M0DA 5DSTA 5TQ0A 1KKUA 4BO9A 3YASA 3HABA 5HKBA 1V7PC 1A96A 1N2GA 2PJDA 1S3GA 2VAXA 3CISA 1EM8A 1P0CA 2GJKA 2Q3LA 4G1CA 4XX0A 5CM9C 5IXJA 4NENA 3VMFA 1I3CA 3NZEA 4HGOA 4YMVA 1DCMA 1Z15A 3N2IA 2JARA 4RKFA 3SHFA 7ADHA 2ZK7A 4AG6A 3ZKWB 5JWOA 1LPMA 3VVBA 5IFKA 1DIBA 2DULA 3RTDA 3GDWA 4HEQA 4GVPA 1O58A 3DKRA 4EUHA 4E5DA 4Y1GA 4B4VA 5LUAA 2AHRA 3PQCA 2GTPA 3MQ2A 1C1HA 2PWBA 1Y3FE 3PSHA 3FPGA 5C81A 2R7AA 1FNBA 1DKQA 4GZLA 3O1LA 4ON9A 4A8HA 2QUAA 3D81A 4Y98A 4BFVA 4PYJA 1U8XX 2GARA 1VL2A 4XSHA 5JS6A 4DCMA 1UXGA 1GCAA 3MBKA 3HJHA 3OFKA 1PL0A 4IHJF 4OB6A 4XPIA 4EG7A 5BRAA 4MVJE 5FPKA 1E1CB 3B1JA 4RTMA 1GTL1 2RK4A 5CGZA 1N2XA 5AO9A 3PD1A 5L6LB 3RRFA 1NLFA 3V2GA 5LQRA 3AKYA 1XMPA 2FJPA 4DDMA 4BS9A 3HNPA 2H00A 4MWTA 4PFKA 3TYXA 2XUZA 2JLZA 3BS4A 3NBAA 1P4JA 3IAUA 5SZHB 4WEOA 1U2GC 2O2ZA 3VDXA 1F0PA 5BOVA 5IH3A 1D9XA 2OESA 2QSYA 4FN4A 4HH1A 4PC3A 1KVUA 4I2VA 2O8EB 1PR0A 3ZHQA 3QA9A 1VG0B 3KTAB 1WABA 1DHRA 1C2YA 3M3DA 1A5AB 4QBTA 2FW0A 4P8RA 3GJ5A 2QU7A 4JJIA 3QU9A 1PZHA 5BNFA 3KWJA 5ADHA 4CHTA 2I54A 9MHTA 1XDWA 2AOUB 1Z0DA 3B9BA 1LY1A 2CK3A 3BFXA 1KBOA 3WG9A 4DC1A 2MR6A 5FWAA 1GTJ1 2YV4A 1FFYA 5CTAA 5HF9A 1F2UB 1G7SA 1UZLA 3KUCA 3SMVA 3ZHXA 4C4ZA 3TK1A 2JFXA 4PXAA 4IH1A 1DC6A 2AN4A 1CUWA 4HLQB 4YJDA 2V03A 5DX0A 3T7EA 2NMVA 3I5MA 1D04A 4LV5B 4NU8X 5EWLB 3QPVA 2FQWA 3PQ6A 4IMJB 1UDCA 5LCXA 3ZY3A 3JY6A 1XEXB 1IAQA 3MYRA 4JBLA 1ZP6A 2QMEA 4J9VA 3VX4A 1J97A 1EEXB 2REQA 1SIBE 2VHTA 4AS2A 2WU0A 2XOXA 2YXEA 1AZLA 1QG4A 4HEA6 3TUJC 3ZNOA 3N2ZB 4PCAA 5B58C 3A37A 3DHYA 3MD0A 3OWXA 3I9JA 1KETA 5E0KB 4I19A 1U4NA 3JD3A 4N7MA 1Y3AA 3ZY5A 3CLUC 4FEGA 1WRBA 1V43A 4PZZA 5AW5A 3TTVA 1YNOA 3D7LA 4IGEA 1XA4A 1UDAA 5JFOA 1JPNA 4LK2A 4N41A 3JWIA 2QV7A 5ESRA 1KO4A 1J5PA 3COJA 4CLRA 3LX5A 1QF7A 1LDNA 3T1TA 1CSEE 1X3LA 2OD7A 4H18A 5C4GB 3SLGA 1N2CA 3TSZA 3LNCA 3V7NA 2ZM6B 3NWBA 3ANLA 2QPAA 1GPDG 2FFBA 3A1VA 2AN3A 4A2PA 2HAEA 2E5LB 4IXTA 2D1SA 2ISCA 3VUEA 1MOZA 3FROA 4RIEA 1A2KC 3QKIA 2PHZA 2VHCA 1E79A 5G0TA 3CF0A 3EA4A 4D2IA 3W6ZA 1D1SA 1KSHA 2DBZA 2PGLA 3EGWA 3VR5D 2NU9B 3NDJA 4ZRMA 4IXMA 3H2SA 2NUTA 3AC0A 1U2SA 4RHXA 1T8WA 4O5OA 3ZUPA 3GQBA 3DCYA 2IXBA 1P60A 4YGYA 4LXIA 4M7PA 3AGPA 3N59A 1PLLA 4PFSA 1CHDA 1OZHA 4QG7A 3WWCA 3B51X 4G5RA 1YZUA 4WY2A 1K27A 2FXVA 4KQKA 5DHTA 5C7IO 5FYDA 5C5CA 2RG7A 3K0KA 3S8EA 1TO6A 3KQNA 1YDGA 3OECA 4K6GA 1C4XA 3A1SA 2PGIA 1JQBA 5ESDA 4CQJA 4EW2A 4IWYA 5KOHB 2Q99A 2G76A 1Z16A 2VPIA 1GNQA 3WP0A 2CXHA 3ZEIA 3DO8A 4HYYA 4AKSA 5DO9A 4KNWA 3U4IA 2J0UB 2XMQA 3OOEA 1JLMA 1Y4DE 3Q7RA 4JROA 2Q1XA 1FDIA 4KVFA 4QJIA 4TQUS 1N9KA 3FGOA 3C24A 3GA7A 3DW1X 3WB0A 4XYBA 1ZBQA