3F8WA

Crystal structure of schistosoma mansoni purine nucleoside phosphorylase in complex with adenosine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
280
Chain Sequence
SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adenosine binding to low-molecular-weight purine nucleoside phosphorylase: the structural basis for recognition based on its complex with the enzyme from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords Purine-nucleoside phosphorylase
total genus 91
structure length 280
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f8wA00
5F76A 1U1DA 3MB8A 4F3KA 4PNPA 3BSFA 3PHCA 1V45E 2I4TA 4R31A 1CB0A 1PW7A 3OZBA 1Z5NA 4ECEA 3DP9A 1ULAA 5I3CA 3FB1A 4I2VA 4TS3A 4U2KA 4NY1A 3OPVA 2AI1A 3KUKA 1PR0A 4OGLA 4M1EA 1PF7E 4OJTA 2AC7A 3IEXA 4TYMA 1A9TA 2XRFA 2B94A 4LNHA 1PKEA 4F1WA 1RYZA 2HSWA 1RT9A 1YQQA 4TTIA 3U40A 4DAEA 1N3IA 2ISCA 4OF4A 4QAQA 4D8VA 4TXNA 3EEIA 3OZEA 3LA8A 1Z34A 4DABA 4TTAA 3OZDA 2QSUA 2AI3A 2BSXA 3P0EA 4JP5A 3O6VA 1CG6A 4OGKA 1TGVA 3D1VA 1OTXA 1PR6A 4L0MA 1FXUA 1Y1TA 1V4NA 4D8XA 4JOSA 4JWTA 4QARA 1ODJA 3DDOA 1T8SA 4DAOA 1I80A 3NBQA 2PGAA 1JDTA 1YR3A 1Y1QA 3OF3A 1VMKA 3ONVA 1C3XA 2HN9A 1Z38A 4F2PA 1B8OA 1Y1RA 1YQUA 4X24A 4RJ2A 1LV8A 4WKBA 1QE5A 4DA0A 3NM5A 3K8OE 4QASA 1VFNA 3FWPA 1ODKA 3UAVA 4GMHA 3KVYA 5F7XA 3OCCA 1G2OA 3BJEA 3EUEA 4PR3A 5EPUA 3E9ZA 5C80A 1Z37A 1RXYA 4K6OA 1PR1A 1JYSA 1M73E 4DARA 2QTGA 5B7QA 4OY3A 1K9SA 3PHBE 1Z39A 1TD1A 1Y1SA 3DJFA 1A9SA 5CYFA 3INYA 4GLFA 4UC0A 3UAWA 5K1ZA 1PWYE 3EMVA 1JDVA 1U1GA 5B7NA 1PR5A 4NS1A 1V41E 1Z33A 4MCIA 1NW4A 4WKOA 5F7ZA 2OC4A 1A9OA 1V2HE 3DPSA 1SD2A 3F8WA 5F7JA 1VHJA 4G41A 1JDZA 2AI2A 3ODGA 1T8WA 3FOWA 4YO8A 5CYGA 2QDKA 4P54A 4MCHA 1YBFA 2A0YA 4LNAA 4YNBA 1OU4A 3SCZA 3OOHA 1RXCA 4TXMA 2HRDA 3LBAA 1LVUA 2RJ3A 4D98A 2I8AA 1SQ6A 2HWUA 4R2XA 3C74A 3P0FA 2P4SA 3E9RA 4L5AA 1PBNA 4TTJA 1YRYE 4KN5A 1PR4A 3UAZA 1Z36A 5CCDA 4BMZA 3KHSA 3UAYA 3UAXA 1K3FA 4TXJA 5CXSA 5EUBA 1OUMA 1A69A 4QATA 5ETJA 4H1TA 1SD1A 1TCUA 3OZCA 5IFKA 1T0UA 1JDSA 4WKPA 3K8QA 1Z35A 3ENZA 3LGSA 1WTAA 3TL6A 1ULBA 4TS9A 1SJ9A 5JPCA 1RCTE 1B8NA 5KB3A 4M3NA 2QTTA 3NM6B 1JP7A 4D8YA 4QFBA 4D9HA 2A0WA 5F78A 3QPBA 3NM4A 5B7GA 4F3CA 2Q7OE 1RSZA 3PNSA 2QPLA 4GKAA 4BN0A 1A9QA 4TXHA 3GB9A 1K27A 2A0XA 4YJKA 2GUWA 5EFOA 3FAZA 1A9PA 1T8RA 1ECPA 3FUCA 4DA6A 2OXFA 2IQ5A 1VHWA 1V48A 1ODLA 1OV6A 2ON6A 1A9RA 4M7WA 3PNPA 1Z5OA 1TCVA 4BMYA 1U1CA 3O4VA 1V3QE 1NC3A 1LX7A 4L5YA 4LZWA 4L5CA 3DF9A 3MMSA 3FNQA 5IU6A 3KVVA 3E0QA 4MARA 1JE1A 1PK9A 2A8YA 4R2WA 5DK6A 4E1VA 4DA8A 4LDNA 4LKRA 4NSNA 4TXLA 1JDUA 4FFSA 3UT6A 1TGYA 5F7OA 4F2WA 1Y6RA 1OTYA 4G8JA 5FAKA 3OOEA 1RXUA 4G89A 4BMXA 2OECA 5CCEA 4DA7A 4YMLA 1ZL2A 1NC1A 4IP0A 1JPVA 4OEHA 3BL6A 2OC9A 3KU4A 1ODIA 5F73A 1RXSA 3BGSA 1PK7A 2H8GA 4QEZA 3KVRA 4WKNA 1RR6A 3EUFA 4GLJA 5B7PA 1U1EA 1T8YA 5F77A 1OVGA 4EB8A 4L6IA 4EARA 1RFGE 1XE3A 3IOMA 5CXQA 1PR2A 3T94A 1U1FA 1ZOSA 4DANA 1Q1GA 1JE0A 4WKCA 1Z5PA 3GGSA 1Y6QA
chains in the Genus database with same CATH superfamily
3RVSA 4ZGBA 1QGZA 3NGMA 3S0JA 1MW8X 1RD4A 3BA6A 4K9RA 1ZH6A 2XAUA 4QNMA 1XC7A 4LW8A 5GY7A 1MU0A 5TMPA 1Z63A 3C1UA 4PNPA 3T5PA 2AL7A 4TM8A 2YHBA 3DW3X 5AXAA 4D81A 3QBVA 7YASA 5JBIA 3A2KA 4MQFB 4A9AA 4DF3A 4INAA 1GL3A 1G9XA 4ZDKA 1OZFA 2C04A 1H3EA 2PRYA 3AUYA 5KMGB 3EGDB 1QHHA 2H4FA 3NRJA 1LQTA 2HDHA 1YDEA 1DX9A 2HMYB 4IH1A 4K86A 3OEEA 4BNHA 1DIRA 5BPFA 3QLVC 1UMBA 5J9FA 5EYPA 3CNQS 4JT2A 3C5CA 4LVOA 4OUKX 4P8RA 3CX4A 1XK6A 1R10A 3VNRA 3VAYA 3A9TA 4IMRA 2ZYRA 2O4UX 1N8KA 3C85A 2AN5A 2GB4A 2PANA 5DM1A 4N3NA 2VEDA 3B3AA 2VYVA 3DHYA 1CUZA 3E0XA 1LNZA 3A3KA 2UUBB 3KO8A 5MFPA 3RVNA 5A1TA 3COVA 1XZQA 1T9AA 5KHOC 3L05A 1QM5A 3N75A 2GJSA 1DRJA 3E03A 1ORRA 2QGZA 1HYBA 5JJLA 1UXJA 1RT9A 4IDDA 4P82A 3V4SA 4TTIA 1IY1A 4Q16A 1D2HA 1FDSA 1P4GA 2X3FA 4CLDA 4ZQGA 3U3DA 1OGJA 1W1IA 3WMRA 4HFJA 1RWWA 4JIMA 3UYKA 3MS7A 1U8EA 5K6AC 4TX1A 2RHWA 1AT1A 1H8HA 1HV8A 1Q50A 2PZ8A 3CPJB 1HT0A 1KJZA 2CLSA 3I58A 4NEGA 1O96A 5LYJB 2ZIZA 1IIRA 1XR3A 5JH7A 1Z5UA 1U7OA 3N2ZB 4J16A 4Z9FA 2VN8A 2WKRA 3BXFA 4GQBA 2JJ2D 4FZRA 1UEXC 5CVTA 1QNFA 3CMMA 2VDWA 2R97A 2WPDD 4GXNA 5BY2A 1J9ZA 4G85A 3THYB 1RZRA 3MBOA 4DLNA 3RADC 4DMGA 5HM6A 2B4TO 4HXEB 5C5IA 1JALA 5ALPA 3JQEA 3TJMA 2DY1A 5IYZF 2OGUA 1O1YA 3B6MA 4MYSA 4EHBA 4K0RA 3JQ9C 3N7AA 4R01A 2E6KA 4W4TA 1RPZA 2NMVA 3SK0A 4HUQA 2O1WA 2YS6A 2ZVPX 4HZUB 4NBWA 3ZJUA 4U4AA 1BJTA 3EPHA 4ENPA 3OMWA 2LDXA 3NTLA 2CFSA 3S5JA 5I47A 5ALDA 1R0YA 3B1XA 5D51S 2EKDA 3WQRA 4CL3A 1IZ7A 4RPJA 2IZOA 3WIBA 5EXPA 4B9EA 1FMCA 3Q8LA 1YZFA 1QIMA 2TMKA 1SU8A 4JKYA 4IG4A 1NOKA 2GXQA 2NXWA 2VJAA 3TECE 1LF0A 4KSBA 3C6MA 1U98A 4DQKA 4UU7A 2GZ1A 1ZN7A 1LV8A 3MYRA 4U3JA 4UJ3A 3QPCA 4AJHA 1KXZA 1JN0A 2OBLA 2ZRQA 4L95C 3UC5A 4MRAA 4BVAA 2NZXA 5C37A 1R3UA 1T5SA 1NW5A 2BHSA 5CB4F 3KFVA 2GDJA 1BO6A 1BFKA 1TMOA 2V7XA 3JQAB 5TQJA 4ONEA 3E8XA 5TJ9A 1L4FA 3ZHOA 1GGMA 2VP5A 4LJRA 3KVYA 1VIVA 1FNNA 1WB4A 5CDUA 2OCBA 1KZ9A 1VTKA 4O4LB 3WY9A 3B5IA 1WUYA 3BMCB 3F73A 4UPEA 5B64A 5JJKA 2XR1A 5EIXA 3A10A 1W94A 4ZQHA 3EF0A 1BMQA 2RHBA 2VEOA 1LDBA 