3T4UA

L29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWILDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L29I Mutation in an Aryl Esterase from Pseudomonas fluorescens Leads to Unique Peptide Flip and Increased Activity
rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase, hydrloase
molecule keywords Arylesterase
total genus 103
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t4uA00
3Q0TA 3E4DA 1VE7A 2OQIA 2ZJ7A 3FVTA 1LZLA 4LXGA 2OGTA 3I1YA 1VLQA 3AINA 4IH1A 3KWFA 4W1PA 2WHPA 4Q82A 4OUKX 4X00A 3C5WP 1L7AA 3WK5A 3WK6A 4AMZA 1I6WA 5DLPA 1U2EA 4UBOA 5ALMA 1BCSA 5EIHA 1W52X 1EK1A 5EHZA 1LGYA 5AICA 1N1MA 4IH4A 2B61A 2GBIA 4I4CA 1UXOA 1CEXA 3D4LA 5FP0A 2XUJA 1KU6A 2HM7A 3KD2A 1BROA 3QVMA 3VXKA 4G8DA 3HSSA 1RWQA 2CEKA 3I2JA 1P0QA 5LZ2A 3ZWQA 1KEZA 3H04A 1PJAA 1THTA 4OD0A 3ESAA 4KE6A 3IDAA 1UT6A 1GZ7A 2XT0A 5T4BA 1O6FA 1ODCA 1LPNA 3OOSA 2J4CA 3F9CA 1G66A 2OGSA 1F0PA 4MQLA 4BATA 1VA4A 4X71A 3OC0A 2QVBA 2DQZA 1UKBA 3FVRA 1CUAA 1JU4A 1T2NA 1OXMA 2JGKA 4UFNA 4EBBA 1P0PA 3E1GA 5LZ8A 1IUNA 2C58A 3B12A 2I03A 5D3ZA 3EQ7A 5HCUA 4Z49A 5AI5A 1JU3A 4DLNA 3O4IA 1QIJA 1A7UA 1DX6A 1XRNA 2WFLB 1H2YA 3HLKA 5AKGA 3T4UA 2HRRA 4BCCA 4X6UA 4AX4A 4B80A 2R11A 1L7QA 4ROTA 5D6OA 5EFZA 1ODTC 4GW3A 4J7AA 4B82A 3PUIA 4BCBA 1GT6A 4YK7A 3WLAA 1ZD2P 4MJ3A 4MWTA 5C81A 4MEBA 4QLOA 3H1AA 2XUPA 5ALEA 2PUJA 2XUHA 5K3FA 3F96A 4HRXA 5F4ZA 2JIDA 2QS9A 2PPLA 3WK8A 3GROA 4L0CA 3TJMA 1BN7A 5ALIA 2PBLA 5CT9A 1TCAA 5HZGA 1QONA 2WIKA 5JADA 3HI4A 5DNVA 1UOOA 1DTEA 4P93A 1R1DA 2Z8ZA 4Y2RA 4BRSA 2H7YA 3A70A 1Q84A 3PFBA 4M0MA 3DKRA 1PFQA 3R3ZA 2DSNA 1LBSA 3WK4A 3IUNA 3CN9A 1YS2X 4PSUA 1P0MA 3DKKA 4DGQA 1E89A 1CIJA 4FBLA 5AIBA 1HL7A 4BE9A 2PL5A 3VVLA 4G4GA 4DNOA 5D3KA 3AIMA 4DM7A 1THGA 3BWXA 4BZZA 3G8YA 3WK9A 2FJPA 4B9EA 2YYSA 3W2TA 1F8UA 1YB7A 1NX9A 5JANA 1G4HA 3QITA 1R9MA 1TIBA 3D5EA 1C7IA 3S2ZA 2RAUA 3F8SA 3PFCA 1QO9A 3SWWA 3WYDA 3DL7A 1VXOA 1EI9A 3U1TA 4YASA 3QBJA 3D7RA 2JGIA 4CG3A 1SCIA 2WTNA 3DOIA 4X85A 5A7HA 5AO9A 4G9EA 5LLSA 4XVCA 5T4FA 5CW2A 1MT3A 2CKMA 3NUZA 4TGLA 3WA7A 3ANTA 2O7VA 3KDAA 4F5ZA 4FMPA 4DNFA 2JGFA 3M81A 3FYTA 3BIXA 4X3CA 5ALTA 2Z5GA 3DOHA 2CJPA 4BVKA 1Y7HA 5CBKA 2ACKA 5KWJA 1WB5A 5AIAA 2PM8A 2Z8XA 2ZSHA 4KACA 1ZOIA 2JBWA 3UUFA 3OM8A 4AMYA 2XQGA 1QJ4A 4L3WA 5HK9A 5ALHA 2ROQA 1IVYA 5AKZA 1MO2A 3I2FA 2BKLA 1QO7A 3KSRA 4X91A 2VSQA 4UBNA 3AZPA 4KJXA 2XDWA 1TRHA 2GYUA 3AFIA 3DCNA 3DNMA 1CR6A 2CUTA 2XUKA 3JW8A 5AM3A 4MEAA 4G1FA 3W9UA 3Q8WA 4CIBA 5T4HA 2D0DA 3NGMA 2B9VA 4KAAA 2BGRA 4GBGA 2E3JA 3VJKA 2VJDA 3C43A 1J06A 1CUDA 1BS9A 4GDMA 1RP1A 4B84A 4GWLA 3O4GA 3HXKA 3L1HA 2QT9A 5AI4A 3F67A 4JUIA 5JZSA 1JKMA 4BTVA 2FUKA 1FFEA 1Q0ZA 4PNZA 1CUFA 2WLSA 5EHNA 2V98A 4QLAA 1JJIA 4DMHA 5AP9A 5HKAA 4J0DA 2PSEA 3PICA 3W04A 2Y6VA 1K8QA 2ORYA 5EIAA 1DWOA 1XZGA 2C4HA 4OSEA 4BAUA 3TRDA 2DFPA 3WKDA 4W63A 3P2MA 3WQHA 4BC1A 1BRTA 5DJ5A 5HFNA 1AZWA 5LP1A 5LZ7A 4IO0A 4Q3OA 5AKIA 4J0GA 3JWEA 2I78A 3IBTA 4BTLA 1UZAA 1NU8A 4CCYB 5KWIA 3RK4A 3DDUA 4WFKA 3U0VA 1MNAA 1WCYA 5AOCA 3D2CA 1EINA 3OG9A 1HBJA 5SYMA 1MX1A 5LZ9A 1WPRA 1XQWA 4PW0A 3DS8A 3PUHA 4QA9A 5FPPA 3WWEA 1QIDA 2V96A 4H0CA 2LIPA 5HQ3A 2PVSA 2VA9A 1EHYA 5JIBA 4E11A 2QM0A 4E15A 1SFRA 1H23A 5DWDA 3WL8A 1YASA 1OILA 4BE4A 3F97A 4CG2A 3HYSA 5ALOA 3O95A 5FV4A 4FFWA 1W76A 3LIIA 2PKYX 2V97A 1XZEA 1ACJA 1XZAA 3PI6A 2XUGA 1H2ZA 2WFMA 3WWCA 4QDZA 1H22A 1TKRA 1FFDA 1XROA 2QRUA 1KU0A 3C8HA 3D0KA 1AQLA 4C88A 1E66A 1QIHA 1LPBB 1VE6A 3I2IA 4J0HA 4HS9A 1JFRA 5ALQA 4KYVA 2QUBA 2OQVA 5H3HA 5IVDA 4C01A 5JZBA 2WJ6A 4Q1VA 2XQKA 3I6ZA 3H17A 4H7FA 4QZVA 3ESDA 2VT6A 1YA4A 2CZQA 4EZIA 5JARA 4F60A 5ALZA 2IITA 1ZI8A 4GI1A 4UBMA 3FCYA 3O4JA 5ALJA 1Y7IA 4CCYA 5ALPA 1O6GA 2GYVA 2Y6UA 1VJ5A 1YA8A 2QTBA 5EGNA 4EY7A 3MUOA 1ZGCA 5JATA 5HK8A 2HA4A 5D7BA 3BF7A 2GZSA 5AKKA 1YAHA 4FHZA 3TGLA 1VXRA 5AKYA 4K6KA 2WJ3A 3QMVA 1XQVA 2G5PA 4Q05A 5CT5A 1XZHA 4FLFA 3EF3A 1K4YA 1ISPA 3QPDA 3WL6A 2G63A 3G9UA 2XUAA 3FSGA 1VA5A 4UHDA 4PSDA 3H2HA 2XMSA 4AN0A 5HKBA 3STTA 1EH5A 3ED1A 3O4HA 4QE3A 4PSCA 4Q3KA 4PQEA 2HRQA 2XMQA 1YB6A 1CUWA 4J0KA 1E3QA 4OU4A 5CURA 4KRYA 4Q34A 3V1KA 1QZ3A 3CN7A 2QMQA 5YASA 4U2GA 2XE4A 4U2BA 2CB9A 2C5GA 4N8DA 2QR5A 5E4YA 1F0NA 4ETWA 3VISA 1AUOA 1SC9A 2DCMA 2EDCA 5BWCA 1U4NA 2WIGA 4G4IA 4FLEA 1MN6A 3LLCA 3VDXA 3G0DA 3DJYA 1C7JA 3WKBA 2ZYSA 4UHHA 3QPCA 1CLEA 4MWSA 2HIHA 2WTMA 3VKFA 3C87A 4F21A 3BJMA 1S8OA 4KE8A 4NS4A 2J3DA 2JF0A 4BB0A 2HDWA 1P0IA 4HTAA 2HA2A 3EIOA 1WHTA 1J2EA 5AI6A 2WIFA 4JYMA 5K3AA 1AC5A 2W6CX 3WMRA 5K3FB 7YASA 5AM1A 2AJLI 1LBTA 4QDXA 2BAGA 4RE6A 4ZWNA 4CG1A 5CMLA 1XRRA 4OYLA 3HZOA 3DL4A 3E3AA 1XLUA 1J07A 4QDUA 4W9RA 1GXSA 4M0FA 4Y9SA 4N8SA 3STYA 2QJRA 3I6MA 2VJBA 3X3HA 5DNUA 5A7GA 2ONCA 4X6XA 3BDVA 3EBLA 1Q83A 4OPMA 3W9BA 1TCCA 4CFSA 2R8BA 3ZI7A 3C6YA 2PUHA 2VQ6A 3GBSA 4L9AA 5ALLA 3ZLVA 1XKTA 4EY8A 1IZ7A 4CIAA 2WFZA 3WYNA 5DNWA 4ZV9A 2H7XA 4QWWA 4BZWA 1E8NA 1JT2A 5IH7A 4MXDA 2W22A 2XQJA 1K5PA 2PSJA 4LXIA 5EIEA 4GLBA 2I3ZA 1FFBA 5AM0A 2QZPA 4P9NA 4ZV7A 4MYDA 5AM4A 4QDTA 4EY4A 2XQFA 5IVIA 2Q0XA 2AJBA 1GQSA 