4ND5A

Crystal structure of the lactate dehydrogenase from cryptosporidium parvum
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
302
Chain Sequence
MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVIITALLFGNARILDSVAEGVKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPATSSVSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGVKGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of Cryptosporidium parvum Lactate dehydrogenase.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Oxidoreductase
molecule keywords Lactate dehydrogenase, adjacent gene encodes predicted malat
total genus 105
structure length 302
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nd5A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4nd5A02
1LDYA 3WJ7A 5EESA 5KVSA 3QVWA 3C7CB 5CHEA 1HTBA 4L4XA 3TL2A 3GMSA 4PGFA 1JAYA 5I8ZA 4B7UA 1ZUD1 4URFA 1P3DA 1GV0A 4TZKA 2NUAA 2I66A 2EF1A 4Q3AA 4OKIA 2Q4EA 3ULKA 3UCEA 2OUIA 3HG7A 1A9YA 2ZTVA 2GO1A 4FFMA 1RM4A 3IIEA 1ZJZA 2JKVA 4IDAA 3PJEA 3ETGA 1U3VA 1DIGA 2BI7A 3DL2A 2P5YA 3RFXA 4M86A 5IZCA 3OJFA 3S2IA 1IPFA 2W8ZA 3BMNA 3UXYA 4W4TA 4F45A 3VPSA 4R9RA 1ZH8A 4E5MA 3TOXA 4PG8A 4D46A 3OM9A 4TSKA 4DQUA 4YQZA 3IUSA 4I9UA 2Q50A 1XWFA 1LSJA 2HU2A 1FMCA 5TNXA 4N5MA 4R51A 4WCFA 1V35A 1WLYA 3MOIA 4GI2A 4I9HA 3B1KA 2TMGA 3VH3A 1VLLA 4CJXA 3AU9A 2HRZA 4NDNE 1HDXA 4E2ZA 1WP4A 1ULUA 2D59A 4OXKA 1PZHA 1HDYA 1GUYA 3NUGA 1B3BA 3WB9A 2C2YA 4HKTA 2A35A 2CD9A 2BLLA 3AOEA 1B7GO 1YO6A 1VSUA 3UKOA 3PPIA 3INTA 4F6LA 1LI4A 3BTUA 4CM1A 2R00C 3JQGA 1H94A 3WOHA 4GBJA 3DOJA 3B20A 1Y8RB 3DAPA 1XLTA 1GQYA 1Q2XA 2PZLA 4IS2A 4CMIA 2WE7A 1UP4A 3I9KA 4MVJM 5CAEA 1G1AA 4JP3A 1TEHA 4XB1A 4OQZA 1UDAA 3MJSA 4DIBA 1W0CA 5FF9A 4QEDA 1EEHA 2DPGA 3AY3A 5FYDA 1GQQA 4WLFA 3R3SA 4ZQBA 1MFPA 1ZXLA 2EWMA 2Q3EA 4OXYA 4FGWA 2P91A 4HFRA 3H3JA 1R0KA 1LDNA 3CKYA 1I0ZA 2Q2VA 4HWKA 1E1LA 3WGZA 4HNHA 1GYPA 1F8FA 3HFSA 3DAGA 3PTZA 3KETA 2H1SA 4CUZA 1P45A 3W1VA 4L8VA 1HDOA 2P4HX 5AVOA 4TRNA 3M2TA 3C85A 1BRMA 2E82A 3PYXA 2C54A 2VHZA 1Y9AA 1WDMA 1NQAO 2IZ0A 5G4KA 3FNEA 2Y93A 4PLPA 5A9TA 2HRBA 3GZNA 3E6AA 2OHXA 2O48X 3JQ9C 5L7YA 3E1KA 3HSKA 3DAFA 4N5NA 3DFZA 3K31A 1O5IA 3AI1A 1LDEA 4U8GA 1PJTA 1ULSA 4RJTA 3RBVA 2CNBA 3TZQA 3DOOA 4RPJA 4DREA 2Z1NA 2FRDA 1NFRA 3WG9A 3KO8A 4DA9A 4BKOA 4AJ1A 1ZIDA 3BAZA 4BKPA 2FZWA 5A06A 4BO6A 3PHHA 4ND4A 2YQ4A 1DC6A 1U5AA 2PFGA 1Q7CA 4MVJH 2J3JA 4R3NA 4BQPA 2PY6A 2HO5A 2BGMA 3Q9NA 4UVHA 1JQBA 4DBVO 1M75A 2X5KO 4CLHA 1E7MA 1YH3A 2CDBA 4P38A 2PZKA 3JYPA 4KP7A 2FPGA 2A94A 4K9DA 3LU1A 2IZZA 3AM3A 2QRJA 4YBZA 1DJQA 3KLPX 4YR9A 1UXKA 4I08A 3EHEA 4WCDA 2NTVA 3WSWA 1E6EA 2I5PO 4BO7A 2J5RA 5JCJA 3C8MA 1MC4A 3NV9A 3H9JA 4INAA 4AJ4A 4JIGA 3W8FA 3PGXA 1FDWA 3GGPA 3VTFA 3W8EA 2WM3A 4K1LA 4ZQFA 1MGOA 1PWZA 5L45A 5T67A 1XQ6A 3HE3A 1PGPA 3OA0A 5IN4A 2ZQZA 3KEOA 4BKRA 2C7GA 3FRJA 5TS3A 3UW3A 4LVUA 4RCVA 3EVTA 4BGEA 4EI2A 3ON5A 4ZU3A 1VJ0A 3FTNA 3N74A 5H82A 3ZNOA 2PH5A 3I9NA 3N7UA 1GTMA 4CMKA 3RUDA 3PZBA 5EQFA 4KQWA 1PS9A 2V7PA 1U5CA 3OJOA 5G4LA 2WTBA 3P2OA 3OFSA 4BO1A 1ISHA 1G0NA 1H9AA 4JJFA 1BG6A 4IBOA 4RVGA 4IJVA 4O59O 4KUHA 5A9RA 1XIVA 3SJ7A 3UUWA 1PU2A 5K0ZA 4XR9A 2VYVA 2Q4BA 4XIYA 1KY5A 2CDAA 5FI3A 2LDBA 1DPGA 2PKQP 2Y1DA 1C0PA 1DJNA 3F5SA 5HBRA 4CV3A 3H3FA 2Y0CA 1MXHA 4I8XA 2E48A 1SZJG 1U4SA 1WAMA 4CLOB 3G79A 2YW9A 1ONPA 1YE3A 2UAGA 3AY7A 4XB2A 4AJKA 3Q1LA 2JHFA 4RF2A 4CMHA 4PG4A 3ICPA 5C5IA 4E30A 1M6WA 2ZYDA 5JMPA 2LDXA 4K28A 3OECA 5CDUA 3WTCA 4YAIA 2FMUA 4YVFA 4OM8A 1JA9A 1J4AA 1T2AA 3LC1O 1PJCA 1A72A 1V0JA 2RCYA 2PD4A 4DXHA 4R01A 1HDCA 1VSVA 2PTGA 3DMTA 5COAA 3PYMA 2GCGA 2YV1A 1SAYA 4IMPA 4FC6A 2G0TA 1R0LA 2DLDA 1RPNA 3DHNA 4YA6A 1MV8A 1QRRA 3JYQA 4Q3BA 1T1SA 4CMEC 1UDCA 4BNJA 1ENYA 3H65A 2HJRA 2I65A 3JQ8A 5ENVA 2Y68A 4CPDA 4MVJE 4M8SA 3PFFA 3K6JA 3AUUA 3TJRA 1RKXA 3GLQA 3KLMX 4DLLA 3Q3CA 4I1IA 3C7AA 1E3WA 2X1HA 2ZCVA 3F1KA 1Z82A 3EYWA 4RF5A 5AXBA 4RL6A 4EUHA 3K96A 4CMGA 4Z9XA 3ZWOA 3ITKA 1B0AA 3AUTA 1AHIA 2J6IA 1PL6A 3QRWA 4WECA 4EZBA 4ZA2A 4QT0A 3RQSA 5EJ2A 4HUJA 3NYWA 3MWDB 1B8VA 3MJCA 3KSZO 1P33A 1EUCA 1VM6A 3ZNNA 4N18A 1LDGA 3DTTA 3KEQA 3Q0EA 4WGGA 1NVGA 5LCXA 1PJQA 4RVFA 2NSDA 3LVFO 1GZ4A 4XQEA 1N92A 3OICA 3DXFA 4NJMB 5AXDA 2Y1GA 1JWBB 1YJQA 4GX1A 1GFSA 1QXSA 4UUMA 2D8AA 4J7XA 3WS7A 4NJMA 4L9RA 1BWSA 2VT2A 4JGBA 4OXNA 1PZFA 4CM5A 2Q45A 3E9NA 1U3TA 1J0XO 3ZI0A 2WJPA 4IMRA 4MOWA 3WJAA 3DHYA 3AWDA 3NJ8A 3UCXA 4CMIB 5FFFA 4B3HA 4CR7A 1L7EA 1QYWA 3GVXA 3ROQA 2PA3A 2CVZA 4R9SA 4J43A 4RDHA 1H9BA 2VHYA 5G0TA 1LJ8A 2X23A 5I9MA 3R3JA 1KEVA 7ADHA 3I3OA 3U4HA 5K9ZA 3M1LA 4Z3DA 3V5NA 5JAMA 5F1KA 2Q99A 3VZPA 1O9BA 4BKUA 2Q1WA 2YDXA 4U6QA 5G0WA 2VT3A 3FR8A 2A92A 2AE2A 1NQ5A 3PJGA 4FGSA 1NAHA 4P4LA 5L51A 3PLNA 3V2HA 1ZMTA 4IZHA 1SNYA 2HK8A 1VL8A 1EMDA 1Y5RA 3NT4A 5HA5A 5H81A 3PRJA 4NNJA 1HRDA 4DQVA 5BR7A 8LDHA 4JNKA 4PRKA 1ZBQA 2OZPA 3PYLA 3ZV4A 1Y6JA 2GF2A 3UOGA 1S7CA 2IEBA 1X0XA 1XELA 4ALIA 2CDCA 5T57A 3GDOA 4CQMA 3IP3A 3OJLA 3V2UA 2NV6A 5GMOA 4UEJA 1QV6A 1YXMA 1ZCJA 3QLJA 2FPIA 4ZVVA 5TQVA 4BNUA 2SCUA 2VRCD 4CM8B 4CV1A 4HBGA 5A3JA 3WTBA 2B5WA 5K6AC 1J5PA 