1SB9A

Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-glucose
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
340
structure length
340
Chain Sequence
MSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIENTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords wbpP
publication title Crystal Structure of WbpP, a Genuine UDP-N-acetylglucosamine 4-Epimerase from Pseudomonas aeruginosa: SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 123
structure length 340
sequence length 340
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sb9A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1sb9A02
5JDCA 1YL5A 1VL6A 4IIUA 1LEHA 1E3LA 2I66A 4TRRA 1R66A 3IOYA 1TT7A 2HMWA 1Q0HA 4G5HA 1PGJA 4UVIA 1I8TA 1A72A 4IZHA 1U4SA 3A9WA 4IMPA 4IZIA 4PG6A 3ZW8A 5KKAA 1ADGA 4XQCA 1QYVA 4FOSA 2CSUA 4CM9A 4LISA 4NJMB 4Q39A 5JYDA 1BDMA 1M75A 4LRSB 1HSZA 4PLVA 3RUAA 4RCVA 2X5JO 3BIOA 3I9OA 3GPDG 4H15A 1E6WA 4DVJA 1DRWA 1P1KA 1UH5A 3GDGA 3QVTA 2GN9A 8ADHA 3E9NA 1WDLA 5KVCA 2DQ4A 2YDXA 4J49A 5KKCA 1JKJA 4BNTA 1HDGO 5JAQA 4I1IA 2HDHA 1YL7A 1P33A 2O3JA 1YE3A 3DHEA 1ZXBA 4PG7A 1YWGO 3R0IA 1SOWA 3LVFO 3AUSA 4MINA 1YB5A 1CQIA 4NHEA 4D43A 1WZIA 4IDBA 1GZ6A 2WWRA 1KVTA 4TRMA 4D45A 2GF2A 4OKIA 3PHIA 2EJVA 3KOUA 3ZV5A 3AUAA 1H9BA 2CZCA 1MFPA 3GEDA 3JQBC 4CM4A 1BW9B 2GUGA 2IYOA 4NBUA 3JQ8A 2Q4BA 1JTVA 2E4AA 2PGJA 5I9LA 4TRJA 1I01A 1XGKA 4IY1A 7MDHA 1JVSA 3GK3A 1KEWA 3TL2A 3RD5A 3S55A 2V6MA 1ARZA 1PX0A 4GLOA 3VAZA 4ALJA 1WNTA 1J49A 3U4HA 5JLAA 3DB2A 4YACA 1GV0A 1E7QA 4XQEA 4IDAA 1W8DA 4XGKA 5ITWA 3QVXA 1NR1A 3WOHA 4N5NA 2QIOA 1F17A 1I10A 4YJGB 1IHYA 2ZQYA 3H9EO 1P0CA 1HSOA 1LUAA 1Z6ZA 4D0RA 5BR7A 1R37A 4XYBA 1O95A 1TEHA 3VOSA 1R4MB 3R3SA 1SB8A 3P19A 3EW7A 2E49A 4U5QA 1DAOA 1ENYA 3GPIA 5FYDA 1TB4A 3GNSA 3I23A 4UEOA 2B35A 4NH4A 3JQDA 3ROKA 8LDHA 3U5TA 1LLDA 3INTA 3G0OA 1LTHR 1R4NA 3IS3A 5JO0A 3OQBA 3WQRA 3OICA 4UVEA 1QYWA 4CODB 4R1TA 4XR9A 5BNTA 3ZN2A 3Q1LA 3JD2A 3D3WB 3V2HA 1VSVA 1NWHA 2X6TA 4J91A 4WCFC 2UYYA 1DEHA 4EJ0A 1FDWA 2DVMA 4CR8A 4TROA 2VWPA 1Q0LA 1LQTA 4YVFA 4RPKA 3R6DA 3B70A 2EGHA 1I3LA 4TVBA 3WLFA 4CMHA 3MZ0A 1LQUA 2EEZA 4DPMA 1O5IA 4ZRNA 1JN0A 2EW2A 4O63O 4B4UA 4BO4A 3BMNA 3VZRA 5TT0A 5L51A 2HKIA 3H3JA 3QVOA 3RSHA 1ONNA 4DIFA 3IUPA 4XJSA 1H0KA 4ZN6A 1JAYA 1N1GA 3KM0A 2H6EA 1WDKA 4BGEA 3AFNA 4KQXA 3VZSA 4E4YA 1UP4A 4N54A 4FW8A 1AUPA 5MGBA 4XRGA 3I6IA 1Y8RB 3EDMA 2PGDA 5DCUA 3GMDA 3DMTA 1AHIA 4LVCA 5L9AA 1Y81A 1QP8A 1CJCA 2VNSA 2V6GA 1NAIA 1KYQA 2Q1SA 1NQTA 4I9UA 4CUZA 4I5EA 3RCBA 4WNIA 1E7YA 3CH6A 2BKAA 4J90A 5CPBA 2XXJA 3GY0A 5KWEA 4FB5A 4YAKA 4CMIA 1H93A 3RJ9A 1YH3A 4IDCA 1IL0A 1OBFO 4UREA 3DBVO 2ZB4A 1NBOA 1LA2A 2QZZA 2Y1FA 1VJTA 4AVYA 3ONDA 3PQFA 3GAZA 3ON5A 1V6AA 1Y5MA 4J16A 4PLCA 4BO3A 3OFSA 2JKVA 2IDZA 4U7WA 2OP0A 4MVJD 5JNLA 3NEPX 4ZRMA 2LDXA 1V9LA 4UAGA 4CMKA 3C3XA 1N7GA 4E2ZA 1I2CA 3C24A 1GZ3A 3ROPA 1E92A 3CUKA 4GI2A 3WGTA 1NQOA 1JQBA 2B69A 1RPNA 4NJOA 1UZMA 4CPDA 5ICSA 1ZK3A 2Q1UA 2AQ8A 4FQ8A 1H6DA 4CQMA 3PWKA 3ZU2A 2EXXA 3MEQA 4BO8A 4CR7A 1LDEA 4J1TA 3MJEA 5G0UA 1NVGA 5EESA 4WPGA 4UULA 2FZWA 1EUCA 1O0SA 2CDCA 2O23A 3QVWA 1N9GB 4OO3A 1RKXA 3I9JA 5KIAA 1U28A 2NADA 2I76A 3LT4A 4OHUA 2BGMA 1CQJA 2YQ4A 3VDRA 3GEGA 3WNQA 2P9GA 1P77A 5ES3A 1F06A 3AUTA 5JW6A 1O89A 1B0AA 1B8PA 4L9RA 4YTEA 1H6AA 3WGOA 5DP2A 1XG5A 3GDOA 3QE3A 1KETA 5G4LA 4DPKA 1B7GO 4AJOA 1HXHA 1K0UA 2I6TA 4CM5A 1Z7BA 3WSWA 1V3UA 3GVPA 3LSYA 6LDHA 3C1TA 2VNAA 3HN7A 1P1IA 2YV1A 1NP3A 3C7AA 4GX2A 1QV7A 4ALLA 1VL8A 1U8XX 2V6BA 2NU7A 2AQHA 3I6QA 2J5RA 3Q2KA 3HADA 2X0JA 4CV3A 4Z9XA 1ZNQO 1EUDA 4PVDA 4QUKA 2CFCA 3B20A 1I33A 3TOZA 4PLFA 3U49A 2Y99A 1P45A 1IPEA 1DHTA 1P74A 4ZGWA 5C7LO 1OI7A 2GPTA 4I9HA 3AOEC 3CMCO 3WWZA 4AJPA 9LDBA 3E82A 2Y0EA 4DL9A 3PHGA 2VHYA 5KJEA 5TJHA 4BIIA 3DZBA 4HUJA 4QX6A 2ZTLA 1LSJA 4BNMA 4TZKA 2FR0A 1B8VA 2PTGA 3BMOB 4BNXA 2VZ8A 5HM8A 2A92A 1QKIA 1G1AA 4R41A 5THQA 2R6JA 2VHVA 3ZNOA 2C29D 2W90A 1AXGA 4CLXA 1B26A 2X0RA 2V7PA 2CY0A 4L73A 3PK0A 4MVJE 5DP1A 5AXAA 3ZV4A 3DOCA 3F5SA 4QQRA 4FFMA 1TLTA 4C4OA 4IDFA 2VRCD 1S7CA 3SC6A 5B12A 3DOJA 3FTPA 4NNJA 3VHRA 3EYWA 1A9YA 2D5CA 4BMSA 2GSDA 5BSFA 5IZ4A 3FI9A 2DTDA 4XGNA 1AHHA 1P1JA 4J1NA 3S2IA 1VJ0A 1WXDA 2QRKA 3UN1A 2CDAA 2V65A 4IDEA 4GX1A 3UH1A 3WBBA 2VUTA 4OYRA 1DFGA 5DBFA 1FMCA 2ZB3A 2PWZA 4GSLA 4Y6PA 1BSVA 4WCFB 4F6CA 3GQVA 1ISIA 4O1MA 3FSRA 3OJFA 5IN5A 5IF3A 1XKQA 4UVDA 3UGKA 4KQWA 3S8MA 1YQGA 3BZUA 5TQVA 2HJRA 3DBRB 2D4AA 4B79A 3DXFA 4DUPA 1FDSA 3ETDA 4WLEA 1GADO 1KY4A 1PJTA 1BRMA 1YDWA 4JJIA 2EP7A 2F1KA 4RZIA 3V1YA 5C37A 1EVZA 2I3AA 4YJFB 4J9VA 5AVOA 1D8AA 3VPHA 5A9RA 5JYEA 1FF9A 1GDHA 3KYCB 2VHXA 5KVSA 5JMWA 5F21A 3W8FA 1UJMA 4FDAA 1F8FA 2JD0A 5EJ2A 4XA8A 3VTZA 2OXIA 1L7DA 4UVHA 1PS8A 2O2SA 2VT2A 2V6FA 4NDNE 5B4VA 2O3UA 1Y8QA 2HJSA 3AJRA 3ZWVA 2CVOA 3ZNNA 4E12A 1DIAA 1ZSNA 4I5DA 1ORRA 4XDYA 4HV4A 1XHLA 4B3JA 1ZBQA 4MP3A 5CEFA 1HE5A 5K6AA 1X7HA 3NTOA 3PTZA 4W9NA 4E2XA 1BXKA 3FWZA 3OSUA 4HFMA 2POQX 4XKJA 1YB4A 4OIMA 4W6ZA 4CL8A 4E21A 3VH3A 1T1RA 1YJQA 5TGDA 1PIWA 2GO1A 4L4RA 1ZEMA 3H65A 1RWBA 4URFA 1UXKA 