2OVBA 2PH7A 3QKSA 3DE1X 3LNTA 4CKCA 4H18A 2X41A 1ODTC 1V5GA 1W30A 1ZGJA 3HU1A 2BTOA 2PUVA 2R751 3NB0A 4ID9A 5KAMA 1ZXLA 4DARA 3RYIA 2WQZA 3MJTA 4N0PA 1P75A 4PAQA 2PDAA 4D3ZA 3B12A 4ZEWA 2OQVA 4RPIA 3N8HA 1U9ZA 1EI9A 5IAJA 5K3DA 1CC1S 1G21E 3WLLA 4D4KA 5CNIA 2J07A 2W43A 5HG0A 8OHMA 3WGMA 1IHDA 3O3MB 1RHJA 5ECDA 2WIDA 3HB4X 1OGIA 5AFSA 1FQJA 5BYKA 3L4SO 4FFLA 4EL5A 2ZDQA 1FNCA 3LPAA 2ZJ7A 3I72A 2B5OA 5DBEX 3CNEA 4M99A 3G6KA 5T5QA 4F2GA 2FPKA 3VPDA 3PZRA 1L4YA 3EFEA 2VTDA 3PQ2A 1VQ1A 1WXWA 4U2EA 1XZDA 2YJNA 1OXVA 4R0NA 5B7NA 3URMA 3WMWA 2BFBA 4EJ6A 5JASA 1XZIA 1W6RA 4HN9A 5A4JA 2WC1A 2QENA 4C6SA 2YS7A 5BNZA 3PPXA 2LCIA 4N5IX 2P4UA 4CU2A 3E9CA 2E1RA 3T1OA 4JNKA 4PNHA 1G6HA 3QOXA 4JBHA 1ZNXA 5L3ZA 4HATA 1MR3F 3QHQA 1VXOA 3RS2A 4LJ9A 1GQYA 2ZJ2A 4FOPA 5E9AA 1PZEA 3NH6A 1DAGA 4IZ6A 1R4AA 4RHEA 5B3AA 4KR0A 1L7OA 3L02A 5FV7A 3IL2A 1SKMA 5C51B 2E87A 5CYGA 5F5LA 1EKXA 2FPGA 3GJ3A 3U13A 3IMGA 4EDHA 4BLTA 1SRQA 3PRKE 3D81A 3QKTA 1QGUB 3H17A 3FZQA 2F62A 1SC1A 3I4LA 1SZPA 2I6FA 2VJLA 2G76A 4CM8B 1YBAA 2VSYA 3NHBA 1XO1A 1RYYA 1FFCA 3LBAA 1GDTA 2BW0A 3A6JA 4O29A 3HP4A 2D13A 2PUJA 3ILXA 4L8YA 2CB9A 3Q0EA 5C5DA 1CF2O 5JLAA 1YIOA 1E9DA 1M7HA 1GKYA 1K68A 1JA0A 1E61A 1GP2A 4QDKA 4U6QA 4AD8A 1O9BA 3WZMA 1UPAA 2EEZA 3G3EA 1FX0A 4CMJA 3HUTA 5DYTA 3WZ2A 3N7TA 6ABPA 5LP1A 5L7TA 4XVQA 2EERA 2NTYC 1N33B 1GQOA 2IE8A 2C4NA 1NQTA 1ZMRA 2Q8QA 821PA 1E1QD 3DVLA 3I39X 2IUUA 1UQRA 3P7MA 2FFJA 4GC5A 5EIOA 4I6GA 4LJ7A 4UKDA 1A5SB 4MDYA 1LSSA 3GT3A 4QECA 4UEKA 1AQNA 3U4QA 1Z4JA 4IFBA 3DUWA 4XGRA 3VUFA 1MFPA 1WE2A 3GLHA 3FPEA 2PKQO 4QRIA 5D00A 3H2IA 3ZH9B 2AFIA 2Y1EA 2B2XA 2ZUBA 4D9CA 3K2IA 3ITDA 1NI4A 2RMKA 1XBTA 1QE0A 4V3CA 3UAYA 3A28A 3QUAA 1ZICA 4XIYA 4RJTA 2G71A 3FMOB 5KTOA 1QS0B 2Q1XA 1J06A 1TLTA 2RHOA 4LY3A 2QT0A 3LUBA 3ZY2A 1Z07A 1K3FA 3RQSA 2IZ0A 1C8KA 4JT4A 4GSKA 3PNKA 1AB5A 1AB6A 2GFQA 4ALJA 3KYCA 3RGWS 5JD4A 3B48A 3CC8A 5FX2A 4K3VA 3JD1A 4Q3EA 3C4VA 3W2EA 4PN7A 5TQ2B 3VGJA 2JLVA 3M4YA 5AMXA 1T6ZA 1VRCA 3V6MA 1VJTA 3O1JC 3H1AA 4DBLE 4EB0A 4H1WA 2C9MA 2CLHB 4AAYA 1Y1PA 1Z9BA 3ZU5A 4R16A 1PE0A 4FKZA 3I52A 2RI6A 3DOEA 5AI8A 4YDSA 4RVOA 4QYMA 2BKXA 1MC8A 1AK9A 3UJDA 3FIJA 5B5SA 2CLMB 1E7SA 2HA3A 2JGDA 2YBEA 3IVCA 1LA2A 1Q1NA 3U4IA 4NPAA 4Z49A 5CH3A 1BYIA 4GNRA 2ZS7A 3DOCA 1O94C 3PUYA 3UWSA 1DWQA 2IHTA 1R9NA 1BQ3A 4NECA 2GDZA 1ORHA 3K8QA 1KYXA 4KE8A 4BNJA 5IJ0B 2MDTA 3HBLA 4OKNA 4IOJA 4Y0AA 2P2ZA 1PV4A 1PSDA 4CQMD 3MTEA 1QHSA 5LP6B 5THKA 1DAHA 3I1YA 4FFBA 4NENA 4ZAYA 3K31A 3BPSA 2WVJA 2YXBA 1YB4A 4D9GA 1EUZA 1XZBA 3BB4A 1JP7A 1PLJA 3DO8A 5JXGA 4KSYA 3GPIA 3H9GA 4JOCA 3OQNA 1BGWA 4KFCA 3SBOA 4PWYA 1MX5A 2QWXA 2F9MA 4LCJA 1YVUA 5CPBA 4DUPA 5DGDA 4UTXA 3LHDA 4YCNA 1RXWA 1NUQA 2C9ZA 4CN8A 3FTFA 2H4JA 1WRBA 3R0JA 4RL6A 2NXJA 3LQKA 1PQ4A 3Q6IA 2B7CA 4KQ6A 5C1OA 3GRAA 3UMVA 3VR5D 2J30A 4OUDB 4JFRA 3HCRA 2QTHA 4RV4A 1NAHA 4UVHA 1G8SA 5ICEA 3P4UA 5ADHA 3AR5A 3QVTA 1C8LA 4YMHA 5K0NA 1QYWA 2IRWA 2X8AA 5HFAA 3LUDA 2NN3C 3K30A 3V80A 4UDYX 2GRJA 4UVIA 3BWCA 4OQMA 4ZWNA 4PCVA 3ZI0A 1MLDA 4K9OA 3EPJA 3IP6A 1ECFA 2AQIA 3FUCA 5EXDA 3VR6H 1K89A 1GT6A 3ZUGA 3F71A 4QTZA 1OA1A 4RNDB 4ZYUA 1RADA 2BSAA 1SU4A 4OQZA 4UQOA 3STVA 3A3NA 5M5BA 3G68A 3GG9A 2AR0A 5JCJA 1RP7A 1LK0A 4M46A 2JC3A 3H0CA 2AZXA 5B3KA 1JR4A 5GV8A 2A0KA 2PS9A 4UUBA 4BX0A 1JTFA 2CXHA 4AG6A 1VIMA 3LHIA 4CBVA 5K0ZA 3PDHA 1Y9AA 1I4EB 1XQYA 3I1FA 3VSAA 4D9EA 2ZUDA 4HX2A 1NC3A 1FL9A 4NV0A 1T43A 4N3AA 1E6MA 4L5YA 4PBRA 4ZCLA 3CF0A 3U48A 2OAP1 4E5YA 3HXPA 3NAMA 2OCYC 3AIOA 1YQ9A 3DMRA 1SHKA 1LLFA 4MW4A 4HY3A 3HB5X 3N86A 4ITUA 4PX9A 1YONA 1R6AA 2YDXA 1II8A 2W4IA 4MARA 5EZ6B 4KTVE 5A4IS 5KYWB 1EE2A 5REQA 5JRZA 5IS2A 1L5HB 3DXYA 1A96A 2PVCA 1KH1A 4ZVMA 1Z12A 5HKKA 5CDYA 3MWFA 3CEJA 4JJGA 4MVXA 1WHSB 3P32A 4Y2VA 3O93A 4FHCA 2N1MA 1E2UA 2G9ZA 4OFZA 5BRAA 1B00A 5LU8A 2XNCA 2BHRA 2E21A 3PYLA 4G9EA 1NVBA 1LF5A 2NZ8A 4DYHA 2HJVA 2NX2A 3DM9B 3OM0A 3SNHA 1MZVA 1U5CA 3SICE 1JH9A 1PLKA 1OIWA 1RCUA 5AHKA 3B53X 6NULA 1E8MA 2H00A 2BHNA 3RYTC 3DOHA 5DOVA 3RLFA 4QJBA 1Y6RA 4RW0A 1GTJ1 5LZ7A 1W7AA 1L5OA 3RE1A 1Q3KA 4XH9B 3R0IA 4NL4H 2VQ6A 3RS8A 1T0BA 3SM3A 5AW3A 1QO9A 4QTYA 5FR1A 3UJ9A 1NXXA 1Z7WA 3FPBA 2QMYA 4G07A 1Z6YA 4V0OA 4ZI5A 1UKVY 2YY5A 3AM4A 1U2SA 4G63A 3W7AA 5C7YA 1KKUA 2NPIA 5JAZA 3DMTC 3T06B 2ZVJA 3QLEA 2OC9A 4K81B 4E4YA 2PCLA 3D6MA 1Z25A 1SIUA 4TL9A 4J0EA 2R4UA 1UM9B 1N1DA 4TTSA 2Z5VA 5JSZA 1EGHA 1MJ5A 4OXIA 4TL8A 3KSAC 2RGXA 4IVPA 1YJCA 3RANA 3ADDA 1WDWB 3ASYA 4UJ5A 3ZE2B 3C24A 1N6RA 3ZXUB 2G67A 4EHNA 3EZ7A 3ITEA 2NV2B 3ZHXA 4LF9B 3GFRA 3MW8A 4MGYR 3RASA 2W6JA 2MSNA 3HVUA 2J0EA 3QFSA 4CE6A 4Y9UA 1SBCA 5LFAA 2LXNA 1RIIA 3IB6A 3RSCA 1PW5A 5A6SB 2NU6A 2WIJA 2PMWB 3IUJA 3PSHA 4J1TC 3CNOA 3MAJA 2ZTUA 2AVNA 4UAGA 2F43B 2WJ3A 3K8YA 1P4RA 2IDMA 3T9DA 5KYXA 4WFKA 2X76A 4DXHA 2FDCA 3EA4A 1X14A 5J4YA 2HU8A 2XGSA 4F06A 3ZS9A 1SRRA 2Y6UA 5FI0B 3BSSA 4CODB 2VZEA 1DWUA 2IYFA 1JHXA 2W2TA 1G8GA 3LP5A 1PWHA 3CH6A 2HDWA 3MTBA 4NKRA 4U6NA 1QHYA 1I01A 2H2IA 4MWZA 3E2MA 1VGVA 3B70A 5AXDA 3WNZA 3TLGA 1Y9JA 3AL0C 4D41A 3NVDA 1C81A 1W1WA 2G82A 2PXAA 3EH1A 