4ND5A

Crystal structure of the lactate dehydrogenase from cryptosporidium parvum
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
302
Chain Sequence
MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITALLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPATSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of Cryptosporidium parvum Lactate dehydrogenase.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Oxidoreductase
molecule keywords Lactate dehydrogenase, adjacent gene encodes predicted malat
total genus 105
structure length 302
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nd5A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4nd5A02
2IEBA 3VH1A 5A03A 4U5QA 4G81A 4W99A 5DBFA 3G0OA 4E2YA 2B5VA 4DC0A 5L7TA 3DL2A 2BKAA 5T8KA 3W4IA 2BRUA 2FPGA 1I10A 1KYQA 1QV7A 3CH6A 4MINA 1E6WA 3PTZA 2WD7B 4RJTA 4CMBA 4XR9A 3BZUA 1T2DA 1N9GA 3KSZO 4ZGWA 5TJHA 5KNLA 3OJFA 1ONNA 5IXYA 1PX0A 4RVHA 4CLEA 1HE4A 1QXSA 4KTTE 1R66A 3ONEA 4NU5A 4R9SA 4JP2A 1HEUA 1HZJA 2VNSA 3RKUA 3VH2A 3ZU4A 5EL0A 2O2YA 3NJ8A 5JCJA 3BMNA 1PQUA 3HWRA 4ND2A 3ZHXA 3WJAA 4JBHA 1L7EA 3TL2A 4XB1A 3UH1A 3CEAA 1YVEI 3BXXA 1U5AA 3EZYA 4LISA 3W1VA 3I5MA 5FEUA 4W82A 4JXKA 3GHYA 2GUGA 4WOJA 1HDGO 1VC2A 2FZEA 3BMQA 3E6AA 5BSFA 4FN4A 3G1UA 5THQA 4AJOA 3NTQA 5IN4A 1C0LA 3AOEA 4J9UE 3AFNA 1IHYA 1EVIA 3O9ZA 2I65A 3UF0A 4R5MA 1WDLA 2VZ9A 2RH4A 3FBGA 4B4WA 1B16A 2X4GA 5EMHA 5HWSA 5IDQA 4Z6KA 1MG0A 4FBGA 4IZHA 5DT9A 5IFLA 3I4FA 3JYLA 1Q0LA 2Q1SA 4Q3DA 1KERA 4ILKA 1P1HA 1UP4A 4NI5A 4RGBA 2V6MA 2P9EA 5MGBA 4ALMA 4N5LA 5TC4A 4JGBA 3GEDA 4EYEA 2X6TA 3N74A 5DP2A 5BQFA 1NXQA 4J7XA 5CG1A 1NNUA 3F6YA 4KUGA 5G4LA 1R6DA 1RWBA 3BAZA 3AM5A 1QYDA 4QFDA 1CRWG 4TKMA 3QVOA 4N5MA 4MIEA 4U7WA 5G2OA 3UN1A 2EW2A 2UVDA 3CMMA 3ZV6A 1HDZA 2O2SA 1K6IA 1ULSA 1MX3A 4S3MA 5KVQA 2Z5LA 1ISJA 3AFMA 4MVJM 2E48A 2P9CA 3RVDA 1NYTA 4M55A 1N7HA 1K3TA 4F46A 3WB9A 5CPBA 4I5FA 1C0KA 1MLDA 4PVCA 1PWZA 2JHGA 4XQ9A 3V2UA 3P19A 1I32A 2DLDA 2YHIB 2YQ5A 3DBRB 4ZICA 4HWKA 5DDIP 4Z3DA 4E31A 1R4MA 3HDQA 3F9IA 1FDUA 2V65A 2Y99A 2NACA 4OH1A 4JJGA 1MC4A 1BDMA 1MC5A 3OH8A 2RBEA 4UVHA 4OSOA 4HY3A 2O3UA 3ZWAA 4YQZA 2ZYDA 4B79A 4RLSA 4BOYA 3ANMA 3C8MA 5AXBA 2PD4A 4WLOA 3ZU2A 1LDGA 3NTRA 2PKRA 3WS7A 1ZMOA 1VI2A 3I4CA 3GMDA 4ITUA 1B15A 3HHPA 2O3RA 2GN8A 1P1FA 2PA3A 4Q3BA 3EC7A 3JQ8B 1KVTA 1YWGO 1UUFA 4J3FA 4HX5A 4D42A 3CE6A 3Q9UA 2WE7A 1QMGA 4FS3A 1ZMTA 1D7OA 3JD2A 3ABIA 4YJGA 2BI8A 1GYRA 2EJWA 3V5NA 3PFWO 5JY6A 2CDAA 3GN1A 4BV9A 3ANLA 3JD3A 2D5AA 3VKUA 1HKUA 1NWCA 3ROPA 3FPLA 5L4LA 4A2CA 5L45A 1YB4A 5EERA 1V3TA 4FW8A 1Y5MA 1Y1PA 1I2BA 3OICA 2H63A 2B83A 1ZW1A 4LW8A 1T2FA 5KKAA 4Z0TA 3OSUA 4CR7A 2BGKA 2O4UX 3D3WA 5JMWA 4MIYA 4YT2A 1U28A 5JC1A 4XD2A 2VCYA 2YDYA 1JU9A 3PYXA 5FYDA 1U3TA 3GNSA 2V6BA 2FWMX 4R3NA 5L4SA 2VUUA 4GX2A 3WNVA 4HFNA 3PJGA 3H5RA 3DONA 1H2HA 2PZMA 5IZ4A 4BMVA 3GVIA 5CFZA 4CQMA 4J4HA 3MJTA 4CMIB 4W7IA 2C59A 3UGKA 3PXXA 1Q2XA 3GOHA 4IQ0A 1K2WA 1KY5A 3PGXA 4RPJA 1W73A 1P1IA 1JKFA 3AI3A 1NFFA 3VPSA 5F1OA 5KVVA 3G1TA 3TSCA 3LC2O 4I1IA 3AY3A 3QP9A 4NJMB 3GDOA 5AXDA 3RC2A 3ASUA 3M1AA 3QVXA 5A9SA 2I66A 1EVZA 2EV9A 2PV7A 1T2CA 2CMDA 5DCWA 1U7HA 3K73O 3UCEA 1WPQA 1YE3A 4K1LA 2ILTA 2TMDA 2GZ2A 3PQEA 2UUOA 3A28A 2I3GA 4EEZA 2NVBA 4Q3EA 2C7VA 2PNFA 5A4DA 3TZCA 4D3SA 5IZCA 2X0IA 1PJ3A 2W2LD 4CL8A 2VWGA 3IS3A 4OQZA 2ZKLA 3ZV3A 1DIBA 2BF7A 1SOVA 3GR6A 4Q3CA 4E21A 1F06A 1N8KA 1HXHA 2O3QA 2QRJA 3R3JA 4P8RA 1V8BA 3D1LA 4O1MA 4OJNA 4B3JA 4CLDA 4TRJA 2LDBA 4PZEA 1LLUA 4UVDA 1ZZEA 1M76A 1RM4A 3WGHA 4K28A 2DAPA 3HFSA 3RI3A 5H82A 3ITDA 4M49A 4R1SA 3RU7A 3PGJA 4AJEA 5HTOA 4Y6PA 4AICA 1XU7A 5CG2A 3JD1A 4NBWA 1RM5A 2CVZA 3JQBC 3KVOA 4E5NA 1MXHA 2YV3A 3O38A 1PJCA 3JQEA 4RLHA 1QYWA 3ST7A 4OOEA 4B8ZA 3S2IA 5IF3A 3BTOA 1BG6A 5KVSA 3U4IA 3B20A 5CEFA 1V9LA 1YDWA 2P2SA 1O5IA 1K6JA 2BFPA 3NYWA 2IDZA 5U1PA 3H9QA 1A4IA 5LCXA 4JBGA 2HJRA 1HZZA 2BHLA 2B35A 1GCOA 3M2PA 1TEHA 1Z45A 2FMUA 2QZZA 3E8XA 3GC6A 5BNFA 2D8AA 1MG5A 2G82A 3EGOA 4I9NA 4NJMA 3TDKA 2W2KA 3EDMA 4R4JA 5K6AC 2V7PA 5DF1A 3W8FA 1KEVA 1DLJA 1GZ4A 1MFZA 3LT2A 1NFQA 3V1TC 1BW9B 4K26A 4XRGA 3QJ5A 2CZCA 1PJQA 2Y1GA 3H5NA 1D1TA 2FRDA 1JLLA 4BB5A 5JNLA 3CZRA 4UEJA 3HSKA 4XZ3A 4FOOA 5CPFA 5I7EA 3CINA 1GQQA 1VJ0A 2A94A 5I7VA 5LDHA 4ZD6A 4XB2A 3GVPA 1K6XA 1AUPA 4YYZA 1OC4A 4EDFA 4J4TA 2DM6A 3K31A 4MVJG 2C82A 1YQGA 5DULA 1D4FA 1I36A 5K9ZA 1LRJA 4PRKA 4BNYA 6ADHA 2GD1O 3V2GA 3U62A 3ZWXA 2OO5A 1DDOA 2HDHA 5MDHA 4XDYA 1H9BA 1BWSA 3KO8A 4TWRA 1P1RA 1JAXA 3JV7A 2HCTA 3KOUA 4ZQHA 4AJ1A 4M8SA 8ADHA 2Y05A 2D2IA 3KYDA 4CLRA 4HV4A 4II2A 4IJWA 2VYNA 1FDWA 4JJFA 1LLDA 3JQDA 1Q7CA 3DWFA 3S55A 3ETGA 4KUEA 3UW3A 5KJCA 3BA1A 1PGQA 2G5CA 2NLOA 1GQ2A 2P4HX 3ROKA 4AL4A 3I9NA 1EVYA 5G0TA 4BO6A 1XELA 2Y68A 3A06A 1GR0A 2JL1A 2I5PO 3GRKA 4AJKA 4KDFA 3DAGA 2BFMA 3IAHA 3AJRA 2AQHA 3RASA 1YBVA 4M86A 1X0XA 1ZJZA 4RPGA 3WBFA 3P7MA 4XWYA 3P2YA 1UR5A 3HNPA 4R69A 1YQDA 3UVEA 1OMOA 1PZGA 2OGUA 5C37A 1M2WA 2CF5A 3K2EA 4BO0A 5G4KA 1DAPA 3C24A 4YCAA 3PLRA 3HQ4O 3WWZA 3E03A 4WUVA 3OIFA 4J0FA 1OOEA 4OM8A 5KIAA 4WE3A 1I30A 2EIHA 