2PZMA 3AU8A 4J1SA 4CM3A 4JJGA 5K9ZA 2EP5A 2GYYA 1WLYA 5I7EA 1D1SA 3EGOA 1DFIA 1IUKA 2NTNA 4BKUA 1G6KA 3ZW9A 4RF4A 1HETA 3SVTA 1DHRA 3QV1A 1HDRA 3BTSA 3RI3A 3FCOA 1PZHA 4RVUA 3L4BA 5JAZA 1X1TA 1VI2A 4GKVA 2J3HA 3ONEA 4C7KA 1M67A 5DN9A 2BMAA 2QYTA 4Z9FA 4ZVVA 5FEUA 1YONA 3TN7A 3UXYA 1N92A 5F3RA 1K3TA 4FOOA 5KJ6A 1RYEA 1Z45A 2Y67A 4J6FA 4XZ3A 3H7AA 4MVJI 4ZD6A 5ADHA 3PVZA 4DBZA 4NK5A 4EEXA 4L74A 5COQA 3EZYA 4EUFA 4RF2A 3NRCA 1PS0A 4WNCA 2IYPA 2W2LA 1X15A 4PIVA 5JC8A 1P3DA 2NM0A 4HXYA 3I9NA 2WSBA 4JCOA 5A5FA 1PSDA 2NQTA 2IZZA 4A7PA 4O59O 2VOJA 1T2FA 3ASVA 1B16A 2UV8A 3HFGA 4HY3A 3C7CB 3RUFA 4OXYA 2EF1A 1HWYA 3ENNA 4B7CA 1LDGA 5CDUA 1DIRA 3PJGA 4BNUA 4DWVA 3G79A 1QORA 4BQPA 3WX0A 3ROQA 4IJKA 3S1LA 1SCUA 1UXJA 1HE3A 3V2GA 2AQIA 3PGXA 1C0PA 4U8GA 3QP9A 1EK5A 2G82A 3HNPA 4GSKA 4RPGA 4GWGA 3FPCA 3PYXA 3E8XA 5THKA 3E5MA 4CL3A 4DRYA 5HA5A 3QWHA 1U2DA 2RCYA 1TT5B 4LGVA 4CMJA 2X22A 1YB1A 4R01A 4L76A 1A5ZA 5F5LA 3I83A 3QRWA 3G49A 1ADBA 4E33A 5HS4A 3X2EA 1YO6A 4MDHA 2Q1TA 3K6JA 3O9ZA 4B8ZA 1YQXA 1U9JA 1TVEA 4XQGA 1KEVA 5ER6A 4X54A 3UCXA 1U4OA 1V0JA 3GA0A 1C1DB 2AG5A 3D0OA 3O8QA 2Y1EA 1IHXA 1XQ6A 3G1UA 2X23A 4OXNA 3U4DA 1OOEA 1HDXA 4DTIA 2ZTUA 2DLDA 2X4GA 1QRRA 1LU9A 1T25A 3OBBA 3N7UA 3RBXA 1LSUA 1PJSA 3FWNA 2AEMA 2FSSA 2DTEA 1KY5A 4NPCA 3UOGA 4RLSA 2DUWA 4IDGA 4CMGA 5H83A 1T2AA 2JHFA 1JU9A 1ZKMA 5B1YA 3VZQA 3DAFA 1A9ZA 4S3MA 5B4UA 3JQ7A 4CMEA 2AW5A 3DAPA 3AY7A 2B0JA 2CNBA 2VWHA 3IDSA 1MXHA 3JQFC 4PLYA 3OMLA 2HK9A 1ADFA 4IDDA 3ZU3A 3A14A 2FY8A 1C1XA 5F1KA 4NFYA 4A73A 2BGLA 4OQZA 3DZFA 3ZWWA 3QSGA 2PD6A 3F46A 3TOXA 4PG5A 2IRWA 5ENDA 1H9AA 4RF5A 5JAIA 2FZEA 2CVQA 1T1SA 1BXGB 2VYVA 3Q11A 2O4CA 4A03A 5H81A 3KHUA 3EUWA 5A06A 3IMFA 1LLCA 5F1PA 3RC7A 3WYBA 3C1OA 5CP8A 2A4KA 4CM8A 4FJ2A 3DBLA 1SBYA 3GG9A 2X5OA 4B3HA 2GASA 3HUDA 4XDZA 3GR6A 1LC0A 3COSA 2LDBA 1XU9A 5IN4A 2CUKA 3NT5A 5IXYA 4E5PA 2R00C 3W1VA 5JDIA 1KERA 5L45A 2GDZA 5HS6A 4DC0A 3HB5X 3ZZNA 1C0IA 4IXTA 4XQ9A 1E7WA 3WB9A 2Q1WA 3KYDB 3VH1A 4TKLA 2B37A 4FJ0A 2QYSA 1C0LA 1VJ1A 2G17A 3GUYA 3NV9A 2PZKA 1O8CA 4ONEA 1XSEA 3RKRA 1GYPA 1E7MA 4RPLA 2DT5A 5AXDA 3LT0A 4PLGA 3RUCA 5EINA 3PYLA 1D3AA 2VUSA 1O9BA 4EDFA 3NKLA 4RDHA 1N1EA 5DNAA 3D3EA 1ZUD1 4RPJA 3VVBA 3WDSA 2C20A 3H9UA 3UICA 3WGZA 4OOFA 4CLRA 1PJBA 4WGGA 1HL3A 3IUSA 5JCJD 2OBYA 2ZATA 2EKLA 3JYOA 2X1HA 3F4LA 3QVSA 5IG2A 1GFSA 2QQ5A 5TLSA 2VWGA 4WUVA 4RQTA 1RJWA 3WGGA 2I3GA 1E3JA 4XIJA 2HK7A 4R5MA 4YEDA 5FF9A 3PI7A 5EL0A 2HMSA 3G1TA 2Y1CA 3N58A 4F6LA 3DFZA 5TC4A 3HSKA 4RLHA 1NX6A 4XYEA 1ENOA 4D41A 2HSDA 2FP4A 3JQGA 4AJ2A 2H63A 4PZDA 2C82A 3NGLA 2I65A 4INAA 3DMTC 4ID9A 4DYVA 2VUUA 4FC6A 4JX8A 4LK3A 4R4JA 3LU1A 4OSOA 3AY6A 3TZCA 3PWZA 2FRDA 3PP8A 4CLOA 2GERA 1E3WA 4RF3A 4XR4A 3DMYA 4U6SA 4E13A 4WOJA 1DOHA 4BOYA 3WJAA 5EQDA 1YQDA 2NWQA 2ZK7A 1Q2XA 4PRLA 2JFGA 1DBVO 4P38A 4MVJG 4TSKA 4ZJUA 1EUZA 5A03A 1UP6A 1U7HA 4F45A 4RO0A 1ADCA 1CERA 3MJVA 4MPDA 1E7SA 2G5CA 1F12A 1T2EA 1X1EA 2BLLA 5L40A 2AE1A 2Q45A 1Y7TA 3ZWYA 4KMSA 2DBRA 2IODA 2DPGA 4GBJA 3LC1O 5BQFA 1X7GA 4Z6KA 5JO9A 1DSSG 1E3EA 1DJQA 2QG4A 2JCVA 1X13A 3ZGYA 3NDIA 2VYNA 3RFXA 2PLAA 4R54A 1V8BA 1ZJYA 3FBTA 2X9VA 3T4XA 2VZ9A 4HFNA 4J0EA 3DHNA 4GWKA 1NFRA 1Z82A 2VT3A 2AMFA 1AXEA 5A9TA 2WD8A 2YYYA 4PLPA 3L77A 4GH5A 4N5MA 2JFHA 3JQ9A 3VPXA 1WAMA 4CLEA 1UP7A 4DMMA 3AI3A 1LSSA 2UUOA 3EK2A 3LDHA 2ZQZA 2AHRA 2ZB7A 4BNGA 1LDBA 3CKYA 2OFPA 2O2YA 1QV6A 1ZIDA 4FFLA 1HKUA 4DXHA 1NAHA 2B83A 4L4SA 4BNNA 2RBEA 1Y8RA 1BXZA 2O3RA 1Q7GA 2FR1A 3F1KA 1DIGA 3GVIA 4QXMA 5G4KA 3U3XA 4Y8VA 4BHTA 4KP7A 3IIEA 5CAEA 4Y98A 2OOSA 1ZK1A 3ZU4A 4AJKA 4RQUA 3D5TA 2YHIA 3BMCA 1YBMA 1IPFA 2PNFA 1W73A 2UAGA 2RAFA 2FWMX 2Q2QA 3K8ZA 4KUHA 1VL0A 4R3NA 3WFJA 4K9DA 3AY3A 4Y6RA 2PH3A 3HDJA 4TKMA 1VKOA 5JY6A 5G0SA 3H4VA 1EEHA 5DF1A 3WTCA 4D7AA 2JFFA 3GMSA 1QYXA 3GLQA 1U3TA 3JQ6A 4CM4B 4XCVA 3JQ8B 3NJ4A 1E1NA 3E5RA 3TSCA 4UEJA 3VH4A 2Q3EA 3CZRA 3DZHA 1ID1A 4J1QA 1CIVA 4BNFA 1PGOA 3MJ4A 5CEEA 3PIDA 1T4DA 1ENPA 4AJ4A 1LC3A 2VOEA 1G0NA 3KRTA 2C2YA 3KTDA 4PLWA 3RFTA 3OA0A 4BO6A 2JAPA 2X5KO 2D0IA 1YS4A 4EZBA 3ENKA 3HDYA 1P31A 5A3VA 4Y6SA 4C7JA 1BHSA 3ST7A 4Z3DA 4NR0A 1BG6A 5G2OA 5JC1A 5I8WA 1MV8A 4AJLA 4MVJH 3H9JA 2J5KA 4EYEA 4KZPA 2J3KA 2ILTA 5B4TA 2VTEA 1KEPA 1R4NB 2A35A 3JQCA 3UF0A 1MXFA 3WTBA 2Y68A 1WP4A 1UAGA 2VQ3A 5T67A 1GUYA 1QLHA 2AXQA 4G81A 2XF8A 1PGQA 5LCXA 3D7LA 3DEYX 3KVOA 4BNHA 2C5EA 1I32A 4CM6A 4DIBA 1EDOA 4ESOA 4QSMA 3K73O 3RAJA 1I24A 3KETA 3RJ5A 3D64A 4Z9YA 3T7EA 4CM7A 1YDEA 5BNFA 4GX0A 4NZ9A 5KTKA 2NACA 3GRPA 1NWCA 1M6HA 1R0KA 1TI7A 3EHEA 1L1FA 5JMPA 5IDXA 1MUUA 4KUGA 1YBVA 5A04A 4NG5A 1CEQA 1E5LA 3AI2A 5COBA 3I5MA 4E5NA 1B3BA 4RVGA 4FN4A 2GN6A 3HZZA 3BMNB 1EVIA 3PFFA 2NVUA 1DIBA 4GMFA 1Y9AA 4JBIA 4Q3NA 2C5AA 1PR9A 1ZSYA 1AE1A 4MJLA 4IJUA 2PD3A 5KOIA 4TRNA 3OETA 3PLNA 1Q1NA 3JQBA 4B4VA 3H5NA 1N8KA 4CMCA 1QSGA 3GF4A 3JYPA 4BVAA 3JSAA 4HFRA 4XB2A 1A7KA 3RKUA 3GN1A 2Y93A 1DAPA 2R2GA 4YAEA 3K31A 3OIDA 3L6OO 4A5OA 4QEDA 3JQAA 3TDKA 3EAGA 2NTVA 4FFPA 3KUXA 1KIFA 4DQXA 2ET6A 1OC4A 2EKPA 2ZIZA 4PCVA 2PR2A 1RM5A 3JD4A 3MJTA 3JD1A 2HO5A 4HP8A 