3T4UA

L29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWILDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylesterase
publication title L29I Mutation in an Aryl Esterase from Pseudomonas fluorescens Leads to Unique Peptide Flip and Increased Activity
rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase, hydrloase
total genus 103
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t4uA00
2OGTA 2OQVA 4FLEA 5K3CA 2RI6A 3WK9A 4CCYA 1R3DA 1VE6A 1YSCA 4AMZA 5ALKA 3SC2A 4FOLA 4NZZA 5CH8A 1R9NA 3KSRA 4X85A 5A7GA 5DNUA 3K9BA 3C6YA 2XMRA 3CCCA 4B84A 4TGLA 5CT6A 1IUOA 4WJLA 4B0PA 5DYWA 4JUIA 4HTAA 1AUOA 4EA6A 5IVIA 2GYVA 1JJIA 2HA0A 2J3QA 3N0TA 1CUYA 3ICWA 2JIDA 4A16A 2WFLB 5JAUA 3R3YA 1JU3A 2CJPA 3JWEA 3GELA 3RARA 1XKTA 4MYSA 5IKXA 5AKKA 1ZICA 4AMYA 5I9IA 5CBKA 5JIBA 1C7IA 3IURA 2ZYSA 4PO3X 2WHRA 5JAOA 2QT9A 2VTVA 4G8DA 3VDXA 2HU5A 4DNFA 1Q83A 1UOOA 2YH2A 1ORWA 1W4LA 1WHSA 1AZWA 5LKRA 4MQMA 3DKRA 3VISA 5LYYA 3SWWA 1WPRA 4CCYB 1A8SA 1MPXA 4WY8A 2ACEA 4ZV9A 1E3QA 1YS1X 4W1RA 4JEIA 4UHFA 4Y2JA 4BBZA 3EIOA 1LLFA 3WWDA 1K4YA 1EX9A 4Q05A 1E5TA 3VVLA 2VT6A 4KE7A 1ZIXA 2QJRA 1MNAA 1H2WA 1Y37A 3DOIA 3R3ZA 4QNNA 3FLAA 2OQIA 1H23A 4QE3A 2WG2A 4G9GA 2WIDA 5BWCA 3NUZA 4BCBA 5YASA 2XMZA 1KU6A 2O2HA 3IDAA 5JD5A 1A8QA 3R41A 3UUEA 1CUXA 4J0CA 4K6GA 1FSSA 4GWLA 1SC9A 5ALLA 3UMJA 4KRYA 1XZLA 4EBBA 3HSSA 4DGQA 5K3EA 1LGYA 2WG1A 4G9EA 1XQWA 4L3WA 5KBYA 2XQJA 3GBSA 4EY4A 1ZJ4A 2ONCA 1O6FA 1BN6A 1LPOA 2PUJA 5ALOA 1QIMA 4YPVA 2V96A 1FFEA 2C0QA 4PQEA 4AXBA 3DLTA 1CQWA 3D3NA 2WU4A 5HQ3A 1VZ3A 2QJWA 2Y6VA 3FLEA 4BE9A 3FVTA 1BU8A 4Y2QA 1XRLA 2JGFA 3RK4A 3NGMA 3P2MA 2RIPA 3BF8A 2XQFA 1SCKA 1P0QA 3O4HA 1MN6A 5FDFA 4QDZA 3DQZA 3EBLA 4QDOA 4X93A 1CUUA 2DQYA 5BV7A 1DWQA 4HRYA 3O9VA 5ALRA 4H0CA 1VZ2A 2HRRA 3C6XA 7YASA 1BRTA 2WIJA 1QONA 2WUGA 4PSUA 2QVBA 3D2CA 5ALHA 2HA5A 5AK4A 1E66A 3DL7A 4XVCA 4HXEB 5HK9A 4FWBA 4ZWNA 1YB7A 4EHBA 3ILSA 4PF1A 3WK6A 4KEAA 4FTWA 3PDCA 