3F8WA

Crystal structure of schistosoma mansoni purine nucleoside phosphorylase in complex with adenosine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
280
Chain Sequence
b'SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine-nucleoside phosphorylase
publication title Adenosine binding to low-molecular-weight purine nucleoside phosphorylase: the structural basis for recognition based on its complex with the enzyme from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 91
structure length 280
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f8wA00
4TTAA 5EFOA 5F78A 4BMYA 1T0UA 1ECPA 3GB9A 1YQUA 3DJFA 1YR3A 4D98A 4YO8A 1RXCA 3LBAA 1CG6A 4BMZA 5CCEA 1OUMA 1Z39A 1OTYA 3DDOA 5F76A 1RR6A 3OF3A 1Z38A 5CXSA 5CCDA 1JE0A 4F2WA 4OJTA 4KN5A 4QATA 1VMKA 4JP5A 4PR3A 3D1VA 3QPBA 4F2PA 1NW4A 4TTJA 3UT6A 3FNQA 4U2KA 1JDTA 3OZEA 1ZOSA 4IP0A 2AI2A 2Q7OE 4DAOA 3BGSA 3INYA 4JWTA 3FOWA 1RSZA 4G8JA 3U40A 4LNHA 1U1GA 5I3CA 2AC7A 3BSFA 5B7QA 1Y1QA 3O6VA 4M1EA 2ON6A 1RFGE 2QTGA 3EMVA 2QPLA 1V48A 3OZCA 1RT9A 3FWPA 2HSWA 4F3KA 1OV6A 5F7JA 3NM6B 1TGVA 2H8GA 5IU6A 1G2OA 2A0XA 2P4SA 3MMSA 2I4TA 1PBNA 2OECA 2PGAA 4EB8A 4GLFA 4DA7A 1Z5OA 1TD1A 1K9SA 5CYGA 3KHSA 3E9ZA 4QARA 4DABA 1M73E 5CXQA 1PK7A 2AI1A 4NSNA 4NS1A 4OEHA 5K1ZA 4YMLA 5F77A 4G41A 3BL6A 4OF4A 4M3NA 1Z33A 1PR4A 4DA6A 4DA0A 1NC1A 5KB3A 3LGSA 3KU4A 2AI3A 4YNBA 1RCTE 4EARA 3OOHA 3E0QA 3GGSA 4DARA 4LZWA 3UAYA 1PR0A 1A9OA 3UAXA 1YBFA 1XE3A 4FFSA 1LV8A 3OCCA 4WKOA 3UAVA 1RYZA 1A9SA 2QTTA 4G89A 2A8YA 1SD2A 1ODJA 1LX7A 1WTAA 1V4NA 4WKNA 3NBQA 4L5AA 2ISCA 3MB8A 3ENZA 3OPVA 3NM4A 4GLJA 3NM5A 1JDUA 3F8WA 3EEIA 4LDNA 5ETJA 1PR2A 1PW7A 3K8OE 1A9TA 1PR5A 4TXHA 1YQQA 4F1WA 3KVYA 1Q1GA 5C80A 1V45E 4LNAA 1RXYA 4TS3A 1JYSA 1LVUA 4OGKA 3ODGA 4P54A 3SCZA 2IQ5A 4L5CA 4I2VA 4GKAA 1U1FA 5F7XA 4R31A 1V2HE 1TGYA 2QSUA 2OC4A 2HWUA 3P0EA 4DAEA 1A9QA 1PKEA 4QFBA 4D8VA 1Y1RA 3T94A 5EPUA 1JDSA 4D8YA 3E9RA 4D9HA 4QAQA 3KVRA 2HRDA 1ODLA 3EUFA 1Y6RA 3ONVA 2QDKA 1T8RA 1Z36A 1QE5A 1B8NA 1PR6A 3OOEA 4PNPA 1A9PA 2OC9A 3EUEA 1Z37A 1U1EA 1JDVA 3C74A 1T8WA 1U1DA 4QEZA 4K6OA 4OGLA 5EUBA 1A69A 1VHWA 4MCHA 1RXSA 1SJ9A 4R2XA 3DP9A 1A9RA 4GMHA 1Z35A 1ODIA 3FUCA 3OZDA 4ECEA 1RXUA 2GUWA 4BN0A 3FAZA 3PHCA 1TCVA 2I8AA 4TXMA 1YRYE 1N3IA 1CB0A 3P0FA 4M7WA 4L6IA 4WKPA 4DA8A 4YJKA 4RJ2A 1ULAA 1V41E 5JPCA 3PNSA 1Y1TA 1PF7E 4TYMA 1Z5PA 1VFNA 1T8YA 3PNPA 1JE1A 5B7PA 4MARA 4R2WA 2OXFA 4UC0A 4WKCA 1B8OA 1NC3A 3DF9A 1ODKA 1ZL2A 2XRFA 1PWYE 1PR1A 1K3FA 1I80A 1Z34A 1Z5NA 5FAKA 1ULBA 4L0MA 1JPVA 5B7NA 4OY3A 1VHJA 3IEXA 1FXUA 3IOMA 4H1TA 3BJEA 4QASA 5IFKA 1OU4A 2BSXA 4L5YA 5CYFA 4TXNA 3LA8A 3KUKA 4DANA 4TS9A 2A0YA 1U1CA 2A0WA 4F3CA 4X24A 3UAZA 3TL6A 1C3XA 5F73A 4E1VA 1JP7A 2HN9A 4TXLA 4BMXA 4TTIA 1PK9A 1Y1SA 3OZBA 2B94A 4D8XA 1JDZA 1V3QE 2RJ3A 1K27A 4NY1A 3DPSA 4JOSA 4WKBA 3K8QA 5B7GA 4TXJA 1SQ6A 1OTXA 5F7OA 5DK6A 3O4VA 1OVGA 3PHBE 1Y6QA 3FB1A 1TCUA 4MCIA 1T8SA 4LKRA 1SD1A 5F7ZA 3KVVA 3UAWA
chains in the Genus database with same CATH superfamily
1JI0A 1PT6A 3LT0A 2JAOA 3C3BA 5EIBC 4BO0A 1FDUA 1RXIA 2SKCA 3O8OA 2FEAA 3G5TA 3JYPA 3RU3A 1ZIDA 2ERCA 2A30A 1TK9A 1DCFA 1V2GA 2VOJA 1QIKA 1WULS 3NATA 1U9IA 3PE6A 4JBGA 1T5IA 4N0MA 4WDQA 4E12A 4DSZA 5CDFE 1CQXA 1M10A 4Q3CA 2IK8A 1O96A 1GGJA 1YR3A 4ZCPA 3C5EA 2CZCA 4CG2A 5LZ9A 4GVXA 1PDVA 1T4DA 1VP3A 3B8HA 4RIFA 4IYJA 3RJ5A 1H9AA 4FJ0A 1JKJA 3FYUB 4OBBA 1NI4B 4FR5A 4NFYA 3QHAA 1U7OA 4XGIA 5D3KA 4L72A 4UBLA 3LY5A 3OE7A 4RLQA 3SD7A 3ZC3A 2JGIA 2NTEA 2FFJA 2XSZD 3KZMA 4YUVA 1MU0A 4LRYA 3IIMA 4LVOA 1XAGA 2OZVA 5FB3A 4TSKA 4YXWA 1QRUA 3PLAE 1RR6A 2D2EA 1A9XA 1N2JA 2G4CA 4F93B 1XZLA 3IAEA 3EXEA 4EQ6A 1V71A 1XQYA 3CRRA 3M82A 3SHVA 4KUGA 3AVVA 1UDXA 5EMMA 4U2GA 4IVQA 2P30A 4I9FA 1JWAB 1YR7A 3C5WP 4BRZA 5DV9A 5HRUA 1NW4A 5T5QA 1F0KA 3C5HA 3LQQA 4BAGA 2DAPA 4Q47A 1K5DA 3B9RA 3ZQ6A 3PNBA 2GEJA 2WE7A 2H8KA 3HCWA 3S1AA 3R3HA 5F1YA 3U3JA 1L5OA 2YZ7A 5ADUS 1QVWA 2W6QA 4EOGA 3CO5A 3SICE 3ZV3A 5AM5A 2QRMA 3WO1A 4Y6RA 4AQYB 1QKIA 1Z6QA 3K73O 2FSUA 4P2BA 5K0LA 4B47A 3PICA 1W2WB 3BJMA 1BFDA 4ZOQI 1DOHA 2OCIA 4P3YA 3CU5A 3S29A 2AF3C 4MA4A 3FGPA 1IRIA 2C3PA 4UM5A 4LSWA 3BSFA 4PFJA 3UMFA 3W0LB 5BSGA 4Z54A 1T9HA 4PRKA 3W5SA 4OOFA 5L9AA 3OCZA 3PGXA 1H1DA 1RPJA 1TLLA 4KITB 4UMFA 4O4LF 2HH9A 1K7SN 2ZSAA 2I0FA 4HZIA 4BLQA 1U8AA 2O3TA 4H7DA 3ZXSA 3IPAA 3QITA 1WXFA 3TUZC 1VL2A 4A82A 3ASVA 4WLNA 1GSOA 2FEOA 3IVAA 4YAJA 1YI8A 1AUPA 3CF6R 4XI9A 4ZPXA 5FPHA 1U9JA 1FYXA 3H18A 5B1YA 5C7LO 5I51A 4IIYA 2H8GA 4IDCA 1ACLA 5KJ1A 3GRKA 3N53A 4IIDA 3ZKAA 1L7EA 1NXWA 1NTOA 1X86B 4S3MA 3SIRA 5HVNA 3HYSA 3EF3A 1YASA 1YFZA 1J5XA 1IVSA 4WECA 1PBNA 2D5IA 3B7PA 1QF9A 1EGQA 4OA8A 4ASUD 4RS3A 3ELDA 3AUYA 4RAQA 5JYCA 2OAGA 1KVRA 4PIMA 1K9SA 1QWOA 1RE0A 4MYRA 3DB2A 1ZXLA 3H9QA 4M9SA 1V16B 2XBUA 3R6LA 5DU2A 4YMUA 5IAJA 1E9EA 5EHIA 4GQBA 1KMMA 3F9CA 2WF8A 1Y5NA 1J4AA 3FMOB 1KPIA 5JHGB 5CNIA 1RCUA 1YMUA 2A88A 3OIUA 5SZKB 1I7SB 1QRDA 3EG9B 2W6JD 2IU0A 4F6RB 3FPFA 4QJIA 3UAGA 1ETUA 3TQQA 1JHZA 1PJRA 2JD2A 3ZHXA 4GT1A 4D92A 3O75A 4LF5B 5IVHA 1WPGA 2O14A 2OFFA 5IWAB 