4RL6A 3S2GA 1BTOA 1WMAA 2P91A 4Z0PA 5CFZA 2YFHA 3VDQA 1RYDA 1Z73A 3GUCA 5EQFA 1MP0A 1D7OA 3ZWCA 2Q2VA 4WEOA 3MJCA 4CMIB 3OH8A 2FPPA 4G65A 5LDHA 4GGPA 1MG5A 2FPIA 3NX4A 5EN4A 4CMAA 1I3NA 4IINA 4ZQBA 3CTMA 3L4BC 4FR5A 2B4QA 3FNGA 3MOGA 5TNXA 2CDBA 4OXKA 3RIHA 2BFPA 3KSDO 3OECA 4ND4A 2F00A 2FN7A 4LCEA 1X0VA 3QHAA 4BO1A 1NTOA 4BV9A 2DFDA 5TT1A 3MWDB 5LC1A 4D42A 1XLTA 3F6YA 2BHLA 4YA6A 4MVJP 2HK8A 3AW9A 1HT0A 4A26A 2DBQA 5A05A 2W2KA 3P2YA 4B4WA 3PYMA 2Y66A 3L9XA 4NIMA 1JW9B 2VZ0A 2X58A 3Q0EA 3H9QA 3ZWPA 4JLWA 3FR7A 3O38A 3L0DA 4YT2A 4ND2A 3C85A 2VCYA 1E5QA 1IE3A 1JDJA 4YDRA 1NNUA 3LT2A 3ANMA 4OMUA 5HWSA 2CMDA 5A3JA 1R15A 3I52A 3JYQA 4GGOA 3IP1A 4QECA 4E2YA 2VN8A 3ADPA 3MJSA 4WJZA 4ZA2A 3B6ZA 4RGBA 4CUKA 3OP4A 2YDYA 4A10A 3HE3A 3FHLA 3IJPA 4IBOA 1GPJA 1ZFNA 4ZQEA 5GZ6A 3ZU5A 1E6EA 2BELA 4YYZA 3B1JA 3GH3A 1WW8A 4MVJM 4Z0HO 1GCOA 2X9NA 3VPFA 2WD7A 2BGKA 4M86A 4KTVE 3EZLA 4WLUA 5L3ZA 5DOZA 5GZ1A 1ISGA 1NYTA 3K9QO 3QIVA 5I8ZA 3DL2A 1H6BA 2Q4EA 4J2HA 4W82A 5DBGA 2DBZA 1NVTA 4P4GA 1H94A 1P9LA 3PEFA 3BTOA 4ZHSA 2IXAA 2FR8A 4UVGA 1NR7A 4BNYA 1PL7A 4AJIA 5IZCA 1ZK2A 2FMUA 3VPSA 4E6PA 4LSMA 4Y67A 2E48A 4R9SA 2EKQA 1FDTA 3A06A 3LF1A 4XYMA 3NDJA 4FJ1A 1Y6JA 3K2BA 3WQQA 3MCVA 3MTJA 4UUOA 4OM8A 4ZICA 4CMEC 2DUUA 2X86A 3WGHA 1P1HA 4P8RA 1I0ZA 3F4BA 4TMFA 2O48X 3ROMA 3QJ5A 4YJHA 2JJYA 3V5NA 3OJEA 1FXSA 2HRBA 3UHAA 1C14A 5KCZA 3TFOA 1DC4A 4EUEA 2D5AA 5T8KA 3PZRA 3BTUA 4GKBA 4O6VA 4OQYA 1Z7EA 3NTRA 1KVRA 5H82A 4Q9NA 1A4IA 2CVZA 4UUNA 2NQ8A 1E6UA 4DBVO 2HQ1A 3RU9A 1JKIA 3GZNA 3W4JA 1TXGA 3HFSA 3OHSX 1HLPA 1Q7CA 4NFHA 2HLPA 5ILGA 2PV7A 5I9MA 4XYLA 2TMGA 1AGNA 1E0DA 2I5PO 2QX7A 3ZDFA 2IZ1A 1EMDA 1VPDA 4FIZA 4CM9D 4YAIA 5BNIA 2DFVA 2Z5LA 3TZKA 4ALIA 4J4TA 3GNQA 1MC5A 1ZK0A 2NLOA 3QW2A 3BXXA 4UEKA 3RVDA 4RJTA 1K2WA 3O03A 5JDIC 4IGFA 4HNGA 1GUZA 2D8AA 5DULA 2ZCVA 5JY1A 3AM3A 1I3MA 5TJ9A 4EEZA 3K5PA 3ZWXA 1PQWA 1XIVA 4FFOA 1ISFA 2PKRA 1O94A 5J23A 2P9EA 3G17A 3HQ4O 4MVJA 2ZYAA 2A9FA 4I8XA 4E32A 4ZU3A 1D1TA 5TIIA 4CQLA 3OEWA 4QFCA 2JHGA 4BNJA 1ONPA 1Y8QB 3B1FA 4DC1A 3DO5A 3TPCA 3OM9A 5TSDA 4AG3A 4MKRA 1EE9A 4M8SA 1YL6A 2JD2A 2B5VA 2HMTA 2JD1A 4FGSA 1HTBA 1F14A 3EC7A 3JQEA 1MX3A 1PZEA 2YJZA 3GAFA 4FD3A 4J43A 3RWBA 5T5QA 1NM5A 2PK3A 2UVDA 5JPIA 3SEFA 2C07A 4PFJA 3PQEA 5A02A 4NBRA 1U5CA 3PXXA 4WE3A 3H5RA 1I2BA 4KTTE 5JDCC 1LDMA 4BO9A 5CG1A 2VRBA 3GGGA 4MP8A 1YGYA 4NBWA 3K96A 2YY7A 3SLGA 3H3FA 4MOWA 5EPOA 1UAYA 3GT0A 3NAQA 5DT9A 1DC3A 1XELA 3ASUA 4W7HA 4BB6A 4D3FA 4PG8A 4XB1A 1P1FA 2C7VA 1HYGA 1XDWA 4O0LA 5FFFA 5TF4A 4R1SA 5EMHA 3OJ0A 2CF5A 1BXGA 1L7EA 2AQKA 2DPHA 4YCAA 2JCYA 5AYVA 1LX6A 1GY8A 1EVYA 1SC6A 2UDPA 3RQSA 1YOVA 3GVXA 4GL4A 2FHSA 1LXCA 2WTBA 1ZCJA 5BT9A 2YW9A 3ZWOA 1PJ4A 4RZHA 5AXCA 1JWBB 3ITKA 1LLQA 1GV1A 4LCJA 3HDQA 5ILOA 2D2IA 2OUIA 3I3OA 3U4IA 1ISMA 2HAEA 2BI7A 1J0XO 1YVEI 1EVJA 4OAQA 3JTMA 1HZJA 3L6EA 2IEBA 3EVTA 3D4OA 2X8LA 4JIGA 1W6UA 3KEOA 3BHMA 5ER9A 1K5HA 5U9CA 1HE2A 1LDYA 4BNLA 3QWFA 5CDYA 2HRZA 1RM0A 3WYEA 3QWIA 4WLNA 4YT5A 1HDCA 4W7IA 3P5SA 4YWJA 4K6FA 1UZNA 4YAJA 4OH1A 1ZVMA 4D0SA 3BA1A 2NV6A 1SOVA 3DBHA 3LC2O 2P4HX 1V35A 4DLAA 3H6KA 1EDZA 1HYEA 2IXBA 2ZYDA 3UKOA 2EJWA 3ONFA 4WLVA 4F46A 4IMRA 3ZNPA 3CE6A 3HDHA 1JLLA 3GGOA 2Q2WA 1VSUA 3ITDA 1HDYA 1KC1A 3LZ6A 4BNIA 3FNFA 2PD4A 5IAAA 4DREA 1PR3A 3GFGA 2JL1A 1MLDA 5A9SA 4XD2A 1EBFA 2GRAA 4PRKA 3ICCA 4XJTA 3I4FA 1FJHA 4JNKA 5KJ1A 3JQ9C 1U3VA 5CPFA 1U2GA 4GVXA 1BVRA 2IZ0A 4ALNA 1MC4A 1I2ZA 4GX5A 1ZO8A 1XU7A 3BAZA 3LC7O 4WLFA 2OHXA 3GEMA 2YV3A 1VLLA 5CHEA 3O8QB 1GEEA 1VE9A 3DDNA 1ULSA 1XQ1A 2GN8A 1LBEA 4NJMA 1PQUA 3WXBA 3TZ6A 2E82A 3DZKA 4GLLA 3OA2A 4FS3A 2P2SA 5K0ZA 1ZXLA 4E5MA 1PZGA 2AEFA 2Z95A 4RVSA 4EW6A 1XWFA 4HNHA 1V3TA 3W6ZA 1JAXA 2DM6A 4D46A 4DPLA 1KVQA 2WMDA 2O50A 4M49A 3W8DA 1SAYA 4ZQHA 2HCTA 4CR6A 5KVVA 1GTMA 3WYCA 4IUYA 1JKFA 3RASA 3WIDA 3EVNA 3JQ7B 3HB4X 2VHWA 2Y05A 3H8VA 3LQFA 5C7IO 2OP1A 5I9NA 4W4TA 3IKVA 4FBGA 4XWYA 4BL5A 1XA0A 5G0WA 4PZEA 5IDWA 1WWKA 1IZ0A 4ROSA 3V8BA 4EJMA 1C1XB 5FI5A 4PGFA 2NUAA 1X0XA 3AUUA 3E1KA 3VZPA 3LLSA 4E3ZA 4JK3A 3NT4A 4B3IA 4CQMD 4WEQA 1K6XA 4HWKA 1GUFA 1BW9A 1PL8A 2C7GA 4MIOA 4NQZA 2P4QA 3AFMA 3QLJA 4NFSA 3T7CA 4YR9A 3CMMA 4PLZA 4UUPA 5IXSA 1R0SA 3ZV6A 4JROA 3NGXA 5T57A 3PQDA 4HFJA 1Z75A 1U8FO 2A94A 4CM8B 3DBLB 4I08A 1BDBA 3FR8A 4JGBA 4QO8A 2OORA 3NT2A 3STHA 9LDTA 1QYCA 2SCUA 3L07A 4NU5A 4EGFA 1A4UA 3KSUA 3IKTA 4YJGA 1PTJA 4J9UE 3DONA 4Q3DA 3WGQA 4TZTA 1R4MA 2EG9A 1ISJA 4JBHA 5DZSA 3WLEA 3DZGA 5JSFA 1PZFA 1ISHA 4L0QA 2I99A 4BGIA 1SEVA 1YXMA 3ZHBA 4B7XA 3WFIA 4LMRA 3ETEA 2CD9A 3D4PA 1DLJA 4Y9DA 3ZWNA 3QWAA 2UUPA 3FD8A 2J8ZA 4BKQA 1CETA 5TRTA 3IP3A 3D3WA 1SB9A 2B4TO 3WWYA 2WM3A 3T4EA 4BO5A 1FDVA 1F0YA 4CLRB 4JQCA 1Q0QA 5JXWA 3FNEA 3JYNA 3AI1A 1DLIA 1GZ4A 2NVWA 1NQAO 3IQDB 1U3UA 1M6WA 4GPD1 3I9KA 4IQ0A 3FNHA 3BMQB 4JP2A 1E7RA 1SO8A 1PS9A 4YRAA 2WYUA 5IDQA 3JQFA 1I3KA 2AEJA 1BWSA 5HBRA 4YPOA 2WDZA 4R68A 5JFOA 1EBUA 1LI4A 5C5IA 2BFAA 3ICPA 3KYBA 1BMDA 3R3JA 3N74A 1CRWG 2YFQA 3PWSA 5IFLA 3PFWO 4DLLA 1Q7BA 1RM3A 1PQPA 4W99A 4RPHA 3WIEA 2O7QA 2PGLA 2DTXA 3I4CA 1QG6A 3JQGB 