5FRDA 5AI8A 2GZRA 4JYPA 1SOMA 2GBGA 4LHEA 2JGMA 5A71A 2XMZA 4YPVA 1AKNA 5K3DA 4PO3X 2OCIA 3D3NA 4QNNA 5ALVA 3CCBA 3CCCA 3DYIA 3WZMA 2DHCA 5HF5A 2DR0A 4FOLA 1ORWA 1JJFA 5ALXA 4ZXFA 4G4JA 4N5IX 4D9JA 3D2BA 2IX9A 3I1IA 5FXMA 3KOOA 1QIIA 4B81A 2OCKA 3WJ1A 5JD6A 5CXXA 2O2GA 2HU5A 2XUIA 1LZKA 2BUAA 5FDFA 2HL6A 3ESCA 1G42A 5JYCA 2J4FA 3K9BA 1MX9A 4Y2QA 2DHDA 5KBYA 3C8DA 5BV7A 3IB3A 4ZRDA 2EDAA 4DYHA 3M82A 1WB6A 5IVHA 1QLWA 4UPDA 3HC7A 3V9AA 3WWDA 5K3EA 1QTRA 1W1IA 5ALDA 2RIPA 2XMCA 4X6YA 3HABA 2WG2A 1W4LA 3WKCA 4W1RA 4Y2UA 4UUQA 3I2KA 3R3VA 5AKJA 5JAHA 1EDDA 2XUOA 1VOTA 1XZMA 2UZ0A 1XRMA 5I9IA 2OAEA 4CCWA 2XMBA 3G9TA 4EY6A 3FYUA 1NU6A 1ZI6A 1XZLA 4OB7A 4EA6A 5AM2A 1ORVA 5LIPA 1UK7A 1ZD5A 4U2DA 1ZICA 1XZDA 2OCGA 1VKHA 3IA2A 4BDTA 2WKWA 4C6HA 1T4MA 1DT5A 2IIVA 4AQDA 4IH9A 5A6VA 5JD5A 5IKXA 1H2XA 3TEJA 4J0JA 4W1QA 2QOEA 1USWA 1ZIYA 5AKXA 1QIGA 4GECA 2BCEA 2OG1A 4TVKA 3QH4A 3WWOA 4B0PA 3CXUA 3DQZA 4X94A 3MGAA 4ZREA 3B3QA 3AJAA 5CH8A 1SCKA 5DTIA 1EDBA 1DINA 2JGJA 1W6RA 2VJAA 4KR0A 2AXEA 5LYYA 5I7UA 3AILA 1Q0RA 4QDOA 2WHPB 3V1MA 1FFCA 4HXEB 4IHAA 1XZBA 5ALKA 1TCBA 3LP5A 3BJRA 1LLFA 3OTQA 1UKCA 4UFOA 4DMKA 1BE0A 4PV7A 5IVKA 5HQ3B 2ZJ6A 4K6GA 3I2GA 4Y2JA 4BRZA 5K5EA 5JD4A 5KREA 2OLEA 3PE6A 1WM1A 5ALYA 2H9YA 2VEOA 4W1SA 2XQIA 2HA7A 1CUIA 3FLAA 4BC0A 4K6HA 1LPAB 4C4YA 3FAKA 3AIOA 1XZCA 1IUPA 4I19A 3WWPA 3FYUB 4OB8A 1QIFA 1YR2A 2ZYHA 2YASA 2WM2A 3C45A 3A2MA 5AOAA 5JALA 1IUOA 2GBCA 2G4LA 4WDRA 3N0TA 3S8YA 1EVQA 3BF8A 2WQZA 3IIIA 3HRHA 4UBKA 5ALUA 2AJCA 1B6GA 4WDQA 1L7RA 1YCDA 1ZIXA 3MUNA 1A8QA 4N5HX 4H7HA 4UHBA 3C70A 4LYEA 4Y7DA 5DYTA 1W75A 2J3QA 4E46A 4X92A 4FBMA 5ALSA 2X5XA 4ZI5A 5E4JA 1EDEA 1VZ3A 1ZJ4A 4C4ZA 4WJLA 5AKHA 3IVMA 3QYJA 3FNBA 1FSSA 4LXHA 5AI0A 5AKEA 3WKEA 3RM3A 3QMMA 4MQMA 4J03A 4BAGA 1R3DA 1WOMA 2VT7A 5CH5A 4K5QA 1J1IA 1TAHA 1OCEA 5A7FA 5BOVA 5AHXA 1XLWA 2BFNA 5HFAA 4KRXA 2X8BA 4J0IA 2RI6A 2GYWA 4KE7A 3KWJA 4B9AA 1UK8A 1A8UA 1VZ2A 3MVEA 2Z3ZA 4H7EA 5J3JA 2O7RA 3ZPXA 4E14A 2B4KA 4LYDA 3G0GA 5SYNA 1IMJA 2H7CA 3C6XA 3H2IA 2X76A 1DX4A 5AK4A 4FWBA 2WU4A 4J3JA 1HQDA 1E8DA 3PF9A 1R4ZA 2WIJA 5LKRA 1HDEA 3NWOA 5FKJA 1CUEA 3RLIA 3H2KA 1XZJA 4KEAA 4M0EA 1DT3A 4AO7A 5JAPA 1IZ8A 2C0QA 4N8EA 4OB6A 2QXTA 1DU4A 1CFJA 2OXEA 3SC2A 1Y37A 1WB4A 3GFFA 4I3FA 2XUQA 3IULA 4H7JA 4U2CA 3QMWA 4FNGA 5JZ9A 1UOQA 3UMJA 1XZKA 5AK6A 4IQ4A 2GBFA 2FX5A 3B5EA 3FOBA 2Y1KA 5ALNA 3GUUA 1FJ2A 2WUGA 4AO8A 3HACA 2QXUA 4X93A 3V48A 3G9ZA 3QZUA 1LPSA 3VVMA 1N5RA 3RKSA 4Y2PA 5AH0A 2EEPA 1DWQA 5HF8A 1CUSA 4A23A 1JMYA 1EA5A 1QTIA 4OU5A 1CUVA 4RPCA 2O2IA 1ETHA 2RHTA 3FCXA 2G5TA 1N5MA 2XUDA 4O08A 3DD5A 3SK0A 6YASA 1CQZA 5DTJA 3R40A 4NVRA 2BUBA 4KAFA 3A2NA 5C8VA 1DWPA 3O9VA 3WKAA 3EQ9A 4FNMA 3H2JA 1CUCA 1WPXA 4HXFB 1EK2A 2K2QB 5C7YA 2ZYIA 3I28A 1LPOA 4DSZA 1BU8A 3I6YA 1QGED 5T4EA 2HA0A 4AO6A 2PSHA 5ALGA 2PU5A 3WK7A 3DYVA 4XWGA 1BCRA 1CQWA 4QEKA 2Y2UA 4EB0A 3ZLTA 2ES4A 4B7ZA 3ICWA 4NMWA 5CT4A 3A2LA 1ZI9A 4GEGA 3WI7A 3DEAA 2WIDA 4FFVA 4GXNA 4DMFA 1JJBA 5BWBA 3RARA 5DYYA 1LPPA 1GQRA 4G9GA 1GPKA 1U65A 2WU3A 2XLBA 2WHRA 2HHAA 1YSCA 1LPMA 1CPYA 5AK5A 3LCRA 1CUJA 4K2AA 1BEZA 4JEIA 3BDIA 2RGUA 1M33A 3FLBA 2AJ8A 4G5XA 4YX9A 3H2GA 4H35A 4BBZA 2VF2A 3E0XA 1QE3A 2WJ4A 4BVLA 2BUCA 4LIPD 1QOZA 4UBIA 3R3YA 2JGEA 3LIPA 5A62A 4HVTA 2HADA 2O2HA 4A5SA 3L1IA 5HF9A 4FKBA 1ZD3A 4RNCA 3AIKA 1XRPA 3WIOA 4OCZA 1XZIA 3BL8A 4BVJA 2C5FA 3AUKA 2HA6A 3FSGD 2HA3A 1E8MA 2Y2VA 3K6KA 2V9ZA 4P08A 2CBGA 3ANSA 2WSLA 1EB8A 4FTWA 3G0CA 5CRIA 2VAXA 2ACEA 3BE8A 1MTZA 5CH3A 3D59A 3IUMA 1BN6A 1GGVA 3A6ZA 5DYWA 3G9XA 4TPKA 4A16A 3I2HA 3GZJA 2WG1A 3FYUC 1UOPA 2QKYA 4Y2VA 1MPXA 3G02A 4C4XA 4UHFA 3VJLA 2BGNA 2PX6A 2HU7A 2HFJA 4C87A 5LKAA 2PSDA 1CUBA 4DMCA 4AB1A 1MAHA 3PDCA 5AM5A 1R50A 4DTCA 2OAGA 1UK9A 3HJUA 2HU8A 3WIBA 5JAUA 4H7DA 4WCVA 3WJ2A 4B0OA 4GHWA 2VAVA 5AKLA 1XQXA 2C0PA 4C89A 3AZQA 5FUMA 3H1BA 2CMFA 4JNCA 5E2IA 1FFAA 1CUZA 3H19A 1TQHA 3ICVA 3ESBA 4Y2SA 4UHCA 4UBJA 1K6EA 3WL7A 2ECFA 2NW6A 2VTVA 2QJWA 3ILSA 4X7BA 1C4XA 1QIKA 4B85A 4B6GA 2Z3WA 2XI4A 4H77A 4EY5A 4U2FA 3WL5A 3OPMA 2RHWA 3M3DA 3C5VA 1XZFA 5K3CA 1EXWA 3R3UA 1GPLA 2JEYA 4ITVA 3G0BA 3M83A 3STXA 4KAJA 3G0IA 1ZJ5A 4MYSA 5ALRA 4CI9A 1GKKA 1F6WA 1MAAA 2XUFA 3PF8A 2FJ0A 5AK3A 1WHSA 4WY5A 1A88A 3JYHA 4UBLA 4L72A 5LZ5A 1EVEA 1AMNA 5JASA 4BAZA 2RONA 2DHEA 1MNQA 3AZOA 1QFMA 4WFIA 3WA6A 3G7NA 3FLEA 4EUSA 4H7KA 4ZGBA 4QWMA 3V1LA 1YS1X 2B20A 4X95A 3OURA 3T52A 3R0VA 4OYYA 4G8BA 5LZ4A 1XLVA 4U2EA 4RE5A 2XMGA 1XKLA 2JGLA 3D2AA 3F98A 2YXPX 4Y2YA 4DNQA 1XQYA 2XMDA 4WFJA 3DLTA 5AOBA 4PF1A 1G5FA 4AN1A 1X70A 3YASA 2WG0A 1XFDA 3W05A 4HXGA 2XB6A 3KXPA 5JAOA 4AZ0A 2QUAA 1CVLA 3C6ZA 5AI9A 3HEAA 4H18A 4JH0A 3STVA 3H18A 4AZ3A 4UHEA 5CT8A 3EQ8A 2OPHA 3LS2A 4ARAA 3SX4A 4XIIA 1K63A 3W06A 1AGYA 3C6BA 4XJVA 3K2IA 2ZJFA 5ESRA 1DQZA 4G8CA 5HF6A 5E4TA 4Y2TA 3BIWA 1CUHA 1LNSA 5AJHA 1XRLA 1CUUA 4BYMA 2I3DA 2WUFA 1H2WA 2OGZA 4FLMA 2JEZA 5C8ZA 3H0CA 1MJ5A 4H7IA 1UFOA 4DNPA 1HPLA 2VJCA 1E5TA 1YAJA 5C8XA 5EHQA 3IUQA 4ARBA 4BP8A 2HA5A 5I8PA 1CUGA 1GKLA 1HKHA 1QIEA 2WILA 2BJHA 1GPNA 