2BMAA 2WWRA 3FI9A 3DDNA 4XRRA 4KUHA 4BVAA 4E2WA 5C7LO 4GPD1 1NPTO 1TXGA 3K6JA 1ZUD1 4E6PA 1YXMA 4EUHA 2OFPA 1KVUA 2XPCA 1VJTA 3SVTA 1UP6A 2BFAA 1FDVA 4IIUA 3GDGA 4XGKA 5IXSA 4A7PA 4KZPA 4MKRA 3I23A 3O8QA 3AUUA 5GY7A 3FN4A 1Z82A 5CHEA 3LC7O 2DC1A 2ZCUA 3Q9NA 3B6ZA 3PWZA 4DMMA 3E5MA 1BXKA 4CLXA 2YY7A 4YJFB 4IQGA 4CV2A 2Q2QA 5K0ZA 4ALJA 4DVJA 1GV0A 2C0CA 3HDHA 1AE1A 1HE2A 2EKLA 3E9QA 3R0IA 3FF4A 2IZZA 3GF4A 1W8DA 3PRJA 4Y67A 3VDQA 5JW6A 2Q1TA 1Y8QA 3KUXA 4PFJA 3NJ4A 1C1DB 4O0LA 2GDZA 3EMKA 4RF4A 5COAA 1E5LA 1XDWA 3JQFC 1VJ1A 5U9CA 3L4BA 3CMCO 3OJLA 3TRIA 3TJRA 5JS6A 1D1SA 2QHXA 2WJPA 3G79A 1I01A 3OJOA 1DC3A 4BNZA 4WLNA 4Z3KA 1MV8A 4BO9A 2PZLA 3BTUA 2B4TO 2VYVD 1GCUA 3JQCA 3DMTC 4XJSA 3UKOA 3W6UA 2C2YA 1UJMA 1CDOA 2IEDA 1K89A 2AE2A 3OEWA 2ZB4A 4FD3A 4WASA 4G2NA 2ZJ0A 3WFJA 4AJNA 4Z9FA 1BSVA 4RF3A 2VWQA 3B1KA 4GLOA 4DWVA 1ZH8A 1A9YA 3GY0A 1EE2A 1DC4A 1PEDA 3X2EA 2C29D 5I7FA 4E30A 4PRLA 1G0OA 3MTJA 4E3ZA 4BKUA 1H0KA 2OHXA 2VOEA 4CMIA 3SEFA 1U3UA 2NTNA 1VSVA 1PIWA 4JNKA 4RZHA 4YAGA 3OIDA 4GMGA 5T67A 3AUTA 3SBOA 3PDJA 2Y93A 3JQGA 5F1KA 1ZCJA 4YVFA 1UDCA 1PR9A 4DIBA 2YZ7A 3PYMA 5T57A 4BNJA 3JD4A 3DAFA 4GI2A 4O5OA 2OOSA 3ZWMA 3VAZA 3Q11A 5C7OO 1O95A 1N5DA 3QIVA 4JROA 3JD0A 2V6GA 4YQYA 1ZXBA 2FHSA 5EN4A 2X5JO 1QYVA 3Q0EA 4DLAA 1IE3A 1SO8A 4CM9D 4YAEA 3DBHB 2POQX 4EZBA 4IDFA 3K5PA 1UXIA 1DJNA 3H7AA 4CV3A 4WCFB 4RVGA 3A9WA 3PK0A 4TVOA 2G1UA 3HB4X 1N1GA 3RFTA 1DFGA 3BMQB 4N54A 3TZ6A 3NRCA 3H65A 1JWAB 3DB2A 4FIZA 3ONDA 4J0EA 3T7EA 3SXPA 1Z73A 1I3NA 4PN3A 1ARZA 1EBFA 1HDRA 5JDCA 1YOVA 1TLTA 1DO8A 2OBNA 1GZ6A 4IM7A 4Q3NA 4RO0A 4Y6SA 5BNIA 1YB5A 1R16A 3HADA 2QW8A 1DFHA 1XG5A 4IJKA 1QYXA 2EGHA 4WGGA 3DR3A 4Y98A 2X8LA 5F21A 4D0RA 4XQGA 1QKIA 5DP1A 4J1TA 3H9JA 4AJPA 3LQFA 2WD7A 4RVFA 2X22A 4C4OA 1VE9A 3V1YA 3ICPA 4XYBA 3TNLA 1CETA 3WGTA 4MVJI 3ETDA 2YJZA 4CODB 5B4TA 2Y0CA 5HBRA 1O9BA 1MFPA 4ALLA 3PZBA 4RQTA 3HE3A 4NFHA 3C1TA 4WLEA 2FR0A 4IXTA 1FDSA 3VZQA 4WPGA 5A5EA 1VSUA 3T4EA 4Y8VA 4YTEA 1N92A 1KOLA 3PPIA 4NK4A 1B8UA 2H6EA 4BNGA 1FJHA 3FNHA 1VPDA 3NX4A 4Z9YA 4YT8A 1SEPA 2AEMA 2UDPA 3GDFA 5TLSA 4HADA 1DB3A 5KCZA 4CV1A 5ES3A 4BV8A 1A4UA 1J4AA 2P68A 3F5QA 4BNWA 3KYDB 3EY4A 1O8CA 4CLRB 4DTIA 3LU1A 5AYVA 3DZKA 3VZSA 4ND4A 3DZHA 1V35A 2ZB7A 4WK6A 4UULA 2HMVA 1DBVO 5A04A 4Z0HO 2D4AA 3W4KA 4Y6RA 3K96A 1ZO8A 3PQFA 2ZJ1A 3TFOA 3ASVA 2GERA 4PLHA 2GRAA 1VLLA 3LC1O 5ER9A 3DMYA 3FTNA 4FSHA 3OQ1A 3MZ0A 3KLMX 1HE5A 1P0FA 3WLFA 2YYYA 4FB5A 3BTVA 2A92A 4CQLA 5K6AA 1P45A 3L77A 1JKIA 2VRBA 3LT0A 3MJSA 1F17A 5THKA 1U5CA 4DYDA 4J1NA 1I2CA 2YQ4A 3NTOA 4PG5A 4WLVA 4BNUA 1G0NA 3FTPA 2NU9A 1L1FA 4W4TA 4CUKA 1MGOA 1E7WA 1I0ZA 2JAPA 3FBTA 4IJUA 2O4CA 1WZIA 1A5ZA 1X7HA 3PIDA 1J0XO 4PLGA 3VTFA 3VVCA 3H9EO 4HUJA 4WNIA 4DL9A 2Q45A 1X1EA 4CMHA 4EBFA 5G4KB 3L4BC 1MXFA 4YPOA 5L95A 3JQFA 1HTBA 3D3WB 3ON5A 4FPXA 3JQBA 2Q99A 4IINA 3OM9A 1LLCA 2NQ8A 3U4DA 3SLKA 5TNXA 2GNAA 3GPIA 4RVDA 1QLJA 1WXDA 1A7AA 1ZFNA 4DQVA 1SC6A 5TJ9A 4J7UA 2F00A 2W4QA 4UEOA 3IOYA 1BRMA 3JQAA 1XA0A 4KTVE 4FFLA 2GLXA 3I83A 4YRBA 1SPXA 4D0SA 3KYCA 3QHAA 1PJSA 4PLTA 2OUIA 4EGFA 1U8XX 1ORRA 3OA2A 3QY9A 1UZMA 3KSDO 1XQ1A 2HU2A 3KETA 2O3TA 4PG4A 4RORA 3WQRA 2Q4BA 2Y0EA 2X9NA 2VHXA 1S6YA 1A27A 1R0LA 1KY4A 3W8DA 2I99A 3CTMA 4GWKA 2NU8A 1T1RA 3GMSA 2X9GA 4FOSA 1NWHA 1TT7A 3Q2IA 3NV9A 4J43A 2JFGA 4C7KA 3RSHA 1ADCA 4L8VA 3ROMA 5HA5A 3W4JA 2JFHA 4RDIA 4I5GA 1QLHA 2SCUA 3A14A 3I9OA 4DPKA 1YBAA 2EG9A 2IZ1A 2AEFA 2J3IA 2NUAA 3UAGA 4D43A 4ZHSA 1XHLA 4KQWA 5COQA 1A7KA 4K6CA 1LSJA 3GRPA 1U1IA 3C7CB 4LK3A 2Y0DA 4CV0A 5CAEA 2Q1UA 3AM3A 3VPFA 2PH5A 2EKPA 3TZQA 5AVOA 4IUYA 4L4RA 4BNFA 1KIFA 3PHHA 2JJYA 3TPCA 3OJEA 3NT2A 4LGVA 3FR8A 1J49A 3KYBA 3ANNA 2GGSA 4BGEA 4URFA 1UXKA 3I52A 3LSYA 5JCXA 3H2ZA 4MPDA 2JKVA 4TRRA 3JYQA 1Z7EA 2X86A 2QZ9A 1T2AA 4MP8A 3WBBA 5JDIA 2ET6A 2RHCA 3DTYA 1Q0QA 3WWYA 1E6UA 4LN1A 1FMCA 1NQOA 1XLTA 4U6SA 4BNMA 4PLPA 3U4CA 4CM4B 2EWMA 3DZIA 4NMHA 4AVYA 3OFSA 1C1XA 4OKNA 4YRDA 2AA3A 3BMOA 1R0SA 1B8PA 4H7PA 1DC6A 4I9UA 5TSDA 3IUSA 4ZVVA 1K5HA 2ZIZA 1HRDA 1C0PA 3KM0A 3M6IA 5TS3A 3DAPA 3RJ5A 3MEQA 1P44A 4YAJA 5T6BA 1J6UA 2GPTA 3I6QA 2BH9A 3ENKA 4PIVA 4ZJUA 3OEYA 4NZ9A 1E77A 1T4DA 4JLWA 3VZRA 4E2ZA 3ZNQA 3OA0A 5TT1A 4CL3A 2FPIA 3NDJA 3L4SO 4HNGA 3A4VA 3BIOA 3NDIA 4B4OA 2VZ0A 3ORFA 2GF2A 3G49A 4GH5A 1E6EA 2VUSA 2J3HA 2NVUB 2P91A 1O94A 4NFYA 2OL4A 3DHYA 5JAZA 4DQUA 2BGMA 4MP3A 2DBQA 2R2GA 1G6KA 3DFUA 4CQLB 3HDJA 1I24A 4JN6B 4ESOA 2BLLA 3CKYA 4BGVA 3VTZA 1R12A 5B4VA 1ZEMA 4MVJP 3BMCB 2B4RO 1NVTA 3MTGA 5CEJA 4PLCA 1LJ8A 4D46A 1LDNA 1BVRA 2B4QA 2GR9A 1QV6A 2NSDA 3W8EA 4R5HA 1BXGB 2IXAA 2O23A 2OORA 3NT5A 5T64A 1GDHA 4TRMA 1J5PA 2AQKA 1ZJYA 5KTKA 1ZBQA 1DSSG 4GAEA 4ZA2A 3ZV5A 2UV8A 1PL7A 3C1OA 2JFFA 3GAZA 4YJDA 1ZK2A 4FJ1A 1AN9A 2G17A 2OZPA 4FFRA 4BNTA 4FJ0A 5CEEA 9LDBA 3AWDA 1YJ8A 1KS9A 2PD3A 3LK7A 1M6WA 1BTOA 3IL2A 1LDBA 3ADOA 4RQUA 5G0UA 3RUIA 5JDIC 3Q3CA 4GL4A 1Y8RA 2DBVO 4PZCA 1R0KA 2VZ8A 2X5KO 1DJQA 3ULKA 2VT3A 3LVFO 2PLAA 2IE0A 2J5RA 4GWGA 4M89A 4N18A 2J3JA 3INRA 1SB8A 2Y1EA 5G0SA 3MJ4A 1I3KA 5COBA 4ALKA 1ENZA 1MA0A 4E4YA 3KTDA 