5DOVA 1OZAA 5I7VA 5JCXA 5GMOA 4LW8A 3GVCA 1NXQA 4BNKA 4E30A 5KJCA 3DR3A 4L75A 2GN4A 2Q49A 3F1LA 5TX7A 1HRDA 4CMBA 4CLOB 3PPIA 3TZQA 4KDFA 1XR3A 3JYLA 4IQ8A 4MIEA 2EERA 2W4QA 5AOVA 2ZKLA 1E3WB 1U1IA 4BNZA 1HDOA 4PN3A 4EITA 3HG7A 1GU7A 2Y1GA 1MA0A 3ZV3A 6ADHA 3WS7A 4BKRA 4BKPA 4BV8A 2GGSA 2R00A 1N5DA 2VHZA 4LRTB 5EIOA 1GL3A 2G1UA 2GLXA 4WECA 3KLPX 2I9PA 1B15A 2GD1O 5CEJA 3RC9A 4YT8A 2RIRA 3P2OA 4YRDA 2WYVA 3Q9UA 3S2FA 5KVQA 2PZJA 2RHRA 4OOEA 1IYZA 4ND3A 3UFXA 4M55A 4D79A 4GMGA 1GYRA 1ZW1A 2YV2A 4B8WA 1BVUA 3Q9NA 1LSOA 1NHWA 3OQ6A 4H7PA 4M89A 4ALKA 1VRWA 3ORFA 2J6IA 1YJ8A 1DB3A 1ZMOA 3LF2A 4Q3CA 4J4BA 2RHCA 1CWUA 2DAPA 1LRLA 4YB8A 3PJEA 1OAAA 1KVUA 3PIIA 2P68A 1CYDA 2X0IA 3CSDA 3JCZA 4FFNA 3HHPA 1PWXA 1IB6A 4J7XA 2H9IA 4WK6A 4MKXA 2GZ2A 3PJFA 2JCXA 3UW3A 3ZHYA 4K28A 1VM6A 3ZI0A 2B4RO 4K6CA 4P22A 4M54A 3UVEA 1GYQA 1T24A 2PA3A 3D5QA 2YQ5A 3TZHA 1PJCA 4J4HA 2WEKA 4P4LA 4K26A 3Q3CA 4DYDA 5DCYA 1ML3A 3GDFA 3KO8A 1N9GA 4XX0A 5DDIP 1FDUA 5COAA 4IS2A 2XOXA 3C1AA 3OQ1A 3PLRA 3NTQA 2J3JA 3Q6IA 4O5OA 4R16A 3RBZA 4BO7A 1Y9EA 3I1JA 1J5PA 1QLJA 5G4KB 5HRUA 3M1LA 3GRKA 4AFNA 1ONOA 3W4KA 2O7SA 3ZWMA 3DZIA 1DC6A 2BD0A 1XYGA 2YHIB 1B2LA 3VPGA 1ZZEA 2C0CA 3BMCB 1IY8A 3PDJA 3QY9A 2YZ7A 4J0FA 4P4NA 2NU9A 3GNTA 3OEYA 1PL6A 4LMPA 4LSWA 1A7AA 4YQZA 3ZH2A 1X7DA 3IC5A 3W4IA 2O3QA 4XGIA 3IJRA 3ETGA 3U09A 3ZWAA 1WMBA 1UUFA 3C8MA 3K30A 3OF2A 3KZVA 3WQSB 4FPXA 4EJ6A 3R1IA 2B36A 1ULUA 4NI5A 1EQUA 1MG0A 2OO5A 4A27A 1O6ZA 5EERA 3TL3A 1GQQA 2IEDA 5ENVA 5IZCC 5L4LA 3HJAA 2J5QA 4K1LA 3KXDA 1N7HA 1MGOA 2BI8A 3CPSA 3RU7A 3WGIA 2WJPA 2B5WA 3KV3O 5JCJA 2W2LD 1DFHA 3EY4A 1A71A 1HF3A 3GC6A 1DXYA 2C54A 3ABIA 3PDUA 4EUHA 3RC1A 4PG4A 1FK8A 3D1LA 3H9GA 3NUGA 2G76A 4D3DA 2HMUA 3LYLA 5K6AC 4I5GA 1KBZA 3BMOA 4GQAA 4RV9A 4W9NC 3RUIA 3WG9A 3RFVA 4DGSA 5F1OA 4RVHA 5T8KC 2O3TA 1XEAA 4DQUA 4YAGA 2VWQA 4QO7A 4Z3KA 3W8EA 1T4BA 3KB6A 1MFZA 4M1QA 1NFQA 3TF5A 1R6DA 1JWAB 1UXIA 3O4RA 2ZB8A 4AICA 1R0LA 2RH8A 4WCDA 4NK4A 4L8VA 3O26A 3DOOA 5BSHA 2NU6A 4BGVA 1WZEA 3GHHA 3DQPA 4N7RA 3QWBA 4A2CA 4B7UA 3AOGA 4IM7A 1K6IA 3TQHA 1G0OA 1OMOA 4FGWA 3DWFA 3AK4A 4MP6A 1YRLA 1DJNA 4CV2A 5JS6A 5JAMA 3WJ7A 2C2XA 3SJUA 2VTDA 1B3RA 4AJ1A 4KDEA 4BB5A 2HUNA 1HE4A 4ND5A 4WCFA 1AN9A 3SXPA 2EIHA 3FPLA 4N18A 3RUHA 3GGPA 3M2PA 5ITVA 3DTTA 4R1NA 2AA3A 5F5NA 3CXRA 3IAHA 3CINA 4ZQFA 1NPYA 3PGJA 3DBRA 2FSVA 2NVUB 3MWEB 3GFBA 1PJ2A 3LK7A 1U7TA 2Q46A 4CQMB 4R51A 3F9IA 2DKNA 1LLUA 3GVHA 4YJFA 2QHXA 1NFFA 2IE0A 3BHJA 3GN2A 4BNWA 5AXBA 4D44A 4D3SA 2Q50A 3KYCA 4E2WA 3JD3A 3TFQA 1KC3A 1YKFA 2BF7A 2PKQP 2P5YA 4ITUA 2OMEA 1NASA 3E03A 4FFRA 1E1MA 5IDYA 1S6YA 2JAHA 4QTZA 3RC2A 4CJXA 3OIGA 2QRLA 4AJJA 4G2NA 3JQAB 1WDMA 3V1UA 4EI2A 4II2A 1QXSA 3TWOA 3I9MA 3UCEA 1I5RA 3PHLA 3HN2A 4KOAA 3ANLA 2VYVD 2WYWA 4KWIA 4NU6A 4WKGA 2Z1MA 1SEPA 3WICA 4LVUA 3E9QA 4KUEA 4TQGA 2Q99A 4Z0TA 1HZZA 1E3SA 2J3IA 4IS3A 4BGUA 3JV7A 4WLOA 2DC1A 2Y1OA 4DQVA 3KSZO 5MDHA 1GAEO 1GQ2A 3WR5A 1DDOA 1GCUA 3UCFA 3U62A 4BO0A 2AE2A 4PLTA 3U0BA 4WASA 3WNVA 4YBZA 3FF4A 1Y1PA 3VKUA 4BNVA 5G0TA 3BHIA 1EFLA 5LDGA 4FC7A 4L4XA 3SLKA 3PZBA 2GR9A 1HLDA 2D1YA 3E9MA 5JE8A 2E6UX 1CDOA 1WVGA 2ZJ0A 4OSPA 2W2KB 1EK6A 1T2DA 2BRUA 3I9LA 3KEQA 1UDBA 2PKQO 4DIOA 3H5AA 4ILKA 1PEDA 1KEUA 2NSDA 3OIFA 5IJZA 3M2TA 3ZNQA 1NVMB 3D4NA 2CF6A 3E6AA 4JN6B 5I7SA 1GPDG 2C59A 2TMDA 3RUEA 1W0CA 3A4VA 3U4CA 1NQ5A 7ADHA 1XCBA 1KOLA 5A1TA 1LRKA 4DMLA 4CLDA 2P9CA 4I9NA 4S1VA 4CLHA 1OC2A 2NU8A 1NPDA 2W98A 1BGVA 4KWHA 2EWMA 3GOHA 1H2HA 2EHDA 4IIVA 4WOKA 2XXBA 2Y0DA 4HBGA 3WGYA 3WMXA 4YXFA 1ZJZA 4NBTA 5L4SA 3DZJA 3LLVA 3E48A 3GZ4A 3MOIA 1T26A 4J7CA 4JP3A 4RVFA 4HKTA 1ZK4A 1F8GA 4IJWA 1QYDA 4UUMA 1K6JA 2ZCUA 4Q3BA 2QW8A 1SMKA 1OFGA 4MKZA 2GCGA 4OGWA 4YRBA 3RUDA 2WD7B 4HADA 3INGA 3TNLA 1B8UA 4MO2A 1EE2A 2PZLA 4U0KA 3G3EA 3OJOA 4ZQGA 3IL2A 2XPCA 1TT5A 2ZTVA 1HEUA 1W4ZA 5A4DA 1I30A 3Q2IA 3VC7A 4AJNA 3H2SA 2PFGA 1K89A 1RM4A 4OJNA 4CUJA 4TWRA 4BMNA 4ND1A 4BO2A 4EBFA 3DAGA 1C3VA 4OKNA 3L4SO 3QQPA 3SX2A 3L9WA 1C1DA 4E5YA 3PJDA 1ZEJA 1KS9A 5TS3A 1U5AA 4RDIA 1DRUA 5FWNA 3AOEA 2P5UA 4B4OA 5BSGA 3PHJA 4XRRA 2Z1NA 1J6UA 1H6CA 2BFOA 3P7MA 2I67A 1I36A 1R16A 4XYGA 2FOIA 3QA9A 3OJLA 5GZ3A 1SNYA 5C7OO 5G0VA 4YJHB 3AM4A 5KNLA 3DFUA 1PJ3A 3DHYA 3M6IA 4FSHA 2GZ1A 1PGNA 5A5EA 4XIYA 1P1RA 4FCCA 4R5HA 3UAGA 1H2BA 1SPXA 1HDZA 5C3MA 3DC2A 3ZHXA 3K2EA 3ANNA 1YBAA 3GZNB 1UDAA 4R9RA 2VYND 1TA4A 4J3FA 2X9GA 2W8ZA 2PY6A 2NNLD 1JA9A 1DC5A 3NJ8A 1PGPA 1D4FA 5KJFA 1EFKA 1ZSVA 4IGEA 3NYWA 1X14A 4QT0A 3U9LA 5FI3A 4H16A 3H2ZA 1PJLA 4II3A 5U4QA 3E18A 5L7YA 4H3VA 5ICMA 1R12A 5L95A 3DTYA 3NDRA 5CDGA 2ZTMA 2OGUA 1UR5A 3LT1A 4Q3EA 4IPTA 3TRIA 1CF2O 4J2OA 4MIYA 3WBFA 4YT4A 3M1AA 3EMKA 4GAEA 1GR0A 3F3SA 4J7UA 4U0JA 1UDCA 1QR6A 1E1KA 4BQRA 3JD0A 1T2CA 3WSVA 4RORA 5GY7A 4BUCA 1SZJG 3ADOA 4JXKA 2HMVA 4PLHA 3X2FA 3KYDA 5DBIA 4HX5A 4CQLB 1DPGA 4RVDA 3F47A 2FPGA 2O4UX 4JJFA 1V3VA 5U1PA 2Y1DA 4DLBA 4YJDA 2PH5A 4NBVA 3V1TC 2XAAA 2EW8A 4IQGA 1P0FA 1J4AA 2YHUA 4AJHA 1P44A 4E0BA 3SC4A 1IZ9A 3RROA 3V2UA 2G0TA 1HYHA 3VKVA 3WMWA 4Q3AA 5DCWA 3A1NA 3MTGA 5I7FA 2WE7A 2H1SA 