4GW3A 1CVLA 2VATA 2ZSIA 1QFSA 2J4FA 1W76A 2AJDA 4G8CA 2OCLA 3DEAA 5K3DA 4TVKA 3C5VA 3L1IA 2HFKA 4UFOA 4G4IA 1F8UA 4YASA 1DX4A 1CIJA 1QTIA 2ECFA 3G9XA 2AJCA 4B85A 5HQ3B 5EHZA 3PICA 4X94A 3KWFA 4UHBA 3PF9A 3X3HA 4UBLA 1MJ5A 2IIVA 1THGA 1LZLA 2BGNA 1LPBB 2XUHA 2G63A 4MEAA 1GXSA 5ALPA 5LZ2A 4DNOA 1NU6A 1AC5A 1GGVA 2XLBA 2BAGA 3IA2A 3WWOA 4M0FA 1XRPA 4UFPA 1AMNA 1CR6A 3G7NA 2YYSA 5SYMA 2HA4A 5FKJA 4AN1A 3VVMA 5K3AA 3N2ZB 3H2GA 2GYWA 1T4MA 2QS9A 3ANTA 1CEXA 3DD5A 4BRZA 3FBWA 4QLAA 2HM7A 3FWHA 3BDVA 4F60A 4DMHA 4RGYA 5J3JA 3G0CA 4JH0A 2BFNA 1CUBA 4KAAA 4U2FA 4DSAA 2WTNA 3IBTA 3HZOA 5JASA 2DCMA 3FSGA 3STWA 3WL5A 2H7CA 3LLCA 1PFQA 1AX9A 4Y2PA 3FYTA 2Z5GA 4EUSA 1WB6A 5DTIA 1ODCA 3H2IA 1LNSA 1CUIA 1USWA 5ESRA 5F4ZA 2D0DA 2XLCA 1H2YA 3A2NA 2Z3WA 2OXEA 1FFBA 3HC7A 1DU4A 1WCYA 4QDTA 3KDAA 3STVA 3CXUA 4S0XA 2BKLA 4CIBA 3D5EA 5ALFA 5FRDA 3VXKA 5AIBA 5T4HA 3QM1A 3W05A 5JAHA 4XIIA 1JI3A 2CMFA 2VJBA 4V2IA 5EIAA 2ORYA 1IMJA 2EEPA 1KU0A 3A2MA 3WKAA 3MUNA 3H17A 5C8VA 1XZFA 1XKLA 4X97A 2C5GA 5JYCA 1ZI8A 2WG0A 5AKIA 5AKZA 2GBIA 3A2LA 1U65A 1CUAA 4P9NA 3KXPA 4ZV7A 3ESCA 1Y7HA 4QA9A 1JMYA 2HA6A 2HA2A 2PSFA 1QO9A 2DFPA 2Y2UA 2WJ4A 4AZ0A 4W9RA 2QRUA 1YA8A 2XMDA 2GZRA 1QIJA 1IZ7A 4Q3LA 3ESBA 4Y2UA 2DHDA 2VA9A 3OC0A 3U1TA 4LXHA 3WYNA 4G4GA 1IUPA 1L7RA 1QIKA 3I6YA 3FCXA 2C4HA 3I2GA 3Q8WA 5LZ7A 2QUAA 5EI5A 1I6WA 3G0GA 3KOOA 1EK1A 1ETHA 2BUAA 3CN9A 3D2BA 4DTCA 2O2GA 5JARA 5CH5A 1ZOIA 3WIBA 1HKHA 1HL7A 3HABA 1THTA 1YASA 3WA7A 3WJ1A 5JZBA 5CMLA 4BC1A 2RHWA 3IVMA 5SYNA 4B80A 1QIDA 3AINA 1UK6A 1MTZA 4WCVA 4FLFA 1DWPA 1UK8A 2VT7A 1WOMA 4H77A 1Q0RA 2XUPA 3WL8A 4G8BA 1CFJA 2ES4A 3ZV7A 2OCIA 5AIAA 2R11A 1UZAA 2CB9A 3AIMA 3I6MA 4FBMA 4GXNA 4Y2VA 5EHQA 2OG1A 1QZ3A 2XQIA 4B9EA 5ALDA 1UFOA 5FOQA 4N8DA 1QFMA 2HHAA 2C0PA 3G9ZA 2OGZA 3WKBA 2WU3A 4CG3A 4EB0A 5HF6A 4UUQA 4GHWA 4RE5A 1S8OA 1EB9A 4BB0A 5K5EA 4BE4A 1XZDA 1H2ZA 1WB5A 2GYUA 2ZJFA 1DTEA 1GPLA 3H0CA 4HXGA 4J3JA 3WA6A 5AI8A 4Q34A 5AO9A 