4ND5A

Crystal structure of the lactate dehydrogenase from cryptosporidium parvum
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
302
Chain Sequence
MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITALLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPATSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lactate dehydrogenase, adjacent gene encodes predicted malat
publication title Biochemical and structural characterization of Cryptosporidium parvum Lactate dehydrogenase.
pubmed doi rcsb
source organism Cryptosporidium parvum
total genus 105
structure length 302
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nd5A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4nd5A02
1EK5A 1J6UA 3E82A 3F4LA 1DFIA 4BGEA 3W4KA 3GHHA 5ER6A 1GZ4A 5F1OA 2WD7B 3FHLA 3U62A 4IDGA 4CMIA 4CQLA 1FDUA 1Y9EA 4A7PA 1GAEO 3H7AA 1JWAB 4BO3A 3GVHA 1GV1A 5KNLA 3R3JA 2Y1GA 2PGJA 4QUKA 1P1KA 1YQDA 2DFVA 3INTA 3R3SA 3JQAD 3L77A 4BOYA 3RFTA 3GPDG 4OH1A 4IQGA 1AXGA 2PV7A 4HUJA 2HCTA 4IBOA 5EINA 4E5MA 3JCZA 3T7CA 4LMPA 3WICA 2PKRA 3QVTA 2B37A 2AA3A 4PGFA 5KKAA 1WLYA 3K96A 3JQFC 1LC0A 4H15A 2NTNA 1X1EA 4JK3A 5EQFA 4RF5A 1QXSA 1U7TA 4AJPA 1KEVA 2X5JO 4R5MA 4UUNA 1UAYA 4BNMA 5IJZA 4MINA 2G0TA 1HKUA 2FMUA 3PHJA 4XZ3A 5L95A 3WXBA 5JPIA 5GZ1A 1WZIA 4BKOA 1S6YA 4CR7A 3CIFA 5CDSA 5IDQA 1PEDA 2NNLD 4HXYA 4PG4A 4UUPA 5DULA 5JDIC 3EUWA 2X5KO 3AY7A 4YRBA 1IUKA 1PQPA 1TB4A 3JD0A 5DZSA 1NFQA 4ITUA 3WWZA 1ADFA 2JL1A 2BGLA 1GDHA 3QE3A 3TPCA 3ENKA 1X0XA 3QWAA 6ADHA 1N7HA 5DOZA 4TROA 1EVIA 4W6ZA 4RVHA 1W8DA 4J0FA 1EUCA 2GLXA 3P5SA 4MVJG 3PP8A 5L45A 2PR2A 5ILOA 2C07A 2Z1MA 3E8XA 2W4QA 3B1JA 1I3NA 4DPMA 1D4FA 4YRDA 2FZEA 2UVDA 4JX8A 3EY4A 1MG0A 4DIBA 1T2CA 1W6UA 3C7AA 4YT4A 1X13A 3B1FA 1H93A 4R1UA 2NLOA 2Y0CA 5AVOA 1DO8A 1PJ3A 2NQ8A 3TJRA 3DXFA 3AOEA 5JLAA 4NU5A 4GSKA 1NR7A 3TNLA 1I36A 3D4OA 1Y1PA 4GVXA 3TF5A 4BNXA 1NVTA 1OC4A 4BB5A 3DBVO 1FJHA 4R01A 1MV8A 1DAPA 1XSEA 2Y93A 2PD3A 3SVTA 5KJFA 5KVCA 1V3UA 4XB2A 5DBIA 1V35A 1DBVO 4JBHA 1NVMB 1RM3A 1BWSA 1XGKA 4CV1A 1E7WA 3GG2A 3MWEB 3NT2A 3E9QA 1LSJA 3KLPX 3QWFA 4DRYA 4EZBA 3MJCA 1NASA 1Y8QB 5EIOA 5LCXA 1ZMTA 1EE2A 4IDEA 4RQUA 2IE0A 1I2BA 2LDXA 3JQDA 2B35A 4E12A 1SOWA 3A4VA 4J2OA 4CLOB 1DIAA 4B8WA 3L9WA 3PZBA 4YJHA 3ADPA 3OIDA 3PXXA 4AJLA 3DEYX 3FSRA 1T24A 4M55A 2WSBA 4NH4A 1SBYA 4LVUA 3G79A 1A5ZA 1ISIA 1ZXBA 4QTZA 3OJFA 3ZW9A 3AY3A 4DIFA 1YVEI 4Q3EA 4PLPA 4R1TA 2X9GA 4N5LA 3WBFA 2XOXA 4ZRNA 1C0PA 1NQTA 4B7CA 1I3KA 2BFOA 4OKIA 4XD2A 5A9TA 2HDHA 5KWEA 3GAFA 3KOUA 4A73A 1R37A 4ROSA 3UH1A 5A5EA 1MFPA 4OQZA 1E6WA 1ZSNA 3TSCA 4J7CA 4CJXA 3NGXA 3PIDA 4YACA 1P1JA 3K9QO 2Y68A 2GZ2A 4WUVA 5BR7A 3BMNB 4XDZA 4UEJA 3S2IA 4AFNA 3BAZA 1DRUA 1OMOA 3WNQA 3GEDA 5CG2A 1RM0A 4RPGA 2FRDA 3LT4A 3DWFA 5AXAA 1EMDA 3JYQA 3AFMA 1SOVA 2J8ZA 3KUXA 2VYVA 1ZSYA 1B16A 2YYYA 5KJ6A 3W4IA 1XU9A 3HADA 4TKLA 4AJKA 1Q0LA 2PNFA 2EIHA 3NTOA 3WGQA 1IHXA 4YA6A 4B4OA 3DTTA 4D45A 2X0RA 3OJLA 3GY0A 1YL6A 3KSUA 4HP8A 5J23A 4W9NC 1LJ8A 5GZ6A 4IJWA 4PZDA 2ZYAA 4XX0A 4ALNA 4EGFA 4C7JA 4Z3KA 1PJSA 2JJYA 1ADGA 1ZKMA 4ND2A 2BI8A 4QO8A 4LSWA 4DYDA 5FI5A 2DM6A 2ILTA 1SO8A 4DGSA 5G0WA 5TF4A 1IE3A 1V3TA 4RF4A 5LC1A 2QHXA 2ZQZA 3DBRB 3PLRA 1LI4A 1MP0A 3KXDA 1R16A 1MC5A 3RI3A 4LRTB 4D0SA 2VHYA 4L4SA 4BO8A 1LTHR 3W4JA 3MZ0A 4HBGA 3BMCA 2P9CA 1WAMA 3ENNA 3C8MA 5A9SA 4J0EA 1PGPA 4NFYA 1Y7TA 4BNIA 1V6AA 3GQVA 1I0ZA 1E1KA 1ZO8A 3CE6A 4RJTA 4WK6A 2YY7A 3PJDA 4Y9DA 5I7FA 1WMBA 4WLNA 3WDSA 2V6BA 3Q1LA 4WKGA 3DFZA 3AJRA 3WGHA 4DPKA 4U7WA 3RASA 3VZSA 5B4UA 1ZFNA 2JD0A 1UUFA 4BNUA 2PZJA 5JS6A 2D59A 3G1UA 5LDHA 4Y6SA 1ISGA 1HSZA 1Y8QA 4IXTA 4FQ8A 5TGDA 1PU2A 4CLOA 5JXWA 3CMMA 1A72A 2VT2A 2RBEA 2W2LD 2HKIA 1NAHA 3CXRA 2W2KB 1GUYA 1I10A 3DQPA 5I8ZA 1EDZA 3DAPA 4GAEA 4ZQGA 1NYTA 2Q4BA 4CUKA 3EVNA 1GPJA 3OHSX 4XB1A 3V2UA 2VTDA 4WLUA 1E7RA 1PZHA 3OIFA 4GLLA 2C7GA 1RKXA 2EV9A 3FN4A 3BTSA 3ZHZA 3M2PA 1T2DA 4MDHA 1JWBB 3HE3A 4IZIA 1ZZEA 3UW3A 4R3NA 3P19A 2V65A 1DC4A 4H3VA 3ITDA 2XF8A 1Q0QA 3F1LA 4W7IA 5BSHA 4XA8A 3DL2A 4CM6A 5A03A 4DWVA 5A9RA 1ZNQO 1U3VA 1OAAA 1M6WA 4XQCA 4NIMA 1D1SA 3O03A 3G17A 4BQPA 1GYPA 1TT5B 2JCXA 1IZ9A 2VYNA 1XU7A 5EPOA 2Z5LA 4WE3A 4GBJA 3IKTA 2YJZA 3G0OA 1JQBA 4OOFA 2QG4A 1EZ4A 3I6IA 5T8KC 1NWCA 4I5GA 4U0JA 1MFZA 3RU7A 2C59A 4ID9A 1NPDA 5EQDA 4YVFA 4CV2A 4GL4A 3VC7A 4DREA 4MVJI 1P0FA 2DBRA 2YW9A 3TN7A 3TWOA 3I5MA 2V6GA 3D4PA 1DHRA 2OL4A 2FWMX 2AE2A 2HLPA 4MO2A 3GN1A 1D1TA 1IZ0A 5THKA 4K9DA 4ZHSA 2HMTA 3ZWYA 3NJ8A 1HRDA 1KYQA 4WLVA 7MDHA 3DOOA 4OMUA 4JCOA 3GHYA 5ITVA 5L4SA 4DIOA 2NU6A 4FDAA 4R9RA 2Y66A 1B8UA 3FTNA 2AMFA 4E32A 1J4AA 1V3VA 3RUCA 1SEVA 4E0BA 5JYEA 4BKRA 4CQMB 5T6BA 5CAEA 1KERA 3H3FA 3LT0A 4YAJA 1HLDA 3ICCA 1ENPA 4CM9D 3Q6IA 2ZCUA 1RYEA 3PHHA 4HWKA 3KYCB 4AJNA 4BV9A 1P1FA 1MUUA 3CZRA 1LDMA 3HQ4O 4KTTE 4QFCA 1LA2A 2B5VA 3C1OA 3NYWA 5BNIA 5JCXA 4QECA 3E18A 3PJEA 1O89A 1XEAA 4CUZA 4K1LA 3L4BA 5EERA 1YOVA 1BDBA 3TZ6A 4FJ1A 4A0SA 4EUEA 1MXFA 5CDUA 1I30A 1LRKA 3FBTA 3PEFA 3STHA 4HFNA 3W6ZA 3NX4A 2O3UA 2JFFA 2VYND 5L51A 1HL3A 4M54A 1ENYA 1UXHA 2J5QA 4FPXA 3UCXA 4JJIA 3QWBA 