3AWDA 4IJVA 4F3YA 1PJQA 2ZJ1A 4R1UA 1ENZA 1E77A 3FN4A 4CV1A 2QRJA 5L7TA 1LDNA 3S2EA 2VRCA 5CDSA 5L53A 3TJRA 1JVBA 4PZCA 4QFDA 3VH2A 3C7DB 2EV9A 5T6BA 4JBGA 4MVJF 4AL4A 3RBVA 3INRA 1M76A 4N5LA 4M87A 3VVCA 1M2WA 4ALMA 1IOLA 4DA9A 1GEGA 3ULKA 4R3WA 1C0KA 1ZMTA 3UUWA 3ZCXA 4NMHA 2X7HA 3K92A 3GG2A 1E3IA 1VC2A 5L4NA 1WPQA 2NTJA 3L6DA 2NVBA 1YOVB 2YUTA 3BYZA 5CG2A 3W6UA 2EGGA 3AM5A 5JBIA 2D59A 3F5QA 1A27A 3ZHZA 4E31A 3FRJA 5CDTA 3BTVA 3PHHA 1IULA 2GZ3A 4TVOA 2RH4A 4YQYA 5T64A 3FBGA 5B37A 1E1LA 1EZ4A 1DIHA 1N2SA 1UXGA 4XEHA 2DU8A 4BMVA 2OZPA 2WE8A 3PRJA 4R69A 1MB4A 3VTFA 5BSEA 3FTNA 3ZWBA 2GNAA 3SJ7A 3GHYA 4CV0A 1Y5RA 4IXWA 1KVSA 3CEAA 4E5KA 3KBOA 4PVCA 2E37A 1ZH8A 4OL9A 4CM1A 5L7WA 1NPTO 1VKNA 1DRVA 1GD1O 1M66A 2OBNA 3DBHB 5HTOA 3CZMA 2O3SA 3KLMX 2X0NA 2AG8A 2Y0CA 2ZYGA 5AQ1A 1B14A 2HU2A 1PU2A 1LNQA 4AJEA 1H5QA 1EQ2A 2H5LA 3SBOA 1QMGA 1GQYA 1LRJA 1UZLA 2QZ9A 1LJ8A 1NHGA 1Z74A 2DBVO 1PWZA 2BFMA 3BMQA 3AU9A 4I5FA 4BKOA 4U6QA 4LN1A 4BS9A 1DO8A 5A9SB 4GVLA 1UXHA 3A28A 2OL4A 1U3WA 2BH9A 3CIFA 3JQAD 2D3TA 3HWRA 4A0SA 3B1KA
chains in the Genus database with same CATH superfamily
2Q7DA 3WKDA 1FLVA 5JDCA 4QAQA 1LEHA 1E3LA 2PGAA 3EVBA 1R66A 1FTNA 3V8RA 2P11A 4NV3A 4AECA 2VPWA 2QAIA 4WAUA 5B3KA 1E2LA 2WIKA 1FP6A 1U4SA 2EJCA 3A9WA 3EXIA 4PG6A 5K51A 1IBMB 2PUAA 3UTDA 5HFAA 1D0SA 3EGCA 4XQCA 1QYVA 2XVXA 2HJGA 5A5GA 2CSUA 5I6DA 2WTAA 3AF6A 5JT1A 2HTFA 4FDTA 4Q39A 1MW9X 3ZCTA 1N1MA 5IJ0A 1WXGA 3CLRC 4M1WA 5HMMA 5C52B 4LWPA 3EVCA 2E5WA 3UH0A 2XSZD 1U2PA 3S99A 4LFCB 2ZRGA 4DB2A 1E9RA 2IHYA 4QDTA 4EHIA 1E6WA 1RHRA 4M88A 5HGJA 3SYLA 2GEFA 4DVJA 3CLTD 1DRWA 1X1BA 5LXTB 3F6BX 5DISB 1F6WA 3B8HA 2ZBFA 1UH5A 4HGNA 1EM6A 1NNI1 5YASA 4BDTA 4EITA 2GN9A 3LUHA 2OO3A 8ADHA 3GLFA 3OBIA 3I92A 1RWPA 2YDXA 2EDCA 3WHPA 1V7QA 2F2TA 3EF3A 3HKBB 2B6NA 4BNTA 1GPLA 2RHWA 4OHFA 1UOOA 1YVPA 4I1IA 3ZE6A 1ZQ1A 2O59A 3TJZA 4PG7A 1U7OA 1YWGO 6YASA 1Z8HA 3QKRB 4F71A 3AUSA 3K35A 1KGSA 1YB5A 2QX9A 3EVEA 1E69A 1X7XB 2E5FA 2OO5C 2YVUA 1GZ6A 4IDBA 2WWRA 1KVTA 4TRMA 1SCNE 2GF2A 4D45A 1WDWB 2EJVA 5KOJB 3G6KA 2G07A 3HCWA 4MUNA 1H9BA 2CZCA 4Y1FA 1SQ5A 4QPNA 1MFPA 2OC9A 3JQBC 3JR7A 2JBWA 3GLIB 1CU1A 1E6CA 1OLOA 1WV1A 2HA5A 4NYMR 2PGJA 4YCDA 5I9LA 1NW5A 1RXVA 4LZLA 4B33A 1BDHA 1R88A 1OZGA 3GK3A 4OX9Y 2XQIA 2V1XA 3T3OA 5EHGA 1KEWA 4M8IA 4UOQA 2NG1A 1EJ2A 1O9HA 1AS0A 2B1JA 3TL2A 6PFKA 1WXXA 1PX0A 4GLOA 4Q7EA 3VAZA 4ALJA 3TOSA 1J49A 1U2TA 2AI2A 4E5MA 1V96A 2IPXA 1ICEA 1QE0A 2POCA 3I04A 3SD7A 1ODLA 4MW1A 2HREA 5ITWA 4G1UC 3WOHA 2HYIC 2NYUA 2QIOA 1DT5A 1F17A 1I10A 1Z0UA 2EU8A 2O2ZA 2J9FB 3D2BA 3IVMA 4P4SA 1IHYA 4W7SA 5FJJA 4XLZA 3H9EO 2AVDA 3P9YA 1LUAA 3PCXA 4HB2A 4PTYA 4U39A 3ZE8A 1R4MB 4L28A 2W4IA 3R3SA 5EA2A 3EW7A 4HK4A 2QE7D 4V03A 4XOUA 5FYDA 4GXNA 5B58T 2O5EA 3OOEA 2P7HA 2B35A 2OXFA 4JQZA 3RU2A 2EX4A 2F6RA 3G2JA 4IKPA 3ROKA 8LDHA 1EXVA 2VP2A 2AF4C 1LTHR 1KMHB 3IH5A 4GMDA 3VSBA 5K2MA 4U7HA 4EKIA 3Q0IA 3H0KA 1DQSA 3H04A 3OICA 1YMQA 2A58A 1QYWA 5DM0A 1N4AA 3A4IA 3BBLA 2B20A 5ELXA 3ZN2A 1DKRA 1YUMA 3Q1LA 3JD2A 4LF8B 5TY0A 3SJBA 3A1UA 1IJEA 4WMLA 4WCFC 4BCBA 1DEHA 3U80A 2DB3A 2HXSA 2D62A 4HQLA 1Z56C 1FDWA 3N05A 3RBAA 2Y76A 3RKSA 3WVNA 1T34A 2IK8A 1ZPDA 4P1ZA 1LJLA 4QEKA 3ICEA 3TQQA 2ZQ5A 4L15A 3TUJC 3R6DA 5BNZA 4C7XA 3SJAA 1EXDA 4TVBA 5FTWA 4WH0A 4CMHA 1E9FA 3UJHA 1IXRC 2R1VB 1LQUA 1N9KA 1TYCA 2EEZA 4I4LA 4UAUA 5TMPA 3PCRB 1JN0A 2EW2A 1U9YA 5EFZA 2IXGA 1L3IA 2R751 3JZIA 3BMNA 3VZRA 4B4UA 4DLZA 3FE2A 2GTHA 1CLEA 3HCDA 4O8ZA 5L51A 3T7RA 1GWNA 2IYEA 1DARA 3VU8A 3H11A 3HB7A 3T9AA 3PICA 2WHYA 1M0EA 3L1HA 3D0QA 3IUPA 2VDMB 4JUFA 2H1LA 1OPXA 5JQGF 2OK8A 1JAYA 4QARA 3EXHB 2Z98A 1XZPA 1GA4A 1N0IA 1O6CA 1WDKA 4Y7CA 3A6PC 3BRSA 4HH1A 3AM1A 4C89A 1TCCA 1UP4A 3ZDYB 4E4YA 3WLJA 3ZCPA 3MHTA 3V7WA 4FW8A 1AUPA 1KL7A 1VLQA 4YRSA 5BMVB 3B38A 3GMDA 1OREA 3CYFA 2GF9A 1RTKA 2HIHA 3UAXA 4FBLA 3E3NA 1T35A 3ZKWA 1CNMA 3G5AA 3K9LA 1QP8A 3P97A 1CJCA 1OI2A 4GBGA 3UWPA 4EW3A 1KYQA 1KAOA 2RK6A 4I9UA 1UIMA 1KK3A 4AZ0B 4ZOLF 4HN2A 2NV0A 3FDJA 3S0JA 1DIOB 3ONWA 2WUFA 1Y5IA 2WAAA 4EB6B 5KWEA 1V48A 3TD6A 4KQHA 3TGWA 3OJXA 3IXMA 1N2GA 2V54A 3H87A 3ICWA 4YRZA 2GM3A 1QGED 4EYOA 4O2LA 2FLWA 2Q5HA 4LRXA 5KWJA 3P9NA 4G09A 2XUIA 4AVYA 3C15C 1E60A 3ONDA 4OMCA 3SU8A 1NRXA 3GAZA 1XEXA 3K0FB 3EPHA 4QVIA 4NRDA 1C9JA 4J0DA 4Z99A 2ZR8A 1EK0A 2P9QA 5DTEA 3RVKA 2GXQA 2N75A 3KELA 3O8BA 3H6GA 5JNLA 4JUDX 4ZRMA 3UMSA 3O1LA 4LXTA 4QBKA 1V9LA 2X6QA 4CFSA 2R1UA 4O2AF 3CUYA 3BXZA 1L5NA 5I4KA 3EWNA 3C24A 3ROPA 4X1KB 4GXQA 2MR6A 4GI2A 4MZDA 3WGTA 1OUMA 3A8TA 4F21A 2QSYA 2AX4A 2B69A 2ZBRA 1UZMA 3PUWA 5H02A 4WADA 5A4IS 4C0AC 1H6DA 3T12A 3GLRA 2ADOA 1WNFA 1SOAA 1XTJA 4MUYA 3ZU2A 1OWLA 3DE4X 2OCBA 3AEKB 4J1TA 2ZRIA 3SF8B 1BCRA 1OX4A 1SOMA 2YCBA 4JUIA 2AFIE 5E9JA 5EESA 4WPGA 2W6ZA 1E64A 1X8JA 3E3MA 1EUCA 5EXXA 4R8SA 2RB4A 3QVWA 4QEZA 3SEQA 2JGIA 4XX0B 3FHJA 4KZKA 1FDOA 2W2NA 4LNHA 4BZXA 2ATXA 5D84A 2I76A 4PZYA 3LT4A 2GF0A 3USES 3S81A 5EIBD 4ADSG 2GN0A 1CQJA 2EBFX 1Y3IA 2YQ4A 2ZT6A 4P0TA 5CLJA 4JI3B 2C8LA 5ES3A 2NSHA 5CB4A 2VHEA 4M9UA 3SBEA 3KR2A 2YWBA 4UDXX 3GCDA 