3F1LA 4DC0A 1DC5A 1H6AA 1T2EA 4RPGA 4MVJG 1R4NA 1AXEA 3VZSA 1E3IA 2DPHA 3MJEA 4KWHA 2E4AA 1PGQA 4ALNA 4B4WA 2PGDA 3MCVA 1I36A 3QP9A 5CDYA 3NGLA 3TZHA 1RM0A 1TT7A 3KYDB 1LA2A 1EFLA 2C07A 2B37A 2F00A 2PWZA 2OO5A 1W4ZA 4FS3A 1IL0A 4UUPA 4PLCA 5KOIA 2FP4A 3JQ6A 4FJ2A 3GPDG 4PLVA 1M6HA 4XDZA 4AG3A 4E5KA 3E5RA 3GNSA 3GRPA 1R15A 3DHEA 1NFFA 2XXBA 3DC2A 1M76A 3WSVA 4QX6A 3AK4A 2EIHA 2P2SA 1PL7A 1A5ZA 3PHIA 4MDHA 5KKAA 4P4NA 3QSGA 2ET6A 1EVJA 5AQ1A 4ND5A 2HMTA 3OBBA 4GWGA 1YQDA 3ZHZA 1T4DA 1TVEA 4BB5A 1VI2A 2O3SA 3K73O 4QECA 2YV2A 3UAGA 4AJIA 3OETA 3MTJA 1X7HA 3JQ7B 1IZ0A 4MP8A 1JTVA 4ITUA 3G1UA 5HWSA 2X0IA 4R4JA 2ZQYA 2VTDA 3AI3A 4BS9A 5IDWA 4YPOA 1B3RA 2A9FA 1HF3A 1SC6A 3RU7A 4J9VA 1PGNA 1LRJA 3WIDA 4RORA 4OHUA 3VH2A 1MB4A 3KZVA 4Y6RA 3C1OA 4R68A 1LBEA 5DBFA 4U0JA 5BNFA 4CLRA 4OIMA 4FJ1A 4WLNA 3JYNA 4XQGA 1H93A 1PJSA 1JKFA 1I30A 1MUUA 3H9UA 4BNGA 2BFMA 3FBGA 1NPYA 1V3UA 2A4KA 4N5LA 4CLXA 4DUPA 4XGIA 1E3SA 1S6YA 3QWAA 5KKCA 2AQ8A 1PGOA 2Y0DA 4O5OA 1KERA 5IXSA 4BNLA 4J0EA 4UREA 2C29D 2J3KA 2R2GA 3BYZA 4PRLA 3RKRA 5C3MA 3EW7A 3V1YA 3JQAA 5TJ9A 1QKIA 1SPXA 3RSHA 3SJUA 4YJHB 4BMSA 5A03A 1AHHA 1BXGB 3IC5A 3HHPA 4UEKA 4FFPA 3I4FA 2FR0A 1PSDA 4RDIA 2B36A 1LSSA 4NJOA 4UUOA 1K2WA 2GYYA 4HXYA 4BUCA 4ZN6A 3LC2O 2BKAA 5EL0A 5K6AA 1K6JA 2BI8A 4E2YA 1ZEMA 1XKQA 1PJBA 3L77A 4JBIA 9LDTA 5L4NA 2VZ0A 2UYYA 4ZGWA 3K8ZA 4BMVA 3H4VA 5G0SA 1XCBA 3BIOA 3PQFA 1OC2A 2AHRA 3VKUA 2VWPA 3CUKA 3EDMA 3MWEB 2GRAA 3VDQA 4CMJA 4JLWA 4J3FA 3RI3A 3WBBA 4IDEA 2VNAA 4WLUA 3HN7A 5COBA 1LSUA 1D1SA 1E7QA 1I2CA 1FDTA 3OEWA 4CLOA 5EN4A 2AMFA 4NI5A 1ARZA 3B70A 1TI7A 1CERA 2QRKA 2VUSA 3GG2A 4ND1A 2X0RA 3KBOA 1GR0A 2Q2WA 1F06A 1O89A 3KHUA 4O63O 4OOEA 2ZB3A 3ZZNA 4F46A 1CQIA 1I2ZA 1U2GA 2AG5A 2IYPA 2OORA 3FD8A 3KOUA 5BSEA 5IG2A 1R16A 1WWKA 4YJGA 2GN4A 4J4TA 3IJRA 4G5HA 3PHJA 4BO2A 3AI2A 3Q2KA 4K6CA 1Z75A 1U3WA 3TNLA 5ILOA 3OIDA 4BHTA 2DBVO 4YYZA 5B12A 1JW9B 4XZ3A 3EY4A 3PHGA 1OOEA 3D4NA 3DZKA 5ITVA 2NVWA 4DPMA 2VWHA 1EE2A 3C7DB 1T25A 4J2HA 1UZMA 2Z95A 2OBNA 1NPTO 3FI9A 2WD8A 3D7LA 1UDBA 1N1EA 2O3QA 3GQVA 1RWBA 3WICA 3MZ0A 4FC7A 5J23A 4ONEA 4MO2A 2ZB7A 3QJ5A 1P1IA 1VJ1A 4J1TA 1KOLA 1E1MA 1P1FA 5IF3A 2GD1O 1UXHA 1VPDA 2W4QA 3ANNA 5BNTA 4YT2A 2DTEA 3FWNA 1ADGA 2C7VA 1FJHA 3BMNB 5KJFA 5JXWA 3ZDFA 3DZJA 3RD5A 1UAGA 4D42A 4B8ZA 3K9QO 3L4BA 3ONFA 3WWZA 4GSLA 2XPCA 3NT5A 5IDYA 4A7PA 3WNQA 3D3EA 1WW8A 2EV9A 4GH5A 4Y9DA 5MGBA 5CEJA 4GX2A 1ZK2A 3W6UA 4OO3A 3JQGB 2X9VA 1V3VA 3ZWAA 1PS8A 2G76A 4CLEA 2RBEA 4EYEA 1BHSA 2XOXA 1BGVA 3GAZA 4BNYA 1PL8A 3U3XA 1BXZA 3R0IA 2VNSA 5JDCC 3WLFA 2WD7A 4GGPA 3GVIA 4NH4A 4EEXA 2TMDA 3KXDA 3NGXA 4FFLA 4HP8A 4IDFA 1Y8RA 5U9CA 2I67A 2BH9A 1DAPA 2HUNA 3TL3A 5CPFA 3WLEA 4YB8A 2Q46A 2XXJA 5IZCC 4IJKA 2QRLA 1QORA 4FFOA 2WD7B 3WBFA 2QYTA 4BGVA 4G2NA 1BSVA 3AM4A 3GFBA 1L7DA 3FBTA 3M6IA 1CQJA 3D0OA 1DXYA 5KVQA 4AJLA 4LSWA 1EK6A 3TWOA 1K3TA 3HDHA 3RASA 3H2SA 5KVVA 4GL4A 1KIFA 5KIAA 2NU6A 4Y8VA 2DU8A 4CM8A 4BIIA 2X9GA 4F3YA 3C1TA 1WDKA 2ILTA 4ZD6A 4ALLA 2W98A 3H6KA 4U7WA 1P1JA 3HJAA 1BDMA 7MDHA 1HKUA 1LLCA 4CMBA 3OJ0A 4E21A 4F6CA 4NFHA 2FOIA 3RJ5A 3UH1A 3PXXA 4LW8A 4WUVA 1NM5A 4LVCA 4RF4A 2BHLA 5U4QA 2YJZA 3I6IA 3ZV3A 5BSFA 1I5RA 1N7GA 5T8KA 1KVUA 4O1MA 1JKIA 2HMUA 1QMGA 4KTTE 2B0JA 2C59A 4RZIA 3R6DA 4FJ0A 4XD2A 3WNVA 4FB5A 4D0SA 4YT4A 4II2A 3GZ4A 3DBRA 4FFNA 3DZBA 1WZIA 2BFPA 2CSUA 4BGIA 4WNIA 1V8BA 1P1KA 2VWQA 1ZVMA 2Y67A 4ILKA 3KYDA 3LSYA 5CP8A 3F3SA 2O4CA 4J7UA 1ONNA 3KYBA 4HY3A 3H2ZA 4LK3A 3ZV5A 3OA2A 3RUIA 3V1UA 3BMOA 2JFHA 4J1NA 3HADA 3PK0A 3R1IA 2XF8A 3RFTA 3EK2A 3IL2A 3AM5A 5TX7A 4YAEA 4YAJA 2ZCUA 1IB6A 4RO0A 4JK3A 1EVYA 4JN6B 4E33A 1NHGA 4PFJA 3ETDA 4HFNA 5TC4A 1Y8QA 4IXTA 4IUYA 3KYCA 1Y81A 2OMEA 2NM0A 5BSGA 1WDLA 3F46A 3O8QB 3PVZA 4CLRB 5JCJD 1B26A 2EP7A 3JYOA 1A9ZA 3IUPA 3LT4A 1ZSYA 3O8QA 4GMGA 3MJVA 2C0CA 3JYLA 4J90A 2AQIA 2C20A 5IJZA 1Y8QB 1I32A 2NACA 3UVEA 3JQ7A 3PJFA 2QW8A 3OF2A 2JAHA 1N1GA 4PLFA 2XAAA 4AFNA 3D5TA 1CETA 2FZEA 2WE8A 4B79A 1YL7A 5TT1A 1E7SA 1QP8A 5DT9A 2PZJA 5JBIA 2GASA 3GN1A 4NMHA 3L9XA 1MA0A 2NNLD 3H9QA 3WYCA 3PWZA 4R1NA 3KSUA 1QG6A 4ZQHA 4Z3KA 5JAQA 3E8XA 4XYEA 3H8VA 4K6FA 3ZWNA 4NBRA 3DBLA 1NWHA 3JQBA 1C14A 4XR4A 2VHXA 5TGDA 1LQTA 3W4IA 4XQ9A 3DO5A 3U0BA 3RC1A 3VC7A 5DDIP 4AJNA 4IINA 3U9LA 5JDIC 1EZ4A 3PZRA 1PZGA 4IXWA 1EUDA 1ZEJA 4UVDA 2B4TO 4BO9A 1EBFA 1O95A 1RM3A 3JQAB 4J4HA 1DHTA 4NU6A 3DTYA 3C3XA 3QVTA 3GHHA 3Q9UA 4XWYA 3CMCO 1R0SA 4KQXA 3JQEA 1IY8A 1DB3A 4RVUA 3H7AA 4GX5A 1WXDA 1ZO8A 3KM0A 2ZIZA 1JVSA 3TDKA 4IGFA 4E32A 2G5CA 4IDBA 3DBVO 3WGQA 4CQLA 4AL4A 4CM6A 5B4VA 3QWIA 3RWBA 5DP2A 1VKOA 4I5FA 3ZU4A 2EKLA 3RUEA 3COSA 4P22A 1ZW1A 1K89A 4B7CA 2G17A 4HFMA 4W9NC 1JWAB 4Y6SA 3STHA 1G0OA 3CPSA 1HDRA 4MPDA 1JAXA 2VQ3A 3QHAA 2AA3A 2AEMA 4GLOA 2WYVA 5L4SA 1DLIA 1HT0A 5HS6A 4PLZA 1BDBA 2Z1MA 5DBIA 2CF6A 2Y0EA 4OH1A 1U4OA 2YDYA 1PJ2A 4GQAA 3ZU2A 3HB5X 3VZQA 4KMSA 2D3TA 3A4VA 3FPCA 1V3TA 4R3WA 4E2XA 3GAFA 2FPPA 3L4BC 3JQFA 4W99A 2GZ1A 1U9JA 1IZ9A 3IDSA 1LNQA 1LC3A 3O4RA 1UXIA 4RV9A 2VZ8A 4FBGA 1MX3A 3D1LA 5BSHA 3KSDO 4N54A 3UCFA 3ZWPA 3PIIA 4IM7A 3DQPA 1DC3A 