1SB9A

Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-glucose
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
340
structure length
340
Chain Sequence
MSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIENTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords wbpP
publication title Crystal Structure of WbpP, a Genuine UDP-N-acetylglucosamine 4-Epimerase from Pseudomonas aeruginosa: SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 123
structure length 340
sequence length 340
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sb9A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1sb9A02
2FHSA 1ZMTA 4CODB 5BNIA 1UDCA 3O8QA 2G82A 4IM7A 2PKQP 5F1PA 4MP6A 2GGSA 1MV8A 1PEDA 4YB8A 3ZHZA 1SAYA 1YB1A 3O03A 5ES3A 3C1TA 3MJEA 2QYTA 3DHNA 4JGBA 5BQFA 3RFTA 5B4VA 1I36A 1V8BA 3JYLA 2HLPA 4QFCA 4R5HA 3I9LA 1E5LA 2E48A 2A92A 4DBVO 2FMUA 3KO8A 3VZPA 1GR0A 2VYVD 1FDUA 1YWGO 4CLOA 4L4RA 3PI7A 1B3RA 4BMSA 2Y05A 2Y1EA 4R1TA 2PY6A 3TZCA 2VUSA 1VI2A 2CDAA 3AOGA 3ZU2A 3E5MA 5EIOA 4DBZA 2ZKLA 1NQOA 2EKQA 2EP7A 3HNPA 4B4UA 1BXGA 4CQLB 2OUIA 3JQAB 4J3FA 4HX5A 3RQSA 2PFGA 4YT5A 4XR9A 1OBFO 4L4XA 4LSWA 3K5PA 2UDPA 4TRRA 3H9GA 3UICA 5COBA 1NXQA 5ADHA 1DLIA 3NDIA 2O7QA 3K8ZA 4Y8VA 4PGFA 3PXXA 4N5NA 2Y0DA 3VC7A 1ISMA 2ZB4A 5AXAA 5AVOA 4BNMA 3C3XA 4KDFA 3G17A 5ITVA 3AY6A 5A3VA 3AY3A 4BNVA 1UXHA 3PJDA 1I5RA 1R0KA 3NV9A 6LDHA 2DFDA 4XIYA 1RJWA 4P38A 4P8RA 5G4KA 1P0FA 2CF5A 2E37A 3ZCXA 1JTVA 2IXBA 3N58A 4I5DA 3PYLA 2DQ4A 2GN6A 2RH8A 2ET6A 4FOSA 2VHWA 4E5MA 3RBZA 2RBEA 3N74A 1MXHA 1U4OA 2JAPA 2PA3A 5L53A 1E7WA 3LLSA 2RAFA 4CM4A 4ND1A 3IJRA 4CMJA 5G0WA 1ISJA 2PGJA 2X5JO 1DJQA 3BMCB 2NTVA 2X9NA 5ILOA 3K9QO 3UVEA 3ANLA 5A4DA 4ONEA 2HSDA 4UUNA 1EVZA 4LK3A 4NH4A 1DIBA 1H2HA 4IXTA 1N92A 1WXDA 4GX0A 2F00A 4IJUA 4LVCA 2YHIA 5JDCA 1YOVB 1YDEA 1W73A 2FP4A 2Q1WA 4OXYA 5THKA 3VHRA 4B7XA 3IP3A 4J16A 5TLSA 5TC4A 8LDHA 1I3LA 1T2FA 4J1QA 1LRLA 3S8MA 2ZTMA 3JYQA 3IKTA 3PFWO 4IGFA 2VHVA 3HZZA 3DMYA 1BHSA 1E5QA 4XYLA 1TB4A 2B4QA 4IQ0A 3RWBA 1ZKMA 4HFMA 4RVFA 4YT2A 1H93A 4E13A 2AQIA 5GMOA 3OECA 3F47A 2DBQA 2EGHA 2QZ9A 3OMLA 4XGNA 1EE2A 1R15A 1LLQA 4Z3DA 3FWNA 5GZ6A 2UUPA 3OP4A 4XYGA 2D2IA 1E6UA 1H6DA 3TOZA 4PVCA 2J5QA 2CVZA 4JJFA 4ND2A 3I6QA 2GDZA 1HDGO 1C14A 1E3IA 2GN4A 5ENDA 3FTPA 3RC7A 3K31A 4XYEA 5DOVA 3LK7A 4LMPA 3QVOA 1RKXA 1PQUA 1H94A 4ZQFA 2DBRA 3WTBA 5B4TA 1D4FA 1ZZEA 3GEMA 4I9NA 1LSSA 2DT5A 4I9HA 2GD1O 4XB1A 5JYEA 1WPQA 4BGUA 2IZZA 4BO5A 4RV9A 1XQ6A 3WFIA 5IAAA 1YO6A 1GL3A 3ON5A 2BFAA 4WEQA 2BKAA 1ZSVA 1P77A 1DBVO 3GG2A 1MC5A 1JA9A 2UUOA 4MP8A 1XELA 4YJHA 4B3JA 5I7EA 1YH3A 3EVNA 1PJSA 4JJGA 3FF4A 4RPHA 4AJ2A 4DQUA 2B69A 3TJRA 1T2EA 5C7LO 2G5CA 1HE2A 1E3SA 2HCTA 4DIFA 4OSOA 5U1PA 3VPXA 4XWYA 3LZ6A 3ZWOA 1M75A 3BTUA 3RUEA 1EQ2A 5CEFA 2WDZA 2W90A 4CR6A 4FJ2A 1NVMB 2BFPA 4OO3A 4TMFA 3LSYA 4AJHA 3NAQA 1NP3A 1Z82A 4YYZA 1HDXA 3PDJA 5L7YA 3H3FA 3V1YA 1Q0LA 1BDBA 3D3WB 1RWBA 4BKOA 3K73O 3BMOB 4MVJG 4LVUA 4AJEA 3JQDA 4OKIA 3RU9A 3MJ4A 4CUJA 3U09A 5HWSA 1Y8RB 3JD4A 1GUFA 3EVTA 1RM3A 4R5MA 5JAQA 5KNLA 1TVEA 2FSVA 3OJOA 5IZCC 3DMTC 4O5OA 1U2GA 4PLYA 1B14A 5B1YA 5JLAA 5LCXA 5BNFA 1LDEA 3F9IA 2Q2VA 2V65A 2EJVA 2Z95A 2EWMA 4DTIA 4JROA 1GQYA 2O3SA 4GKVA 4K9DA 1HRDA 1PIWA 3ZHBA 1GUYA 3JD3A 2ZTVA 1SMKA 3A06A 4CV1A 3B1FA 2R6JA 1UAYA 1UAGA 3OFSA 4FFLA 1SC6A 4CR7A 3NDJA 4DLAA 3H5RA 1NPDA 1I2ZA 1QYCA 2FY8A 1Q2XA 4DYDA 2B36A 2J3KA 3U3XA 1HZJA 4QEDA 4IS3A 5LC1A 1NQ5A 5T8KC 3S2IA 2NADA 4PIVA 3TZ6A 2B4TO 3MOGA 1E6WA 2NM0A 2J3JA 2HKIA 2YQ4A 4IMPA 4U0JA 3WXBA 3LC7O 2Y1OA 3KSZO 1HF3A 1WP4A 2P5UA 4EEZA 2HRBA 2C59A 4ZQHA 1ZK4A 1ZH8A 4J7XA 5EMHA 4E31A 4WPGA 5L9AA 3INTA 4W9NC 1P0CA 1PGJA 4IDEA 4J4TA 4BKUA 4OGWA 2VZ8A 3JQ7B 3WX0A 1T26A 1K6IA 3P5SA 4FJ1A 1EK5A 4YJFB 4B4OA 2ZCVA 4NK5A 1VM6A 2Y0CA 1T2CA 4IDCA 4IGEA 3IS3A 4XQ9A 2X0IA 4DLBA 2X5KO 4RQUA 3U4CA 2AQKA 3VH1A 3H9QA 3WGHA 4Q3AA 3W8EA 4RVDA 4MVJF 4I08A 4M87A 5B12A 5HTOA 5AXCA 3DO5A 3KOUA 1NTOA 2E82A 1KVUA 2AQHA 3OF2A 3TF5A 2YV3A 2HO5A 1U3WA 1SNYA 1KEVA 4XYMA 1IOLA 1HLDA 5TIIA 4J9UE 4BNZA 3GAFA 1LXCA 4MIOA 1IPFA 1M67A 1P1KA 3PGXA 5JO9A 4RL6A 4D79A 3KYDA 1ZUD1 3TDKA 4NFYA 3S1LA 4R54A 3O8QB 1IHYA 2CVOA 3JQAA 1LU9A 4GLOA 3HUDA 4J91A 3B1JA 3ITKA 4GVLA 3EW7A 4NHEA 3LF2A 5K0ZA 2YYYA 3OIGA 1WDKA 4W7HA 1X7GA 4BV8A 3ROMA 2WTBA 3OM9A 1MFPA 1Z7BA 5AYVA 5L40A 1ZK0A 2E49A 1NNUA 1ZJYA 3KBOA 4IDBA 4YQYA 1LNQA 3IL2A 4BO3A 4CMEA 2FZWA 3QWIA 4U6SA 5IDQA 3G3EA 3WGYA 4NNJA 1BXKA 1I01A 5HS6A 1LLUA 4CLOB 2O3UA 3RVDA 2ZCUA 4NQZA 1RM0A 5A5FA 4GMGA 3S55A 1CETA 3DAFA 1GQ2A 4GKBA 2YHUA 1YVEI 3ENKA 2Y68A 2VWQA 2GR9A 1F0YA 3VVBA 3ONFA 3JQ6A 3K2EA 1MX3A 5K6AA 4E2WA 2JJYA 1JWAB 1WVGA 5DOZA 1DHRA 2OXIA 5JO0A 5KKCA 3GDGA 2J5RA 4J0FA 3ZN2A 5CDYA 3WJAA 1O5IA 1V35A 3PK0A 4XCVA 1JAXA 1XKQA 3D64A 3BMCA 4RF4A 3RBVA 4OSPA 4R16A 1DOHA 1KVRA 3DWFA 4UVDA 4Z9YA 2EW2A 3M1AA 1KY4A 3W4IA 4BO8A 2HK8A 1XA0A 4IXWA 4DQXA 2VRBA 4UEKA 2HMTA 2JL1A 2O50A 3ANNA 1OI7A 3NT4A 4MOWA 1PGNA 4URFA 1MXFA 3K6JA 4NZ9A 4NI5A 5JMPA 1GYRA 5ICMA 1ZNQO 5KOIA 5I9LA 1I24A 1BG6A 5G4KB 5KJ6A 4JBIA 4XQCA 