1C7QA 4D4JA 3CF4A 1O89A 4KK3A 1YRHA 3N76A 4JBXA 4TKUB 3WGOA 2NU9B 4CWAA 4ENRA 1N0UA 2ZIAA 1O58A 1J2JA 2IOQA 3GDOA 3R9XB 5G3YA 1UMBB 4WNAB 4AJOA 1W94A 3KAQA 4DABA 2NT3A 4TV9F 4CM5A 4GSYA 1I7PA 3T6KA 1A5AB 1WCWA 3GVPA 3ZZ1A 5J1SB 1ORTA 5TMDA 3HN7A 7AT1A 2NPOA 1VL8A 1XWWA 3ESXA 1U8XX 1YDHA 3T41A 1KDOA 2YZGA 5T41A 3W2EA 4AMGA 5HF6A 4Z9XA 4PVDA 5AJZA 3B20A 1Y98A 3TOZA 4UBMA 4CKBB 1JFTA 4OGFA 4P36A 1IPEA 1XBTA 4KXWA 5BVGB 1DHTA 4E7OA 1I1HA 1IM5A 1P74A 4ZGWA 1H3EA 4HB0A 4NONA 5C7LO 3CMCO 4AJPA 3ACDA 2A33A 1Z7WA 3BDVA 1V1MA 1L8AA 3PHGA 4I2VA 3UKJA 2ORYA 5TJHA 1NIPA 1WV0A 2WUWE 3I4LA 1R9GA 2V5VA 2G5GX 3IPCA 3CX8A 4YRNA 3NTXA 2EJBA 1QX4A 1RJ9B 1NVVQ 2UZAA 3PKJA 4NMXB 1M2GA 2BFFA 2FR0A 3TX6A 1WTCA 3CPHA 4NYJR 3RYHB 1FEZA 4OLJA 4F5DA 4Z3OA 1GPNA 3BFJA 3MTDA 1UKZA 2GEDA 5THQA 2JEOA 3IO3A 5K0EA 3CX4A 2VHVA 3BJIC 4A4DA 4CLXA 2REXB 3R41A 2X0RA 4O4JF 1BJRE 3Q8MA 2V7PA 3PK0A 5KMGB 4Q4JB 4MVJE 4NOKA 2R8ZA 2M1XA 2PFSA 2RIPA 1E5DA 2BGWA 3T3IA 4PHCA 4Y2VA 1RMTA 4X1IB 4UJ3A 2VRCD 1X80B 4KRGA 4Y1GA 4YI3A 1ND5A 1XRNA 4PPYA 4WK0B 3SC6A 3YASA 1UQTA 1JIKA 3BD6A 5CD1A 3GJTA 4AB1A 3RRXA 4DKXA 4GXTA 3TCXB 2PUDA 3HCBA 2OE2A 4FZJA 2H2HA 1EDDA 1K3UB 1T3GA 2GSDA 4MV6A 3RUPA 4B74A 2QIPA 2P0YA 2EZTA 3E0QA 4EMSA 2DTDA 3WZMA 1ZLYA 1AHHA 1OWOA 3UV3A 1V2GA 1X6VA 2IU4A 1EAYA 1E9BA 1A9QA 1NKVA 4EQ6A 1UBOS 4GX1A 4HJXA 3UH1A 2R1TA 2BHTA 3SHTA 2X3FA 4OIFA 2G1AA 3ISTA 1FMCA 3TJMA 2ZB3A 5CR9A 4UOZA 4GSLA 1P75A 1DTSA 1QS0A 1VHQA 3EEFA 3I6ZA 3GQVA 5C1BA 3BGWA 1JHUA 1O8BA 3OJFA 1B76A 4N0QA 5IN5A 5IF3A 3DE5X 3DGEC 1VBNA 3S8MA 4ZKDA 3QBEA 1YQGA 3BZUA 2ARKA 3ZWQA 1UBNA 1Z13A 2LBPA 5HKOA 3GLGA 1EWKA 2O20A 4FZVA 1FDSA 3ETDA 1IN4A 3MQ2A 4CF5A 3H83A 4EFDA 4X64B 3LECA 4WLEA 1C30B 2ETVA 1YDWA 2GESA 2IBMA 4QQKA 5C37A 3JWJA 4FYJA 2PR7A 5JYEA 5A9RA 2ZR9A 1GDHA 5ALDA 4FE4A 2VHXA 4B85A 4HDKB 2YXDA 5JLJA 5JMWA 5KVSA 3PC2A 4K6KA 4XA8A 1DTEA 4FP9A 4N76A 3REFA 3KWJA 3SC2A 1L7DA 1PS8A 5B4VA 2ZSEA 2IZ6A 3AJRA 3T0FA 3QUAA 3UEOA 2CVOA 4AM8A 4DILA 1WW2A 4LNUB 3ZNNA 4E12A 2JFZA 3KJNA 1D2RA 3F71A 1DIAA 1ZSNA 2ISCA 1W88B 3KJQA 4GMFA 5ALVA 1ZR4A 3A2MA 3W77A 1N5JA 4MP3A 4XD7D 4R9NA 5K6AA 1CUWA 2CXPA 3K5WA 3OAAA 4I50B 1V1JA 1BXKA 2AWOA 3Q3GE 4NOLA 3SXUA 1P6QA 3OSUA 5AHKA 3ESZA 2I1QA 2KWIA 2PMCA 3UMCA 1YB4A 2R85A 3IBGA 4NEQA 3DAYA 4ARAA 2GEKA 3QENA 4L4RA 1XZIA 3VJKA 4OGGA 1JP7A 4DSZA 2GH1A 2BT4A 3EQ6A 3HJTA 1ONSA 2PZMA 3AU8A 2A9JA 4IRMA 2HMAA 4FX2A 2GYYA 3TRDA 1E18A 3BM5A 3LZCA 4EF5A 5I7EA 3BCRA 1ZQ9A 3RYTC 4MTCA 2VBGA 4AO7A 1JPNA 1R6VA 2EFEB 2LUOA 4RF4A 1QYIA 2Q21A 1HETA 1VHTA 1YRQA 4G84A 4D6XA 1DHRA 5CJPA 2D7CA 1U0GA 4HWOA 4RVUA 1E62A 4XUDA 1GZHB 5JSYA 1X1TA 3LCMA 1VI2A 4IQFA 2Q3BA 1N36B 3BKXA 2GTPA 1JILA 2H4HA 4AO6A 4CF4A 3F5DA 4UE2A 4C7KA 4IO0A 1MJGM 3IHLA 4YCMA 5LMZA 1JLKA 1VKHA 2PE5A 2BMAA 3QPVA 3RAGA 3N2EA 1YONA 2EX1A 2PXAA 1N92A 3V8NA 5KPDA 5K0GA 1QTRA 4HD8A 1CZKA 3Q7RA 3VR2A 3V4OA 3I5XA 4ER5A 4U7PB 3OURA 1SHTX 2LVBA 1J2EA 2VQ6A 2ODWA 3PFHA 4HS4A 4KFUA 1M74A 1RYEA 4C06A 4YXWD 1SVKA 4YV7A 3CVUA 5LD2C 1C4WA 3VJRA 3ZE7A 1C3OA 1A2OA 3H4IA 3PNVA 4RA6B 2UYGA 4H59A 4ARCA 2C5HA 2ZT7A 2DETA 4ZO9A 2JJ2D 4L74A 3BJEA 4GZ5A 3W3AA 4QYXA 4Z2YA 1Q20A 1UDWA 4EUFA 1NZDA 1COWD 3RRFA 3NRCA 2IYPA 3LC0A 2W2LA 3EH2A 1JQ3A 4W5HA 4PIVA 2NU8B 3W2FA 4AK9A 5JC8A 1SBNE 3DDCA 3H4MA 4HXYA 2BP7A 2A1UB 2CNDA 1EA7A 5JRDS 1NKSA 4M0UA 2TMYA 5TGZA 2ECFA 3PXUA 4A9AA 1DUSA 1T9KA 1TK2A 2D7DA 1XQXA 5EUCA 2WHXA 1PLJA 1XE3A 3C7CB 3OY2A 5F7ZA 5CRIA 2EF1A 1N2OA 3ENNA 5C8XA 1ISRA 3IT1A 1UEXC 3EWAA 3H1FA 1W1IA 1ZNYA 2QLLA 4B47A 1C1YA 3G79A 4Z7OB 4BQPA 3OT4A 3WX0A 3ROQA 2JGDB 2IPNA 4TMWA 2GAAA 1BEZA 1QF7A 3DT9A 1HE3A 3DYIA 3EZXA 2MCFA 4Q1EA 3KSBC 3V2GA 4Q1DA 1CEXA 3PGXA 1N0VC 2FW8A 1C0PA 5PGMA 2NO5A 2PDAA 3KU4A 3NIBA 4UHFA 2G82A 3QKSA 2HHAA 4WFQA 3EPKA 4G0WA 1AMOA 4F3TA 1L2TA 1UPFA 1W85A 2QR5A 5THKA 2CEKA 5HA5A 4TLLB 4LGVA 1PTJC 1TT5B 2OESA 2VTVA 4FINA 4P3XA 1OFUA 3SMQA 2W6ID 1VCNA 4R31A 5ECYA 3PEEA 1ZAKA 5I5EA 1QFZA 3KSAC 1VRVA 4ESEA 3X2EA 3AJAA 2GWHA 1P4AA 2OZEA 4QOIA 3BSSA 1QRSA 3B78A 2HRQA 1YQXA 2FLVA 2KS6A 4N6GA 5EJFA 5ER6A 4N1AA 3UCXA 4BP8A 3QYPA 1JJVA 3PHBE 1PFWA 3ER6A 3KK0A 4CKEB 2I7TA 1N6KA 5FORA 2I4LA 3KALA 3LRPA 4YASA 3U4DA 1E2EA 2XMSA 2RJNA 1GPAA 1U02A 2OCYC 2ZTUA 4JVSB 2DLDA 1TTQB 3IAXA 4KXMA 3RFUA 3UV7A 3QPDA 3OBBA 1HMPA 1LU9A 4B0PA 3AB7A 3K1YA 4DIKA 1RWKA 2ECQA 2FSSA 4V2IA 4H9GA 4QYSA 4YMWA 3U19A 3SG0A 1QU2A 1JX6A 2DUWA 4IDGA 3S3TA 1M1YA 2JHFA 3FOBA 3BERA 1JU9A 4A1FA 2KI5A 4EM6A 4PGGA 3AVPA 3WYAA 3HBMA 5B4UA 4CMEA 2G8LA 1E2BA 3DAPA 2H0QA 4YALA 1MXHA 2R5NA 2XTZA 3GB9A 4PLYA 1Z36A 4KIGA 4PSDA 1J0CA 3UGQA 4NE7A 1DWUA 3RJTA 3A14A 1MO5A 3BXGA 2FY8A 5GINE 1C1XA 4RVOA 4MW0A 3UC5A 4NFYA 2PSSA 1MU0A 1DJMA 3CHYA 4IIEA 2RK3A 4L9AA 5EZQA 2BSXA 3C5CA 1XEWX 2ZJ2A 3QSGA 4HX9A 4M0KA 4MR8B 4PG5A 1ESZA 1OXTA 3T3NA 3VUFA 2LIPA 3CRQA 4FVTA 5F2EA 5ENDA 1B00A 3HJRA 1SR8A 3MFYA 3TD2A 3G8AA 5ERXA 1GN8A 3KTAB 1EFRD 3GJ8A 2QT0A 2QTRA 3DD5A 3JTEA 5K0TA 2OK7A 5H81A 2AMVA 5J58A 4HRXA 4QBFA 3JAWA 4PBRA 4ZYXA 2CNLA 3TTSA 2QP3A 5DWVA 5F1PA 4MVXA 2DUJA 3WYBA 5CP8A 1MTZA 2B1GA 