2RH8A 2VZ0A 4XIYA 2GNAA 1M6HA 4B7XA 2HMWA 4TSKA 3HZZA 4B79A 4IIVA 1PZEA 4U6QA 4GX0A 3L4SO 5HRUA 4G5HA 4RVUA 1DC5A 1ZJYA 1L7DA 3GVXA 2HQ1A 3D5TA 3LLSA 4L76A 5L7TA 1W73A 4P8RA 3DOCA 4EEZA 3VPGA 3WMXA 3L6DA 5CDGA 4Q3CA 1QLHA 2VHXA 4WCFB 2NU8A 4LCJA 4JROA 3VH2A 3ABIA 2W2KA 1E3EA 3RBZA 3HFSA 3WOHA 3SBOA 2VNSA 2PGDA 2NWQA 1NPTO 1PS9A 1M67A 3GN2A 2FN7A 4MVJF 4E13A 5T57A 3I9MA 3GMSA 3KVOA 1WZEA 4WECA 2VWQA 4NG5A 3CZMA 5JY6A 2PY6A 1CQJA 1GTMA 2BH9A 2FR8A 3WJ7A 3Q2KA 4MJLA 1QLJA 3PWZA 4NPCA 1NP3A 5T67A 4G2NA 2O7SA 2OBNA 4CPDA 1I32A 3QW2A 1NTOA 2EW8A 4IDCA 4Z6KA 3MOGA 1JKFA 4W7HA 2OO5A 1BXKA 5H83A 1ZW1A 2OUIA 1TT5A 2AG5A 2BFPA 1BXGA 2CDCA 2DU8A 3KB6A 3RUFA 3ZGYA 2EXXA 1WDMA 1BDMA 4ILKA 2NUAA 4S1VA 2G1UA 2VZ9A 4ZQEA 4KQWA 4J3FA 3WS7A 1CRWG 1JAXA 1HZZA 3F9IA 3GNQA 2FZWA 4GGPA 4QXMA 3ZWWA 5K9ZA 5KOIA 4I08A 1NM5A 1SZJG 4XGIA 3VH3A 4I8XA 1YONA 1R0LA 3PWKA 3V1UA 4J1TA 2DPGA 5ENVA 5DP1A 4HY3A 3UUWA 3AOEC 4RZHA 1RPNA 2JAPA 4FFLA 5GMOA 1U3UA 1E6UA 3HNPA 3TZQA 2B5WA 4HX5A 5A5FA 3NEPX 2BGMA 3CUKA 2Q49A 3PPIA 3A14A 3HN2A 3LLVA 5COQA 2NVUB 1GQYA 1K3TA 3NUGA 3VHRA 1P44A 4II3A 1R0KA 2VRCA 4U8GA 3N7UA 4UVDA 4YJDA 3FI9A 3RUHA 4JBGA 3EVTA 3FBGA 1E7YA 4CQMA 4DXHA 2VWHA 2DTXA 3NDJA 1UR5A 3DAFA 4NJMA 4UEKA 4WOKA 1C1DA 4TQGA 2ZTVA 3U4DA 2FHSA 4XKJA 3RQSA 4BGIA 4J1NA 4ND3A 3GFBA 3GAZA 2DAPA 1NPYA 1B8VA 3L6EA 4ZQFA 1TLTA 3PZRA 3O8QB 4HADA 1LQTA 1AXEA 1C0IA 2VRBA 3GH3A 4E2XA 4HKTA 3ZU2A 1DHTA 1LUAA 3WQSB 4URFA 1DB3A 4XGNA 3QP9A 2B69A 4DMLA 3AWDA 1X1TA 4OSOA 5AXCA 5CHEA 3IC5A 4KQXA 4OSPA 1HT0A 2Y0EA 4RQTA 3U49A 5IXSA 4YQYA 1O94A 3G3EA 4ZU3A 3DMYA 3FWNA 2I5PO 3OICA 3QWHA 3DZIA 1HYGA 4RGBA 4R41A 1DDOA 1Y5MA 3AFNA 4ZN6A 1H5QA 4WLFA 3DBHA 2GRAA 2RAFA 1GUZA 1RJWA 1P1RA 1R0SA 3PI7A 1U8XX 2C5EA 1J49A 4R1NA 1F8FA 3BTUA 4IMPA 4OIMA 1YB5A 4WCFA 3R1IA 3TRIA 1B14A 4RPKA 3TFOA 1X7DA 3DC2A 4XWYA 4WOJA 1YB1A 4ZRMA 1EVYA 2Q2WA 1N9GB 2VRCD 4NFHA 1JKJA 3SX2A 3UXYA 1B3RA 4NI5A 3ZDFA 1PS0A 2Y1DA 2Y1EA 3ONEA 1E7SA 3ZWXA 1QMGA 3GDOA 4BQRA 2QZ9A 5DCYA 5L7WA 1Q0HA 1YGYA 2NM0A 5A06A 2J3IA 3B70A 2O4UX 1DLJA 1SEPA 1A7AA 1GL3A 1Y9AA 2AHRA 3GFGA 3H6KA 3JQEA 5TX7A 3S55A 4BO5A 1R6DA 4YXFA 3AM4A 1CETA 3LDHA 1SC6A 2YV3A 4GX2A 3RKUA 3QSGA 1QP8A 4YT2A 3ADOA 2RIRA 3CMCO 2D5AA 4D43A 1TA4A 1VKOA 1U3WA 2W98A 1T2EA 3WGYA 5U4QA 3WG9A 4B3HA 2HAEA 3RUAA 2GF2A 4Q3AA 4J7XA 4XCVA 3VH4A 4MVJA 2FY8A 1JVSA 3HDQA 1XYGA 2BMAA 2IZZA 3LVFO 1LLUA 3RFVA 3AW9A 4B4WA 2GGSA 2POQX 1FK8A 3ZCXA 1CIVA 3IIEA 1GEGA 1Z74A 5I8WA 1LBEA 3BYZA 3KYDB 2YFQA 3ZHXA 1Z73A 2O7QA 4AVYA 3JQCA 1HEUA 3ETDA 3DHNA 3LT2A 3ZNNA 2VTEA 4II2A 2WD8A 3NKLA 3K6JA 3COSA 3D7LA 3N58A 3FCOA 4PZCA 1UDBA 2JFHA 4PLGA 3RUDA 2QIOA 1V9LA 4E21A 2X0IA 3EW7A 3PQEA 3KTDA 1CERA 5IXYA 3C24A 3GZ4A 2Q50A 5TRTA 1E3IA 4GPD1 3E03A 2E4AA 1C1XA 4CR8A 2GYYA 1UJMA 2AG8A 4NBWA 2PLAA 4GMFA 1U9JA 3O8QA 3PJGA 1HZJA 3H4VA 4YJGA 1JTVA 5CPBA 3GVIA 4MVJP 4IINA 2I67A 4D42A 2IYOA 1H9BA 4NHEA 4RF2A 3U5TA 2QX7A 2GR9A 1PWZA 1RM4A 3GNSA 4CUJA 1P9LA 2AEFA 4XYLA 2O2SA 4KTVE 1X0VA 1BSVA 1KVQA 2VWGA 1AN9A 1P74A 4GI2A 1YB4A 4PZEA 1CJCA 4O6VA 5TC4A 1GR0A 1H6CA 3AY6A 1U4OA 5CDTA 1YH3A 2G76A 1ML3A 4MVJD 1QYDA 1ZIDA 4LISA 5JBIA 3GNTA 3VVBA 4C4OA 2A35A 3QVOA 4KMSA 4BUCA 2X22A 1T1SA 4Y6RA 2Y1OA 3I9JA 4B3IA 2X9VA 4IGEA 4IDBA 3CPSA 1MLDA 1PX0A 4PLWA 2GSDA 2RCYA 3I1JA 3CINA 3ASVA 1K5HA 3QA9A 2DUWA 3OJOA 2Z95A 2PWZA 3LF2A 4UEOA 1JKIA 3I4FA 3S2EA 3VPHA 5DCUA 3LK7A 2IODA 2UYYA 1TEHA 4IJKA 3Q9UA 1KC3A 4J91A 2GZ1A 2YZ7A 1Y8RB 3PHGA 3U4HA 3OQ6A 4CLRB 4HV4A 2EKQA 4GLOA 3IAHA 4YRAA 5BNTA 5IDXA 4IJVA 4M89A 3LYLA 3BMQB 2C20A 4JLWA 1HDZA 1HDXA 1Y81A 4J49A 2O50A 3BMOB 3GUYA 4Y6PA 5F1PA 5TT1A 4CMAA 4DVJA 3VZQA 1UZNA 5FYDA 3ZV3A 4Q9NA 2PGLA 4AJ4A 1KVUA 5IG2A 2GN9A 2VCYA 5A04A 3UFXA 4UVIA 2ZTUA 4GWGA 3WSVA 1PJTA 1GYRA 3L4BC 5EESA 4YWJA 2X86A 3VZPA 3PHIA 5MGBA 2EERA 1W0CA 5B4VA 1ORRA 1I24A 3KYDA 4CM5A 1FDTA 4PLZA 5BSFA 3TDKA 2HUNA 1ZK2A 3AI1A 4A5OA 3VTZA 3IDSA 2G5CA 1U4SA 6LDHA 2D0IA 2YDYA 4XYBA 1DLIA 2P9GA 4Q39A 2NVBA 3FR8A 1LDNA 3EYWA 4ND5A 3OP4A 5C7IO 3NRCA 1JN0A 4RCVA 1C0LA 2CD9A 3BA1A 3LU1A 4ZICA 2PFGA 2ZYDA 2Q45A 5MDHA 2V7PA 3PDJA 4JBIA 4BKUA 1QRRA 3C1AA 3PWSA 1A71A 1PL6A 4A2CA 4BNWA 1IL0A 3WR5A 1F0YA 4IQ0A 2WD7A 4D44A 3PJFA 3ORFA 2PKQO 1FDSA 3ZV5A 1AHIA 4Z9FA 5L9AA 5JMPA 2R6JA 4PCVA 1U3TA 1X7GA 4BNZA 2AXQA 4BVAA 5THQA 5HA5A 3K30A 4K6FA 5HTOA 1UXGA 5COAA 1HYEA 2B4QA 2OORA 5IN5A 1EVZA 4EBFA 4RPLA 1V8BA 2ZQYA 4IXWA 3RJ9A 1BVRA 2DBVO 5TS3A 4AJ1A 1XA0A 3AI3A 1H9AA 5BT9A 4IY1A 4CM1A 3B20A 3GGPA 4FC7A 2BLLA 3EHEA 3IUSA 3C85A 3GT0A 2QRLA 1LRLA 2EGGA 1G6KA 2OOSA 3FNFA 3R6DA 3ZN2A 1DPGA 1Q7BA 5FI3A 2ZCVA 4INAA 4BNGA 5H81A 2A9FA 4B4VA 3QVXA 1B26A 3PVZA 1DFGA 1PZFA 3U3XA 3KETA 4E2YA 3KM0A 3S2FA 1PWXA 4XQEA 4J9UE 2WYWA 1N1EA 3D1LA 2D3TA 4QT0A 3S1LA 4ALKA 1E3JA 1Z75A 3E5MA 1Y8RA 2I65A 3M2TA 4OGWA 1UXKA 3RD5A 4IDAA 3UN1A 4YAGA 2CDAA 3U09A 1XKQA 5EMHA 2O2YA 4HNGA 4S3MA 4KP7A 2Z1NA 3BMQA 5JE8A 2X4GA 4CM4B 1I3LA 4DUPA 4FGWA 1QG6A 1ZK1A 4RVGA 4BO1A 1I5RA 2VUSA 2FP4A 2I66A 4DA9A 2D4AA 1CDOA 3NJ4A 1VE9A 4NK4A 5U1PA 3WX0A 3D0OA 4FFPA 3UAGA 5F3RA 