2ZTSA 5FYDA 4CIYA 4RA6A 3R7DA 4P4LA 2NXNA 4GT1A 1VL6A 5BSMA 3MGGA 3NP7A 2IYUA 2C2WA 1QANA 3LS2A 5AKEA 4HUTA 2CKMA 1O8CA 2KBEA 1RQLA 3GUYA 1H0RA 3JAWB 1ATZA 2J33A 3EF3A 4K87A 2C31A 3C2QA 3H9BA 1LXCA 3WOHA 3CT4A 5J4VA 4IFTA 1AD2A 3OICA 3VOBA 1ZO8A 1MDFA 2OFXA 3AYXB 4B6QA 4TQAA 2I1QA 4C21A 2ZJ6A 2R7LA 5E9WA 3BILA 4LRQA 3TSWA 5KHAA 3KBBA 1XHEA 1A7UA 5HUJA 2Z8ZA 3GH1A 3L41A 3M5CA 3WP1B 1TM4E 4FFWA 5GVSA 4POAA 4GH5A 4J0DA 5ALEA 3T3GA 4MP3A 1Y9EA 2J87A 3KS9A 4RY2A 2AYXA 5ERGB 4RY0A 3T1HB 5B37A 3WA7A 4WCFC 4FOTA 2Q0HA 2E5FA 2R3SA 2J6HA 3HBJA 2DP4E 5KCZA 3DVSX 1T4CA 4TS3A 1NPDA 2F3TA 3OPVA 2NW6A 1Y6GA 4GI3A 3TLEA 4DPLA 1L7BA 1DBVO 4YRGA 1Z2EA 1CUWA 2DPGA 3NBXX 4JVLA 4KMMA 4O4HA 5JAQA 4ZK2A 1PFYA 3PHIA 4MVWA 1M1ZA 3ZE8A 5GIPE 1HNXB 2JK1A 1KEVA 4CLHA 4LNHA 2WVHA 4RM2A 4OMDA 1DAEA 4EW6A 4IVRA 4HVTA 1E3SA 3L0BA 4FMDB 3VSEA 4LZLA 2ZQZA 3V33A 3QEOA 4M1ZA 4P36A 4P98A 3F5SA 4G67A 3TEMA 4DR3B 1G8JA 4OF4A 1KYWA 1D0SA 2OCIA 2ZIXB 2Z8YM 2IIVA 2YN2A 4FE7A 3VO1A 1IXZA 5A4AA 3R9WA 1D2MA 4HV4A 5BVGA 1WMAA 1FLVA 4TMWA 2DHDA 2R6GA 3AR9A 4MW1A 1L1FA 4O3FA 4KK3A 5BT9A 3RJ5A 5K7SA 1J1UA 4Q1DA 3HV2A 4MLPA 4AF8A 1PG2A 2AJCA 1QRUA 1BKSB 3LPDA 1MFZA 4QKQA 3AZOA 4EGAA 4ZAXA 2JFVA 4G4JA 5E38A 1CY7A 3KKZA 3TVYA 1Z0AA 2J8ZA 5CG1A 3HXKA 3HJRA 1VIYA 1CJVC 1DKQA 3D1VA 1ZN9A 1OTXA 1U02A 2VYNA 2J9FA 3C5VA 1DUIA 5BORA 1RU3A 3KJIA 3UMCA 1U90A 2JHCA 4J0KA 3GNSA 4JLJA 2IHJA 3DFMA 2OCGA 3IESA 3SOPA 4BNNA 1NMYA 5CM9C 1BGXT 3JQFC 3R6TA 3IH5A 1ODJA 2IK8A 2UZ1A 1BX3A 4RSRA 4PG6A 2LCQA 3UWOA 2PX2A 4CEIA 3EC1A 2IZZA 3IULA 4QFCA 3EIOA 1CQJA 5I48A 3ZCQA 2NV6A 3TIIA 3G2JA 4EMUA 1IPEA 4GZ6A 1PYDA 2FPSA 3SSOA 4OBXA 2NO0A 4N18A 1ZJ4A 3FPFA 1KVQA 2ZUSA 4BO5A 1K92A 1PNQA 3GT0A 3QG1A 4PW0A 3GMIA 3ZXIA 3ZVKA 4OB8A 4LMRA 3ZU3A 2GD6A 1T15A 3OX2A 1KNXA 3EGIA 3VAZA 3HJGA 1VKRA 4LHYA 2OHVA 1ZMBA 1D1QA 1DXHA 1N2EA 4RZIA 3RDPA 3KNZA 2NTVA 2NYRA 2QX9A 4C03A 4DNFA 2H9IA 1P80A 3R1IA 3R41A 1NXTA 2R6DA 3W3AA 4EF4A 5JXWA 4P7KA 3AXSA 4INPA 3LLSA 2NU9B 2JCVA 4HLCA 1U7UA 2VSNA 3RUIA 1GTG1 1Q16A 4INOA 2D0IA 5GONF 2HW8A 4HDQB 2OLKA 2XI4A 1YI8A 5AW5A 1B74A 2D2VA 1U3WA 4QRHA 1ZCJA 3CJRA 4HDCA 3WDMA 1DMRA 1P0IA 4RORA 2WA1A 1GPNA 3KJHA 1RQXA 2QUAA 3M0EA 1E7WA 3B7GA 3ENVA 2QPOA 3R3ZA 2EOAA 2W93A 1I4OA 3UUWA 3GEEA 3R3HA 4BFWA 3U6KA 2QHXA 4BV3A 4DC0A 1M10A 3UY4A 4QODA 5I8ZA 1T3TA 2ZI6A 1NKVA 2J5KA 3IPCA 2Y9MB 5AI4A 5NULA 1TUBB 1VPVA 5A0TA 1S3SA 1DS6A 1O95D 3LF1A 5K3SA 4I4TA 3JQFA 2QTGA 4CQNA 1KP9A 1VBMA 3IHTA 1ILEA 3DBLB 1FYWA 3MGCA 3OBBA 5B12A 3A25A 3JQAD 4WTOA 2ZPTX 2HTFA 5IBPA 1X42A 3RKRA 5KCMA 3G82C 3EWNA 4ES6A 3SEZA 2NO9A 4YRJA 1XN4A 3E61A 1X7ZB 1XN1A 5LA6F 4DEXA 2ANBA 2RDMA 1V7QA 2ZRBA 2Z8YA 2CD7A 4I9HA 3VRHA 4MHTA 2J0QA 3QX8A 3RVJA 1LC3A 3CEAA 3OHMA 3AF6A 1QP4A 2C8VA 5CCBA 3W78A 3Q1LA 1EUDB 3CXRA 1U2DC 4FJ0A 1Z26A 5E8RA 5EE3A 5ALZA 4X63A 3UFBA 4P32A 3PG5A 3ZU6A 3DVAB 3ORHA 3VXKA 2WD9A 3A1EA 3UAGA 5L3SA 1A7KA 2DPYA 1D4OA 1NVAA 2G04A 2DHEA 4NZOA 3VV3A 2XNSA 3RTBA 2CVQA 1YB7A 1XTJA 1Z7YA 2R65A 1IMOA 1H6AA 3BOSA 4U9UA 5ITVA 1TX4B 4JBYA 3UW3A 1CW2B 3E35A 1TJNA 4J29A 4PIVA 4UM9B 1AOXA 3CEPB 3N0WA 3ZW7A 1EWKA 5F3RA 5U4XA 4FCVA 4BNKA 3FAKA 4ZO7A 4HEHA 3SS9X 1QUFA 2C83A 2NVWA 3IVMA 1ESNA 1O89A 2BFCB 2PZFA 1PYOA 3Q1KA 1C2YA 4NMXB 5KZMB 2PTHA 3A27A 4AKHA 1GAQA 3OFND 2WNSA 4RDIA 4CKWA 4IGIA 1C9NA 3CRMA 1YBHA 3JU3A 1E1MA 3E7FA 3NKLA 4F60A 1UEJA 4C5BA 2ZWIA 1RXCA 2ZPUA 3IAXA 3ILHA 4GXRA 4IUDS 4D82A 4JL5A 5CVVA 3KTDA 4CIBA 5ARBA 2OPBA 3F5DA 1USWA 3KELA 3ETHA 1JQEA 3OMXA 3SEFA 3U7QA 4BO9A 3TZBA 3WHPA 1LV7A 4N82A 5C3MA 4LA4A 5IH3A 4WCDA 4RPCA 5LKRA 5DZSA 5A4DA 3RWMB 2O7NA 4TRNA 1OROA 2JFGA 1H4TA 3PX3A 2ORIA 2HWUA 3VNVA 1RWMA 1Q74A 5CNJA 4EG1A 3L7KA 3O75A 4DSNA 5KHLB 1KRXA 4JR1A 2LIPA 3T41A 3T5TA 3VNQA 1GZDA 4P3XA 5AHXA 5AIBA 2IPNA 3L92A 4Y30A 4OMUA 2IHNA 2UZ1B 3IC5A 1PRYA 3FW1A 1YC5A 3K4HA 4HDSB 4TTJA 2TMDA 5TQVA 3FOZA 3VH1A 4AY3A 2VHWA 1UQUA 4O4LF 3VR2D 2P3OA 5LJLA 2I34A 1OBVA 1SBIA 3AEZA 1JU4A 3GFQA 5ULLA 1OZ0A 2I4NA 5C4GB 3B38A 4AUKA 1VE7A 1FUUA 1PNRA 3MOIA 4UEWA 2O8CA 1XTVA 4F6LA 1EE1A 3SDSA 3EOZA 3VR5A 3O9ZA 5ADWA 3GLGB 4KRXA 4A2CA 5DBGA 4KQIA 1YVRA 3CXUA 3LO5A 4BNUA 5FUMA 3PXXA 1QHHB 1NUTA 1PZGA 3Q9NA 4M1TA 1QQ5A 3BGDA 5G1OA 1QPZA 3H7IA 1X70A 4EJSB 2ZANA 4MMZB 2QYSA 2Y66A 3CZ4A 2EZ8A 4Y2JA 3T5GA 2EX4A 4ALLA 2VHQA 3PNYA 4N7JA 5KAPA 1E9SA 4RANA 1FEZA 5AESA 4MUXA 4YJHA 2I2AA 1CIJA 2D2EA 4Q4LA 3DC2A 3HXTA 4B45A 3ND7A 4ZJUA 4LXIA 4L4UA 1I1NA 2EW2A 4AZ3B 4EPRA 2PWAA 1L7XA 3L18A 1M75A 1PL7A 1Q0RA 4I5FA 3R8XA 1F8FA 2PL3A 4R1QA 3OC0A 4PRYA 4N0EA 4HWRA 3B78A 4WBNF 3KLMX 3PT9A 2WPNA 5LQNA 4MS3B 1SKYE 3Q7SA 1CJTC 1N78A 1MO2A 2QRPA 2GCNA 1E98A 5AVQA 1RDFA 2KW5A 1Q84A 1XMIA 1VL1A 5EVJA 3P9YA 1GUFA 3IJPA 2WTNA 5DTQA 4B3JA 3DHWC 1HDOA 4NAVA 4CWAA 2V65A 1EBFA 3BJMA 3KPWA 3CM0A 1YR2A 3W7VA 2A7XA 4BU1A 5G4KA 4DDWA 2G0TA 2H2HA 1EUDA 2BRUA 4XIFA 4L27A 2W6JD 4RF5A 4IJKA 2DBRA 2WF9A 4M0EA 2CBGA 4AZWA 5HRUA 1GUBA 2O3SA 2C3PA 5BUCA 2J5QA 3PQ7A 1ULTA 4QXRA 3PPYA 2CLCX 1UFKA 5DGHA 4HFMA 3D0OA 3RJ9A 5H68A 3IQIX 1JMKC 1AMOA 1WQ1R 4D4GA 3SIWA 5LYYA 