4HDSB 3WL6A 1Q2UA 5JVDA 1U0FA 2DULA 4INPA 3FNIA 1OIVA 1GVHA 1Y6ZA 4IIHA 1UWCA 1YE5A 3NS7A 1XNRB 1JMVA 4BNIA 3SQWA 2FUNB 4V24A 1AN0A 2FWIA 2XE7A 3B1YA 4WPGA 5LL6P 3NJ4A 1E62A 2HJSA 3VVMA 4CIDA 5B2FA 1NYRA 4DA4A 1S3SA 3DBLA 3LZ6A 4TS1A 2H7YA 3P2IA 3HB4X 2G5TA 3HDTA 4D7AA 5EXTA 3TZQA 1MFZA 3IESA 3PXXA 5AI9A 2GM9A 5DHPA 2R84A 4E1BA 3NOVA 4PQYA 2XZLA 5G53C 1ID8A 4G65A 1XU4A 4BDSA 1G3UA 1TCAA 4WNIA 2J5XA 3CEPB 2FPMA 3MTIA 4IGIA 4JD5A 4RIEA 5DLDA 5AWFC 2W6IA 5LYYA 2W2XA 3MIZA 5BWOA 4CFYA 3ER9A 4G5GA 4M0MA 3KZCA 1SAYA 3EWIA 4FX5A 2VUHB 3ONFA 4Q3KA 2ZJ5A 3H8VA 3OCJA 1FYFA 3OURA 1M7BA 3WGUA 1HSZA 3FI0A 4IFEA 1XRPA 4YLYA 4QDZA 1DLIA 1V3TA 3LRXA 2M98A 2B69A 2CSUA 2AZDA 2W2KA 3GZJA 3LYHA 5CA0B 5I3ZA 3NTVA 2JAHA 1B6GA 4QUJA 3LHIA 4DG9A 3LPNA 4I0WB 5I9LA 3RC3A 5DNVA 1HKHA 2DT8A 3ZNOA 5GONF 1QQAA 3O3MB 4WNYA 1TU4A 4PZLA 4P31A 1CFZA 1DELA 1G20E 5M2QA 1YJAA 3NM4A 2PGJA 1FFWA 1PT7A 2G80A 2PNFA 3HU2A 4GBMA 1YZGA 4OJYA 5EP4A 5J1TB 4LHVA 4BX8A 3HBNA 4HCJA 2VSOA 2W0SA 3FA2A 5E3HA 3VR6A 2I3BA 2V8BA 2C7RA 2JPDA 3JY6A 3IE2A 2BI7A 4AG6A 4RVSA 1XNHA 4PYJA 4CIAA 3COJA 2EX0A 3FF1A 5I7AA 3W77A 2ARKA 1AGNA 5KTYA 3C1TA 4M1ZA 2PQMA 3CHYA 3W79A 5EIWA 4AXXA 3WSTA 3GN2A 3OETA 4M53A 1EESA 1QUEA 2CVZA 2OD9A 4J49A 3AF5A 3WKBA 4LNAA 4OHYA 5E3IA 4K46A 1R4ZA 2HJWA 1JSZA 3H9JA 1EMDA 4KL8S 4CWAA 1JSLA 4DR6B 1JIUA 1U90A 2WM2A 4HWGA 3GGOA 4INOA 5DBHX 2G08A 1CRLA 4LVUA 2WUDA 3TSYA 4YCCA 3Q40A 1JYSA 2VRCD 1NNLA 3OFNA 4BV8A 3GA5A 2OBXA 4P5EA 3TVDA 1QHFA 3G82C 3IRUA 2WBLC 1BE6A 1GGNA 2EEZA 2VSYA 1X1SA 4NZYA 5LP1A 1GZHB 4CT4B 2H3EA 1JG7A 1IIBA 1NBME 4YR9A 2ONJA 4H0FA 1CF2O 1B0UA 4QTZA 4ND4A 2R751 4BXOA 4I4CA 1VLJA 3L6BA 3AHGA 4JC5A 1YL6A 2BMVA 4FW8A 4JDPA 3D2CA 3CUVA 1XFDA 4D8WA 2YW9A 2WHQA 1EHIA 5B1EA 4OMCA 1YVEI 4MKHA 4ND7A 4MRAA 3V8RA 4HB0A 1MT3A 4CG1A 4DCUA 2CK3A 2JLYA 2UDPA 2WPNA 2H1FA 3CZRA 4GG1A 5BW5A 5JU6A 5HKOA 5D5QA 1P9RA 1ZW1A 4QFMA 1J8QA 1FBTA 3GWGA 1MHTA 1HQDA 2M6RA 1QLWA 2LCIA 4B46A 4IRUB 3QLUA 3NYQA 3I0ZA 3PUZA 3JSXA 2YNMD 1RP1A 3JYNA 4KYUA 3LC2O 1NOIA 1DU4A 2NN3C 2NU9B 1ZA1A 4V0KA 2VSXA 3NFYA 2WB2A 1B2RA 4TV8A 1J0CA 3QEKA 1WXXA 2Z5VA 1KZYC 1ISSA 2WJIA 5B55A 3S2GA 3IAFA 1NFRA 1GPBA 5COQA 4JH0A 1Z4QA 4UD2A 4AICA 1X92A 2HCBA 3PX3A 4ZVQA 3FTNA 3WIBA 2Y76A 4NYIQ 3QKIA 3IEMA 3FUXA 4WFJA 3THXA 1EEXB 3JQPA 4HXFB 3CLSD 4MWCA 5DZSA 3QVKA 5HS4A 2WF5A 2X9VA 2RGXA 4EGSA 4DR1B 1R0LA 1XTTA 4N03A 1F8YA 1PZXA 4KP7A 2XB6A 2ZSJA 3FOCA 3WLHA 5GIOE 4OTZA 2VUIB 4GQAA 1D1SA 1MT0A 3EDQA 4QGSA 2XE6A 3JAKB 4B43A 4MGKR 1N3LA 1EX9A 1SRQA 2F90A 2W71A 2GBGA 3JVEA 3KKOA 3IR5A 4XB2A 1YK1A 1ISFA 2IHVA 3D8TA 3GPCA 3R24A 3SC6A 1NAHA 2FZEA 4D3SA 1SOMA 4YV2A 3PZBA 1XCJA 2XWSA 2ZB8A 4MAMA 4RKWA 5JS1A 3INNA 2CVHA 3LPCA 1MMFB 4UHFA 3V1UA 1DEHA 1N1EA 4L27A 2WUEA 4ZICA 2FLKA 5LPNA 1O6BA 3K30A 2D0OB 3BMNB 4ALJA 5LNK1 4YA6A 3FLMA 1LZKA 3CLUD 1W48A 1TJNA 1JDBC 2AN1A 3ILXA 5FUYA 4CBVA 4EW6A 5EXEA 4I4TA 2GILA 1UWVA 2RJOA 4JP8A 1R0WA 1WQ3A 3JQAB 1W36B 5F52A 5FRDA 5I8PA 3UMYA 1CU1A 2D1YA 2EF1A 5BR7A 1D5WA 1TNDA 3EVNA 3ND9A 3QHQA 1N6HA 3LX4A 4GXQA 4IH9A 2P6PA 3KEQA 4BHTA 1YB2A 2JKYA 4WN9B 4ZTUB 1Z4IA 2Q41A 3HLYA 2KW5A 3HNPA 3KUCA 1FJHA 1NV9A 1HL3A 1WD5A 2WQZA 3B89A 3DLCA 5I8WA 1MRZA 1UMDA 1XEWX 2EFCB 2X5OA 2Y6UA 1N3IA 3ABIA 5IW8A 4EPWA 3IBSA 3PQFA 1BXZA 3T7RA 4IYRA 3U9SA 2Q2WA 3K8ZA 1BDMA 3LG2A 1ETHA 4NBNA 3E9QA 2JG3A 1U2RA 2G1JA 3KJZA 5CIQA 2GEKA 5K3FB 3A4YA 1LQUA 1GNLA 3U7RA 2ZJ0A 4FMCB 4MR9A 5AVZA 1FJXA 4DVGA 1OFIA 1BEEA 2V97A 3T4PA 2J08A 1ZM2A 1UBLS 3H5WA 1F2VA 1H6CA 2F3UA 4EFDA 3M4XA 4TX1A 4CT5A 1R00A 2Q1UA 1BWRA 3KVOA 2HWKA 4L8LA 2GJ4A 3STWA 3ZIAD 1FY2A 4YPOA 5C35A 5LQJA 3ZUPA 1O0CA 1FUYB 2RONA 4N49A 4EJSC 1SCJA 5AUQA 4C6TB 2JJ8A 3OWXA 4LF8B 1A5BB 1TVKB 1G8FA 1U7XA 4G5QA 1ZK2A 1GG8A 2F9FA 3C41J 1P4SA 2C99A 3I23A 4NESA 4QXOA 2HWXA 2YCLA 4PINA 4GWLA 4QYTA 4KCGA 4RSHA 1TT5B 1C9DB 4H7IA 1FFCA 2B8NA 5IF9A 5KJEA 1I80A 2D3WA 2GTHA 2OAQ1 4R4JA 3WL7A 2Z1DA 4Y2PA 2AUNA 3EMKA 3ZDRA 1Y34E 3FH0A 3GJSA 3WBBA 4Y6QA 4NONA 1GIAA 1XN1A 3SBEA 1ZQ9A 4HNRA 4IO0A 1QHNA 3A1EA 2WIGA 3UOGA 4XRGA 1DZIA 3I8XA 3ZU3A 4PGGA 3OZTA 4ZTBA 3QEMA 3W6UA 1URPA 4MI9A 4D6XA 5ALUA 1E7SA 5FLYA 3RS9A 2HMVA 2X19A 3MCVA 4RMIA 5LJIA 4MX8A 1NJGA 2ZANA 3IP6A 5HMMA 4BVKA 2C2OA 2XCRB 4CEIA 3THYA 2FMHA 4F8JA 4GC5A 1SPBS 3LL4A 1H5UA 1LK0A 1ZK3A 2WTBA 4YUZA 3AFIA 2QD1A 4M2LA 3TSZA 3B6JA 3SF0A 4EUEA 5L53A 2BHRA 4MGYR 2H11A 1HDZA 1JHUA 3NC4A 2QNRA 2WT4A 5E3JA 2NZ8A 3JRWA 3RJTA 1CK4A 2ZQZA 3GVHA 1OB2A 3HH8A 1XD2A 3P5BA 3AB7A 2BMJA 5KWSA 4KQFA 3PHLA 3CW8X 1UOPA 1ONNA 3IX7A 1P7CA 1AE1A 4YJ2F 3INRA 2REQB 5EP3A 1LSOA 4HDKB 3MC1A 1M8JA 3PUYA 4IXTA 4E7PA 3JAWA 1M5TA 5CLJA 3WK7A 5KIAA 1P5HA 2P1ZA 2YZNA 5B3LA 3OEHA 1ZITA 2VQ3A 1NR1A 4PFQA 5TNXA 4IJQA 1E2IA 2ET6A 1X1DA 3WFJA 4AUEA 5J2TB 3HGQA 4N3GA 3USCS 2QV7A 1SBYA 3JQCA 2WU1A 1J39A 2GBLA 4QM7A 2B94A 1VL1A 3Q6IA 1VI6A 2PGOA 3BK7A 3OD5A 4GYJA 4OATA 4TS4A 3O8CA 2Q4EA 1US8B 1TA4A 3AJ8A 2IYVA 3EZLA 5AK6A 4ZAZA 1HY3A 4C1NA 4BYGA 3INTA 4EIWA 3IOEA 3QBJA 5EMNA 4NNOA 3RVSA 4AKGA 4WACA 3PXGA 4HUTA 4EHKA 3GLGA 3EXFA 3AVWA 1MAHA 