4DMMA 1NVGA 1KVTA 2YDXA 3K2EA 1S7CA 3RWBA 3ICPA 1W4ZA 3T7EA 4BO4A 4U5QA 4GX5A 3U4CA 2QYSA 3MJEA 5DCWA 4Y67A 3WGZA 2W90A 1H94A 4D3FA 4NU6A 1GPDG 1ZJZA 5L3ZA 2C82A 3G1TA 1PJ2A 2QW8A 3VOSA 5JAMA 2VYVD 1YXMA 1Y6JA 1VJTA 3L6OO 2NACA 2JD1A 4HFJA 1KVSA 4BNJA 3KBOA 5TSDA 4EW6A 3X2FA 2GZ3A 4Y98A 5ILGA 4ALJA 1BW9B 1YL7A 4JN6B 2NU9A 5T5QA 3WNVA 5A3JA 3MJVA 3WTCA 4N5MA 2C0CA 2DC1A 4WCFC 4M86A 3JQBA 3ROPA 1OZAA 2PZKA 2NV6A 4EI2A 2OFPA 4NBRA 5F1KA 5ES3A 5CP8A 1B3BA 3H2SA 2EGHA 2HSDA 4IMRA 3AM3A 3JQ8B 2XXJA 5JFOA 4CM8B 3FTPA 3OMLA 3RCBA 4OXKA 1PIWA 4RF3A 4LN1A 3WMWA 1KEPA 3M1LA 2AQKA 4PLTA 3TFQA 4YAEA 3DHYA 4IDDA 3DHEA 3RJ5A 4BO6A 1YJQA 2IRWA 2ZTMA 3AUUA 3BMNA 3VZRA 4YR9A 3C7DB 1U8FO 3JYLA 1IULA 1HETA 4WASA 2EF1A 2AEJA 5TJ9A 5I7VA 4EYEA 1E1NA 2VUTA 1PJ4A 3I6QA 5L7YA 4F6CA 5IZCA 2ZIZA 3WGOA 4QQRA 5JDCA 1HWYA 2HJRA 3F47A 2YHIB 4FS3A 4XGKA 4BNFA 2HMUA 3H9EO 3OA2A 3GRKA 2FR0A 1P1HA 4PVCA 2J5RA 3ZV4A 1DC6A 1MXHA 2IXAA 3WGIA 1L1FA 4PLFA 4EJ6A 3MJ4A 3U9LA 4QX6A 3D3WB 5CEJA 1RWBA 1PJCA 2PH3A 1R15A 4JGBA 3GK3A 2QRKA 5JAIA 4TRRA 1Z6ZA 4BNNA 2VHZA 4D0RA 3V1TC 2E49A 2X7HA 1C3VA 4BO7A 3SXPA 5ICMA 3KLMX 3S2GA 2DT5A 3OF2A 4Z9YA 2EHDA 3DBRA 3KRTA 1TVEA 3JD1A 3D4NA 5CEFA 2Y1CA 4CM4A 1HDRA 2ZK7A 1D8AA 5A3VA 4J4BA 2ZB3A 3PHLA 4NMHA 2OP1A 2D8AA 5ER9A 2Q99A 4P22A 5F5NA 4D3SA 1C0KA 3BIOA 3Q11A 3FNHA 3WYBA 5GZ3A 3DB2A 3UKOA 2NU7A 5TQVA 3OIGA 3JQ6A 3Q0EA 4FC6A 4F45A 4QEDA 1NWHA 2AQ8A 1QR6A 5IDYA 2P4QA 4D79A 2O23A 4FFOA 1ZXLA 4RPJA 3DMTA 2DLDA 3X2EA 4BMVA 2HK7A 4XR4A 5F21A 1HE4A 3M1AA 1QV7A 4DLAA 1Z82A 4BGUA 3ROKA 3WBBA 4UREA 1H2HA 2CMDA 4MKRA 3ZNPA 4ZVVA 1O0SA 4R51A 3RKRA 1VC2A 1G0NA 3VPFA 3DZHA 3LZ6A 1NNUA 2WJPA 1FXSA 1KY4A 2Y99A 3PYMA 4PN3A 1I2ZA 1SCUA 2C5AA 3C1TA 4XQGA 3RBXA 3ZW8A 4HFRA 4D3DA 4DTIA 4RVFA 4RL6A 2X0NA 4E4YA 3JQ8A 4O59O 3D5QA 1NQAO 1ONNA 4FOSA 5JC1A 4FB5A 3IOYA 5KVVA 3VPSA 5ITWA 1O6ZA 1EFKA 4IIUA 1FF9A 3ROQA 1K6JA 9LDBA 3IUPA 4BIIA 4YAKA 1GCOA 2E48A 1ADCA 1HDGO 2IDZA 3H5AA 5HBRA 3WB9A 1ENZA 4BHTA 1KVRA 2P5YA 2B0JA 4RV9A 3GGGA 2A94A 3ZWMA 3FNEA 2VQ3A 1ISFA 4YQZA 4WCDA 5G0SA 2J3KA 3ZNOA 4XYMA 4CLEA 4FIZA 3MTGA 3K8ZA 5EL0A 4RO0A 3GPIA 1GYQA 1L7EA 3OSUA 1J0XO 5DT9A 1E77A 4PG8A 3WFJA 2CFCA 1ZUD1 4AJEA 3VH1A 2Y05A 4TMFA 5TLSA 1Z7EA 3UICA 3RUEA 3IJPA 3C3XA 3JD2A 1SMKA 4D46A 3EGOA 4H16A 1H0KA 1U5CA 4FFMA 5KJ1A 1P0CA 3DZGA 2DUUA 2TMGA 4BNYA 1ULUA 4ZA2A 2YHIA 4D41A 4R5HA 3JQAB 4DLBA 2E6UX 3MTJA 4WEQA 3QHAA 3PDUA 3CTMA 3HJAA 3QV1A 3HB4X 4HFMA 3ZWBA 3T4XA 4YAIA 5JY1A 1E3WB 2EG9A 3ANMA 4EEXA 3PYLA 2C54A 1LC3A 5IAAA 4RPHA 4X54A 1WDLA 3KYCA 1G0OA 2FPIA 4DC1A 4M1QA 3BTOA 4OL9A 1MB4A 1WXDA 5AOVA 4CL3A 4DQXA 1PZGA 1DIRA 3ZV6A 3KSZO 4LVCA 1SB9A 4CM7A 4CODB 3TZCA 4G65A 4WPGA 4NBTA 4R4JA 2JAHA 4WLOA 2JHFA 3A28A 4G81A 1NFFA 1LDGA 3MWDB 4FCCA 1NQ5A 1CF2O 1YQXA 5DNAA 4B8ZA 3H65A 3H9UA 4I9HA 4PLYA 2AQIA 3O38A 3JQ9A 5BQFA 4KOAA 3GVCA 1I01A 4PG5A 4YBZA 1LLQA 2X0JA 4OHUA 3W6UA 5CG1A 1QKIA 4HNHA 4WGGA 2Q1TA 2Y1FA 3AU8A 1DC3A 2VHWA 1BHSA 1YBVA 4K28A 5GY7A 1ULSA 3KEOA 4GQAA 4OKNA 4KWIA 2X9NA 1VRWA 1YWGO 3MCVA 1Q7CA 1I8TA 3SEFA 3I4CA 1BGVA 2CUKA 3IJRA 3UCEA 5I9MA 3WWYA 2H1SA 1LRJA 2GN4A 4OXNA 4EUFA 2EP5A 3ZZNA 4AJOA 3GVPA 2E37A 1XELA 3SLGA 5IZ4A 3OEWA 3PQFA 1YJ8A 1UP6A 2VNAA 3A9WA 4PLVA 5AYVA 1CYDA 2CSUA 2GPTA 3ETEA 4NBUA 2G17A 1WVGA 2I3GA 4NZ9A 1DEHA 2A92A 2P5UA 2PD6A 3INGA 4CQMD 5JW6A 2DPHA 4ZD6A 5KTKA 1PR9A 2C2XA 1HLPA 1PGJA 3V2GA 1NHWA 4I9UA 2WM3A 5BSGA 3HG7A 4OO3A 1LLDA 4N18A 4KDFA 4PRLA 4FGSA 2HJSA 3E5RA 1O9BA 3IQDB 2CDBA 2VT3A 3DTYA 4J90A 4NK5A 4PFJA 3F5QA 4F46A 2B36A 3EDMA 2BFAA 1XQ1A 4XRRA 2VWPA 3ZU5A 1T2AA 3QIVA 5TNXA 2B83A 2AE1A 4JP3A 1PJLA 4CL8A 3IKVA 1K89A 3GC6A 1HE2A 1OI7A 2IEBA 4TWRA 1BTOA 1CEQA 3CSDA 4ND4A 4MP8A 2CNBA 3TOZA 3AI2A 4D7AA 7ADHA 1F17A 3QWIA 1Z45A 5ENDA 4BO9A 2AQHA 4KUEA 1CQIA 1H6BA 1N92A 1QYWA 4GGOA 1PTJA 1E1MA 2JCVA 3HSKA 5KKCA 4BNVA 4RLHA 1YE3A 1UP4A 3FRJA 2RHCA 2NVUA 3NTQA 4UVEA 4W99A 3JQAA 2BD0A 2VN8A 1ZCJA 2GD1O 5JO0A 2NSDA 3LC7O 1OBFO 4J2HA 5KIAA 5B37A 1GUFA 4RDIA 4MOWA 1XQ6A 1XLTA 1YL5A 1E3WA 2VOJA 4E3ZA 5K0ZA 3E9NA 1QV6A 4ALMA 1UZMA 1T1RA 1N1GA 1P31A 4JJGA 2DTEA 3BTVA 1IHYA 3GR6A 1VM6A 5KVQA 4ZQBA 3TOXA 3DZFA 1U5AA 4IPTA 4CLDA 3JYPA 3PFFA 3JQGB 2BHLA 3FPCA 3RROA 3IP3A 2UAGA 5ICSA 3JQBC 3WLFA 4XR9A 1E7MA 4YJHB 2PK3A 2IZ0A 1KIFA 3E6AA 1N7GA 3F5SA 2O48X 4U6SA 3NGLA 5DOVA 4AL4A 4CM3A 4YT8A 1A9YA 3EZYA 2BGKA 3OECA 5FWNA 2PA3A 3LQFA 3AUSA 3VDRA 3HHPA 4JXKA 1HF3A 3W8EA 3QQPA 3TZHA 4TRMA 3H5NA 4MKXA 4E30A 1K6IA 1YO6A 2DBZA 1MX3A 3UOGA 4YPOA 5BSEA 1ISJA 1O8CA 2JHGA 4TRJA 3S8MA 3PTZA 1UXIA 1UDCA 2HMVA 1LXCA 3QJ5A 3U4IA 2AW5A 5KJEA 5JAZA 1MA0A 1O5IA 4FSHA 2GASA 4LCEA 1A9ZA 3SJ7A 3T4EA 4H7PA 4B4UA 1WW8A 3O9ZA 3I9OA 4N5NA 4R16A 1ISHA 4U0KA 4JIGA 4EITA 5G2OA 4NBVA 5CFZA 2NTJA 1WP4A 4B7UA 4UVHA 1N9GA 1GADO 1LDEA 1VJ0A 3ZHBA 1JVBA 5KVSA 1DJQA 4A26A 5IZCC 4JQCA 3F1KA 4LW8A 5JDCC 1KEWA 2YV1A 5I9LA 2NQTA 4GKVA 1ZSVA 4BO0A 4OOEA 5CDYA 1DJNA 1GU7A 1V0JA 3WQRA 5A05A 4ALLA 4BV8A 3UCFA 1E6EA 1TXGA 5ADHA 1GQQA 4JP2A 1C14A 5IF3A 4CMGA 1Y5RA 2Q3EA 2GN6A 1KEUA 4CMHA 2J3JA 3OETA 5HM8A 