1RLUA 5BMVB 3L06A 2V6JA 4MO9A 4LBVA 1UZUA 5JECA 5ED4A 4YPFA 1WZEA 3S3TA 3D2LA 2YJZA 5JXJA 4NBUA 3LU1A 2DCUA 3AG6A 3HB7A 3GP5A 4LJ6A 5JXIA 2JARA 4ITRC 2IP1A 1J7KA 2XEDA 4JCOA 1CLUA 1WU8A 3I9V6 3SG0A 1M8FA 1K27A 2OXCA 4TLDA 5EJ5A 2VCEA 4TVOA 2FUNB 4G4SP 4NBTA 5EMMA 1FSSA 3ZBTA 4YPVA 1FMTA 4ZZIA 5AVSA 1L8OA 2CNWA 2ZKLA 3Q72A 1JHQA 4MIEA 3C14C 3GPBA 4N12A 3PD1A 4NU6A 4PR0A 1CY2A 2KYRA 2OXFA 2HA2A 1AX9A 4LOHA 4DM3A 2IUFA 1EUCB 2VOEA 2DH5A 1IJFA 1Z74A 3RRJA 3JVIA 1SWWA 2I2DA 3FDJA 2ON6A 4PSUA 1FFGA 2Q29A 2I2WA 2MIIA 3WMEA 4O4HF 3LTNC 5H8WA 1T5IA 1BGVA 2HJWA 2BGRA 1UK8A 2ZCVA 1PD1A 3L9WA 2YJ6A 5EXSA 1YB6A 3QE9Y 2DRIA 2WKQA 4QOFA 3X1KA 5IXYA 5CDHA 1B6SA 2G88A 2FZVA 2Y77A 2YNMC 4MQMA 1L5QA 1NOJA 3RREA 3U39A 2XNKA 4RCYA 1RC1A 1Z22A 4WXYB 4F46A 1QV9A 4EKEA 3UPUA 4DV1B 3AY0A 5AVWA 5TE9A 2GHTA 2GYVA 3IP7A 3DL7A 1H3FA 5JSKA 1RM3A 3TQOA 4WFQA 5CCXA 2C9OA 4OHBA 4UAJA 3DOOA 1G55A 3NTUA 2QMUA 5JHGB 2R0QC 4IVNA 4PBSA 3KQQA 1V3VA 4OGFA 3LLUA 3LBFA 2ZT7A 5BOSA 3HB0A 3BQNB 5FUVA 3QYJA 2IZ6A 2XD9A 5BQPA 1AIPA 2P1RA 2P3QA 1ECBA 2AX3A 2YXNA 2H1VA 1D5CA 3D6AA 1GZSA 3KKOA 1KO1A 1OZGA 3AF1A 4YIKA 5KTKA 2P9FA 2Y93A 4DA8A 2Q5CA 4NMLA 5K8JB 2LZ0A 1J8VA 1WDKA 2QD3A 2X1VA 3FPHA 3PQEA 3LHFA 4L9SA 3OTOB 1GPKA 2I87A 3WJ2A 3H87A 3E9MA 4NICA 4P5EA 4HDNB 2OHOA 4TV8B 5CFZA 4ZALA 3NAZA 4EJMA 2VVTA 1XZLA 4X54A 1QH0A 2HF2A 4R1LA 3LX4A 4WOCA 1SOWA 2IXTA 1UDCA 5E7IA 1N5DA 2JHGA 3BSYA 2D2XA 2YHSA 3T7CA 3CPHA 3NV7A 1KYYA 3CY6A 2FUG1 1IHUA 4EHKA 1NE2A 2Q3LA 4FEGA 1JSZA 5EVCA 3K9LA 4RKWA 3I30X 1EHCA 1JPJA 1XKQA 4M8SA 3NVMB 1YQWA 1PI3A 1HUQA 3EY9A 3W5IA 5CMLA 5I7EA 1Z68A 4MV7A 3HZZA 4W5OA 1OC4A 2V7WA 2XCUA 3LD9A 4FKBA 3JATA 4L7VA 5D3QA 4ZICA 3ON5A 1N92A 4TQGA 1RBYA 1UUFA 4GS5A 4CM6A 2GN1A 4MKHA 4DLTA 3GJQA 1G8HA 2F1JA 5DMXA 2BT4A 2DFDA 2ZUEA 1GU0A 4GI1A 4ZMSA 2GCIA 1V47A 2FQQA 4CEHA 4OXYA 4ZAZA 3F7TA 3I5XA 2OSBA 4QLOA 4BVJA 3T0GA 2I2XB 1BCRA 3SZLA 1XTPA 3DZBA 2ZAYA 1KK2A 4QUGA 4Z2YA 2C7BA 2IPXA 2I7CA 2N75A 3CX7A 4ED9A 5EYPB 4B4UA 5CBKA 3E1KA 4ZZ0A 3PT5A 3ANMA 1E1LA 2ZVQX 3GCGA 4XX0A 2ID8A 3I32A 1H8EA 2K87A 3JAKA 1I2MA 2AHOA 1VG8A 2A1UA 3ZZTA 3UHAA 1QDLB 3AXTA 1XE3A 4B7UA 1ZCFA 4AU1A 4M2LA 3ODPA 1UANA 5FOQA 4PONA 2Z9BA 3N39C 3RUFA 1IVNA 2BJVA 4DCVA 2XXAA 2FHSA 4Q4JB 4CL8A 1EQUA 2L19A 3HBNA 4FHZA 4RTNA 4IIDA 3OZGA 4FQ7A 2PKEA 3I2KA 1XZ8A 1DC8A 3Q87B 4OJKA 2OD9A 3U26A 3O7MA 1Y7TA 5KOJA 1N5LA 2TS1A 1V6SA 2VJMA 3GFPA 1TDJA 3IELA 4CTJA 5C32A 1Z6QA 2MSEB 3FTNA 3I04M 4JDUA 1U0NA 2RB5A 1J0BA 2ZIVB 4HGZA 2Z6QA 2GO1A 3DYIA 1JXAA 3DCYA 4RXUA 4Y6OA 4CKWB 2PHZA 4A6XA 2H2GA 3HR4A 4DM4A 1AM4D 4LF8B 5B58T 1MMFB 4DCNA 3NI2A 4KV7A 1KJYA 3B20A 3CRNA 3K09C 3EPRA 1FP4B 3HO6A 3MJRA 3GRRA 2REOA 1TT7A 1U8AA 3GQBB 5L4LA 1B6GA 2CBZA 4Y2RA 3C5HA 4IOMA 5IW8A 2IJGX 3GMDA 4PSKA 1Z8DA 5I3CA 3ZJTA 2OHIA 1A95A 2K4MA 2EW1A 5IT0A 3L0PA 3E4DA 3BL5A 3ILYA 3VNBA 2BUCA 3RT9A 4CCYB 1KWGA 5EMJA 2AI1A 4NABA 1QHNA 1UOOA 3AKZA 4JX8A 1WUKS 2VDWB 2ZR0A 4OJTA 5P8WA 3VDQA 4CMBA 1R66A 3QIAA 3SPXA 1DQYA 1V8PA 4DY6A 1P2GA 4NNOA 4LJYA 3FSEA 5FL3A 3A1VA 3EQ9A 1A1SA 2EEPA 1NN3A 1C0EA 1O5OA 1GGKA 2EFJA 2PZKA 1MVNA 1VMDA 2AUNA 2Z83A 2Q3DA 3JR3A 4QHSA 3O9VA 4JI4B 3R6LA 2GK4A 4MZDA 1WHTB 1JZTA 3PEYA 2PAAA 2VLBA 1ZINA 2A57A 2PUBA 3AFMA 3QU5A 1A7AA 4H7DA 4C3VA 1EX7A 3OLQA 1RRMA 2VI5A 3EBPA 4QLBA 2BFFA 1A76A 2REXB 3QEMA 3EMKA 4KVAA 5AJHA 4AKSA 1I2BA 2D5IA 4A36A 3B1FA 1IQ0A 1IU9A 3LHSA 4XB6B 2AB0A 2NIPA 3BCSA 3KQWA 5KC9A 2B36A 2WSSD 1CDDA 2JI7A 3KHKA 4C0QC 2HXSA 4N3GA 3SF8A 5JS8A 3DF7A 4YRQA 1EVIA 1Z29A 3M82A 1ZWKA 2Y0BA 2YJTD 3P9KA 5JJ5A 3WSVA 1PIWA 1J4AA 2C1EA 3BRQA 4RK1A 2AI3A 3G7UA 1RPTA 4A73A 1V16B 4W5WA 5K8LA 3QJ5A 2W00A 3F3MA 2CNOA 4IJUA 1P1BA 4OGKA 4LOJA 4JYAB 2WF7A 4RGYA 2M6SA 5FXMA 1JIXA 1XDSA 3WNCA 2QVZX 3IEMA 1N6LA 5G1NA 4KWIA 4L3VA 3RYFA 3CW9A 4G4IA 5BV0A 1OWLA 2PBZA 3ABIA 2XHZA 2PPLA 3LUFA 3P9PA 3NT4A 4DE5A 1I0ZA 1XWWA 1BS2A 2FEMA 5CAEA 4ARSA 2I1VB 3BIJA 2JVJA 4I2NA 4RK6A 4AG3A 3DDOA 5EWMB 3J81A 3GROA 3AINA 3LDAA 1NVKA 4RVFA 4Z4CA 3GUVA 3M2TA 5JAUA 2RGRA 1S9DA 5LLSA 5DWVA 3NHSA 1SVOA 2Y76A 3NIFB 1SEPA 1D07A 4Y2PA 2WE7A 4CDRA 6REQB 1MQ8B 2NUTB 3FYDA 4XX0B 1TECE 3SDZA 5DNCA 1HFJA 4OPMA 5LVAA 1VMKA 2EBHX 3GLQA 3ITKA 3NCHA 4X6XA 3UA3A 2BD0A 2H4YA 2QVBA 5FJJA 3V8NA 1H1TA 3BB3A 1U0OC 3OAAD 3I1IA 1NDUA 4BVHA 3T7IA 1EFRA 1IG3A 1YRAA 3RYHB 1V1JA 2Q49A 4B79A 2P5SA 4ENSA 1FU7A 5JADA 4FGLA 2ZJ0A 1DO8A 1S2OA 4X24A 3EGDA 5BV7A 5KUTA 4RS3A 2YWEA 1G63A 3ANLA 1Y37A 1KK3A 3D8UA 5K0CA 4G26A 2P8SA 2Z0MA 1E62A 2O0LA 3BTVA 3PCXA 1WB5A 1YOVA 2G5GX 4JLKA 4C0SA 5C4IA 1P7VA 4X1OA 2DUNA 3AF2A 4QGFA 4NPCA 1A8HA 3MVEA 3K2BA 1ZJZA 4MGKR 4OH1A 2UZ3A 3WYFA 5B2EA 1CRPA 1W2WB 3OPXA 2JAOA 4BFTA 3OIYA 2AGVA 1E2QA 4Q3NA 2ATIA 3UJBA 4KPEC 2BGMA 2BM0A 4J43A 3OFJA 3GFVA 4QYWA 3GLFA 1I14A 1O0BA 4MJLA 4WN3A 2VO1A 3FNGA 3T3MB 3U0VA 4CMIB 3IE1A 3CVVA 5ECYA 2C78A 2FLVA 2JBAB 3UKJA 3A6PC 4CR6A 3T0IA 2D8MA 1L3CA 3M5WA 4WD3A 3T0FA 3TNLA 4EVIA 2G1AA 3LXMA 1OT3A 1JF8A 3HPRA 4G0XA 4Q9NA 1K6JA 5CEFA 621PA 2YFHA 2P91A 1EU1A 2EVWX 5LXTB 1BWRA 2J9ZB 2WTEA 3ZNPA 2D6FA 3I2GA 3K0CC 