4Q39A 3GN2A 3GNQA 4IGEA 1FDUA 2X8LA 3L6OO 1BVRA 5JS6A 2ZTLA 4WOKA 1DC4A 2IXBA 1VC2A 3BMQA 4GGOA 2NTNA 4S3MA 2HMWA 3RBZA 1LTHR 1IULA 4GAEA 3BMQB 4N7RA 5EERA 4I5EA 2NU8A 4RLSA 1BXKA 1R4MA 3DEYX 2DFDA 4TRMA 3DFUA 4K26A 5DNAA 2FSSA 5AOVA 2GERA 3NDRA 5TF4A 2Y99A 1NQTA 3RUAA 4RPHA 4I9NA 2NADA 3HZZA 2JJYA 3VH4A 3VHRA 4OYRA 1AGNA 4FOOA 1UUFA 2D5CA 4MVJP 3U5TA 2PKRA 2VYND 3RUHA 4MP3A 2YFQA 4C7JA 2AW5A 3K5PA 1C1DB 2CY0A 5AYVA 1K6IA 1KYQA 2Q1UA 4HADA 4E12A 5L9AA 4GKBA 1F8GA 1H6BA 2BELA 1LX6A 4KOAA 3OEYA 2YY7A 4OOFA 2JCYA 1D1TA 5CEEA 1P44A 1PJ3A 3LYLA 3QWFA 3NT2A 4NK4A 1O6ZA 5I8WA 1JVBA 3E03A 5T5QA 1PIWA 4UUNA 3I4CA 2RH8A 4NG5A 3F47A 4NU5A 2UV8A 1C0IA 1LEHA 4TQGA 3MEQA 2OXIA 4BNHA 5IDXA 3SLKA 3JQCA 4JROA 1CDOA 1JU9A 3CE6A 5CG2A 5ADHA 1NWCA 2EKPA 1CYDA 2PK3A 3WYEA 4IQ0A 3D3WA 1ZK3A 4R41A 4DYVA 5CFZA 4CM4B 4HNGA 4Q3CA 4W6ZA 4BVAA 1HE4A 1YBVA 3ROPA 4GLLA 1B8PA 1ZK4A 4Y98A 1SOVA 3E9QA 4C7KA 2P9CA 3LLSA 4CLDA 2JL1A 1TB4A 4O6VA 4XCVA 4TKMA 2UDPA 3CINA 4YXFA 3GDFA 1YBAA 5IAAA 1AE1A 4AJOA 1YRLA 4KUGA 4DPKA 3A06A 5JW6A 2ZJ1A 5CPBA 4YT8A 1KY4A 3GK3A 3F4LA 3VVCA 2IXAA 3TSCA 1XSEA 1HYGA 4DL9A 3OIFA 3O26A 4BNFA 4TRRA 5F1PA 1I10A 4J16A 1V9LA 1UXJA 1ZJYA 4Y6PA 3U4DA 1ADFA 2E6UX 2IZ1A 5I7EA 4I5GA 3ZWXA 1A27A 1KVQA 3H9EO 1DDOA 1EQ2A 3JD4A 3FTPA 3GPIA 3GDGA 3G17A 3INGA 5TSDA 1YOVB 2YYYA 2QX7A 3PFWO 5L7TA 3ZHBA 1ZNQO 1P1HA 1WMAA 4Y67A 4GWKA 4IDDA 3S2GA 5I7SA 4H7PA 2O50A 4WLOA 4B3IA 1SB9A 3HFGA 3T7EA 3TN7A 3ZN2A 1XYGA 1HEUA 1BTOA 3IJPA 2BFAA 2W90A 1DIHA 1DIAA 2IRWA 2JCXA 2O7QA 3BMCA 5TT0A 2GZ2A 4DGSA 1ZKMA 3IP1A 1C0KA 3I6QA 4YJDA 1X1EA 3HB4X 3ZNQA 4KUEA 1LLQA 4FOSA 5KNLA 3IKVA 2FY8A 2EJWA 3CMMA 3GF4A 1SBYA 2Z5LA 5F3RA 3ZWMA 2W2KB 1A7AA 1E3EA 4KDEA 3UGKA 3VVBA 2CFCA 4RVDA 4NK5A 3ONEA 1WVGA 4D45A 5C7OO 1KC3A 5GZ6A 4PG6A 4E5NA 1N2SA 2GPTA 3Q2IA 4BO5A 4PN3A 5A5FA 4BV9A 2ZB4A 4IZIA 4WE3A 1NBOA 3AJRA 4QQRA 3OH8A 2WWRA 3QVXA 3P19A 3CTMA 2O3UA 2BGKA 3K92A 2DBQA 2OBYA 1VL0A 2AQHA 4JCOA 1HWYA 2GN9A 4BL5A 1E3WB 4L74A 3F6YA 4XQCA 5CEFA 1U8FO 5KCZA 4ND3A 3MJTA 4M87A 2ZTMA 2CF5A 2O2SA 1CIVA 3VPFA 4BNVA 3T4XA 2V6FA 3IMFA 2EXXA 4O0LA 1E7WA 3TZ6A 3ZWCA 1NAIA 4YRDA 4Q3NA 3OJEA 4JBGA 1PQPA 3AFMA 2J5KA 4CQMD 4EITA 1B14A 4A27A 1KEUA 3W8DA 3DBLB 2RHCA 3I52A 4M49A 4KWIA 3N58A 5A9SB 2WYUA 3M1AA 5FEUA 1PR3A 3OQ1A 1CF2O 4IDCA 3WGIA 1P0FA 3I5MA 5TIIA 4YDRA 2H63A 4FIZA 4D79A 2DUWA 3ZHYA 2HAEA 4WCFB 1KVTA 2X9NA 2HK7A 1LC0A 4GVLA 4E5YA 1A7KA 4XYGA 5KJEA 4B4UA 3KTDA 5EQDA 3ZU3A 4BKQA 1OFGA 3L9WA 3CZRA 3GH3A 3JV7A 1DOHA 3AUSA 2AEJA 1MFZA 4LMRA 1F0YA 1M66A 4LRTB 4TVOA 5ILGA 3WR5A 5A9SA 1Z45A 5KTKA 1GEGA 1SOWA 4BGUA 1GDHA 3O38A 3FN4A 4E3ZA 1H2BA 3RVDA 4Z0TA 1B2LA 2I99A 5F5NA 3UN1A 4ZHSA 4W9NA 2BFOA 3X2EA 4A73A 3EZLA 3AW9A 4XEHA 4IQ8A 3SEFA 4IJWA 1XEAA 4LISA 5CG1A 5JYDA 2Q49A 3I83A 2Q2QA 2IYOA 1NXQA 1IPEA 3WXBA 1CEQA 3B1FA 5T64A 1QYCA 3ABIA 4FDAA 1X13A 1EVIA 2WYWA 1KEPA 3U4IA 5IDQA 2EW8A 4E13A 3ROMA 4KDFA 1RJWA 1U28A 5JLAA 4QTZA 2E49A 2GR9A 1ADCA 2W2LD 2DVMA 4DWVA 5FWNA 4HFJA 1JLLA 4ALJA 4CQMB 4WLEA 1QYXA 1U8XX 3GVPA 2NVUB 1MXFA 5F21A 1GV1A 1YJ8A 4Z9YA 5JAIA 4A0SA 4L4RA 3VKVA 3LQFA 4BQRA 2CVOA 5JDIA 3E5MA 4A03A 1OAAA 4Z9FA 4CMCA 1B15A 2YZ7A 2DTDA 4C4OA 5L7WA 5LC1A 2AQKA 4CL8A 5CDTA 3P2YA 1KEWA 1T2DA 1E3LA 1ZK0A 2C2XA 3NTOA 1H6DA 3OQ6A 3MTGA 4NHEA 3ZNPA 1YOVA 4IIVA 1NFQA 1ISGA 4EDFA 1C1XA 1B16A 1GCUA 1T4BA 3DZGA 3GGGA 3GUCA 1QYDA 1CJCA 4XJTA 1W8DA 5T6BA 3JD0A 2Y05A 2B35A 3WX0A 1I8TA 4NBVA 2G1UA 2O3TA 3KRTA 5DULA 4W7HA 1YBMA 3EVNA 5L53A 2NU7A 3DZHA 2I76A 4CM9A 1C1XB 3H9GA 1YQXA 1TT5A 4PIVA 5FI5A 3CZMA 3FSRA 3PP8A 2ZATA 5IFLA 4MKRA 1KBZA 4FSHA 4EJ0A 2PH3A 4PZCA 4GSKA 3C1AA 3KUXA 5DCUA 4E31A 3PHLA 3G0OA 4OAQA 5DOVA 2UVDA 2OP1A 3D64A 2R6JA 4JJIA 5EINA 1YQGA 4MJLA 1JN0A 3AU8A 2HMVA 3SBOA 3GT0A 1N5DA 4X54A 3ENNA 4WLVA 1P1RA 4IPTA 4D3SA 3GUYA 1ISIA 3C24A 3OQBA 1U3UA 2VN8A 4BO4A 5A05A 3L07A 4NQZA 1QR6A 4QSMA 1F14A 4ALMA 3IQDB 5DCYA 1YDEA 4XDYA 3KB6A 3ZH2A 3S2FA 1OI7A 2DUUA 2VYVD 2YHIB 3H5AA 4PCVA 5EPOA 2NQTA 4QFCA 3HUDA 1MG0A 1GPDG 2J3HA 1SEPA 2JFGA 4Q3EA 1JDJA 3E48A 1HE2A 3AUAA 4ZQEA 3PIDA 3KVOA 1O0SA 3FNHA 1N8KA 3I1JA 4FQ8A 2VTEA 5C7LO 1P74A 2ZKLA 2DBRA 4KZPA 4EUFA 2H6EA 1YONA 4AJHA 2PGLA 4Z0HO 2V65A 3IKTA 4YCAA 3NX4A 2IDZA 3ICCA 4FD3A 4LCJA 5JAZA 4G65A 1BW9B 2UUOA 4JXKA 4MKZA 1XGKA 2YHIA 1XU7A 5DOZA 4B4VA 2WMDA 1E6UA 4BNWA 3V1TC 5JFOA 1I3NA 3BHJA 4B3JA 3P7MA 4MKXA 3ETEA 3HWRA 3WFIA 1NVTA 1KVRA 1HYEA 1GUFA 3GGOA 4NR0A 3GEMA 5BNIA 1RM5A 5JDCA 1PJLA 2HDHA 2VOEA 2NU9A 5JC1A 4JP2A 1BW9A 4ND2A 3T7CA 3FNFA 4EW6A 3GOHA 5LDGA 4L4SA 1HDZA 3RFVA 3H5RA 1LLDA 2CVQA 3O03A 5EMHA 2VUUA 4RQUA 2V6GA 1HZZA 1SCUA 5AXAA 3Q6IA 2Q1SA 3QE3A 3T4EA 1LLUA 3A9WA 2EP5A 4QO8A 2D0IA 4BNTA 1DSSG 5BT9A 5H83A 5JPIA 3BMCB 1WZEA 3QW2A 1ID1A 1UH5A 4PVCA 5DP1A 3LC7O 3PGJA 3VAZA 1NYTA 4E6PA 3MJ4A 2O23A 4EBFA 4UVIA 5ES3A 3K2BA 3JQ9A 4QFDA 1P77A 3UFXA 3GA0A 3FCOA 3WGGA 6LDHA 3LLVA 4R54A 2JD1A 3GRKA 5KJCA 3HDQA 1SMKA 2PKQO 3ONDA 5DF1A 4J2OA 3AFNA 4R16A 2HKIA 5L40A 1GPJA 5ICSA 1ZFNA 2V6BA 3ZWWA 4J1QA 2PNFA 1VRWA 3ADOA 3OMLA 3DMYA 2QQ5A 3P5SA 2DBZA 3IAHA 1D8AA 