5KUTA 3LQYA 2OPBA 1ZIPA 4DBLC 2DMRA 3EB9A 2VDRB 2XVAA 4M22A 4QOGA 1GN9A 1TW2A 1BAPA 5ALOA 1TFRA 2P5SA 5JWOA 1T5BA 3JSAA 4F97A 3I5XA 1XIVA 2DFNA 5HGXA 1IZZA 4ZT4A 1JMYA 4XOUA 4DY4A 1XP5A 3KLNA 4B7UA 1GTZA 1H8EA 3FX2A 3DYBA 3ZH9B 2B92A 3RBXA 2OORC 1Q0LA 1RLMA 3OZSA 2PKWA 5TEVA 4DQXA 3VJMA 4Q7QA 2J3KA 2EQAA 2HLHA 3NT2A 3UJAA 3DPUA 2NV0A 4EJ0A 2PGDA 4GYKA 2FPGA 2JCGA 1E20A 1G60A 3E82A 4MUEA 3IFSA 1Z08A 2H4HA 4MJ7A 3FVVA 4MYUA 4G4GA 2FX5A 4M8NE 1P77A 4MV1A 4IFIA 5KX5A 1EFRD 1T1IA 3NHSA 1K08A 3DEJA 1E2FA 4Z0TA 2NO6A 2WZBA 1H4QA 1X9HA 2ZIXB 5E1OA 1ZM7A 2C4HA 1JPJA 2X3FA 3LKZA 4IDEA 2BFDB 2WWXA 4QPCA 3PHIA 5GGYA 3KZOA 5IAKA 1DBRA 5B53A 3IPRA 4ZI7F 3DJFA 5PGMA 3CYFA 1V8BA 3FFAA 3TRFA 2CF5A 4MEJA 4CV3A 1W96A 3FZEA 4FSHA 4K26A 5IJ0B 3L6UA 3VYUB 3FPAA 1S89A 1V3VA 1SOWA 4F5DA 2O5RA 2PA3A 3BXOA 2XV1A 4M0PA 2B7LA 3JWEA 1GITA 4WZAA 3QPVA 1SC4A 4HN9A 2Z1NA 1BJRE 2RC5A 2ZYVX 3NKLA 4IHQA 5HFNA 1X7DA 1R6VA 2QG9A 3AUJB 3LFTA 4PYOA 4Z0HO 5AVJA 5GM1A 1AHPA 2IZOA 4DUPA 4JEHA 1TUIA 2XODA 2V3CC 1BOFA 4Y9RA 2EW8A 2PRYA 1DBWA 1MCZA 1Y81A 4HBZA 1IH8A 2JLXA 1Q84A 2OCLA 3OIVA 3A0RB 1YR1A 2FDCA 1SIBE 3D8UA 3OSUA 5AJUA 4PLHA 5C31A 3FNQA 2FMXA 1DXQA 1IHDA 1PGNA 2NW6A 2RK3A 3CX4A 4R51A 4JB3A 1C8VB 4DPLA 4IX1A 1HFEL 5HZGA 3E58A 2JCVA 3ZE9A 2Q7OE 5C46F 2XGOA 1BMTA 3ZHOA 4BNDB 5CP8A 3FTPA 5A9TA 3L7YA 5AW2A 5KNBA 2Z2KA 1Q11A 2C9ZA 3AU8A 1F5SA 1UINA 3Q3IA 4LV5B 5A4KA 2WU0A 3VHXB 5INTA 1J8FA 1Y5IA 4MI1A 1IPEA 5ER9A 4WUTA 2V6MA 5EGSA 3MFQA 1XL0A 4CFZA 4S1VA 5DP1A 4K9LA 1ZH2A 4D99A 2BE9A 2VRWA 1CY1A 3EDOA 1Z6XA 3OAAD 4M1EA 3RE1A 1QV7A 2Z95A 4QBHA 2YBDA 1CNMA 4DCSA 3GYBA 1E3IA 4LMPA 4QDOA 3MHTA 1NQXA 2H07A 1PUXA 2FZVA 2RHWA 3ZHVA 3RS4A 3LUGA 4YDSA 3IP5A 2GHRA 2I5PO 3P9NA 5HE8A 5CIYA 3H9UA 4BX3A 1CC1S 4JBYA 3BHMA 1F60A 3F0TA 2O0LA 3PFGA 4GYWA 1L5KA 4B35A 2D8MA 5BWNA 3GL9A 3GRFA 3L1JA 4AUKA 2EYUA 2AJDA 1XEFA 4ZVUA 2IDMA 2JW5A 2OV8A 4GMKA 4MZXA 5AVUA 5LP6A 1X13A 3ZDQA 4TYWA 2A0XA 2XADA 3DEAA 5IX8A 3ACBA 5HUHA 3RSCA 2P4SA 4M1TA 2QRGA 4WBSA 3B9QA 1UC4B 5ADWA 5BYBA 3H9BA 4NH4A 2AT1A 2GB4A 1TEXA 2JDID 5B1SA 3TL3A 3HN2A 3TLGA 4J91A 1BZYA 1GZUA 3VMFA 4GLFA 2H52A 1M34A 2PLAA 4CQNA 2PN1A 1RTKA 3LD9A 3MT9A 1YB1A 3JQFA 5MGNA 2V0CA 4PZYA 4QGBA 5JH7B 2N1MA 2CLOB 1CUVA 4HX5A 1OKKA 4Q34A 3BCRA 4N1AA 1EFPA 2X6QA 2HADA 3F1KA 4BBAA 2HQ1A 3KQYA 5FBRB 3GA0A 3PS9A 2RCNA 2IKQA 2KLBA 1KP2A 3OTWA 3HPRA 3RU9A 1C50A 4L0DA 4LJ8A 4B8YA 3QNMA 4HTFA 2HF7A 1ZRNA 2YZGA 4ZAFA 1HKUA 1K0FA 2E49A 5FA6A 3KQMA 1R37A 2Y1WA 2M6SA 3G1TA 3N2IA 3T7CA 1P5RA 1DTSA 1FTQA 1IK6A 1PAUA 5EXSA 4OAPA 3VJLA 2F7SA 4V0LA 4EWLA 2PR2A 4IZ6A 3FZYA 2UYOA 3P0IA 3WLIA 1OAOC 3GLGE 2YWRA 2J85A 2OP1A 4FDUA 1ILWA 1Y1PA 2CMHA 2PQ0A 3A7DA 1BMQA 3FSGD 4GZ5A 3T7EA 4JXZA 1TVCA 2H16A 4YNBA 4EBBA 4J0DA 3N8KA 1Z8FA 1B14A 3ZCUA 3A1CA 9MHTA 3DKIA 4B44A 3LUBA 3FCOA 3PG5A 2VWQA 2RGWA 1PS9A 5I48A 4EX6A 4O08A 2HO5A 3SJBA 4M76B 4CKBB 1S3IA 4FPXA 4UAGA 1JYFA 5K4GA 4MAFA 1I51A 4L9AA 3HO6A 1YZFA 3DZFA 3QI7A 1Y7HA 2F3RA 2NO7A 4MV9A 4PE5B 3H5NA 2WVHA 3GJQA 4JQZA 4XVQA 1B6SA 3RC7A 1AZLA 2FF5A 1VYUA 3QF4B 5AK4A 2Q5IA 4XWWA 1HM5A 1NRWA 2ZROA 2DC1A 1P1JA 3IPXA 5KNCH 2BF4A 2DE0X 2F62A 2I76A 4ND3A 4PYLA 4RDHA 2H9IA 5EWJB 2JCYA 2LD4A 6PFKA 4G0WA 1FRNA 1S2LA 4MTCA 2YFQA 3AG6A 3DXYA 3EY9A 2IUFA 2BELA 2A9KA 3SMVA 4DSOA 4DSNA 1SCDA 5CA1A 1LX7A 2F9MA 3LK6A 2X0EA 2EWWA 1N5MA 1D0VA 4FWBA 3D6AA 3ONWA 3UEOA 3ZOZA 3LVRE 1PS8A 1RC0A 1T0BA 3B8EA 3JS5A 3MB8A 3VNUA 5KTKA 1QGUA 2GFHA 3V7UA 3IODA 4R5MA 4HLUA 4UFOA 5JVDF 2JRCA 2QYSA 1V25A 2C9YA 2DTDA 4TTSA 2PTGA 5AHXA 4WZAE 4YTEA 3VU9B 4WCFC 4PO8A 3RHTA 2ROQA 3DFZA 3O8RA 1PZHA 1EXWA 5E7QA 1T0HB 4EFLA 4N7MA 4RFSA 4UASA 5ETJA 2LKDA 2FLVA 4P3PA 1TKAA 1U8TA 3TUIC 3WGVA 2GPWA 1WSDA 5BN3A 4ZO7A 6NULA 5F98A 3E7DA 3THRA 4YT2A 3K9QO 4JYMA 5F5XA 3RVRA 3O95A 1RMYA 4ZOLA 1SIOA 1VSQA 1WL8A 3O8DA 2ZYWX 5E38A 2HK6A 1C9MA 2G3YA 4XIYA 1J0AA 1Y0BA 1F0PA 5ALTA 3VFDA 1PU2A 1V45E 2F48A 3DO5A 3G02A 4MIOA 4UU1A 4JVMA 2JIBA 2AOUA 4R71A 2EGGA 1GEGA 3IRVA 3MW8A 1W7AA 2E4ZA 3AK4A 4YV1A 2CY0A 5D5PA 3VAZA 4RD3A 4RULA 4CUKA 5JECA 3IP7A 1KERA 3TW0A 5CH3A 3F4KA 3TS1A 2Y1EA 4IGAA 4ZYWA 1XQWA 2QGNA 3SVZA 4CETA 3I9V6 3WNCA 2IW1A 4GEKA 3VYRB 3VKGA 1HG1A 1YZUA 2VPIA 3LHFA 1PQPA 5BSTA 2Z6UA 1FYDA 3CSUA 1GWNA 3IUPA 1T2DA 4URUR 5HZHA 1OH8A 1ML3A 2Q1YA 3H2KA 3J80A 2R2GA 1UMCB 1Z2DA 2UVPB 2IYOA 2OC4A 2WV9A 2XY4A 3KX2A 1F3LA 2IYQA 4Q9LA 5E7IA 5BVGA 3H8SA 2JHAA 2Q6KA 3P0EA 3GZNA 4U39A 4Z7JA 1YFLA 4MDEA 4TUYB 5T6BA 1DKLA 1LB1B 4RZ3A 4OI1A 3MJDA 4AWAA 4BFVA 4CM4B 2IH5A 5L3SB 3B60A 2NGRA 2WC1A 5EXPA 4L57A 1RRMA 1ZWLA 2Y1GA 4OIMA 5HUJA 4Q02A 1FYEA 3PNMA 1WAMA 3G2QA 2CLMB 4LE1A 4PLYA 2O8CB 4O8ZA 5ELLA 2H1OA 4L6AA 4ZU3A 2BYTA 1R0ZA 2QN9A 3HWSA 2ZYDA 3JQRA 1W88A 3ZJYA 4C4AA 4EHHA 1F2DA 1Q2XA 1FQKA 4OA5A 1KDPA 1P5ZB 4MW4A 4RZXA 4DBZA 1XF9A 2GZRA 4L2IA 2P27A 1Q95A 3KR9A 1BIFA 4ZREA 3KQHA 1R9JA 4B3RB 1ESCA 3HNOA 5K0TA 1KI4A 3MUOA 4PSVA 2V1XA 3E18A 1QKJA 4F12A 3IDSA 3RVJA 5C4IA 4PPNA 2MJLA 2OC9A 1YH3A 3E1GA 2QLTA 5KYYA 3K0HA 5DFAA 3KKZA 4DLYA 3EXHB 3FIUA 3SN6A 3UXHA 4IW3B 3RS5A 3NGLA 