4CLRA 1IYZA 1ENPA 4LSMA 2IEBA 1D3AA 1EFLA 3ZNQA 2I9PA 2E6UX 1PWXA 1DAPA 2CNBA 4CM4B 1WMAA 2O3RA 1K0UA 1WLYA 2WMDA 2E4AA 3PHGA 4FC7A 3GN1A 1HKUA 3BTOA 4PCVA 5JCJD 2JFGA 1FK8A 1Z45A 3V2UA 3GRPA 3SLGA 3JSAA 2P9CA 1NWCA 3RSHA 5FF9A 3FNFA 4CQMB 3RIHA 1LA2A 1PL6A 2NWQA 4TRNA 3ZV5A 1RM4A 3WB9A 4YWJA 3U62A 1PS9A 2VHXA 4CM6A 5C7IO 5C3MA 4PLCA 5HRUA 3GUYA 1B16A 3H9EO 1HWYA 4O1MA 3PWZA 4HNHA 2NTJA 4I9UA 3JTMA 1YB5A 1KC3A 1UZMA 2VN8A 5CPFA 3DBHB 2EKLA 5I9MA 2QG4A 1YBAA 1EMDA 1ONNA 3I5MA 3QVXA 3F1KA 3ZNOA 4NMHA 4EYEA 4XR4A 3GOHA 1M76A 4UVEA 1LTHR 4KMSA 3LT1A 3EHEA 3GNTA 1PJ4A 5H83A 1CRWG 1V6AA 2O3JA 4E2ZA 4CM3A 1R12A 3STHA 1V3TA 5IZCA 2HMVA 3SVTA 3DMTA 3MJCA 5DNAA 1M6WA 4R9RA 4HKTA 4DIOA 5J23A 1X14A 4PVDA 1I30A 1ZK1A 5MGBA 5EN4A 2JFHA 1E7QA 1KEUA 3FTNA 4C7JA 3WGQA 3D7LA 1YQDA 4XJSA 3RFVA 5IFLA 1Y5RA 3DAGA 3UKOA 3GZNB 5ENVA 3D3WA 1DFHA 1A9ZA 5BSHA 2WYWA 4YAEA 4A0SA 4B8WA 3TFOA 3EC7A 3KEQA 4XB2A 4UULA 1DRVA 1Y8RA 2NQ8A 1EBFA 1GFSA 3DAPA 2P4HX 3IIEA 2PR2A 3ZNNA 4CPDA 5JAMA 4DQVA 3ASUA 3JQGB 2ZK7A 5EESA 3VTZA 5U4QA 4YJHB 1UP6A 3R1IA 4ZA2A 4AJIA 2NLOA 1C1DB 1DSSG 4E2YA 4NU6A 1X7DA 2EP5A 4Q3NA 3Q0EA 4R69A 1U28A 4D3DA 1E1MA 5CG2A 1B26A 1ONOA 1BSVA 3Q6IA 4OHUA 2C7VA 4UUMA 2A4KA 3GR6A 1FDVA 1PGQA 3L4BC 2D1YA 2O4UX 1J5PA 2X58A 3D4OA 1SEVA 3HG7A 4C7KA 2IXAA 2AG5A 2VTEA 3I4CA 4DUPA 1QKIA 3E8XA 3RBXA 1O0SA 3LQFA 4QT0A 3WGGA 1ZK2A 1LLCA 4KTTE 1EEHA 1IULA 2IE0A 5IDYA 1ISHA 4U5QA 2BGMA 2IYPA 3E6AA 3JQ8A 4YAJA 3DHEA 3GVIA 4YACA 5FI5A 1F06A 3U4HA 2QZZA 2HAEA 4FQ8A 3RC2A 4YCAA 4AFNA 2QIOA 3ZWCA 5COAA 3C1AA 1QORA 1Q7BA 1GQQA 1YGYA 1EUDA 3NGLA 2I99A 5A9SA 1B8VA 2X6TA 3B1KA 4UUOA 1DC6A 1MUUA 1J4AA 4YJFA 2Q1UA 1UUFA 4MKXA 3GNQA 2XF8A 1JU9A 4KWHA 3E1KA 3EY4A 2POQX 2DU8A 4II3A 2EXXA 1GZ6A 2ZIZA 1Z7EA 4CMIB 1NFRA 5T6BA 2NU7A 1GV0A 1NVGA 1CYDA 3VDRA 3G1UA 3WIEA 1R0LA 3HDQA 2BGKA 1E7MA 3LLVA 2GSDA 1P45A 2Q46A 4KUEA 4CL3A 5JNLA 3KSDO 2WEKA 3PQDA 4XQEA 4A73A 3ZU3A 3OQ6A 4FJ0A 1NHWA 2EEZA 4PLHA 3ONDA 4J4HA 4Y6SA 3EYWA 4RJTA 3GK3A 4IJVA 4JLWA 4YAKA 4FFOA 3L6EA 2BH9A 1HSZA 1V3UA 1YL7A 2HDHA 2OFPA 1MGOA 1NWHA 3CH6A 2AA3A 1KIFA 3TL3A 4BO0A 3E82A 1A4UA 1DIHA 1VRWA 1IE3A 4YXFA 5JY6A 3O9ZA 4B3IA 1P44A 1Y9AA 3HQ4O 4MVJA 4D7AA 4FPXA 1JLLA 1GADO 1OZAA 4WLUA 1ZIDA 4CMBA 8ADHA 1I10A 3UFXA 2BI7A 3F3SA 2VWPA 1BW9A 5AXBA 4ALKA 3QVWA 2LDBA 3DOCA 4L4SA 2IZ0A 3PWSA 2JCXA 5JY1A 2VRCD 4NIMA 3C85A 3QIVA 4FFNA 4XQGA 1MB4A 2FPIA 4EDFA 4NPCA 5JDIA 2C2YA 2J3HA 3OICA 2ZATA 1Z6ZA 1G1AA 1W0CA 2QW8A 4RF2A 3H5AA 5A04A 1HXHA 1Y8QA 3KYDB 4Q3DA 4WLOA 2V7PA 4KWIA 4OH1A 4EUEA 4EUHA 4TRMA 1B2LA 1R37A 3JQBC 2CVQA 3GVHA 1LQUA 4CV0A 1TT5B 2O2SA 2FR8A 4YJDA 3IAHA 1XG5A 4P4LA 3W6ZA 1DIGA 1VC2A 1U3VA 1YL6A 4B79A 4CM5A 1LUAA 3QWHA 1FDWA 3DZHA 1T4DA 3AUSA 2O7SA 3PZBA 2AMFA 3BTSA 2DTDA 3NRCA 4J1TA 3I6IA 1AGNA 2VT2A 5EL0A 3T4XA 4BVAA 4I5EA 3H8VA 1U9JA 2BRUA 1A7AA 4ZRNA 2FPPA 4YVFA 1GZ3A 4E5YA 4R41A 2AE2A 2GRAA 5TGDA 3GVCA 3NKLA 2JHGA 4EI2A 4PLVA 1JVBA 2GZ2A 4DC0A 3EK2A 2A35A 3CUKA 3VKVA 1DDOA 3HDHA 1H2BA 1D7OA 1EVJA 3ZWMA 3UUWA 1VKNA 2LDXA 2UVDA 4UAGA 3DTTA 1EE9A 1S6YA 3KXDA 1PJ3A 3VDQA 1KVQA 4FW8A 1UXKA 3S2FA 1ZCJA 2DBVO 3Q9NA 4LW8A 3F46A 3RUCA 3GLQA 1PZGA 2UV8A 5IJZA 1Q1NA 3GGOA 4ZU3A 4GX5A 3WGOA 9LDBA 4CMEC 3QJ5A 3HN2A 3KUXA 3FR7A 2WM3A 4A27A 4MIYA 5AQ1A 2ZB3A 2I5PO 3COSA 1PGOA 3AW9A 3HDJA 2C2XA 3W8DA 4XJTA 4CQMA 3JCZA 1YJQA 2G17A 2R2GA 4ZD6A 3JQAD 3K30A 4HFNA 2X0NA 5K6AC 1CDOA 4E5KA 1UZNA 3OIDA 4DYVA 4BIIA 2IYOA 1XQ1A 2Y99A 1GPJA 3ICPA 4XX0A 3Q2IA 1IPEA 4CLRB 1LLDA 3EZYA 4J2HA 4ND5A 4CV3A 3AI3A 2R00A 1BWSA 3INRA 2BFOA 1K6XA 3DBHA 5IZ4A 1ZXLA 4PLWA 3BMQA 3E48A 3HFGA 5I9NA 5DCWA 4J1NA 3RI3A 2V6BA 3F4LA 4KUGA 2YJZA 1UDBA 2NTNA 3ROPA 1KVSA 5IG2A 1YJ8A 4KOAA 3WYEA 2D3TA 2OBYA 3CE6A 3CZRA 4GI2A 4P4GA 4ALNA 4CM9A 5KJCA 2NU6A 4F6LA 2YY7A 3WGZA 4DRYA 4BKQA 5A3JA 5L4SA 1IY8A 1GZ4A 1NX6A 4WLFA 3DTYA 2HRZA 1N2SA 1SOVA 5IXYA 1XEAA 5C5IA 1HDCA 5CDGA 4BL5A 1LSUA 4IUYA 1NVTA 3K96A 3U9LA 4KQWA 1VL0A 3GZNA 5FWNA 3BHJA 2I67A 2NQTA 5EPOA 4RQTA 1ZMOA 4NG5A 4YA6A 3L4BA 3ROQA 5BSGA 4HADA 5CAEA 2B0JA 3W4KA 4ITUA 3FNGA 3KV3O 5G0UA 3DFUA 4IDDA 3WFJA 3E9MA 1JW9B 3P2YA 4ZQEA 4BNFA 3E9QA 4LRTB 3JQGA 1R6DA 1O89A 2NVUA 3ASVA 1HE5A 3JD0A 2VYNA 3PFFA 4NR0A 3F1LA 3PIDA 3TRIA 4QO8A 1C1DA 3WOHA 3ZWXA 3FHLA 3IUPA 1NBOA 1VJ0A 3HB4X 3CPSA 4R9SA 1MG5A 1LEHA 1YL5A 3GAZA 3ONEA 2OMEA 2Q99A 4R01A 2XXBA 1OOEA 4NU5A 4OOEA 1G6KA 1VE9A 1PJ2A 4IY1A 3V8BA 4TVOA 4DVJA 4TKLA 2QRJA 3WGTA 1Y9EA 4WLVA 1P3DA 4JX8A 3VPFA 2Y67A 4YT8A 1XDWA 1PQWA 1KBZA 1U5AA 1EQUA 4GGOA 4JXKA 2JD2A 2AXQA 2DC1A 1EK6A 3O38A 3PJFA 3FNEA 4ZN6A 2PWZA 4XGIA 3JQ9C 2WYVA 4DGSA 1YQXA 2YDXA 1UJMA 4M55A 2OORA 4YJGA 1HDYA 1WDMA 3V2GA 4NBUA 2PNFA 4E0BA 4RDHA 1A27A 3IP1A 4BNWA 1TXGA 1MA0A 5HBRA 4II2A 4PLTA 1P1HA 3RUFA 1F12A 2OHXA 3IUSA 2EG9A 2FPGA 3CZMA 5A9RA 5JAZA 3BXXA 7MDHA 4RF3A 1EVYA 1VKOA 4J43A 3WMXA 3VPGA 4GSKA 3UXYA 4AJ1A 2GLXA 3PYMA 3QRWA 4PLGA 5FEUA 5TT1A 1BMDA 1M6HA 2G0TA 3EMKA 4R68A 4MVJM 3ZZNA 4WKGA 3LF1A 5I7FA 3WJ7A 4N5LA 1VJ1A 1HLPA 3F5QA 4U6QA 5TNXA 5L3ZA 4CMIA 2X23A 1GEGA 1ZBQA 2V6MA 4OIMA 