1SB8A 1ZK1A 1UXGA 1HXHA 4FW8A 3OSUA 4NBWA 1T24A 4ESOA 4DPLA 2POQX 1OMOA 1EE9A 3PJDA 1R6DA 1A71A 1HSOA 4B7XA 6ADHA 1M2WA 1OZAA 1P31A 3HDJA 4MP6A 1AUPA 5TLSA 2FR1A 1GL3A 1GU7A 1HYHA 4R1TA 2D2IA 1PGJA 4L73A 1DIRA 2GZ3A 1Q0QA 5KJ6A 5LDHA 3K30A 1QLHA 3ST7A 3L0DA 1B8UA 2CUKA 4OSPA 2I9PA 1EK5A 1HLPA 3QY9A 1QYVA 2V6MA 2BRUA 5THQA 5JCXA 4CMAA 5DZSA 1ONOA 3LT2A 3PQEA 4PZEA 3QQPA 2FWMX 4MVJA 3CSDA 5JE8A 2J3IA 1H5QA 4DTIA 5JYEA 3SVTA 4G81A 3X2FA 3ENKA 1R12A 2X58A 2EEZA 3B6ZA 4YQYA 4FCCA 4MVJI 1FDVA 3GR6A 3MOGA 3VPHA 1X14A 4PZDA 3NDJA 4LMPA 4B8WA 3BA1A 4CR6A 2GN6A 4EJ6A 4UAGA 2EGHA 3BXXA 1MG5A 2QG4A 2JD2A 3SC4A 4YAGA 4BB6A 2Y1EA 1HE5A 4WEOA 4CODB 1PS0A 3DR3A 4W82A 3TFOA 1I33A 4J0FA 1NVMB 3PLRA 5I9LA 3WMWA 3E18A 4PLWA 2GN8A 3NEPX 3ORFA 5U1PA 3ADPA 4Z6KA 5JO0A 1N9GA 1W73A 3ZW8A 1E7YA 2Q1TA 2VRCA 4CM7A 4IQGA 1GZ3A 3INRA 2FHSA 3ZV6A 3ZW9A 3EAGA 4E0BA 2HK9A 4R69A 1UZLA 4Q9NA 4BV8A 4AJ2A 3QA9A 2PV7A 3LDHA 4JJGA 3JD1A 2Y66A 4ALKA 5HS4A 1NPDA 4AICA 4TROA 3PDUA 1PR9A 3VZRA 1FF9A 3I9JA 4RVSA 3TZCA 3FNGA 4M55A 1DFGA 4YJGB 4H15A 2RAFA 1CRWG 4WOJA 1RYEA 3DZFA 5A4DA 4MINA 2NVUA 2R00A 4YWJA 1M67A 5GZ1A 3QWHA 3LT1A 4UEOA 4D41A 1DFHA 2X86A 1DFIA 4RF3A 1R37A 4FFRA 1EQUA 1J49A 1T26A 5G0UA 2DKNA 3CEAA 2HCTA 1QSGA 4LRSB 3FR7A 4XJSA 4R5MA 2I3GA 5JO9A 4D3DA 1E1KA 5L95A 3U09A 3SXPA 1L1FA 4XIJA 1I2BA 3FWZA 3CIFA 3UHAA 4D0RA 4DQXA 2ZB8A 4H16A 4EEZA 3JQ8B 3GZNB 4EGFA 1Q7BA 3V8BA 2QZZA 4P4GA 3L6DA 3TZKA 3L4SO 3WGTA 1Q0HA 3NDIA 1EVZA 5GZ3A 3ANLA 4OQYA 2O3RA 4H3VA 3H5NA 1E0DA 2C5EA 2HMSA 2WSBA 4WASA 1E3JA 4PVDA 3EZYA 3KV3O 4LCEA 4XA8A 2GLXA 3M2PA 4LSMA 1ZZEA 3A14A 3JQFC 3ZGYA 2CZCA 3WQRA 4RPKA 1BMDA 4BNIA 2Y1FA 4DLAA 2X6TA 5MDHA 3F5QA 5A02A 5A3VA 4CV0A 2HQ1A 2GSDA 1C1DA 4CUJA 2P9GA 4RPLA 3WQQA 2J8ZA 4DVJA 3L6EA 3GNTA 1VJTA 5ER9A 2HJSA 1T2FA 3TRIA 4GX0A 3QVOA 1HLDA 3LF2A 3DDNA 1PQWA 1KS9A 1H6CA 3OHSX 3PWSA 3BTSA 4WKGA 1TT5B 1P9LA 1Z73A 4BNXA 3DBHB 1IHYA 3E82A 1ORRA 3HQ4O 2IODA 4ID9A 4YJFB 2B4RO 4DRYA 3JSAA 3D3WB 4E5PA 4L0QA 4J7CA 2O7SA 4WNCA 1YL5A 3D4OA 3B1JA 4TZTA 5EIOA 4WPGA 4ZJUA 3RU9A 4CUKA 4MVJD 1LRLA 3A1NA 2DC1A 2PD6A 3S2EA 3QVSA 3PQDA 3DBHA 5A1TA 2PLAA 1DRVA 3UF0A 2EW2A 3DWFA 4BOYA 3WGHA 5KWEA 2NQ8A 1YB4A 1EDZA 4BNKA 3RBXA 4QXMA 2Y1OA 2OFPA 5IXYA 4A2CA 3VPXA 2OL4A 1RYDA 2PZMA 3WYBA 1HZJA 2AE1A 5THKA 2GGSA 1UR5A 5JNLA 1P0CA 3QV1A 3RC2A 5L3ZA 2VCYA 1DHRA 4AVYA 4LGVA 1HETA 3W6ZA 3Q11A 4TKLA 3W4KA 4BO0A 4GKVA 3VTZA 2P9EA 1VKNA 4GMFA 4IJUA 4Q3DA 2VOJA 1MLDA 1WNTA 2VYNA 4XGNA 4BNMA 4YRAA 4XGKA 2X0NA 4NIMA 2IEDA 3LF1A 4DMMA 2EJVA 4HX5A 1Y9EA 5B4UA 1G6KA 4XX0A 3I9MA 3RC7A 1Y1PA 2FN7A 3OIGA 5B37A 4A5OA 4M1QA 4CL3A 4RZHA 4EUEA 1GZ6A 1QV7A 2X5JO 1ZSNA 4M54A 1ISFA 4ROSA 3RIHA 3GHYA 4DIOA 5ICMA 3CXRA 4WCFC 3TF5A 2EG9A 3ZHXA 4OL9A 2JFFA 1HSZA 4RQTA 1YB1A 3RJ9A 1X7GA 2OGUA 4FN4A 2RIRA 1ENOA 1I3KA 3ZWVA 1DBVO 1PTJA 2PD3A 3BHIA 1GADO 2FR8A 5B4TA 4D7AA 3G49A 1XG5A 2RH4A 2YV3A 3VOSA 5IZ4A 4TRJA 1YDWA 4U6SA 1LQUA 1K0UA 1GAEO 1U7TA 3GVHA 1IE3A 2QZ9A 1WPQA 4CM9D 2EKQA 1C3VA 3RC9A 3FF4A 3ZCXA 1X1TA 5DBGA 2O4UX 1KC1A 1FXSA 3FHLA 4EJMA 2H9IA 4RVHA 4WJZA 1ISJA 3NJ4A 1EUZA 4NPCA 5I7VA 2HLPA 2GNAA 3ASVA 2CMDA 2NWQA 2P5UA 1GYQA 3WIEA 1XA0A 3BHMA 4BNNA 3W4JA 3WQSB 3LZ6A 5A04A 3GG9A 4OGWA 5ER6A 8ADHA 2D5AA 4XYLA 2B69A 1X7DA 1I24A 3WGYA 1Y7TA 4D3FA 1OC4A 3G1TA 3S1LA 1Q1NA 2RHRA 1UAYA 3GC6A 1Q0LA 3RUFA 1D3AA 3EGOA 2O2YA 3WWYA 1E5QA 3QIVA 5JC8A 4MIEA 2C5AA 4PLTA 1XHLA 4YJHA 5JY6A 4PG7A 1E6WA 1GY8A 5BQFA 4NBTA 3E9MA 4J1SA 2B4QA 3RKUA 1I3LA 2VHVA 2B83A 4JQCA 4MIYA 1XU9A 3BTVA 4MVJF 2J5QA 2YUTA 4I5DA 3LK7A 1U2DA 1DEHA 4UVEA 3ASUA 1VE9A 3OP4A 4NZ9A 1NTOA 4GPD1 1PWXA 4XYMA 2IE0A 3I23A 4ZRMA 4PG5A 2BMAA 4UVGA 3TOZA 3HN2A 1K5HA 3U62A 1LUAA 2OOSA 2QHXA 2X7HA 4AJEA 2PGJA 3I9OA 3DZIA 3PWKA 2UUPA 3GEDA 3SX2A 3U4CA 1NHWA 4JX8A 1LU9A 4J91A 2NTJA 1AN9A 1IYZA 5G0VA 4UULA 1FK8A 1U7HA 5C37A 2ZK7A 1LXCA 3V2GA 4IDGA 3I9LA 2P4QA 1GEEA 1GD1O 3S8MA 1BXGA 1T2CA 1O8CA 1PJ4A 3JQBC 5HTOA 1A4UA 2NVBA 4YJFA 4NBUA 3SLGA 3A28A 3DMTC 3JD3A 2BD0A 5CDSA 4U5QA 1EDOA 2H5LA 2P68A 4GVXA 5JY1A 1PEDA 1D4FA 4CMEA 4YT5A 3RAJA 1IHXA 1W6UA 2YQ5A 4XRRA 3PEFA 3DB2A 2X22A 5G4KB 1GQ2A 3ROKA 1E7RA 2DFVA 2YFHA 5HM8A 1N9GB 5JMWA 1QLJA 1LDMA 4E2WA 1N7HA 1BVUA 4L75A 5DCWA 1U1IA 1TLTA 4RLHA 3DONA 1EBUA 2YHUA 1Y5MA 1DO8A 1PZEA 1R66A 1NQOA 3JCZA 1YS4A 1YVEI 2D4AA 2DAPA 4MIOA 2BF7A 4BO8A 2E37A 1FDSA 2DTXA 2VWGA 1IUKA 1UJMA 1ZSVA 1ENPA 4ZRNA 3AOGA 1X15A 2EGGA 4II3A 2QYSA 1C0LA 1ENZA 1GCOA 4A26A 2VHWA 4W7IA 4IY1A 1DRUA 5CDGA 2D1YA 1Z74A 2VUTA 1UP6A 2JHGA 3DBRB 4CM3A 2I6TA 1HL3A 4XKJA 1NR1A 4DLBA 3GEGA 3GMDA 2B5VA 5B1YA 5L4LA 3PDJA 1GUZA 2GDZA 2AXQA 5DN9A 1E5LA 3JD2A 3TQHA 2ZJ0A 3KYCB 4R5HA 1NX6A 3EMKA 1ISMA 1HE3A 3D5QA 3GVCA 1XR3A 4FPXA 2WDZA 1IOLA 2X5OA 1WMBA 3DOCA 5KVCA 3F4BA 1CWUA 4RGBA 1XQ1A 4AJPA 2QIOA 4YTEA 1YGYA 2DM6A 1NR7A 1TA4A 1PQUA 4WK6A 4AJJA 2X4GA 1MP0A 3GFGA 5TJHA 4LN1A 1NNUA 3ANMA 2ZTUA 1UZNA 1I01A 2DT5A 5GY7A 2GUGA 5C7IO 3GY0A 3G3EA 3WMXA 4BMNA 1SO8A 2DQ4A 2PR2A 1NP3A 4DBZA 5HRUA 1F17A 3K2EA 3RCBA 4ZICA 4OKNA 3ZU5A 5ITWA 1LDBA 1R4MB 1VL6A 1AXGA 3HNPA 5I7FA 