2XUHA 4LBVA 3WDSA 4BUZA 1V7QA 3S55A 1G8PA 3V00A 3WLTA 1BOOA 2X0NA 3QG1A 3GYGA 2BMFA 4JBXA 5J4HA 3EVEA 3G8BA 5LSAA 2XDYA 4NR0A 1U94A 2OZLA 1VRWA 4JFAA 5LU9A 4J2HA 3BRQA 4L9WA 4E21A 1PFWA 3CIOA 2HJGA 2WAAA 2ZJ6A 1SJ9A 1NX9A 3D59A 3N7TA 3K9BA 2EV9A 5DIZA 5E6SB 4NCAA 1X1BA 2JASA 1GV0A 2C07A 1OX4B 1FFXA 1CUUA 2WYIA 4M83A 2C3YA 3OE7D 1CKEA 1TADA 2NXEA 4KSCA 2VZEA 3EC7A 3HYNA 4XGRA 4JOCA 1MAVA 4YXWD 1ZI9A 2PBRA 3AUFA 1JAHA 1JB1A 2O2EA 3CT6A 1SU8A 3WP1B 3HRKA 1Q77A 4XQ0A 1FJGB 1L5QA 1SD5A 2CUKA 1OD6A 2QX8A 1KYZA 4I3FA 4K3VA 1T9CA 2WTMA 4BP1A 4TV8F 4NBSA 5TMEA 1GM5A 2EEPA 2FQ1A 2XBLA 5CEJA 4BP3A 3B5IA 3UH1A 2Q3FA 4TXMA 3JYQA 3PKIA 2XOKA 1ODFA 1FQJA 1P91A 1A7KA 1T9AA 4HEQA 4J1SA 1TQ8A 3CUSA 4HHEA 5A6SA 3AP2A 2QL9A 3RO7A 4OXRA 2JIPA 3ML1A 1POWA 2GYYA 2ZIVB 1N75A 1S2GA 1PG0A 3HEBA 3FI9A 1ORWA 1RAEA 4RCVA 1U0OC 5D3QA 1AH2A 2J0UA 4HLQB 2P35A 2ZAMA 3TVTA 3QXHA 2FPUA 4XYLA 1VG1A 3QEAZ 3DQQA 1PJCA 2CLDX 1K7YA 4CG0A 1IUKA 4UE3S 1XRSB 3U3OA 3V55A 1SCKA 3MWFA 1KRHA 2VDWB 4R0VA 8ATCA 3SF8A 3MK31 1C7FA 1TE2A 4LOJA 4Q05A 4LSGA 3LRTA 3TOVA 1NBMD 1NQTA 5IDVA 1PS0A 2GQ0A 4G9EA 4QOSA 2CYCA 4WKCA 1KWGA 1OI2A 1PL8A 2P5TB 2PWYA 4YRTA 5HQ3B 1D4ZA 1YE8A 3EIXA 3LC1O 5JAHA 1GTL1 1UJ4A 3L41A 1BGXT 2C0CA 2O0HA 1YRQA 1PO7A 2YHSA 3AR3A 3E0XA 3N2GB 4I4TF 4P93A 4RQAA 2PPLA 3HYCA 1LCIA 2WHXA 1M6YA 3CX7A 4DV5B 5F23A 1DC8A 3C8MA 3KXIA 2XB8A 4IJ6A 4IDGA 2OYSA 5ICSA 3UG7A 4KUEA 2B9EA 3HA3A 5GZ1A 3EVAA 4IQ4A 3KQLA 2XI4A 4X6UA 1WVIA 2J32A 3AUTA 1NW5A 1EFKA 5I6DA 4ALMA 3ZV4A 2UZ3A 1DXHA 3PIIA 1R4MB 1P8AA 3OJCA 1W46A 4AMZA 4YCJA 3TLBA 3PPIA 1O0SA 4J2OA 3OC0A 2IPAB 2ZRAA 3J81A 2P0EA 4GO1A 5ULLA 3EGXB 3TPCA 1XTZA 1NVFA 4NARA 1E3SA 3MD9A 2OO7A 4CM1A 4W5QA 4R7GA 5BQ5A 3KBOA 3GCDA 1FU8A 3OKAA 4JGBA 4RU1A 3GLIE 4TXNA 4LXYA 5BXQC 1BD4A 1E1QA 1LQTA 3DOHA 2GPJA 3T4XA 4J1TA 5DI9A 4DIMA 4K1XA 4R3UC 4YT5A 2JI8A 2G70A 3JQ9A 5EPOA 4BZXA 1LSSA 1U1CA 4M0UA 3V7NA 1E0DA 1AXRA 4F3CA 5FLXA 2XF8A 3ODPA 4N65A 1U7UA 3R7BA 3UK6A 2DY0A 2ZB7A 3GOQA 1NQWA 5JFTA 3GVXA 4WT7A 1DRJA 4DOMA 3AWDA 1DEKA 1N2SA 2DB3A 2XUIA 3ABZA 3GH1A 4NBUA 3SHOA 2WHEA 4JR0A 5IARA 4YCDA 2GZ3A 1FDIA 3BXXA 2E0IA 2OEPA 3AB8A 2CJFA 1LVGA 2C95A 2G7ZA 5LZ5A 3DVAB 1M7HA 2ZXEA 3BFKA 4G4JA 1AGPA 3DE3X 1RKVA 3DE2X 3M9WA 2FFRA 4YQEA 3E61A 4WERA 4UBKA 1LRKA 3NBKA 1X14A 2ISQA 4FEYA 1RYHA 3X1JA 1ZICA 2PUVA 3ZD8A 1XA0A 2QUHA 1FMCA 2VN8A 1UCFA 2J45A 2P62A 4M87A 4B3CA 3AHEA 3C2QA 1WKVA 5F9MA 2ERYA 1P2GA 2W6ID 2QLMA 4ZO4A 2JARA 1YACA 2PS3A 4QJBA 1IY2A 1DPGA 1MH1A 1S6YA 2H54A 3GEMA 3QPDA 4NCNA 1BVHA 4YVFA 4NBLA 2WJ4A 4ZPJA 5HF5A 2ZU0C 5LZ8A 5KDOA 3MHPA 4IIVA 3K0CA 4ITVA 4YHBA 1KJQA 2QMQA 2WSSA 4TKLA 5EXXA 3ZVLA 3MWKA 4CKZA 2X40A 4I6JA 2SECE 4ZEVA 3GUVA 4BFUA 1PX2A 3TCNA 3WKAA 5D5HA 1EIZA 2IYZA 3C8ZA 1RKQA 4CPDA 3DKPA 4NYMQ 3W5UA 1NXQA 1UZUA 5AVYA 1EIWA 4IH4A 2XOXA 5DNCA 1NW9B 3TCXB 5IBQA 1E8MA 1NMQA 2GXQA 2Q1XA 3STUA 2FOLA 3V3TA 3ZJTA 3P1JA 1E8DA 3RS7A 3NR2A 4M8IA 3SC4A 3F6BX 4D26A 1K9VF 2QPAA 3A25A 4R69A 2FEKA 3FZQA 4NI5A 1DIAA 2WM8A 1K4KA 4QBTA 4YJ3B 5J4LA 4F9EA 3VR6D 3QK7A 4TTAA 3ZVMA 4D9GA 5F78A 3R9WA 3DR3A 4TQUS 1YNSA 2HDNB 3COSA 1V11A 3QP9A 5IXSA 1EGHA 4OYRA 2I2AA 4OXXA 4LF7B 3R0VA 4MQEA 3TSCA 1RLOA 1R3DA 3LA6A 1SUEA 2XDQB 1E2JA 2VFAA 4U1RA 4QU9A 1SB8A 1YKGA 1USGA 2G7MC 4XB6B 2YRFA 3A05A 3IAUA 4MS3A 1JLMA 2CXRA 4LXQA 1V4VA 4P7JA 3KALA 2CNLA 5DM4A 3SSAA 4DHWA 1AUQA 1OY1A 1O03A 1WCIA 4E5YA 1VPDA 4JT4A 2PMFA 1T2VA 3H4VA 1Z38A 2NSJA 4OQPA 2PO5A 5JAQA 1AB6A 1NOJA 1WB5A 1N0IA 2ZFUA 1WXWA 3C48A 1X42A 3TE6A 3EX7C 2BTQB 1BA2A 3OFND 3HXMA 4NFHA 3FCAA 1DJMA 1M6HA 4GR5A 4RWZA 4CF5A 1M1YB 1OYVA 4XASA 1U7PA 1V7ZA 3NBMA 4JP5A 4PR3A 6CHYA 5I9IA 2BJVA 1L7VC 2G25A 1X7WA 1UMKA 5EJ6A 1LWOA 4IRMA 4Q9IA 5EEGA 1LLDA 5EZYA 1TZBA 1OH6A 4CEHA 5DNWA 3UC5A 3AFMA 2BFNA 5AM2A 3O47A 3RS8A 5KMGA 1JDTA 5EJ2A 3TZEA 2PLFA 2IXEA 4DWWA 2PXCA 1U4NA 4RNCA 2A35A 3EOAI 2MMCA 3GK3A 3JYOA 2GZDA 1T36B 4LSMA 4PG7A 1Q0SA 1SBQA 4PAWA 4DAOA 5KX5F 5AHWA 1JR4A 3ND6A 2OESA 3B36A 2CK3D 2PJRA 1XJWA 3UFXA 4E7OA 3BMXA 2EYQA 4KYVA 3ZOKA 3I92A 4IFBA 3RUCA 3BX1A 2GDZA 3PFCA 3IAHA 2EHDA 4FXOA 4S1NA 3TBKA 4YUAA 2GCPA 4CMGA 1X15A 3LCCA 3OWOA 2ECPA 1JHAA 3BKWA 1TO2E 2Z9CA 3H2SA 3O6VA 1SGWA 3OX3A 5FFFA 1PI3A 2ZRQA 2D0DA 5H70A 3WRXC 1RFGE 3KTAB 3K1AB 1YXMA 2ZSBA 3P4YA 4N3AA 2D62A 3I4CA 3MT8A 1S4QA 4W9RA 4YDQA 1NBIA 1TKBA 2RAFA 3GP5A 2LVBA 5DWDA 2UUCB 2C7BA 1OI7A 3QFTA 3JD2A 1JJBA 1FVFA 2PT5A 3KUDA 3T0FA 1Y4UA 1OV6A 3V4SA 5EIOA 3DOIA 4EY6A 2COUA 5GJCA 4CN9A 1ZD2P 1KJWA 4X8OA 2BR4A 2QN7A 2VT7A 3E7FA 5I5GA 2QRJA 3LKDA 3RYIA 2G72A 3KPYA 3VOTA 1PJTA 2VHQA 3K0KA 4E94A 2F6RA 2QE6A 2BFEA 1QAQA 2VJCA 2ZI5A 2ZQ5A 2EF0A 1QS0A 4BMNA 3S1SA 3ED1A 2QLLA 4PHCA 3ZD9A 1Q3KA 1TYAE 3MMSA 3M8KA 4RH1A 5A1JA 1GQOA 2CDNA 3I64A 4IDAA 4MUJA 1RQPA 4BEWA 3G23A 4OLAA 4WBNA 1KJ8A 3K6RA 5JSFA 3DFUA 4LDPA 4P84A 1Q3HA 3CNHA 1P45A 1UBJS 4BMVA 3C6ZA 4EYEA 4G5SA 4BTVA 3GFPA 1LSJA 2W2QA 1YIOA 4X54A 1CZNA 3CMCO 3NHLA 3S27A 1E0AA 1JAXA 4Y18A 4HLNA 3I61A 1IYZA 2WJGA 4ZKEA 2ZU6A 3EXIA 4L6CA 1F6BA 2WHYA 3SC3A 3SXUA 1RNLA 3TQOA 5A2GA 2CNBA 3L8GA 