2Z5LA 3WG9A 1H9BA 2VQ3A 2VYVA 1WMBA 4DPLA 1DRWA 2C07A 2X9VA 1ISGA 4NJOA 4W82A 4CMHA 3JQ8B 5B4UA 1R16A 4W7IA 2C5EA 1QP8A 4RZHA 5JPIA 4J7CA 2X7HA 4D42A 1K89A 4DLLA 4NDNE 2WD8A 2ZQYA 4TWRA 3A4VA 3BHIA 4BO4A 4BV9A 1HL3A 5BR7A 5A9SB 4FN4A 3TPCA 5HS4A 4L75A 1CIVA 3QHAA 4KTVE 2OGUA 4BNNA 1HZZA 4NBTA 4CL8A 5JAIA 1QYDA 1VPDA 2PZLA 1X15A 3Q9UA 2EW8A 3UGKA 1BGVA 3JQBA 5IN4A 4TVBA 3NJ4A 3UCEA 3DBVO 4IDGA 2Y1DA 3C7DB 4BO1A 5IF3A 1DLJA 3E03A 2NACA 5CHEA 5CDSA 3DONA 4D41A 3I9MA 4L76A 2BHLA 3RJ5A 4EGFA 2ZTUA 1DIRA 3UHAA 1G0NA 4FFMA 4OXKA 2PD3A 1DFIA 3PTZA 2FR1A 3BA1A 2Q3EA 3GFBA 3OH8A 3ZV6A 1BRMA 3ZV4A 1PTJA 2GZ1A 1ZFNA 2WWRA 2EGGA 2VNAA 4MKRA 4R3NA 3NTQA 3GPDG 3VAZA 2W2KA 1J0XO 3NYWA 4M86A 1A7KA 4Q9NA 5THQA 2HMWA 1CQJA 4YTEA 3W6UA 3QA9A 1QR6A 4WECA 3LYLA 3TNLA 3WTCA 4FIZA 4BNJA 2JD0A 1T2DA 3I4FA 3I9OA 3ZI0A 1K2WA 1TT5A 1ULSA 3LT2A 3AM4A 3ZWBA 2X1HA 4CMGA 3KETA 5F1KA 1DC4A 1ZEJA 1E1KA 4K28A 1ONPA 5H82A 2ZYDA 1PJBA 1BW9B 3JD2A 3D1LA 3AK4A 4GX1A 4N18A 3QVSA 1HE4A 3OJ0A 1XGKA 3FBTA 5DN9A 4OJNA 1ZO8A 5AXDA 5TS3A 4MPDA 1MC4A 3EAGA 1YONA 1DO8A 4L74A 5DF1A 4PLZA 4NBWA 4O6VA 3VZSA 1ZVMA 3GDFA 1P31A 4CR8A 2NV6A 3HE3A 3VVCA 2B4RO 3LC1O 3MTGA 4BKPA 1PR9A 3HHPA 1Y8QB 3GH3A 5TJ9A 3L6OO 2UYYA 2RH4A 2FZEA 4EJ0A 2JAHA 4Q39A 1PR3A 2RCYA 3GC6A 4B4VA 2CUKA 4JQCA 4A2CA 3ZHYA 1N9GA 1DEHA 2BGLA 4F46A 4BMNA 4WCFB 1QV6A 2Q2QA 4XGKA 3RKRA 3GEGA 3RUAA 1T24A 1ENYA 1E1LA 2D59A 2WD7A 2HUNA 1PZEA 3H7AA 1KC1A 3PYXA 5DDIP 3SXPA 3GRKA 1NAIA 4OQZA 5BNTA 4K26A 2V6FA 5JDIC 3GA0A 2ZYGA 3QV1A 4MVJH 4N7RA 1O8CA 3HB5X 3PGJA 4XD2A 4EBFA 4MVJI 2DBZA 4CM7A 1HSOA 1M66A 2Q50A 4IDAA 4QTZA 5TX7A 5CEJA 1UDAA 4XA8A 1Q0HA 2HMSA 5ER6A 5T57A 3IDSA 4E4YA 4J0EA 3KSUA 3WWYA 4WCFC 4CUZA 3BMNB 3AU9A 4PG8A 4YR9A 4J6FA 4Z0TA 5HA5A 1U4SA 4O59O 2XOXA 4G65A 2X86A 4IBOA 4PG5A 4RCVA 2PGLA 2I6TA 1DXYA 2VWHA 1I32A 4E32A 3TZHA 3G79A 5FFFA 2I3GA 4Y6RA 3U0BA 1E7SA 2H6EA 3MJSA 3BYZA 4U7WA 5DULA 5EQFA 1NHGA 2YQ5A 2ZTLA 1L1FA 1LDGA 3VKUA 3W1VA 1PS8A 4E5PA 4ILKA 3JYPA 4EZBA 3G0OA 3S2GA 4H15A 1B7GO 4DA9A 1HE3A 1MG0A 2VOJA 3OA0A 1AXEA 4DIBA 5CDTA 4YT4A 1DC3A 1SOWA 4G2NA 3R3SA 2YDYA 1DAOA 1E3JA 4IPTA 4JNKA 4R1UA 3PJGA 2G1UA 3KYCA 1XLTA 2PV7A 3RFXA 3OSUA 1Z75A 4DREA 4BO2A 2Y0EA 5CFZA 1A5ZA 2WE7A 1PSDA 1YQGA 4M1QA 3TWOA 2CY0A 2DVMA 3F6YA 5A5EA 3AY7A 4BGIA 2AEFA 3BMQB 3DC2A 3D0OA 5JW6A 1N5DA 1UXJA 4Z0HO 1I3KA 4JK3A 1GAEO 3RC9A 4CV2A 1L7DA 3CMCO 5DP2A 1U7TA 4A7PA 3PLRA 4HBGA 3KEOA 5T64A 2CDBA 2VHYA 3FWZA 5L45A 4M49A 3FCOA 3CXRA 2DM6A 3TQHA 1HDOA 3JQ9A 4N5MA 4ND3A 4IQ8A 5CEEA 1ADCA 4R3WA 4BNIA 1R4MA 2V6GA 3ANMA 1TT7A 3GT0A 3AI1A 1I8TA 3A14A 4HUJA 2JKVA 2R00C 2D5AA 1DRUA 3QLJA 4GQAA 4BB5A 1PJQA 1PL7A 2P91A 4GSLA 2AHRA 2W4QA 4E33A 4TZKA 5EINA 4JP2A 2OZPA 4S3MA 3UH1A 1P1RA 4FFRA 2PH5A 3ZU5A 4INAA 4AG3A 2BLLA 4CM8B 2Y1GA 1BVRA 1I2CA 2HU2A 2P2SA 4Q3BA 3RASA 4O63O 1YRLA 2QRKA 3ZWWA 1B15A 4RVSA 1ADGA 3WMWA 5CDUA 2NVUB 4J9VA 4BNTA 1XR3A 3ENNA 2AEMA 2I76A 4CQMD 3DOOA 2G76A 2PZMA 3GGGA 4QO7A 1H6CA 3B20A 2HK7A 1A72A 4HFRA 4ALMA 2ILTA 1XWFA 3QWBA 1KY5A 5JC8A 3WYCA 4WE3A 2ZJ0A 1K6JA 2EJWA 3ORFA 3FI9A 3RROA 3GNSA 3D3EA 3TFQA 3AOEA 3ZV3A 4DWVA 3EZLA 1UZLA 5DZSA 3I9JA 4JCOA 3ZWPA 3U4DA 2JHFA 1C3VA 1XU7A 4XKJA 3E9NA 1MFZA 1BTOA 3UF0A 3WLEA 2PGDA 1FXSA 5TJHA 3NDRA 4C4OA 1GD1O 4FBGA 3OQBA 3PRJA 3WBBA 1LRJA 4UUPA 4AICA 4E6PA 1NQAO 2NU8A 4CM9D 4FOOA 4E12A 3GVXA 3PDUA 1PL8A 1I2BA 1UP7A 2C0CA 3BAZA 3I9NA 5G0TA 5T5QA 4GGPA 3SJ7A 4FCCA 2PKQO 2X9GA 4AJJA 1E77A 4WJZA 4ZGWA 1ENZA 5JCXA 4QFDA 1UXIA 4Y9DA 3WDSA 1RYDA 4YJGB 2O4CA 3KRTA 1PJCA 1ZK3A 1ZJZA 5GZ3A 4LRSB 1EUCA 5ICSA 1F17A 1P1JA 2PD4A 1NYTA 4XRGA 1NR7A 3ZW9A 4Q3CA 4B4WA 4BO9A 3M2TA 2YUTA 3VPSA 2JCYA 5DBFA 3F4BA 1F8GA 5L51A 2C20A 3ZWAA 1GY8A 2WJPA 1YB4A 3ETGA 1Y81A 3QVTA 1QV7A 4HXYA 2FR0A 2Y1FA 3PP8A 4PG4A 5F1OA 2OP1A 2YZ7A 1E3EA 1IUKA 4D46A 4ZRMA 4JN6B 3C7CB 4J90A 3WBFA 3ROKA 4WOJA 2AQ8A 4IJWA 2D0IA 5DT9A 4D44A 4OAQA 1LX6A 2W2LA 2EIHA 3JQEA 1U5CA 4DL9A 4EEXA 3I3OA 1WW8A 3AFNA 4KUHA 5U9CA 3FR8A 4Y67A 3LDHA 5JMWA 1EDOA 1R66A 4ESOA 4B7UA 4F3YA 2NVBA 1DPGA 1VL8A 4TQGA 3T4EA 4ZQBA 3AWDA 3V1UA 3OETA 1V3VA 3ETDA 4PG7A 1C0PA 1B3BA 5F21A 1WWKA 1YKFA 3C24A 4WK6A 3WIDA 4CMCA 1LQTA 4GPD1 2OOSA 3P19A 2TMDA 1OMOA 3DB2A 1E3WA 3P2OA 1DJNA 4A10A 4ALJA 1AHHA 1BVUA 5GY7A 1U3TA 1LDBA 1P9LA 1UXGA 2X5OA 3SEFA 4QQRA 1V9LA 3GUCA 4RVUA 4BUCA 3QQPA 2Q4EA 2I65A 1GDHA 3C1OA 4EW6A 2B83A 3MJVA 3WSVA 5I7SA 4I8XA 1Y5MA 4OYRA 3HDYA 4BNKA 2C7GA 4XIJA 1S7CA 1SO8A 3DZIA 4GVXA 4IS2A 4P22A 1M2WA 5CPBA 3V1TC 2W2KB 1XIVA 5KJFA 2C82A 4OXNA 3WWZA 1JQBA 5DCYA 4BNYA 3GG9A 4AJKA 4BNLA 4EUFA 3AUAA 4OKNA 3HSKA 1IL0A 1U2DA 3EDMA 5G0SA 3MZ0A 1D1SA 4WCFA 2YV1A 4ZVVA 2AE1A 3INGA 2PH3A 3UCFA 2CDCA 1ADFA 3H9JA 5JCJA 4W6ZA 1AE1A 1J49A 1HEUA 1EDZA 2VWGA 3OEYA 3SC4A 3DBLA 1I0ZA 3ZWNA 2DPHA 1YXMA 2D4AA 3I23A 4ALLA 2C29D 2GASA 3VZRA 2D5CA 3R6DA 3WR5A 3PHJA 1CERA 1GCOA 4F6CA 1X0XA 4OOFA 3WQSB 1E7YA 1PJLA 1T25A 2CD9A 5JE8A 2JD1A 3N7UA 3GF4A 1UP4A 1X7HA 5KTKA 5I8WA 1NFFA 2VZ9A 4AL4A 2B5VA 3CIFA 4NFSA 4OQYA 4ROSA 4WLEA 4GMFA 1PQPA 2Q4BA 1W8DA 4G5HA 3BMNA 4OMUA 4YRDA 