4J6FA 3NKLA 4IIUA 4ZQGA 1LRKA 1UP7A 2AEFA 3F9IA 9LDBA 4IS3A 1DIBA 4D44A 2F1KA 1ADBA 2OP0A 4FR5A 4BO3A 4OJNA 4PLYA 2Y1CA 1E92A 4J49A 3PI7A 1E77A 1OBFO 1KETA 2AG8A 3IS3A 2EHDA 3WGOA 1T1RA 3D4PA 1ZXBA 4YEDA 5I9NA 4R1UA 3NRCA 4E4YA 1YB5A 1DLJA 1NASA 4PLGA 1Z7BA 4DYDA 3JTMA 3JQAD 2I3AA 4YACA 3ITDA 1K6XA 4Z0PA 4J4BA 3CH6A 3VH1A 4DMLA 1XDWA 3VPGA 1O94A 3O9ZA 4NFSA 4A10A 2JD0A 3S55A 4BNZA 4TWRA 1EFKA 3JQDA 1DAOA 4L76A 1E1NA 4XYBA 3ZWYA 3NTRA 1R4NB 1LSOA 4XRGA 3RUCA 4CM4A 4KTVE 4OSOA 1GYRA 5A5EA 4CR8A 1PX0A 1A4IA 2FSVA 3RROA 2HSDA 4S1VA 5F1OA 1JKJA 3BTOA 5IN5A 4D43A 1ZMOA 4DC1A 2BGLA 3NAQA 1D7OA 1Z7EA 2JCVA 4JBHA 5TRTA 4B4OA 2C82A 3WDSA 1ML3A 3BZUA 4QO7A 1V6AA 4OMUA 4R1SA 4DIFA 4YRBA 5AXCA 4NFYA 1YL6A 4P8RA 3VDRA 1I3MA 3LT0A 1H2HA 2X0JA 3TPCA 1TXGA 1Z6ZA 4QUKA 3EC7A 3TFQA 1MC5A 1KVSA 3BMOB 4WEQA 2JAPA 4U0KA 1X0VA 1J6UA 4J9UE 4PLHA 4TMFA 2VRBA 2ZYGA 3EUWA 1H0KA 3IOYA 5T8KC 5ENDA 1Q7GA 3UICA 3HDYA 3ZWBA 2EERA 2O3JA 3NTQA 4CQLB 2W2LA 1F12A 2WEKA 2W2KA 1YKFA 2VZ9A 3AOEC 3FPLA 3QWBA 5F5LA 4YAKA 2NLOA 4TVBA 4HV4A 4M89A 5G2OA 5COQA 3U49A 3WFJA 5JSFA 5KJ1A 3AY6A 2G82A 1SEVA 4CV2A 2ZYAA 1YWGO 3SC6A 1DRWA 1HDGO
chains in the Genus database with same CATH superfamily
5E4FA 1UK7A 1MO6A 2VEDA 2QTWB 2V3WA 4GXQA 3BE6A 4PCAA 3C7CB 4YAWA 3C39A 3RAEC 4XUGB 4MCJA 3A7DA 3FLAA 3TOVA 1G8AA 4CKCB 2XV1A 4B7UA 1ZUD1 2XGGA 3E2PA 1P3DA 1QBKC 1VLVA 2EJBA 2EF1A 1T8PA 1EK1A 1ZNWA 1FB5A 3CKKA 3SQLA 1W48A 1XTBA 3UCEA 4MJXA 3HG7A 3W3AA 4RE6A 1A9YA 1QGED 1RYYA 4FFMA 2VJYA 2HHLA 3IIEA 2JFNA 4LDPA 1PG5A 2JKVA 1HE1C 4IDAA 3BE5A 4PZLA 3ETGA 2J46A 2G3YA 4YECA 3W3AH 4CIAA 4F5ZA 4W5QA 2V5AA 1BDJA 2R68A 4DEXA 721PA 1HPLA 3O5AA 2BI7A 2GBPA 5TS2A 4DWJA 4RTRA 3EGXB 2X0EA 2F48A 4M86A 2YHAA 2O6HA 2X6QA 3FZYA 1IPFA 2W8ZA 3BMNA 3GJSA 4KXXA 3UXYA 1Q0TA 4R9RA 5LQRA 4LJAA 2F59A 1OXVA 3TOXA 3K70D 4MR7A 4TSKA 3LY7A 3BH6A 3WP1B 3ELYA 1OA1A 1ZX1A 3DMRA 3MMPA 4G1VA 4HUQA 4QNMA 1LSJA 5IKXA 3ZJVA 2PT6A 4MRMA 4JI1B 4Q4AA 3CUEF 4LOKA 4KSBA 1KI6B 4NZNA 4YWHA 3T6KA 3U81A 2QLBA 1Z4QA 2ZDQA 2AJDA 3WDMA 3GDHA 1P4HA 5AJUA 4MWDA 5DU2A 1VL1A 1C3LA 1QUFA 3B1KA 1Z62A 3DV2A 3R5XA 3VH3A 4IHAA 1I1NA 1EUYA 3CKMA 1HDXA 2G5TA 1VBNA 4D98A 3FOAA 1YVDA 4OXKA 5LA6A 1GUYA 3E3LA 2OZEA 2AG6A 3U0VA 2YWGA 4BBPA 4AZ3B 4BB9A 3NUGA 1B3BA 5M29A 3KR0A 2R6CA 2FW1A 2C2YA 2RG7A 2A35A 1AK1A 4TSRA 2RI0A 1OFVA 1B7GO 1QHFA 1U7ZA 1RD4A 4WX2B 1VSUA 1MOSA 3GW8A 3INTA 1Z68A 5NLLA 2OYCA 1DKOA 3UKOA 3E3NA 3BTUA 2H5EA 3T3DA 3VR5H 3JQGA 1MH1A 1U2TA 3RF7A 3B20A 1Y8RB 1TUGA 1XLTA 1Q2XA 3C6MA 3RVNA 5CLLA 4ZYLA 1T1JA 3K0KA 2O2CA 3NYRA 1P2TA 1AN0A 2IYEA 3I9KA 4UEQA 1JH8A 3LV8A 1AIPA 4RHEA 4JP3A 2XCSB 4OQZA 1GZVA 3BD8A 3CV3A 3OT4A 2YZ2A 1M2HA 3EDOA 4G63A 5C1DA 3T1HB 2IEYA 3QF7A 1QYIA 4X9XA 5FTKA 1W0CA 5M2QA 1EEHA 2ZIGA 1JVNA 3MCZA 4KG7A 1XP5A 2LKCA 1PSZA 2EWMA 4B3CA 3HRKA 5DSTA 3B60A 3P4YA 4YREA 4IUDS 3ZE2B 1LDNA 1PBTA 1I0ZA 1M8FA 2PUTA 2X40A 2C5SA 3OZWA 5KYUA 3WZ2A 2XZOA 1PG2A 3WMEA 2VP6A 4YXWA 4YAFA 2GQ0A 1RTTA 3RYHA 4DSUA 1G9TA 3KAJA 2NYRA 1GYPA 1KDOA 1QVRA 2YOFA 2E0IA 3G82C 3O94A 3PTZA 4Y2JA 1RRCA 4PPGA 4CUZA 2GF9A 2CHEA 1XTSA 3BRWA 5DGDA 5TVGA 4K2AA 1H2AS 4RV5A 1IK4A 4K03A 3L8YA 3RRYA 6REQA 4TRNA 3M2TA 3C85A 5IWAB 1U94A 2CFOA 2E82A 3PYXA 4J8PA 4AK9A 1GQRA 3W5BA 3K5IA 3KQKA 1C9EA 1W2GA 2IZ0A 3FNEA 2Y93A 4PLPA 5A9TA 1K2VN 4MGKR 4EJSC 2RBKA 3HRIA 1GP2A 1A2QA 1H0RA 1UANA 1LH0A 2CW5A 2GMWA 2SBTA 2A3RA 3ANTA 3HMQA 5L7YA 6REQB 2HR1A 1KRWA 4N5NA 3DAFA 2ZIXB 4RS3A 4LKRA 4YRMA 5KDLA 1LDEA 1C7RA 1EP2B 4RA9A 5JEDA 1L5SA 1ULSA 2WUVA 4I4IA 2JZCA 2WM2A 2X1MA 2GRUA 3HKDB 1TUIA 2CNWA 3DULA 4C9BA 4RJTA 5EJ5A 2CNBA 1VLHA 4QOJA 1DO0A 2O54A 2Z1NA 1XZNA 4BFCA 1WBDA 2FRDA 3DDUA 5BWNA 1VZ2A 2LTAA 3EISA 3NJRA 4MEAA 3KO8A 1NXSA 4KWCA 4RIGA 4DA9A 1ZIDA 3BAZA 1MW9X 2QXTA 3I9FA 2G7MC 4Y6GB 4C08A 4MW6A 1EAYA 1OIWA 2PRKA 2HX1A 4ND4A 1DC6A 2XMQA 1Q7CA 3LTNC 4KFTA 1VPVA 2WJGA 1U3FA 3TOCA 2BGMA 3DDSA 3P2EA 5EXXA 1JQBA 5HRCA 1QR2A 3I92A 4B6PA 4C3ZA 1DQPA 1ZH0A 3A0UA 5AK4A 3AIKA 2CXOA 3DLPX 2CDBA 4MARA 2PZKA 4C2TA 3JYPA 1COZA 4HK4A 4JJ6A 4KP7A 1ZUWA 3T9DA 3ZI4A 4BVEA 4RIEA 1Y3CE 3L84A 1XD2B 3LU1A 2I7CA 3T3NA 6CHYA 4YR9A 1ESNA 3KJNA 1EHCA 4HGOA 4QLAA 5LQSA 1A98A 3UB2A 4QJBA 4CFYA 3EHEA 1ZW6A 1EAMA 1N2CE 3HA7A 5JVDF 4DV4B 4WCDA 2NTVA 4RA6A 2I5PO 4BO7A 1JNYA 5JCJA 4AUNA 6GPBA 1TKRA 2QPAA 3NV9A 1GPUA 2VA9A 3HCOA 3P32A 4ON9A 3TGLA 1XD9A 4JJ4A 3W8EA 1D8TA 4U7JA 1JFSA 1MGOA 1PWZA 3MJFA 2YASA 3R6WA 2HA5A 3TLGA 4JU9A 2X3FA 2YBDA 2R5WA 4BKRA 4W5RA 3M81A 3W5CA 4BGEA 1ZA2A 4EI2A 5CT9A 4BLUA 2V0CA 1SKUA 5K05A 2OCDA 3FMPB 3N74A 5GOTA 5JROA 2G9NA 1F0NA 4HYEA 1N77A 2PH5A 1NX9A 3EXHC 2PJDA 5EWLA 2HBZA 3N7UA 1KSJA 1CVRA 4WFIA 1GTMA 1QS0A 3PZBA 4EZIA 4JKIA 5CIYA 2HIGA 1H1DA 3E9YA 5G4LA 4YV2A 2WTBA 5A6SA 5IT9A 4C78A 5LYYA 1OJLA 1L1RA 4ARUA 4BO1A 1ISHA 1H9AA 1UQUA 4JJFA 4D4GA 1YHNA 4IBOA 1CUXA 4O59O 4KUHA 4PNEA 3HCCA 3UUWA 4DLWA 1PU2A 3L7JA 3HY6A 2J0SA 1XJ5A 4PSUA 1PDVA 4PSAA 3WGVA 3W3AD 1T6ZA 4JV5B 3KYIB 3SX4A 2LDBA 4WK0B 1DPGA 1NBWB 2H4FA 3SHQA 3A32A 2PKQP 1JHRA 1T6BY 1P7WA 2CLHB 2R48A 2V9PA 2Y1DA 5AOAA 3DEIA 3S2ZA 