4Y6SA 4JI5B 5E9JA 3DMYA 1KO8A 5I7FA 2O2JA 4GLOA 4OM8A 2ZBDA 1YJAA 3O2SB 4AIIA 4L08A 3RYCB 1UJMA 1RKQA 1F0NA 1QB7A 2E18A 3EXHC 3GBPA 1C7JA 2D1RA 4FD3A 4H7IA 5B1IA 3TUJC 2VRCA 4QT4A 3D4NA 1QIEA 2H4ZA 2QRJA 3I6MA 1SELA 4P58A 2CFRA 4QTXA 4X8LA 5ERXA 5EZQA 3OWHA 4XOUA 4RKFA 1E3IA 3UB2A 4L5BA 3B1YA 5C8YF 1NX9A 1JDVA 1EFVB 4O5OA 2O8NA 3ZXSA 4B6EA 4X8HA 3A6FA 5AW4A 3ICEA 3FCEA 4AMBA 2GT1A 4I3FA 4OBEA 4DGQA 4PN3A 4R9UC 1VIAA 3TRDA 2VF8A 2WV7A 2Q28A 4BE9A 1O6GA 2ZSEA 4F7WA 1T2NA 1X1AA 4DWWA 3FCXA 4HGOA 3RVMA 2YTZA 3HZOA 3LGAA 3RU3A 4FE4A 2JJ2A 4FHFA 3G2MA 3G2IA 3HUDA 4E51A 4V38A 2YY7A 3A26A 1TKRA 3KB2A 3D31A 1O95A 4N47A 5J47A 1ZDMA 1KU0A 3O91A 4HT3B 3TX2A 2O8EA 1SM4A 5FFNA 1GWNA 4L0DA 4A4DA 3FOWA 1FUKA 1YB2A 4NNJA 2GPTA 1FNMA 1W8IA 2AXNA 1ZU4A 5TEWA 2QR5A 5LCXA 1AH2A 2G28A 4W5QA 1GPYA 3KQUA 3LX6A 3SSMA 4WY8A 2H92A 2WUVA 3KJZA 4PNZA 1R6TA 2C84A 5EHXA 4EZIA 4B3RB 5L3QA 1I13A 1XNHA 2W37A 1K4KA 3PE3A 3IEIA 5JWRA 3L49A 4RLQA 1T3LA 2ZB8A 4LYAA 4D3DA 1OBOA 4I1YA 4ARBA 4X94A 3FDIA 1CNMA 5DXAA 4V0RA 4ZYWA 5CITA 4Z4FA 3HCOA 1OVMA 3CZCA 2WM3A 2Q6IA 2VDRB 3ID6C 3L8FA 5FORA 1TTPB 1I4LD 4MQ5A 1BYUA 1OBHA 1EBUA 3PGXA 2GK7A 5EJAA 4DY4A 2X0DA 1WUJS 5EKSA 3W2HA 2CC2A 3P0FA 4X91A 4FGJA 4OV6B 1YBVA 3TGPA 4CXMA 5DSXA 3ZK8A 5BWNA 3CKMA 2R68A 1X7HA 2HQSA 1N7HA 3ET5A 4XDHA 2C29D 1J5PA 4MS1A 4OXQA 1LI4A 2NZVG 3R9KA 4ZOLF 1E2JA 1OB2A 1JILA 3AJ8A 4CL0A 4PIPA 1UKBA 1G42A 1UC9A 4H7FA 3IQHX 1IXKA 5LP6C 4LXTA 4B3FX 1RVDA 5AW8A 5L6LB 3HXOA 1RMQA 3QX9A 5FO0A 5FNVB 1K88A 3O73A 3SWWA 3EZLA 3QPVA 1HC7A 1FPMA 1ZW1A 1II9A 1P5JA 2WLTA 3ED5A 4PG5A 3A4LA 5KDLA 2X8BA 1Q1QA 2KS6A 2JHAA 1M7GA 2FFAA 3OY7A 4RVUA 4RMIA 5EAIA 3J7AC 2A33A 4G5RA 5CLIA 3ZGZA 1CDEA 2Z57A 3IT0A 4QSMA 4OQNA 3B6ZA 4ZXPA 1N3YA 4BJ5A 4J0JA 3VPXA 1Y3HA 2OHXA 3N5CA 3AVQA 4H7JA 4JLOA 4K2HA 1A69A 4AQDA 4XEUA 1IAQA 3KUUA 1D8AA 2W22A 3A7EA 5JPIA 1CUUA 3OE5A 2VNHA 2WWXA 3ZNQA 1A8IA 2ANCA 2YXDA 3PE6A 4XYLA 1L4UA 2WNIA 5JYCA 4YRRA 5DYGA 2PVSA 1E2PA 3LSYA 1Q1BA 2K2WA 1H69A 3FXAA 5HGJA 4D25A 1GFWA 4HFNA 2G06A 4MIKA 3OZCA 3I8OA 3JV7A 3PE4A 4KI0A 2LWIA 2IOFA 3PVZA 1EFKA 1NKTA 1W46A 3CW2A 4QYTA 3VBEA 4CKEA 1K86A 1U63A 2HXYA 4HR7A 2Q2QA 3DFKA 4G5OA 2FP3A 1GNVA 2JGJA 3U3KA 5C52B 2ZB7A 1ZH0A 5AM5A 3V3TA 1WHSA 5GIOE 1XYVA 1HE5A 4ACBA 1MEJA 1Z2PX 3DWEX 2JI6A 3KFLA 2W6QA 2Y0CA 3NVAA 3LCCA 2PX5A 4UNNA 8AT1A 4KO3S 3VM6A 1A72A 2YZKA 2FMFA 1NI3A 2QTTA 5J1SB 2Y4OA 4GUAA 3I6QA 4GZMA 4CEJA 1CKEA 2YINC 1DEAA 4G36A 4WOJA 2PZAA 3A7DA 4I36A 3WVNA 3TQTA 3AUKA 4Y6RA 3ZV5A 4B46A 1FX0B 3PJDA 2ZIWB 4FYHA 5A06A 1WAMA 1P4HA 2PWYA 2QD4A 5FQOA 3TTXA 4PC3A 2QNBA 5CFLA 3GOQA 4I0WB 4EMSA 3DLAA 4ER5A 3R0ZA 4Q05A 1KBZA 5CVDA 3NX4A 3T7EA 1ISHA 2ODPA 3WS7A 4GKAA 3ZBUA 1DBWA 2ERXA 3ONEA 3Q3VA 1MP0A 4I08A 3UVEA 2OKGA 4GBJA 3L7AA 1MO3A 4LZJA 4JK3A 4KX5A 4CL2A 2C7RA 3R09A 4QBFA 5LL6P 5CFQA 2H1IA 4BO3A 1QK3A 4MV6A 4AQ7A 3NS7A 3SC6A 1PJ3A 1H5UA 3NALA 1ECPA 4NARA 3CB4A 4G5HA 3PCTA 4ZREA 5TJHA 4E11A 2VQFB 4P84A 5EFZA 2ZSJA 4O3MA 5AXBA 2BJWA 3B6KA 4EUEA 4U7DA 4BRWA 2PV0A 1K08A 4IQ4A 1IBCA 4DV2B 2YC4C 3QBTA 1ODLA 10MHA 4EG5A 2ZBPA 1EDZA 4DBLC 2R00A 1A9RA 3HYTA 3MJVA 2VAXA 2GHRA 1YR1A 2XQKA 1DJQA 5ECGC 4DXDA 1CY6A 2QUHA 2B78A 1WUTA 3BZBA 1P1JA 3DHEA 4BMYA 3I09A 4GC9A 4XYBA 2RGAA 3T9AA 2WHPB 3WGUA 2QP3A 5T64A 5JYEA 5K0SA 5FV4A 3VTZA 4RADA 1XX6A 4M0DA 4OL9A 2ZI9A 3VU8A 3L7MA 1PGQA 1VLVA 3ICPA 5BPHA 2AQKA 2E89A 2IPOA 3GAZA 1VSVA 1H6BA 3FGPA 4LZWA 3FPAA 2WYUA 5HKOA 1QYRA 2GN9A 4CF5A 5CT8A 4B8YA 1M6VB 1FDWA 2DERA 1ZC3A 2ORED 2WSIA 1GU7A 3QVGA 4KLZA 2XUAA 2O2SA 1KSGA 3Q85A 3WTCA 2QU8A 3Q7QA 4MRMB 2H18A 1QIKA 1XJQA 5E7QA 4OGWA 2JD2A 2JF0A 3QITA 4AECA 1OLSB 3VPGA 2OO5C 2DCMA 2CYCA 5M3BA 4GG1A 1JLKA 2W8BA 1QX4A 2V4MA 2Y1OA 4IILA 4R1NA 4RUKA 1U8FO 4V0LA 3SOZA 2CXPA 4BKOA 3E81A 2WTBA 3DBLA 1MCZA 1PUJA 3IUEA 4PGGA 3S1SA 2ODWA 5FEUA 4Z0PA 1USIA 3W5BA 4I1PA 1UM8A 3HDYA 2OUKA 2JRCA 4P31A 4BKQA 5HFNA 4HWOA 1M1NB 1DWPA 1N6IA 2PGLA 4BIMA 4M38A 1C7IA 2H4HA 3RSGA 4DEVA 1YOVB 4IEFB 1A4XA 4BNIA 5DLYA 2A9OA 2HQ1A 3FROA 3HVHA 3A1CA 1VMIA 3MJEA 4JT9A 3T3EA 3WLSA 1R7RA 4JLMA 3CPEA 2AOUB 4QOGA 3DC7A 4IAOA 5FTJA 3VDXA 2NV0A 4KE6A 4RLSA 1A50B 2EYUA 2LVBA 3W79A 1JLRA 1E99A 3E3LA 2GAJA 2XYQA 1KF0A 1P44A 3EISA 3IMKA 3PU6A 4ZT3A 3IKLA 5GZ1A 4P1ZA 1W59A 1IK4A 1T4CB 1DC5A 3VKFA 4EG3A 1KY5A 2JBHA 3KUCA 2BFOA 3DB1A 1KTVA 2PG3A 4CUKA 4RVNA 4KFUA 3HM2A 5MHTA 2Q3BA 2PUFA 5TGZA 4X45A 2XW6A 5A05A 4R98A 1PR3A 1VHQA 2J85A 4ZV7A 1PK7A 3NDBB 4ZARA 1M8JA 4DB4A 3MLEA 3RJTA 1RZRD 5JCOA 4DNPA 1DJPA 3FF4A 3I9KA 2OFOA 1QZ3A 3OZSA 4UU8A 1VL5A 1G2PA 3BULA 1A2BA 5ALYA 4LV6A 3EIHA 3W2IA 2B37A 4TMZA 4BHTA 1YZYA 1AZTA 3NQ41 2QSYA 2ARKA 1T26A 2VK4A 1IZ9A 1QCZA 3O47A 3GF4A 4GOLD 4ARZA 2NPFA 3OE4A 1OLOA 1VZ3A 4WPGA 3NBFA 3K9WA 1U1EA 2QK4A 1J2JA 2YCBA 4KHZA 2XKBA 4KPUA 4UBNA 4XX1A 3VDRA 5I01A 1L5VA 1LJUA 4CMAA 3V4PB 1YF3A 4Y9RA 4WCFA 3WBFA 2JFBA 2J4DA 4IJQA 3ZNNA 3M9XA 4KQWA 1EFVA 1HDXA 4LDPA 3U9SA 2QGFA 4AP5A 1X7XA 1JX6A 3WBBA 1LTKA 3HB9A 2X2FA 4Z8YA 4E12A 2X6QA 3FKJA 1ZL0A 3R7LA 3WHIA 1DRVA 5ERYA 4BXOA 2QX8A 3VR4A 5GM1A 1MD9A 