1HETA 3S2EA 4BNGA 1N7HA 1N9GB 1IZ9A 2DPGA 1PZHA 3LU1A 4EJ6A 1YDWA 3QW2A 3KHUA 5FI3A 3BZUA 4AJLA 2ZB7A 2WD7B 1I33A 2ZB8A 4G81A 4L0QA 3NUGA 1AUPA 3AM3A 2FWMX 4U0KA 1QMGA 2VCYA 3DZFA 4MKZA 3D5TA 1FF9A 3M1LA 1HTBA 3G1TA 4YDRA 1UR5A 1WDLA 5DP1A 1N1EA 2O3TA 3D4PA 2GN8A 1JDJA 3WYBA 1DHTA 1NASA 3R3JA 3JYNA 3LT4A 3QY9A 4RPKA 1LBEA 1Q7CA 1U7HA 3QSGA 3U49A 4FB5A 1J6UA 3TOXA 3V2HA 1F14A 4R51A 2QRLA 2YW9A 3VH4A 3DEYX 4LISA 3LC2O 3DBRA 4DPMA 4Z9FA 2NU9A 3FRJA 3P7MA 4J4BA 2GERA 3ZH2A 1FDSA 2ZYAA 1OC4A 1N1GA 1OAAA 1ZEMA 3OHSX 4RF5A 1BDMA 3QP9A 3NT5A 4Z0PA 4RZIA 4IIVA 1PU2A 4RGBA 2ZQZA 1RYEA 2XPCA 2DLDA 1V0JA 1KOLA 3BTVA 3DZBA 2IZ1A 4YAGA 4UVIA 2QYSA 3MWDB 4BS9A 4PRKA 2HJSA 1PGPA 5TSDA 3WICA 1C1XA 1C0LA 1FJHA 3T7EA 4MVJP 1L7EA 3CSDA 4ND4A 4MO2A 4RPGA 2Q49A 3GHHA 4W4TA 4AJNA 1QYWA 2GUGA 3KYCB 4BGVA 1NQTA 2P5YA 2WSBA 3HWRA 3H9UA 5LDGA 2EV9A 4HWKA 4CM8A 1I3MA 2X8LA 4I1IA 5C7OO 2Q1SA 1Y6JA 4IDFA 2AEJA 1NR1A 1CJCA 2Y66A 3ABIA 1FMCA 1G0OA 2DTEA 4TSKA 5A05A 1ZW1A 4FD3A 3BHMA 3TN7A 3OJEA 2X22A 4IMRA 4BNXA 5ITWA 4CLHA 3RD5A 4AJOA 1JWBB 5HM8A 3C7AA 3ZGYA 1MLDA 4KP7A 3Q2KA 1R4MB 2EF1A 1NAHA 1NFQA 3UCXA 1XHLA 3F5SA 4MJLA 3OA2A 4Z9XA 2XXJA 4M89A 1U8FO 4XDYA 3EUWA 2GYYA 2W8ZA 2XAAA 2A94A 2X0RA 4ID9A 5FYDA 1A71A 4YBZA 4GH5A 4IZIA 4M54A 3JV7A 3QWAA 4FC6A 1ML3A 3NTOA 4BQRA 3CTMA 1T2AA 1CEQA 3KB6A 3Q3CA 5EERA 2Y93A 5F5LA 3MCVA 1D8AA 3VTFA 3KLMX 3C8MA 3DDNA 3NJ8A 4K6FA 2Z1MA 1LJ8A 3PHHA 4MP3A 4I5GA 2VHZA 1WAMA 1R4NA 3DL2A 1XSEA 2O2YA 4HV4A 1PS0A 1ENOA 4NBVA 1DFGA 2OP0A 3L77A 4PZCA 5KVSA 1EZ4A 2B37A 4WLNA 3AJRA 3JQFA 3PHLA 3WNQA 3IMFA 2PK3A 1LDYA 4UVGA 2H9IA 5COQA 3IJPA 4YQZA 6ADHA 3UN1A 4CLEA 3UOGA 1T4BA 5EQDA 2OO5A 2GF2A 2SCUA 5L7TA 3L4SO 4WASA 4QSMA 2B5WA 3L6DA 3QWFA 1YBVA 2CSUA 3RCBA 4MVJE 1E1NA 4RPLA 3L07A 3SLKA 2IRWA 4WEOA 3QE3A 2I66A 4CLDA 2VRCA 4IQGA 1VSUA 3ITDA 3UAGA 4UVHA 3E18A 4W99A 1WNTA 4PRLA 4QUKA 1JAYA 1SEPA 1DB3A 1DIAA 4NJMB 2P9EA 1E7RA 1VL6A 2HQ1A 3RUDA 5BT9A 3GMDA 2WE8A 1LDMA 1P1FA 2B35A 1KS9A 3AOEC 2HMUA 3UW3A 1SB8A 2PTGA 3GN2A 9LDTA 1C0IA 1HYEA 3RKUA 2NUAA 3FPCA 1TI7A 3MJTA 4XYBA 3PZRA 4D45A 4U8GA 3VH3A 1UH5A 2GN9A 5G2OA 1YS4A 3RAJA 4K6CA 1YE3A 2F1KA 2PKRA 2Q2WA 2YFHA 4JBGA 4BKRA 3X2EA 4I5FA 4D0RA 3FPLA 3GVPA 5B37A 3CEAA 4MINA 2DTXA 1D1TA 2EERA 4R4JA 3OIFA 1AHIA 2RIRA 4XDZA 3RJ9A 2J3IA 4J7UA 1F8FA 2TMGA 4E21A 2OL4A 1SBYA 5IXSA 4Q3EA 3D4NA 3HADA 2GPTA 3GEDA 3T7CA 3PHIA 3W4JA 1GV1A 4FS3A 4RO0A 4WCDA 1LSOA 2VTDA 5L7WA 3HN7A 4KDEA 2IDZA 1JKIA 4MIEA 2VUTA 3O4RA 3Q11A 3DR3A 1KEPA 4BQPA 3RU7A 4FFPA 2FRDA 4BNHA 1FDTA 5L95A 2J5KA 4Y98A 5CP8A 4ZHSA 5KWEA 3CINA 3U5TA 2DUUA 4J2OA 3HJAA 2ZJ1A 3PPIA 3JYOA 4DXHA 3I52A 4CUKA 1VJTA 3GFGA 1KVTA 1QLJA 3H4VA 4LMRA 5LDHA 1U8XX 5KJ1A 3G49A 2UAGA 4WNIA 1LC0A 4Z3KA 3JQCA 4FR5A 3GQVA 5JC1A 4YPOA 1E3WB 1VLLA 1A4IA 4LCEA 4AJPA 1K5HA 3FSRA 1T1RA 1TLTA 3ZWYA 2BFMA 4HNGA 3A9WA 3WLFA 1X1EA 5KVQA 1ULUA 5G0VA 1GU7A 2IEDA 5EJ2A 5GZ1A 4CQLA 3AUTA 3OBBA 3IQDB 1O6ZA 3DXFA 4OL9A 2AG8A 4PLPA 4TROA 1ID1A 1PZFA 4WGGA 1W6UA 1GYPA 2CF6A 5DCUA 4BNUA 2O23A 3WGIA 2VNSA 4J1SA 1B0AA 2O3QA 2BELA 3NT2A 4A26A 3GDOA 3WNVA 1X13A 1U3UA 3NEPX 1XYGA 3ZHXA 4ZICA 1AXGA 1IHXA 2VT3A 4E3ZA 4D3SA 2BMAA 4O0LA 5KIAA 4X54A 3H65A 4NK4A 4LCJA 4CJXA 2QQ5A 1CQIA 3FN4A 1KYQA 2P4QA 3AI2A 4YEDA 4DPKA 4PZEA 1B8UA 2W2LD 1VSVA 3KVOA 3WSWA 1Y7TA 4QX6A 3DBLB 4R1NA 5DBIA 3MOIA 1E92A 1EBUA 4DC1A 3RUIA 4B3HA 1CWUA 4RVGA 2A9FA 5A03A 3OQ1A 1BXGB 3MWEB 1LDNA 5G4LA 3L0DA 1SZJG 4PN3A 5JYDA 3DOJA 3SC6A 4E5NA 1E0DA 1K3TA 5AOVA 1RM5A 1XCBA 3V5NA 1GYQA 5JSFA 1NM5A 3VOSA 4ZQGA 3GPIA 5H81A 3DZGA 2AW5A 1P74A 4JP3A 4MVJD 1JVSA 4J49A 3OEWA 3KM0A 3JD1A 4L73A 3ST7A 3ZWVA 2GZ3A 4JIGA 3U4IA 3TSCA 1PJTA 5C37A 1IZ0A 1SPXA 3AM5A 3DZKA 2IODA 4L8VA 1I3NA 1PX0A 3PJEA 1YOVA 4CLXA 4RVHA 5DBGA 2EKPA 3DZJA 4Z6KA 1H5QA 2DUWA 4BO7A 4YRBA 2RHRA 1TA4A 2P9GA 1O95A 3ZW8A 2D8AA 2DKNA 1B8PA 3R0IA 4YRAA 4WUVA 3AU8A 2YFQA 4BB6A 2PZKA 2JCVA 1MP0A 4B7CA 2BI8A 4OM8A 3GMSA 1O94A 5MDHA 4D43A 3CKYA 4GAEA 4E30A 1WZIA 4IJKA 1R0SA 1QRRA 1W4ZA 4LGVA 4KZPA 5IDWA 3ICCA 2NSDA 1EVIA 5T67A 5JS6A 1XU9A 2FSSA 3TL2A 3ETEA 3GHYA 1QLHA 4BGEA 4XEHA 2X0JA 1WZEA 4D0SA 5JXWA 1HDZA 1JN0A 3WS7A 3DBRB 3PQEA 4GLLA 4HFJA 1KERA 5BSEA 4KQXA 3LVFO 4JBHA 4K1LA 4UEOA 1JKJA 3PWKA 2YHIB 3PLNA 2HK9A 2QHXA 5TF4A 4GWKA 4EITA 1Q0QA 5K9ZA 1P33A 3VH2A 4QXMA 4FSHA 4TKMA 3FBGA 3PEFA 4MDHA 1OFGA 1X0VA 2X4GA 1ZXBA 4IZHA 1Q7GA 4TZTA 3X2FA 5A1TA 3LT0A 3KZVA 1T1SA 1IB6A 1NPYA 4H7PA 4BHTA 4RLSA 1O9BA 5IDXA 3SJUA 3FD8A 3IC5A 2PLAA 1H6AA 3TZKA 5KVVA 1C1XB 1BXZA 3ZU4A 5F3RA 4F45A 5L4NA 4RDIA 1LRKA 2FN7A 2FOIA 2NNLD 2Y1CA 4FGSA 2H1SA 3DHYA 2VOEA 3B6ZA 2CFCA 3ZNPA 4YAIA 1EUZA 2PD6A 4IIUA 4NBRA 3NTRA 3PVZA 5JDCC 1QXSA 1QYXA 3ADOA 4JJIA 5A9TA 5KKAA 5A02A 4Y6PA 4IINA 4XRRA 3DFZA 1Z74A 3B70A 3H3JA 1HT0A 4QECA 4TRJA 2BD0A 4CMAA 5JFOA 4NFHA 1TEHA 3BIOA 4A5OA 3EGOA 3O26A 3L9XA 1JKFA 3ADPA 3WQQA 4L9RA 5F5NA 3M6IA 3RC1A 1ZSYA 1OC2A 3IOYA 3OJFA 4PFJA 3M2PA 1P1IA 3IKVA 1SB9A 3FNHA 2J6IA 5L4LA 1HDRA 1H0KA 4H3VA 4CM1A 1GUZA 2C5AA 4CMKA 3BMOA 5KJEA 3H6KA 4XZ3A 1SCUA 3AUUA 1ISIA 2EHDA 