2VR1A 1YQXA 4DZTA 4DXHA 4EX7A 1HT3A 4OKSA 5AW4A 2XMRA 3LWBA 4M3NA 4RELA 2PS1A 5SZIA 1EXDA 3VNQA 4MRRA 4AJ2A 1ZH0A 4W8HA 1EHYA 3JD1A 4Y2TA 5F12A 4AO6A 3I58A 3MGBA 3EAFA 5KB3A 2X0RA 3CKKA 2F3TA 3T34A 4E88A 2FUG1 2VPTA 4IGFA 4UUPA 4U5QA 3WADA 1Q57A 1SMKA 5REQA 1SKBA 5JZMA 5HBGA 2W6ZA 4DLZA 3N7AA 2QAJA 3WX0A 4LHWA 1N6PA 4XSGA 1G7SA 1YRAA 1L4HA 4W5NA 4KH1A 3U2QA 5LP6F 1PFKA 3GAMA 1RTTA 3I04A 3KSUA 4CEJA 3D7MA 1XFAA 4WUVA 4KAAA 4DGQA 1G2QA 4JVOA 1KEUA 1WLSA 4U4AA 3E4CA 2DHCA 3I04M 4NZOA 3R0ZA 1UKBA 3R6TA 2CJWA 4HFMA 2JFYA 2P9CA 1OXVA 2YHIA 1F2TA 1GNQA 1YK0A 2WG1A 3HR4A 4J1NA 4JJFA 4PO3X 3GY0A 3F3YA 3G0IA 3L7LA 3ZGZA 4YMWA 3EIWA 4WKOA 2QJRA 2QTHA 4Q03A 4EYSA 4Z7OB 5JZSA 2DECA 3FIJA 1KGDA 2X0DA 2O3QA 2OXTA 2XZPA 1MJGA 3REQA 4ALKA 2GJ9A 2IZ0A 2ZG6A 4C78A 2CEKA 2Y2UA 3GAZA 2J4DA 3KQNA 3G2NA 3NHZA 1QHEA 3EODA 3EGDB 5HA5A 1Z0IA 4HDAA 4LRWA 1J2RA 2QA5A 4FR0A 3WL8A 4J3NA 1YCFA 4J4HA 1BQ4A 5FBHA 3E27A 3VSDA 3EEYA 2R65A 3N3AC 3RTCA 2W2MA 5K3EA 4BRSA 4V3CA 1LI7A 2ZR0A 2QLFA 3AYXB 3CLKA 1AN9A 4ALNA 1J42A 2HHAA 2V9PA 2YYYA 3E9NA 1DUVG 1QDEA 3NM5A 5JMPA 4C06A 4DJJA 1AQNA 2AZ4A 3G0BA 1P18A 2D1TA 3NLLA 4LDNA 4PPGA 1CZHA 3AJDA 5JD4A 3M9XA 1SFRA 5LIRA 2ZTHA 4J07A 1YA6A 3FVQA 1MB0A 2VZLA 4UVHA 3KT6A 3RVKA 3L49A 5KHLB 4PG4A 5AXBA 4JFRA 4W9NA 1N7IA 4UTPA 1DVRA 2OV2A 2QF7A 2RBKA 2QG6A 3K9CA 4NAHA 1M72A 5TMPA 4Y8VA 2BGWA 2G1PA 1TCBA 1IRXA 1JXAA 4F04A 5BWMA 4B3GA 2YVAA 3ET4A 3SZGA 4PS0A 1U8ZA 1SOVA 3EVCA 4B79A 4EZEA 1GKYA 5C80A 4H77A 1WSWA 3DEIA 5EUQB 3EA4A 3K35A 1XXHA 1NBOA 1NLUA 2KSQA 3TSOA 4LOIA 4Q4HB 1NBHA 4GW3A 1E9FA 2RCYA 5F2KA 4BEBA 2PRSA 1KPGA 3BTVA 4RKYA 4GSLA 3OU7A 5ICFA 2I6GA 4KI7A 3PQ4A 4ADSG 2Y66A 4QQKA 1HTBA 3WZMA 3LFUA 3DOFA 3PQ6A 4X85A 3V2GA 5KYXA 4HRXA 5K8JB 1QU3A 1QDLB 1SQ5A 3OCUA 3IP3A 4PAGA 1VLHA 2GD2A 5CA1F 3J81k 1Q21A 3Q4GA 4TRMA 4KSBA 4JA0A 2BBSA 3L06A 4ND8A 4U7TB 3TFWA 5BW8A 1J0DA 5AW1A 4Z4GA 1GGEA 4Z9BA 4L4YA 4BVBA 5H68A 4DIOA 4MQMA 1RKUA 3IEVA 3BFXA 3G2LA 1Q1BA 3OEHD 2PZLA 1VB3A 3Q6NA 4FD3A 1Y5LA 2QAIA 3M1IA 1GL7A 5DLYA 3D6HA 5DX8A 2XWPA 3QXGA 4U3JA 1PEAA 4PZ0A 3TIFA 4FHEA 1DG9A 2BGLA 2FNAA 4QTUB 2R0QC 4ID9A 4MEBA 2JJ2D 4BNNA 4DWJA 1NY6A 3I0NA 3AWIA 2CE2X 2W37A 4M1OA 4PRZA 1DUIA 1P62B 4YMVA 4ISBA 3TFOA 3QV1A 3AIOA 1EG2A 3E8MA 3R9XB 1VYVA 2XTZA 5ALDA 4ZOLF 3MT7A 3NH6A 4N3NA 3ANMA 4H6WA 3MYRA 3F71A 4D8YA 4EY8A 4EM6A 1N8NA 2ZKLA 5GOZA 3ZY2A 1TM7E 3N0XA 4QAQA 4KYTA 1E69A 1WY7A 5TQ2B 3CEJA 3KSZO 3MOIA 5JJKA 4F2GA 1M8KA 2PGNA 4OGGA 1L5LA 3AB3A 1JECA 2X1LA 1H8ED 2JD1A 4H6PA 5FUBA 4A8PA 3CQ9A 2CBXA 2E3JA 4OH1A 4GKKB 1CQPA 1CY4A 1Z36A 3HI6A 3FF4A 4S0XA 3WYNA 3QW2A 2D54A 2ZUVA 1L5WA 1SZJG 4BBZA 5B36A 5I4BA 5JCZA 3EUEA 2ZWOA 3L6RA 2ZS8A 2NZUG 5EKXA 1EVJA 1N9GA 5C8YB 3DAGA 1GCGA 3NTRA 2FSVA 3AJRA 4XJSA 2SHKA 1NU8A 3ND7A 3SLKA 1M9NA 1SBNE 3QJGA 3TXYA 5BYKA 2RHBA 3RKUA 2NO9A 2GT1A 3HCPA 4HDCA 4LDRA 4REQB 4WE3A 3WYEA 3SGLA 3BVPA 4A6EA 1BKDR 5TXGA 1RVV1 4C0WA 2D6FA 4URWR 5SY6A 3V4OA 1GPAA 2PL3A 3LC7O 2Z4TA 5H1YA 1OLUA 2B4QA 2A9VA 4E2FA 3BIWA 4LYEA 2FWBA 4J8PA 4UCXA 5IDYA 1ULSA 2GBCA 5LZ7A 1RADA 1KYVA 1OU0A 1P6XA 3EFHA 2WZQA 1RYDA 4BQQA 5JZ9A 2R96A 3TDKA 3BL8A 1C14A 4HVTA 4CU5A 4PAQA 3SPXA 3BWCA 3VU3A 5LQUA 3AFHA 4HFNA 3NTOA 4HVAA 1GZSA 3TOCA 4BN0A 4BCDA 4GC9A 3FGZA 4E5PA 2FZKA 2A0UA 5C5CA 3KD3A 1W59A 1TTHA 1YDWA 4UEWA 1AQJA 1YB6A 2AG5A 4ZXFA 2WA1A 3P0RA 4LQLA 1YRWA 3C7KA 1ULTA 1E59A 2EGHA 2L69A 2A84A 3O90A 1XRQA 3T3PB 2WKPA 2J9GA 5JC1A 5AJZA 3QA3E 2JEOA 1P9WA 1OWMA 5BRAA 1KKUA 4BJ3A 1ZU5A 9GPBA 2IV2X 1L4YA 2ZDHA 3B6IA 4ARVA 3GJ6A 4BNJA 1HNZB 4X20B 3OCVA 5CVVA 3SS7X 3NHUA 1U8CB 2R8BA 3ZWDA 3IA2A 4E33A 2QBYA 1BXRB 3K9HA 2EBHX 4JOBA 1SC1A 5KNBD 4BIMA 4FDAA 3NHMA 5BSRA 4RCZA 1Z6ZA 1TMGE 1SZPA 2WYVA 1ULAA 2XYVA 2B8EA 5EPEA 3ITKA 1CQZA 2ZJ1A 4XJVA 2K7ZA 5LXTB 5J2UA 1MOPA 3HO1A 2BCJQ 4JYAB 4Y2XA 1P39A 4RKEA 1UKCA 4TKUA 1Z6PA 4N3BA 4YT4A 1YL7A 1WDLA 3NXSA 2WM9B 3HM2A 3N0WA 5E6RB 4AECA 4EGFA 1XYYA 5EWLA 5CJPA 1NC3A 2W4QA 2Z83A 1ECBA 1J8MF 1QHHA 3O91A 4XCXA 3T35A 1JQAA 4EFKA 2O8BB 3Q7QA 1T4MA 4L5BA 4OQXA 4IQGA 5DN9A 4B40A 1XXHE 3PA6A 4IM7A 3NQ41 1ZD3A 3GUHA 3STXA 3BGDA 1R15A 1GU0A 3L4KA 1JBQA 2VF8A 2IEDA 2WTAA 4MITA 3QVXA 1QWSA 3RWOA 2HU7A 4Z2AA 2EKZA 2CFCA 4PYQA 3BDAA 5H81A 1XLUA 4QX6A 3IEXA 3WO0A 2C2HA 4L15A 3ETEA 1H0RA 1YI0A 5JISA 1K8RA 3VR3A 2K2WA 2ZETA 3QOWA 4TWIA 5EQJB 1PJZA 2ZP1A 4BWYA 1GUZA 2XMGA 2AFHA 3H97A 3WJAA 2QX7A 2NX2A 3MAJA 1IY1A 1HQYE 4H4CA 2J3DA 4OYLA 3COYA 4QDTA 3EC1A 3JARB 3KSMA 2ZBPA 1U4SA 3RJ9A 1Y1KE 1OKKD 4MV0A 1N9KA 2AJTA 4E70A 4M60A 4EUKA 1I4DD 2GEBA 2PSEA 4IEFB 3RK0A 5IANA 4YRFA 3E3AA 4PX9A 1NW7A 4BVLA 4KREA 1IFXA 2GRJA 3QLVC 4U00A 4HVLA 3IOBA 4QL3A 2P77A 2FDRA 4A2WA 1C1XB 4KXVA 3KLOA 3DW1X 3DUFB 4AG5A 3TL6A 4HSEA 3GLHE 3VM6A 1G291 2BLNA 2M6KA 1W4LA 2CLHB 1T2UA 1JNYA 4ONEA 3D1JA 4NBKA 5C37A 3DWFA 4A8JC 4QPDA 2VSFA 4NEQA 3AOGA 2GSWA 1IQ0A 3V1TC 5L3RA 4XUEA 3AVXA 4DQLA 3FAKA 1J20A 5FEUA 3K9NA 3R77A 5A5GA 5EE9A 2PH5A 4MR8A 1JG2A 3IV9A 2VTVA 3AM3A 5DTRA 2ZSUA 1PUIA 4UXIA 4ZANA 4LKOA 4J0JA 1KI9A 1J90A 3LQ2A 1RQ7A 5JPIA 4BOYA 5K2MA 4EBFA 