3I9KA 3L9XA 4YDRA 3VDQA 2NVWA 3DFUA 3ZWAA 2PZMA 3OQ1A 4FFNA 1PR3A 2O3QA 3KYBA 4PVDA 2IZ1A 5G4LA 1X15A 2EJWA 4WNIA 3RFXA 2D2IA 3F6YA 3GMDA 2WE7A 4O0LA 3DR3A 1E5QA 2TMDA 3EZLA 4MP3A 1F12A 1GCUA 3V2HA 2P91A 2BI7A 5B4TA 1OFGA 2R00A 4AJJA 1ZK3A 1SAYA 1NR1A 2X6TA 2UUPA 1VL8A 2SCUA 3GZNB 5TT0A 1B8PA 4LK3A 2O3SA 3C7CB 4GX1A 2J3HA 3TL3A 4DL9A 3A06A 1P33A 3BMCB 4AJIA 3BHJA 3Q3CA 4NQZA 4NNJA 3H9JA 2OMEA 5A9SB 2OGUA 2X5OA 4O1MA 3R0IA 2Q2VA 2ZYGA 3DMTC 5H82A 3TL2A 4F3YA 4CLXA 3UF0A 4KUGA 1GZ3A 2LDBA 5G0UA 4QSMA 1LNQA 4BKPA 2EKLA 2V6MA 4OAQA 3SJUA 4PG6A 4OXYA 3L0DA 3ZI0A 4Q3NA 3EK2A 1KC1A 4L4XA 3ZWPA 5DDIP 3H2ZA 1IPEA 4IJUA 1HTBA 3OQBA 4DQVA 3RC2A 3FPLA 3TQHA 3DZKA 1YKFA 3JQGA 1YRLA 1DIGA 2RHRA 1R4NB 3ZU3A 4NDNE 2NADA 3M6IA 1UDAA 4BGVA 4Z0TA 3EAGA 5JYDA 2PH5A 1M66A 4BNHA 3PGJA 1RM5A 3JD3A 4L9RA 1U28A 2EEZA 4LRSB 1R12A 4RDHA 4CMKA 3GDFA 3K31A 1M75A 3WYCA 4DBVO 1Z7BA 1TT7A 4TVOA 1K0UA 1SNYA 3PGXA 3WIDA 3O4RA 1SPXA 3OFSA 5LDGA 2GCGA 4JNKA 2O3TA 1I3MA 2J5KA 3JQ7B 1JA9A 5DBFA 4W82A 1YBAA 1DIHA 1HE3A 1ARZA 1ONPA 3OH8A 2PZLA 3QVWA 2HMSA 3EMKA 2Y67A 4BKQA 5DP2A 1GQ2A 3RC7A 1EQ2A 1ZH8A 4ND1A 3RSHA 1NFRA 1DRWA 2AEMA 4IQ8A 1U7HA 3IMFA 1H6DA 1EEHA 2HO5A 2HU2A 3HDHA 1EDOA 3GLQA 1KY5A 2DQ4A 5A02A 2DFDA 3HWRA 4BMSA 4E5YA 1AE1A 3RU9A 3RVDA 2HRBA 2IEDA 2D5CA 1YDWA 3Q9NA 4K26A 4BNLA 4MVJE 4CLRA 4BMNA 2NTVA 3H5RA 4GMGA 4A03A 4E6PA 1ZBQA 2W2LA 2ZTLA 3H8VA 1JW9B 5DN9A 4ZGWA 3KZVA 1EE9A 5G0VA 4CMEA 2OBYA 1QSGA 2WYVA 3BMOA 3D3EA 2ZB8A 1WDKA 3ONDA 2Q1WA 2ZB7A 5HS4A 1P45A 1D3AA 3HB5X 3QRWA 4KZPA 4PIVA 4GSLA 4R69A 3A1NA 3BHIA 2UUOA 1H2BA 3HDJA 4OJNA 4C7KA 2VUUA 4MPDA 5DF1A 3CKYA 2WDZA 4LGVA 3BXXA 4BS9A 3KEQA 4EJ0A 4ALIA 4NR0A 4UUMA 1GEEA 1MC4A 3H9GA 4FJ2A 3NAQA 2DBQA 5FF9A 3GZNA 3OBBA 1AUPA 2ZJ1A 3ITKA 4XEHA 4PRKA 3ROMA 3JQ9C 3RUIA 1YOVB 3VAZA 4IS2A 2R2GA 2QQ5A 2J6IA 4IS3A 2BFMA 1Q2XA 1F14A 4M49A 3F3SA 5KJCA 5HS6A 4I9NA 2P2SA 1OOEA 2E82A 1PQWA 1LEHA 3GA0A 4E2ZA 3NDRA 1T26A 1VI2A 4RVSA 3NT5A 2PKQP 1E7QA 4MKZA 4MP6A 5JC8A 2CVOA 1F8GA 4AG3A 2YUTA 4E5PA 4J4TA 1I2CA 3RBVA 5K6AA 1DSSG 3WLEA 4CLHA 1J5PA 3ZWVA 1M2WA 1ZMOA 3I9NA 1GD1O 3QLJA 4R9SA 1GFSA 4CR6A 4LSMA 1NBOA 1VSVA 3PRJA 1R4NA 3GUCA 1A7KA 4PG7A 5B1YA 4EDFA 4NFSA 3PYXA 4E5KA 2I3AA 4XIJA 3OJEA 3WTBA 2P4HX 1AHHA 3WIEA 1QORA 2EJVA 3I23A 2WMDA 4CM9A 1PGNA 2EW2A 2GDZA 4DBZA 1LLCA 1NX6A 3B1KA 2H63A 4TKMA 4J1QA 4LMRA 1JLLA 3LF1A 4ZJUA 4DQUA 3KHUA 2GERA 1JDJA 3SLKA 2WEKA 2GUGA 3E1KA 4N7RA 4FJ0A 1HDCA 1VPDA 3JQ7A 1KBZA 4FW8A 5G0TA 4K6CA 3ZWNA 4YB8A 3ZWCA 1MG5A 2I99A 5EN4A 3O26A 3AU9A 4WEOA 1B2LA 1BXGB 3OA0A 4OYRA 2EP7A 3ASUA 1LSOA 1I33A 1VJ1A 4GWKA 5FEUA 1E5LA 1TI7A 3JQFA 4R68A 1LDYA 1Q7GA 3FF4A 3K5PA 1LDBA 1X14A 4WNCA 4BO2A 1UH5A 1ID1A 1Q1NA 1BMDA 1XWFA 4A27A 2C29D 1F06A 4MIEA 3PQDA 3V8BA 4J6FA 3F46A 5BNFA 1XHLA 4WLEA 4UVGA 1BG6A 3H9QA 4AICA 2O3RA 5IN4A 3VKUA 3NV9A 5JDIA 1U1IA 3RC9A 1WNTA 2F00A 4KDEA 3I83A 3NT4A 5CEEA 1LSSA 2RH4A 4UAGA 2PTGA 3BZUA 3DBLB 3DONA 4Q3DA 1DIBA 8LDHA 3KO8A 2CF6A 3JSAA 1PS8A 3GRPA 3I3OA 1UZLA 3MJSA 4WJZA 2FOIA 2CF5A 3FNGA 4I5EA 4DC0A 3DO5A 4FN4A 1ADBA 5I7SA 1O95A 2W8ZA 1IPFA 2HK9A 4RLSA 4MIOA 4RVDA 4Q3BA 4NJMB 1HYHA 4QFDA 5C3MA 5U9CA 5A4DA 5L4LA 1LQUA 1VL6A 1C1DB 3AOGA 3VTFA 4I1IA 3GG9A 1BRMA 1HXHA 1PJQA 1U2GA 4Z0PA 3DOJA 1XCBA 1T2FA 3WQQA 1GY8A 3E48A 3FWZA 3K92A 3AUTA 5L40A 3ONFA 3VVCA 4KWHA 2GN8A 1LU9A 4BNTA 2FR1A 3INRA 4L74A 3ULKA 3MOIA 1K2WA 3OM9A 1JU9A 1KOLA 2YHUA 1R4MB 4L75A 5T64A 3LC1O 2VHVA 1EUZA 3DZJA 3Q2IA 4DPLA 2OXIA 1BW9A 4R54A 3NDIA 4I5DA 4IGFA 4P38A 1P77A 3ANNA 5JCJA 3P2YA 3DBHB 2Q4EA 4BNKA 3UHAA 1BXZA 1WWKA 2C2YA 1VKNA 5KCZA 1UAGA 1D7OA 1KETA 4YEDA 3WFIA 4MVJM 1NHGA 2Y0DA 4CM8A 1T4DA 2BF7A 2Q46A 4J7UA 2CY0A 2V6FA 1DXYA 1YDEA 5L53A 2F1KA 1XIVA 2BELA 4RORA 4TZKA 1HDOA 4O63O 3ZH2A 4E2WA 4KUHA 5JNLA 2I9PA 4E31A 1KS9A 2QYTA 4IZHA 5I9NA 2CZCA 2OZPA 3ETGA 4IM7A 2P9EA 3ON5A 4A10A 4XQ9A 2IXBA 2QRJA 3OJ0A 4TRNA 2IYPA 3SC4A 4OQYA 4J4HA 2DKNA 3PIIA 1PGQA 4J1SA 1XG5A 2G82A 2FSVA 3GGOA 3QVSA 4J43A 3GOHA 5AXDA 1HDYA 2JD2A 3JD4A 4GVLA 3V5NA 1NQOA 4Z9XA 3OEYA 1AGNA 4AJHA 3I52A 1B0AA 2R00C 3W1VA 1QYVA 3IS3A 1GZ6A 4GH5A 4DLLA 1U2DA 4TZTA 4BB6A 1N5DA 5TJHA 1N8KA 3CEAA 2H9IA 1VLLA 2WYUA 4XJTA 5G4KB 1EBFA 1N2SA 1DRVA 1CWUA 3WGTA 3D3WA 1IY8A 3PLNA 4W9NA 5JCJD 1DFHA 1LX6A 4YJFB 1X7HA 1ZEMA 1E1LA 4UULA 3P2OA 4XYEA 2B4RO 3W8FA 4L8VA 3DBLA 5B12A 2X8LA 2WE8A 2YQ5A 1ZVMA 2FPPA 3WGGA 1K6XA 4ESOA 1E3SA 4CMJA 3HFGA 4FD3A 2H6EA 1GV0A 1XR3A 3SC6A 1G1AA 9LDTA 1UXJA 2ZKLA 4FR5A 1EVJA 1BVUA 4FFRA 3AK4A 3W8DA 1NXQA 2CVZA 3VKVA 3FD8A 2A4KA 4TVBA 1DAOA 1A4IA 3MJTA 1ZEJA 2X1HA 3IL2A 1EK6A 3WYEA 1IOLA 2YFHA 3LSYA 3ST7A 1EUDA 1VSUA 2X23A 4GKBA 4J9VA 4P4LA 5IDWA 1C1XB 1PL8A 2WWRA 5JAQA 1RYDA 3G49A 1ENOA 2YQ4A 3HN7A 3H3JA 4OM8A 5A1TA 1SB8A 4YJGB 4CV0A 1WPQA 4CMCA 1A4UA 1P1IA 4P4NA 4XJSA 4F6LA 2WTBA 3ZWOA 4YYZA 4PLHA 5TIIA 1VL0A 4M87A 4CMIB 2ZB4A 4E33A 3IP1A 4CQLB 3K73O 1ISMA 1UP7A 4CV3A 3AUAA 5C7OO 2Q2QA 5AXBA 1R4MA 2UDPA 3ZNQA 2I6TA 3VPXA 4B3JA 1FDWA 3TZKA 2PD4A 3BHMA 5C37A 2Q1SA 3GDGA 4YCAA 1MGOA 1H6AA 2GO1A 2BRUA 3E9MA 1ONOA 1PJBA 2H5LA 