2J8ZA 4GL4A 3VZQA 4R1SA 2CZCA 1ORRA 2RHCA 5KVCA 5T8KA 4LN1A 4RPJA 1GPDG 1N7GA 4WOKA 1PWZA 5IN5A 1U1IA 3A1NA 5A06A 2VZ0A 3VPHA 2VUUA 3A28A 2QX7A 1ISFA 4H16A 3AFMA 2DAPA 1E3LA 2GO1A 2P68A 1QG6A 2GNAA 2I3AA 7ADHA 2O48X 5I8ZA 5TRTA 2NVWA 4W9NA 5I7VA 5ER9A 3HFSA 3K2BA 3KYBA 1Y1PA 4NJMA 4RORA 3W8FA 2H5LA 4BOYA 4M8SA 1R4NB 1ADBA 1HYGA 3L9WA 2YV2A 3TZQA 4PG6A 4S1VA 4DMLA 2CMDA 5KCZA 1GTMA 5CG1A 4PZDA 5ILGA 4UEJA 4PLFA 1X1TA 1N8KA 3MTJA 2BF7A 4ZJUA 3H5NA 2Q1TA 3I83A 4P4NA 3NX4A 5TT0A 5TQVA 1GEEA 4AVYA 2VYND 1KEWA 1RPNA 3E5RA 3KTDA 1CF2O 1HYHA 3GZ4A 3CMMA 4HP8A 1ZSNA 1C0KA 1DC5A 4BO6A 4EJMA 1AN9A 3OJLA 3PQFA 3Q1LA 4GBJA 3JQ7A 1GCUA 1EFKA 1YBMA 2Q45A 2W98A 4D3FA 1LC3A 4N54A 4GWGA 2Z1NA 3H2ZA 3SBOA 3DQPA 3JQFC 1QYVA 4A03A 1QSGA 2DFVA 2PZJA 2JFFA 1ARZA 2HJRA 2C54A 2WYUA 4WNCA 4B8ZA 3KLPX 2H63A 3D5QA 1KETA 4DMMA 4E2XA 1E6EA 3SX2A 1LSJA 1Z73A 4RLHA 3GGPA 4GX2A 5JBIA 3ZDFA 2GCGA 4FGWA 1LI4A 3I9KA 3WQRA 4UREA 4HY3A 4BMVA 4FDAA 3I1JA 3RUHA 5BSFA 3GY0A 2OBNA 3ULKA 3K92A 3H2SA 3PIIA 4AJ4A 3MEQA 3NGXA 1H9AA 4ALIA 1H6BA 1A9YA 1NPTO
chains in the Genus database with same CATH superfamily
1CJSA 5E9JA 1LKZA 2HSZA 4TZ0A 4KK4A 3H3XA 1II0A 5IXJA 2WB2A 2RI6A 3W5CA 2DGDA 4MWZA 4XEUA 2WG1A 2XQJA 5KWIA 3OPYA 2GGSA 1BN7A 4C29A 3FNRA 4EPXA 3PPVA 3KSRA 4YB8A 3ZHZA 1HQYE 2E87A 4P6VF 3RJMA 2H08A 4M6WA 1V41E 5JQWA 2KJQA 3JW8A 4B48A 6Q21A 5LSAA 2GCNA 4OK3A 3RFTA 2ZSJA 3TB6A 1W5BA 3O5AA 1T34A 3WQHA 5DN6D 3IIJA 3SX0A 4QOHA 3I9LA 2OFXA 1E5LA 3MMPA 3T5DA 3CVWA 1AQYA 4KJXA 4XGQA 3H11A 1ODJA 4KXMA 1PT6A 4PQFA 1R8SA 2OTCA 4FFDA 3L06A 2RJNA 4UPDA 3Q98A 4F9EA 2EWVA 3E3MA 4CLOA 2HPVA 1E2DA 4BMSA 2Y1EA 1P62B 2XQKA 4KVFA 4B33A 3KQUA 4RZQA 2VUSA 1BE0A 2FLVA 2JFNA 1FXUA 4GP9A 2ZSEA 2EKQA 2QENA 4DGQA 1BXGA 4DS3A 2P8SA 5HKKA 3KQHA 3JQAB 1KFEB 3K1AA 1Y4SA 3EQ9A 4J3FA 1UPUA 5IM4F 1U0OC 3ZLVA 3BM5A 1OBFO 4GZLA 4X71A 2ZKIA 3HWWA 4AM8A 2UDPA 1E6CA 1V6CA 4OI1A 1FLAA 4ZHQB 1PG2A 3PR2B 4AXBA 4B75A 5JADA 1L3BA 5JNUA 3IEPA 2OT3B 3WHKA 1W4RA 1P1BA 3K8ZA 3U3MA 4ZMSA 4QREA 4U3JA 4MV8A 1RQNA 4LDPA 3ZXSA 5BORA 1ZY2A 2B78A 3LTEA 4LGMA 1P80A 1D4OA 1MOZA 1W1UA 3E81A 5AXAA 4BNMA 1TF2A 2QUKA 4EI8A 2JH3A 2QGFA 5ITSA 4RY2A 1H05A 1K8QA 3D4LA 4HEJA 1KZ1A 4B87A 5JPDA 3QKUA 3LRXA 2P4UA 2RGGA 3FGNA 1CNEA 1FRNA 1I5RA 1U0EA 3L0YA 3R23A 5DHRA 1VB3A 5DSTA 4B40A 1A2QA 2W6PA 3AR3A 4MR8A 4DCCA 1QK5A 4P38A 2PWYA 2UKDA 3TUZC 1UFRA 1LD3A 2CF5A 2ZDHA 5G02A 3UWMA 4DTCA 4I5DA 4KQ9A 1QIKA 1I4WA 2I1LA 3B6EA 3PDCA 2RH8A 3R0JA 3TZBA 5KUTA 2I6QA 1MIOB 3DTVB 1MC8A 3RBZA 1B93A 2VDQB 1JDZA 1Q5PA 1MXHA 2MR6A 2NO9A 2G5PA 1ESMA 2PA3A 3UV3A 3V7FA 5KNCH 5L53A 1TW3A 2QL6A 3TSZA 1KMIY 4YRIA 3CSSA 1AQIA 3MGCA 3CLRD 1WUJS 4HR7A 5D3MB 5ANRB 2YYZA 5G0WA 1ISJA 2ZI3A 2X5JO 1U2PA 1DJQA 1PR4A 4I46A 2X9NA 4Y2PA 5AVQA 4N65A 1NE2A 1SK9A 1Q0TA 5IBPA 4ONEA 4M0LA 1NY5A 3I5UA 2YN4A 2PXCA 2O2ZA 3LGSA 2C5GA 1PV1A 3D1VA 1WXDA 2JZOA 1H2YA 3G2NA 3KB2A 4GX0A 2HA4A 2J3EA 2XVZA 1Q6YA 4LVCA 3WGVA 1WZ2A 1FVOA 3BREA 3KAPA 4IQFA 3HDVA 5E95A 4KFCA 3HU5A 4URHA 3O4VA 1GPBA 1NUTA 2FP4A 1OTXA 1DEOA 1V2GA 2ZULA 3NPMA 1IN4A 1RR6A 3VOAA 3HY3A 4FDUA 1R6AA 5TLSA 1L4EA 4F04A 4TTAA 3ZUPA 1ZM7A 1LRLA 3A3KA 2ZTMA 3JYQA 1SCBA 1HL7A 4EFLA 2N75A 2VHVA 1UCFA 3AEKA 3DMYA 1BHSA 3HZZA 4LBWA 2JJ8A 3KWJA 1TB4A 4RMJA 4WY5A 5D3ZA 5DHQA 1CNFA 3DAYA 4JUAA 2Q5FA 4HFMA 5I9SA 4YT2A 3JASA 5J2TB 3TRJA 1TVKB 3FE2A 2QX6A 3LM8A 4MV4A 1T8RA 2WU0A 1Y1QA 3SIPA 1D07A 2EGHA 2QZ9A 3FOWA 5ALOA 4MWTA 1DXHA 1J8YF 1K9SA 2ST1A 2ZWOA 4QNNA 4XGNA 4D3ZA 2V55B 5GQSA 3PS9A 3L41A 4ZI3A 3ZXUB 3KSAC 3F7MA 1UT5A 1YU9A 1KFCB 2WWHA 5DMXA 2UUPA 5GZ6A 1OR8A 5FBKA 4A5SA 1T3GA 4WZBA 1N4DA 2JGDB 3ICVA 3KG2A 3R0ZA 3R24A 4PBSA 3CF2A 3NU1A 3RLFA 1X1QA 1DO2A 3BB1A 3CJRA 3H42B 4IJQA 4IHJA 2VP6A 3BCHA 4ND2A 5DLEA 5FNVA 4RKWA 3RODA 1A96A 2VYCA 4QD3A 4ZOCA 1TMYA 2GN4A 2HM7A 2VDVE 2NZJA 4FVTA 5AWFC 4DCTA 5CCBA 1WKCA 3WL7A 2O0JA 2WF8A 1YR8A 1QKJA 1AF4A 3JU3A 4CCWA 3ANSA 3LK7A 5DOVA 5BOSA 4OQMA 4Z4QA 1O94C 1P1CA 2YJ4A 3NHJA 4IRXA 4JH0A 4CF6A 4CG2A 4V0RA 1P4JA 1LSSA 3IAAA 5EUCA 4YYEA 5KYGA 3MQ2A 4MTLA 4KCGA 2DX7A 4Q1DA 3VR4D 3OLCX 3ELYA 2O0KA 4BTEA 3DWIA 1C81A 3WFIA 4LHYA 4Z0NA 1MTZA 1YO6A 3I0ZA 3AUKA 1GL3A 3QVGA 5DCLA 3SHQA 1WSAA 3BWYA 3CG4A 2R44A 1ZD2P 5CURA 3LK6A 3T7IA 4CKCA 1P77A 1Z37A 5TB5A 1NLYA 4MP8A 1XELA 2IHBA 5IAJA 5I7EA 2ZI4A 4F84A 3NIWA 1PJSA 4H1UA 4ZEWA 3ZX5A 3FF4A 2G9VA 1M34E 2X19A 4GW3A 4RPHA 4YNBA 1SIBE 2OD9A 4FYYA 4R31A 5HMLA 1W76A 4L4UA 3FWHA 3OFJA 4GOJA 3GXBA 1R0ZA 2CCKA 4LXIA 2SECE 1ESCA 1DCKA 1U7DA 5LXTF 3HJUA 1AQ6A 1KL7A 1UKAA 3LZ6A 4JWTA 1M75A 3R5TA 4L7VA 2WUWE 5C1PA 1JR3E 4FI3F 5JQGB 2PLWA 4P7BA 1FFXB 1O94D 5CEFA 2ID8A 5AKEA 3V8MA 2R5WA 1C41A 3NTUA 1F1BA 5I48A 5K2MA 3MXTA 4ETWA 3HACA 5DWQA 2C96A 4UU0A 3PDJA 3V1YA 2GEBA 4DCGA 4ITRC 3C7KA 1ZH0A 3Q8LA 1NDHA 5DISB 4D9BA 4BFXA 4JQSA 4MWDA 2CJWA 3L0BA 4AJEA 5F23A 3OLQA 3KSMA 4P1ZA 3VYSB 4HS4A 4EGAA 1W93A 1ISPA 3Q72A 2AD1A 1W5TA 4AKIA 4DV6B 1G1MA 5KNLA 1RZ3A 4WCVA 1AN0A 2FSVA 3OJOA 4JLVA 3RO7A 3ROFA 4D99A 5BQXA 3C45A 4Y2QA 1U2GA 2YASA 4NOMA 5B1YA 5EA2A 5JLAA 5LCXA 3UAWA 