4D74A 4A8JA 4ER0A 4YJ2F 1PP4A 1DEOA 4K6MA 3EQZA 1YZUA 1J7JA 2YXEA 2ZYGA 4E6PA 5BVHA 1MC4A 2GA8A 1AC5A 4TWJA 1GNTA 5EZYB 4C76A 3SP1A 3IR5A 2ZYVX 2N47A 2VL7A 4NRDA 4QBTA 2V7TA 1F20A 3SC4A 4MTLA 4PQYA 3FTCA 2QN2A 3ND9A 4CQLA 2C5SA 4DA4A 1IQUA 2XWBF 3LRXA 2LPMA 3WV5A 3E9YA 3CCBA 3L5KA 1PEDA 1FQWA 1BFUA 3U60B 1JEQA 2C8LA 2HDOA 3CUVA 4NFSA 2VF4X 1Y82A 2R6FA 4MA5A 3VTFA 3OT5A 1XDBA 5HIAA 4GVPA 2AHRA 2UVPB 3V00A 1QYDA 1UDWA 3OLWA 1M8GA 1ST2A 3BJRA 3W2TA 1YASA 1YQEA 1H22A 4IZOA 1CEYA 1UMDA 1RYHA 3BM5A 3DEJA 5KEIA 3UBTA 1CVRA 1LTQA 4JJ8A 3K70D 2P9ZA 1QR6A 5CU7A 1JG1A 3F0TA 5KJ6A 5LYJF 4Y2TA 4F9GA 2VSFA 1PR0A 1VP3A 4YQZA 4PQRA 1UIMA 2VAVA 5E95A 2P5UA 2A35A 4DKXA 2AA3A 3S5UA 1Z08A 2YRWA 3N2NA 4N54A 4DYVA 1Q5PA 2ACVA 2IELA 2G80A 2PT9A 4RULA 1GQSA 1H1DA 1JDPA 4HYTA 4UNRA 3WL5A 1BD3A 2CWDA 1XZCA 1SUSA 2MMGA 4PXAA 1HX7A 2BTQA 2QGNA 1IZ8A 2AN1A 2QTVA 1K7XB 3QV1A 2CJFA 2WMDA 3OZ7A 4QHTA 1BQEA 2B1QA 2FEKA 3EBLA 3FD8A 2B2NA 3Q3CA 2A94A 1J0AA 2Q5QA 4MUEA 1B0ZA 3P0IA 5AM0A 2XEXA 3UTDA 5IT9A 1QAQA 1YACA 3HC7A 3M5PA 2Z43A 2EKBA 5BYJA 2X6RA 4RC9A 4BMCA 4YBZA 2VPTA 1EX1A 3S28A 2ZW9A 1IHPA 2C2HA 4RPLA 3GVIA 4ZTZB 2FKAA 2ZE7A 3ASUA 3P0JA 3EVEA 4CU5A 4BEWA 4AWAA 5DCUA 4DV0B 3ZYZA 1DT5A 4G23A 3O1LA 4HH4A 4JP5A 4W1QA 4Z4QA 1JIKA 4WLOA 3SQOA 1O57A 5DTJA 4LXXA 1HF3A 3DMFA 1G291 3DW1X 2JCGA 2MYPA 3G1UA 4NBSA 2P9JA 1D4AA 3WXMA 4JJFA 4BQOA 3IXMA 1ZUD1 2CNWD 2H16A 1EESA 1NJ6A 4LDZA 1V26A 3RB8A 1MRNA 3CVOA 4NYMR 1EDEA 4UCQA 3WK7A 4MVJM 1RAIA 3VZBA 5I9BA 2ZKIA 4UXJA 2VZLA 2FWRA 5ES3A 1F8GA 4JUBA 4E5KA 4R6WA 3OE7A 4HAWA 1GARA 1HKHA 2W2KB 4WUTA 3STWA 3ZI7A 1LVGA 2W58A 3TYXA 1ADFA 2BPOA 2PSDA 2BDUA 2EL9A 4ASUD 1W4RA 2R1ZA 2RKOA 2WMOB 5CX1B 5LLDA 5FI1B 1A0OA 2VK8A 1TUBA 2CXSA 3W9UA 1KFJB 4NCNA 3RWBA 3ZJYA 1PQUA 3T5DA 1XTZA 4ZYYA 1L5YA 4M8IA 3ZGYA 3FNFA 1Q91A 4RTMA 5KVSA 1WVIA 2QXUA 3G7NA 2V5VA 3WLFA 1W85B 2HT1A 3U61B 2VXCA 3OEHD 4I1SA 4Q03A 5J5VA 1KDPA 4EFMA 1PDWA 1NY6A 1I3KA 1UFOA 1ZJJA 2I6XA 3I6BA 2M32A 4J3JA 4R84A 3GVHA 4MUGA 1U8ZA 4M55A 2PFGA 3QPUA 4R40A 2G4VA 2Z9CA 1ODKA 2GCOA 3LX5A 3OA2A 3AMVA 4BNDB 3LPMA 1X19A 1GCAA 4CETA 1BSVA 3MSXA 2FWPA 4PLGA 4TV8F 3DE5X 4X1KA 1XI2A 1NYTA 1TJ4A 3ZGLA 1XJ5A 3RS5A 4X3CA 4MQ4A 3QU9A 3WRXC 1G2OA 3O2JA 5BR4A 4DWVA 2XVMA 2GRUA 1ADYA 1I2ZA 4P6VF 2CNLA 3MWLA 4XR4A 5LBTA 5JFTA 3WMXA 3SQDA 1B0UA 3R7FA 1PJ2A 1NI4B 2CDBA 2Q5EA 2H5JA 2CL6X 3EBOA 3ORRA 5AK5A 5G40A 4DUZB 4FT2A 1NVFA 4ESEA 3A1UA 2VHCA 5IYZB 2ONJA 3PDIA 1HMYA 4RGBA 3RS4A 3QUCA 2NZYA 5FOVA 3UA4A 4WECA 2B8EA 4XRRA 1UDRA 3N0VA 3NT2A 4HNUA 4LF6B 1B8VA 3I8SA 4GGPA 1L7VC 2XIQA 3TOCA 1A5BB 4GLFA 2CHVA 3IA2A 5IJAA 1KE1A 2Q4DA 1S02A 1EAYA 1P6XA 1SC3A 1I7NA 1U0HC 3EOBI 4HK4A 1PZHA 2PWZA 3EA5A 3UMYA 2FJPA 4KLNA 4KPFC 5AVYA 4EA7A 1NRXA 3V8BA 2O9JA 1RYDA 3MWEA 1CP3A 1CZUA 2GETA 4J8PA 4JASB 5AWFC 1J21A 2NVUB 3NTQA 2AIRA 5COQA 4CUJA 4EYGA 5LKAA 1YMVA 2XB8A 2V6FA 4YXWD 2RH4A 5FQNA 3ET4A 4RA9B 3WGQA 3TD6A 3SC3A 1DDOA 1SH7A 5IKEA 3RU7A 4OP2A 4PYNA 4ZVKA 2ZUTA 4NESA 1FTSA 5DNAA 4EFKA 3D4BA 1CQJB 2HU7A 4RHTA 4M22A 1R4NA 3EODA 4DQ0A 3QOWA 4LMAA 2BC9A 4MS3A 3Q8XB 4X1YA 4KNYA 3LC2O 2CVHA 1TYZA 1X7WA 4LNUA 3ABQB 5JO9A 2IHVA 1VL2A 3C3BA 1TL7C 3EZXA 4QOIA 2EATA 1AZLA 1TC2A 3L7JA 4O63O 1DZ3A 1W5FA 4EWLA 1R8JA 3EVFA 4MKZA 4MCHA 2GILA 3AH8A 2JGIA 2RARA 5D85A 2PA0A 4FWBA 2W5UA 1UBOS 3JAKB 5EQFA 4BNFA 3PGJA 4J0QA 2VZ0A 4BTLA 1SXGA 1UZLA 3LQQA 1P3JA 4BX2A 3F3KA 4HWPA 2NOAA 1YRHA 4IZHA 5C0OE 5IVPA 1LD3A 1D5WA 1NZDA 2RAVA 2QI9C 2O7QA 4CZ2A 4HHEA 4MRRA 2C61A 2J0UB 2ASEA 1CJMA 121PA 2QW1A 1J97A 2J0UA 1B93A 4H3KB 4D3FA 3ZLUA 4AYTA 2WSBA 1PL8A 2HD4A 3MJSA 3CNLA 3KQOA 1XPRA 1ZJWA 5EL0A 3C74A 4US0R 4EP1A 3O4FA 2F1KA 3E9RA 3SLKA 2IIPA 2DLCX 3B8EA 5F1YA 1X1QA 1M33A 3K15A 2V7BA 4RH3A 1H2RS 4EG6A 3V4VB 4M49A 1JKMA 3E84A 2OILA 4X20A 1BVYF 3B1WA 2R8BA 4TYNA 5LMCA 2MSKA 3OE7D 2OZVA 2CJWB 3MWKA 4KN5A 4D9FA 4W7HA 1L8QA 1ZEMA 3G79A 4FINA 4OSEA 4NQRA 2IYWA 4OI0A 1FYFA 1R0BA 2H57A 3LDHA 5AKJA 5DKFA 5EUMA 2O19A 3DV9A 4B6JA 1GADO 3B8HA 4Z51A 1I30A 1R88A 1YGYA 3IMEA 4NU8X 3H4TA 3KSRA 5EXXA 3AETB 2X9VA 4C78A 2IV7A 3CLUC 4LE0A 4P4UA 5KDOA 1TKAA 3TCKA 2XBLA 1XP8A 2J6IA 4M1OA 3TTTA 3O92A 4AL4A 2H7YA 4BO0A 3ZY3A 2CSUA 2QYOA 1OUMA 4QO7A 1IRIA 2FSVA 1O4WA 3FNBA 3WB0A 4D5GA 4CG3A 2GESA 1JIUA 1U2RA 3JQAA 2CHEA 5IM5A 5CD1A 1G5HA 1JHVA 5EE5B 4B35A 5HKAA 3BCHA 4LV5B 1P7CA 4PO9A 2IEBA 3PJRA 4CKXA 2GWHA 4U2BA 2WFAA 3PC6A 4QPDA 2X0JA 2VPWA 4Z9AA 4CKYA 3K96A 3MJFA 5EPEA 1TK3A 3NWEA 1G7RA 1OI2A 2VUTA 1GIAA 3OFVA 3QKUA 2QTRA 4HF7A 1UZMA 1YKFA 3DKRA 3OSZA 4IICA 4HQNA 4Q48A 1FP2A 4XKJA 3DBHA 1KDYA 1C7EA 2CDNA 3H7AA 2B5WA 3Q3JB 4QUEA 3TW8B 1Q6YA 1R1DA 1LW6E 1IXYA 2G1PA 2RHTA 4CQJA 2AXEA 1IN8A 4AWXA 4IJ6A 4BNYA 4MDEA 1DBPA 2VK2A 2YICA 1MB9A 2YWGA 5CW2A 1AO3A 1Q0ZA 1TQ8A 2NO6A 2OHHA 1E2NA 2VZ9A 4MLZA 4YDHB 7ABPA 2BMAA 3USES 2BZ0A 1JA9A 1K4YA 1MJHA 2REBA 3PIRA 3ZV6A 1L5SA 4TLAA 1P45A 5J58A 4ND6A 1VKHA 3NIWA 3W4JA 2IC5A 5EKTA 1X9IA 2UZIR 3K4PA 4JCCA 2G77B 4A0GA 4YDQA 4D9HA 3QSYA 1NAIA 1RRGA 3QVOA 4OI1A 1YFZA 3UHJA 3NM4A 3EDOA 3GZ4A 1RPNA 5DNEA 4DEYA 4F3CA 