2ZATA 1R66A 3PFWO 4E5NA 4J16A 5JO9A 1ZK4A 3AM5A 1HE5A 4R1SA 5C7LO 2YV2A 3V1YA 3ZU4A 1A27A 1E3LA 1NAIA 4M8SA 3RAJA 4W4TA 4L0QA 5EJ2A 2ET6A 3DDNA 1YS4A 2OP0A 3B6ZA 3WSWA 3QY9A 1ZK0A 4YT5A 4L73A 3U0BA 5L4NA 1PGOA 3LC2O 3NTRA 5AQ1A 3LT1A 2B4TO 1XDWA 2X58A 1E92A 1T25A 3P7MA 4DYVA 2QZZA 2JKVA 1PQUA 3RIHA 2DTDA 4Z0HO 1EBUA 2FPGA 3JYNA 1T4BA 3DAGA 3GEGA 3MEQA 1M76A 2XAAA 8ADHA 4Z3DA 2UV8A 4CMEC 1IB6A 4QO7A 3JYOA 2XPCA 3JTMA 1QYXA 2HK8A 1B7GO 4ZQHA 4EJMA 2P68A 5T8KA 5FFFA 4XDYA 5HWSA 3DZBA 2C7VA 1PL7A 3HDYA 4RZIA 2D1YA 3N74A 5C5IA 2Q1UA 4O5OA 1HSOA 5CPFA 2BKAA 4N54A 4XYGA 4EUHA 3CH6A 3HUDA 1LSUA 2DVMA 3KSDO 1EFLA 1JAYA 4BL5A 3I9LA 3F4BA 4I5FA 4NJOA 4AJ2A 2HRZA 2FSSA 4R3WA 4CMBA 5F5LA 5G4KA 4IDFA 1WMAA 3GEMA 2JCYA 4Y8VA 1OC2A 1YQGA 3UGKA 2I76A 3GF4A 3JV7A 1QYCA 2O3JA 4YJFA 2O4CA 4JJFA 5DBGA 3WJAA 4UUOA 1EQUA 4L4RA 1B15A 3PK0A 2EWMA 1FMCA 1FDVA 2VOEA 4MVJH 1DOHA 2EKPA 3UVEA 3RC1A 3D64A 2ZJ0A 4FBGA 4FOOA 4XRGA 5I7EA 4IUYA 3KV3O 2VZ8A 2OHXA 5JMWA 3ZHYA 5K6AC 1YBMA 2JFGA 1P3DA 4YTEA 3L07A 4MIYA 1E0DA 5COBA 4P4GA 1PSDA 5IFLA 3ANLA 3FR7A 4PLCA 2CVQA 2XXBA 4ONEA 1IYZA 3K2BA 5JSFA 3EC7A
chains in the Genus database with same CATH superfamily
4YJ2F 3TYXA 2F55A 1J6UA 1N8NA 2D06A 3BF8A 2WAAA 1TD9A 1UANA 3OIVA 1OKKD 1M3SA 2ZUCA 4V24A 2WFLB 2KWIA 3NUQA 4LHEA 1MB0A 3PC4A 5BVGA 3ICEA 3A2KA 2B4AA 3EE6A 4IMIB 3VSEA 4JYMA 2JIRA 1GZ4A 1CD5A 2WD7B 4G37A 3FHLA 3HO1A 2DY0A 3SYKA 1HQYE 4QELA 4CMIA 1L7RA 3EEIA 3RTDA 4C3VA 1Y9EA 5IXJA 1GAEO 2JHPA 2Q2NA 2OBLA 3H7AA 4ZKDA 4BO3A 3X3HA 1DV1A 1GV1A 2VP3A 1SU4A 3MMSA 1TC2A 2PGJA 4QUKA 5CH8A 5BSVA 3SQOA 3HTXA 5EXDA 1XJQA 3D54D 1Z68A 5CFRA 4DUYB 2FFHA 5BUZA 3L77A 2NPFA 1A9XB 4RH3A 3RFTA 1A2OA 3GPDG 4OH1A 3WB2A 4IQGA 1AXGA 4OAPA 5C18A 1THMA 3U40A 4IBOA 5EINA 5FWDA 1UFRA 2PIAA 4E5MA 1RHQA 1JJ7A 1XMOB 2VF7A 3EISA 2X0FA 3J80A 4UQLA 1E2JA 4PGFA 4OQNA 3DNMA 4BPRA 2VQ6A 13PKA 1SD5A 2G8NA 2VDPB 3PQ8A 2NTNA 4AJPA 4OGGA 1KEVA 1SH7A 2PO5A 2R8EA 3BWYA 1EFUA 2G0TA 5K6TA 1HKUA 5L95A 1L5RA 2CMKA 1PEYA 1WZIA 3A6GA 1S6YA 3HL4A 3L1UA 1TZKA 4JIMA 1F4PA 1I7DA 1YHNA 5CDSA 2UZ4A 2QY6A 3DHWC 5K03A 2GPSA 2JLCA 2NNLD 1U5BA 3N76A 4HXYA 3EUWA 3W79A 4ZOQI 5M7EA 1CQZA 2PJDA 2MSDB 1H05A 1L4FA 1VE5A 2WU8A 1GR1A 2ZBUA 3FPSA 2JFZA 1G9SA 2JIMA 2VC2B 1OT3A 1TB4A 3LIIA 3WMRA 1DWOA 5HKKD 4RPCA 1K4MA 3DMHA 4AKGA 5P21A 2VQDA 4O4HA 1ADFA 3N70A 4A6XA 2BGLA 3QE3A 1KA9H 2BISA 1U7ZA 2R1TA 3QWAA 1FRZA 5B3JA 1ST2A 3N5KA 4TUYB 4A6EA 4D9GA 4BFSA 1CJUC 3NYRA 4RVHA 3RDPA 5AVJA 1QVAA 2GLXA 3NIDB 1OIWA 2Z83A 5D3MB 3P20A 1HY3A 4XUEA 5FOWA 5HYVA 4JJKA 5EGSA 5ALFA 3V34A 4AX8A 1Z8HA 1JR3D 2HM7A 2QN8A 3DEHA 3EC1A 4GSYA 4UATA 1SXJB 2P27A 4AMVA 4DPMA 3F3YA 5KOJA 1W0KD 4YRDA 3LL7A 2RKBA 3JTEA 2YHSA 1MG0A 3EY4A 4JX8A 4YT4A 5J4VA 5C5CA 4FMCF 3B85A 1RXWA 2FE4A 1H93A 3NTVA 2Y0CA 3Q7RA 2ASVA 1DO8A 3RYFA 4MS4A 1F2TB 2FP4B 2M32A 2WNHA 2W4MA 1IM2A 1Q44A 4GSKA 1Y1PA 4JASB 4ES6A 1NVTA 2HJGA 5E3JA 3CVYA 3NVDA 4LOHA 2QGFA 3T1OA 5IBCA 1XSEA 2ZVQX 5GIPE 1Q0SA 4DKJA 3P27A 4J0DA 1V3UA 2X40A 2JFYA 1U6IA 3D8BA 2WWIA 3AEYA 5JZVA 3WIUA 1DCKA 3NHRA 4MR9B 1V35A 4UAVA 1KMHA 3QV2A 2ZRKA 3I0MA 2PT7A 1Z88A 4JBHA 4LOAA 1XGKA 1Y9ZA 1IJFA 1K8YB 3NT2A 2QZ4A 1TMKA 5LYYA 4HDRB 3GP3A 3QWFA 4D4GA 4NOMA 4DCTA 5B58C 5FD8A 3EBPA 1W47A 2N42A 3MMNA 4OBEA 1ZMTA 4C6SA 5FUWA 1UBUS 1KORA 2I2DA 2IE0A 3SQXA 1IN5A 4CLOB 2P0YA 2G9QA 4B8WA 4ZT2A 3HH8A 3DKRA 2PUHA 4Z8XA 4D26A 4QATA 4ZGBA 5AVSA 4Y1RB 5SV2A 2NU9B 1QGDA 1Y6QA 1TGVA 4HL6A 1FNCA 5IT9A 3ZZTA 5J59A 4I7EA 3O3CA 5FBZA 1V7ZA 3ZW9A 4DMFA 3A2NA 3FPJA 4XVUA 4CDRA 4Q3EA 5J4YA 4PLPA 1WHSB 1X7YB 3FY4A 4B3GA 4G1VA 3DDUA 2HX1A 1PLLA 2R0QC 3AUKA 2XOXA 1NQTA 4GOKA 2GF0A 1W1WA 3PKIA 4FEYA 1YFKA 5EWLA 4UE6A 2ZS7A 4XD2A 4WKNA 1UC4B 1R37A 5AQEA 3IVRA 1UMCB 4ROSA 1U3FA 3P4YA 4CQLB 3K6SB 5JCPA 5A5EA 1FQWA 3HO8A 2C88A 5CFLA 4M4SA 2ANCA 3P9RA 5DB4A 4D8YA 4DRXB 2GPJA 1K4KA 3O1IC 4FILA 1ZOOA 4BN0A 3O8CA 1USKA 4YACA 1P1JA 1PHPA 1VBMA 3IBGA 4XDZA 4UEJA 4ZCLA 3GEDA 3WGVA 3UWSA 3ZJVA 1YDGA 2FRDA 2BP7A 4RPGA 3I04A 4EK9A 3AKDA 3BDAA 3AF4A 3VOTA 4Y2GA 5GAJA 1M8KA 2BEUA 3N0RA 3KUXA 5HQTA 2VYVA 1F51E 5T7BA 4O0MA 2X1MA 2CJPA 1B16A 2YYYA 5A2QA 1N5IA 1U2DC 2I7XA 3FNIA 4P4SB 3UJ9A 2HBRA 1FP4B 1OUMA 3FBWA 2ADOA 2PNFA 4WA7A 4ZI7A 5EP3A 4PYRA 3ZE1B 1J23A 4KO4S 3EHDA 5F52A 1ZD8A 1WD7A 2YIMA 3GY0A 3HUUA 5D86A 2FYTA 2FV8A 2QL5A 4IJWA 4GDFA 2COUA 1KYWA 2B92A 5JHGB 2IS6A 4NS4A 4ALNA 5AHXA 3K70C 3ESQA 3JU3A 5AM0A 1NJ8A 4NAHA 3W5DA 3HU1A 2VJDA 3TSYA 1ZKMA 3GUUA 1PYOA 2BI8A 4QO8A 5INTA 3STXA 1G8FA 1Y5IA 2XKJE 4PHGA 4P3XA 4ECAA 2LCIA 2FJ0A 4I46A 1P2FA 4DGSA 4BX9A 5B7PA 3AETB 3PPWA 1ZL0A 4UUAA 4DNFA 1IE3A 5EUMA 1V3TA 4F9FA 3DF7A 1WKCA 4AO8A 2X3UA 3NM6B 3PLRA 4LQ4A 3H05A 3OCJA 1IG3A 3K0AA 1S2NA 1R16A 3KXDA 3RRJA 2A7XA 3N3AC 4Y7CA 1FNMA 1P7PA 4M6WA 4LRTB 2VHYA 4DR7B 3D8TA 1MB2A 1ZCZA 4WOBA 4WXYB 5CDHA 1RC0A 4OJQA 4K2AA 3AMVA 5AK5A 1FX1A 4M8LA 3U3MA 3MZ0A 4EHKA 4F4JA 5KYKA 1IDN1 3QVMA 3GCZA 1GIAA 1MIOB 2FNAA 2QA5A 3AR4A 4Q12A 3P45A 2XYRA 4KR6A 2G67A 1MC1A 2GYVA 4GOND 4J0EA 4LJ8A 1TIPA 1Y7TA 4HH4A 1P80A 2NNWB 2OCXA 4IOMA 4KLAA 3L7JA 