4NZZA 4HZGA 2HFKA 1AURA 1JI3A 2AJDA 5CXUA 1QIMA 4HRYA 1UKAA 2H1IA 1N8SA 1XRQA 5ALWA 5ISMA 1JMKC 4S0XA 4EHBA 4F0JA 1CRLA 4XX1A 5EHXA 2PSFA 4WY8A 2ZSIA 1ZD4A 1R88A 4B83A 4V2IA 4X97A 1Z68A 3GA7A 3R41A 1UK6A 3ZLUA 3VJMA 1MU0A 2DQYA 2WHQA 4FDMA 1ODSA 2C7BA 5EI5A 4DIUA 5A2GA 1U8EA 5FOQA 3BXPA 4Q3LA 3O0DA 1QFSA 4BCDA 1D07A 2D5LA 4J0CA 5K3BA 2ZVDA 5CTAA 3STWA 4Y2XA 1B41A 4AXBA 3FWHA 3QPAA 3NOXA 3R3XA 2P8SA 4INZA 3IURA 4P92A 1TK3A 1DQYA 1PV1A 4LKOA 2XMRA 3WZLA 2WUDA 3UUEA 1HLGA 4DSAA 3N2ZB 2WUEA 3R3WA 4HAIA 2VATA 3IUJA 2PU7A 1MX5A 1R9NA 5CT6A 1A8SA 1ZGBA 3V1NA 1X2BA 1EB9A 3STUA 1CUYA 1CV2A 4X90A 4UFPA 2WFLA 5FLKA 2OCLA 4KE9A 1RYYA 1ACLA 3ZV7A 1X2EA 4BP9A 1BEEA 1UWCA 2ZYRA 1CUXA 5ALFA 3L1JA 1EX9A 2YH2A 5FPQA 1AX9A 4BDSA 4RGYA 3FBWA 1SCQA 3O9MA 2XLCA 3GELA 3QM1A
chains in the Genus database with same CATH superfamily
2NZVG 3U4HA 3Q0TA 3R9KA 4JA2A 3E4DA 1VE7A 3OZFA 3LHFA 5D2CA 1A8PA 1M75A 2UXCB 4HDAA 3ZW7A 4AF8A 1B0UA 4IUBS 1C30B 1N9GB 1VBFA 2CHGA 4G0PA 5MGNA 1LZLA 5C5EA 3I1YA 2RHJA 5AMXA 3KWFA 3N6RA 3GCWA 3W9YA 4ZHSA 1HSOA 4EGAA 2F55A 2OBFA 2PUEA 3T7RA 5EMMA 4CCAA 3WK5A 1L7MA 3H7IA 4MPJA 3SBXA 3V7YA 4B7UA 5H0IA 4C6SA 3BXFA 2ZOSA 2WJHA 2QD2A 3HXMA 4JJZA 1N7IA 4QPZA 1FCJA 1FS6A 2RGXA 3VHXA 4B6RA 2BTEA 4B6JA 2HLHA 3JD1A 3IPLA 3DG9A 1S7CA 1WAMA 1JR3A 3NC1C 3GJ3A 2H00A 3CZ4A 3H5IA 3OQ6A 4FYHA 5AICA 1Z4NA 3SLKA 4CDRA 2GXAA 4C7OB 5LQMA 1UFVA 1DJMA 1MOSA 1XVAA 2Z30A 3K5HA 3NBMA 1J0AA 1KOJA 2AC7A 3COSA 2IIBA 3E15A 3EF0A 3Q4GA 1AH2A 2B94A 4HTFB 1QLHA 3EXIB 3O03A 2NU9A 5EEHA 3IAXA 4CF3A 2HWKA 1KHTA 1PL7A 4Y1RA 3TLCA 3D9QX 4R81A 3ZHOA 4ENUA 1Z0IA 3KD2A 1BROA 2XCTB 3BWBA 5ARCA 1RI1A 3O5AA 2VNIA 5IXYA 5LZ2A 2CF5A 3I2JA 4URHA 2CLOB 1AN0A 4KSYA 3ZWQA 3UMFA 3EIFA 2PUWA 4IIDA 4KQCA 2RHOA 4NBKA 3WMWA 3IQDB 3L43A 4DLKA 3B70A 1THTA 4O33A 4AMVA 1YMVA 3TFOA 3BL5A 4GQBA 4O4LB 4RANA 5KNCH 5H81A 4F71A 5DX0A 1EWRA 1GZ7A 4BZQA 5BUZA 2GCIA 5T4BA 1ODCA 3ETGA 1ORHA 1Y9AA 3IKMB 2OO3A 3N59A 5IX8A 4TLBA 1P62B 2A9OA 3F9IA 2C7OA 1ZHHA 3IUPA 2CXUA 2OGSA 1N6KA 3I9LA 4MOWA 5BP7A 4XIGS 4UE6A 4OHYA 1R0SA 4YP0A 4BATA 1QVZA 1VA4A 4WNAA 1JR4A 2WYWA 2QVBA 3WX0A 4YXWA 5TMBA 1FP7A 3CG4A 4WK4B 1OI3A 4W5JA 5KQLA 1JU4A 1ZM4A 3ZTTA 2FCAA 1T2NA 4IDBA 4YT2A 3LC7O 2JGKA 3IP8A 3LYUA 1GUBA 4UFNA 4EBBA 1P0PA 1SQGA 3E1GA 5EVCA 3BIFA 4EFLA 1RAEA 5H9VA 4EI8A 1IUNA 1MENA 2CYBA 1LH0A 2O8NA 1X3SA 2L82A 4C2TA 1K1EA 1ZDMA 4A2PA 2ZETA 1ZP6A 2PGLA 4NG5A 3EQ7A 4TX1A 2JFGA 1K88A 2M9MA 5AI5A 3CNNA 3OQMA 3K70B 2BGWA 1HY3A 1UZNA 1XRNA 5DT2A 3ZG6A 4W5TA 3U9LA 3Q2IA 5AKGA 2OP1A 1GV0A 4C4SA 1XMIA 3PHHA 4G5HA 3K70D 4AX4A 3UNXA 2ASVA 4LVNA 3UMSA 4MVJD 4O4JB 5F2EA 1MC1A 2LDXA 1AA9A 1DIOB 1U3TA 4YJKA 2BMDA 3AR4A 2A0UA 3Q88A 4YAOA 2H4ZA 5JEEA 4YV7A 3NGLA 1OFUA 2CXPA 1KQGA 3K9LA 3KAJA 5TRTA 4AX8A 2DPXA 3C7AA 3KEQA 1H1LB 3PUIA 5GWXA 4CW7A 4BCBA 3T7IA 2ALJA 1GT6A 4X1IA 4Q18A 1IB6A 3WLAA 3NHMA 4B6FA 4MWTA 1UBKS 2ID9A 5CPBA 1T1IA 4MEBA 4CMJA 3H1AA 1KEKA 3A31A 4DR3B 2WMNB 2B98A 1T9HA 4I8DA 2NYUA 3VZRA 4NPAA 4OJYA 5CVVA 1SMKA 2HMTA 4RF4A 2O7SA 3PXAA 4HRXA 5F4ZA 2JIDA 3GRAA 3HDQA 5FNVF 2O3JA 3BMQA 3HWWA 4MUXA 3Q5DA 3UG6A 3LPMA 4L0CA 2GLTA 1XTBA 3GUZA 2H1SA 4ZT7A 2QF7A 4BJ5A 5AUPB 1P6XA 5K8LA 2BGKA 3L0ZA 3E2IA 3RSZA 3B1YA 4A36A 1QM5A 3CVOA 4GXTA 2PBLA 3OT1A 1O9BA 2Y68A 1TCAA 4AS3A 2XE8A 2ZB3A 2WIKA 1M6HA 4C7XA 4ZOLB 1NVXQ 2BHNA 5BV2P 5DYNA 2W2PA 3OFJA 1CZUA 3LNCA 4IRMA 5KNCD 1BX0A 4L8VA 1O96A 3DKRA 1Q1NA 4IOKA 1PFUA 2ZRFA 3CLKA 1DDOA 4NCBA 4P2GA 5EEGA 1V9CA 5IDVA 4C7OA 3P2JA 4F4CA 1PFGA 3NAGA 5DM4A 1WXQA 4DIFA 2F59A 2HQ1A 2VH2A 3DKKA 2P2NA 5I7RA 4RV4A 4W82A 3CF4A 1XCMA 2FQXA 5LYJA 2CXHA 1HGXA 3T1VA 3KB2A 4LE0A 1PO7A 2FPXA 1TPYA 1XD2A 1HL7A 4BFZA 4DIEA 4OHBA 2DFLA 2ZXEA 1JP7A 2ZANA 3DWIA 4GO1A 4R9NA 3VVLA 4DG5A 1XMXA 2RCYA 2UZAA 5M04A 1GEEA 1M67A 2VP9A 4E5NA 1NIJA 1UT8A 1K2WA 3A04A 5GM1A 2IHBA 1FMTA 3AIMA 3KE9A 4KFTA 4MVWA 5CXSA 5JHGB 5KNDA 4C1NA 1KEUA 2R8RA 4LYFA 3NLLA 4R8SA 1THGA 1I2MA 2FG6C 4MR7A 4WKGA 3NI2A 4QGSA 4POOA 3W2TA 1HXHA 1X15A 3LT4A 4M2LA 1F8UA 5FWXA 2CFIA 4R2JA 4Q19A 4MW9A 1NN1A 3OICA 3M1AA 4K6OA 4L4ZA 3FPFA 4L27A 1LTHR 2BEVB 3TNYA 4JB0A 3TTXA 1X8LA 1V6CA 4MUAA 3HKDB 1E9AA 3K70C 1ZK3A 2X9QA 4ZYUA 2Z6QA 2RAUA 5I9LA 1JDPA 2R8OA 3NUGA 1C4KA 1R12A 1KVUA 1O6ZA 1TYZA 3LI2A 4FYYA 1QO9A 4EPXA 1OBOA 3NOOA 4NMMA 4LK3A 2I7CA 3EVEA 4NARA 4N1AA 4R5HA 1FVOA 1VXOA 1ZOLA 3DMPA 1HYQA 3UOWA 1G5RA 5ESWA 5BOSA 4OG2A 1X1EA 3PTZA 2IVZA 4EJ6A 4MLZA 1KBQA 3BE5A 1IQ0A 1OWLA 2QY9A 3GR6A 3TR0A 3L2OB 4XEUA 2IHUA 3EEFA 1FMLA 4H1HA 4QBFA 1KQFA 5ICFA 3KU4A 2FSSA 2Z1DA 3DOIA 3R75A 5A7HA 3RUDA 1U1DA 5AO9A 2VEDA 2PZKA 2Q9BA 5C8YA 1VGQA 1B6RA 1EGHA 2Q5JA 3U7IA 3DVAA 1J9EA 4ZN6A 3AC0A 4OAQA 3AEUB 4R0NA 3GFQA 2F8SA 2XVMA 3L4SO 2WY2D 4ALIA 4EG5A 3N7AA 1MT3A 3Q40A 5KU7A 2YW2A 5KQPA 5TJHA 5K6AC 2QAGC 3UYLA 1M5UA 2AW3A 2AGVA 2O7VA 4OQLA 4DVJA 4F5ZA 1P60A 1XF9A 1ZS9A 4DNFA 4DT1A 1LC3A 2DG2A 4LAFA 5TV2A 4QSMA 1J70A 1Y5IA 2FGJA 3EY9A 3C16C 4G41A 2WWHA 1TA9A 2DHQA 4TTJA 5DW0A 2WMDA 1WB9A 3G13A 5F33A 1RT9A 4OX9Y 1EXMA 1Y7HA 2J07A 2Z8YA 2ACKA 