1JWLA 4PO8A 3X0DA 4D9NA 4EPTA 2YMLA 3GEDA 5T4BA 2CE7A 5DU2A 3IDSA 4OFWA 1J20A 3RKSA 4B09A 3VNAA 4AP9A 3BORA 3D2BA 1DSSG 4XD2A 1S7GA 5B3JA 1DQNA 4TKUB 4D9JA 5G2OA 4KIFA 5KTRA 5HQTA 2W9XA 1YU9A 3OJOA 4YJKA 5F4BA 4LRYA 4B4OA 4DR5B 3KPJA 4JEUA 3B82A 1C9DB 1ODFA 3WA6A 1UZNA 2J9XB 4JHXA 1YDMA 2N3ZA 4ZO4A 5A7GA 1UWCA 1ISJA 1FNSA 3OU6A 1OWPA 2FVXA 1F1BA 3DUFA 2X4DA 4YXWA 1CQWA 3A05A 3MLBA 4U2DA 1TYEB 1IVSA 3OIFA 4IR7A 3OQVA 3V5NA 1VI5A 1VHWA 4C4PA 4Q15A 1ISIA 1SC6A 2NTNA 2DJIA 2PNJA 3TRFA 1OV6A 1DV1A 2AW3A 3BWDD 3CH4B 2XT9A 3R4VA 3SIRA 2JIBA 3UK1A 4S05A 4RTKA 1GD1O 1XTQA 3C5EA 3EIWA 1IQRA 4L6CA 3WAKA 4JYBA 1YFLA 3SXUA 1THGA 5BSWA 4KRYA 2B3TA 2VCHA 1TYDE 2ZE8A 3MJHA 2GBPA 1P8JA 5LPNA 2YQ5A 3M6LA 2GCPA 5MDHA 3SIXA 2E4WA 5B4UA 4PZZA 4K6GA 1IEQA 4CM1A 1OFUX 2I8LA 1U7HA 3ADPA 4QG7A 1LX7A 2FPMA 1K2VN 4OLHA 1U0FA 3SQNA 2WWWA 4EABA 4JB8A 1VCHA 2K7ZA 2R5FA 2XODA 3D6FA 5A7HA 1GPJA 5T3YA 2VQ3A 2BKAA 3ZY5A 3E1SA 1RTKA 5CT9A 1BU5A 5DISB 5B58C 5KYUB 2P9HA 1UOQA 1AKEA 2II6A 1UPXA 3C0KA 3HYLA 4JJKA 4W7SA 1PJCA 2PD3A 2YCLA 4V1CA 2C7VA 3OZAA 1ZOOA 1PK9A 5KTYA 1F2TB 3BCUA 5DEIA 4OLAA 1T6YA 3U31A 4E1VA 3ST7A 2X13A 2GZ3A 1MAWA 2BGNA 2VJOA 1QPBA 1KI8A 1KKLA 3WNBA 4ALIA 4FX5A 5BRJA 2IEYA 1F3LA 2VRCD 3W0LB 1N8SA 1JBEA 5C2JB 2DBZA 1KAHA 2IP4A 1JEOA 3KL4A 1EPUA 3EGCA 2PMBA 1N5IA 2O5RA 5EY5B 5H9WA 4ARUA 1GHTA 1TQ6A 3EDQA 5JOQA 2IW3A 2CLFB 1E89A 3OO0A 3A4VA 4MA4A 1QF7A 3ZWQA 3D6JA 5IM4A 4FS8A 2XJ9A 3RGGA 3SZGA 3ULKA 2HSGA 4M83A 3LQYA 4BATA 3J7TA 5KOHB 1QB8A 4B84A 5LMUB 1ENPA 5ALKA 1X9HA 4UDOA 2JGLA 5TB5A 2F3UA 4ZHSA 1EA5A 2ODNA 1Q1AA 1V5WA 2W0SA 3S2SA 1YZLA 1A7JA 1ORTA 4LBYA 5DXFA 3WLHA 1AE1A 4HQRA 2J09A 5CCEA 5MN6A 3SJBA 3HRIA 4H59A 3GLFE 5HIJA 1ZQ9A 1QE3A 4A7PA 1JMVA 1NV9A 4QGHA 5GP1A 4OXNA 3LUGA 2F1HA 1E8DA 3IS3A 3O3CA 4CG1A 1JDBB 3FVRA 1ZH2A 3GLVA 3WK6A 4UHHA 5FTKA 3RFUA 4AF6A 1G5RA 3BGSA 4GP7A 1KL7A 4QUAA 3WK8A 4DILA 1I5EA 3W1WA 2ZJ5A 1SU7A 3W7BA 2C4WA 2QG9A 1BEUB 2GJ4A 4J0CA 1WP4A 5ALXA 4HP8A 2GZDA 1VFPA 4RF2A 2XNHA 1JHMA 2CYAA 2PMCA 3H9JA 3LJKA 3R20A 4MRPA 1J6UA 2XTZA 3O8QB 2ZTMA 1P62B 3W5SA 4R3NA 1ZYUA 4O2AA 1LKZA 4FHEA 3QKSB 4P5PA 1OW3B 3GNLA 4YC7A 2IF2A 3QKIA 3U4AA 2VDMB 4YAUA 3SVTA 3T7RA 3ZKWB 3QLVA 2B4YA 3FFAA 2H65A 3QA9A 1RZUA 3MBKA 1B26A 3VFDA 4NH4A 4IHJF 4HDNA 1QMGA 3RABA 2WEKA 1WCIB 4GMFA 1LDGA 2OORA 4BO1A 5TV2A 3OPYA 4B9AA 3DE2X 1A3CA 5DJ5A 2VF5X 2DT8A 2OO3A 3DFIA 5KREA 3K5PA 3LPLA 3NHJA 4U63A 1T9KA 5LP6F 2Q9AA 4B40A 1XXHB 5J5CA 3VNSA 4BKRA 2JIMA 5A5GA 4MYHA 5DW3A 5T6BA 1X7WB 2A5GA 3D8TA 4LNUB 1Z0FA 4GICA 3M1YA 3NORA 2AKEA 3KJEA 4M6WA 4LXYA 1G7TA 1NONA 2ZITA 1Z2NX 2BZSA 1NF9A 4URZR 4GMGA 1UBMS 1LI7A 4D9BA 4WNCA 1TU3A 1UKCA 3I5UA 3PGVA 2D06A 2ZI7A 1TT5A 3QLTA 4MRSA 1QXSA 4D3YA 5CB8A 1WZ2A 3MB8A 2H1CA 4TGLA 4AJNA 1K5PA 4RY8A 3PGA1 2Q4EA 5L95A 3GD7A 4X62B 4L8GA 4K9DA 5F33A 5K4HA 5IM4F 2A1UB 4F72A 1K97A 5J2TF 5E4JA 1H4SA 3OZBA 4IJWA 2LDBA 4G5GA 1KQ3A 2XWJI 3UK0A 3DDZX 1VMAA 3SI7A 3ABZA 1K6IA 3JAWA 4FZ5A 5BURA 1XXHE 1CETA 1P7YA 3FRHA 4XUDA 2VDVE 4ENTA 4NZZA 4H77A 3WYCA 2VYFA 4BVKA 1Z83A 3H05A 3BQMB 1CUIA 1Q2XA 2OMEA 3PQFA 4KMOA 2ZIUB 3R3SA 4GMDA 1EHIA 3KDAA 2PSJA 5MGBA 1PF7E 4MUBA 3WB2A 4XWKA 3DMGA 2QMHA 1PTJA 3JXEA 4AKGA 4UHKA 3G1TA 2FOIA 2VR1A 2F59A 3TFWA 1FJGB 1PJRA 4OU5A 3G6WA 5FFMA 4UE6A 1CYDA 4GSYA 4LSWA 5LDHA 2B94A 1H5QA 4XGKA 4KOAA 4ENQA 2GKOA 4Z99A 1Z2DA 1EG7A 1QHEA 1YQQA 1NNSA 4N5DA 5D8DA 4TYQA 1TF2A 2B8NA 2KSQA 5AVRA 3TQFA 1Q83A 5FBHA 4EVQA 2ISCA 3RRFA 1BG6A 1AQYA 1BWSA 1AZWA 1QVAA 3GEBA 4IMPA 1LSOA 1DAKA 4MLCA 3KQKA 3T7SA 1FUEA 2HWXA 1L5KA 3TFOA 4LQDA 4P4SB 1CWUA 1X7YA 1V1RB 4PZEA 3Q88A 4Y1RA 5GPBA 2CK3D 1TQ4A 2AEEA 1WLSA 3M1IA 4HX5A 3K70C 2BSXA 3WNVA 1DU4A 3IVXA 3O8OA 3Q7RA 4EKNB 3KPUA 4GDMA 4RHYA 3TAUA 4C3ZA 2ODQA 4DCCA 3U62A 4OHMA 3N8GA 1TGVA 2G70A 2GN2A 3NEJA 3FHTA 4UNQA 3GZTB 4F1KA 2RHLA 1WCXA 1WSWA 4WA8A 4FT4A 1RM4A 3I23A 5FJIA 3L43A 3CTMA 3W6PA 3KXPA 3QP9A 4XVHA 2GYUA 1SA0A 5CP8A 3AOGA 1GDDA 1PJSA 5EKDA 1YL5A 3IVAA 3TI7A 1DL5A 5DO9A 2RONA 1JAHA 1P3DA 3ND8A 4M1KA 1YDFA 3TQCA 5C8YA 2NO4A 2R7KA 2H0RA 4L9WA 4E2YA 4ER7A 2X6TA 3USCS 1Z6TA 2D3WA 4QLAA 4YGYA 3CE6A 3AWDA 4EF5A 2VLIA 5AOVA 1X1BA 3U1TA 3PR1A 2HWYA 4JI8B 3ES9A 3QHAA 2O8BA 4EUFA 2ZM5A 1Z16A 1DQRA 1U65A 5FBQB 1PEKE 2WP8J 5BV8A 2QJTA 1X80A 4TT3D 4OOFA 2HK7A 4ZHQB 4WT7A 4JBLA 3SMQA 4D97A 2OG2A 5A9RA 5JAIA 1LPOA 5FA6A 4BB9A 3WLNA 1U9IC 3PUKA 3RTCA 2IBMA 3ISJA 4TT8A 4NMWA 3RUCA 3K20A 3PFFA 1ZUIA 3O0TA 3VZSA 5K8CA 4QUKA 1O2DA 2XGMA 3N9IA 1UBLS 3FYUC 3ZDYB 5EIFA 2YUIA 3H6GA 4J94A 5THQA 5A2GA 2EFGA 2GXSA 4N41A 1N6OA 1GZVA 3PTZA 1PT7A 4MR7A 2ZXEA 4YWHA 3JYLA 1DADA 5FAXA 4DZRA 2B1IA 3GDWA 1PDVA 1UP7A 1YHZA 5F7XA 2ZXUA 3IJ5A 1W35A 1SCQA 2HIAA 3MRVA 1L7RA 2EU8A 5TVKA 4G0PA 4QOHA 4ANFA 2FN4A 4NYJR 2IYOA 4DOMA 1UKEA 3PWKA 4H0CA 1DC3A 1SU6A 3STTA 5K3EA 1V11A 1VI2A 1N9GB 2X3YA 2XNJA 5J1TB 3HYNA 4TYWA 2IYQA 2ABWA 3LDGA 2ONKA 1IN7A 1ZRNA 2B9EA 3KZXA 2YIDA 2DLDA 1C30A 1QO0D 4GBED 1KZYC 4NCIA 4PQEA 4IGAA 3P20A 4JYMA 4AZVA 4B83A 1GM5A 2OFPA 4KAFA 1M0WA 3V8PA 4DBVO 3BXEA 1ES9A 2O06A 1ENZA 1E63A 2X22A 5DYNA 