1VMAA 1ESZA 2QG4A 4B7ZA 3BBLA 2PEZA 4GHWA 1XK6A 3GLUA 4KV7A 3U3KA 1NPTO 3AI7A 4GOMD 3ZW9A 2ZBVA 5DBFA 2PPVA 5ITZB 1AZTA 4W7SA 3VI3B 3PPWA 1XAHA 2H48A 1I3CA 2JCBA 3HKBA 3LPLA 1D1TA 3F6SA 3TMKA 3TOSA 3IKTA 1RCFA 2ZRMA 3I2HA 4A0SA 5BR4A 1RPNA 1DCKA 1GTMA 2LNDA 1FNMA 2JGDA 2Q4TA 4ODIA 5HRAA 3AHFA 1E2PA 2PKCA 2GWRA 2NZ2A 4GXRA 5AJWA 2BL4A 4GQIA 3DOOA 3T1TA 4A26A 3E1KA 2Z2XA 1DTWA 1BXKA 1ATZA 2ABWA 3LQ1A 2JB9A 5B2ZA 1E2NA 2V6FA 2QRVA 1GG5A 1GPUA 3CBQA 3EBLA 2IV7A 3UFBA 3LO8A 5G02A 2QD2A 4YPVA 3KRTA 2WYHA 4LFAB 5HOEA 2CXTA 5FPPA 2Y1CA 2CUTA 5HX7A 4B4DA 3G13A 3LRPA 3QQPA 2H1HA 1Z5UA 5CGZA 4B34A 3JW8A 4FQ5A 5ALMA 2H4WA 4PPYA 3O7WA 5JCOA 4D98A 3FTDA 3N2LA 1OI4A 4U2DA 4WOBA 1Z2PX 4XQ9A 5EXDA 5FOTA 1QORA 2C1XA 4M6WA 5BQFA 2AC4A 3D3WA 4K1LA 3E70C 1KZ4A 1I36A 2RGUA 4Y0VA 4H3SA 3OH8A 5C2JB 2YJTD 1KARA 4UDOA 1D2EA 3OLCX 1HFKA 2PKQO 4ACBA 2CLIB 1DWOA 2YNMC 3KFXA 5KWIA 3MINA 5COAA 3D7SA 3ETLA 2ZRGA 1EKXA 4AZ3A 4DJDC 5JZBA 2CXNA 1LV7A 2HFKA 4Z1OA 3PQ3A 3B6KA 4K6MA 2EKQA 2RIRA 5CXSA 5HEKA 4AG3A 4KXXA 5CCDA 4MVJP 2JLWA 3QMWA 4MJXA 4X71A 3E5RA 3SFZA 2VJLA 2YWJA 2FQYA 2AE1A 4UAVA 2AK3A 3FKSA 1X74A 3KE9A 5HNKA 2DWUA 2O2SA 3DE0X 4FYKA 3LDGA 2RGGA 4YRBA 1AXEA 3VGPA 4EHAA 1E3LA 3FNHA 4LC0A 3DO6A 1BDJA 1CUGA 1HL7A 3CLSC 4BBJA 4RWEA 2JFNA 2BKLA 2JFFA 3H5TA 4IDNA 4IIEA 2IOQA 2ZM5A 2HD4A 3CVWA 3TX6A 2F1HA 4JWTA 4LJ9A 3UJCA 3FYUA 3ZLBA 1NI4A 2A9QA 4HWOA 4QULA 3ROZA 6LDHA 2V1UA 1E66A 3PZRA 2OWDA 5L3QB 3FDXA 1FQOA 4NABA 4LHSA 4AC9A 2JJ1A 1FP7A 4XQEA 2V45A 5TR9A 4H6VA 4EPVA 3I39X 3CEAA 1R5JA 4X45A 1ZC4A 2IBSA 3NYIA 2E4WA 4GXNA 3A2MA 1Y1QA 3A1VA 3U39A 4OBXA 1EVKA 1GHTA 2R3SA 2VDVE 4QICA 1PQ4A 1GOTA 4EMBA 1L4BA 2VXYA 3EMVA 4EG1A 5KQSA 1AK1A 1KYTA 3CLUC 2IZ5A 3OZCA 1U0RA 3QE2A 4O1MA 1DIBA 3MWLA 1KOLA 4DV7B 3W8FA 2A5LA 3ZV6A 5LOVB 2NVUB 4R1MA 1A8UA 2ZULA 2VRBA 3KQQA 4HWKA 1UFOA 4KPGA 1MV8A 2FI1A 4EF4A 3NIFB 2BFPA 4D8UA 3Q0IA 1N34B 1FFGA 4X97A 3PFFA 2WFLB 5CFLA 2ADOA 1TM3E 4M38A 4JYZA 4BZWA 2X4DA 2B25A 2GTPA 1W35A 2ZR8A 2PKRA 4FGLA 2IKSA 1XVVA 5IBCA 2C42A 3KKNA 3E35A 1EZZA 5HS6A 2V6IA 4RSRA 5EZYF 4FS3A 5LQNA 1BDHA 1XRRA 1WF3A 2Q50A 4PFKA 1WX1A 4XUCA 2Y2VA 4DA7A 3FE2A 3O26A 4FYHA 4M1YA 4OP2A 1QVAA 2ZR9A 2X86A 3NZEA 4AJKA 2BMAA 1JDNA 3ABSB 3BMOB 3UHFA 4KHZA 1HRDA 4EVRA 1YOBA 1L7AA 3ZK9A 1FUUA 4TQAA 2YHBA 1M67A 2Y1OA 2ILVA 5HJ7A 3LXXA 4JBWA 4XIIA 4Y0AA 5DO9A 3DVQX 3QWIA 4OQYA 4PNEA 3AVPA 3LW7A 3H87A 4NV0A 4OF4A 3K6SB 1QCZA 4YRRA 2P9EA 3ESYA 3ZGXA 2XKAA 4WADA 1FL9A 1X7YA 4CIWA 1JZTA 3AM5A 1EUDB 2QSYA 2P78A 1NC1A 3AJEA 4FDMA 3W7AA 4F5YA 3W5DA 1M74A 3LDUA 4YAEA 1O6CA 1FBNA 1NE2A 1OXTA 3F2IA 1JXMA 4JASB 4X00A 3FWZA 1KZ1A 4B45A 4C0JA 1JJAA 1HFWA 1BS9A 1SVWA 2X9NA 4FDVA 4I2NA 4ZI2A 2BV3A 2Z8YM 4X1YB 3UJ9A 2R4QA 4IIJA 2HSDA 1V16A 2I34A 1NP3A 2XOKD 3IQFA 4JCOA 1F7UA 5AI5A 3MFYA 2C8LA 2JIRA 4PHHA 4PGAA 4YR7A 2FPLA 5KC8A 1WNFA 1H1LA 1K7XB 2DT5A 3W5AA 2JFWA 1VI5A 4F6RA 1MW9X 1G1MA 1YBFA 2AOXA 2HU8A 4FGZA 4RPLA 2B34A 2Q3JA 2ZJZA 3WY9A 4A91A 4D6YA 1NQ5A 2ZRDA 3LFHA 2O54A 1KK0A 2EBWA 2WMNB 2HF8A 3ESBA 1DEOA 2RK6A 3W34A 1PIWA 1WJGA 4WBNF 5T4BA 4HDSA 4L22A 1TVMA 3V80A 2HF9A 4J0KA 1FVHA 2V3WA 3IHLA 4FUTA 4NYJR 1MKYA 4Q4LA 1EE9A 1SHTX 1A5SB 2P7IA 3D8RA 3GZTB 4L5JA 4Q21A 4JMPA 4HR7A 3LAWA 2VNHA 3HRIA 3LGXA 1W4ZA 4CI9A 4PLWA 3CJRA 3ND5A 3TOZA 5EJ9A 2IY7A 1ZS9A 2NSHA 5HDBB 4U7PB 4CF7A 2ZVJA 2J3QA 1KHTA 2I1VB 4KO2S 4XKJA 5AIAA 4B3DA 3SOZA 1OA1A 2EAUA 4HX9A 3K05A 5YASA 3AGQA 1C1DB 4XW2A 4F21A 5DT2A 2XVYA 1EI9A 2WJYA 2GHIA 3ZCSA 3E03A 1W0JA 3TNFA 3AW8A 1IXKA 3H4MA 2P3QA 4HF7A 4KRFA 3FYSA 1TEZA 1QB8A 4JI2B 4OJNA 3TMYA 3ZZNA 1ZH4A 4W5HA 1ADCA 3B7GA 3OJEA 1ZYUA 4MROA 3H6KA 4O25A 1A9TA 3ZZMA 2GDJA 4E08A 4LA4A 5H3CA 2AFVA 2OV3A 1S7GA 5CA0A 1GTSA 5D84A 2GK6A 2HIGA 1U6KA 4IZOA 2PSSA 5BYJA 3AF0A 1D9ZA 2O2HA 3KC2A 3MG9A 4LYFA 4D3FA 2IXFA 3P9IA 2Q6VA 1M2OB 4R6XA 1DPFA 1E5DA 2WAXA 4Z9YA 4KN9S 2H2GA 2QZ4A 3Q8XB 1IXRC 3RVQA 1E1QD 1KSHA 1YS7A 3KPVA 3FKJA 3QVGB 5AI0A 2FMTA 5JJIA 4KNVA 2PX2A 3A3YA 4E5DA 3D5EA 1FFAA 1MJHA 2VK4A 4L73A 3KWFA 3SWWA 4RKRA 3REGA 2IXTA 2VK1A 1WXDA 3CJTA 3QFCA 1RS0A 3LHSA 1K7EB 3N2KA 2GEVA 2DVMA 3R6WA 1U8YA 1CUYA 1NXXA 1U3FA 4F06A 5SZJA 1DAKA 4YMTA 1ORRA 5CBPA 3I53A 2ONZA 4JN6B 3VV3A 3IBFA 3VMMA 4IUDS 2ZXFA 3FETA 1UFKA 1H0SA 3TLKA 4TN5A 2D5CA 2OBNA 2VH5R 2Q46A 1TECE 5HIMA 3NC0C 1YJCA 3GJRA 4AO7A 5DM70 3AOEA 4LF9B 4MLZA 4CDNA 2NU6B 3STYA 3BA6A 1F8XA 2VHZA 1T1RA 3BIOA 4AY4A 2H1SA 2B21A 1J21A 4Q1FA 1WEHA 3QLTA 3OCWA 1F06A 3PPVA 1QK3A 5ESDA 1XAJA 5IXJA 1Y6GA 1G8MA 1G6Q1 1RU3A 3OZWA 3P52A 2WZDA 4V2UA 4EI8A 1PJ8A 2H7XA 2IVFA 3ED5A 3GHHA 2LCFA 2OBMA 3DZCA 4XLTA 1ZD9A 2YOHA 4MWOA 1BVYF 3RFVA 2ZB2A 1EGVB 1KKLA 2NADA 2RC6A 3VZPA 3R9IA 3NHWA 1IN1A 1E92A 5G0TA 4C07A 2NZJA 1YBVA 2WP8J 2FPKA 4V03A 4B74A 1SEVA 2JANA 2B7CA 2DBVO 1QH8B 2WSSD 2NZYA 1TD9A 2Q5OA 3FFTA 1T4CA 1CY2A 3JXEA 3KZNA 1ZHFA 1KU0A 3PR1A 4G0XA 4W7HA 4Y3UA 4CVNA 3BE4A 3ER6A 1YQTA 2XMSA 1PR6A 2VSQA 5AOAA 3FPHA 3D8NA 4LHYA 2A14A 5MN6A 1Z74A 1CT9A 2NTNA 2G1UA 3E5NA 1Z37A 4ZIRB 4QDXA 1XR3A 4TWZA 1TT7A 5FWYB 4K5QA 5CD9A 4BNWA 4GD3Q 2MSDB 4ENUA 