4EJMA 5CBKA 4MWZA 4Z3OA 1K9VF 1Z7BA 4PONA 1E5VA 1ETUA 1I5RA 4OOFA 1HURA 4R2MA 1J39A 3JY6A 3QVGB 2Z8XA 3ZE8A 4NG4A 1TJPB 3NP9A 4RC9A 3TLZA 4G5YA 3MXTA 1FPQA 1WXHA 2HO4A 1L5LA 3PNBA 2JBHA 1EUYA 1T5TA 1ZONA 1NTRA 1RQ7A 1V3TA 2B8NA 1TMYA 3QI7A 2D2FA 1Y8AA 3PNYA 4MQBA 4R6WA 3W6OA 4AMYA 4BVFA 4WXPA 2XQGA 2LV8A 1PT5A 1QJ4A 2WMOB 3DZ8A 3I8OA 4GGPA 3GOQA 4L3WA 4R0VA 5ALHA 5BRNA 1Z7YA 1HETA 5IJ9B 1U7ZA 3NH6A 2O3QA 1WMSA 3JYOA 3N7UA 5DYGA 4A8TA 5GTDA 2FEXA 1PFYA 2F62A 5TC4A 4I5FA 4OHPA 2J31A 2QVLA 3F73A 5ARDA 3IKTA 1SQ0A 4N7RA 3EEIA 8AT1A 3LUFA 3O4FA 3AZPA 2Q46A 1TRHA 1UFRA 3FPAA 1IZYA 4HAOA 3OBBA 4L95C 2FF5A 1XEFA 3W8EA 1N2CB 1E3DA 2HGSA 3AFIA 3DCNA 5DBFA 4D8XA 5JISA 1KMQA 4YHHB 1ULZA 3MFYA 1X86B 2WWXA 2FSIA 3BB3A 3R0QA 5D86A 2H1CA 3NHKA 4YP7A 2PH1A 5K51A 3QUSA 4Q6WA 2XUKA 4LY6A 5AVJA 2VSNA 2CHUA 4JZKA 4Q3EA 8MHTA 2NU7A 3EULA 3LG2A 1AXEA 1GCOA 3BXHA 3KOYA 4G26A 1D2CA 3L7NA 4B2PA 4GOMD 1SKMA 1HYEA 1EP3B 3EWSA 1VB5A 5JJ5A 3F6PA 5LYJB 2E1RA 3Q8WA 1OIXA 2GD2A 4HNHA 1WE2A 2C2MA 3ZE2B 3MT9A 3QEKA 2K4MA 5IAJA 4WLVA 2IV2X 3ETCA 3TOVA 3FDZB 2YWEA 4TMKA 5FH9A 10MHA 3AEQA 4JI4B 3BL6A 1X38A 4KKXB 3T5AA 4WOCA 4KAAA 5IZ4A 3R3SA 3NT2A 3W2HA 3SC3A 5JWRA 3SYMA 4FZ5A 1DLIA 2BGRA 1KH1A 1WZUA 3VJKA 1MFPA 3KVVA 2B0JA 4D3SA 1J06A 2GB4A 2YMQA 1T9ZA 3ACCA 3DEZA 1L4NA 1BS9A 1JDVA 1RXYA 2C4KA 3DW3X 1RRVA 4H27A 4XARA 2C8KA 5FBHA 4D02A 2OZLA 2DFNA 1RP1A 1T5SA 4PY2A 3ZWVA 3BOSA 2J09A 2JAWA 3HPRA 3HXKA 4NOMA 1PBTA 3GGPA 4A92A 1B74A 3TLEA 1E4EA 2YOFA 2Q4RA 2YFYA 3MRXA 2PX8A 4EO7A 3SZLA 4MGKR 4KO2S 2WJJA 1G5HA 2XF2A 3OOJA 2WZQA 1Q0ZA 2CNNA 4KMMA 1E9VA 3AYXB 3JD0A 2FQ1A 3JXEA 1CUFA 4D5EA 3ZY4A 4DJEC 3CU5A 2QYHA 2BKAA 4IOMA 1ZBQA 5CNMA 5FBZA 4JP2A 5BN5B 4ALNA 2FVYA 4EPTA 1IBSA 3HUFA 2ORED 3VOTA 2IQIA 2L69A 4BWYA 1AZTA 4M1YA 5BR1A 3QXHA 4N48A 4C76A 1E2HA 4X9XA 4AECA 2WF8A 2O2JA 2Y0DA 1P2SA 1KPHA 4WRRA 4PIMA 2H2DA 4EFDA 3KSMA 3LUDA 3HBMA 4LYGA 1DDGA 4E5YA 4QFBA 3MJRA 3G7UA 3S4YA 3TQIA 3CTPA 4HGYA 3F49S 3KR9A 1FL9A 4E5UA 4RGQA 2PSEA 1E3IA 1W5TA 1THZA 4B8ZA 1PLJA 5KPJA 1Y6FA 4RSMA 2GI4A 3M2TA 4AG5A 4DTIA 2FLVA 1VM6A 4NYJQ 2QNRA 3FOCA 3ZZMA 1F2TB 2XBUA 2FN4A 2YYAA 1SGWA 4GX1A 4XJSA 3ZX5A 1IHUA 4QQFA 3L8ZA 4BMOB 2RMKA 4OSEA 2ISQA 2C59A 2P68A 3K5WA 3SMVA 3TRDA 3UB2A 1EJ2A 3K72B 1RWOA 3IMKA 3C3XA 2H65A 4MRVA 5E1MA 4H3KB 1QHEA 2A92A 2ZJ5A 4DBLE 3DOEA 2EKZA 2AH5A 4L15A 1TB4A 4YLEA 1QS0A 5FB3A 2OV8A 1NBMD 5BRJA 7REQB 1AZWA 4EKIA 2DY1A 3K1TA 4HO1X 4IO0A 3Q7RA 3Q3VA 4Q3OA 3HDYA 2C9DA 4KQFA 1RZVA 3LHIA 1HDCA 1GU1A 4GI5A 3KFVA 2CJFA 1QQBA 3UV7A 1QAOA 2E87A 4BTLA 4C0XA 2PZBA 3MIZA 3R23A 2JAXA 4CCYB 3ZZUA 3M6XA 3ILHA 1FUUA 4BNYA 4B7CA 4HX5A 4HBGA 5BQ5A 3IERA 4HS4A 2VUSA 2QZZA 1Z07A 2RI1A 3VUFA 1MNAA 2EBUA 5WRFA 2WM3A 5D1NA 5IAGA 4O2BA 3FCCA 1XALA 4DLLA 5CLJA 1RRCA 2I1LA 3H6HA 3OG9A 4LZLA 1T2AA 3B1JA 1HBJA 4S0ZA 4D8TA 1XCLA 1MX1A 2JAUA 3H4TA 1HFJA 3NH9A 1W9MA 2H2WA 4ERNA 1WQ3A 4L2IB 2YMMA 1Q0QA 1YNSA 5AJUA 3DS8A 1R6UA 3F1LA 1GIAA 1VG0B 4GZLA 4KZKA 2QL6A 3HWRA 3BMCA 4JBXA 5E4FA 4C3ZA 4FXPA 1SKBA 2WVGA 4M99A 2GN4A 3ND7A 1AK1A 2Q9AA 4G23A 1P31A 2ZWOA 4JP3A 4OLBA 4CQLB 5AUNB 4XD2A 2F9FA 2P9GA 3KFXA 4KWHA 3L4BC 4PAQA 4J1TA 4EJFA 2AZ4A 4AY6A 4KX3A 3U7EB 2VF4X 4B48A 1V41E 4O25A 1NVAA 2EHJA 4HUJA 3ZCVA 3BCHA 2VHYA 1OHHD 2G1UA 2W4IA 3PGJA 4JZYA 2QZSA 2IS1A 4F6RA 4V0OA 4E15A 4AWAA 1SFRA 1R66A 2XECA 3GNTA 3KV3O 3R7BA 5JBQA 1QRAA 2O1SA 4LZNA 4XSHA 3BB4A 4G0OA 1E2NA 3W4JA 2IU4A 3CE9A 1RWVA 3ZH2A 4P80A 4LDZA 4URXR 3LE8A 3S3TA 3GT0A 3WB0A 4M38A 1IZ9A 2CNOA 4PYJA 3F97A 2ZRDA 4OLFA 2UVPA 3HYSA 4P8RA 3UJAA 4EKNB 4NDNE 3FOEC 3RYCA 5FV4A 5IDWA 2WTBA 2GEKA 5GMOA 3KEFA 3LIIA 3VSBA 4Y6RA 5HK9A 1Z2NX 3CNOA 2A7QA 4FHGA 5C1DA 1ESZA 2GBLA 2GK4A 3G9QA 2CCJA 4FYWA 2XZDA 4HDRB 2NXCA 4P0TA 3LSTA 3UXHA 2INGX 1ZW1A 3IOYA 4ALMA 5FFMA 2O05A 2DEUA 4MAMA 3RS2A 4MIEA 5KHOC 2AXQA 3D2LA 4ZMRA 3QJYA 2AF4C 4RVUA 1TKRA 3A9UA 4HDCA 2WC1A 4JT4A 1XROA 4UPVA 1WJGA 4YCMA 4NC9A 4Y6LA 4DV1B 3P32A 2CFSA 4CDNA 1VHJA 2O8FB 5IT9A 1F3LA 3AB3A 1F8FA 3V7UA 3FROA 1ULTA 3HKEB 1QIHA 1O57A 3EFHA 3EXG2 3I04M 3EA5A 4YDRA 3I2IA 4RD2A 3T9AA 4HS9A 1JFRA 5AVQA 5MFPA 5C4MA 5C8YB 5E38A 3ZJ4A 1YZVA 3EFOA 3SAJA 3BMOB 2YZKA 1HT1E 3EGCA 2FH5B 2FOIA 1OFGA 5LQJA 5CTJA 1K7YA 4HSGA 1H85A 3KOUA 3I09A 4YUAA 3N0XA 3GLKA 4JWTA 3OJLA 4GYJA 4AVYA 2XQKA 4MYHA 2JZCA 3UWMA 1XEWY 3L8HA 1GDHA 4G5OA 1NAIA 3WBFA 1Z6YA 2Q28A 1DG1G 1QG6A 2ZU0C 4ZYYA 3ESDA 1A7KA 2CK3A 1QX3A 4MKRA 4Z8XA 4ZQHA 4CKYA 4D9BA 5TMPA 2JZOA 4EZIA 3OZWA 1Y4UA 2BONA 3EDQA 3GP5A 4QXPA 2FRXA 4RMNA 2CDAA 3TTYA 2B2XA 1E0SA 2RSLA 4AROA 1YQUA 1ZI8A 4PHFA 2ILTA 3FCYA 4RX1A 4ZAFA 3TLXA 4RVSA 5FCDA 5DWQA 3NT5A 2OBLA 3NBUA 1HFEL 4J2HA 4YV1A 3VV3A 1FNNA 3PC3A 1JHUA 4PFQA 2JFFA 1PT8A 1Z18A 3LC1O 4E5DA 4FC7A 3WGHA 1ES9A 2Y6UA 4RH1A 5JG7A 5EGNA 3UJ9A 3ZVMA 3MUOA 1HEIA 1Y6RA 4QTTB 5HOEA 4J7CA 2J3IA 4XFDA 3OIUA 1PL6A 3BWVA 1DO8A 4LC1A 2NO9A 3ONWA 3JQPA 3SQNA 1US8A 1KMIY 4IVPA 4OYRA 3PFGA 3T8YA 1RXIA 2L0XA 2PBRA 5UKDA 4R9SA 4DT1B 4PAWA 1YAHA 4L2IA 1GXSB 1U7HA 1RTKA 3QE9Y 1P1IA 1RMYA 3EEQA 2QD5A 4O59O 5CGQB 