2AEJA 1WLYA 1YDEA 5G0WA 5JDCC 1PQWA 1YL6A 1AHHA 4FC7A 3TZHA 2JD1A 1UXJA 1SAYA 2OMEA 3NAQA 2PKQO 4H3VA 4U0KA 3GGOA 5IZCC 4JX8A 5JO9A 5JO0A 3HFGA 2C20A 1GU7A 2D3TA 1H6BA 3VHRA 2BELA 2P5YA 3GG9A 4RZIA 3QVTA 4CM9A 4JBIA 3IDSA 1U9JA 3RROA 1A71A 4R41A 3V8BA 1Y5RA 1KBZA 3Q2KA 4HXYA 2FSSA 3MOGA 3K9QO 4HFMA 3MJEA 4EITA 1U4SA 2HMWA 1T24A 4D45A 2CF6A 5CDTA 1TB4A 1B3BA 4J91A 4CQMB 1PJTA 5JYDA 4BNNA 3B1JA 1E5QA 3WSWA 4J2OA 1Y9EA 1CERA 4J6FA 3R6DA 1OC2A 4J49A 3GGGA 5JFOA 4NBTA 2UAGA 2ZTUA 4DC1A 1NVMB 1QORA 2JD2A 3IC5A 3WLEA 2DTEA 5TIIA 2FOIA 3GT0A 4IY1A 1YL7A 3QWBA 1HWYA 1PJLA 4IPTA 1QR6A 2EP5A 3KLPX 1HDCA 1NR7A 1Z7BA 4ND1A 4NHEA 2TMGA 1NTOA 3EVTA 3WQSB 5L40A 1GYQA 3M1LA 4PLVA 4YRAA 1UXGA 1KEPA 3FNFA 2Z95A 1GPDG 1HETA 4DUPA 2PGDA 1NQ5A 2VYVA 1DRWA 3CSDA 4GSLA 4XDZA 5A9SB 4IJVA 1CJCA 1XCBA 8LDHA 3TL3A 2HRZA 5G0VA 4IS2A 3KBOA 4YB8A 3ZWOA 5DCUA 4E13A 3L9XA 1KVRA 3L6DA 2WYVA 4BMNA 3SLGA 1GADO 3ZWPA 4TKLA 4A5OA 1BVUA 5I9NA 1U8FO 1GQYA 2NNLD 3RCBA 4YR9A 4GVXA 1E1MA 3KXDA 2ZATA 3PQDA 1YJQA 4PG8A 2BI7A 2CUKA 3MWEB 1VRWA 3BHIA 4M87A 3GZNB 1VM6A 3DZJA 3NGXA 4XCVA 1XKQA 5L9AA 1EUZA 3CUKA 1YQXA 1JN0A 2O50A 3NEPX 2EXXA 3DBRA 1X14A 3WOHA 2HQ1A 3SJ7A 2AQIA 5FI3A 1PJBA 3PVZA 1EK5A 1LTHR 1T25A 4YWJA 4AJJA 2E6UX 4BS9A 1WDMA 3AW9A 1A72A 4RL6A 1E92A 1XU9A 1NFRA 4J7CA 3MWDB 1WMAA 4F3YA 1ZK4A 4PG6A 3D7LA 5DBGA 2IYOA 4CMGA 2HJSA 2Y1CA 4LRTB 2VUTA 2H9IA 2IRWA 2E37A 1KVSA 1KVQA 2WDZA 2FP4A 1YRLA 4EJMA 3GAFA 2HSDA 4IDEA 4HFRA 4YJGB 3RIHA 4B4UA 1SNYA 5JPIA 4L75A 1DC5A 2ZB3A 1IZ9A 4I5EA 4GX0A 3OETA 1UZNA 1DHTA 2XF8A 2YV1A 5IG2A 2WEKA 4E5KA 1GV1A 5ENVA 4F6LA 3WTCA 5JSFA 1ENPA 2ZTMA 3PJDA 4E32A 3PWSA 1OAAA 3JSAA 5B12A 3JQ7B 1BGVA 1HDXA 1E3WA 1NPDA 1WZEA 3DBLB 3EHEA 3WYBA 1X7DA 1JA9A 2WTBA 3QV1A 1HF3A 1UXHA 4ND5A 2JD0A 3FRJA 2DTXA 3GVHA 4ZQBA 2HK8A 5FI5A 5JLAA 4QSMA 3M2TA 3S2FA 3U3XA 4XYGA 1ADFA 1NAIA 2W90A 1R15A 3UCFA 4JIGA 1ISGA 1EMDA 3ZV4A 3SX2A 1LC0A 1PR3A 1U4OA 1W4ZA 4FJ2A 1Y6JA 4IXWA 4OGWA 2E4AA 2YFHA 1NP3A 2G0TA 2AQ8A 4YACA 1W6UA 3AOEC 1YO6A 3IP1A 5ENDA 3GZNA 4OIMA 1X0VA 5AXCA 4LSMA 3PP8A 2PZJA 1X13A 1C1XB 2HK7A 3ZI0A 4G5HA 4IDDA 2WYUA 1ISHA 1C14A 4PG7A 2HO5A 1N9GB 2ZB8A 2HKIA 3AM4A 1I3LA 2O48X 3C85A 3MOIA 4Y9DA 2NADA 2QYSA 4MVJD 2Q49A 2ZYGA 3CIFA 3HJAA 3H3JA 4WKGA 2Y67A 3F5SA 3OQ6A 4A73A 4J1QA 4XYMA 1LLQA 4BKOA 3LT1A 2IZ0A 1EVJA 1ID1A 3JQ7A 4WJZA 3EUWA 3BMCA 4TQGA 1ONOA 3D64A 2LDXA 3BYZA 1TA4A 2YHUA 4RPLA 3KRTA 3EW7A 1E3EA 4OL9A 4WCFC 4WECA 1CEQA 3RUDA 2O3JA 3Q1LA 4INAA 4XX0A 3ZZNA 3GZ4A 3I3OA 4HFJA 4DREA 5AXAA 1IPFA 3ZU3A 4UUPA 1U2DA 3OQBA 5FWNA 3ADPA 2FR8A 3SC4A 1PQPA 4NDNE 2NV6A 1Y8QB 3WGZA 3DMTA 1LSOA 1ZK0A 2GZ1A 4MVJF 4JP3A 4RDHA 3WSVA 3KV3O 4GMFA 4L4SA 4GGPA 4NPCA 1SEVA 1Q7GA 1JWBB 1F8FA 3QRWA 3S2EA 2AHRA 3MCVA 2NQTA 2X23A 5GZ1A 1KETA 4I8XA 3FWNA 1DFIA 1RM0A 4IDCA 3O4RA 4AFNA 4P4GA 3D4OA 1T4BA 4EW6A 4RVSA 4FFPA 3ETEA 3RUEA 3IKTA 4L74A 2RAFA 3RU9A 3QA9A 4CUZA 4R9RA 3DEYX 3JQAD 3PHLA 1V0JA 1QRRA 2XAAA 3WGGA 4MKZA 4WLFA 4QT0A 3GPDG 3AI2A 1I2ZA 5EPOA 2OP1A 1VL6A 2X7HA 1LSUA 2GYYA 2WD8A 3RAJA 5KVCA 2B5WA 3DZBA 4R51A 4NH4A 2PH3A 1GFSA 1OFGA 2VNAA 1PZHA 1T2EA 5TRTA 4XJTA 3RBZA 5BSEA 1E7RA 1H6DA 1H93A 2AG8A 3F1LA 4FCCA 3TOZA 4II3A 1GAEO 1LC3A 1JKJA 1Q0HA 3GVXA 3ZDFA 1V3VA 4QEDA 5FFFA 1V6AA 3GUCA 2PGJA 3HZZA 5L7YA 4KWHA 4E5PA 1ISMA 3DFZA 4UUMA 2ZK7A 4EJ0A 1U3WA 3JYNA 4I9HA 4BO1A 1GEEA 1E7QA 1MB4A 3D4PA 3LT4A 3E1KA 1IYZA 1DRUA 2Y1FA 2RIRA 3LZ6A 2X9VA 3NUGA 4BKPA 5AQ1A 5I8WA 4M1QA 1PGPA 2NU6A 1QG6A 1F0YA 4YJHB 1PS8A 4G65A 3ZHYA 4EI2A 5JCJD 4MVJA 3OIGA 3I9JA 2DPHA 2QIOA 4X54A 1YKFA 3A1NA 1QP8A 3ZW8A 2GASA 2B0JA 4MIOA 1P0CA 3CZMA 2C5AA 3INTA 4PLYA 4YBZA 1XYGA 3AY6A 1EQUA 2Y1OA 4CLHA 5A9RA 1BW9A 3F46A 1F8GA 3E82A 1X1TA 3UFXA 5HS4A 2ZQYA 5BSGA 5I9MA 5KOIA 2WMDA 1EE9A 1ZSVA 4Q3AA 4CMJA 3RUCA 3WGOA 1HYHA 3ZNPA 5ITWA 3D0OA 1A9ZA 2D1YA 4L73A 4MKXA 2DKNA 5A9TA 4E12A 1KEUA 1OBFO 1D3AA 3K2BA 4RPKA 4YJHA 3JCZA 3EZLA 3ZHZA 2NM0A 1XR3A 3WX0A 2UUPA 3JQAB 1RM3A 2Q46A 3H9UA 4PLFA 4KMSA 1O0SA 4OQYA 4OAQA 4WNCA 3WNQA 4H16A 4N5NA 4U8GA 2FY8A 4BNIA 1GTMA 1LRKA 4J1SA 4LSWA 3KEQA 1HYGA 4NG5A 4U6QA 4E33A 5HRUA 4NBVA 7ADHA 4IDGA 4MO2A 3TWOA 3H2SA 1P1KA 4BO2A 3AU8A 1GUZA 4H15A 4XR4A 3R1IA 1BMDA 1U2GA 3U09A 3GNTA 1WW8A 1E3LA 2DT5A 5DOVA 1LRLA 4FFOA 4ZQGA 5F1PA 1JW9B 3Q6IA 1U7TA 1H6CA 1ZKMA 2W2KB 4GKBA 5KJFA 4FFMA 1B0AA 3SJUA 5I7SA 3JQ6A 4BHTA 3WDSA 1LEHA 2VHWA 1UAGA 5JMPA 1IL0A 1C3VA 3NT4A 4FC6A 5J23A 2DVMA 4KDEA 3WXBA 5F5NA 9LDTA 3ITKA 3PYLA 3ZWBA 1JDJA 5I8ZA 2R00A 2NU7A 1D8AA 1WMBA 2PTGA 2QRKA 1E3SA 1LA2A 3VH4A 2IYPA 3JQ9A 2HRBA 1UDAA 1HE3A 4NR0A 4QTZA 4W7HA 4TZKA 2GZ3A 3VH3A 3K30A 2NVWA 5B4UA 2O3SA 4CQMD 2W98A 3WFIA 3QVWA 1DIGA 4DYVA 2H1SA 5BNTA 4DRYA 3IJPA 2J5QA 4NIMA 1NR1A 5LDGA 1B7GO 4PLZA 3RUHA 1NASA 1ZIDA 1LXCA 3NKLA 4PZDA 2UYYA 5EESA 2P5UA 1GUFA 4ZQEA 5L7WA 1FXSA 4BNXA 2OP0A 4FDAA 3PEFA 1EFKA 3LLSA 3ZWNA 1TVEA 1R4MB 4FGWA 3VVBA 4BKQA 2YHIA 1SZJG 4PVDA 5A05A 4NU6A 4WEQA 3R3SA 2DQ4A 1E1NA 1WAMA 3LF1A 5GZ3A 4DA9A 2XOXA 2Q3EA 5AOVA 1C1DA 2ZTVA 4W6ZA 3JYPA 3H8VA 5B1YA 2AW5A 2QRLA 1NHWA 3DZFA 4CR6A 