3CE6A 5CLIA 2YY7A 1QCCA 3ZE6A 1EFVA 3IEKA 4Y9DA 5E6RA 3S29A 1NYQA 3NHLA 4HH0A 2K7ZA 1Z0SA 2V6BA 1THTA 3DFZA 1P29A 1XD2A 1GRNA 4DPKA 3ZIUA 5JS8A 2GHQA 1T43A 2O2CA 1S4MA 2JFXA 4BNUA 2HT1A 4N7JA 4O4JB 3EEQA 4IXTA 3L7MA 1TVCA 3ELWA 4FQ8A 1GPLA 4PC3A 1E4VA 4JUAA 3UM9A 4B17A 5HK8A 3QFCA 4BVGA 2RBEA 3B1VA 3FOWA 2W2LD 2HKIA 2X13A 3FMIA 3NS7A 3QNUA 4MIKA 4OB7A 4C4ZA 1F5SA 4IH9A 3D3NA 1F38A 4NQRA 4GAEA 1Z6AA 2MIIA 5TMEA 3TD6A 4IIJB 2Q4BA 5K8IA 1XXLA 3PUVA 2F8LA 3U44B 1SQ0A 3E61A 3P97A 1L4HA 1RI4A 1Z5WA 2ZJ5A 1PZHA 1VTKA 2SKEA 3JR7A 5B6PA 4ASUD 1OZGA 4QU9A 1S02A 4GLLA 4O1IA 2D74A 2EV9A 3ZE9A 3M2PA 1TD1A 1ZZEA 2DPLA 1DC4A 3U1BA 4Q47A 4XWGA 3BXEA 4OK3A 4B0OA 1RTTA 2QLJA 3F1LA 5EEHA 4EI9A 1VE6A 4W7IA 4EB6B 4XA8A 3DL2A 3Q3JB 2AWNA 1L4LA 1ZNQO 1U3VA 4MAMA 1TADA 1M6WA 4NIMA 3RVKA 1D1SA 3Q7EA 3F5MA 1GYPA 1WCYA 1IZ9A 3A1EA 2WF7A 4CIDA 1QHSA 2Z5LA 4ZYXA 2QF7A 2ZR0A 4PR0A 1ZLYA 1JQBA 4IO0A 4OOFA 4MTLA 3TLEA 5CVVA 1ZX1A 1SHJA 1JHDA 2DBYA 2J09A 3I6IA 3CT6A 2CB0A 3QBEA 4RSGA 3OQIA 1Y3HA 4TS4A 1Z2NX 3ESRA 2C59A 4ID9A 1XV5A 1W36D 1J00A 1GAQA 1Z4JA 5EJ5A 4NV0A 1RJGA 5KDDA 2DBRA 2VPXA 2YW9A 3UYKA 1Z15A 1G21E 4C7OB 4N0PA 4RD4A 2V6GA 3GIDA 3A6LA 3PENA 3FB4A 4Q4HA 1KARA 3NWPA 2HLPA 4RJKA 2ONCA 3PQ3A 3GN1A 4PGGA 3GXOA 1VPEA 3S40A 1EGMB 2XIJA 3VR2A 3ZWYA 2DPXA 4PS0A 1ODTC 2CL6X 4Z1OA 3NJ8A 3U26A 7MDHA 5CYPA 3JATB 4N0DA 5ITVA 2ZAIA 1PYDA 1XCJA 2B7CA 3IIIA 4FDAA 4L5IA 4MW7A 1WXFA 3G5TA 3JZIA 3K6KA 1SEVA 3RUCA 2O8NA 5JYEA 3VJRA 4UBKA 2UYHA 2ZYVX 1EGVB 1LPBB 2FN8A 1U2EA 3CGWA 4KN8A 3H3FA 4EY5A 3AHFA 1F6WA 1XCGB 4MGYR 2W9XA 3E7PA 2Z2IA 1N2HA 4XASA 4CM9D 1TA9A 4ZMBA 4HWKA 4AJNA 4BV9A 2ZUVA 4NZNA 3CZRA 1LDMA 1LPMA 2OFOA 3O95A 3WLRA 3O2SB 5T4FA 3N75A 5BNIA 5JCXA 3ROGA 4BVBA 1HL7A 1LK5A 1O89A 1XZ8A 1XEAA 4OMCA 4CUZA 5B1HA 2IYEA 4UNNA 1RBMA 2B25A 2XQKA 1J2EA 1PAUA 3Q15C 1NVEA 1Y9DA 2G9ZA 1USVA 1HOXA 2OGWA 1OGIA 2VJOA 2WKRA 4FMBB 1J07A 2G6BA 2SNIE 5EKDA 5LBIA 5LWHA 1XCOA 4GI5A 2WT8A 1LRKA 3H2IA 2GD2A 1DKUA 5L51A 2VYND 2JFFA 4Y6LA 1FX0A 4HGRA 4FPXA 4UPDA 4HWTA 2RG7A 3P26A 4Q9AA 3IE1A 2VAXA 3C6BA 1CVIA 2BTOA 2VBCA 3A1DA 3HZZA 4UVGA 4B79A 3G2PA 5JQGF 1HT2E 1PZEA 2F4VB 1I6WA 5E4JA 3C45A 1MPXA 4OVKA 3NPAA 4RVUA 5HRUA 4LJ9A 1RWVA 2DQSA 2QUZA 2QYHA 3HYNA 1IQRA 1B43A 2HQ1A 4G0PA 4IH1A 3D5TA 3P9PA 3LLSA 4MV3A 5HX7A 5L7TA 1OT5A 3R5FA 1ZPDA 3NVAA 5EJMA 1YAJA 4KMMA 2F3TA 2NPOA 3DZCA 3GLSA 3O1LA 3WMXA 2JS7A 4Q3CA 4UZEA 3ABRB 1Z8FA 2RJOA 2WYIA 3G0GA 4WCFB 1EZ1A 3HO6A 2JI8A 3OZGA 1GN9A 2A7QA 2W2KA 3RBZA 4K05A 3HFSA 1RABA 1XQYA 2Q1XA 2ZBDA 4QHTA 2CNWD 1NPTO 2VPIA 4RMNA 4E13A 3TNYA 4BE4A 5FBQB 2H1RA 5T57A 3R7LA 3V80A 3WWCA 3K32A 1NTRA 5CA1B 4OF4A 1CZRA 2JA2A 5A5DA 2ADMA 5IC4A 3O8RA 1HKHA 1O95D 2EATA 5JY6A 3PD1A 3ANTA 2PY6A 1GTMA 1U0LA 2GTHA 3DULA 3DD1A 5FWYA 3MB5A 5D1NA 4MJLA 1SXIA 5CBPA 4IGKA 3NVMB 4XFDA 1FFXB 3V8RA 1NIPA 3QXCA 4HDOB 2AXPA 4G2NA 2P6RA 2O7SA 1GPUA 1GL6A 4J07A 2P90A 2EX1A 5A6SA 4CPDA 3VA7A 2JIZA 3VJLA 3WIVA 3FNBA 4C2UA 3KWLA 1SZCA 2PJUA 3HBAA 4W7HA 1E89A 3PUHA 5H83A 2G06A 3SVZA 1SG9A 1H0RA 2DU8A 2BFFA 2I2FA 3ELYA 3ZGYA 1D2EA 1X80A 2D5IA 2QJRA 3FDZB 3NCTA 3QBDA 1TK2A 1H2ZA 4HTFB 4F1WA 1XEFA 1KRHA 2VZ9A 3GLFB 2VF8A 3GJQA 1NNEA 1CRWG 1SWVA 3ENVA 5F64A 4XM2A 1JAXA 3F9IA 3ZWWA 2JK1A 3M5CA 3A27A 1NM5A 1SZJG 1XFDA 1RCUA 1WNFA 1G7SA 2HLNA 4K46A 4I8XA 4QXRA 1TZJA 3RYIB 5BUSA 3STWA 1N77A 4MDYA 3SYLA 5FHQA 3H11B 4UTRA 4MTCA 4ZYWA 5FTMA 3PEVA 3C5EA 1Q91A 3CX4A 4AROA 5IU6A 2PZAA 4RZHA 5CUQA 2JAPA 2A5DA 3AJ9A 4YCMA 1ABBA 5A0TA 4NHOA 4Q6BA 5ERGB 3KFXA 3OZEA 1TZMA 4FINA 5JT1A 2Q49A 3QG5A 4Q6WA 3A14A 5F7ZA 4UXHA 4G0WA 3S1AB 4IIDA 3D2CA 4U8GA 2VUIB 3ZK9A 4OIFA 4TKVB 4YJDA 2YV4A 4LFCB 1OHHA 3RUHA 4LHSA 4ZV4A 5JPDA 4OI2A 4QIHA 4TLCA 1MRSA 4YRIA 2CJFA 1SVWA 2J0SA 1W5EA 5KAMA 2XVXA 2M6LA 1R0YA 2XUZA 3M3HA 3U4DA 4TN5A 1VLHA 2DWCA 2G25A 4DLWA 4F4DA 4YIHA 3D6VA 4BGIA 5HHTA 4DCJA 3ESZA 3GFBA 3HDTA 3GAZA 2DAPA 1NPYA 4R7ZA 1C1HA 4YRJA 3O8QB 3L1HA 5AOBA 1R2QA 3KAQA 3CF2A 3DKPA 1AXEA 3F3MA 2I22A 4ARIA 3LYAA 3HCOA 3UB2A 1ZL2A 2PCLA 2Q0XA 2V3WA 4OUDA 4TGLA 3BJIC 5CT9A 3MCUA 2V5AA 1DB3A 1Q11A 5GOZA 2PUEA 3WL7A 2EQBA 2NO9A 4XGNA 3SE0A 3ZXSA 4DJJA 4ERXA 5MN5A 1LBQA 2XYPA 1X1TA 4DMLA 1ES9A 1JIKA 1E9RA 2D1SA 3IC5A 3KCNA 3MQ4A 4OSPA 1XMXA 5IAEA 4RQTA 3X1WA 4BMCA 1LWOA 1ODKA 2XWJI 4YQYA 3LNTA 4TMWA 3HVJA 1KR2A 1DI0A 3DMYA 3KUKA 4K9PA 3UHFA 4EWLA 1H2WA 1HYGA 2JIPA 3G89A 2IUYA 1I3CA 3BGIA 3WLPA 1H5QA 2W43A 3NHSA 3TVDA 2JANA 1KSGA 2CMFA 3IBTA 1D4AA 5KHOC 2WLTA 1KJQA 4MQ4A 4ROTA 5DYGA 3JAMA 3NEYA 2Q2OA 5B5SA 4FQ5A 2L17A 3L46A 2ZPUA 1VLVA 4FGUA 1J49A 3D6NB 1RXUA 1V6SA 1UMKA 5BMOA 3DNPA 3LY5A 4OIMA 4X93A 1KO1A 1ULAA 5J5VA 3TRIA 4DR4B 4AS2A 3MBOA 4PXYA 3TH5A 4LF4B 4PTZA 2QXYA 2GHRA 1FLNA 2ZIXB 4MMYB 4F9TA 4G5GA 2AUNA 1QGUA 3L1VA 1OFUX 1POXA 1YB1A 1FP1D 3CNNA 3QPWA 5DHUA 3WSTA 1VG0B 2VRCD 1IJKA 4NFHA 5CFOA 1JKJA 1O4WA 4NI5A 3L41A 4FFVA 1AIPA 1PS0A 4G3XA 3ZDFA 2WICA 3EG5A 4MKFA 1DC7A 2GNOA 4X8OA 3ZWXA 2IL1A 1N9ZA 2XVAA 3O6VA 4BQRA 1Z7GA 3GRFA 1U2TA 3DDCA 2C9OA 4OYLA 5BRJA 1FP7A 3MCAA 5F3WB 1YGYA 3GWGA 1P4JA 3OEHD 4LRYA 3ZY5A 4BLTA 