5HQJA 1V8FA 3TGLA 4EHFA 2IUTA 1O9HA 3BXEA 4YRLA 1NQOA 2FWIA 4AYTA 5LQNA 1IN5A 3QVUA 1MOZA 4D0NA 3VHXB 3AUAA 1AIPA 1Y81A 2G5PA 2GUWA 2BDTA 2HNKA 2IY9A 3H13A 3KCNA 2NX2A 2XKBA 1ZSVA 2X4DA 2RH9B 1E4YA 2GJKA 3KYCA 4IJUA 2G0NA 1X1RA 4Z6KA 3JQAB 2R6FA 2AR0A 3OZSA 1J8YF 3HVUA 4UAJA 4NCAA 3EARA 3BWDD 4Q9IA 1NUUA 3HB1A 5EIBC 4UTVA 1UUFA 4GR4A 4A91A 1M1NA 1W581 1K3FA 2V9CA 4W5QA 3ZE9A 3Q8MA 3ZVNA 3HL4A 1G64A 3CW2A 1XWIA 2JK0A 2P0YA 3HUUA 4OMUA 4YRQA 3G9UA 5EGSA 2XUAA 3LGSA 1U5AA 3GP3A 2C9CA 3HGQA 5IASA 4F5YA 3OT4A 2VF7A 5CDTA 4G89A 5DHTA 3ED1A 5DM1A 4Q3KA 2PD3A 3NC0C 4PQEA 5FA5A 1IQUA 5TIIA 1VJRA 4RJKA 3M6VA 4EK9A 2PHZA 2PJDA 4D8VA 4CQMB 4ZRNA 2QYOA 1KFBB 3A6GA 4XQEA 1D4FA 1QZXA 1UWKA 3KB1A 3J7TA 3WMGA 4WMLA 1AA6A 1A1VA 1RAFA 2O1EA 4WOJA 1Z8HA 3OESA 4X41A 1M2OB 1IQPA 4DCVA 5CURA 3FFTA 1U63A 4R1PA 4KRYA 3T38A 4B32A 4RVOA 1O58A 3BM5A 3RBVA 3V1KA 1CRZA 1FXSA 3GBVA 4BKPA 4C05A 2XYRA 3W5BA 1X7DA 3ICCA 2BMWA 5IAEA 3NWJA 3P9ZA 5K05A 1SY7A 3FNIA 4U2GA 3V8PA 1K8ZB 3IPAA 1HDRA 3RG2A 4EH1A 2CB9A 4FYXA 1CG6A 1TQ8A 2QR5A 3F8TA 5E4YA 4EUHA 4KPYA 1H94A 2IC5A 4O3MA 2RHCA 1XZNA 1AUOA 1Q11A 4YRJA 2DCMA 3TVYA 4YPFA 1PQYA 5CCEA 3NHLA 1O2DA 3JQCA 1J23A 4GPIB 3S1SA 4LJLA 5AYVA 4A6EA 4M87A 2P1RA 2YXBA 3LLCA 3R6LA 3VDXA 1L9XA 4FOOA 4I9GA 2VN8A 2CSXA 5HJ7A 3O94A 4NQRA 1G3IA 2FHPA 4B8YA 2DR2A 2NTJA 1GTJ1 2R4UA 4I08A 5K0SA 4BKMA 3H5RA 3CPSA 4AMGA 3UMMA 1CLEA 1K4KA 3AP1A 1Z0UA 4US0R 5FTWA 2WTMA 4IKPA 2AMFA 1UXKA 2JVJA 3VKFA 5LMUB 1LBIA 1O89A 1TZJA 5G3YA 2O8CB 4OF4A 2OO5C 1R7RA 1Z0KA 2VWQA 3DJFA 3OU7A 1QE0A 1SBQA 3G6WA 4NS4A 1TM5E 2O2CA 4ZV4A 4II2A 2ZAGA 1VJ1A 4M49A 1WV0A 4AUNA 1C3VA 2CBZA 1B26A 3ACDA 5IC4A 4WLUA 4TXMA 4B47A 2HDWA 4Q4AB 3F6EX 5H4HA 5I9SA 3UMGA 1TMKA 1J2EA 3M6UA 1EFLA 4Q4DA 3MT8A 1MJNA 1Y1KE 2BFAA 3VOSA 1E9BA 1AC5A 1PJBA 2C5LA 4IHJF 1GR0A 1I4DD 2OHHA 2W6CX 3D8BA 4BLQA 2XNSA 4DUZB 1GUYA 4HLQB 4ARSA 3CUKA 4CMEC 1EWYA 2WU1A 4FCTA 1OFTA 3Q3GE 4LBZA 4NZOA 4X8MA 4M83A 3DH0A 4PVCA 4F5DA 2P91A 5JJKA 2JCGA 4QDXA 4RE6A 1ZVMA 1G20B 2FXIA 3E7DA 4MQ5A 1T2FA 4RY9A 3UHPA 4F5EA 3AF4A 3V97A 4EVIA 1XRRA 2VS1A 4CTNA 4DGSA 4X1YA 5REQA 3TW8B 3A2KA 3LX4A 3LCVB 2BLLA 2J0UA 3DE6X 1XDWA 1ID1A 1PLLA 3E3AA 4E4TA 2HYDA 5E9QA 5L3VA 1JG6A 4R9RA 3AVPA 4G4SO 1N1DA 3H1GA 3B3GA 4BZPA 2G06A 1OLSA 1PKXA 4PC2A 1IY0A 1K86A 2D7CA 3H9EO 4ZAXA 3STYA 3PA8A 4NECA 4AF6A 5HVNA 4FILA 2FGKA 4N12A 3L0CA 1CJVC 2G07A 2GZMA 2VWHA 3ENWA 3QVWA 4FEGA 4ZEOA 3VR0A 2DWQA 3MWYW 4RENA 3VR2A 1RVV1 4HDKB 2OBXA 1PZMA 2IW1A 2ONCA 3BDVA 1E0AA 5FBQB 4CKCB 1RHQA 1QRTA 3OOHA 2PZEA 2DFDA 3UY4A 3RO7A 4J6FA 3DBRB 1OOEA 3UVEA 4CFSA 1O95A 4MUMA 1E3EA 4QXAA 3ZI7A 1T2DA 3C6YA 3F4LA 3SQLA 1Z62A 2Y93A 1ZMTA 1A5ZA 2WEKA 4GWKA 3OCUA 4QG3A 4CGZA 1JEAA 4QJ4A 3WO1A 1O7JA 1BDJA 1T1RA 2FB9A 3G59A 1YE3A 4IUYA 1T9KA 1FNCA 4QC2A 1TPZA 3OE5A 3I1JA 5TNXA 2IYRA 3TQHA 2EF0A 3KQYA 4TRRA 1XKTA 2IE0A 2Z83A 3MT0A 4EEKA 1IZ7A 1OI2A 2LKCA 1PWHA 4XSGA 3WYNA 1AZLA 2W6OA 1KH3A 4LNHA 4JV5B 3JQFC 1L8OA 3PV0A 5DNWA 1VIYA 1N2HA 1UMBB 2BSQA 3ROGA 2H7XA 1W4ZA 2J5BA 2OO7A 1WUYA 3AKZA 1VKOA 5EYPA 4YHBA 5F52A 1OTHA 4MDYA 1KDOA 1XTRA 3LPCA 4QYMA 2DPHA 2QTGA 3KYBA 2SECE 2XVZA 2R751 1IU9A 4RU1A 3K20A 4PXYA 4TVBA 1JT2A 1BH2A 5FNVA 5HQTA 2NT3A 3EGIA 3MCVA 5DBHX 1EJ6A 2ZRLA 2UVQA 5K09A 2QAGA 3DVSX 3N0VA 3OPYI 4MVJM 4M1QA 3UAWA 4ZI7A 1HMPA 3N28A 3PL5A 4LJYA 3BGDA 2Q41A 4BO4A 1M6YA 2Q5QA 2QT1A 3KUKA 3CISA 3X44A 1SZCA 2XOKD 5H7XA 3IP7A 5M29A 5EIEA 4GLBA 3O8QA 2ZJ2A 2RJOA 2W6PA 3A27A 4NICA 2YZ2A 2XW6A 1SNYA 3E1KA 5FOWA 1T2UA 2PZ8A 4Y1EA 1NXPA 2FZLA 2R1VB 4EYOA 2YVAA 4B44A 4MYDA 1KDTA 5AM4A 2PT7A 2WSIA 2NXEA 4BEJA 1EFAA 4Q4JB 3THWA 2RKOA 3O31A 5K0EA 4EY4A 2W9XA 2J3MA 1MQSA 2WNIA 1YTUA 3KWMA 4GMDA 3V8BA 2ZKLA 1ZAYA 4NOJA 4BFCA 5IVIA 2YNMC 2O8DA 3A9RA 2GA9A 3CHYA 2KS6A 4WUTA 1ZU5A 2PMFA 1V5WA 4HQ6A 3JRXA 3RYIA 1GQSA 4R7TA 4R3WA 4RMJA 5AI8A 1WXGA 1V35A 4AG3A 3JD2A 1GCAA 1SOMA 4JYPA 3O8BA 4IGKA 4H1WA 2A9VA 1WABA 4RPLA 5L9AA 2Z2IA 2WVJA 4YUVA 2JLVA 1G3UA 1EK6A 3OLQA 3PDHA 4GE0A 3NKFA 3HN2A 5L3QA 4GZ3A 4ZIRA 1TQ4A 3HO8A 2JVIA 4HH1A 1ZFNA 3VR3D 2NZ2A 1Z25A 3EZ9A 4RFSA 4ZARA 1SCDA 5I48A 4FCWA 2JFBA 5EPOA 3FAZA 1XQ6A 1DKUA 4E88A 4K9LA 2G1AA 1DJLA 3MGCA 1D8AA 2CFTA 1VMIA 1Y34E 1ZH8A 2OLJA 4J2OA 5EWMB 1CY8A 1N7JA 3WAKA 4MRPA 4MGZR 5EY5B 3W90A 1JJFA 1NKVA 2FU5C 5ALXA 3RC1A 5EHIA 1JQEA 1TW2A 3ZDRA 4D0GA 2PS0A 3CZRA 1BW9A 1WY5A 3HCFA 3C3JA 4KUHA 3O2QB 3KOOA 2CV0A 1Y4SA 2PK3A 3AR8A 2OCKA 4CI0B 1LC0A 2OMEA 3L5KA 1JGTA 4HLNA 4GBMA 1YOVB 2QUIA 3LUJA 5KYVA 2VHVA 3WOHA 4K03A 3W4IA 2RGNC 1QU3A 1ZGJA 4BBAA 4F4FA 2WHYA 1MXHA 2IZZA 5AW1A 3O8RA 3CH6A 1JTVA 1W36B 1NA5A 3FUWA 1SXQA 1UQUA 2HIMA 1PX2A 3KQSA 2BHLA 1MX9A 3WB9A 1XXHB 3WS7A 2PVPA 3QUAA 1MEOA 4BBPA 4RJJA 4UJ5A 1TGVA 1NKTA 3FPLA 4OFWA 1LLDA 4F38A 3FDIA 3FG9A 1DZIA 2AYYA 1T1GA 4E1AA 3K9FC 4EKDA 2O07A 3JATA 4M1OA 1CZOA 1KSHA 3B6KA 3ORSA 3U4DA 4MLCA 4XPIA 5JQGF 4WINA 4FSXA 1RBZA 4B4KA 1S3FA 4ZO8A 3UWOA 3WWDA 3FKSD 2CNDA 1C30A 4MW7A 2Q3EA 5JZOA 1Y3DE 2HQSA 2OM6A 4ZT2A 1CXZA 3HABA 2WG2A 4G37A 4JS0A 3SR4A 3WKCA 1FK8A 3OX1A 