4YEDA 1AXEA 4L76A 1LSSA 2VT2A 4OHUA 4E5MA 1DPGA 1CYDA 4WCDA 4ZQFA 1NPYA 1NQAO 4IGEA 4R16A 2D59A 2Z1MA 1H6AA 1BXGA 2DFVA 4EUFA 1VL8A 4AJHA 2YFQA 4BQPA 1DXYA 2V6FA 2VRCD 4HBGA 4EUEA 3F47A 3N58A 4HP8A 4O6VA 3NGLA 2E49A 1R37A 2VYND 5T5QA 4YT5A 2C54A 3BHMA 4DPLA 4F6CA 4RPHA 3QW2A 1AHIA 4CMCA 4CM1A 5C3MA 4JJIA 5L4NA 5EQFA 1XWFA 3N7UA 1ZVMA 2AE1A 2P9GA 1GD1O 1M67A 1JVBA 1E1LA 1TT5A 3PLNA 4P4LA 1WVGA 4MDHA 3RFVA 3EAGA 5KWEA 1X15A 1I5RA 2D5CA 3JTMA 4QX6A 3EVNA 2PGLA 2J8ZA 1IB6A 1AXGA 4LCEA 2VN8A 1EUCA 2A35A 5ICMA 2HUNA 2QX7A 5A3VA 4KOAA 1NM5A 5A1TA 3E18A 2NTJA 4OOFA 3VPHA 3AY7A 3D3EA 1LUAA 4Q9NA 4CMEA 4QXMA 4GGOA 3GG2A 3OJ0A 4CM8A 3LF2A 3T7CA 1ISFA 1PSDA 3L6OO 4P38A 3WMWA 3IIEA 4QFCA 1Z6ZA 1PS0A 4BQRA 4ZRMA 4JCOA 1PZEA 3LLVA 1ZXLA 1B2LA 3IP3A 4OXYA 3UCXA 4OKIA 2PD6A 1TT5B 4CR8A 4TZTA 2Q50A 4TSKA 4XYLA 4B3IA 5H83A 2FPPA 3C7AA 1ISIA 4OO3A 1BHSA 3AI1A 1WNTA 2FN7A 3F1KA 2VRCA 3DXFA 1UP7A 4FGSA 3U0BA 4WEOA 1EDZA 2NWQA 1DRVA 3IMFA 3OBBA 2E82A 3S2GA 3PJEA 1DOHA 1BDBA 3QQPA 2C07A 4I08A 4YAIA 3ENNA 3P5SA 5HM8A 1YONA 3H6KA 4R01A 3P2OA 4YA6A 3WMXA 1PGJA 3I6IA 2D0IA 3GLQA 4BO5A 4UVIA 2YW9A 4GX1A 4HKTA 2OXIA 4XQCA 4CJXA 3PI7A 4J16A 1P1JA 1ZNQO 5JYEA 4BO4A 3KYCB 3O26A 4DQXA 2GN4A 4BNLA 3PIIA 5ADHA 3OECA 3ZH2A 2WM3A 4UUNA 5CDUA 1IOLA 1Y9AA 1RJWA 1N1EA 3H9GA 1HSOA 3FR7A 4D41A 1ZK1A 3FCOA 3WQQA 4ZN6A 3UUWA 4DPMA 3H3FA 1DLIA 3GUYA 5F3RA 3EK2A 2QG4A 4TROA 2B69A 1G1AA 2PR2A 4YJFA 5KKCA 5TT0A 3FHLA 4A27A 4BNKA 3TOXA 3H5AA 4BGIA 4CMAA 2IODA 2DBRA 2JAHA 1NBOA 1LBEA 2WSBA 1ULUA 5TQVA 3VZPA 4CLOA 2QYTA 1N7GA 2I76A 5LC1A 4BMSA 3GN2A 2X5OA 2CD9A 3DC2A 1ENOA 1JTVA 2HMUA 1IHXA 1M6HA 1ONPA 1ADBA 2YDXA 1LQTA 4MVJE 2Q2WA 3ZW9A 1X7GA 3G17A 2VQ3A 3WIDA 4HNHA 1HDOA 4BKRA 1H5QA 2EP7A 2I9PA 3GA0A 1K0UA 3AUSA 1YOVB 4K9DA 4D3DA 5BSHA 3C3XA 5DNAA 2J5KA 1GYPA 4JK3A 4RV9A 2VWHA 3STHA 4AJIA 4CM4A 2GN6A 2EEZA 3L07A 2HAEA 3AOGA 4W9NC 5EINA 4W9NA 5A06A 4R68A 5F5LA 2NVUA 5L3ZA 3INGA 5B37A 1M75A 2CVOA 4DLLA 5TGDA 1GPJA 2Z1NA 4J2HA 1LU9A 3GHHA 3RBVA 3V2HA 1PGNA 1LDYA 3RBXA 4CM6A 1RKXA 1HYEA 5DBIA 3ZCXA 1P77A 1CQIA 3L9WA 1SCUA 4A26A 2DU8A 2Q2VA 4YDRA 3DBHA 1XEAA 1I3MA 5FF9A 4NNJA 2X1HA 3IKVA 1RPNA 3F3SA 3T4XA 2X58A 4KP7A 5U4QA 1DAOA 3PHIA 1YGYA 3RKRA 4B7UA 4BGUA 3OF2A 4OXKA 3WGIA 3C1AA 3TQHA 2ZCVA 4XYEA 1F12A 2RCYA 2DFDA 3JQGB 2EJVA 4MJLA 4LRSB 1V3UA 2HLPA 4UVEA 2XXBA 4LCJA 5GZ6A 2W8ZA 1E7SA 3KB6A 4GKVA 2EF1A 5IAAA 4UUOA 3JQ9C 4PGFA 4KQXA 3RC7A 4DMLA 4FQ8A 5A02A 1IPEA 1LX6A 1NX6A 2J3KA 3HN2A 1CIVA 4OMUA 4D44A 3WR5A 4R1UA 5KJ6A 3DBLA 3UOGA 4L4XA 5ILOA 4KWIA 4NK5A 1HLDA 4LVCA 3JYOA 4CUJA 2CVQA 1HLPA 1PJ4A 1UZLA 2P4QA 5EQDA 4CM5A 1FDTA 1VKNA 4IS3A 6LDHA 4B8WA 3U49A 4OXNA 3DTTA 4JQCA 2AG5A 4CMKA 3WG9A 1ENYA 2CY0A 3ZWCA 3ZU5A 3DZGA 4NJOA 2VOJA 1ML3A 2FR1A 1KC3A 5T8KC 3B70A 1PJ2A 1JAYA 4BO7A 2C2XA 4IIVA 1SBYA 3V1UA 1SOWA 1EZ4A 4DLBA 4NBUA 1HSZA 5JXWA 1PL8A 3H4VA 5JAIA 4B7XA 2RHRA 4D3FA 4AG3A 1H2BA 4GBJA 3K8ZA 3D4NA 3FD8A 4IGFA 4MP6A 1R4NB 4O59O 1YB1A 4D79A 2F1KA 2JHFA 1KC1A 2A4KA 3L6EA 2Y1DA 3HG7A 5JAQA 3WGYA 4GSKA 3W6ZA 3E5RA 2WE8A 1T1SA 2VHYA 1P3DA 5JY1A 4TMFA 4UVGA 3HN7A 3O8QB 4CM3A 4J90A 1JVSA 5I9LA 5ITVA 4C7JA 1JQBA 1KEWA 3BMOB 1NAHA 4AJLA 4CMEC 3ICCA 5EIOA 3OMLA 4FFNA 4Z9XA 3HB5X 5EJ2A 4ALIA 2Q4EA 1RYEA 1GZ3A 2DTDA 4BNHA 3WYEA 2BGLA 4K6FA 1YL5A 3KZVA 3HUDA 4XIJA 3RC9A 1Y8RB 3PZRA 4RF2A 1CQJA 1XQ6A 3PDUA 3ZN2A 2VWPA 4XGNA 1IUKA 2A9FA 3D5TA 2RH8A 2GN9A 3KEOA 3ONFA 1H9AA 1LDMA 4YAKA 3I9LA 1VKOA 3LYLA 3PFFA 5L51A 2JCVA 2B37A 2R6JA 2IXBA 1C0IA 3VC7A 1EFLA 1IULA 3GFBA 3F4BA 3ZHBA 4L0QA 3I1JA 1Q1NA 3WGQA 3F4LA 1DEHA 1I8TA 4RCVA 4R1NA 1HL3A 1EK6A 4OSPA 1EUDA 3QWIA 5IN5A 4ND3A 3RQSA 2W2LA 3FPCA 1GUYA 4TRNA 3AUAA 3GK3A 3K92A 3OP4A 1P74A 2ZTLA 3E9NA 4QQRA 3DQPA 3ZWWA 1NVGA 4DIFA 5ILGA 2O7QA 4CM8B 4E0BA 4GQAA 5JBIA 3ZWVA 1E0DA 3FNGA 3UXYA 1Z74A 4B4VA 1DHRA 4L9RA 3S1LA 4AJ4A 1LI4A 1Z75A 4PLWA 5IJZA 1XSEA 2PWZA 5JE8A 5C7IO 3PJFA 5CP8A 3TFQA 4BL5A 1I33A 1YS4A 3E9MA 3BHJA 2ZQZA 3DOCA 4RVUA 3QWFA 3RC1A 1NHGA 4QUKA 4MVJH 4WOKA 2X0JA 4UAGA 3KHUA 4GVLA 3AU9A 3GQVA 4IMPA 5C5IA 3IUPA 1BXZA 5JAMA 5DOZA 3ZNOA 1ZEJA 3DBVO 3C7DB 1PZFA 1XGKA 4EEXA 2JCXA 1P33A 2DUWA 1PL6A 1WP4A 1Y81A 4Z0PA 4UREA 5DN9A 1ZSNA 3BTSA 1N2SA 2PY6A 4LVUA 3S8MA 3PHJA 4WLUA 1GY8A 1FF9A 2QQ5A 4XA8A 2CSUA 4BNVA 5GMOA 1E3IA 4ROSA 3WYCA 4NBRA 4YXFA 4XGIA 3FWZA 2I3AA 4QO7A 3GNQA 4E2XA 4GLLA 5CDGA 2CNBA 2AMFA 2AXQA 1AGNA 3FSRA 4CLOB 2R00C 4WCFA 4D7AA 3IQDB 4BO8A 2XXJA 1PGOA 1XIVA 3PHGA 4IDBA 1T26A 4BO3A 1EDOA 3ZNNA 5HS6A 1E7MA 3QVSA 4DBZA 1E3WB 3GEMA 5ER6A 2H5LA 3RFXA 3WTBA 5IDWA 2C7GA 1O89A 5IDXA 4ZU3A 3IJRA 1YBMA 2PK3A 3VOSA 1S7CA 2I67A 1P9LA 4QECA 5BR7A 2EERA 3L0DA 2VHVA 3U9LA 4BB6A 2X0RA 4I5DA 4A10A 1E7YA 1LNQA 2CDCA 1VL0A 4OYRA 4DXHA 7MDHA 3MJVA 4U0JA 4M54A 1P31A 1WDKA 4XIYA 1ZK3A 1E3JA 3GFGA 2YV2A 2C5EA 3DOOA 3U4HA 4QO8A 3DOJA 3GEGA 1Y7TA 1WWKA 1GEGA 4LMPA 4DIOA 4P4NA 3TF5A 5A3JA 3DHEA 2BD0A 2X0NA 4YT4A 4RF5A 5DCYA 3TN7A 1U3VA 1UH5A 1B8VA 1UAYA 1EQ2A 2PZKA 4R1TA 1F14A 3DHNA 3RUFA 4P22A 2I6TA 3DO5A 2JCYA 2EGGA 4IBOA 2PKQP 4GX5A 5H81A 4EJ6A 3WJ7A 2ZYAA 