4CV3A 3GLIA 4WW0A 4IV8A 4OM7A 3W5UA 1MXHA 4B74A 2ZOSA 4I8XA 3FNIA 2E48A 4WZBE 1U4SA 1WAMA 2VBFA 4ENPA 5JSUA 1SHZA 1GR1A 3AEUA 1C8KA 4R84A 2YW9A 4F0JA 1VPTA 2UAGA 2PU5A 2Z43A 3AY7A 2CHVA 4XB2A 1SXJA 2BEVA 2VP5A 2ZI6A 3Q1LA 4RF2A 5D3MA 5DV9A 3ZEAA 4EHDA 4PG4A 2PX3A 5I45A 2QP4A 4E30A 1M6WA 4UTXA 4D6XA 2LDXA 3QY0A 4P3OA 3OECA 1JG3A 2QE6A 3WTCA 2HQRA 3WGNA 5F9FA 5CA1F 5IHPA 1EXMA 2K5UA 3VXKA 5AW6A 5B6IA 4NCNA 3SZ3A 2HT6A 1ND5A 1Z07A 4J0IA 1ATIA 5JSZB 1ZOOA 4Y7DA 3GO4A 2PZGA 3T38A 4F8EA 1OGJA 2RCYA 1V0JA 1U0EA 1RQXA 1RPAA 4KFSA 2ZVDA 3SFTA 3EH1A 1VSVA 3DMTA 3CUVA 4ISCA 5COAA 5REQA 2QTNA 3I6MA 5HP4A 4I1PA 2JFUA 5GM2A 2G0TA 1T5HX 3AR6A 3R44A 3QZUA 3DHNA 1MV8A 3L8ZA 1QRRA 3MBIA 3IE1A 3JYQA 1T9CA 5BYJA 4NOLA 4CMEC 4BNJA 3SWWA 3H65A 4R8VA 3U13A 1WCIB 5ENVA 3BWCA 4F72A 1JTEA 2B5OA 3PFFA 3QUTA 5JYBA 2LXNA 1JI3A 5IJXA 1TIPA 3ESDA 3NBZC 1RKXA 2DQKA 5ICEA 3GLQA 1FS6A 3EVAA 2QTVB 1CY7A 5J2UF 3UOWA 3ZCSA 3F1KA 4P0PB 2CDRA 5KHOC 1QUEA 1VRCA 3QYFA 2A6PA 3RS5A 1KJ8A 3IB6A 4LJKA 4CL0A 1Z4JA 4WBNA 5K8CA 1QRSA 3NFRA 1TPZA 2Q6TA 3ZWOA 1IY0A 1U2DC 1YRAA 1AHIA 2Q0QA 3A2LA 3AINA 4U63A 4EZBA 1K8QA 2RI1A 3RQSA 2NX2A 1FXWA 3NYWA 1P6UA 3IAAA 3MWDB 4IYRA 2P9FA 3FYUA 3RFUA 4GYWA 4BRSA 1HA3A 2P3LA 3GCZA 4G89A 1NXWA 4N18A 4QSHA 4DCUA 1CFJA 3MC1A 3GIWA 4WGGA 3WHLA 2HQBA 3Q3IA 4P81A 3R3YA 4EYGA 2NSDA 3B6EA 4MQBA 5BV1A 3LVFO 4LF6B 1GZ4A 3HUUA 4FINA 2GHIA 1PLLA 2BVNA 4FE4A 5CFOA 4S1TA 5AXDA 3H5VA 3IE0A 3H5TA 2Y1GA 3RVSA 2AN3A 1Q7RA 2R1ZA 1EVKA 1HDEA 1M7HA 1TX4B 1YJQA 3PGVA 4GX1A 4ILEA 1YFKA 2M1ZA 4ND6A 2WPDD 5CW2A 5ITZB 2F3QA 1J8QA 2AZ4A 2I3BA 4UUMA 2BE7A 4UBKA 4KIWA 5CFPA 4OJQA 3LO8A 2VT2A 1Z0UA 3EDRA 5IVHA 2WIFA 4OP3A 1FP6A 1FRFS 1KJIA 1OV4A 2Q45A 2B98A 3SDSA 4XFKA 2I8LA 1AA6A 3MINB 5DE3A 1MO4A 3QVUA 1XXHB 2G72A 4KO8A 3WK7A 1US8B 2ID9A 3DHYA 1GRQA 4JP8A 3AWDA 1UFQA 2B61A 3NJ8A 4OEHA 3Q3JB 3KQNA 3KZOA 3RTBA 2YVQA 2Y1XA 3CLKA 4R9SA 2QLFA 2R60A 2FUEA 4FTWA 1PEYA 5G0TA 1LJUA 3R3JA 7ADHA 3DAOA 3HV0A 3I3OA 1CUHA 4O0MA 5K9ZA 1QH0A 3CZAA 3L6RA 3HUTA 3V5NA 2GVZC 3D4IA 1CHNA 1SUEA 3LXXA 5CFRA 1O9BA 2BBWA 1G5IA 4YMIA 4AJ9A 4D9KA 4QUIA 4U6QA 2VT3A 1XAJA 3FR8A 2A92A 5FYQA 4UM9B 3RB8A 2AE2A 3AHGA 4P31A 1NQ5A 2ZBEA 1QK5A 1Y3IA 5CBPB 3MK31 1W87A 3A6LA 4OQMA 4AW9A 3PLNA 3V2HA 1BE0A 5KYYA 1ZMTA 5EPEA 2WMYA 1VL8A 4HNAB 3RTGA 1EMDA 1BWQA 5EFOA 2ZT6A 5BR7A 1U8YA 1G38A 3F5FA 2IUSA 4W5WA 4BQQA 2B4YA 1ZBQA 4DG5A 2OZPA 3STVA 2OCPA 1G5TA 3ZV4A 4BCDA 2FPOA 2NO9A 3T3PB 3UOGA 4MMXB 1TZMA 2IEBA 5KNCD 2QD4A 1NVAA 1X0XA 1PR6A 3DXZA 1XELA 2EZ4A 3B3GA 3PCXA 4GQIA 1RFLA 4M8KA 4CQMA 4CEHA 3OJLA 4AX4A 3N2GB 4UUQA 4PZZA 1OWOA 4Y1FA 3N3BC 1Z6TA 4X66B 1XBTA 2YMMA 4NY1A 5E4YA 2RKOA 1COWD 4MYDA 4F6RB 2VRCD 4MGIR 2DHQA 3PFCA 4CM8B 3LBYA 5A3JA 5K6AC 3KR1A 1DWUA 3OZGA 3UQZA 4DC0A 1WKBA 1VCOA 4RPGA 3RHFA 1RRPA 2Q8QA 1UQTA 4O4IA 3WQBA 1AXEA 1N9KA 1E3IA 2DPHA 2DCMA 2E4AA 3LECA 3H4TA 1PGQA 2WJJA 2IXGA 3V4RA 1YB7A 2IHZA 1UIRA 3L1KA 3W05A 2OGSA 2RHBA 4JYZA 3MAGA 1EFLA 4PXSA 1SCAA 2B37A 2PXXA 1PYGA 4WADA 1NG9A 2ZZMA 3CIOA 4G8CA 4P98A 3RREA 2HK6A 1DAFA 2OO5A 4TYQA 4WBXC 1IXYA 4IH9A 1VHQA 2HUPA 3LY5A 3ISVA 3LHIA 4UMDA 1Y4UA 4LC9A 1V25A 2VUIB 4R7ZA 1E1RD 1MX5A 5HG0A 4BIMA 2ZAYA 2WR8A 3E5RA 2YWXA 3TB6A 2AYXA 3GNSA 3ESAA 3FTDA 2DY1A 2GCNA 1XTPA 3B5JA 1M76A 2QJOA 4QX6A 3AK4A 2BCGY 3SS9X 4C20A 1MH9A 3SE0A 2WMNB 5HOEA 3L0YA 2ET6A 3EMDA 4ND5A 3QPCA 1X9GA 1Y8ZA 1QLWA 4I7EA 5FPQA 2HTEA 1TVEA 3KT8A 4G4JA 2G6TA 3K73O 3ESZA 5ERGB 1SUFA 1NBMD 1VCHA 2QX4A 1PV4A 4POAA 2C4UA 3OCUA 3OZUA 1ZONA 1WEHA 2D7DA 5DEIA 1JTVA 3VRHA 4D9NA 3FZQA 1SG9A 1U0GA 2WVAA 2X0IA 2SHKA 4QYWA 5DNCA 1DZIA 2VTDA 2CHQA 3WOVA 5IK2D 2I3ZA 1HF3A 1SOUA 2FPWA 3AR4A 7REQA 4J9VA 3KZVA 3QKSB 4U5XA 4J0HA 2L69A 3N2NA 3OOSA 4PHTA 2YJ4A 5F98A 3THSA 3HL4A 1II8A 1FLAA 4I0WB 4G4SP 3BIFA 3L1VA 3CRMA 4XQGA 4ZOAA 2IYRA 5GONF 4TL6A 2GH1A 3H9UA 4YBRA 1P2GA 3MYRA 2C92A 4PTYA 4PN7A 2SECE 2F8SA 4N5LA 5E3HA 3QU7A 4G0MA 4CLXA 4DUPA 4QYIB 3A25A 2RGUA 5KKCA 4LXGA 1J8MF 2R1TA 5K6TA 3HK2A 4FIDA 4EO4A 3L41A 3L7YA 3N76A 2KB0A 1Q0UA 1KERA 4S0ZA 3FOZA 4BNLA 1UODA 1YBFA 2EX0A 3QKSA 5IWCA 1P4AA 3CSUA 3S28A 3PXAA 4N9WA 4UREA 3HPRA 4REMA 1O1YA 5B5SA 3UC5A 1O6FA 4A2PA 3OPVA 3EX7C 4LVNA 5DBHX 1UC8A 4PICA 3V1YA 2GILA 3K0FB 4I50A 1TO1E 5TJ9A 3WYAA 1SPXA 4R1LA 2XWQA 4YJHB 1A8IA 5KQMA 1RMTA 2W4MA 4KQKA 4COOA 4IL5A 4OA5A 4UEKA 2GO7A 1KDPA 4FFPA 1EI9A 1T36B 3FKJA 5ES4B 3I62A 3SHOA 1VLZA 1PWEA 1OY1A 3CNLA 3LVBA 2P9JA 4CG0A 1PSDA 1XZPA 4HAOA 1QTQA 4NJOA 2A33A 3RRJA 2YMPA 3LPMA 2GYYA 4HXYA 1DC7A 4ZN6A 3LC2O 2BKAA 3KUCA 1E2QA 1U1DA 2JJQA 4KE7A 1ZEMA 1XKQA 3LVRE 1PJBA 2J0UB 3IFSA 3P0RA 2FMTA 1K4MA 2W22A 3PS9A 1FFEA 5K45A 4M7RA 4ZGWA 3T54A 3K8ZA 3N2LA 1M7BA 1VGQA 1GFIA 4GKAA 1KQNA 1ZGCA 4HLUA 5T4FA 1MO2A 3PQFA 5AM3A 1J39A 1ZIOA 2QE7A 1S3FA 1N25A 1SCKA 2R8EA 1S89A 4HDMA 4A2QA 5KX5F 5C52B 3MWEB 2EFEB 2GRAA 2X0DA 2Y1KA 2A0WA 3WGMA 1C80A 2P0AA 3RI3A 3WLSA 5KNDH 4WLUA 5LZ2A 1LSUA 2QAIA 2Z5FA 3AEKB 4N0EA 4RGVA 1I2CA 4O02B 2F3RA 4IG4A 4BQNA 5EN4A 5CRIA 5A5VA 2W2NA 4NI5A 3CRVA 1CERA 4LC0A 3U60B 2I4LA 3G6KA 2XMZA 1OPXA 1GR0A 3OU7A 621PA 