1NW9B 4DLUA 3SN6A 5LU9A 3JZIA 3E22A 4Y2UA 3GLSA 4UUQA 1F9AA 3I2KA 3GNLA 3PE3A 1IOWA 1P44A 4M9UA 5TMEA 5AW7A 3GRFA 1UBRS 4QRHA 4WBNA 1TYDE 5EZ6B 2JGNA 5FHRA 3RRFA 2Z1MA 8ATCA 4K3VA 4LV6A 4OUDA 2DBYA 3UJ8A 2I7TA 4WN9B 3INGA 4XR9A 5FD8A 1VOTA 2QG4A 5IHXA 3MS7A 2A0FA 3H2BA 5TPZD 1R8QA 4LWZA 3EJWA 1SB8A 2F2TA 2QN8A 2X19A 1GP2A 3C8UA 4FQ7A 4QTUB 4PCLA 3CEAA 3BHIA 5DLEA 4ZEMA 5DZSA 3HFGA 1UBEA 4EY6A 3MG9A 1AXRA 3QFRA 1NU6A 2M98A 2LD4A 2X8JB 3IMGA 1J4AA 1E64A 1PGOA 1RXEA 4GUDA 3VSEA 1YR7A 4DDUA 1Z83A 3I73A 5TB5A 1FDOA 1XZLA 4CT0A 3EMDA 4CF5A 3OWOA 4ND8B 1PG5A 1LLQA 4PLTA 4TMTA 1MO4A 4GM4A 3ZVLA 5AM2A 4JI0B 5TDHA 4Y6GB 3TAHA 4JR0A 5JDIC 4TTPA 3R5FA 5BYAA 1EVYA 4IX9A 4AJ1A 1EQUA 4AYXA 4KX5A 3WMEA 4LSGA 1OYVA 1ZD5A 4U2DA 1XZDA 2XX3A 2GFIA 2O2ZA 4JJ7A 2JLXA 3R8FA 1RYEA 1ZOPA 4A73A 2O8EB 4BFVA 3LWDA 3P0IA 1U1FA 3K0KA 1EZ1A 2O48X 1NW5A 2WKWA 2ZULA 4BDTA 4FB5A 1CT9A 3G8CA 5DP1A 2G1PA 2B4AA 2KLHA 3HYLA 1N3YA 1DT5A 1GRCA 2XCIA 3SHVA 5IEJA 3RSOA 2IKQA 3F5FA 3HYNA 3K7EA 2VDUE 4RIFA 5JD5A 3K5IA 4MO9A 2X0DA 4ZI7F 4J75A 5FI0B 1FP4B 1Q0TA 5GIPE 1UPFA 2C2OA 1FXWF 2QOEA 3ZXYA 1TECE 4ZPJA 1N4DA 2FR8C 2VHEA 2XYHA 3JQ7A 5AR1A 4XAQA 3QKSB 3PQ7A 5KOYA 1V47A 2R65A 2IELA 3BAFA 3R7NA 1OROA 2VDOB 4RL6A 1RLJA 1WXDA 1E3WA 2EIXA 3EPLA 5CD9A 4TVKA 3QH4A 4AZVA 2ZJZA 2WMYA 1J8DA 4FB4A 1XPUA 3EFBA 1NP3A 2ZAIA 4BTEA 1QHGA 2BELA 2R3SA 3ODPA 2AEEA 3Q9NA 4I7EA 1BWPA 2C5EA 2IF0A 3AJAA 2NQ2C 1Z6GA 1SCKA 1PD1A 5SZKB 1AXGA 4JGGA 4N9QA 3RBZA 1DINA 1KJYA 2W83A 2VL7A 3M6IA 1PQ4A 2HPVA 4NEQA 1FQOA 5CM8B 5J4VA 4M21A 4Q1EA 5GJCA 4KL8S 4K6CA 3WNBA 5I7UA 3AILA 2CVZA 4AJ9A 1OYWA 4KXYA 2MIIA 4FBGA 2WHPB 2QUJA 3V1MA 1GQFA 4BNIA 1AD2A 1FDTA 4L4YA 3E5RA 3V8MA 2FSVA 3WE7A 2R1TB 4MARA 4GD3Q 1CJSA 3NWPA 2OL4A 1JQKA 2QEQA 1XZBA 3HUEA 4HNAA 4RVDA 3IODA 1RZRD 1F2UB 1YK1A 4HDSA 2E7ZA 2JI9A 3FW1A 4MIKA 2BZSA 1LLFA 3LDGA 1UC4B 1ESMA 3Q6IA 2AXPA 2DX7A 2E4XA 4UFOA 2IEBA 2UVDA 1BE0A 4KRGA 4PV7A 1E59A 2QT0A 4QYTA 4UUPA 3SYKA 4DZZA 4HWGA 9LDBA 4Z54A 1JDZA 3CVXA 1OC4A 1AUXA 2ZYWX 2XKAA 5KKNB 2RAFA 4Q1DA 2FEMA 4F6CA 5K5EA 4FFDA 3NC4A 2VUIB 2WWIA 2NU9B 4XCXA 4F8YA 4M54A 2IA5A 5HEKA 1EG7A 3GO4A 1C1HA 3RVQA 4M1ZA 2QMOA 3DB2A 2GNOA 2JIZA 1DIAA 4DIOA 2CE2X 3L06A 5E2BA 2VEOA 4MS4B 5HFNA 3V4SA 5ENVA 5EZYF 5PGMA 2QGNA 2FEWB 2MSWA 2XQIA 3DD1A 4BGVA 2QTTA 1SQ5A 3DTNA 5KTNA 2W11A 2XKJE 4BLSA 1KZ1A 4EMTA 1QVRA 4U7FA 1TA4A 2AX4A 1T5OA 3L7BA 3V00A 1J5EB 3B8EA 3G68A 1E1RD 4IYJA 1LPAB 2PD6A 1A9XA 3OO1A 1Z7WA 3AU8A 1VDMA 3RI3A 3VTAA 3EF1A 4QYIB 3R7AA 5FV7A 3CWZA 1FVFA 1P72A 3NHYA 3PHLA 4QOSA 2VP0A 2VVTA 1QIFA 2VBGA 5ERXA 3OHPA 1JHOA 1FDVA 2ZYHA 3MNFA 4PC7A 3UKJA 4M8KA 2DY0A 4MHSA 5DB4A 3EWNA 4E2FA 4PWZA 2VH5R 5LMCA 5BQFA 3OQJA 1BGVA 1JAHA 4PSVA 4N40A 4WDRA 3N0TA 1N34B 3L9WA 3S8YA 3S1LA 4GQAA 3KLOA 2WQZA 4Z4GA 1N5DA 4DDHA 1AG9A 4DYDA 5ALUA 5BN3B 1RYMA 3L5OA 5FUYA 1ENZA 1JVBA 3C15C 4MPTA 3SM3A 1ZL0A 2RGGA 2BFEB 4OJMX 2XWQA 1YCDA 3QLEA 5AHOA 3MUNA 1HOTA 5JFOA 1A8QA 1QHHA 3FOWA 1OJLA 1ZCAA 2IPMA 1LF0A 3FNFA 4H7HA 4M76B 5DXFA 5K3SA 5KYWB 1VJ0A 1SWVA 3TG2A 1IXYA 5DYTA 5GY7A 2WYUA 3D8UA 3C3BA 4OFBA 3OETA 5B1SA 5I7OA 5EE9A 3LPNA 1MB0A 2AR9A 3OEWA 4OQMA 5J5AA 3T12A 4X92A 2Y1CA 4QUEA 1QDLB 3IDSA 1KJQA 4E46A 2X3FA 3E61A 3FZEA 2WT4A 1T5DX 3EZFA 3FBTA 3IFSA 3KXIA 4QYSA 3UQYS 3U7FB 1TVEA 2Q2VA 3E9DA 1ZJ4A 4BN4A 4TV8F 3CUUA 1SD2A 3VYWA 4WZBE 3J80A 2FFQA 1YBMA 1TMGE 1XIVA 1GKIA 2HSWA 1E60A 4LXHA 4X44A 3ZV3A 3GUVA 5AI0A 4YCBA 5AKEA 3V2IA 3W77A 4AP9A 4B74A 5B55A 2XBLA 3GK3A 3CX3A 1P5ZB 2HMVA 3EWIA 4J03A 2HCJB 3T7KA 5DNAA 2WV7A 3WBBA 2JARA 3DE2X 4RCYA 5IFLA 1YUMA 3SKVA 1N5IA 1DUIA 3KTAA 1TTHA 5CH5A 4MVJG 1KRHA 3PEWA 4XUGB 3LYAA 4PLGA 1MZPA 3D5TA 2ZE6A 3FGNA 1NBWB 3NATA 4TLLB 3IJEB 4JLKA 4ENTA 2JHAA 2RCNA 3IT1A 1EPUA 4FGLA 2QYSA 4R1LA 1IBLB 3ZS9A 2HHCA 5HRAA 1HLDA 2N9UA 1FRVA 4J0IA 2RI6A 2GYWA 1OH6A 1F1JA 1QXSA 4LXXA 2HZBA 2R7KA 3GMIA 4NE7A 9ATCA 2WTEA 4H7EA 3ZE1B 5C1PA 1Z6AA 4BO7A 2O7RA 5L3SB 4HZIA 1OSNA 3AJ8A 5HRUA 3GI1A 1SVIA 2V3CC 5FLEX 3N2IA 1OKKA 1M72A 1XXHA 2CE7A 3JASA 5IAKA 2BR4A 2FP4B 2VLIA 1IFXA 2WE7A 1W25A 1P7CA 4HHEA 1RTTA 2A2ZA 4YP1A 3RTGA 3T5MA 2H7CA 5CDUA 5JNWA 3HCBA 5BSMA 1DX4A 1POWA 2JB9A 1M0TA 1T2EA 1DIGA 4UM7A 5JNVA 3DUWA 4WERA 3OMLA 1DTWA 1AS0A 1RHJA 4J3JA 4BRWA 1NDUA 3FYDA 1GARA 3PF9A 2H2GA 3OIYA 4EPRA 2ID8A 4A0FA 2WIJA 4OOEA 5TEVA 5A3RA 1FJHA 1NM5A 2D06A 4CKBB 5I8ZA 1GGNA 3O4RA 1M9NA 4HGZA 4FMBB 2W6ZA 5L51A 3UIEA 1Z34A 3JSXA 2XKKA 1AV7A 1COWA 1HO3A 3LOPA 4E5MA 5A5GA 2HF2A 1T9AA 3PHBE 5GP1A 3WGUA 3NG1A 1CUEA 3PZBA 3FY4A 3ABOB 2Q50A 4K6FA 1GY8A 4AO7A 4MR9B 1JAYA 2C0QA 4PWYA 3KB8A 1D7OA 4BKOA 1JEQB 2LW7A 2GVZC 1P4AA 3KZVA 2QXTA 4I46A 1XTPA 5B3JC 2G9RA 2YRFA 3RRXA 4E33A 1VL6A 2RB5A 5BO5A 5KC8A 2VZ8A 4YP9A 4Z2AA 4Z4CA 3QPWA 2KBEA 1PT7A 3TQCA 5DIZA 3X1ZA 5FWDA 4I9UA 1V7PC 1DTSA 1W36D 1YL7A 1YDGA 3BG5A 5AVRA 4LRXA 3MQ2A 4I3FA 5LM3A 2XUQA 2B99A 3RJZA 2QX4A 3F7OA 2ZSEA 3JZDA 4LQLA 3IOMA 3ABZA 3AEQB 3DGEC 1FX1A 4KNWA 1IHYA 1UOQA 1YRWA 3GRZA 1XZKA 2EW1A 3QPVA 3UMJA 4JJIA 4BMCA 3W4KA 1MRSA 4X84A 5B7QA 2Z2JA 4AY4A 