2G76A 1B26A 2HK9A 1YH3A 5DZSA 4PCVA 3O03A 3QLJA 2GO1A 3AK4A 2BFOA 4N7RA 5JC8A 4AJ2A 3VPXA 4ALNA 1MP0A 1EEHA 1SMKA 4ZRNA 3X2FA 1HT0A 3E48A 4IZIA 1CF2O 4NQZA 3PWKA 1PTJA 1EBUA 3RUAA 3QWHA 4LMRA 3QE3A 3RWBA 2GSDA 1GL3A 4Q39A 3D5QA 4A03A 1W0CA 2Y66A 3I9MA 3ZWYA 4BUCA 2HMSA 2VTDA 2J6IA 3B1FA 4R54A 5TX7A 2VTEA 5CDSA 3G3EA 3NDRA 1CWUA 4O63O 5KJ1A 4DGSA 3CPSA 1LQUA 1E1KA 3LDHA 1B14A 2B36A 2VHZA 5A5FA 4FR5A 1PWXA 2HMTA 4XKJA 1FK8A 1Q7BA 1PU2A 3GH3A 2NTVA 3GGPA 3HDYA 3ROQA 1DIAA 4F45A 3TZKA 2YUTA 5ICSA 1IZ0A 2Q1WA 2GCGA 5L53A 1RYDA 5KJEA 1ZSYA 1MUUA 1PS9A 4IMRA 5TF4A 2FSVA 2DUUA 4BIIA 4MOWA 3WIEA 4IDAA 4NFSA 2DPGA 4B3HA 4TVBA 4XEHA 3QWAA 4E5YA 3FNEA 1NQTA 2O7SA 4UEKA 2PFGA 3JQ8A 3VPGA 3VDRA 2EKQA 1LDEA 2CDBA 3CXRA 1TI7A 2EW8A 1OZAA 3GVCA 2CFCA 1DIRA 4CPDA 5CDYA 4DBVO 3COSA 1B3RA 4IQ8A 1QYCA 4ONEA 1SB9A 4S1VA 3WICA 2DBZA 1ADGA 1R4NA 3BMNB 3ZGYA 1L7DA 3I9KA 3KSUA 1O6ZA 3QSGA 3RJ9A 3UHAA 3RD5A 1OI7A 4B7CA 4R3WA 3U5TA 1H94A 2WYWA 5BT9A 2OBYA 3MJCA 1UDBA 1DIHA 1M66A 4CM7A 4ID9A 3EYWA 4J4BA 1QSGA 4J9VA 2FZWA 5IDYA 4XQEA 1HDYA 2EHDA 3OHSX 1IY8A 4A0SA 3SC6A 3UICA 3VKVA
chains in the Genus database with same CATH superfamily
2IEBA 2BT4A 1U8AA 4RVNA 2QTTA 1ZC4A 3DTVD 4XXHA 1DVRA 5DNDA 2WZDA 3G9UA 3OWOA 4E2YA 3T3OA 1IXRC 3HYLA 2C7BA 4FZVA 5L7TA 1DQRA 1VI6A 2XGSA 4RENA 2BKAA 5CVDA 4HPXB 3FVRA 4GXTA 5JRJA 3TG2A 1KYQA 4LXXA 4MINA 3H4TA 5EGSA 4UU7A 1VRVA 4PEVA 3BZUA 4OHWA 5DLQC 1BAPA 1G5TA 1EFTA 5TJHA 5KNLA 3OJFA 3D2LA 2BGNA 2FMFA 3NO4A 3HR8A 4RVHA 1F9AA 3BXGA 1R66A 3ONEA 4ZZ0A 4R9SA 4LJKA 5CAEB 2RGNC 3FCYA 1HEUA 4JJKA 3RRNA 3PA6A 4ZXFA 3ZU4A 2EBHX 4GR4A 4PS0A 4JYZA 4CEIA 1EFAA 2R1VA 3NJ8A 5JCJA 1VMAA 3AI7A 4ND2A 5EKSA 3DOHA 4FEGA 1NC1A 1L7EA 1FFHA 3TL2A 4G1FA 4N65A 1M6VA 3ENZA 2IZ7A 4IDPA 3SMVA 5ITZB 4LISA 1W76A 1DV1A 3W1VA 2EOAA 3B1ZA 1JIKA 4B85A 5LIPA 1ZD1A 4HNAA 1QRAA 2WJ4A 1HDGO 2J45A 3OHMA 3NKVA 5EZ5A 1O77A 1IDN1 1W59A 3GPLA 4JUAA 5D3MB 1P7YA 1ZWLA 2JJ2D 5THQA 2F3SA 2CKMA 1TTQB 3NTQA 3D6NB 1CZUA 5A4AA 3HVKA 2NXJA 1EVIA 1O9HA 5IKOA 5ES4B 4RZQA 1EFVB 3O94A 1YRQA 4EDHA 1WDLA 2VZ9A 2RH4A 4KE7A 3ENVA 4ZO4A 2QP3A 1XMIA 2X4GA 2YINC 3NPMA 5HWSA 4TLMB 4Z6KA 2YYAA 1EJ6A 4EG0A 1V5IA 5CFNA 1K68A 5DT9A 4AUMA 3AXSA 4G5XA 2G7ZA 3CLKA 4L7VA 3C6QA 4F7WA 4D8YA 4NI5A 1TU0A 4FE3A 1ZRMA 4FHEA 2G08A 3NW9A 1S3SA 3HVJA 2REXB 3QKSB 2NU7B 4JGBA 4EYEA 1KO8A 1SCQA 1GLVA 1NXQA 1TMOA 3F9RA 1NNUA 3R3YA 4J7XA 4WQMA 4F1WA 5B6JA 1RWBA 1Y8AA 1RS0A 5AW9A 1XV5A 2P9JA 3CT4A 2ZZKA 3ESAA 2H59A 1JQ5A 1D6JA 1E2QA 2JJ1A 2ZR7A 1VZ2A 3MGKA 3QVOA 3PHCA 2X1VA 4GYKA 3NEAA 3OIVA 2H5IA 4MIEA 3NIFB 2OVBA 5G2OA 4G01B 2BTEA 1Y1TA 2O2SA 2WC1A 1K6IA 4XSGA 4Y18A 3K1YA 2NW6A 5ILQA 4UDNA 5KVQA 1NN0A 3LI2A 1G9TA 3AFMA 4F4HA 4LGCA 2P9CA 1QGDA 1HTTA 4MS1B 3JAWB 1N7HA 3ZCVA 2IOHA 3A1DA 4HJRA 1K3TA 1RBMA 3IA7A 4Y9TA 5IYZF 1VLMA 3LLUA 4I5FA 4W9RA 3T3HA 1F8YA 4ED9A 1F3LA 1NR5A 3IAM6 2AMLA 1JIQA 2X4DA 1KDZA 4BYGA 2DLDA 2DOKA 3Q40A 1VCOA 4HWKA 2BC9A 3X1XA 3L7LA 3VO9A 1R4MA 1Y3DE 4UQPA 3F9IA 4E31A 4Z49A 2V65A 2Y99A 3H87A 1SIOA 3HYCA 3OZCA 3A9TA 4FYHA 4H77A 4PZ0A 2YC2C 4JJGA 3WIVA 1BDMA 1VI5A 3ZTTA 5K4HA 4TYWA 4HY3A 3K72B 5AI5A 3GUHA 7AT1A 4YQZA 3WWEA 4E1BA 3FRHA 3C8MA 3PFCA 1C3LA 1FY2A 1NP6A 1X70A 1ULBA 1EXMA 2I7VA 1NTRA 2PKRA 3NTRA 5IAJA 3GJ3A 4O2LA 3WS7A 1L5VA 1VI2A 4F6RA 3GMDA 1QQ7A 1RTKA 1GA1A 3HHPA 2PS0A 5HR5A 1NMEA 1IG3A 3HBAA 2BKXA 1ND6A 1SBZA 2PMDA 4BRZA 3KJGA 1P19A 1EXVA 5FR2A 4C43A 4CXMA 1OT3A 3EC7A 3JQ8B 2P2LA 3BFJA 1UPFA 5CCXA 1YWGO 4YRRA 4YASA 3Q9UA 2BAGA 4ZOCA 4J16C 2ECFA 5H16A 5DJ5A 3DMFA 1IQPA 2QJFA 1YB7A 1Y4SA 4N1AA 2CJPA 2HQBA 2YVAA 4UE3S 4RIEA 4RIFA 4YJGA 3MGGA 3AEUB 3H1EA 3UBTA 1M2FA 2XUQA 3E4CA 3K9BA 5AQEA 1QP7A 2CDAA 3BWCA 1GRQA 2H52A 3EA0A 3MTAA 4HWGA 2HH9A 1PR1A 3PEUA 4JC8A 3OKPA 3FWKA 3PNQA 3OU6A 4R6WA 4C88A 3STUA 2FPOA 2PZBA 2WMOB 4RHXA 1W581 3BE5A 1V8PA 2ETVA 3WB2A 1MAHA 3ROPA 3FPLA 3WL4A 5JLJA 5L4LA 3GMIA 3H2JA 5L45A 4RULA 1Z25A 4PGMA 1LX7A 4MYTA 3RR2A 1QQ5A 1SURA 3TNYA 2C5LA 4G41A 4PANA 3UC5A 5HSGA 5LWHA 3OE1A 4ZI7A 4HBZA 4Q4LA 3STYA 4X94A 5K0LA 3OICA 3VDMA 1ACMA 4AZ3B 5KKAA 3QMWA 1QS0B 4TMXA 4EJSC 5AJWA 4LXHA 2O4UX 1GL9B 3D3WA 2A7QA 4MIYA 4YT2A 3JAKB 3H2YA 3X43A 5I47A 1A82A 3NCHA 4EYKA 3FVWA 3DT6A 1QCDA 5DIFA 2I71A 3TQQA 5T4EA 4ZCRA 1X80B 3GZJA 4IW3B 1XDDA 3WNVA 4LNAA 1KI3A 3ZJ5A 1DUVG 3TJMA 4B3GA 3OPYB 2X4IA 1C7QA 5F77A 1V7QA 1EX7A 1VL5A 3D0QA 4HEJA 3U4GA 4E09A 3ZY4A 4BMVA 3GVIA 2HGSA 3EE6A 4Y0NA 3AR5A 3DWGA 3IR7A 4RKQA 4CQMA 4J4HA 4O4HB 4YUYA 3MJTA 1QCCA 2CC2A 2FQ1A 3W9BA 2IYNA 4DARA 4QTUB 4LHYA 4DCNA 2W48A 3AZQA 1H22A 1Y98A 1U3FA 2GD6A 2IYYA 4GPZA 4HDRA 5GQSA 1K2WA 3PGXA 2X0DA 4ZAYA 5K3OA 1E3DA 3UG6A 1P1IA 3AI3A 3WAJA 1C9EA 1NFFA 2REQB 5F1OA 3TSCA 1MO5A 2YCBA 3OP1A 1KJYA 4ARCA 1FL9A 3QP9A 5EE9A 3WMWA 5EIHA 2NQ2C 4CU5A 2QUBA 1TKCA 1XO1A 2HWUA 1EVKA 4FHZA 3LH5A 4JYCA 3HO1A 1WULS 3QKTA 1KI1A 1E96A 1SHLA 2AXPA 3P0JA 4MYCA 1T2CA 3IAUA 2ERXA 4CG3A 1FU7A 1U5BA 4F4IA 3K73O 4MS3A 4RNCA 3RFCA 1MNAA 4TLBA 5KO2A 2GZ2A 5T41A 4YALA 4LE0A 4KV7A 3LW8A 4YI3A 5LU9A 3CH5A 5DBEX 3HMKA 3KC2A 1FP7A 5A4DA 4NHOA 