2ZB3A 3NCTA 3ORRA 3SFVA 2W2VA 3ZZNA 4F46A 3V46A 1RE0A 2C4NA 2N42A 1U7XA 3D31A 1XJCA 2C78A 1G4HA 1CZOA 1WWKA 5K2MA 3HCWA 1O97C 4J4TA 3RIEA 2X2PA 4G5HA 4BO2A 3HTXA 3Q2KA 3HU2A 1U3WA 3VSAA 4OUKX 4B80A 1K97A 3L1UA 5M3BA 2AI1A 3OIDA 1X7YB 3PQ7A 2DBVO 5HFJA 2Y4OA 3U7QB 4B4KA 4M8IA 4XZ3A 2ONCA 3D4NA 3DZKA 1M0EA 4IJMA 3TCKA 1YI8A 2Q3LA 3ZGLA 3PUYA 2Q1YA 3EWNA 3SIRA 3U4AA 2W6IA 3BICA 1QP4A 1P7CA 1T25A 2IBMA 2PUFA 4YIHA 1CEEA 1UZMA 1X39A 5TXGA 4PGGA 4JL6A 4IXMA 4PQRA 3K5WA 4R1OA 4UU0A 4GZMA 1XZMA 3FI9A 4WVLA 1R5JA 4GI1A 3RVOA 1G17A 3U37A 4J3JA 4EABA 5FFNA 5JXHA 5FV4A 1S9DA 4UQLA 3OT5A 3U1VA 4MROA 2X6RA 1J1ZA 4FC7A 1VOTA 4IIJA 2P5TB 1JXMA 4ONEA 5J23A 2R6R1 4MO2A 4AZSA 2BHTA 1P1IA 2NO1A 5LLDA 1WU8A 1E1MA 1GNTA 2P2DA 1MF7A 2QD1A 3MW8A 4HAXA 2C95A 3FB1A 3V4ZA 2GD1O 1QZZA 3ZVRA 4MAAA 2ZYRA 1VPDA 2CBGA 1JGTA 4C3VA 5BNTA 3G2KA 1TKAA 2YN2A 4FYMA 1USGA 3Q40A 1ADGA 4MGYR 4TWIA 3VR6D 3BMNB 2D2FA 5JXWA 3DZJA 3LE8A 2PSHA 1UJ4A 2QXYA 2F9LA 4B8ZA 4D42A 1TA0A 1R5NA 3K9QO 3OIUA 3ZH9B 2FPUA 2PCJA 3ONFA 1S96A 1CF9A 2IYNA 3H2IA 2W2XA 3L02A 3L7AA 1YR7A 1WPGA 3RYFB 4B6FA 2HSJA 5BV7A 1RLTA 4QJIA 3RR2A 3WNQA 3SQNA 4DA7A 1E32A 3WLHA 3G8CA 3MFQA 2HF7A 2I2FA 1SJ9A 2H1HA 2QL7A 2RGCA 4Y9DA 4BVLA 4OI4A 2XVAA 2FWJA 3JVIA 4BJHB 3NHJA 1HO3A 3ZHOA 1JZQA 1XZCA 2E5WA 3DP7A 4REOA 4EA8A 1VIMA 2X9VA 2PEZA 2PZEA 3LPAA 1PK8A 1NI3A 4L8YA 3RJZA 1PS8A 5KOHB 2D06A 4MR8B 4CLEA 1ETUA 3QIAA 3GRAA 2JLUA 5ADVA 3WLOA 1S3SA 2XDQB 4FGLA 1Q83A 1WZNA 2QYOA 3IP8A 3O8BA 3U3XA 3TVYA 3T3MB 3DMPA 4BNYA 3RS3A 3RVLA 2A5YB 3ZYZA 3GVIA 4DB4A 4BLWA 1AO0A 3S44A 3JVVA 4EEXA 3KXDA 2YKGA 4IDFA 2QAGA 2DR0A 3A1DA 2I67A 2BH9A 1L4LA 2HUNA 4LYYA 1UK8A 3TL3A 5C3UA 4YB8A 3ZE1B 4C0SA 2XXJA 3SS8A 1CVLA 3SCZA 1O95D 5DM70 3TVDA 5CYOA 1SBIA 2W48A 4PO3X 3ZE6A 1I7QB 1K4YA 1A97A 3FTCA 1W93A 2QYTA 3HGMA 4BGVA 4UD2A 4WVFA 2CL0X 5KTTA 3F71A 2GN2A 4CU2A 2XBMA 5FUQA 2C1XA 2PL1A 3RS4A 2BGJA 5KVQA 4XX1A 2OBMA 3IXMA 4NOJA 3OCJA 3NBMA 3QPVA 1A9SA 2VAMA 2ODTX 1KE2A 2JCSA 3TWOA 1K3TA 2CHFA 2R4UA 3HDHA 5MFPA 4UQPA 1QRTA 3KG2A 4FGUA 2FQQA 1VGVA 4GLJA 1QHHB 3HV2A 3UXEA 3TBFA 5I7OA 1ODCA 4RIFA 3UM9A 1RRFA 5EXTA 3USCS 1X3SA 1BDIA 2RI6A 4NX2A 2X9GA 4D9IA 1QGAA 4WI1A 5CCXA 2ILTA 4ZD6A 1ZIYA 1A4RA 2GRJA 1ZN8A 3EA5A 3BWBA 4PFSA 5EJAA 3DO6A 3H6KA 2DLNA 5JYCA 2HJVA 3I42A 4H6PA 3NHRA 1VI6A 5BN5A 3GXBA 1G1MA 2J4CA 4WXPA 5AVXA 4LYAA 1H8ED 3RF6A 1M5TA 5F51A 1NF3A 4CCAA 1QHHA 4DRZA 5J2UA 1JYSA 1F4PA 3IBGA 1GUBA 3ZV3A 5BSFA 1AG9A 1CE8B 2B8NA 2QRPA 1JKIA 4O1MA 4V0NA 4XD2A 4D0SA 4DCOA 2XKBA 4EUSA 4YT4A 1PJ8A 2FPIB 5FUXA 1G9SA 1L7NA 2EJCA 2XQIA 2VNJA 5B58C 2BFPA 1RJGA 2ZIWB 3G8AA 2CSUA 4BGIA 4DA0A 4WZ6A 2FMIA 5EWJB 3AEKA 3H1EA 1KRHA 1Y42X 1YE5A 1ZVMA 5CHYA 3NXSA 3U7EB 4KNVA 2YS7A 2V7BA 4IX9A 2DGDA 2HXSA 1UFVA 2GJ9A 3QU4A 4H60A 1A8UA 2XQJA 1V4NA 5E9WA 1AM4D 1QHIA 2H1OA 2XF2A 2A1UA 4HY3A 4LK3A 3ZV5A 2JVKA 3OA2A 3P2KA 4IRXA 3TI7A 1OTYA 1IOWA 4TKUA 1NI5A 5B3AA 3EB9A 3HADA 1U2ZA 3EXEB 3R1IA 5LQDA 2W6CX 3BIJA 3AETA 1Z15A 2BGUA 2FN4A 3EK2A 3LRPA 1YRYE 1QJCA 3C98A 4K9KA 4RO0A 4YAEA 2QENA 3EBOA 1GSHA 2WU8A 2V97A 4LV6A 4M60A 2BPOA 3CLUD 6YASA 4N48A 3RW9A 1JQJC 3PI6A 2ZI3A 1FJ2A 3IAXA 3I72A 3STXA 3SAJA 4RANA 4YUXA 2I6GA 5BSGA 5FTMA 2RK3A 3A6HA 4GD3Q 4BX3A 5BUCA 5IAJA 1QGYA 1TEXA 3PSHA 3IPLA 5J5CA 4C89A 2EJTA 4Q3LA 3MVEA 3PVZA 2MWMA 4IVNA 4CLRB 5J2TA 1VIYA 3AL2A 4QXPA 3NALA 3M0EA 4QRHA 3ZZTA 3ZCQA 2EP7A 4Q7QA 3JYOA 4G1UC 3AHCA 2HLDA 2QPOA 3LT4A 2C3MA 4GMGA 2MYPA 5SY4A 1FE8A 1KI1A 1DUSA 3Q87B 4MWZA 4PF1A 3U9TA 1Z33A 4NCIA 4BLPA 2X8WA 1KYTA 2XQGA 2OXEA 2C20A 4FWBA 1Y8QB 3RFCA 3QELB 4KDCA 2VQEB 1EU1A 3AHHA 3FKSD 3PCTA 2NACA 2YJTD 4DMGA 3NNSA 3PJFA 4FMCB 4FILA 2H7YA 2JAHA 4PLFA 2HBYA 3QEBZ 1RRGA 4EP1A 4QBFA 1A8HA 2CLMB 2QLNA 4G0ZA 2YHSA 1SC9A 1GTZA 3A3KA 1FDRA 4ZP1A 4D0NA 3QXGA 4QPNA 2PZJA 4EY4A 3Q5DA 3H0KA 4UNIA 2X7JA 1J99A 1NXTA 1RIFA 2ILVA 3GN1A 4I55A 4NE2A 1MA0A 1DU4A 1JFFA 1OBOA 1R3DA 1T9DA 2NNLD 1CCWA 4R1NA 4EF5A 1QG6A 4MDEA 4MQFA 1FFBA 2P6OA 5TMDA 3TLCA 5JAQA 1SK9A 2WM9B 4IVRA 5ECGC 4XYEA 2UXDB 4IGKA 3TD6A 2QRVB 1T3HA 3FUWA 3H8VA 5CXUA 1CX9B 1UJ2A 3DBLA 1NWHA 3I39X 4FHDA 2Z2XA 4Q47A 5TGDA 1NW8A 1G5RA 1ZUNA 1YR2A 3QBJA 2ZWVA 4XQ9A 2OFFA 2XZLA 1IRIA 4HDCA 3U0BA 4H7KA 3HR7A 4HDNA 4KV7A 2XMSA 2J4DA 5LDDC 2FZ5A 4GEKA 1BZYA 5AW4A 1X77A 1ZEJA 1PFQA 1R1DA 4XWWA 4L1KA 2I6XA 2B4TO 1L4GA 3I01M 1XK6A 4G1MB 2BFEA 2WWIA 3MCTA 1O95A 3WLQA 2HWYA 3ZQ4A 4Q37A 4RD1A 3JQAB 1DEAA 1R6BX 4IQ4A 4ZEVA 1C0EA 1L8OA 4D4HA 2JZNA 1YA6A 3TLJA 1VBFA 1AU9A 4ANFA 3C3XA 2WI8A 3ELUA 3QVTA 4XWYA 2A9PA 3JWGA 5PGMA 4P0TA 3VMMA 1NBMA 4LC1A 2FUG6 1ZO8A 2YJ6A 2R5NA 2GN1A 1AQUA 1UBUS 2ZUUA 2ZUVA 2PX8A 3KM0A 2CYAA 3PDHA 4FYWA 2BC9A 3SIWA 4F84A 1NJ5A 4UOEA 2G1JA 5B4VA 3WGQA 1IZ8A 1VE6A 4CM6A 2QRQA 5CCEA 4ZI7F 2J9XB 5DP2A 1D1PA 5JI2E 1W46A 5TQJA 1FSZA 4LI0A 2W4IA 4G8JA 1YUNA 5BPHA 4M9UA 1YVPA 3BQNB 2G17A 3LUKA 5KKNB 5AK6A 3PFHA 1U8CB 3BRCA 1VCIA 2ZWMA 2ZTSA 4I3HA 2VQ3A 2XTNA 4HEA6 4P32A 5FEMA 4TLLB 2AA3A 2DUMA 4BMDA 1TQDA 4H27A 2P4UA 3MM4A 3PICA 1CRZA 3LL7A 4C03A 3UYLA 2I33A 3TW8B 2CF6A 5F12A 1AJEA 4KMSA 1W8IA 2A7XA 5LXTF 3ZVMA 