3AUXA 4HATA 4ZO8A 5EPUA 2Q2VA 5DJ5A 1XN1A 2EJVA 2F1IA 2JJQA 2XHZA 2M1XA 2CYBA 1WXXA 2O3SA 1V1MB 4KNYA 1YV9A 1BEZA 3FGPA 3O3CA 1Q7EA 1VB5A 4FE7A 1NLUA 4G0ZA 3BK7A 5TS2A 1JHMA 2GMWA 3BXGA 4EPTA 5JJ5A 4GS5A 1XL0A 1YZTA 3KU1A 1EFVA 3OFSA 3G5LA 4O2RA 5JZOA 3C5EA 5CX1A 2XZLA 4CR7A 3NDJA 4GO1A 5I5EA 3H5RA 1A8HA 1NPDA 4A8HA 3INYA 2J32A 3CNQS 1I2ZA 1QYCA 2FY8A 4EB3A 1Q2XA 4DYDA 1K92A 3GP8A 3ZLAA 1P2GA 3GLHE 4EFMA 4B44A 2W2XA 4QEDA 3ELDA 4AROA 4LHWA 2AOUB 4IS3A 2OLJA 2J0UA 3SXUB 4D74A 1NQ5A 3QLVA 4F1WA 1QGYA 4PIVA 3V3KA 1A7JA 1TQHA 2V3WA 1QWOA 1I9GA 3NVAA 1IY1A 4UHFA 4JB3A 3VV3A 4YUZA 2J3JA 3PUXA 5HRAA 2HKIA 4HMOA 2OY0A 4IMPA 1U0BB 3EDCA 1GITA 1MB9A 3WXBA 1HLGA 3P2MA 4YRRA 5K3FB 1H3EA 5DX0A 3PF8A 1ACMA 4L02A 3KSZO 3HBAA 2HRBA 4NWIA 4ZXFA 1OJ7A 1ZK4A 5EMHA 4BJ5A 4V0KA 4DDWA 4CT0A 4WPGA 2JASA 3HB7A 4AX4A 1RYHA 1P0CA 1USKA 3L79A 1Z34A 2WNHA 3ED1A 1C1YA 4PYNA 1GAQA 2YJ6A 4KSYA 4OGWA 2VZ8A 1EUDB 3HBMA 1K8RA 1JA1A 2PXHA 2WW8A 3JQ7B 1MW9X 4Y0AA 5TEVA 3WX0A 1K6IA 2O8DA 5EQJB 5JSHA 2Q2NA 4MRNA 3KFXA 5BT8A 2DH5A 3KPVA 4Y2XA 5AVJA 2VDMB 2ZCVA 4AK9A 1U8CB 2OYRA 2ONJA 4D9EA 1T29A 2Y0CA 4PO1A 4W6QA 3U1TA 2E2WA 4IDCA 3VPCA 3IS3A 4XQ9A 2X0IA 5JSQA 4OX9Y 4GZMA 1G63A 3P96A 4D9HA 3HHEA 3WRYA 4JLOA 1S2IA 5A4FS 3RYCB 3WGHA 4H27A 1G6Q1 2XWBF 3DCIA 1L7PA 4ZWNA 1E66A 3GA7A 4V1CA 4F72A 1JEQB 3DM5A 3LL7A 3RF7A 2E82A 3PNLA 3ZOZA 1KVUA 5LZ5A 2AQHA 2YY6A 2A59A 3OF2A 4QDKA 2YV3A 3TF5A 3JATB 1PV4A 4XYMA 2W4MA 1T13A 1IOLA 3KC2A 2ZYSA 5ECYA 1GARA 3FVRA 2FEXA 1G6HA 4ZMBA 2J41A 4YV0A 5EJMA 3O94A 4WXRA 1LXCA 1IPFA 1L9KA 4YHHB 1P1KA 1YK0A 1AUVA 4L8GA 4MZDA 4RL6A 2NXEA 3KYDA 1QBGA 4D79A 1ZUD1 5HRCA 1TQ4A 2CB9A 4R54A 1PJZA 1II9A 1V26A 5LQJA 2W6ID 4ZOLA 1DVRA 4WBNB 3FG9A 5K0TA 4RC9A 1FP4B 1JRLA 4G1EB 1PFYA 2NO5A 2W93A 3Q3IA 4C4SA 1AGXA 3UGTA 4GE3A 2JI7A 3OIGA 1RZVA 3RYFB 3E8MA 1X7GA 2V7QD 1IZZA 3TSAA 4ZKDA 1T9CA 1K5DA 1VJ5A 1FP6A 1J9ZA 1AKMA 1Z7BA 3QA3E 4LC0A 5M04A 3K16A 2JFYA 3LOPA 4G5RA 4WUTA 4P92A 1NNUA 1ZJYA 2ALJA 2CHVA 3B6KA 1N1MA 1VOTA 4Q48A 4YRFA 1NC1A 3RS4A 4CMEA 1X19A 3DUFB 4TYMA 2VATA 3A04A 3VKGA 1IQPA 1BXKA 4QGSA 4ZTZB 3L7NA 3RRFA 3TDMA 1Z5ZA 2DY0A 2O3UA 2VHTA 5FQOA 2Z4RA 3WB0A 4GMGA 4Z86A 1CETA 3ZE1B 4LF9B 5LPNA 2GN0A 1C9YA 3ENKA 3VSAA 5IM4A 1T9BA 4DUPA 1U1DA 3ONFA 1TA9A 3JQ6A 5CBPB 4C0LA 1MX3A 2QRVB 3A2KA 3QTLA 2CJFA 3F7NA 2OWDA 3WNZA 4OHXA 4MYHA 5H7XA 4QGFA 4R7ZA 3RU2A 4IV0A 1XRLA 4CEIB 2HXSA 2WIFA 1DHRA 4CFZA 4PINA 4DWOA 1TE2A 4S1NA 4MDEA 5JO0A 1GGJA 2KPOA 1IFXA 3RU3A 2M9MA 2A1TR 2J3LA 4YUXA 5KKCA 2ZRKA 3GDGA 4EENA 3FPSA 3WJAA 2Z8XA 4XCVA 4BMPB 4YMGA 2PX6A 2H4ZA 2BHRA 1ICEA 3BMCA 4GECA 4RF4A 1DEXA 4UM9D 2JLRA 5GIOE 2FNAA 2LCQA 3GJ0A 5KPDA 2Y0BA 4WX2B 4RY0A 2EW2A 4PHCA 1KY4A 5E4YA 2ECQA 2BONA 4BO8A 3P8ZA 1NQUA 1XA0A 4IXWA 4DMCA 2FPPB 3B6JA 4YASA 6REQA 2ZBRA 4ID3A 1IXYA 3DVLA 2I2BA 5C32A 2OV1A 2NYAA 3CO5A 1WCIA 1W44A 3FETA 3T3MB 5LJIA 2FW6A 2YJGA 1UIMA 1PUIA 1WB5A 4LJ5A 3MWKA 1GYRA 1ZNQO 3G2JA 2VBGA 3HV0A 3QG1A 5G4KB 1BG6A 1Z39A 5KJ6A 4EGCB 2GAOA 3RUPA 5LLDA 4LSMA 2FV8A 3HNRA 1YSCA 3O93A 3ZH9B 3ESCA 3Q85A 3ZNQA 3IVCA 4RFLA 4CTOA 4GM0A 4EI9A 1DAPA 1NGSA 1XMJA 4CM4B 4ZI5A 1XVUA 3RYIA 3PSHA 1WLYA 3GJ4A 2DHDA 2QTLA 2WJIA 4FIDA 3S5UA 3QPUA 2VXCA 1AGPA 3FNBA 2BEUB 2BEJA 3FYUA 3BJRA 3WIOA 1NZJA 4IG4A 3VNQA 5E7MA 1RP1A 3GN1A 1ZA1A 4M9XA 3UWKA 1MX5A 4QOJA 4BX8A 2F1OA 3IXQA 2IZ5A 5JCJD 1IHUA 3OOJA 4GBMA 3G88A 4IF6A 1K63A 2R84A 4K3UA 3U37A 3HYNA 3GRPA 2I33A 4LE1A 3JSAA 5H0IA 1DP4A 1SQGA 3RIHA 1PL6A 5JH7B 1OTHA 3ZV5A 3LWBA 5HKKD 4YWJA 3OSZA 2JLCA 4C78A 1JJFA 5E9WA 1UF9A 3UAXA 1DDGA 3LP6A 5C3MA 1JG6A 3E15A 1LFDB 3H9EO 4L51A 3RVJA 1TUGA 4E94A 5K8IA 3EGIA 2X6QA 5E1BA 4HNHA 1KOJA 4ER5A 1G21E 3PXCX 4I9UA 3JTMA 5C18A 4DR2B 3BXOA 2VN8A 4LX8A 3I8XA 5BURA 2XUPA 4R8RA 2P6UA 3LUCA 1US8B 1YBAA 1ONNA 4OK6A 5I9MA 2PMWB 4X93A 4N8DA 3KQSA 3ZNOA 3EUAA 2A0UA 2MYUA 1NF9A 4YP7A 1X3SA 2XCOA 1GUBA 4UVEA 1OAKA 3OEEA 1LTHR 4NCJA 4KMSA 3RSZA 3GZJA 3EHEA 3LT1A 1JSRA 2HO4A 3C74A 3R7FA 4H9GA 1C3OA 1BS1A 1V6AA 1WHTA 3G0DA 3D6AA 4MPJA 4OEHA 1V3TA 3MOSA 2PBFA 4CM3A 1XU4A 2HMVA 3MJCA 3U3JA 2QJFA 4EKYA 1ACLA 4OBWA 1VIVA 3U7RA 1SKYB 4N9QA 4R9RA 2OENG 3NP9A 4DIOA 4RXUA 5MGBA 4DLXA 3FTNA 3WGQA 4R6WA 4AZVA 4XJSA 3RFVA 4F4IA 4FKZA 1XDUA 2FP3A 1OX4A 1VIAA 2MSNA 2MWMA 4G9EA 2AR9A 1JFTA 3QQ5A 3LC0A 4G84A 4Y1EA 3KR0A 4I99A 4ND8A 1YFLA 3D8UA 5BSHA 5AOCA 3CONA 3DD1A 4B8WA 5IP5A 5L3RA 4BLOA 2WPDD 4L15A 1EI9A 5B57C 1HMYA 3I12A 2NQ8A 4MA4A 2IX9A 3IIEA 2L82A 4Q12A 4CPDA 1EWTA 4INJA 2ZJAA 3HCDA 5JAMA 3Q9LA 3ASUA 3QEMA 1ISSA 4WXHA 4DQVA 3NASA 1Z5PA 3LPMA 1R0BA 1II8B 3BULA 3PXUA 5EJ4A 5LXTA 3RRZA 3SR0A 2OD7A 4EVIA 5I51A 1AKUA 2QUZA 1LZKA 2EP5A 2V45A 1ZAKA 4OPMA 4HPJB 1UEJA 5EHZA 5IANA 2EX1A 1SCNE 4GYYA 2QY9A 4U8HA 2OILA 1Y9ZA 2XSZD 1JS1X 3Q0EA 3CB2A 5DGDA 5TQJA 2JIZD 2KM1A 4UCFA 3UC9A 1SZCA 1X3LA 4OHUA 2MYNA 4LC9A 4UUMA 2XRFA 2FRVA 2E1PA 2AN9A 3GR6A 5D84A 4FGUA 1J5PA 1GFWA 3PF9A 1SEVA 2BMDA 1B6SA 4A2WA 1ZGJA 1Z2PX 2PT9A 3EOBI 3LW7A 3I04M 3VNSA 2VTEA 2IOQA 5EFZA 2CLCX 1TZKA 4FEAA 4OREX 3VZCA 4CEJA 1LLCA 1XZPA 4MR9B 2C83A 1TAUA 3IEIA 3WVNA 