1QAOA 3FW1A 2LVBA 2W2LD 3VR2A 5IZCA 5JSHA 3IS3A 2PWYA 1NXOA 2HADA 1UAAA 3HABA 1DIBA 2IDJA 3G59A 4ZXPA 1WSWA 2F64A 4IIJB 2BKUA 9ATCA 1OE0A 1Z6AA 3K0EA 4L9WA 1QKKA 1HXHA 3R3JA 1E69A 4H6VA 2F4VB 3FJOA 3KR1A 1U3CA 2FEAA 1L3IA 3L8YA 1L4MA 4OJNA 5ALXA 5C5EA 2IY8A 2HXSA 3QNWA 4MB6A 3F3KA 1LLUA 2C7QA 3PS9A 1ZZEA 2WM8A 4NV3A 3TPZA 4OATA 3V46A 1V95A 2XF2A 3VYTB 2B8TA 4DR1B 3O3MB 4R7GA 3UMJA 3F5FA 4RE5A 3WGHA 5C8YA 2HPVA 2FYTA 1ONBA 4FMDF 1YQEA 4G4SO 2NUPB 3EF1A 3CZ4A 2DAPA 3I32A 5H82A 4R1SA 3PD7A 1YF3A 5HFJA 2E4ZA 4ND7A 1ZGAA 1GKIA 4QJBA 3RSLA 4DZZA 4Y6PA 1XU7A 5CFPA 4NBWA 1RM5A 3JQBC 3KVOA 3PSHA 1U8TA 1MXHA 1T8WA 3G0IA 4E5NA 3TRFA 2GJSA 1NRXA 2YS7A 3E7DA 2Q7OE 3D1JA 1WXFA 4BWGA 5KYVA 5AKHA 1GTZA 4NYJR 4PNEA 4WUTA 3DLCA 3LOUA 4OOEA 4PSAA 3SXUA 5K01A 1E58A 1EFPB 2BFDA 2BGJA 1VJ5A 2GBFA 3KCQA 3R7NA 4ZMBA 5KVSA 2IU0A 1Z2EA 4CDRA 2R87A 3B20A 1KO4A 1JG3A 1AKRA 1JJBA 1S5PA 1V9LA 4NKRA 2ZUFA 1AD2A 2P2SA 5B53A 3NYWA 3ZGZA 3EFOA 4YAWA 5U1PA 3LDAA 1WCV1 2VNKA 3B6JA 4ZPXA 2HJRA 3BF7A 1HZZA 3BZBA 5BSMA 1SVOA 4KN5A 1U2DC 4D8VA 3RV4A 1XBTA 1NBHA 1Z45A 1YBHA 3IE2A 4IICA 4RMJA 4KXYA 4Z4GA 1HG0A 3WZLA 1GVHA 4DANA 4MRPA 4AZWA 2IOYA 2XGGA 3DO8A 2IEZA 4ZVPA 2SNIE 1MVLA 2OESA 1QGUA 1KJZA 1NFQA 1UCFA 1BW9B 1O57A 2IHBA 4XRGA 1KPHA 3COVA 3OTGA 1OGYA 2Y1GA 4PPQA 3B9QA 4HGOA 3NVDA 4CI0B 1PSWA 3UPTA 1MHTA 3K9LA 2Q2OA 2G9VA 1E2UA 1UDWA 3CZRA 4XZ3A 1X3LA 2GZRA 1TIPA 4FOOA 3PC4A 1SQ6A 5BR8B 4J07A 4DA6A 5C1PA 1MORA 4WINA 3EF0A 3W2FA 4H17A 5FIUA 2AW3A 1PG2A 4YYZA 2GBCA 4DDUA 1LPSA 1XLUA 3M4JA 3DVSX 4ZOLB 2DM6A 4MVJG 4WIAA 2GF0A 2XCRB 5CB0A 3PBKA 2AR7A 2ODEA 1IRIA 2C82A 4A92A 1YQGA 5DULA 1CFJA 1D4FA 2NUAB 1ULTA 2HU8A 2VJDA 3QOXA 4BNYA 4PRKA 5H9WA 6ADHA 2GD1O 3VNBA 3RVJA 3BD6A 3VHQA 2J6CA 4BX8A 2ZLBA 3PE4A 3OCYA 4JI0B 3HJUA 1DDOA 2J9XB 2HDHA 3QXGA 5MDHA 4XDYA 3PQ7A 1H9BA 3GV0A 4BCCA 4YDQA 1V16B 3KO8A 2CNOA 1JAXA 4TTVA 1OXKB 2JAWA 1SK9A 4M8SA 1I7NA 1NSFA 1J00A 3NWPA 4D0LB 1UZUA 4DLKA 4N76A 3KYDA 5GIOE 1GPNA 3L8FA 3BIFA 2V0CA 4IEEA 3HI6A 4II2A 5EEHA 4YONB 4HV4A 3WISA 3EXG2 4Z4CA 2W2TA 3DCIA 3EUAA 3L1VA 1Q7CA 4JB8A 5FWXA 3UA3A 5FUXA 4OBEA 4LQDA 4CFZA 2WKPA 2QLMA 5BSWA 5IT9A 3D7NA 1ODSA 4S0ZA 2NLOA 4JI4B 2P4HX 4YMTA 4LZOA 3I9NA 5JXIA 4FYMA 1CDDA 3S7TA 1SCKA 1XELA 1P81A 3ZVRA 1A5AB 3GMTA 1Y3CE 4KDFA 3DAGA 4G5SA 4DLRA 5JAOA 5DV9A 5KWVA 2NT3A 3PNSA 2KBFA 1N5MA 4JYMA 3WBFA 4NE2A 2I6SA 4MWEA 4QJ4A 4BIMA 2EQAA 1GRVA 1O8BA 2H4JA 1MX1A 1Q1QA 1LPNA 1M2HA 2FDRA 2ZSDA 3HU3A 3NHBA 4MSUA 3T1VA 1QB8A 1YQDA 1JDUA 2V7QD 3UVEA 3AH8A 2I4IA 4KXXA 3EOAI 1KMHB 2VDVE 1WXGA 3PPWA 4V0RA 2JGNA 1O7JA 3CB2A 4MPTA 1Z3CA 2Q4TA 5SV2A 3NGMA 1ZGGA 3OIFA 3VSAA 2XR1A 4EFKA 2PUEA 4GE0A 3KCNA 1TZBA 1WV1A 2GTIA 3OPQA 4WE3A 2EIHA 1Q50A 3TNDA 1Y3HA 5HE8A 3VR4H 3ND8A 3FI9A 1BVYF 2ZXFA 4JQOA 1CEXA 1VMKA 1P4JA 3LZDA 2OD9A 1PEAA 1XMPA 5JS2A 4Z8XA 4HRXA 5JD6A 4KZKA 1JP7A 1TXGA 2GFIA 2HF9A 3ESBA 1Q74A 4JBYA 1ZRSA 2Q5QA 1KVUA 1XEWY 2OFPA 5LZ4A 3H2HA 1VJTA 4ZV7A 1N6HA 4KLAA 4YCMA 1UP6A 4P9NA 4AO6A 3CH4B 1RLIA 3GDGA 1PE0A 5IXSA 1FIUA 4A7PA 4EHAA 3CW8X 3A9RA 4PWZA 4WXMA 4FN5A 2JH8A 2J5XA 2ZTSA 5GY7A 5LP1A 2BLNA 3R8FA 6YASA 2HWWA 3LC7O 4QLAA 1UMCB 3OF5A 4ENVA 1TQDA 2DQKA 2CL0X 3B6ZA 2I1VB 3CJRA 3E5MA 4NWIA 3NHRA 2QJTA 3GJQA 5C81A 4X8LA 2GCNA 1IHOA 3KSMA 1FU4A 3M3DA 5LQDA 1M73E 1X9HA 4B31A 3PUIA 4ALJA 4MX8A 4EHDA 3PDIB 2ACKA 1OLXB 2VXCA 1W29A 4RY8A 5HFAA 1GG2A 3HDHA 4ZJZA 2IYAA 1BHJA 3C2QA 3E9QA 2IF0A 4CUJA 4DA9A 3WA7A 3PRJA 3KAJA 1R18A 2CFOA 3UWDA 4HGNA 1C1HA 3AB8A 1GRNA 2GDZA 3EMKA 2ZZMA 1E5LA 3AW8A 3JQFC 5C1DA 2E4XA 3NBAA 1UANA 3L4BA 5U9CA 1NW4A 3DYVA 3LBIA 3TJRA 2BGGA 2J07A 2NP6A 4I9GA 4MV9A 4LFCB 3NXSA 4V1CB 1I01A 1LW6E 4LZWA 1N6PA 2CK3A 4WLNA 4Z3KA 1MV8A 1W4CA 1M74A 2FPGB 1G8GA 1G5IA 1P72A 4ZO7A 4BO9A 3KVNA 5A5GA 2FJ0A 5IKPA 2VYVD 2YRWA 3BIJA 3UKOA 5LKRA 1IRXA 3MWYW 5E1MA 5IC5A 5CFMA 3I9FA 1JKJB 4TS3A 3OEWA 1K89A 1JMVA 4CIVA 1YDHA 2FR8C 4G2NA 1X7WA 2ZJ0A 1HORA 3N9IA 2JBAB 3QVVA 2KSQA 4N6OA 3TZEA 4AJNA 4C0XA 1BSVA 4JDPA 1A8PA 1ABBA 3CHYA 3K0AB 4JASB 4DWVA 5DIZA 1EE2A 2V9PA 4KNVA 2H9AA 1PEDA 3F6CA 2DULA 3X2EA 3PEEA 2E21A 4L4UA 5I7FA 1H1DA 5ALSA 1R00A 4BKUA 4JKOA 4G1UC 3T7IA 1YOBA 4CMIA 1U3UA 3CO0S 1K7YA 1Z0JA 4K9MA 4P3KA 2VF2A 2BSQA 1L8LA 1OVMA 3QTLA 3TSOA 3DP7A 4XIFA 3OIDA 4UHBA 5T67A 3SBOA 3I37X 2WG2A 1ZCJA 2R48A 2ZS7A 3ABOB 4YVFA 3TSWA 4V3CA 2YWCA 2AFRA 5T57A 2XYVA 1VG1A 2DBYA 4XWOA 1W47A 3DM5A 3ETHA 4GI2A 1O58A 2OOSA 1Y4UA 4PX3A 3QKRB 4JLKA 1KGSA 3QIVA 4EO9A 4AKIA 3RS8A 4YQYA 3PENA 5EN4A 3TW4A 5EJEA 1Q12A 1K7SN 1JLSA 1PW7A 4YAEA 4CM9D 2HSEA 3IVCA 1R8YA 1TLFA 2H3EA 4HDKA 1CS0A 3DHWC 2P6NA 3AUJB 2C0PA 2A33A 2PO7A 1FOEB 4ZDWA 4YHHB 4UE2A 1GTG1 4F11A 1K7FB 2G1UA 4NC9A 5K2MA 3BMQB 4HDNA 3QBTA 4DIMA 3RYCA 4BN4A 2G5TA 1XVLA 3NRCA 2X76A 4PW0A 2F7SA 1G66A 3T1NA 3TQOA 4NMLA 3ZD7A 4US1R 3AIIA 4TM8A 5ESDA 2YS6A 1I3NA 3SXPA 2QM3A 4XWTA 1S2DA 4JX9A 5TB5A 1DPFA 2EZ8A 4EPYA 3B6EA 1X7XA 4IM7A 5F3WB 5FL7A 2AMJA 1WBJB 1R50A 1SXJA 4C0SA 3HADA 1BGXT 2QW8A 3ZQJA 1DFHA 1TW2A 4IJKA 1JEYA 2CFSA 2OUKA 4RTOA 4C20A 3WLQA 1FSPA 3DR3A 1ZH4A 2V6IA 2X8LA 2X13A 