5DPMA 4P4TA 1K6MA 2P68A 3FWKA 5I4IA 3M3HA 3QMPA 1R9MA 2YXDA 1P1BA 1VG0B 4IIBA 1N5RA 3P20A 4Z3DA 2BFWA 2BR5A 1ODCA 1K6EA 4XCQA 4CQMA 4E6PA 4KQ2A 5C5DA 2REOA 1XMSA 1EBBA 5BQXA 5FHRA 1Q3TA 3DMGA 1A69A 1ISPA 3Q0TA 4N82A 4KMSA 2WWVD 2VJMA 4ZQHA 1GG9A 3WMFA 1PTKA 5EYPB 3AO0B 3ZUGA 3OMWA 5TX7A 2HLPA 2GVDC 3D02A 1GL6A 1QNFA 4UARA 2VDQB 3E53A 1Y6FA 4XUDA 1QIJA 1XMVA 4MW6A 2FFHA 3QYFA 4YLEA 1MO5A 3F46A 2GEDA 4A7PA 3UB4A 1V3UA 2I80A 2OUKA 4HXYA 1TU0A 1MC8A 3CLVA 3TLZA 4KR7A 5AKLA 4RVGA 1RWNA 1XMJA 4BGEA 1AKNA 4ER6A 2J6BA 3WDLA 1H2EA 4G8DA 1R1DA 2JF0A 1G6OA 2FQXA 4MUYA 5EQFA 1UPAA 4A2PA 4G1FA 1E1YA 5DGHA 2Z43A 1T6ZA 4PZZA 3D4IA 3GC6A 1YZLA 1N8SA 5HE9A 1JFFB 2HHHB 1R0SA 3NONA 3N6RA 2D2XA 5JS2A 3OQMA 1NVTA 3EDCA 3KOWA 3IILA 2P75A 4MP8A 3TZBA 3I5UA 3QVTA 4TRRA 4WOKA 3P0FA 1AO0A 4WKPA 4MRSA 1P0QA 1Y9JA 3BMNA 4KBGA 4YJDA 1BJTA 1Z7EA 2IY8A 3I8SA 4FC7A 3KZXA 1N6LA 1E9RA 5KNDH 3LUAA 1Y4DE 4FNAA 5JXIA 3G2MA 3G0CA 1LNZA 1YJ5A 1UEJA 2EX4A 1UBHS 3VX3A 5K09A 1QPGA 1GZ4A 1MGOA 4MP6A 3CGWA 4Z3KA 1V6CA 1XX6A 2UYQA 4JEUA 4OREX 4WN9A 1RMTA 2Z30A 1CZOA 4U9UA 2DFKB 2XVXA 3RYTC 1HEYA 2V5UA 3M6LA 3P8ZA 5BP7A 4FZ3A 4HRYA 4R2KA 1YGPA 3I05A 4E03A 1MQ9A 3OX1A 2FJUA 1RQLA 1QP0A 4E09A 4AMGA 3II6X 4KRYA 3AXSA 4DM3A 3QY0A 3ESQA 4MTLA 1OV4A 3SK0A 1ZPDA 4PVCA 4D4IA 3PYXA 3UENA 5JJBA 1OGYA 4REOA 5EP1A 5T8KA 3CH5A 4PO9A 2Q9CA 4UNRA 3G9UA 2VOEA 3S70A 3PXEA 1DI0A 5K6TA 5FUXA 2N0SA 1JIQA 1XTRA 3UUWA 3YASA 2C9DA 1JHXA 5IJXA 5LKAA 1KMHB 1FXUA 3MCUA 3MUFA 1JIXA 1BSVA 3KM0A 4GR9A 5BV0A 4MVJA 4ON9A 1DADA 3KR0A 4UE6A 4D57A 3JCZA 4BUCA 1OIXA 4DZRA 1O94A 3IOMA 4K9PA 4C6TA 3ITNA 4AJ4A 4RIGA 2YUIA 4BCBA 1PHPA 1OU4A 1GT6A 1QFJA 2HK9A 5TARA 4HB3A 4CNQA 2ZYGA 1F1JA 4FGWA 1LDYA 5KTTA 1OXXK 1TT5A 4OX9B 4GMFA 4N48A 4C4SA 2CDCA 1X39A 6ADHA 3ANNA 3CVOA 1A98A 3LA8A 1IOLA 4MQFB 2HWYA 2WD8A 1QPBA 1JLLB 3K5IA 4NZMA 4QNNA 5ERGB 3ICOA 2YFKA 4BO5A 4E4TA 2A0YA 4P2GA 5BSFA 5BPHA 3LU1A 4HWRA 4PVDA 4RVNA 5DKFA 2W98A 3L2OB 5IBPA 1SXPA 1FLVA 4ZCRA 4K6GA 1ECLA 2A0WA 2G07A 4C7MA 3UMMA 4JEMA 3HCDA 1N7JA 3RAFC 3Q3VA 1Q7EA 1PQUA 5GZ3A 5JBQA 4RS4A 5TS3A 1GTG1 5B3JC 2AN3A 2EZ9A 4JT8A 3WGNA 3P7MA 4FHCA 1G55A 1T2NA 2QD5A 1J6UA 5AP9A 1MRSA 3M7IA 4CM7A 3NNNA 3ZE6A 3BF7A 1Y3HA 4PLZA 4QBIA 3TAHA 1TX4B 4N9WA 1IJBA 4QHSA 3SOPA 1GZ6A 1YE3A 3EBPA 3H84A 2ZK7A 4QVGA 4IV8A 4O8CA 3VKWA 3W1VA 2RJ3A 1A8PA 4LYAA 4FQ8A 4IQ0A 3TR5A 1LPOA 2E2WA 4CKWB 2JIMA 1E3JA 3FCEA 2DBYA 2BISA 4IDPA 2YASA 3IBCA 3WNDA 1OXUA 1N2CE 3A9CA 3A26A 3GNSA 3NAQA 3O38A 2AQHA 1X1QA 5E9JA 4C87A 4ZJYA 3R6DA 1FNBA 1N3YA 1GLVA 2P6MA 3M5DA 2REQA 4GZ3A 4HDKA 2PZJA 1DKOA 1C7ZA 2ZIEA 1GQYA 1OVGA 1PWXA 3I2FA 4P08A 1PTJA 3A58B 3F9IA 3E9CA 1DX6A 4DR2B 2ECFA 1FSGA 1ZIOA 2AEJA 2WT9A 2YIVX 1W34A 3PC8C 4GYYA 4L95C 4ALIA 5J2TA 3MJSA 1WM1A 2JFQA 3O9MA 2QVCA 4RPIA 4LKRA 1KQGA 1P4JA 1M1ZA 1ULUA 3PDIB 4Y2JA 1QHGA 3UMVA 2W2OA 3A04A 2AB0A 1LNSA 1KWKA 5FDFA 2VYFA 2MYPA 1US8A 4TMFA 1PNVA 3RGGA 1RRKA 4KACA 5K0SA 2P90A 2PXHA 2DFDA 3VU0A 2BVNA 5HJ5A 1NUHA 5C52B 1PD0A 4B3HA 2AE2A 1Z8HA 4MXDA 3KXPA 4JK3A 2FR1A 3GJ3A 4F4CA 3H83A 2OFWA 4ZYLA 3H9EO 3HP4A 4N6GA 1JEAA 1XMXA 3T5TA 4EA8A 1YMVA 2B1QA 2OSVA 2QLBA 1AKEA 3MTGA 3TMAA 2PM8A 3DDSA 1ZSVA 2ZTUA 3PWSA 3RSHA 4A8HA 3KSRA 1SHZA 2O4CA 1UEXC 4NBTA 2FOXA 2YFHA 2GJSA 3GT4A 1OBCA 4NCXA 4V0NA 2YV1A 2OCDA 4BJ6A 1NXTA 4DLAA 1T6YA 1X7HA 2O52A 1J56A 1G42A 1QK4A 2CZGA 4FYMA 4ZWNA 5H83A 5U9CA 2DKOA 5D7NA 3I1YA 4A27A 3KUUA 2OD2A 4JLDA 1P3JA 4IMJB 3TB6A 2OM2A 3T52A 1KQFA 5F76A 4QEDA 1XROA 5FEMA 4RKQA 1RAGA 1U63A 4LZJA 1ECFA 1FSSA 1CETA 1UBEA 1VBKA 1R88A 1M0TA 3DVSX 4G1UC 4F91B 2NG1A 2GZHA 5TV2A 3WGTA 2X3YA 2CC2A 2BFDA 2OLEA 2XMQA 2ZUUA 3K7EA 1KZGB 3C7TA 4F9GA 2CVOA 3WMGA 4PQGA 3GOHA 5HTKA 4CR8A 4MW0A 3LBYA 4TM7A 1DG1G 2FMKA 3P2YA 4NBWA 4YI3A 5IJ0A 1EE2A 4MUKA 2JGMA 1IN6A 1QE0A 4Z8YA 4S1OA 1ZN7A 3JQQA 1KIAA 3H6HA 5EY5B 5I01A 4XYEA 4BKOA 4NZ9A 1RC1A 1FNNA 2C1ZA 1GTVA 3RNOA 2C5AA 4J9UE 2AW5A 4NENB 3MJFA 4K0KB 1U9IC 3VKVA 1AHIA 1H3EA 3IUBA 3MRSA 3ELYA 2VHYA 3Q10A 3VSEA 5CFMA 1U1GA 4C2UA 1Z07A 2X42A 5B7QA 4KO8A 5HIKA 3ER8A 1V96A 1C3JA 1VDZA 4NZZA 4US0R 1XHFA 4OQFA 2QTBA 1VMDA 3OESA 2J33A 4RV5A 4TTRA 3W2FA 4GI1A 4B6SA 3K1TA 3FJOA 1FOEB 3KR1A 1T4GA 4DUZB 4GZMA 4YRAA 2I3ZA 3NH9A 5A4MS 4N7JA 3DM9B 5AYVA 3RABA 3FPBA 4WESB 4YAUA 3TECE 1G7RA 2VUSA 4MOWA 2P3SA 3I09A 1XZBA 4AKHA 1K2VN 2WG2A 1E60A 4BNDA 4JQCA 4V0ME 4RJJA 4CMHA 4EITA 3C3PA 3ZG6A 4BB6A 4YRPA 2Q27A 4BKPA 4L8GA 4UM9D 1ACJA 3AUXA 3EGIA 3VHXA 5LD2B 1C81A 5HK8A 3ADDA 4EZIA 2JK1A 2FEPA 2QMYA 2YXLA 4FNGA 1JHPA 4HNAB 3C3JA 2IP2A 3B12A 4PCLA 3CR3C 3G9QA 2PGAA 3VV2A 2C2ZA 5FPKA 5ALLA 4AZTA 4NXMB 1E2BA 2WIFA 1HYEA 1FSFA 4BNTA 2OFPA 4EPRA 2PV7A 1U5CA 2V7UA 1ISIA 4NBRA 3U0BA 4B6PA 2Q0XA 2F8LA 1XPJA 2WHRA 4UNQA 1B3BA 1FUIA 4FI3C 1KVQA 1MB2A 1U28A 4H0CA 4QYIB 3TWOA 4EPYA 3BD9A 1YZHA 1WOMA 4Q7MB 3PCRB 3TUJC 5E1DA 3SEAA 3ZWXA 4FINA 3G8CA 3W5IA 3JD0A 3L4BA 3A4VA 1J97A 1RI4A 3B5JA 3PCXA 4BVGA 5IULC 1T43A 1G3QA 1ZMXA 1FSPA 5KQPA 2FWAA 3ST7A 2R6DA 1NFFA 2OBYA 4NVRA 5A4AA 5F5NA 4L16A 5IUNC 4OGWA 3WRYA 1QLJA 3UZUA 3CG4A 2X15A 