3L8HA 5ESXA 4F5YA 5G1PA 4X8MA 1ISRA 3HBFA 2HA6A 1O08A 4X20A 3JQ8A 4G0WA 2Z2IA 3GVIA 2C5HA 3Q5DA 4YACA 3W8RA 2EBUA 4LAFA 2PXXA 2QIOA 4OQPA 4HC4A 2GX6A 3ZWCA 1B1AA 3CKLA 3AL0C 2A5LA 3SYNA 4BBJA 1ZI9A 1FFYA 2GCIA 3ET4A 3KKKA 3FUXA 4D4GA 4YXWA 2X6TA 3EFBA 2ORYA 4I50A 4BVFA 4LPKA 3SBDA 3S40A 3GX1A 1JFVA 5HKBA 5HKAA 2P2CA 4TS3A 3PDIA 2J3MA 3LECA 3D7NA 2QDKA 1GPH1 4CN8A 3KUKA 2Q1UA 4NNOA 3T7RA 4MWGA 3FFXA 4L07A 1LVGA 2QTVA 1QK3A 4KWHA 3HXKA 3EY4A 3CGGA 4KGDA 2PFKA 4QGAA 3RPEA 1X87A 4ASUA 1FFBA 5IEBA 2EXXA 5SZHB 1D6MA 4NP6A 9MHTA 3MTAA 1U2GC 1GZ6A 2WJVA 3WMEA 1Z7EA 4I4TF 2QL9A 4XCQA 2XUFA 1NFRA 2BLNA 4L7QA 1N0VC 1BKDR 1C4XA 1GV0A 1CYDA 1AVTA 4WADA 4DMHA 4C7MA 3UM9A 2BGKA 3LLVA 4MR7A 4CL3A 3NR2A 4X1KB 3K09A 4LXYA 5EJIA 1JVNA 2ZPAA 3LUAA 3ZU3A 1PHPA 4C87A 4FJ0A 3HCPA 3SVLA 5B7NA 3G9UA 3G5UA 5C8DA 4UDOA 4J4HA 1ZDMA 3EYWA 1Y6RA 4N3NA 4Y6SA 5BSRA 2AUMA 3GK3A 3EHDA 3IBSA 4JLNA 4W8OA 3OTIA 4FFOA 5FNZA 3U7QA 3L6EA 1FFEA 4R2LA 2GZSA 2BH9A 2VAVA 1V3UA 3FVTA 1MT0A 3KWFA 2OFPA 3N2GA 1VHLA 4V38A 1MGOA 3D6HA 3CH6A 3OLZA 3AHFA 5FBZA 5TPWB 1T9GR 5ALRA 4O4HF 1DIHA 5AIAA 1VRWA 4HHEA 1IE3A 1Y33E 3U61B 4IDNA 5JY6A 3D9QX 1P44A 5JHHB 5DB4A 4EX7A 1NE7A 1T9KA 4F9GA 1TGVA 1ZU4A 1QANA 3INNA 5AVVA 4FPXA 1JLLA 1IK6A 2YH2A 2RAVA 1Q0ZA 4MUGA 4RH0A 3T5BA 4Z1MD 2MDTA 2PKCA 1XVVA 1W5AA 2RHDA 4H59A 2BI7A 1VHDA 3C5HA 4Z9BA 4C7VA 4QTUB 5AXBA 4ZKEA 4BEBA 3NLLA 1UMCA 2DSNA 2LDBA 3DOCA 3IP7A 3ZVLA 1DG3A 4PYRA 2VJLA 3UB3A 4R1QA 1BWQA 3OTQA 3C85A 3UO8B 1A9XA 3QIVA 2YWEA 4FFNA 5IT5A 4N0EA 5KI6A 3CX8A 1BIFA 2D1TA 1MB4A 4RHEA 4A0GA 2FPIA 2RKBA 1EDBA 3WK4A 5JI2E 1UAAA 3AHEA 1Q1GA 3EVAA 4MWOA 1Q92A 2BMVA 2X15A 1G1AA 1M8GA 1F38A 1W0CA 3Q5GA 2O6LA 5ELLA 4AURA 1PK9A 2PUEA 2A86A 4IJ5A 5LP6C 1OWOA 1KJ8A 2HCBA 4WLOA 5LD2C 3JZMA 3KDAA 4S2UA 1BFKA 3DOIA 4H4CA 4MRRA 1PKXA 1XE3A 4EUEA 1EA5A 2IUTA 4EUHA 1B2LA 1L7QA 1V9SA 2B6HA 2CVQA 2DLNA 4ZT3A 2VBIA 2OOKA 3L5OA 3WRYC 4A6DA 4UUAA 5A7HA 2XCQA 4FOTA 3U3RA 2M6KA 1XG5A 3UJ8A 4C2BA 3VKWA 3CPHA 1DIGA 1VC2A 3LS2A 1AY0A 1U3VA 4B79A 5LQKA 5AJVB 1RLJA 4M0KA 1XJWA 3DZHA 1BH6A 1WCWA 5I01A 1THZA 4K46A 4AY6A 4WXYB 4C3ZA 3BTSA 2WZBA 4J1TA 5EL0A 2EATA 5CR9A 2VT2A 4RLQA 3THRA 3GYBA 3H8VA 1U9JA 1N2ZA 1Q1QA 2A0XA 4YVFA 3TMYA 4K8RB 4E5YA 3I72A 3IQEA 2AE2A 4RTKA 1UIRA 3FFBA 1BMQA 3GVCA 2ZRGA 4BAZA 2PGAA 1OHHA 2NUBA 2R68A 2P6MA 1A9SA 2AR7A 2VDNB 1H2BA 3GRYA 3Q9SA 1D7OA 2X0FA 2P41A 5CFRA 4U9HS 1RC8A 3BXPA 2GAIA 2PLFA 4YRJA 1VKNA 2PZFA 2E6KA 2UVDA 4PG8A 1W2WB 3K0FB 4GOXA 2YOHA 4IEFB 1DDIA 1EE9A 1T2VA 1S6YA 3FTQA 2IV2X 1W48A 2JCBA 1G16A 2HYDA 4LW8A 2JCSA 3F46A 3KEMA 3RUCA 3GLQA 4ZJZA 3T5AA 5BUSA 3Q8MA 4ARIA 1Q1NA 3KKEA 2F8SA 4KR6A 3LHSA 4GX5A 4FMBB 1GDDA 5CK4A 2YV4A 3AIKA 3LRTA 4CMEC 2EFGA 1EB9A 1VCHA 2A3NA 3H8JA 2XOEA 4IZ6A 1T5SA 3KUXA 1T5DX 2WRZA 4H6WA 3GJSA 3LBNA 1EFPB 2OHJA 2YRWA 3T3IA 3Q6MA 1VE1A 4KGVA 2KI5A 2NZUG 3AF0A 3NCTA 4O4LB 5BMOA 3W5BA 3THXB 1NUPA 2PVCA 1PGOA 3QFHA 1TYCA 2C2XA 1Y4ZA 2JIOA 3F9CA 4CQMA 5FTLA 2G17A 2XD4A 4DLNA 5MN5A 2ZQ5A 2OCLA 2BCEA 3I01A 4N6NA 4YJ3A 1CX9B 2R87A 4HFNA 3MCAA 3NB0A 4E5KA 3D4BA 1FRFS 2Q3FA 3OIDA 2VJYA 4BIIA 2HJWA 3BD6A 4XX0A 2UXDB 5ISMA 4LG1A 1B0ZA 4ND5A 1Z5WA 1JEAA 2FEKA 2W2NA 3AI3A 4GZ5A 4JJ8A 4B0OA 1UBGA 4HT3B 1TCBA 4RTSA 4K3VA 2BFOA 1K6XA 1UOQA 3DULA 3HCOA 4A6XA 2DF8A 3BMQA 2EBWA 3HFGA 5I9NA 4J1NA 1RLOA 1QS0B 4UHCA 2VR1A 4D0LB 1CUYA 3F4LA 4KUGA 1TW2A 2YJZA 1OWLA 1KVSA 3KJGA 3KVNA 2IHYA 3BKXA 3NM6B 4PSAA 1RWWA 4QUBA 4RUKA 4B2YA 4DLZA 1IONA 1OVGA 1VCIA 1CJMA 2OBYA 3CZRA 1VIYA 5KJCA 2XNDA 4CM9A 3OC6A 2NU6A 1NUAA 3IPXA 2BTQB 2MYPA 2Y92A 2PX0A 4XPIA 3RVOA 3UH0A 3UJHA 5AH0A 4CU2A 2CUNA 5BUZA 5A3JA 4FMDF 5L4SA 4FZVA 4FM9A 1NX6A 2ZSFA 1GL9B 1MQSA 1QRDA 3O9MA 4H3KB 1UDXA 3C3JA 4IICA 5I9TA 5JANA 3ROTA 2ZI9A 3ZJTA 5CDGA 4BL5A 1QHHA 4ZU1X 2VXOA 2PS1A 1NI3A 3QXCA 4J94A 3W3AH 3LWDA 3BCSA 2XJ4A 2JLBA 1XTRA 2I67A 5KWJA 4MQEB 2NQTA 5EPOA 1ZCBA 3WO1A 3UBTA 1MRZA 1ZMOA 2AG0A 2VNHA 3Q10A 1ZUIA 3L4BA 4KQIA 5BSGA 3CV3A 5LQDA 1IJBA 3W4KA 4F93B 1DBIA 3FYUC 2VKQA 4PPGA 3O4FA 4ROTA 4ZYZA 4WDRA 3A36A 3WFJA 1JW9B 5B58T 5IJAA 4BNFA 4RGYA 3A37A 4ZTUB 3GLUA 3E9QA 3JQGA 5JJKA 4FHCA 4C04A 1O89A 2Q6TA 2VYNA 4NR0A 4P3YA 2VJBA 3B78A 1LCIA 2ATEA 3WOHA 2WJ3A 1NVVQ 1E9RA 1QGUA 1YR3A 1VJ0A 1O6BA 1VLVA 3HB4X 1DO0A 5JROA 4WESB 4R9SA 4X97A 1XWIA 1JJIA 4PZYA 5AK5A 3DSRA 4OXRA 3DB1A 3E27A 4D96A 4BMZA 4G4GA 2AF3C 2ETXA 1J00A 2BKVA 2XXBA 4OI2A 3UWPA 3W1WA 1RCTE 3G8AA 4K9QA 2E9SA 4P3OA 4DR5B 4G5FA 4IOLA 4GDMA 3VVMA 2LXNA 4JC0A 1VE9A 4EG7A 4IY1A 4JLUA 4LFBB 1CUCA 2CNOA 3HWSA 1UPCA 1XMVA 1ITZA 4TKLA 3WGTA 2ZJZA 1WBDA 1M2EA 4I3HA 1XPJA 4OGLA 5GTDA 1Q2UA 3VHLB 1P3DA 3F5MA 4KZKA 4PC3A 3TW8B 1J21A 3WLSA 1VMAA 4OI4A 4LJSA 4BC0A 3AZQA 2VF7A 1G291 2ZJ6A 4YT8A 5DV9A 3RAFC 3F0TA 4B0PA 2JDID 1QH8A 1QC5A 5LMCA 2PV0A 3FDIA 5HE8A 4EUKA 1PQWA 4YRPA 1KBZA 4ZT7A 1ZRMA 3MIIA 4GGOA 2G1JA 3MS2A 2AXQA 2DC1A 1EK6A 1PT7A 1QIJA 5A0FA 5JRJA 5EZ6B 2GUWA 2I2AA 1E4VA 2BJVA 2IPAB 3NNNA 5K01A 4QASA 2VP2A 2YFKA 4WD3A 5CCEA 3JQ9C 1BA2A 3CFYA 4Y2YA 2Q9CA 1RHRA 2P4SA 3DMHA 1ZPDA 1TQ6A 1R9GA 1YQXA 2H7VA 2YDXA 