3T3DA 3SJCA 1PR4A 3R7FA 4O4HF 2K7FA 1EDZA 1FTQA 2RGDA 1UM9A 2D3TA 4ZYTA 5A3QA 1APBA 2FNAA 3AW9A 1DB3A 4J3FA 5ALNA 3Q12A 1IHXA 4KLNA 2I2WA 3CTMA 1XB2A 1ARZA 1GYPA 3TEFA 4E7PA 4FGJA 2ACVA 2CDRA 4CM3A 2V6IA 4MMYB 1A9SA 4W7HA 2G82A 4BQNA 4B3FX 5EJ6A 4MR8A 3WHIA 5T3UA 1BXRB 3QI2A 2DU8A 1SQFA 4X93A 5K0LA 3WLPA 3EBPA 4ZI2A 5FUBA 2HY7A 1N5RA 2W5UA 4DREA 3IAS1 4LZOA 3U3JA 1DWQA 4IQ0A 1LX7A 1CUSA 1U0EA 3VH2A 5LB4A 5EMKA 4DILA 5E9WA 3WB1A 1V8DA 1Z17A 2O7QA 2J85A 3FPKA 3PEUA 1EA5A 4PYRA 2IEYA 3OHSX 3S29A 3VFDA 5CA0F 2LTAA 4D4MA 3FPJA 4LQCA 5B53A 1KSGA 1OAOA 2PPVA 4RPCA 1OFIA 3TCKA 4RA6A 4O08A 3UAGA 3DD5A 1NPYA 5EERA 3ND5A 1JSZA 1JHPA 4B3BA 2RK4A 1GTVA 2ZCVA 4JQCA 3NALA 2IYNA 4ZZ3A 3CRQA 2ZITA 4KI0A 4L57A 3ZVRA 3R40A 3R5SA 4CVNA 5AVWA 1V1RA 3I32A 2XCSB 4ASUD 1ZNQO 3K0CC 1MD9A 1T5LA 2VI5A 4P33A 5DH9A 2BUBA 2AZDA 3OOEA 1QR6A 3KUUA 2X0IA 2B37A 621PA 4Z0HO 2JVKA 4X20B 3NVKI 7REQA 2WOOA 3ICPA 4M1TA 4GYWA 2HJGA 2J1LA 3HVKA 1UXHA 1QGYA 2MT9A 4HNAB 3V33A 5K2MA 1EVKA 1QGUA 3U44B 5KSZA 4HXFB 3ZHBA 1CS0B 1JPVA 3W2IA 3AFGA 2GHIA 3RS4A 2QZ4A 4FD3A 3W0LB 2ZYIA 2G88A 2BEUA 1G8JA 3QEJA 1XNRB 1U4SA 1YZYA 2ARKA 1ANKA 1F2VA 1EM8A 1GRRA 1GPAA 1QGAA 4BEWA 1L5NA 5DGHA 2ZM6B 1LPOA 3NDIA 2YHIB 2O8BA 4D0RA 1N92A 4GPD1 2VYVD 3KR2A 1PJRA 2Q0SA 3I6YA 3LA6A 4MIOA 4MTCA 4O4HA 4P54A 4PXAA 1QGED 1YJCA 2DKNA 5D3QA 5T4EA 3SBEA 5ESXA 1OJ7A 1V0JA 2H0RA 5H80A 5JI3E 3I62A 2C42A 1PTJC 1D1QA 2PSHA 2PQ0A 1H4SA 4KMOA 1BO6A 2Y9MB 1VB3A 3CIFA 3DYVA 3PT5A 4XWGA 5CDFA 2GM5A 2Q21A 4FT2A 3ZIAD 1BCRA 2PX3A 3ZVKA 2OGWA 4BO3A 3F9RA 3K09C 2AOUB 3ED5A 1QYXA 4QYXA 3WYBA 4CR8A 4F7WA 1W34A 3A1FA 4GGMX 4IGAA 3SSOA 2ZPTX 2CHEA 1Y1LA 1NY5A 1ZN8A 1FS4A 2QQEA 3EJ6A 4UXJA 4EB0A 4DB4A 2BI7A 3ZLTA 2ES4A 5HNKA 1OTYA 4R54A 3ZJVA 3EEOA 3NASA 4G0WA 1YVDA 1NSFA 4NMWA 5DN9A 4EMBA 1MR3F 2H57A 3CWQA 1DQPA 2NPFA 2ORWA 1B16A 3ORHA 4ABYA 5KMGB 4GXNA 3ES9A 4RVHA 2B83A 3REGA 4H6PA 3SE0A 1Q7TA 3M2PA 4RJTA 3KS9A 4AUMA 2CMKA 2O3RA 3H6KA 3KR0A 1AUVA 2SHKA 1VIVA 2Q1TA 3OM9A 5DOVA 3ND9A 3WLIA 3OEED 1Z8FA 1COWD 4IIYA 4KO1S 2ZM5A 1KDRA 4URWR 3ZIUA 2HC9A 1JTEA 5LVAA 1FJXA 2O23A 1A9YA 2B7CA 2XLBA 4N6GA 1YSCA 2JFHA 5FO0A 1P7YA 2ZE7A 3OQBA 4A2WA 2ODAA 4MKIA 1LDBA 1DQNA 3ZJUA 3DR3A 3RYTC 5CBPB 1GL3A 1BEZA 3VNAA 3LH5A 2VPTA 4CMGA 1UBNA 2IXEA 1I2AA 5I51A 1PTJA 4PQRA 4U8GA 5LUBA 3RIGA 5IT0A 1C7FA 1GQ2A 2GJSA 3IJPA 4YDHB 1M33A 4FKZA 1Z39A 2AJ8A 4G5XA 1NLMA 3H2GA 5CCBA 4F93B 6ABPA 1L7BA 1PJCA 3OE4A 4DF3A 4BBZA 1E2BA 3BFXA 3E0XA 3KYJB 3V8EA 1BFDA 8GPBA 2WJ4A 5IM4F 3QY9A 1QVVA 3WQQA 4RH3A 1P1HA 4LMBA 1R3UA 4YH1A 3KELA 1ONSA 1OGJA 4U7GA 4OTZA 1GG2A 2NQTA 1CDOA 5DYIA 2XNHA 1IBRA 2HADA 4ZVKA 3V5NA 3W5VA 3ZEIA 3GPBA 4LUCA 5HF9A 1E2QA 4LVUA 4GKBA 4BJ1A 1USGA 4FDVA 1VE1A 5K4HA 4ZOCA 3FPHA 2A6PA 3K3PA 4CPDA 1IJFA 3G2PA 1B6SA 2YXLA 5TX7A 3RROA 1VSTA 1XFAA 2WHEA 4Z9XA 2ZBFA 3RTAA 4F8EA 1JYFA 3FPBA 1QPBA 4KHPB 4IFIA 5DOZA 1XZIA 4Q16A 1V43A 3O92A 5JLJA 4Y67A 1J8MF 1GA1A 1M76A 2BBTA 4FJ2A 4XQCA 2ICAA 2UZ1A 2OYRA 3ZHZA 4MYRA 4O5OA 3VNBA 2Z6VA 3LP6A 4NX2A 1RWKA 4S1OA 3W5IA 4TSRA 1PJ4A 4UOEA 5BR4A 3FSGD 5K99A 1XNQB 3RRNA 1XO1A 2Y2VA 3JQFA 2QUHA 3K6KA 3V4FA 1T4BA 2V9ZA 1YJXA 4HLCA 4LDPA 4M8SA 2YMPA 4NU0A 5H3CA 2RC6A 4FTWA 4V1CI 5EPEA 4WZAB 5JVDA 3OQVA 4RV9A 1XTTA 1YJAA 3P0RA 1DJPA 3DWFA 3D3JA 3O3NB 5AW4A 2J5QA 5KYXB 3O83A 4I99A 3ZWAA 5DN6A 2R5WA 5CA1A 4NOKA 5BVGB 2C2KA 1C3EA 3KKQA 5B4TA 2FY8A 1EFVB 1KHHA 1ZWLA 1KMMA 3AFOA 4R1UA 4TQUS 3QSGA 2EKBA 3ASVA 1DAPA 2X1VA 3D5QA 4LBVA 5EXXA 2I9KA 2OHIA 5TJ9A 1OPRA 4UU1A 5SV2A 3C5EA 1Y3AA 5BR7A 3B7GA 1TT5A 3WGMA 3LFTA 1BN6A 2GOYA 2JAQA 4F2PA 1OUMA 3HUDA 1BWRA 5DYWA 5D5HA 3VR3A 4PPYA 1FIUA 3IILA 2DJIA 3O1LA 3DCIA 1VJTA 2IF2A 3DZKA 4MNTA 2JLZA 4RO0A 4UQLA 2F00A 1DO0A 1ZCJA 4HDNB 3OF2A 3TX6A 3MERA 1L7DA 3ITNA 1R15A 1NVKA 4KSCA 1L5MA 3UENA 2X4GA 1C9MA 1VHDA 2XVYA 1JSXA 2BR5A 3BCSA 3CSSA 4HH3C 5A1TA 3FYUC 2QKYA 3Q87B 3C4JA 4Y2VA 1B6TA 1MPXA 2OV3A 2C7VA 2QRVA 3P2KA 4FFNA 4MCJA 2QN3A 4P83A 4FP9A 4UVGA 1KOLA 1M34E 1FYXA 3RYFB 4ZJYA 4UHFA 1ILEA 2LXNA 3ZLJA 1SIBE 5D7NA 6Q21A 3IMFA 3NNNA 4RHUA 4XWAA 2WVHA 2P77A 3KIPA 3OFNA 4ER5A 3KQNA 3HKCA 4IIFA 4RABA 3DMRA 3HA3A 3LK6A 2HU7A 1H4TA 2F43B 5LKAA 2PSDA 3JQAA 1LI5A 3I9NA 4U8HA 3D8SA 4UU0A 2MSLA 3TOZA 4DMCA 1Q17A 4JMPA 3OZRA 3LY7A 2DBVO 2IH2A 4LF5B 3KAQA 3C97A 3A9WA 4Q37A 4DTCA 4XFKA 4RTMA 3KX2A 3UB4A 1YQ9A 3IDZA 1MJGA 3WIBA 3IESA 3GEHA 1PD0A 2IYPA 1G7TA 1ND6A 2PIAA 3U3OA 1SBIA 5EMLA 3WJ2A 4HGOA 1KQOA 1PT6A 1X9GA 1BH6A 2ZW9A 4B0OA 2VR1A 5EXPA 4JELA 5GM2A 3T4EA 1E1NA 2E4AA 1GCIA 1XQXA 4I55B 2C78A 5DSTA 2RAPA 2GCGA 2X0EA 4CLOB 4EF6A 1DFGA 1UDWA 4L4UA 2F1RA 3NPAA 4FFRA 4OYHA 1AV6A 2HT6A 3ZW9A 2VTEA 1V39A 1SA0B 3PC6A 2XMPA 1Q74A 2E49A 2QU8A 3H1BA 5E95A 5LDDC 4P2BA 3OKFA 1FFAA 1CUZA 4LCBA 2NN3C 1G5PA 1D4AA 5G0VA 4LN1A 3DBLB 4BLPA 3K0SA 4PS0A 2GCPA 3ICVA 1QOQB 3MEQA 1RYDA 1K6EA 2G8LA 2QN7A 4L5JA 4QT0A 5JS6A 2NW6A 2VTVA 4NJEA 3RVPA 2AZXA 2QY6A 1LK5A 1MIOA 1VL5A 2FPMA 2FUEA 3QQPA 1ZN9A 3B60A 5BMOA 3DGFC 1EFPA 3HPQA 4HADA 4LHYA 3WL5A 1CBUA 1NRJB 2A88A 1ENPA 2NO4A 4AP5A 1GOTA 