4XQGA 1KYXA 3D2BA 4QNRA 4OK3A 1OLOA 2IW1A 3CX8A 2I22A 5AM2A 5BRAA 4C4OA 1R8JA 3HKBB 4LJAA 1I1NA 4P31A 4BV2A 4I50F 3ICPA 4CFYA 4CODB 3AHIA 3WGTA 4AS3A 5E0KB 1O9BA 1XQVA 2DQZA 1X8KA 2WG0A 1X92A 1I7DA 4FSDA 3MS7A 2AT1A 2H7YA 4YMIA 2RGGA 3D6AA 2WDPA 3VZQA 5A5EA 1IJFA 1GLGA 3QX8A 1N92A 2KPOA 4RY9A 3PPIA 4DLWA 4RUKA 2JLYA 3A1UA 4KXQA 3U9SA 1Y63A 2H6EA 3ZVMA 1KARA 1QU3A 1QNLA 4TXJA 1ZA1A 3GO4A 4RACA 5D84A 1SEPA 2ATCA 4HNTA 4QPDA 5BN4B 1USVA 1T8YA 1F8XA 3BE4A 3WZ2A 4WCVA 3LFUA 1DKMA 1LKZA 4B4KA 4BV8A 2OORC 4CV1A 4B74A 4ARAA 3L0SA 4BNWA 4CLRB 2MDTA 1HMPA 2ZUVA 4DTIA 5K2OA 1EHYA 5ALQA 2JGFA 3RTBA 3DZKA 3DZHA 4EG7A 1ECGA 4P7FA 3AEQA 5D3ZA 2F3QA 4WK6A 1DBVO 3UAOA 4GUDA 2Z8YM 3NUQA 3QF7A 4LOAA 1OYVA 4AIIA 1DTEA 1U2PA 4Y6RA 3BBLA 4YCJA 3OC6A 4BZXA 2Y0PA 2WAMA 1T2UA 4J29A 4A8JA 1A9PA 3T12A 1W5SA 3Q15C 4QHTA 3U7IA 1C30A 2RHTA 4YRJA 4BU0A 2QYHA 4B2LA 5KIAA 2HBZA 3NRBA 3QVKA 2ZVJA 4TN1A 3KLMX 4RY0A 3PDWA 1SD1A 3QFSA 4JNCA 4B87A 4BLVA 1GJRA 3KZKA 3R9KA 1XE3A 4LHXA 1AUQA 3BTVA 2A92A 4QPCA 2V7BA 3I01M 1P8AA 1H2RS 3IIIA 5LXTB 5IULC 4X97A 1PCXA 3L77A 3P45A 2Y71A 1Z28A 1QH9A 3F5DA 5EJMA 5THKA 1Y3FE 4RY2A 4CN9A 4RKYA 1JLLB 1U5CA 4LHEA 3VNAA 4B45A 3AXTA 4J1NA 4RFSB 4OQDA 2GTPA 3M7IA 4RU1A 1ZD4A 1U9ZA 1RKUA 4Z7QB 3PGA1 3FTPA 3O8CA 4KPYA 4W4TA 3RGWS 1E7WA 1Z0ZA 4RMHA 5HF9A 3A25A 5FBKA 3CVYA 1WZIA 2VP0A 4MS4B 3PIDA 1G5FA 1F4PA 4S35A 4DL9A 3GRYA 5E6RB 3B9PA 2ZJAA 3E22B 3E58A 3ZKWA 1ZGHA 4CMHA 4EBFA 5G4KB 2OFXA 3O91A 1NVKA 2HV8A 4JUFA 2ORVA 4LS3A 3QKRA 4AZ0A 3ON5A 4HDSA 3IP8A 2RI0A 3DPSA 1KE1A 3OM9A 3A6KA 1LLCA 5KTTA 4BAGA 1J06A 1ZN8A 4EPTA 4BV3A 1MRNA 1QLJA 3QVUA 3U7EB 1JAIA 3MM4A 3ZCSA 1DKRA 4YR7A 3K70D 3A05A 3UG7A 1W48A 4WBNA 2F00A 1WCWA 2W4QA 3L7NA 5GADl 1S9DA 3L93A 3DLTA 1XA0A 4REMA 3WYAA 3AHDA 3SOZA 1SPXA 1XZIA 2QSYA 3M6AA 1FNNA 4LBZA 1Y4AE 1MPXA 4FMPA 4ABTA 3IUQA 4B34A 2WHEA 1KAEA 4MLDA 1UZMA 1QTNA 4E6EA 3L02A 1XQ1A 3IAEA 3KETA 2O3TA 1MOPA 2XQVA 4I4TB 3W5UA 2YQZA 2RONA 2X19A 1MC1A 4Y6LA 2VHXA 4A8HA 3B89A 4I3GA 1R0LA 3CEJA 3L01A 1ATZA 1KY4A 1SK8A 4YP1A 3STVA 3W8DA 5D2CA 3CTMA 4YI5A 5BYBA 1G6Q1 3GLGA 1HPLA 3GMSA 2X9GA 2GJ9A 4MGHA 3C8UA 3NV9A 5HUQA 2ZU0C 3C4JA 3QE4A 1X87A 3RSHA 1H4TA 1PR6A 3OZFA 5ULLA 3W4JA 4DV6B 3GIDA 2P3OA 2BBTA 2GFHA 4I5GA 4KQ9A 3FOWA 2SCUA 4ETIA 3I9OA 1FFAA 2EG9A 2PXAA 3TLCA 4YJ3B 1U2RA 4FKBA 1ODKA 3UAGA 2IL1A 4D43A 4ZOAA 4KQWA 4BVKA 3DEZA 5KYXB 1A7KA 1S2LA 2E6KA 4K6CA 1U1IA 2HEIA 3C7CB 4OBWA 4AB1A 3C87A 2Q1UA 4Q15A 4C05A 4DEVA 4YRKA 2CHEA 1QP0A 3K8YA 2GBLC 2R5FA 3KQTA 1RMQA 1FTGA 3IODA 2E4UA 2EFYA 2XWBF 5JCOC 1T8TA 2GPSA 3MELA 1W4LA 4L4RA 4WV3A 1BE6A 2G28A 3BWXA 4FK8A 4PRZA 1KIFA 3VHXB 4F97A 3PA8A 5DX8A 1EFUA 4BFTA 1TKAA 1WUJS 3MGCA 4DCPA 2XTZA 3NT2A 2G25A 4RKRA 2ZBFA 4BMDA 1N3YA 5AJTA 2GGSA 3JR3A 1MJFA 2AOTA 1G7RA 2Q3BA 4HXFB 3WBJA 2W0MA 3UEOA 2K7FA 2TRSB 4PQGA 1OZFA 4TRRA 2Z57A 4LXIA 4TQUS 3FHTA 2X86A 1W85A 2QZ9A 4BQIA 1KQFA 3VC2A 1I7PA 4M1MA 2AB0A 4AY3A 4ZO6A 4K9OA 1NE7A 3C15C 2PVSA 2UZ1A 2RGBA 5F76A 1ETHA 2IT1A 3VC1A 4A91A 2FZVA 1WCXA 2O8FA 1JEOA 4LECA 1NQOA 3B6KA 1XLTA 3ML1A 3LYAA 3DZIA 4NMHA 4TOIA 1OZGA 3QE0A 4MQFA 4N01A 1O54A 2B8JA 5REQB 2VKTA 3GRUA 2HJ9A 2P2ZA 2BF4A 4WWHA 4H7PA 4I9UA 4ZVVA 1K5HA 2P79A 1YJXA 3KM0A 3KS9A 4D9CA 2ISQA 2FW0A 3BSWA 5TS3A 3R6WA 3A6LA 5LJIA 2R4UA 2AYZA 1IOWA 2JLQA 3MEQA 1P44A 1S2MA 4NZMA 4R1LA 1CY0A 5JHHB 5DB4A 4PC1A 4XUCA 3QF4A 4IOKA 1J7KA 4IYJA 5CNKA 4AZ3A 2QN7A 3PL1A 1NLZA 3DLBA 3DJYA 1P3Y1 3TX2A 1OLSB 2GJ8A 5DHPA 1TYBE 1Q44A 1YAHA 1W52X 3A4YA 4PPNA 3EBLA 3W3AA 2FPIA 1OVGA 1XD2B 4HWSA 4Y1RA 3LGAA 5F78A 3H7IA 4R9VA 1PHPA 2GNOA 3E8SA 3HGTA 4PNPA 3P2EA 2P5SA 3BCSA 4REQA 3UQYS 3QKWA 4JGIA 4CG2A 3LQ1A 3ORFA 4JLPA 2JZCA 2J9ZB 2FRDC 2WMNB 3ILHA 3QY0A 4C5CA 3UANA 1DRKA 2B4KA 3QMMA 3RK1A 1RRMA 1ZINA 2O1EA 2H2WA 2PL5A 3QI2A 4PYKA 4ZYLA 5JAUA 4AKHA 5DWQA 2OPBA 2DBQA 2R2GA 1G6KA 1JUDA 1P0MA 3DFUA 1HFEL 4JN6B 3GJZA 3DLIA 3FMPB 4EW1A 5HZMA 2DQSA 3DXZA 1WXIA 3CKYA 3HUTA 3TG8A 1M2EA 2ZJFA 4F2HA 1NVTA 5CEJA 1OXBB 1B0PA 4PLCA 3WIOA 3EPJA 4G8BA 4D46A 1ZCZA 1MJHA 2GR9A 2JIDA 1C3OB 1QV6A 2NSDA 2VH5R 4R5HA 3HXLA 1BXGB 5IP5A 5T64A 1HY3A 1LFDB 4R05A 2Y8EA 3ZIAA 4EO7A 1ZBQA 3DDHA 4ZA2A 4D3YA 4LWQA 5BN1A 3T3NA 1K63A 3NWOA 2VJAA 4JR2A 4URXR 4N5HX 4AZVA 1QOPB 5ETJA 4Y2JA 3JZAA 2FPWA 4EI9A 1TW3A 3OOHA 5IVPA 4FGJA 4TT3A 1X7YA 4Q7LA 4P3YA 1KS9A 4AZSA 3KXIA 1TAGA 3SYNA 5BWOA 4I6JA 1LDBA 3ADOA 4RQUA 1OX4A 5BNZA 2J9YB 3R77A 3DWEX 1TOAA 3Q3CA 1Y8RA 3CNLA 3NUZA 4Q12A 1CUDA 4J1TC 3ULKA 3UOWA 4EVQA 2Q3JA 4DV0B 4R6XA 1DS6A 4WKNA 3NS7A 1HT3A 3W1WA 4MHTA 1PVVA 1T6NA 1IHUA 1U2SA 2HEGA 1XUOA 2QGNA 4FW9A 5IJAA 1Z0FA 4YH1A 2X8AA 5BOSA 4KO8A 4Z9AA 5C8VA 1QX4A 2XYHA 5JMPA 4RADA 4YP6A 1H5UA 4FC7A 1MA3A 1SAYA 2OMEA 2PRSA 4V0LA 4OJKA 5SYMA 5CXXA 4DF3A 4H3VA 4RL4A 2I8LA 1J8VA 2XIJA 4HXEB 5NLLA 3HFGA 1NW7A 4B3CA 1M2OB 3ASZA 2C98A 1PBTA 2BELA 1RLMA 3GG9A 5AJYA 3THRA 4RZIA 2GEVA 2YWXA 2Q5CA 2JLRA 3QVTA 2YBEA 1X8LA 4JBIA 5THXA 4ZVRA 3RROA 1A71A 3V8BA 2B20A 1Q95A 2HJWA 1JG7A 2HSJA 3Q2KA 1ITZA 2G6TA 5DCLA 2FSSA 2I1QA 2Q8PA 2ILVA 2FEMA 3MOGA 5JNTA 1ZI6A 3MJEA 