4ROTA 2Y1KA 2DHEA 3STYA 3JYHA 3D4LA 3R3WA 4I3FA 5CXUA 5AK3A 4I4CA 1A8UA 1TCBA 4X92A 4HZGA 5AKEA 3LS2A 2PM8A 3F97A 4MWTA 1K63A 5AM1A 1SCQA 1G66A 4HRXA 2QR5A 3V1MA 1ZD5A 2G5PA 5AK5A 3QMVA 4DNQA 2PSHA 1XLWA 4W1SA 3UUFA 5AHXA 3IUQA 3S8YA 5C81A 2OCKA 2BUBA 4AQDA 4CFSA 1J07A 3WZMA 3TJMA 2CBGA 5ALUA 5AI0A 4HVTA 1UKAA 2ACKA 2ZVDA 1IUNA 1DWOA 3IUJA 4L9AA 1W52X 3S2ZA 2RAUA 2EDCA 4J0GA 3F96A 1CLEA 2J3DA 2CUTA 2QXTA 2JGIA 2XUIA 3G9UA 3GA7A 4IO0A 2G5TA 4EZIA 2DSNA 2WIFA 4A5SA 1ORVA 1X2EA 4NMWA 3DDUA 2PL5A 1OILA 2HU7A 5AI6A 2V98A 1XRNA 3T4UA 2PSDA 1TRHA 1XRQA 2ZYIA 2BCEA 4MYDA 2PKYX 5ALIA 1ACJA 4ZXFA 3LIPA 2WQZA 1EINA 5AI9A 2XMQA 3OOSA 4FMPA 3ZWQA 1ACLA 2JGLA 5CW2A 4BAGA 3TEJA 4INZA 5AM2A 3NOXA 1PV1A 3QZUA 3WLAA 4WFKA 1XZIA 3LP5A 5C8XA 1GZ7A 4PNZA 4H7HA 4N5HX 1AGYA 1W75A 1CUSA 2H7YA 1FFAA 3B5EA 5AM5A 4C89A 5CT9A 3W06A 5EHXA 2WM2A 3AFIA 4Q3KA 3W04A 2YASA 1CUDA 1Z68A 1DQYA 1L7AA 3O4IA 3LIIA 1TIBA 2C7BA 2XUFA 1G4HA 1YS2X 3U0VA 4D9JA 1RP1A 4LIPD 1ZGCA 4J7AA 5H3HA 1QIGA 4AN0A 5ALWA 3FCYA 4ZRDA 4HS9A 5HFNA 4E46A 3DNMA 3RM3A 4FNMA 1K8QA 1MX9A 5AM4A 5HKAA 4MWSA 3E3AA 1E8DA 1CRLA 1CUGA 3AIOA 1Q84A 4KE6A 1WPXA 2Z3ZA 4BCDA 4J0HA 2GBFA 3QPAA 1KEZA 1JMKC 4K5QA 2ZSHA 3M3DA 3G0DA 1EVQA 3GFFA 3OPMA 2ZJ7A 2Y6UA 4LYEA 4QWMA 1K6EA 5CT4A 1ZD2P 3QPCA 4EY8A 1GKKA 2ROQA 2XUGA 2JEYA 3HLKA 1EB8A 4UFNA 4UBIA 4KE8A 3DS8A 2OAEA 2VJDA 3QPDA 2PUHA 2FJPA 3K2IA 1VXOA 4Y2RA 5AKHA 5JZSA 2X5XA 3QMMA 5EGNA 4Y2XA 5JALA 3E0XA 3A70A 4I19A 4C01A 5DLPA 3WL6A 1ZD3A 3K6KA 5ISMA 4W63A 4KR0A 3H2JA 2H7XA 3TGLA 4AO6A 1XLVA 5DNWA 4OCZA 4Q82A 2QM0A 3RLIA 2WTMA 1R50A 3W9BA 5AOBA 4FDMA 3I1IA 3C8HA 2CKMA 4IQ4A 4XX1A 2JF0A 4LYDA 5DNVA 4BP9A 5C7YA 2GZSA 3D0KA 3WYDA 1GPKA 4M0MA 1CUWA 2QUBA 4DSZA 3L1HA 4F0JA 5DYTA 4ARAA 1BE0A 4DMKA 5AI5A 1XLUA 4Q1VA 1LBTA 3KWJA 2WUDA 3ZLUA 4AO8A 4C4YA 4Y2TA 5AI4A 2DHCA 3I2JA 3WWCA 5EFZA 5AKXA 3M83A 1DX6A 5JAPA 5K3FA 2V97A 2G4LA 1EDDA 1ZI6A 3I6ZA 4UBNA 5AOCA 4UHDA 5AH0A 5D3KA 