2WNHA 4CM8A 1SBYA 1ZM3A 2E1RA 2X5OA 3CLKA 3B1WA 1RU3A 2BMWA 3HUDA 1IBLB 3EIEA 1Z25A 4QRDA 3COSA 2LDBA 1XU9A 1QJCA 3MBIA 2CUKA 3NTUA 2RGNC 5JNRA 3LTEA 2QD4A 2R00C 3SYNA 1WHTB 1GU1A 3OIVA 3L06A 2JC3A 5ALYA 4HATA 2IHKA 1I7QB 3CF6R 1JEYB 4HQRA 3AETB 1O7JA 2JKYA 3ZZNA 3I62A 4IXTA 4P3YA 1V9SA 2H1HA 1AMNA 3OKFA 3WB9A 3DLPX 3I2YX 1KTIA 3T06B 3BCSA 1X1SA 1YNOA 4YUWA 2XDAA 3KV1A 2NYAA 2V7QA 4L3WA 2CUTA 3NV9A 3HKDB 1QFMA 5K4HA 1M1NA 3HB1A 3UB4A 4EH1A 4FK8A 5AXDA 4QLAA 4IMJB 1RWQA 2NSJA 3RUCA 2F17A 1UXOA 1YI8A 3ILXA 4IDUA 1A9PA 1X42A 3BE8A 4NCXA 5KNDH 1EFVB 4RDHA 3DBOB 2VDNB 4RPJA 5K0BA 3O3NB 1D0IA 3WGZA 2QKYA 4OOFA 5EJGA 1NJ1A 1JI3A 2EKLA 2MSNA 2ECPA 2IU3A 2W7TA 3L0YA 5CLHA 3ZDCA 3QVSA 4QG3A 2QQ5A 3UK6A 1WCXA 3FCAA 1RJWA 2ODAA 2WHEA 3WBJA 4D9MA 3P27A 5A5VA 2FSUA 3ET5A 3OLVA 1Q1AA 5JSHA 4KXUA 2CK3A 3QMVA 2Y77A 3D4IA 3W5JA 5IP5A 4ZMBA 5IAKA 2GAIA 1AF4A 2PSEA 1FPQA 3EIXA 4YEDA 3DSRA 1BFUA 2H3HA 2ZXEA 4KGXA 3AV3A 2FW9A 3PI6A 3O82A 1OILA 2KBFA 2AR0A 2FMHA 3DFZA 4YJKA 3LQYA 1AKEA 3U5ZB 1YTUA 3TGPA 5LZ9A 2H0RA 2GAOA 3BL5A 4D41A 2E5LB 3KQLA 1RJGA 3JQGA 4AJ2A 1RXIA 1NMEA 3DCJA 3E0XA 1Z5VA 3NGLA 3CKLA 2PUFA 1USKA 3DV0A 5BW6B 3B48A 4B2IA 3ITNA 4MI9A 3TW8B 3VSCA 3O2JA 1T8SA 1JSLA 1Z6XA 1XA4A 3NP7A 2IJGX 3TZCA 1GSAA 2FRDA 3PP8A 3WLQA 3IIKA 4CLOA 2HV8A 5CMLA 2IZ5A 3DEFA 3DE3X 4KC0A 4EY7A 1LV7A 2I2WA 4UD6A 3CW8X 3OZWA 1BE0A 3DMYA 3CO0S 3OPXA 3LOQA 4MI3A 4YY3B 3KKZA 3EFHA 1DOHA 4BOYA 3OC6A 3ZXXA 4QOHA 5BR1A 4QOJA 4X94A 2YIVX 1XZHA 2NWQA 3PE6A 1DMRA 4C5BA 4LBYA 4R9VA 4GP6A 3UJNA 1WUKS 2YV4A 2ZDGA 3BL6A 4TSKA 4BVFA 3FVVA 2FKAA 3AH8A 2ODEA 4HTFA 4I1YA 3E8MA 4JLPA 3SJZA 4PW0A 4J16C 1J97A 2JHPA 1C3JA 4UNPA 3NYQA 3AVWA 1CERA 1WU7A 5BN3A 3PNSA 1E7SA 1W9MA 1XZDA 2JVKA 1R5BA 3HGQA 2ZUUA 1ZS9A 2BLLA 1T2EA 2L82A 1CDDA 2WSSA 1UPXA 4O1IA 4M2LA 1U7PA 2AE1A 2Q45A 4RE6A 4DDWA 4RZUA 1YTLA 2FJUA 4OB6A 3OEED 5I3CA 2IODA 1V1RA 3LC1O 5BQFA 4Z6KA 4F84A 1U7XA 2VK1A 2BMEA 3WV5A 1GKUB 1IK4A 1GNVA 1NG1A 3AINA 3WK6A 3EXFA 5BSMA 3OE4A 1GU0A 2IWRA 3F3YA 4B40A 2BFWA 4R54A 2H1OA 4HMOA 1V8BA 3T4XA 1KI2A 2G83A 1NVBA 2I78A 4J7AA 2J6BA 5IAJA 3ZY5A 3Q6NA 1Z2NX 4J1JA 1C9YA 1GLGA 4GWKA 1H4VB 2VT3A 3EXIB 1NULA 4PLPA 5HSGA 2W11A 3IEKA 1VL1A 2PU5A 4M22A 3KE8A 4BTLA 1YZUA 5KYVA 4CLEA 2N1MA 4DMMA 1QP7A 3AI3A 3G8YA 2UUOA 3EK2A 3LDHA 5IJ0B 3TRKA 3TO5A 5HPYB 1F2VA 1JB9A 1AKQA 1ZIDA 2ENWA 4B3DA 3K0EA 2AZ4A 1BQEA 1RABA 3NW9A 2RBEA 1BXZA 2O3RA 3F1KA 1L7MA 2ENUA 1DIGA 1S3IA 3B5IA 3H2GA 3MWKA 1HEIA 3GLFB 2ATCA 3ABQB 1A7UA 3OPYA 2QGZA 4Y98A 1ZK1A 3LPNA 4NHOA 5IEBA 1NMXA 4AJKA 5HIMA 2QMEA 3D5TA 3DLHA 1TF2A 4RJLA 3QVVA 1CJMA 2V7GA 4KG7A 1LWOA 2I2FA 1IBKB 2UAGA 4MEJA 3FFWA 2Q2QA 1KK0A 4Y9RA 3RS8A 4KUHA 3JWGA 4KXFB 1O54A 1OR8A 2PH1A 1ZXXA 3AY3A 2C3OA 4Y6RA 3VR4D 2GETA 5AM5A 3SX4A 1N9ZA 2BKVA 3HDJA 4KLAA 3ZWDA 2YV5A 4LPKA 1VKOA 1GRRA 2W0MA 1C9KA 1K4YA 1TM7E 2PH7A 5HHTA 1EEHA 3TBKA 3LQ2A 3VFDA 3KHKA 4D7AA 4NC9A 1L8QA 1U3TA 5E9AA 1A7JA 2YJ5A 1SVWA 3WNZA 1A3CA 1RVV1 2WUVA 2NX2A 2Z2ZA 1I94B 3E5RA 3TSCA 4UEJA 5H8WA 1NOJA 3GJ3A 3C2QA 5F1YA 2P9FA 1R0YA 4NTZA 4J1QA 2CBZA 1CIVA 3EZ2A 1U3GA 2JLBA 4GI7A 3FPBA 3HA3A 1DKMA 5AICA 4M1SA 3AF5A 3U3OA 1Q0PA 1K4KA 2AYYA 2J41A 1ENPA 2VPXA 1UADA 1LC3A 4WA8A 4AJ4A 4BEWA 2CCKA 2Z9DA 2V96A 1G0NA 2V58A 3KQQA 1WCYA 3T9CA 3URKA 3RFTA 3OA0A 3UOWA 3A2KA 1J2RA 1A76A 2ZBEA 2JAPA 4INPA 1AV6A 2P79A 2VI5A 3D02A 1O77A 1PX2A 3BB3A 3ENKA 3HDYA 4P4SB 1P31A 4RY0A 4D4LA 5AM3A 4Y6SA 1MZVA 3GJXC 5GJVC 2BFDA 1U0EA 1J20A 1WB4A 3KUCA 2YICA 3MLBA 4GPTA 5FOSA 3ZLTA 2VTBA 3ICQB 1TADA 1ESCA 3L82B 4NR0A 4FXPA 2ZI4A 2XLCA 3HUUA 3RM3A 1FFEA 1MV8A 1UPUA 3D2AA 4MVJH 4C3UA 1G9XA 2H31A 1OTXA 3HJBA 4A92A 4NBSA 2BE9A 8AT1A 4KZPA 3FHTA 1SVUA 1YRAA 2ANCA 2N46A 2A35A 3PNPA 3DPSA 1TCVA 4Q93A 4A15A 2PUWA 3N87A 2BZ1A 4AF7A 4R8MA 1QLHA 3EARA 3W5SA 1QH8B 4WXMA 1KWKA 1PGQA 3H86A 3D7LA 1HT1E 4WV3A 1DELA 4K9OA 3M5WA 3EIOA 3HJHA 5GGYA 4BNHA 5BWCA 1F8UA 1I32A 5TR9A 2WUGA 1EDOA 4ESOA 1NYQA 3K73O 1GA6A 3UJ9A 4DS3A 3MIIA 3FUTA 3ZHCA 5JAOA 2IY9A 4MUAA 1W44A 2Q9BA 1X3LA 2VRWA 3PFBA 4UJ5A 3RJ5A 3T7EA 5THXA 3TSWA 3M6FA 5K0JA 5DMHA 3EQZA 2NACA 4ZFNA 3A04A 1JIIA 1F0KA 1NWCA 3GROA 4YDSA 5LA6F 4YCCA 3X3HA 1UC4B 1ZCFA 4PANA 1QRTA 1XLUA 5H9WA 4KUGA 1YBVA 2CFOA 3P9IA 3Q7TA 3AI2A 3LUBA 4I2NA 2V9CA 2IXFA 2ZIGA 3I2FA 4NG5A 4R9UC 4E5NA 1D4AA 1NXVA 2OBFA 2QN1A 4RVGA 1DBWA 4RJJA 4M0LA 1IQUA 4N6NA 2V5AA 2GN6A 5DGTA 4DY4A 1UBMS 4HZIA 3BMNB 3E61A 1DC7A 4JBIA 4K7JA 1JSRA 4QGHA 4V0ME 1Q7EA 3H11B 4PZAA 1ECBA 4MJLA 1XF9A 2PD3A 1QIFA 4RM3A 3DVAB 3NBQA 1BS9A 1J56A 1Q1NA 3JQBA 4B4VA 4PR0A 4D3ZA 3KT8A 1YQWA 4XB2A 3CISA 1DKOA 2Y93A 1DAPA 2G63A 3I6BA 2AMYA 3K09C 3OIDA 4PXYA 4MUMA 3SZUA 1B2RA 1L7AA 1M8KA 2ZYVX 3EVDA 4A5OA 3EOAI 2PGXA 5KDOA 3VBCA 4XIIA 3EUEA 3OTHA 2ZW9A 3S4YA 1ZMXA 3JQAA 1TPZA 3TDKA 2VPIA 4FFPA 3OZCA 3KUXA 1KIFA 4YDHB 1GDDA 2IHVA 2N1BA 3Q3IA 2A2ZA 2ET6A 1N25A 1OC4A 3PTLA 2ZIZA 4DQXA 5BSWA 5BQXA 2PZGA 3AZPA 1L8OA 1S89A 3QBJA 2V7BA 3ZD6A 3HJGA 3MLAA 3MJTA 4RL6A 2HO5A 4HP8A 5AUPB 2GKGA 4C78A 1PLKA 4G56A 4TMVA 2X5XA 4OQPA 1R0XA 5CVEA 5EQFA 4DF3A 3AC0A 3ANXA 