3T12A 3QFHA 1E2QA 5A06A 3MUFA 4KYVA 1BAPA 1K97A 3ZHOA 2PX6A 3DDSA 5CB4B 1UIRA 2JHCA 2XOKA 2YWDA 4DQ0A 5BNWA 3GBPA 3W6PA 3GFGA 2ERXA 3H6KA 3JQEA 2WP8J 4HRAA 3S55A 1R6DA 4F1KA 2HCRA 3GFPA 4GX2A 4E14A 5ALJA 4ARAA 1CZHA 2XD9A 1FYWA 4YT2A 4HWRA 1PT7A 3RD5A 5DXFA 2D5AA 4M1ZA 3NLLA 1L1QA 1TA4A 2G3YA 1A04A 4X1KB 3T06B 4D43A 4GPEA 4EHFA 2OCGA 3UFXB 5C4MA 1P2VA 3VU9B 3RUAA 3HR7A 2GF2A 3KAJA 2HRCA 3IAM6 2UUAB 4MVJA 1IHDA 3FDFA 1XYGA 2BMAA 1WR8A 3A9UA 4KR7A 1JEYA 1M2FA 3PC8A 4GE3A 1REQB 1A9SA 1JFLA 3AW9A 3NIWA 4MUYA 3BREA 4NS1A 3ROXA 2ZT6A 1FK8A 2GN2A 3ZCXA 2E4WA 3SXUB 3IIEA 1Z74A 1AUQA 5I8WA 3O4VA 2Y3IA 1QH0A 3KYDB 4M37A 3SYMA 1DX4A 2ZTSA 4HH3C 1T6ZA 3RS8A 5A7GA 1JEJA 3NBQA 3JQCA 3OE1A 2D1QA 4F3CA 3I8OA 1A77A 2Q4OA 3ETDA 3K53A 3LT2A 4R31A 4II2A 4EAAA 4CT0A 2WD8A 1BFUA 4HDMA 3DTNA 2BL4A 3T1NA 3WC4A 3FCOA 5TPZA 4B40A 2JFHA 2FMFA 1LS1A 2XCUA 3CS3A 2A67A 3RUDA 3HBMA 3MCTA 2ZJ8A 3V9PA 3EW7A 3GLVA 1KFBB 4MJXA 5SY9A 3KOMA 3N2GB 3MJRA 3OCVA 1UL1X 3BZWA 3E03A 4GPD1 2C8VA 5JXGA 2JB9A 4FT2A 4CR8A 4BYGA 1W2WB 3UGTA 4AMGA 1J06A 3CLRC 4JLAA 4KQ9A 3AF3A 4NBWA 3T9EA 2J85A 3PXBA 3S2YA 3RFCA 1HZJA 3H4VA 1Q74A 1D8TA 2BONA 3SFZA 5BW5A 5H68A 1W29A 1GA1A 1U04A 1Z5UA 2XSZA 4MVJP 1QP4A 5DBEX 1QGAA 1TCAA 1BMQA 2I67A 1J9EA 1H9BA 2IYOA 3DE7X 2V7QA 1N32B 3L02A 4HAYA 4HX2A 4RF2A 3OTWA 3WGJA 5AK3A 1H65A 6YASA 2ZYHA 4N1AA 4RIHA 2E4UA 1DRKA 2GBIA 3NP9A 3PRKE 4KTVE 3P52A 4ZVQA 2QK4A 1KVQA 4BBZA 2NV0A 2Y1XA 3OWXA 4RD2A 5C1DA 2HXGA 3MB8A 4L7QA 4POAA 1NVVQ 1YB4A 3CZQA 1NF3A 3VR0A 5BMVF 2JG3A 4DZZA 3TLXA 3FKJA 2DSNA 2G76A 3O4JA 3O8BA 4IJQA 3TW0A 5TMDA 1AXRA 2OGZA 3DLHA 2VYQA 2WB4A 3REGA 2PPLA 2SKDA 4KMSA 4H9GA 4C03A 1Q21A 2IYQA 2X22A 1T1SA 4OGFA 4Y6RA 3ZCTA 2XE7A 2PUAA 3ADCA 3TXYA 1VHWA 3T1TA 2FFRA 4F6RB 1LX7A 2QW1A 3CPSA 3IXQA 1DX6A 2FSPA 3G9QA 4HN9A 2MMGA 3KZMA 3I1JA 3CINA 3QUCA 2MT9A 3ASVA 1T3GA 1W19A 3QA9A 4IFEA 5J2UF 3OJOA 1Y63A 2H7XA 2R7LA 1JKIA 4HDNA 3S2EA 4TVSA 4QU5A 3ETNA 3HLTA 2HA5A 4FKZA 1TEHA 4V0LA 2I4RA 4OHFA 4V0QA 3T3IA 5I4CA 1ZIOA 1V1MA 1NV9A 3G9XA 4XM1A 2WWHA 2JJ2A 3VRHA 3ZPXA 2GZ1A 1BN6A 2IP4A 4KDRA 1VB3A 5AW5A 1NONA 4HV4A 4CN8A 4GLOA 4ERNA 3NMUF 1YQQA 4WN9B 4Q66C 5BNTA 4BAUA 5MHTA 4M89A 5HQJA 2JFPA 3BMQB 1Q14A 3O3NB 1KDYA 2F3SA 1YT5A 1Y81A 5CNJA 4EMSA 3BMOB 4JUFA 4G36A 3PQ5A 4IEEA 5TT1A 1ACJA 1UZNA 5FYDA 1VKJA 4E1AA 1E1CA 2NYVA 4GICA 4IOKA 4NULA 3TCKA 1QF6A 3TZBA 1DCFA 4CW7A 2PGLA 3HB1A 1GGNA 3OE4A 1KVUA 4V0SA 4AJ4A 3OZIA 3BERA 2IHBA 3CF0A 3EUAA 5AKXA 1IZ7A 3DHVA 1RE1A 1Z6XA 5TMBA 1O08A 1KQFA 1XVVA 3R9WA 2V5UA 3L4BC 3FMVA 4TXJA 3VZPA 3HJNA 4CCSA 1EWKA 2DCMA 3BK1A 5MGBA 1ZOIA 4BQSA 4BX3A 1WB9A 3CEHA 1YUNA 3P71T 1C4OA 3ZY6A 3C6KA 4GR9A 2HXYA 4KR0A 1ZIYA 3T95A 2AOUA 2EERA 1PSWA 4WL0A 1WQ1R 4GEGA 4TSFA 1QDEA 1UWLA 3MMZA 1FDTA 4IYJA 4Y6GB 4PLZA 4MA0A 3SDZA 4DB2A 2LUOA 1C0EA 1DBSA 4RE5A 2HUNA 4K6KA 2FW6A 2H4WA 4NX2A 2UXCB 2OLJA 1KL7A 3VTZA 3IDSA 3KLOA 4C20A 3LX4A 5ALYA 5H7XA 6LDHA 1I0LA 2D0IA 1DLIA 3BKXA 3H18A 3TVYA 1DUIA 3F4KA 1ZGHA 1LDNA 1SZPA 3EYWA 5K5EA 1I1QB 2WKWA 5IYZF 2G77B 5TMPA 2XADA 1L4UA 1JN0A 3MFQA 1BWRA 2QN7A 2O1SA 4CL0A 2IXGA 2CD9A 3FKSD 1J8VA 2PFGA 2ZFUA 1R9MA 2ZYDA 4BEJA 1HMPA 2Q45A 1XWIA 2WUFA 1JBKA 1EDBA 4AT1A 1FTNA 1LFDB 3F5DA 2R68A 1QVZA 2HU7A 2CXXA 1TECE 4A2CA 1IL0A 3SEAA 4EA9A 2DZDA 1M54A 4O4IA 4CBVA 7REQA 3NM4A 2D7CA 2VH1A 2W93A 4NBLA 1O6CA 4D44A 2GEBA 4LXHA 1AJEA 1GTJ1 1N5JA 2EGUA 1N8TA 1C41A 4HPXB 4X94A 2Y0PA 4PCVA 4L95C 2FRXA 1W94A 2WBLC 3FZGA 3R6LA 4BNZA 1CBUA 4BVAA 4RESA 2VA9A 3K30A 4K6FA 5KYVA 1RYFA 1U0FA 4R8KA 4DR2B 1KNXA 3Q1KA 1SOUA 4BFXA 4HTAA 2B4QA 4N5HX 4OI1A 3QHPA 3VX4A 2NXNA 1L8AA 3OM1A 4F7WA 3AX6A 2HMYB 4UHDA 4TZ0A 1Y8ZA 2ISQA 3ACDA 4M38A 3LX8A 3CR7A 2IY9A 2FF7A 2YWGA 5TS3A 1XA0A 3JVVA 4M1YA 4B45A 3TIIA 2K87A 3FCAA 3LLUA 1HZZC 4BV2A 2QN6A 4CM1A 4OJTA 3EHEA 4D9JA 5F7OA 5HIJA 1IH8A 1UT8A 2HQOA 4WMLA 2X3FA 4IGAA 1TUEA 3EWSA 4H6PA 4IUCS 1LI7A 4P58A 2I6GA 5KC9A 1QU3A 1VQ1A 3MINB 1M8JA 2QRLA 1M0TA 4GXTA 3ZBQA 3FNFA 3P2IA 4GQIA 2B1JA 3R6DA 4P32A 3V8NA 3RRFA 5I8PA 4INAA 1OI3A 2Z6QA 2Z2XA 4L1KA 3UYLA 2WNSA 4Z4QA 4R8MA 3LA6A 1JQ5A 3U3XA 4I9FA 3S2FA 3EXG2 3SR3A 4U2EA 4XQEA 4KE9A 2RC6A 3T3EA 2D3TA 2WWFA 5EYPA 3NONA 2XUQA 3A31A 4QUHA 4GYWA 4PYNA 4EL5A 2D2VA 4A82A 2I65A 3M2TA 4OGWA 4B7ZA 1UXKA 3H19A 1EKXA 1NRWA 4QDJA 5BQ3A 4AKHA 3U09A 5EMHA 2W2MA 2O2YA 2YYSA 3GI1A 1OYYA 4HNGA 3PC2A 1THGA 2XWSA 3W7BA 4AY4A 5LZ9A 4FXOA 1T6XA 3EXHA 1OILA 3HKEB 1JSZA 2XTZA 3VI4B 4D2IA 3RC8A 4DUPA 1I3LA 3ZK8A 5A5GA 3IKMB 4RVGA 3SEQA 4BO1A 1RE0A 1HT1E 2A84A 4ZYLA 4BX8A 1I5RA 2VUSA 2I66A 2R6DA 2C77A 2IGTA 4XX1A 4EGQA 5FNZA 4M0KA 5U1PA 3D0OA 4FFPA 5CA0B 1J1IA 1AB6A 2WIGA 3A4MA 1BVYF 4JR1A 3K2EA 1PE0A 4LPKA 5IAOA 4EGSA 4PONA 4TTSA 3AEQB 3RWBA 3AR2A 3ICPA 1W4ZA 3CEPB 4PV7A 4HMQA 1H9CA 4U5QA 4GX5A 5JNWA 5A6VA 4MQBA 3T5DA 2BM0A 1W0JD 2W90A 1H94A 3WGZA 5DNEA 1GPDG 2DH5A 1GGKA 5L3ZA 3ZE0B 4J0KA 4D3FA 2C82A 4Z4GA 3G1TA 4RMIA 2QW8A 3VOSA 2HHJA 3TKAA 2FMHA 2VYVD 4MWEA 1H2YA 3AKZA 1FNSA 3DE5X 5AM5A 1K6MA 1SPBS 1U0OC 5AVKA 5GJVC 1Y89A 1KVSA 4DLXA 1XNQB 1TVKB 4JVMA 3HXQA 3BJEA 5L3SB 4WFIA 