3O8DA 3BE5A 3VJLA 3O82A 1J90A 3ZLJA 1UXOA 3ZVKA 4UAJA 4E0BA 2H4YA 1KKUA 3DD5A 3HKBA 3OD1A 2W0MA 1P1HA 3PIRA 1F12A 1KU0A 4IOJA 4A91A 3THYB 1G18A 5FYQA 2DT8A 3ZZMA 5A9RA 2H1IA 4KFTA 2O07A 1F0PA 1YDGA 4EHAA 1PR6A 5CW2A 3FPBA 4ZZ1A 2SKEA 1PDOA 2V6JA 2X2PA 1UWCA 2O5RA 3M6WA 4P08A 2V97A 4U9IS 2HFJA 3WLTA 5TT1A 3EMKA 4QYIB 1IOVA 1NJSA 3A1DA 3BL5A 3LF1A 2R8PA 4R68A 5I6DA 4NJEA 4WA7A 5I7FA 4U6QA 4MYTA 3DXZA 1PE0A 3RREA 3BWVA 5L3ZA 4CMIA 4N3CA 5JSYA 4OXIA 4G24A 5DE3A 3H1GA 4FI3C 2C07A 3A2MA 2P9JA 1JHQA 3N2YA 4D6XA 4RPCA 1N2CA 2DSTA 1Y98A 2R79A 3QNWA 4ERXA 4L16A 1P29A 3IV6A 4XIFA 4AMYA 1T5HX 1QF6A 3ROZA 1ZGAA 5JPIA 3AVPA 2JLUA 1Y5LA 3CR8A 3GYGA 4Y1RB 4RA9A 5AI0A 3G0BA 3PX3A 4ND7A 4ZC1A 3DO8A 4XM1A 3UMVA 2LKCA 4V03A 2IH2A 2H51A 2IEGA 4DUGA 4A6PA 5LQCA 3A4VA 3MCWA 2OEPA 4FN4A 3TJMA 4I5IA 2BZGA 2HA0A 3CJQA 4OK5A 4V2IA 1K7CA 1S3GA 4XWOA 4PYIA 1OZ0A 4PCUA 4ETNA 1VRVA 4I4TA 2WB4A 1VPDA 4YO7A 2H11A 3R40A 4GSYA 4OB8A 3UGKA 1UBMS 4K8OA 3ZZ1A 4C6TA 2Y3IA 4YALA 4HDQB 5IN4A 4DRXA 4YCLA 4MWSA 3NJ4A 1J25A 3EZ7A 2Y1DA 3R3UA 1CS0A 1T8WA 1K3FA 4LS3A 2XCRB 2YC2C 3L7JA 4JDUA 1TZBA 2BHLA 4RKEA 1R5BA 1DIRA 2RIPA 4FFMA 4OXKA 1T5OA 3PNSA 1FA9A 1M2HA 3GBVA 1IHDA 3BA1A 4PSKA 2BEVB 4YFYA 1NTRA 3OH8A 1QGAA 3ZV6A 4YGXB 2CJXA 2GZ1A 5T4FA 3CVVA 3GEBA 1ZFNA 1OGIA 4O4HA 4TGLA 4OHWA 4RIGA 3I9V1 1EA7A 1JYSA 1MJFA 2X13A 3NYWA 4HX9A 4RQBA 4M86A 4ZI2A 1A7KA 4L0CA 5THQA 3PD1A 3AEXA 3QA9A 1BCSB 1C2YA 3G89A 1QR6A 1V9CA 3H0KA 4LUCA 4UZSA 3TNLA 3HTXA 5HIJA 4LWZA 4XFKA 5FBVB 2JD0A 3CRRA 3TOVA 3I9OA 1NXXA 2A0KA 3HKDB 1Z07A 2ESRA 3CX4A 4X61A 1ULSA 1UBJS 5SYMA 4CL0A 2R2AA 2X1HA 3O47A 1KJYA 4CMGA 2PO7A 4M1TA 5EXDA 3R3XA 2NUPA 1STOA 1E1KA 1A4RA 4K28A 1ONPA 2AFIA 5CLLA 1D0VA 3K09C 2RGEA 3D1LA 3AK4A 1YVRA 5K3DA 4C07A 3QVSA 5C35A 1EFCA 2FAXA 3FBTA 1RJ9A 5DN9A 2XBMA 1YNSA 3QENA 1PTKA 5KYUA 3U3KA 3T1TA 4RTPA 1Q1BA 5EYPB 3ESQA 3BCUA 1BCRB 3C3MA 4L74A 1TYEB 4Q9JA 5DF1A 5FORA 4BE4A 1CY2A 1E1RA 3VZSA 3GDFA 2XOKA 2QBYA 1XNQB 2LV8A 5FUWA 2ZDGA 1NBMA 2C7RA 1K86A 1QDEA 3AL3A 1PR9A 1QFXA 2DKFA 3HHPA 5LZ4A 4P3NA 2Z3WA 2RH4A 2W71A 1KSFX 3QXHA 5J5AA 4OHYA 1JEDA 1CHDA 4MCIA 2OLEA 3GC6A 3F90A 2VTBA 3K9CA 2WVAA 3D2CA 1NNSA 3JY6A 1JEJA 2IPNA 3ZIAA 4DLKA 2YS7A 3U40A 5KQSA 1HEYA 2HA3A 1EX6A 4OU4A 4WCFB 1SM4A 2Q2QA 3OOWA 3GEGA 1T24A 1ENYA 1IUNA 3B3QA 2IKQA 1E1LA 2J0VA 2OXRA 4INZA 5TR9A 1PZEA 3AVUA 4HTFB 4KMRA 2ZJOA 3PJRA 2IS6A 3C14C 3PYXA 1GXSB 1T1GA 3X43A 5DDIP 3S1AB 3ZDYB 3HM2A 3A9RA 3HP4A 3SXPA 2RSLA 1G60A 1JQDA 5FTWA 4D92A 3RS9A 1EFHA 1ZOIA 2R6AA 3GA0A 4ZEVA 4UXJA 2ZYGA 1KTVA 3KXLA 1H5NA 2NAPA 2EGUA 1FBTA 1SZPA 3HB5X 5K6RA 4UM7A 2UUCB 4MVJI 4FE4A 1TAGA 1YZGA 4QIHA 1HSOA 2VQDA 2JFXA 2ZTHA 5BVHA 3PITA 2CDRA 3DCJA 3IUYA 3JAWB 2DPYA 2D2VA 4QTZA 1SXJE 1YDHA 3TTUA 5A4IS 4QGHA 4XA8A 5ER6A 5T57A 3W5HA 4DJDC 3CE9A 3HCNA 2RONA 2VSNA 4OA8A 4QUGA 3AYXB 5KNBA 1T9AA 1VL2A 2ZWIA 3MWFA 4BFCA 1I14A 3D8SA 4IDUA 1M2JA 4RCVA 2AGVA 3N2KB 1IK4A 2I6TA 1WPGA 3QKTA 2HHJA 4J1TC 1E0SA 1S2DA 3DDCA 3G5AA 3N70A 4PBTA 1BROA 1H22A 2I3GA 1BU8A 1TVMA 2OPBA 3U0BA 5I3CA 1RRPA 2QLTA 1JR2A 1U0LA 4N3GA 1L1FA 2R62A 4DILA 2ZTLA 2WFAA 4TS4A 3W1VA 1PS8A 1L5NA 1FPQA 2CL7X 4DLPA 1IOZA 2B8JA 3JYPA 2ZR0A 3IPCA 5B6IA 2QPLA 4NYMQ 4ENSA 1MHTA 2IX3A 1KI6B 5FADA 2DHRA 4AMZA 4DIBA 3C4QA 2B9EA 3QELA 1WSWA 3FYHA 4LRUA 4MV3A 5JCZA 1QO7A 3HGMA 3WADA 7YASA 2YDYA 3TW0A 2CFRA 2QN6A 1VBMA 3SKYA 1RACA 4B6RA 3HSSA 1NBWB 1KJWA 5C1BA 1P7PA 3CGWA 2B9VA 1V16A 2H2GA 1ACJA 1XLTA 2PRJA 3CH4B 3KYCA 4KQEA 4PEVA 5AHOA 4EX6A 1LPPA 4L5YA 2Y0EA 2YMPA 1DKNA 3N2ZB 3TWOA 2QAGB 3IBGA 3DFFA 1BMFA 3I0MA 2CY0A 5A5EA 4EF4A 1P2BA 4BGIA 3K0AB 3CTPA 1MD9A 1SA0A 2FDCA 1L5FA 4UMEA 1EXWA 2ZSIA 1N5DA 5EWJA 3IURA 3PL5A 4PCLA 2AV6A 1TAQA 1MJNA 2QZJA 3OZIA 3UBMA 3P4UA 4M83A 2FX5A 1I3KA 4JB8A 4JK3A 2VQEB 3L8ZA 3ECCA 3U4QB 2E0IA 4HBGA 2XITA 5GOZA 3EXHB 3BPSA 4X6YA 4C6RA 5J4YA 5LQUA 3K7EA 3RVMA 3OZAA 2QLLA 3CXRA 3MMSA 2DM6A 3REGA 5AVYA 3TQHA 2NMVA 4ND3A 3GT7A 3TLGB 4CIXA 4YCJA 1LQ2A 4BNIA 1QQ5A 1R4MA 3WWEA 3AIIA 3T1NA 1CNMA 1TO2E 4OJQA 3AI1A 3O0DA 1Z4PX 1TECE 5CJJA 3A14A 2IEZA 2B7CA 4HUJA 1TJNA 4BB5A 1P73A 1KAEA 3GP5A 3WRXC 3NAMA 4GSLA 2AHRA 4N40A 4D4KA 1UM9A 3UATA 2CKMA 4GRAA 4X24A 3RABA 3TTSA 5HM6A 3R3ZA 1TYAE 3BF8A 1IATA 2HMAA 1TTQB 1YHNA 1Y1LA 3LUGA 5IU6A 1C30A 4INAA 4XSGA 1TC1A 5CB4B 2ILVA 1I2CA 3PRYA 2M6LA 3U56A 2OZKA 2WT4A 1YRLA 4O3FA 1CK4A 5K45A 2J07A 4D97A 1B15A 4RVSA 2HJHA 2CYCA 2NVOA 3IDQA 3MTIA 4NCHA 5CDUA 1XR3A 4JMLA 2Q7DA 3ENNA 4CQMD 2XMQA 4HS9A 3UMRA 3IODA 4C05A 4QO7A 4MKHA 4D9FA 1Q12A 2HK7A 1A72A 3A1WA 2ILTA 4Z2AA 4UAUA 3EVEA 5EZYF 5CXQA 4EFNA 1T0UA 1ZIOA 1MORA 2WSSD 2BKLA 3PRKE 1FVXA 1MIHA 1K6JA 2HX1A 4G89A 1WHSB 4BZXA 3ORFA 5KU7A 3D3EA 3ZV3A 1D03A 2ANCA 5B30A 3I9JA 1ULTA 4IP0A 5IYZF 3U4DA 3O91A 3R0VA 5KYNA 1G8YA 2JHFA 2DUJA 4GRIA 4B09A 1HNXB 1TMGE 3E9NA 1MFZA 3IERA 4TTJA 1IH8A 4RLFA 3REOA 3WLEA 5JWOA 5AKLA 1DKUA 4HBZA 5TJHA 4CDMA 4O2AA 5KYKA 4NPAA 1KQPA 3I58A 3HY6A 3PRJA 4URYR 3WBBA 2QN3A 2JARA 1XJQA 3HMQA 3K0SA 4E6PA 3FHJA 2XNDD 4C0XA 4CM9D 2GESA 3GVXA 3K8QA 1BDJA 2YWGA 1W94A 2CC2A 4ZICA