5KNDD 1H66A 1KSJA 1O97C 2QE7A 3MZ0A 1A9SA 3C7TA 1CLEA 1TFUA 5ED0A 2VHVA 4RWZA 2I54A 3KKMA 1IG0A 3B3GA 1IHXA 1JW9B 2Z4RA 4JI2B 1N4DA 3A1SA 4MJ7A 2I03A 4M1WA 4PS0A 1F4LA 4X00A 1GSIA 4BC1A 4OFBA 4M0FA 1E9RA 4HWTA 1ENYA 1K2WA 1Q0UA 1T29A 2AMVA 2GF9A 2KLBA 1HL7A 3K5IA 5CTJA 2D1SA 1E18A 4M88A 3EZ6A 4M36A 3M70A 4WESA 1SNYA 1GPUA 2RKWA 1QOQB 3IIMA 1HLDA 4HO1X 2JLZA 1UF9A 3ZIUA 4NS1A 4IX9A 2QP4A 1CT9A 2DPLA 3F67A 3K1AB 4WW0A 3UJHA 3PHJA 4M0MA 3OQPA 4EI2A 3OZFA 1JDNA 4ZPJA 5EEHA 5JDCA 4D1YA 2N1BA 1GCIA 4EUSA 2O05A 1A77A 4HB0A 1O96B 3AOEC 5J2UB 5LYJA 4CMHA 5GJBA 1O6FA 1YK0A 1M6YA 2D74A 4GXTA 1ZA2A 3GJXC 2VFAA 4B3TB 3T15A 4XD7A 4I19A 1ZA1A 2FPUA 4KH0A 3T4XA 4U9HS 3DKVA 3EIXA 1SCAA 3ZHUA 2LIVA 2QDKA 4F4UA 1ARZA 4Q4AB 5FULA 3K7EA 2BEVB 3NTXA 3FYSA 3PSAA 2BBWA 3C3YA 3IAS6 2A14A 3HB1A 2DPHA 4YCCA 3B2NA 3JYQA 1HQDA 2C03A 2E5WA 2GYWA 3E5HA 4LE2A 1WLYA 2CL5A 1ULUA 3VOSA 2PK3A 4WACA 5KNCA 1IOWA 1FZQA 3K9NA 4MVJE 4ENVA 1NL3A 1FFAA 3D3KA 3QU7A 4V0MA 4Z8XA 4X66B 2IYPA 4KKVA 1ID1A 1T36B 5DGTA 3WLMA 4JC0A 1S2NA 2Q5FA 1YB1A 1FVFA 4J7UA 3D7KA 5DX0A 3F46A 3AC0A 2XKKA 2QVGA 5DN6A 2RC5A 4EEZA 2BLNA 4MW2A 5C46F 13PKA 4QUJA 2QS9A 2QUZA 3H0KA 4D43A 4NOLA 1EM8A 3TTUA 3FRJA 1DEHA 1ZUNB 5IKOA 4DWOA 4AN1A 1DJLA 2YXPX 1YS9A 3VYUB 2VKTA 3KZVA 4KJXA 2PY6A 3BHMA 5B1YA 3KT3A 2ZUUA 1YJ5A 3GP3A 3S8EA 1OB5A 1DELA 2J9FB 4RTQA 1KZ7B 2ZRMA 3GCZA 2PJDA 1E5DA 3AV3A 2J4CA 1VA4A 2EKLA 4FHGA 3GLHB 5F21A 4M9XA 3WLIA 5JI3E 3E58A 1NN5A 3TR5A 3OZXA 1CUJA 1PNVA 4NATA 3L5OA 4Y1EA 4ZCRA 4WBXC 3IIKA 3MN1A 4PAMA 3TLJA 3QLUC 5AJZA 3VJLA 1B15A 3WYGA 1YULA 3MB5A 1B14A 1F14A 3QTLA 1PX0A 5LD2C 2Q6VA 4KO1S 3GFBA 4ATNA 2FMIA 3DV0A 1BMDA 3RRBA 2YR0A 2GPBA 1NW7A 3N6XA 2H4WA 3INRA 1R50A 1AGXA 5K8UA 4G6ZA 4BO4A 1TO2E 1A97A 2ZDGA 4EFDA 2O8BB 4Q1BA 1JHUA 4FHDA 2IH4A 1Y3DE 2DWUA 2VNJA 2W2NA 2ZSBA 2W11A 1W9HA 3GXOA 3H5NA 4S1TA 3SS7X 3R77A 3I76A 3COSA 1PR9A 2WM9B 3PWSA 4PAOA 3W1EA 3T7KA 1LS6A 1ZK1A 3FCCA 2IX3A 4Y9SA 3WLRA 3LC0A 3MCUA 2PSHA 4K8RB 2HJSA 2VYND 1BD4A 1T24A 2PLNA 4LJ5A 4OI2A 4DS3A 3ASZA 2NU8A 4QXAA 1EEXB 3C3MA 3W1VA 3MUFA 4BE7B 4DCGA 1XTRA 1RXIA 4WKPA 2ZJZA 3E82A 4EJ0A 1Z8NA 3LGSA 5LNK1 4M21A 3FI9A 5M34A 1VM6A 2Y27A 2YWCA 3G0GA 4ZIRA 1XZMA 2VRWA 1M54A 2O8VA 2YWRA 1Z4MA 3WJAA 3GRCA 5BMOA 1Y8RB 2VJYA 1LU9A 5JPCA 2O57A 5ESXA 2DR3A 3UGKA 1BC5A 2NT4A 3O8BA 2ZAMA 4BCDA 1C7FA 2GAIA 5KTNA 1BW9A 3OEED 4U7GA 1T2CA 3JATB 2FW9A 5ALWA 4XDZA 5CX1A 2J3HA 1E7MA 1P39A 5G0WA 2V4ZA 5K0TA 4DR1B 2E55A 5FKJA 2YV4A 2ADOA 3FM9A 4O4IB 3RRXA 4U0KA 1DXQA 3HV0A 4LWOA 5EP4A 2GEUA 1KJNA 4I4TB 3WQHA 2A4KA 2FRDA 3KZOA 4BECA 3RU2A 4RETA 5KVVA 1ISSA 1IN6A 1ESZA 1N3LA 1U3DA 1Y80A 2W6CX 2YV5A 3O7WA 4R9RA 4Q19A 1EFUA 3KD3A 2YJ4A 3OQ6A 4JEIA 1CF4A 4PXSA 1THTA 3LDFA 3HJBA 5JD6A 2PLWA 3QEJA 2BEJA 5BNTA 3QUBA 5DH9A 4IDHA 3A2LA 1C9JA 3MTAA 4F6RA 1VJ0A 1DT3A 3PGMA 2GUWA 3ZDRA 5GWXA 3TS1A 1AK1A 2IW1A 3CTPA 1O6BA 1DDIA 3T5BA 3ZJVA 4UD2A 1RACA 2PL9A 4IIJF 5KYTA 4P4SA 1T8RA 2JD0A 1U4NA 3BH6A 2C42A 3AEUB 1FCJA 4CJXA 4YWJA 4EO9A 3VVCA 4E3ZA 5F2OA 4Q9IA 3GDGA 1YR8A 2CZCA 3JRNA 1WSAA 3NYWA 3WGNA 1QX3A 1O03A 1NP3A 4J91A 3GD5A 3U9LA 2UXDB 3R7BA 4ALMA 1X8KA 3MTJA 1E4YA 1J8YF 3QFRA 4JU9A 2JH3A 3JYOA 5JATA 1RMTA 4S2UA 5ELMA 1Y5RA 3KCQA 1E6LA 4HLUA 3SX2A 2IH2A 4L75A 4GE3A 3KB8A 3JTEA 2YOHA 3NVKI 3HCPA 3L0SA 1AQUA 2L0XA 2XDWA 3WYNA 1JG4A 1G2QA 4CMCA 3NDJA 5DV9A 4RH0A 4IF4A 5EQDA 5JNUA 3U09A 2BCEA 3CRVA 3OQ1A 3U44A 1TVMA 3SFVA 5DM4A 3TJRA 4PZ9A 3KAKA 4I3HA 4CMKA 4D8WA 5J43A 5LB4A 2ZTLA 4ZVRA 4F38A 3REQA 3IAHA 1MGPA 2XX3A 4HAOA 5FPHA 3D43A 4DLWA 4MV4A 4CF6A 1Z5WA 3T3HA 2ZRNA 1QIJA 1Q17A 2Q5HA 2OZEA 1HDZA 4L4SA 2O1EA 1EB9A 4WNAA 5DP1A 5ELXA 5DK6A 1S2GA 3HP1A 3WO1A 4AKIA 1M2FA 2I7DA 3E22A 3F5MA 1A4UA 1HI9A 1I1QB 3TLKA 4RGQA 3UUFA 3RC3A 3SHVA 5I7UA 1R0XA 5EE9A 4AW9A 4D0SA 4BGVA 3OF5A 1BXRB 3I9JA 1AGNA 2VP9A 3RC9A 3SJZA 4M9CA 2RGYA 1Z6PA 3PUHA 1GZ7A 1ICIA 3IP1A 4DIDA 4XTCS 2DBQA 4GYJA 3SQWA 4EY6A 1LLCA 3PC2A 3QELA 2AXQA 3F4BA 1N34B 1JG2A 3QVLA 1QAOA 4PY2A 1NF8A 5GJCA 3RUPA 4WVLA 5TNXA 2YV3A 3D64A 2DQYA 1EIWA 4QWMA 1XYGA 3WLEA 4HNHA 1ZG3A 2X1HA 1JT2A 3PXCX 2FW1A 1TFRA 1XVIA 4MQEB 4BMXA 2FN9A 1LVHA 4CLXA 4ZYLA 1IY9A 1MH9A 2JGEA 3QUTA 1O87A 1PZNA 1NYLA 1XWFA 4BEBA 3DV0B 4DSZA 1K7CA 5I9LA 3AEQB 3O94A 5LMZA 2X1MA 3UH1A 2YVAA 2BGLA 1KZ6A 2QZ9A 1RBMA 1WD5A 3ZEIA 4KEAA 2PQ0A 4C7MA 2JLUA 1UM9A 5HE9A 3RJMA 3EQ8A 2AN4A 1UKAA 2ZT5A 1KYIA 3HRKA 1UXIA 4PLWA 1IC6A 3P2YA 1M6VA 4QEZA 3PENA 4H7KA 3ZS8A 2ZG6A 2PKCA 3U5ZB 1JKXA 3GEGA 3U4CA 2RHDA 4H0FA 3DPIA 1V9SA 4JEHA 4QGAA 5FOUA 1GLVA 4L76A 1XKXA 3BQ9A 3ILVA 5I9TA 3WIEA 5KJ1A 2EZTA 3LFUA 4KQXA 5JNRA 3HA7A 3AIMA 1KQPA 5JCJD 2JI4A 2XMBA 4MRNA 1U5BA 5EIBD 4XFKA 3CX6A 1KI3A 3X1WA 4JUAA 3I62A 2V8OA 5LLTA 1Y7PA 3ECCA 4W5RA 3GXBA 3BKWA 4IUCS 3M6VA 4UE2A 2DHQA 3TSCA 4UCXA 3DKIA 1OXSC 2OR3A 3PQCA 4R5HA 3V8MA 4B8ZA 3IKVA 4EJSC 1JR3E 2QLLA 2WT9A 4PO3X 2F55A 5KNLA 4R51A 1U5AA 1HK7A 2O2CA 1PVOA 3TN7A 1E2BA 1J39A 2QB5A 1C0IA 4L16A 2QZJA 4JU8A 3C4JA 3ZHRA 1YRWA 3F78A 1XL1A 4YQEA 1GRNA 2FXIA 2WJHA 4F4JA 5C8VA 3RSHA 2IXDA 3QY9A 5C1IA 2J5XA