5TSDA 1VJCA 2FU5C 4O5AA 1XZFA 3UG7A 1JNXX 3VTAA 1RP7A 1X2BA 2O14A 2Z3WA 2ZJ6A 2QD3A 2HJHA 4Y98A 5ILGA 2GJ8A 4ALJA 1YL7A 2HREA 4JQOA 2QX4A 1TJ4A 1UEJA 5T5QA 1YZYA 1Z0JA 5FLXA 1LPPA 4GLJA 2ZUEA 4YCJA 3AR6A 3CUEF 4MVYA 3U17A 1RRCA 2DC1A 3MT9A 4F9EA 1OZAA 4NFLA 2D00A 2B8TA 1V2HE 4BMOB 2CJYA 1L5VA 4NCNA 5CP8A 5HIKA 2HQRA 1B3BA 3R7WB 5DSZA 4V1CI 4X45A 3NOQA 3NBXX 4O2AF 1FU8A 2GLTA 5JUWA 1KTVA 5LMCA 3V32A 5HQ3B 2XXJA 4DZTA 4CM8B 2FXIA 5H3HA 6AT1A 3PR1A 1BJRE 3PHCA 1VMDA 5IAJA 1PX2A 3FFAA 1JYEA 4GC9A 2F9MA 3K9CA 2XRMA 4RF3A 2XXAA 1BEUB 4LN1A 3COWA 4DDWA 2WF6A 4JLPA 2A1UA 4FLEA 3K4HA 2ZI6A 5B2ZA 4NCAA 4H0NA 1KEPA 3AERB 1EPUA 1G5IA 4KH1A 4PLTA 5EE0A 2M2IA 3UAYA 4MS3A 2DHCA 4E2FA 4ARZA 4BO6A 1JH9A 1QE3A 4KGZA 5HE8A 2IRWA 3D3QA 4BP9A 3AUUA 3JX9A 3THYB 1KJ9A 1U3DA 1VP3A 3CG4A 1KIAA 1YTLA 4PPFA 4FKBA 3JYLA 1Z38A 5BR4A 3S0JA 1JIIA 2GILA 3QEMA 1I5OA 1PNTA 2ZITA 4UHCA 2WMOB 4MARA 4WASA 1XRJA 2EJCA 2Z6VA 2BHNA 4MQ6A 1FJXA 2AEJA 5I7VA 3ZHXA 2R6AA 3OZVA 3O8OA 1E1NA 2CCGA 4S0XA 3Q3EA 2VUTA 4EYEA 4TX1A 3G2OA 4CCYB 2EARA 1FP6A 5KTSA 4PM4A 5IZCA 2ZIZA 2WG2A 3OZUA 4RANA 2F8MA 2DHQA 4JOBA 3H1AA 2ETXA 3NKFA 3TTXA 3PHBE 2VQFB 4DG9A 1MABA 3G88A 4BNFA 4DJ5X 2A5LA 1CIPA 3OA2A 4KB5A 3T9DA 3NDBB 2NZ2A 2WNIA 2J5RA 2QL9A 3O21A 3ZV4A 3ZWQA 1MXHA 1JSCA 5BYAA 2H92A 2ZIWB 1JG7A 1IBLB 2CNLA 2JBAA 3D6JA 4EJ6A 2DWUA 2QNBA 2H3HA 1W88B 2PWYA 4L16A 1PV4A 5D5QA 2ZRHA 3D3WB 3Q6NA 2UUBB 1RWBA 1PJCA 5DOVA 2J87A 4D82A 1JHQA 1Z6TA 4C4SA 2GCNA 4UBJA 2QRKA 1BS9A 1YB2A 4TLEA 2X3YA 2VHZA 2OGTA 3V1TC 3RRYA 5BSTA 5JS7A 4JB0A 3KSAC 2X7HA 5HIMA 4R9NA 4BO7A 4F4IA 1NVFA 4LJYA 3SXPA 5ICMA 1NUSA 2HLDA 3KLMX 2B98A 3IIJA 3H3XA 4IKOA 5C53B 3CSSA 1YBHA 1TVEA 2JJ1D 2PBLA 3HGMA 2VBFA 1VP9A 5FKJA 1IN1A 1D9XA 1FL9A 3D4NA 1AU9A 5CEFA 2PMBA 4CXMA 1KY3A 1HDRA 3U48A 4QYIB 4KQCA 4OHWA 2QOEA 2ISCA 1JPVA 2XMPA 5D51S 5A3VA 3U37A 2MINB 1RYMA 1M8FA 1NXWA 4AMZA 4DCVA 3PHLA 3QA3E 3JWGA 4D98A 4LF5B 1N5OX 2CHVA 3NR2A 3OT1B 4Q48A 3DL4A 1QH8A 5F5NA 3ZLUA 1AQUA 2ZETA 3BIOA 4B32A 3WYBA 3DB2A 4HUTA 5L3QB 3P9KA 2YZ2A 4D9BA 2NZYA 4F45A 2AFIA 1GCAA 3RNLA 1K75A 1BXRB 3BFXA 3PEEA 4DEVA 2AQ8A 1IAVA 1CDEA 3I2FA 3KQNA 1CZNA 3NALA 4UE3S 1TU0A 4HVAA 4QUDA 1B42A 2HDNB 2O23A 4FFOA 1ZXLA 2F43A 5JNRA 1MO3A 1D03A 5EMJA 4KO8A 5IVPA 2HK7A 3IUEA 4UPVA 4D02A 5KQLA 4GKJB 4K9RA 1JVNA 1V7QA 2NYRA 4DCOA 1HE4A 3KJGA 4NE2A 4U9IS 2AGVA 1Z82A 4BGUA 2B82A 1EP9A 2ZRLA 3WBBA 4N7BA 1UJNA 4RLQA 1FMFA 1TYAE 4G5YA 2XIQA 2ZZNA 4Q1EA 1TZCA 3EZ6A 1WCWA 3DPSA 3C8DA 3U81A 4EO9A 1NU6A 2B7BA 2DQYA 3B82A 2CBGA 2XBUA 3ACCA 1Z2CA 3DV2A 4CIBA 4J3JA 4K88A 2BZSA 1VGRA 4KSCA 1KY4A 2Y99A 3DZ8A 1XWWA 3PYMA 4OP1A 4RL4A 4PN3A 4TYNA 3ANXA 2C5AA 4UCFA 3T38A 1V1RB 5DTJA 6NULA 4YRCA 1OXVA 4Y3UA 1B8NA 4RVFA 4YECA 4E4YA 4O59O 1JR2A 4FOSA 4DNXA 1H42A 5IAGA 4WBSA 1CZUA 3OF5A 1D2AA 3FGZA 1X1DA 3QK7A 1JF8A 4MUJA 4OP3A 3VPSA 1EFKA 4IIUA 2J3MA 4ND8B 5DHPA 3OU2A 1OPXA 3VO9A 1E64A 2DY1A 5REQA 5F33A 3ROQA 9LDBA 1Q0TA 2RONA 2JLWA 4YAKA 1J5XA 1XC7A 3MT8A 2E48A 2IDZA 5HBRA 1LS6A 2DR3A 1ZAKA 1ODJA 4JYAB 4RV9A 1FSGA 4JHLA 2A94A 3IPAA 1ISFA 1G8SA 5FFMA 2BZGA 4WCDA 4ZVKA 2IP2A 2J3KA 1E0JA 1T34A 1HFEL 1GG9A 4H4DA 4FIZA 6ABPA 1ZGCA 1XQ9A 2FLKA 4Y2QA 3SZGA 1FYFA 1RQGA 3PUXA 4G5OA 1PZXA 3OSUA 5CVUA 1J0XO 3BE5A 1T9KA 2Y92A 4OLJA 5AFSA 4DLNA 2GJ9A 1PD0A 4F04A 1IXRC 5IJ9B 3IJPA 2W70A 2QVXX 4RH0A 5KX5F 1W85B 2MR6A 5BQOA 4IDPA 3T7SA 3WDLA 2BJVA 5E4YA 2DECA 5BUQA 5BRNA 5TF0A 5KJ1A 1I13A 4P7JA 1E60A 1QFXA 4ZZ1A 2OC9A 3A37A 3CR8A 3HY3A 4QT4A 4ZA2A 3WL6A 4BXOA 2CXPA 4D41A 4JR2A 3WHKA 5IKEA 2BGUA 1MO5A 3HCWA 4HI0E 4R5HA 1MPTA 1SXJE 1XVIA 4YXWA 4BO0A 2E6KA 1QHHB 1PDVA 1NVUQ 1P7YA 4DN6A 4OHVA 4MITA 5EIBD 1OVGA 3HJAA 3A4IA 5GV7A 1P9NA 2O8FA 1HFJA 3HB4X 2I4OA 2V3VA 3ZWBA 1BVHA 3T4XA 4NAUA 3JVIA 1E3WB 2YBEA 2Y2UA 1NXOA 2J7PA 1T9AA 3KZCA 2DFKB 3PYLA 1R74A 2WOOA 4O25A 4A0QA 4BWFB 2XYGA 3L8GA 3KYCA 2VDUE 4N7MA 2FPIA 4S1WA 2IV7A 4DC1A 1Y6FA 4ZAFA 2NUTA 1WXDA 3NHPA 5BSKA 3F8TA 1NUPA 4DQXA 1PZGA 1DIRA 3ZV6A 5ICFA 4FI3F 4KYIB 3GOQA 4OQPA 2I87A 3KPJA 1SQSA 2I3BA 1ULTA 3C4VA 3F6EX 3IE0A 3EXAA 4G65A 4HZIA 2CFOA 2JIZD 4LV8B 4OFWA 4R4JA 1KAOA 2OYRA 5YASA 3ZW7A 5C5EA 3K0CC 5K0EA 1NFFA 2P9FA 1LDGA 2CBXA 3MWDB 4KN6A 4WSOA 2QTZA 3F6SA 4N9QA 2XW6A 4CKZA 2AD1A 2M9MA 2Q5EA 4L15A 3VV2A 1CY1A 3O38A 3LUDA 1WZ2A 4YBZA 3HYCA 1N6IA 4D0GA 4EGAA 1LLQA 5DI3B 2YVAA 5CG1A 1J42A 4WGGA 1A8SA 3SP1A 4G0QA 4DHEA 5C5DA 2ZAOA 2M1ZA 1XFAA 2VHWA 1QE0A 3FSGD 1PW5A 2HNBA 3K5HA 4FSXA 3KBBA 4UKDA 3OPVA 4ME6A 3DFMA 4OKNA 3EA0A 3LZDA 3KXKA 4O4LF 1CY4A 2OZVA 4H18A 1G4HA 4F5YA 5HFAA 5TGZA 4CIAA 4CEHA 1L7MA 3UKJA 1MCZA 4ZDJA 3KQLA 2H1SA 1LRJA 2GN4A 4ENVA 2M6RA 2PEZA 3HZRA 3C6ZA 3OEWA 4KV7A 4QODA 2VNAA 1UP6A 1QQBA 4QD3A 2GPTA 3CM0A 1Z2OX 1FEZA 4RW0A 3VSBA 5KAPA 1WY5A 1WVGA 3PQCA 4CI9A 4FYPA 4MQEB 3MLEA 2PD6A 1K3UB 5JW6A 2P7HA 5CK4A 3VKGA 2LBPA 2QRHA 3M33A 1IMJA 1G8GA 3PPYA 1NZDA 3BSFA 1GN8A 1ETUA 4ZD6A 5SY4A 2PAFA 4GG1A 5KTKA 3GJ6A 1M2NA 1G42A 1BROA 3OD5A 4XCXA 2VRNA 3GUZA 5AKEA 2R85A 3ZCQA 1NHWA 5JJBA 2Q5FA 5GQSA 3JR3A 4KITB 4N18A 1VA5A 1IJEA 2B34A 5IJXA 2NSHA 3GJ8A 4J90