4HFMA 1IUNA 3EGXB 2L0XA 2W71A 1CY2A 4GE3A 1PV2A 2CXOA 3SJBA 1T24A 1TVMA 1N2XA 1HUQA 2QROA 2W2PA 1DIOB 2PX5A 1DINA 1HMYA 4GXQA 4J91A 1EIZA 3OFNA 5LB4A 1XPUA 4KREA 4PU0A 4BNNA 1WUHS 3NTXA 3HZRA 3JALA 3INYA 3EGDA 1BJKA 3ZGNA 1OH8A 3LY7A 3EQ7A 1ATIA 4GNRA 4X64B 3PFIA 1AKQA 1CNFA 4G0YA 5LA6A 4MIKA 5K3EA 3KR2A 4PYMA 3HPRA 3R6DA 1OC2A 3FVTA 4BNDA 1RZVA 5B64A 5JFOA 3OZAA 1RQLA 1UIMA 1J21A 1JG2A 3DYIA 4TV9A 1T2NA 2OAQ1 2Q5IA 4AY6A 3AZPA 1IXSB 4QYTA 3EUFA 2AFVA 3IHTA 3W7BA 1U8ZA 2BMVA 4X9XA 2SKDA 3H75A 3IC5A 2PVCA 2DTEA 1UMBA 1N2OA 1M6EX 2WABA 5DNUA 4KPFC 3AZOA 4IY1A 3ERCA 3QWBA 3CLUC 1HWYA 3KJIA 5GONB 5JU6A 5K4AA 4O4IF 1S8OA 3WAKA 4OP3A 2EP5A 1CE8B 4K6OA 4HDQB 2IZOA 1T15A 1JX6A 3IV9A 3KJZA 2G70A 2QKYA 4ND1A 3RYCB 2GT1A 4O2AA 4LE2A 1Y48E 4PLVA 1G8AA 2BBSA 1UXGA 2WM2A 5FEUA 1E0AA 4L27A 1FNSA 3T94A 3KKEA 4DUPA 3G88A 4EABA 1GLNA 1DRWA 2GLTA 3CSDA 3KHSA 4GSLA 3PIRA 4B2YA 4CTKA 5I3CA 1CJCA 4G84A 1B6RA 1D07A 8LDHA 4UQLA 3O8OA 4G0XA 8GPBA 3JARB 2HRZA 5G0VA 5LJLA 3Q8LA 1M33A 2OCBA 3LECA 4IS2A 1UJ4A 3DNMA 3KBOA 4YMUA 4CEHA 3LY5A 4R40A 3MYRA 3F74A 1M2NA 5B3LA 3A37A 4LK2A 3BFVA 2N75A 4A9AA 5K03A 4A5OA 1GADO 2AC4A 4TKLA 1JHVA 1SKAA 2JZNA 3UT5B 5J4HA 3CRRA 5I9NA 1HT2E 1U8FO 3DGFC 4NU8X 1T5IA 4O4HA 2D00A 4REOA 4OXXA 4OJTA 3GJ6A 5I4KA 2WTAA 4J2TA 2ZATA 3PQDA 1V4NA 2OFWA 2PXCA 2TS1A 4DJFC 3CLSD 2CUKA 2W6JA 3MWEB 1LBHA 1QPBA 2EX4A 2H1IA 1VM6A 2JGRA 3NGXA 3TIVA 5KU7A 2PMWB 5FJJA 5L9AA 1YJAA 1EUZA 1Y1RA 4IIFA 1KYWA 4TXHA 3RSGA 3SYKA 4CKBB 2WFMA 3MUOA 3NEPX 3KPWA 2EXXA 2IIQA 2G71A 1DWUA 3P0FA 3RS0A 1TYAE 4ZT7A 4AQ7A 1XCPA 5ALLA 3ODGA 2KX7A 5J59A 1PJBA 4OI2A 1Q1AA 2PUGA 3AMVA 7MHTA 1LTHR 3HYTA 5DGHA 5FJIA 1D2EA 4YWJA 1VJCA 2O8CA 3JZIA 3IDQA 2BFWA 4P32A 5E1OA 1IB0A 5AW6A 4DJDC 1Z47A 1NFRA 3C6ZA 4QGHA 4BECA 3IEVA 3QU4A 4QYWA 4J7CA 4ZCSA 3NH9A 2XMPA 4GHWA 4YNBA 3SZUA 3VQTA 4BRSA 4F3YA 1ZK4A 5DBGA 1IOVA 2D7JA 1KQOA 2IYOA 3HJRA 4PZLA 3WWPA 4DNPA 2NGRA 1G60A 1WPGA 2Y1CA 1E4EB 2BEJA 4IWXA 2WHPA 2IRWA 3KZ1E 2NZYA 1KVSA 2FP4A 4QHSA 1WD5A 3DOUA 3INNA 3OFND 3RRFA 3CZQA 3IEXA 4DEXA 2Z9DA 4IDEA 4HFRA 2COKA 2G1JA 1NN1A 4JGGA 4MW4A 3RIHA 1SNYA 2F55A 1Z9BA 2ZUSA 2H1WA 3GT7A 1DC5A 4EI7A 4ZAZA 1IZ9A 4GX0A 1UZNA 2NXNA 1DHTA 2XF8A 2IHJA 4ACAA 1IY0A 5LP6F 1KMIY 1L4LA 3R7WB 5IG2A 1XDGA 3OZDA 5LP6C 5F2NA 2D54A 4EEKA 1M1XB 1VB5A 3JSAA 3CUEF 3GJ5A 5JCZA 1KZGB 2FG6C 3K8QA 3M82A 3UHFA 3OOEA 3DBLB 3WYBA 4ER7A 5JMOA 2GHIA 2WTBA 1VPVA 1NMQA 2WHRA 3IULA 3IP6A 3O47A 1HF3A 3L6CA 1UXHA 2IP4A 5HF5A 4ND5A 2C1XA 2DHDA 3FRJA 3PF9A 4ND6A 1TFRA 5CB4F 4M4SA 2HK8A 5FI5A 4QSMA 3VKFA 3UWOA 4WZ6A 1UEJA 1A95A 2JBAA 4XYGA 3KR9A 1NAIA 4XARA 5HDBB 4BX2A 1DQSA 3V9AA 4DS3A 3G5MA 4P3OA 1NJ2A 1QIMA 1OZ0A 3RTEA 1EMDA 5EIEA 4QTTB 5EA2A 1A8IA 1PR3A 1XNGA 4H7EA 3W5AA 1W4ZA 5DTIA 1BH2A 4WBSA 3VO1A 1Y6JA 2VJQA 3UHOA 1TCAA 3IDOA 5DM2A 3FGOA 3N8HA 3NRJA 1W6UA 3QUAA 3QGMA 3F9CA 3MJFA 3URMA 1N2CA 1A7UA 2JIRA 3B85A 2YZNA 3BGDA 3IP1A 3GZNA 4ZJYA 1KRWA 1X0VA 3RAEC 1ESNA 2H0AA 3CLTD 1VIAA 4MWGA 5K3CA 2PZJA 1D03A 1C1XB 3ESXA 3KIPA 3ZI0A 5AVWA 3E7WA 3FMIA 2ZE5A 3RSZA 1C14A 4HEHA 1K4MA 1RI2A 2GN0A 4PG7A 5DTQA 3AFGA 3FGZA 1N9GB 3AM4A 2HKIA 2CWDA 2O48X 3MOIA 3UJBA 3KUKA 3NHSA 5KPJA 3H3JA 3QOFA 5TV2A 4LRYA 5LXTF 4YECA 5AUNB 1UFKA 2VP9A 1WHTB 4J1QA 4Q3OA 4R1MA 3PFGA 3LT1A 4V0SA 5H8WA 3ABRB 2JAOA 1KE2A 3ENQA 4YIHA 2PYIA 3IERA 2ES4A 1F6WA 4H9GA 1ONOA 4Q7KA 1PJ8A 2CNNA 3BE8A 4OHPA 4S0XA 4N39A 4UM9D 2RFLA 1J0AA 1E3EA 3LO5A 1K2VN 1BVHA 4Q1BA 4R71A 4MDYA 1RVV1 3PUXA 4L5AA 5FHRA 3UA4A 3Q7QA 1F38A 5AKXA 3HKCA 3RJZA 2O3JA 3RUDA 3UXMA 1O6BA 4XX0A 3WB0A 2A1UB 1JRLA 4U5XA 3ZJUA 1IPFA 4HMPA 4AS1A 3HVRA 4HZUA 2IOFA 3EZGA 3MMXA 4Q93A 4NATA 3Q7EA 4M76B 1XRNA 2FR8A 4RS3A 4GLBA 4NDNE 2M98A 5C4IA 3YASA 1G8FA 2CBZA 3E9EA 4F71A 4ZK6A 2GZ1A 4BGDA 3UKJA 5F9HA 1NRJB 4MVJF 4EOGA 1WUKS 4JP3A 4KAXA 3HUEA 3D8UA 1NI3A 3LDUA 3I42A 1G4UR 2HCBA 4LQ4A 3T3PB 2VP6A 3V8VA 3IEMA 4O4LA 3S2EA 4FT4A 2AHRA 4RMNA 5GZ1A 1TIKA 4BFZA 1L5OA 3ZE9A 3BM5A 4C3UA 1NBMA 1JHXA 4MS4A 3M49A 1Y9ZA 4UCQA 5CYFA 4P4GA 1G2IA 4RVSA 1IUOA 2F1OA 3ETEA 4O0MA 3IKTA 1XX6A 2ZVPX 4FGUA 4U7TB 4JI7B 3CLTC 3RU9A 4MVCA 5E3JA 4WNAA 4Z5XA 2IY9A 4QOEA 3LA8A 3I0MA 4LQCA 1YJCA 5CURA 1I2ZA 3AL2A 4AMGA 4BAUA 1YVDA 2WKQA 1KKLA 3FZQA 3MRSA 4LYYA 5IC6A 1XHFA 3RAJA 4P86A 4UMVA 4NH4A 2PH3A 1E64A 1M2VB 1PZHA 4G0VA 1DUSA 1R5BA 1G7CA 3DZDA 4IG4A 3RBZA 1RDFA 4A2PA 5BY2A 4PBRA 2ZG6A 3EXG1 3FNBA 3I64A 5KC8A 1H6DA 3F1LA 4G36A 3TOZA 2H4ZA 5JEEA 1X7WB 4ISCA 1JZTA 2VBIA 5E9JA 1LC3A 2A9KA 2ZSBA 4UHFA 3J81A 2HR1A 4H35A 4NS4A 3BORA 1Q16A 3KEFA 3ESZA 3PEVA 3T4UA 2Q3DA 4O2BF 1GPH1 1G41A 1PNQA 1V6AA 3O74A 2PGJA 2ZSUA 4G5QA 5I9SA 3PTAA 3ZDAA 2HA7A 2I34A 2PCJA 2VQSA 2D74A 3HXPA 4IVNA 5K0SA 3M6WA 1P8JA 2RC5A 2XZOA 3N6VA 4K03A 2EATA 1XRRA 2ZK7A 3K8OE 3JYNA 1GEEA 3RAGA 4DVGA 4LRQA 3LT4A 4YMSA 2FW7A 3Q87B 2RIRA 5TMDA 1AMUA 2XYPA 3DEKA 3G2HA 3LZ6A 3NUGA 5I8WA 4M1QA 4YGXB 4HT3B 2NU6A 1TF5A 2FA9A 1XRMA 1F0YA 4PHHA 1PS8A 4G65A 3ZHYA 4DCJA 5EWLB 2YFKA 1RFLA 1S8AA 2Z30A 3GFOA 4KPGA 2HT1A 2XRFA 1S1CA 4BZZA 2NO1A 2XB4A 2FE4A 1UT5A 4L8YA 2VH1A 1QP8A 3ETJA