1JB1A 3P96A 4BFLA 2JFPA 4G5RA 5JS7A 1VRVA 1IZ9A 3IDSA 3UNXA 4PC3A 5BQPA 3VTKA 2FHPA 5BWBA 1C7JA 4GRAA 3I1IA 4RV9A 1Y4DE 4UHCA 1Y9ZA 5FWXA 3TLKA 5ALPA 2Z4SA 4V0RA 4BLQA 1YUBA 5L6LB 1KU0A 2Q4DA 3Q7EA 3ILXA 3QMPA 4UTOA 1Q6YA 4H7FA 4DHEA 3KFVA 3R0JA 1DC3A 2CCGA 1Z4LA 3GNQA 4H17A 1FDUA 4AY6A 3DE3X 3MT8A 4MUJA 1QIGA 1QIHA 4IKPA 2GLTA 4G5FA 1SXQA 1KORA 2IT1A 1NM5C 1WVMA 3S7TA 3ROXA 5JD4A 2DR3A 3BGSA 4MRMB 4WTOA 4JLVA 3VYVA 1IULA 3U39A 2ZE7A 2HRDA 3QPBA 4KGXA 2GUWA 4RFSB 5EMMA 2I03A 5TY0A 5GJVC 1W25A 3AKCA 4JOQA 1H8EA 5SY6A 1ODSA 2CNLA 2AI3A 3COZA 1N5JA 2IBSA 3R7FA 1KP3A 3EWAA 4TRMA 1Y8CA 3O93A 2VATA 2HH9A 4I50F 5H16A 5DNAA 5LQJA 3DOUA 4FR2A 5CBKA 1CZHA 1EG7A 2PQMA 2TS1A 1UWLA 2Y99A 3AH8A 3RUAA 4US0R 1B1CA 2JJYA 1RWMA 1IBCA 4OYRA 1SD5A 1AGNA 2UU9B 3NP7A 2D5CA 1IEQA 2ZSUA 2PKRA 5ALFA 4C7JA 1G291 1O77A 2AW5A 2EARA 2CSXA 3GU3A 4UM5A 1Y34E 3BXEA 5IC5A 3HXLA 2P7HA 4WZBA 4FGJA 1QH8A 4OOFA 2QR5A 1D1TA 3H1AA 3GLIE 1PJ3A 1ZM3A 4YMSA 3N5CA 3FNRA 2KBFA 3JASB 5T5QA 3I4CA 2OM2A 1CUYA 2P6RA 3PQ4A 2XKKA 2BM9A 5DTMA 4GL2A 1E18A 1JPJA 3QXXA 3HU1A 5DYTA 3OFKA 1JKMA 2YVAA 2XSZA 4NU5A 2OC9A 2OLJA 1C0IA 2OD2A 2VT6A 2PEYA 3GEBA 1HBJA 2GPAA 3MEQA 4X61A 2H5IA 5GV7A 5SZHB 1CDOA 4Q16A 3CE6A 3Q3HA 2VEOA 5BN3B 1NWCA 5GPBA 4G9BA 5A3SA 1QVZA 3BWDD 4R41A 3FM9A 4DYVA 4CM4B 2AOTA 2CWWA 1IATA 1ZOIA 2CBXA 1FX1A 2WA1A 1KZHA 1HE4A 2IHJA 1W1UA 1RAHA 1ZK4A 3QOWA 1DQSA 4Q01A 4ZOLA 1SOVA 1P5ZB 2GS9A 3HJRA 3R76A 1P9NA 3LLSA 3VR2D 2E1RA 1IY1A 3SG0A 2UDPA 2QMZA 3K9BA 3NIWA 4BCBA 4YXFA 5DHAA 5JW6A 3D6MA 1YRLA 4KUGA 4DPKA 3A06A 3SZMA 2PGAA 4NVRA 4PO8A 5EIBD 5LXTA 3GK3A 3F4LA 3EIQA 3LHKA 2OSVA 3GUVA 3KU1A 4EJFA 5KQGA 3OIFA 1WMSA 3OUTA 4F91B 5JALA 1CS0B 1YHZA 2XECA 3W77A 5B1HA 3BZWA 1AKMA 2F1IA 2GM9A 4J16A 4QU9A 4R6WA 1UXJA 4IX1A 4Y6PA 5I7EA 2E6UX 5LZ4A 1A0OA 5EMKA 3ZWXA 1KVQA 2YXDA 1PNOA 1E2JA 4NCAA 4A0GA 1VMAA 1XROA 3I4LA 1CU1A 4LBVA 3UFXB 3GDGA 4R2MA 1E2GA 1KQGA 3I01A 4KK4A 4MO9A 2YYYA 4YCDA 1WEKA 1SBCA 4D9BA 1EIWA 2V7QA 5IBCA 1MVLA 2D00A 5I7SA 1MVOA 1Q1GA 1SB9A 1CXZA 5AHOA 1L5YA 2I80A 3DZDA 3ICWA 1HEUA 1M2OA 3OEED 2BBTA 5BRAA 1YZNA 4O4HB 3N1UA 3GPLA 2K2QB 1DIHA 2IRWA 2JCXA 4KVAA 1YZHA 5CM2Z 1UWCA 1G3IA 4XCXA 5TQ0A 5C2JB 3IP1A 3NAZA 5D3KA 3DT9A 1ZVVA 1C0KA 1YDHA 2JFZA 1G8KA 2OBBA 1D2GA 2PKXA 3BORA 2I22A 3HB4X 3I6QA 2VXYA 2GHRA 3ONWA 4G09A 4UCXA 1J20A 1D9ZA 4KQGA 1KSGA 3OQVA 5C34B 2FY8A 1NVBA 4DR1B 3DEJA 1SBYA 2ZUSA 5F3RA 3ZWMA 4L8LA 4Q4JA 4DV0B 1GDTA 2H06A 3AZOA 1OX4B 3V48A 1E3EA 4LFBB 3HP4A 2A1UB 4KN5A 3VVBA 2W6PA 1ATZA 3BWYA 3ONEA 1T6YA 1WVGA 3U3MA 5C7OO 2WRZA 4OCZA 2AXPA 3CT6A 3GCWA 2GPTA 5CYGA 5LLTA 3CGGA 3COVA 5E38A 3I34X 2I4MA 2OLKA 2ZB4A 4IZIA 5TQ0B 4XSVA 4RGYA 3TVTA 4QQRA 3WYFA 4Z4EA 1KJQA 2A3NA 3M4NA 4R2JA 3CTMA 1JG2A 2O3UA 2XQVA 3K92A 4S1WA 3TS1A 1M5RA 1SKYB 1D6JA 1TZ2A 2AQHA 4A6EA 4DRXA 4IEEA 2XE7A 3RSSA 5HUQA 2CYCA 3JPWA 4NARA 2I2DA 5LUAA 1QV9A 2ZSHA 2QJRA 2WFZA 3HVHA 1NIJA 3GRFA 4JXXA 1XCPA 4ND3A 3MJTA 1AT1A 1ZD2P 2GKSA 1P4GA 2CF5A 2H59A 2O2SA 2W6ZA 1XJQA 2ZTMA 3WWEA 5JZMA 1NUQA 2I34A 3D54D 3DDOA 1XMXA 3V00A 1NN5A 3IMFA 1QS0B 4O0LA 2GFQA 3TZ6A 3RGWS 4RA6B 4ZAFA 1M1XB 4YRDA 2J87A 4DLXA 2FOLA 2GA9A 1O8BA 1ESEA 2CXPA 3NAGA 1T5BA 1N5OX 2HCRA 3KXPA 4WFJA 1E3TA 2O2GA 5HKLA 3AFMA 4Q7KA 4LY6A 4LNUA 5THXA 5CD9A 3DVLA 3DBLB 1Z0DA 4NZZA 1JT9A 4M49A 4Z54A 3FDIA 4MQLA 1Z2NX 4QC2A 5HXAA 4HWOA 1EGQA 2AFHB 3DDZX 3OQ1A 1CF2O 5C81A 2P1DA 3WGIA 2ZRHA 3I09A 3WRYA 2FFJA 2LCQA 3TQQA 4UBMA 4EMSA 2DFKB 4C87A 4D79A 3UJNA 2DUWA 2PR7A 4MS1A 4XWTA 4JYAB 1LVHA 1Q1AA 3EPJA 1TDJA 2HAEA 4WCFB 1KVTA 1E9AA 1SC4A 5EP2A 1IWBB 1LC0A 4GVLA 3HCPA 3W04A 5HEKA 3UWKA 2A5FA 2CXHA 4B4UA 3KTDA 1G2PA 3NHMA 4U7FA 1ZY2A 4WMLA 1ECPA 2I2XB 3GH3A 4LMRA 3IVGA 4E7OA 1MFZA 3X43A 2CCJA 3FYSA 2BHNA 3O2JA 2BTOA 2XTJA 4C4YA 1SOWA 7MHTA 4YN3A 4BGUA 5D6OA 3EIUA 4YCJA 3FSEA 5CMLA 4E3ZA 1H2BA 5CIWA 3MWEA 5CTJA 1CLUA 2FK8A 1M34B 3RVDA 1Z2OX 4A16A 2FLKA 1WXIA 3E61A 3JAKB 1B2LA 3UN1A 1ZUHA 3F9RA 5EZYF 1JQ3A 3SXJA 5BVHB 2BFOA 4MWOA 1E2DA 3X2EA 5EXDA 4A73A 5F7XA 2J7PA 4XEHA 1NVUQ 1RFGE 2YMLA 3JASA 3COJA 2PLRA 2QTZA 5LD2B 3UG7A 5ESWA 3DVRX 2UUAB 2GPYA 3SIPA 5JNVA 1WUIS 2B2CA 4MNTA 2JS7A 1NXQA 2G25A 3G59A 1CJMA 1IPEA 1CUZA 2SCUB 4RZUA 5EFZA 3T15A 5MFZA 4O1IA 1L8XA 4BKMA 3E7PA 1PFYA 1QYCA 4M0DA 3ABIA 1J2TA 1SVUA 1CQIB 1U81A 3UMGA 1BJRE 3E3AA 4Q6WA 3UT6A 4ZV9A 4KXQA 3WL8A 3IO3A 1R9NA 2FDRA 2HLDD 121PA 2H2DA 2WYWA 3VNVA 3U4IA 3AJDA 4GOLD 4C4TA 4KB5A 3ROMA 3TAUA 2NAFA 3PA8A 4OIFA 4CF7A 5AM0A 1QAOA 4L2IB 3R8CA 5A6VA 4N76A 3EXG1 4PBSA 4NH0A 4EITA 1ADCA 3MMSA 2W2LD 3RABA 4DWVA 2FN8A 4L02A 5B57C 1JBQA 3NHZA 1Q1BA 4HAZA 3UANA 4BZWA 4CQMB 5KPJA 4KR2A 4XWAA 1U8XX 3ZX5A 1QNFA 4PQEA 4CIYA 1GTG1 5L3QA 2MYTA 4Z9YA 3L0PA 4IICA 1VG8A 2V6JA 4RCYA 4ZJPA 3M34A 2CVOA 5JDIA 2BGIA 4CTOA 4E11A 4PWZA 1TAGA 3AV0B 5JXIA 4PZ0A 6Q21A 2FOXA 3OZAA 5KTPA 1OAAA 5LNK1 3W78A 4V0SA 4YRSA 3IPCA 4C4OA 2HDOA 1FMTA 1IQRA 2AQKA 4HRXA 5JSQA 1FP4A 3ZE0B 1E0AA 5IULC 4P4SA 3NEYA 1FFYA 5T4BA 1QG0A 1ZK0A 3RLIA 1OFHA 2P3QA 3NTOA 4NHEA 4ZO4A 3BE4A 3ZNPA 4GZLA 1NFQA 5BSMA 4EDFA 4TTAA 1GCUA 2ZSFA 3HB1A