2BGIA 2VDKB 5DN6A 5LUAA 5H82A 4YIHA 4G2NA 2NTVA 2BBOA 4Q3EA 4I9NA 3ROGA 3I6YA 5JH7A 4FFDA 4DG8A 3PWZA 1QSGA 1XTSA 2VP9A 3TQCA 2LIPA 3AERA 3LWZA 4ISCA 4DILA 3S2ZA 4UPEA 2ZYIA 3TIVA 1QGYA 4O3MA 1N2HA 3WNBA 1WZNA 2C9CA 5FOSA 3MWGA 1Q0PA 3SHQA 3PEYA 3UXYA 1TMKA 2CDRA 2ONCA 2PUJA 3I1JA 3ITEA 4HS9A 5EMKA 5DCLA 3E3MA 1GL3A 4KBYA 4A2CA 4BMOB 4MYCA 4NPCA 3ONDA 1LV8A 4XFJA 4JJKA 3OCCA 4D3YA 4OL9A 1H2HA 1G21E 2HPZA 2HWWA 3A1NA 4IJWA 4DPKA 5CVDA 3VHQA 2VWHA 5EG5A 1K86A 1AK9A 4AZSA 4WZBB 5ALZA 5CX4A 2XTAA 3F90A 1USKA 1XVIA 4DLLA 4OYYA 3TD9A 4KTVE 4NP6A 3X1XA 4OSPA 2HK7A 4WKNA 3SHTA 1ACMA 3ERCA 4CKBA 3HUEA 4D3DA 1I4TD 2ZB4A 4DXDA 1EUYA 4OQQA 4XDHA 2X7JA 3PT5A 2VPWA 1OGIA 4HAVA 2UXBB 2FN8A 1TXGA 3FLEA 2PG3A 1S7CA 3CISA 3M1YA 2PSDA 1ADGA 2WSYB 4IMRA 2GUGA 3ACCA 3WZ2A 1Q6YA 4DIKA 2NXWA 2B4TO 1Z82A 3EEIA 3QF4A 4BY9E 3ZWNA 1OBFO 1Q19A 3V3KA 3CRQA 3DNFA 1WW8A 2AF4C 3M6IA 5EWJA 1XMIA 5CU7A 4UQLA 4HAUA 3KB2A 2O59A 4LJ4A 3VR3D 2A3RA 1ZNYA 4XGNA 1H3FA 1TZJA 2XWBF 1ZUD1 4A9AA 4AF6A 1C0EA 3BREA 3L0DA 3C3MA 2HPAA 4XVUA 4FE4A 1R9GA 4YWHA 3V8BA 3KVNA 5A06A 1DC7A 4LTNA 3NYWA 2FZWA 4A2QA 5CVTA 3OM9A 2J9ZB 1ZGZA 4HH1A 3U4GA 3AR6A 4KQJA 2G9QA 3BSWA 1QVVA 3IT2A 4E5MA 1XD9A 1ZRHA 2I4IA 2EJVA 4O2BA 2RBEA 1L4NA 3SM3A 1GZ7A 5JD5A 1MVLA 4GP6A 3VU9A 4JJEA 1RXYA 4ATNA 3O21A 4FIZA 4FB4A 1V5IA 4G67A 1WNTA 4MYDA 3KSBC 3GP8A 3KQSA 4CV0A 3TNYA 2HFJA 5T3YA 4LJRA 3M4YA 5K8VA 3AFOA 1Z0UA 3L04A 5CT5A 3ODGA 3I62A 3CZ9A 3SCZA 2UZ0A 4L5CA 1B1CA 3WISA 4BVHA 5ARBA 3W8NA 2WIKA 4ZAWA 1LEHA 2G4VA 3HZHA 9LDTA 1WXIA 4C29A 2VT2A 5BV1A 1U2DA 4EKGA 3L6CA 1MIOB 2NM0A 4UU7A 2BGRA 2ORIA 3QRWA 3AQ4A 2O0JA 3QUQA 3NHYA 1ZBQA 2R7LA 1YBMA 4FCWA 2Y0PA 3VYSB 4G8CA 1F1BA 1Z4NA 2BZ0A 3AIKA 2NO1A 4C76A 1NW6A 1PJBA 2A78A 3A6GA 4IQ8A 1NLFA 4JUAA 3VOBA 3I9FA 2OY0A 2QQ0A 4R8LA 1Y1RA 3HU5A 3ZY6A 2ZZMA 5CLFA 1RYEA 2ZCVA 1MO6A 1L4MA 3IQWA 4NDNE 4O1IA 5CUQA 5CA0F 1MO2A 1V4BA 1H4SA 4PQFA 1B26A 5HKKA 2Y0BA 3IDAA 2IYYA 3GAFA 4RH0A 3OEWA 4RPKA 1R8XA 1EK2A 1ZCJA 2NSYA 4AUMA 4HXEB 1K8YB 4G0YA 3NV9A 2R60A 1XPOA 2JEYA 3IJRA 3C4VA 3LOQA 3PFBA 4I3GA 2AMVA 1WSBA 1UMCA 3HVHA 5JASA 1XDDA 3VPGA 2O6LA 4HNSA 2ES4A 3IAM6 1CDDA 4DNOA 5CIWA 1J2UA 1UL1X 4P53A 3VZRA 3CZAA 4KQHA 4Y6PA 1L6IA 3TKYA 4CM4A 1ADJA 1SR8A 3S40A 4RW0A 2XXAB 3V4LA 2Y0DA 5L3SA 1DFGA 4HGNA 5ED4A 2E18A 4EG7A 1OJLA 1I0IA 4BFZA 3RYFA 4RD0A 4B80A 4F71A 5AKEA 1QQBA 4QUHA 3SU8A 4D0RA 4E3ZA 4GPBA 1RJDA 2JAPA 4N01A 2BT4A 1M2NA 4AUNA 1Y37A 3N0RA 3JWPA 2Q9BA 4JMLA 3ZXIA 1NVVR 1L3IA 2BAGA 1VJRA 3ROFA 3X43A 4XWAA 4IICA 5EUBA 5DVZA 1MZVA 1SC6A 1WWKA 3HXTA 3TR0A 3BCHA 4BS9A 4YS6A 4UVDA 4PSDA 2HA7A 2I6SA 3V2UA 1ZU4A 2CXOA 4QXMA 4Y2UA 1NF8A 2WVAA 3IQGX 1NRJB 2QOEA 5IVIA 3GVCA 1A9RA 1HOTA 3FRHA 4DBVO 5IMSA 1WV1A 3RV3A 4B6JA 3QBEA 2G9VA 3QLUC 1S3FA 3OZDA 1RXUA 4R1OA 3TLEA 4CF3A 4XVCA 2VBCA 3H42B 1WVMA 3NEAA 2HAEA 2PLRA 2BKXA 4J90A 1XP8A 5ADHA 1BQ3A 2PT9A 2B61A 5EHXA 2HJVA 4UHKA 5KYWB 1R16A 4YJHB 4D4HA 4NULA 3K6KA 3VR5A 1LK7A 4IDFA 5HM6A 3K0SA 3LP5A 4AY5A 3D0OA 3FKSD 3GRZA 5TPZA 4MA5A 3GJ8A 4C7KA 3ECCA 1SKAA 3V8EA 4LOHA 2JEZA 3LWDA 1NWHA 4OMUA 1H2WA 1JTEA 2AXNA 3RAEC 4OBEA 4OHMA 5E6SA 1GJRA 2ZIAA 1PR3A 4CCAA 3URKA 1OX4A 1ZP6A 3MLAA 4EB6B 4C2AA 3FSJX 3PTZA 3DWIA 4ETNA 3CX8A 4J0EA 5D01A 421PA 4LI0A 4ZYUA 2WICA 2ZCUA 1X8JA 2JJ1D 2EQ5A 1EZ1A 3ZS8A 4A23A 1I1HA 3RRFA 4M99A 3F7OA 4DEVA 3E4DA 3MUNA 2YN0A 2L42A 1U81A 1VFNA 2G09A 1E63A 3D6VA 4F6CA 1IM2A 4MGZR 2D2FA 4C5CA 2P11A 1N6NA 2PKYX 3SJ7A 3AH8A 5TT0A 1NYLA 1XLVA 4YJGB 2A1IA 5GADl 4W1RA 1J8YF 2MSEB 4M0DA 4WY8A 6REQB 2I9KA 3DVRX 1ODKA 5PNTA 4F4FA 4Q12A 5AM0A 2FWRA 4L4RA 3DE1X 2P6RA 4J43A 4PGMA 3NAMA 3MWEA 3T9DA 4AKTA 4FWTA 2V54A 4P3KA 3PFKA 5ALYA 4HPJB 3IT1A 1QYWA 1E2HA 2OZEA 4R9VA 3WK8A 3GXOA 3D9QX 3HCNA 4OY3A 4F0JA 1C1YA 1TRHA 4M7RA 1NQUA 5ENVA 2YV4A 1TA0A 1RD4A 2OAP1 2WWIA 4FJ1A 2H00A 2VDWA 3U1BA 1IUNA 1T2FA 2ST1A 3PJDA 4MDHA 4TT3A 3R41A 4WFIA 3QKSB 2DF8A 1II8B 1HC7A 4D0LB 2CF6A 1UXHA 2BUBA 1CQWA 1T1JA 1J2EA 4JC4A 4KAXA 4DW8A 5HQ3A 1PLJA 5LBTA 2WAYA 4D2IA 3G0HA 3QYJA 4BVJA 3DFMA 3GUCA 4MPJA 3FY4A 4P82A 4US1R 3N2GA 1EYZA 1RHRA 3PLNA 3K8YA 4WFQA 1E6MA 2WYUA 2GD0A 2A4MA 4DANA 1O0BA 3CA8A 4UQPA 2FSFA 1YVUA 4TMTA 4E5NA 3RBAA 1GSAA 5HDQA 3RTDA 3KU1A 2FN4A 4KVFA 4RL4A 1N1DA 5FTNA 3QF7A 3ZS9A 4ARUA 5DYNA 2HA4A 2FW1A 3MTEA 1R4MA 2BP7B 2KMLA 1EX6A 1G9XA 1MTOA 4FFPA 4YUXA 4EMSA 3ZZTA 3ZE2B 2EFEB 4KXLA 1GARA 4MQBA 2J0VA 3EGXA 3D5TA 1IN4A 4AJ1A 4DC1A 5H16A 3DT6A 5A0TA 3L01A 3NEJA 4P1ZA 4DLRA 2NU7A 2XQKA 4FMCF 4X3PA 2ZT5A 3NBYC 3VSBA 4EKIA 1P0CA 1E5QA 4PWZA 1R9NA 5DNDA 2XVMA 4XSHA 2XZOA 4TV9A 4WDRA 3SZUA 3OO0A 1U1IA 1KFBB 1B8VA 2X2OA 3JVUA 4MVJF 1AS2A 1E3WB 3PIRA 4WQMA 3O2JA 1TL7C 4QQNA 2RH4A 4C20A 3QUTA 2W58A 2OXIA 4EG8A 1TO1E 3HBAA 3CY6A 4RD4A 4RMJA 2QENA 1U2PA 3IP1A 3WQHA 1B00A 4BMCA 5JCPA 4EKNB 1GYRA 2HBQA 5F7OA 3NNSA 3PI7A 4NCJA 5C8VA 1W5SA 3C3XA 1V35A 1C8KA 2RH8A 4ENVA 2VQSA 4LRUA 4X94A 1F38A 4MHOA 1FNSA 3DVAA 2C0PA 3FB1A 4O33A 5E9QA 1TCUA 2VPXA 4LSZA 3TB4A 2VJQA 5EJFA 1YZ3A 5LMCA 2I4LA 4JS0A 2NT3A 2F67A 2P3OA 3KQVA 3NHJA 4WXYB 3SAJA 2XGJA <