2QUZA 2FPSA 1WX1A 2M6LA 4HUTA 4FTWA 4P58A 2FGJA 3IUMA 4AZWA 5ALRA 3OH8A 2HLDA 3SZLA 4BFVA 2PQ0A 3D6VA 3BWEA 4CMAA 1I3NA 1OVMA 1UJ5A 1E99A 3CTMA 1RE1A 3L4BC 4URXR 3LTNC 1NW3A 1Z5ZA 3FNGA 4R1OA 3OCZA 4M0FA 4AX8A 2PN1A 3CUTA 2X8BA 2QR3A 3VHQA 1XEXB 2G8NA 2F00A 2QDXA 3FPJA 4HSEA 2FN7A 4LPSA 2H59A 3PITA 1HOXA 4FOLA 4WXHA 4X20A 5AM1A 4B2LA 5BSVA 1F8XA 2DFDA 1CQWA 3C43A 1OWNA 3DTVA 3RU3A 3T61A 4RELA 2J6CA 2BFCA 5LC1A 2A5GA 4TPKA 3A9VA 3DHWC 4MVJP 4YA6A 1GJRA 3AW9A 4H6VA 2AUMA 4JDUA 1XWIA 3NXSA 4Q02A 4YJ3F 2X0FA 3X1JA 4BVGA 4D6PA 5ALLA 5LR6A 1F4PA 2QVYX 2DBQA 3SP1A 4GYYA 2HXYA 2W2KA 4EW1A 1UBLS 1DAEA 5FBWB 4J0KA 9ATCA 2V7EA 2Y66A 5K8IA 2ZIWB 4P0QB 1PYDA 1U7WA 2VZ0A 1EFPA 2BHNA 4NWIA 2NSLA 4G0OA 3EUFA 2QQGA 2XECA 3HXOA 1BCRB 1HK7A 1QK4A 1OX4B 1ZI9A 2QL9A 1UBEA 4IRUB 1QQAA 3L0DA 3GEIA 2GNPA 3PFGA 1RACA 1UJBA 1KO4A 2VCYA 4AS2A 1EUCB 4PS0A 2HDNB 1JUDA 3HP1A 5HOQA 1GFWA 1L5WA 2Z6UA 3ZZTA 4N03A 1CR6A 4NSNA 4Q3KA 4TWBA 1SH7A 3TB6A 2CMDA 2JIBA 5INTA 2A84A 3LY9A 4ER6A 1AUQA 2DF8A 3Q41A 4RSGA 3WLTA 4QECA 3K15A 1E9EA 4G23A 3G02A 4PICA 2OYSA 1CQJB 2B9EA 3ADPA 3TE6A 4E2YA 4C21A 1FOEB 4RGBA 5CB4B 2K87A 3NB0A 3OP4A 2OTCA 2PQMA 5DFAA 3LRXA 1VZ2A 1XZQA 3IJPA 2QP4A 3ABRB 4ZQEA 1CE8A 1E6EA 1GCAA 1P2DA 2BELA 4KDCA 4LOHA 4OB8A 4H6PA 4YWHA 3RFFA 4XCQA 4JT4A 5JIBA 3GH3A 1IN1A 1WW8A 4LSGA 5DM2A 1U2DC 1JPJA 1K7CA 2BGIA 2ECKA 4II7A 4IXNA 3ND5A 2CFRA 2VP9A 3D0KA 4LE0A 4C4AA 2NN3C 2GMWA 4OAPA 1TC1A 4KTVE 3EZLA 5L3ZA 5GZ1A 1Z4JA 1SJ9A 4H3KB 3WL7A 2NIPA 3JWEA 2VJAA 3OCJA 2W71A 4P83A 4K0RA 1KO8A 1NVTA 2ASEA 1HY3A 2FB9A 5KPJA 5CJJA 1P9LA 2H2GA 3NAZA 5GVRA 1GNQA 1OYOA 3MT8A 3RC8A 4CRWB 4ZHSA 3KPYA 2C03A 1KR5A 3J81k 1P73A 3U9TA 1Z5OA 4UVGA 1KO7A 1UKBA 2AFIA 4BNYA 3RH0A 1EGVB 4L2IA 4X3PA 4RH1A 3ZQKA 1ZK2A 4LRQA 3IV7A 5BVHA 4BTVA 2WBLC 1C7ZA 4IRXA 2E48A 3LIPA 1O4WA 3LNTA 1FDTA 2X5NA 4N0DA 1LV8A 3LF1A 4EI9A 1SWVA 3LUCA 2BFFB 1V7PC 2LE0A 5DBOA 1TJ5A 4NYIR 1DUIA 3MTJA 4UUOA 4ZICA 4NCBA 2C42A 1U9IC 4QFMA 5L3VA 4XSHA 1Z9BA 1OW3B 2AUTA 3L0BA 4HZGA 2I6QA 4Q47A 3WGHA 4MA0A 1RYZA 1V8PA 5EEHA 1FLDA 2ONZA 2FN4A 4YJHA 2JJYA 2HRRA 4R98A 1FXSA 4LZPA 1MNAA 1C14A 5KCZA 1Z3IX 2ATEA 4D25A 3WDKA 1QTIA 5HUQA 4QGAA 2WJZB 3NTRA 1KVRA 4X8HA 4Q9NA 4N01A 3V4RA 2NQ8A 3QHPA 1L7PA 1U04A 1N2HA 2HQ1A 3JSXA 2ID7A 1ZN2A 2E4YA 1Z34A 2HV9A 3W4JA 1YK0A 5AOCA 3HFSA 1OI4A 4RE5A 1K2VN 3IP8A 1RR6A 4I3FA 2QOEA 3OG9A 5IVIA 1HLPA 3D3JA 3U3KA 2P41A 4EQ6B 1Z4MA 4BRWA 1JDSA 3KOZA 1Y89A 2C1ZA 3OQVA 2PV7A 4TKZA 4BGDA 1J5XA 1J0AA 2R1TB 4XYLA 1KORA 1E0DA 1QQ5A 3FOCA 2I5PO 3LBAA 3Q12A 2QX7A 4HH4A 1P0QA 3S40A 1QS0B 1SG6A 1VPDA 2QJTA 3FZYA 3R74A 3RREA 3S2YA 3AKDA 1QH1A 3GNQA 1ZK0A 2I8CA 4G0XA 4RMGA 3DCYA 4ZXPA 5MF6A 3JQPA 3O03A 3UANA 1RZUA 1EHCA 3EC2A 5JDIC 4IGFA 1NSTA 2Z4TA 3R4VA 1FNSA 2JLCA 1ZNZA 4NULA 1PDOA 4JDPA 3SQXA 2OYCA 1S3GA 4QM7A 4DKJA 4ISCA 1KJWA 1U8CB 2GRJA 2O14A 2WWVD 1NN1A 1DPFA 3CQ9A 3WKBA 1PQWA 1XIVA 1A8UA 4FFOA 4DEVA 3FGPA 5IBCA 1F3LA 3CRMA 2H1WA 4NECA 4HDOB 4HB3A 3ZIAA 1FFYA 2H4WA 3KAPA 5J23A 5TGTA 5LJIA 1IZ8A 4FBMA 4MVJA 3H2JA 1G18A 3DDOA 3JASA 1ATIA 1OXSC 1JEAA 2A9FA 2VDOB 3F7TA 3LX5A 4ZCQA 5TIIA 1Z0ZA 1LBTA 4JYZA 3SC2B 2VS1A 4JYBA 4QFCA 2JHGA 5IUKC 1TA0A 3OCWA 3V8QA 3TPCA 5JVDA 1P29A 4MKRA 4MUHA 1N3LA 2PA0A 5CCBA 3OQJA 3H5TA 1EBBA 4LWZA 4PQYA 1RRCA 1QHYA 3K9NA 1F14A 3PPVA 1V6CA 3K1JA 2I0FA 1PZEA 4KE7A 1E9SA 2HDOA 4PGMA 5H3HA 4HT3B 3SXUB 1AJEA 5CA1A 4GR5A 2C07A 4PFJA 3TIFA 4C3ZA 4IGIA 4JSRA 4JELA 5A02A 2ZE8A 4NBRA 3PXXA 3I5YA 4FYMA 5HDQA 4YQEA 4BO9A 1KS2A 5CG1A 3HZOA 2GCIA 2IPOA 3GGGA 2BDEA 4JLKA 5ERGB 3LDGA 1LPMA 4D4GA 4NBWA 2BDTA 5AW3A 4RMHA 3TZLA 3H2KA 2GFIA 1V8ZA 1CUCA 1XELA 1YZFA 2FK8A 3CE9A 1OLSA 4XB1A 1E20A 4LOLA 1XDWA 4WZBE 2B30A 4R1SA 3OJ0A 4R71A 1IVNA 2HF9A 3W04A 1IN5A 1L7EA 3LLMA 1PWHA 1JEEA 5HR5A 1EUYA 1GY8A 1DQYA 1DRJA 2WW8A 3QEJA 4K86A 7GPBA 5K0FA 2VT6A 1RAAA 2CXRA 2UDPA 1VPWA 2DY0A 4GL4A 3I01M 2IGTA 2FHSA 1LXCA 1CSEE 3ILHA 3N0WA 4Q7KA 4YLEA 5HEKA 2C3YA 2XW6A 3IXQA 4OH7A 2YW9A 3WRVA 5ABPA 2HTEA 2WB2A 5AXCA 3T9FA 1U63A 4NOJA 1IN8A 1LLQA 1JDUA 1U1FA 2D2EA 1V4NA 3IX7A 3MRTA 4LCJA 2ZE5A 2OUIA 3U4IA 3CLHA 1G8PA 3SEAA 3U6KA 2HAEA 1C3OB 1WEHA 1YVEI 1AG9A 5AVYA 2CNKA 2GWRA 4P54A 4UAVA 4BEVA 3L6EA 4D9GA 2FX2A 3DPIA 3WL5A 4KFRA 5FOWA 3K53A 4PX5A 2CV0A 4GZLA 4I3GA 4F86A 1S2MA 3KKKA 4HWSA 1J09A 1ES9A 1RM0A 2JHAA 3WYEA 3ZK7A 3WMRA 2BP7B 4W7IA 1T5LA 3GGCA 4KPGA 2BAGA 2F62A 4M60A 4YAJA 5IAEA 3S2SA 1F20A 1ZVMA 5A2QA 4FEAA 4FKZA 4X71A 3FCYA 4LYAA 4WACA 5HYVA 3DBHA 3BQNB 3G2NA 3TM5A 4KLRA 1EDZA 3QELA 1JMYA 3GT4A 1JHMA 1Y6QA 2O8NA 2IXBA 4KR0A 5ARCA 4B35A 3UKOA 1QU3A 1IOVA 2EJWA 2VAPA 4Q5IA 4KE8A 4IMRA 1XXHA 4F46A 3U1VA 3HDHA 1GKIA 1CUUA 4ER3A 2DMRA 2QY6A 2H4YA 1VSUA 3ITDA 1IOWA 1ULBA 3IAM1 4TN1A 2FUCA 3WHKA 4A23A 4I1VA 1F4LA 3OQHA 3M7IA 1OBOA 3QKSB 3QKTA 3VNAA 5BOVA 4BRZA 3BWYA 1Q1BA 1W85B 1WXHA 3KR0A 3T0GA 2HC9A 3ZZ0A 2F55A 3GFGA 3PEYA 3RSLA 3BQ9A 4OI4A 3TDMA 1Y7LA 4EGCB 2G80A 5FOTA 5GPBA 3HGTA 3AR5A 3KL4A 4HXGA 5CPFA 8ABPA 1AQNA 1T6BY 2QM8A 5DNEA 4EGAA 4B0OA 5I8PA 3F6RA 1DGQA 1RWOA 4YMLA 2IZ0A 1YBHA 2ZRFA 1I2ZA