3BXXA 3ORRA 4MRMA 2MSCB 1UKVY 1G16A 4EI9A 1C8BA 1X7XA 1OGIA 4INAA 2IEGA 2X8LA 5LP6C 4MW5A 1UZMA 1DE0A 4DKJA 3MLAA 1JXAA 3L0IB 1PEDA 4B09A 521PA 1DIBA 3U17A 4M1WA 1W19A 5LQAA 1M7HA 2P67A 3SX2A 5F98A 1SG6A 1VG1A 2R1ZA 4MINA 2G0TA 4M9QA 4QXMA 3G0IA 5IYZB 3OZ7A 2FMFA 2AE1A 2OORC 2VOEA 4P53A 4NFSA 3ZD7A 2DB3A 3TKLA 1L4FA 1G6KA 4FE7A 1P80A 2B2CA 2CY0A 4KIWA 5AK3A 4KFUA 3TAUA 5KTMA 4PZEA 4YBZA 2RBKA 4WY5A 2C99A 2FOLA 2W2TA 4UZFA 1O95C 2XQVA 2Z8YM 3DLHA 1C81A 1K6MA 4AZWA 4FGKA 2UUBB 2I2CA 3PXDA 4D4IA 1A88A 1I10A 2QRGA 2QQ5A 2OVFA 4DUPA 6GPBA 5AD1A 1CB7A 2F9MA 3HFJA 3TI7A 1FFYA 5IANA 1NVDA 2C20A 2HBQA 5ITWA 5TPZA 2YV2A 4YMIA 1DBPA 5H5JA 3RPEA 1ZAKA 3GEPA 3URMA 3ZHRA 4D9NA 1XZQA 3PUJA 4GKAA 4IOJA 2E4YA 2GK6A 4QVGA 4Y7CA 4Q1FA 1F5NA 1JV2B 3DW1X 2RONA 4PZLA 1YT5A 1BE8A 4QBKA 4O4LF 4TYMA 2DHEA 3SLRA 3DQQA 3SNKA 4J29A 3G7NA 4X1YB 5REQB 3TW8A 4URVR 4R9VA 1NRXA 3I8XA 3T9FA 4QHSA 1JIVA 1KK3A 1O6CA 3IDQA 4JXKA 4C29A 1L5GB 5ECGC 3OP4A 3SEFA 4ISCA 3T52A 3UPUA 2XV1A 3R0VA 2ZS9A 4DSOA 3KVYA 4OYYA 4O63O 1MQ8B 3BEDA 3PVCA 3QV2A 4KN8A 5IG2A 4EKYA 2JIPA 4PGGA 3OT5A 1BQEA 2BE9A 1IYZA 2BFFB 2FPIA 2P9FA 2XMGA 3O84A 3OJFA 5BPHA 1QPZA 5C52B 3E81A 1P5FA 3KE8A 1XKLA 5KWVA 3PFKA 4YJDA 4ZA2A 3VPXA 1XU4A 5BNIA 2YR0A 3PDUA 4RZ2A 3SJAA 4Y2YA 1W0CA 3MWDB 1XQYA 1HKUA 3RVNA 3QVTA 4I1VA 1KPIA 4IWXA 4TLDA 2QTMA 3DLTA 1E2FA 3IEKA 4RPIA 2HUPA 1KYIA 3RVJA 1G5FA 4KQ2A 3LPLA 3UKOA 1MMFB 2C77A 1YZUA 4RSHA 2ZTHA 1DFHA 4MVXA 5T8KA 1WXXA 3VJRA 3HV0A 3RUHA 1OX5A 4QGAA 1XFDA 1TCVA 2OFWA 3A26A 4K1XA 2PANA 1S89A 4B6QA 1NYLA 3MJEA 3OPXA 1V3QE 4ZGGA 4HWKA 3BRWD 5C5DA 1BKYA 1MG5A 4S12A 1Q1AA 1FF9A 3GC6A 1ZM7A 1CULC 1ZNXA 5JT1A 1DC7A 3FE2A 4TRNA 3ZWBA 5KZMB 4JQZA 2PS3A 4CFYA 4LYAA 4PANA 2AMLA 2XZPA 3EIHA 4CL0A 1ML3A 2JIMA 3FRIA 4H18A 1HG1A 1WKCA 3DYBA 3U0BA 2TYSB 2ZUTA 4WXRA 3WHKA 3ZDYB 1GWNA 1TVKB 3C0KA 3JVIA 4AZ3A 3PU6A 1SJ9A 5JY1A 1WMFA 3OFND 5AW8A 1KBOA 1MW8X 1AGPA 1Z06A 2I4OA 1H05A 1OH8A 3GDWA 2FX2A 3L93A 3BE6A 4MQUA 1NQ5A 2ZYUX 3DAPA 1GPUA 1T10A 1UBGA 3RVDA 3M4JA 4HQRA 2NUAA 3AR3A 1JZQA 2KW5A 1FB5A 3NJ8A 3TGWA 3UO8B 4BFSA 3EPKA 2X7JA 4ZVSA 2ZR0A 5CXQA 5C35A 3VU8A 1FP6A 1RIFA 3PFNA 1EBFA 5I3CA 4D56A 4HVAA 2OXRA 2QTWB 3K1AA 3K9GA 1Q6YA 3CF0A 1XTIA 1BMQA 2DQKA 2ZJFA 3KM0A 1Z7GA 4XJVA 4BMDA 2OECA 2FFJA 3B1VA 3VOAA 1ZUNA 1DQZA 3KV1A 2VHXA 1E1KA 4G8CA 5HF6A 5E4TA 2Z9BA 2VK4A 1PEKE 4CN9A 4H6VA 3RSLA 1CUHA 2Z09A 2B3TA 1GNTA 3KOZA 3RIMA 1EXNA 3P52A 2F3QA 1RQPA 3DZJA 3H16A 3HVIA 3KHUA 4GOND 4I55F 2W0MA 4UQPA 2KQUA 3LF1A 2I3DA 4I8IA 4Y1GA 4A0QA 5CB4A 1P1BA 1KETA 4M37A 4PX3A 5J59A 2OGZA 2CL5A 3B1XA 5BVHA 2OD9A 4FLMA 5C8ZA 2WINI 1Q0LA 3BKXA 3Q5EA 4D96A 5CW1A 5DFAA 4O2RA 5B5SA 1B42A 1GZ6A 5L4SA 1B0ZA 2VA8A 4H7IA 4A26A 4QUAA 2VYCA 1RLTA 3AETA 1HPLA 1IPEA 1E5TA 2PYDA 1YAJA 4JJ4A 4EYGA 3U7RA 5JO9A 2XIQA 1DPGA 3DLCA 3UT6A 2NVOA 3AG6A 2OO5A 3IIJA 2VDPB 1IZZA 2D54A 3ADKA 4GVPA 2WA1A 5ADHA 1IXSB 5CM9C 2J0SA 5KTRA 2BGGA 4DDTA 4PAOA 1GGEA 3G23A 1XG5A 3C5HA 3C6KA 4KWTA 4ENQA 4LDQA 5HYVA 3HWX1 3QE2A 4DLZA 3ZQJA 2HZ7A 1HKHA 1CB0A 2J46A 3A9TA 2VKQA 2E21A 2WNSA 3AR9A 2W2QA 1E92A 2REQB 5E6UB 4MYTA 1F7VA 1U0LA 2BSAA 2X7HA 1VE3A 4RK6A 1I36A 2ZK7A 1JI3A 2AJDA 1P4SA 2XGSA 3JALB 3SP1A 1QIMA 1BHJA 3PI7A 1WR8A 1ZJYA 4HRYA 2EERA 1UKAA 3QIAA 2ONZA 3EXHA 2Q6LA 1XRQA 4KKVA 2ZVQX 1W94A 1NYTA 4EECA 1SHTX 5ISMA 2OENG 3EH2A 2KSQA 1B0PA 1PZGA 4BFYA 4DQXA 2AD5A 3HBLA 1UMBA 4DABA 1QGZA 4EHBA 1C0KA 4EI7A 1KY4A 3WGOA 4F0JA 2VHTA 4XX1A 4Z1OA 2XDQA 2VLBA 4URFA 4AK9A 3VHQA 1V3VA 1QHFA 1SUFA 5F7ZA 2H1LA 2A9FA 4FJ1A 3H99A 3AM5A 4PTLA 3M34A 4KR9A 2ZSIA 1ZD4A 4BB6A 4CKZA 4C2UA 3RWBA 4CIWA 1LY1A 2J4DA 2ZSFA 3OCXA 4IY1A 3AKEA 1IM8A 3UUGA 3PTLA 2X6RA 4HVLA 4JXZA 4KREA 1JF8A 4W5HA 5HILA 4QUHA 2VO1A 5L6MB 3MLBA 4X97A 2B0CA 2A8YA 3HR7A 4JBHA 4B3MB 1Z68A 3GA7A 1K7SN 1WY7A 3G82C 3HFSA 3R41A 2BM0A 3W3AH 2RC5A 4U6QA 3VJMA 2DUJA 4FDMA 4Z7JA 3WAJA 2C7BA 3RC7A 1W5BA 5CPFA 4YMHA 1IIBA 2V7VA 1X9IA 2O2DA 3ESQA 4J8PA 5A4MS 2ZPUA 3S0JA 2GBPA 1SEVA 1U0OC 2JJ2D 2YWFA 1SBHA 2UAGA 3BXPA 1C9YA 3DEYX 4S2UA 5DDIP 5IKOA 3VR6A 2YV4A 4C6TB 2JIRA 2Q5OA 1YZHA 3MELA 4DE5A 2XYVA 3QMPA 3LUCA 3TO5A 4J0CA 5IDXA 2OUKA 4QQKA 3COZA 2O8DB 2I1WA 3C48A 4LK2A 6LDHA 3A4MA 2ZRHA 5JCXA 4DLVA 1ELOA 3QPAA 3PPYA 3UCXA 3EOBI 3NTUA 2HAEA 2X5NA 1KO5A 1SZJG 2PH3A 1KTIA 4HV4A 1ZQ9A 2OC9A 3T1HB 1VLVA 3MTBA 4JHXA 2X2OA 3OE7D 2P8SA 3R3XA 4CG0A 3INNA 3IV6A 3IURA 3GLFB 1E6WA 3ZZNA 4LOJA 1QAMA 2A5LA 4KUEA 4IJWA 1TK3A 2B7LA 3X0DA 4F3CA 5KU1A 3WGIA 3SQOA 1DQYA 3N5KA 3HDVA 2HB6A 5J2TF 3KL2A 2WI8A 2YWGA 2JFWA 4B3HA 1WVIA 1WF3A 4P3YA 3WDSA 1LXCA 4TWBA 2Z5LA 4CMIB 2RARA 4Q48A 2A5YB 1KZ7B 2PD4A 2PLWA 2PX0A 3R3WA 3EVCA 3VPCA 4B43A 2VATA 3PL1A 4HAIA 4EHAA 3MOSA 5C18A 2FSFA 2PU7A 3WYCA 3C1OA 4E5SA 2P4SA 3ELWA 2XSZA 1WVGA 3N2GB 3QFCA 4LJ7A 4UNNA 3RG8A 4GMFA 3GJ4A 3CT6A 4RK7A 1XRSB 3V1NA 1X2BA 2EJVA 2PR2A 3IAEA 1W30A 1H0HA 3SS8A 5AW9A 2NUPA 1PTKA 4BNFA 3UWSA 4A3SA 4RD4A 5IULC 1A5AB 4ZAGA 5JSYA 1UFQA 3IV7A 1BAPA 2XEDA 1Q7BA 1WW2A 2WSMA 3AU9A 3ADPA 2A5JA 4ZAYA 3WQBA 1KQ3A 2OCLA 1YOVA 2J3KA