2WHPB 3C8DA 1X2BA 2NW6A 4UBKA 5ALYA 1G42A 2HA3A 1C4XA 3D2AA 3VKFA 1K5PA 4W1PA 1B41A 1XRRA 1XQYA 3I1YA 3V48A 3H19A 1TQHA 2FJ0A 4FKBA 4FLMA 4J03A 1QO7A 4O08A 3ZLVA 1AKNA 4X91A 2XMCA 1CUVA 4GI1A 5AKJA 2WJ3A 3H1BA 3STXA 3WKEA 3FSGD 2I3DA 3QYJA 2C58A 1YCDA 4HAIA 1W1IA 1BROA 1MAHA 2XMSA 4F21A 3I2IA 2HL6A 2VF2A 2IITA 4BAUA 2Z8XA 2PVSA 5E2IA 4EY6A 3BIWA 1R9MA 2WFMA 5LZ8A 3HJUA 4N8SA 3YASA 4DMFA 1CUZA 3WWPA 5K3FB 1XZBA 3AZPA 4OSEA 1J2EA 3PFBA 1U8EA 1HDEA 2VJCA 3EQ7A 4QDXA 3OG9A 3QITA 5HF5A 4KAJA 5AKLA 2X76A 2HRQA 3FYUA 3PE6A 1U4NA 1BEEA 2LIPA 4Y2SA 5FUMA 1N5RA 2CEKA 4U2BA 4GECA 1HQDA 3R3VA 5LP1A 3LCRA 1F6WA 3DL4A 3WK5A 3V1LA 4PSCA 4W1QA 4DIUA 1EH5A 1CUEA 4B81A 4KRXA 4IH4A 5K3BA 1VLQA 2JEZA 1EXWA 2WFZA 3TRDA 2AJLI 4QWWA 2HDWA 1UK9A 1J06A 3O95A 4BTLA 5HKBA 4OB7A 2B61A 5KWIA 3FLBA 4KE9A 3I28A 3QBJA 1JU4A 5T4BA 2Q0XA 3VJKA 4LHEA 5ALEA 4UHEA 5FP0A 3M81A 2ZJ6A 4DYHA 5T4FA 1EI9A 3I2HA 2JGMA 1LPSA 2O2IA 5AOAA 1ODTC 2QMQA 3AZQA 3DCNA 1SOMA 3QH4A 2CZQA 1HPLA 1H2XA 2XMGA 2DQZA 5FV4A 4OB6A 3C5WP 2DR0A 3AJAA 3EQ8A 1EDBA 1JKMA 1JJBA 3PFCA 3OM8A 1O6GA 2AJBA 4G5XA 2XT0A 1CUJA 2WSLA 4HXFB 1YR2A 4Y9SA 3FYUB 3STUA 4BVJA 5LZ4A 3H18A 5CT5A 2PU5A 1QIEA 2VJAA 3ICVA 1E8MA 2QKYA 3EF3A 5AM3A 1ZIYA 4UBOA 1XZJA 5T4EA 1IVYA 4H7IA 1Q0ZA 5ALQA 6YASA 3G9TA 4X6XA 4UBJA 4CCWA 1XZAA 3BDIA 1P0MA 1X70A 3DJYA 1GQSA 5D3ZA 5JADA 4CI9A 3HYSA 4NVRA 2VAXA 3O9MA 1LBSA 4DMCA 4WY5A 4ARBA 4H35A 2V9ZA 5D7BA 2WUEA 5AK6A 1XZKA 1A7UA 5FPPA 1P0IA 3DOHA 2BGRA 1LZKA 1BS9A 1QGED 3ZPXA 3CN7A 1QTRA 1T2NA 3MVEA 5LIPA 3DYIA 2XUJA 3C70A 4IH1A 5IVHA 1JJFA 3B12A 1F0PA 2B20A 5CTAA 3C6ZA 3FOBA 1FJ2A 4EY5A 4C4XA 4QEKA 4X71A 3D59A 1ZD4A 2GBGA 2FUKA 4J0KA 5JZ9A 1QJ4A 2OGSA 1TKRA 3O0DA 3BL8A 4C4ZA 3SX4A 2OCGA 1H22A 2VQ6A 1FFCA 1EDEA 3JW8A 2BJHA 2WUFA 4BZWA 5LZ9A 4U2DA 1HBJA 2VAVA 4A23A 1UK7A 4WDRA 5JD4A 1RWQA 1UT6A 2JBWA 4DNPA 2RGUA 3R3UA 2PSJA 1CQZA 3NWOA 1JT2A 1N5MA 5E4TA 4UHCA 1G5FA 1AURA 1FFDA 1XZMA 2R8BA 5KWJA 2C5FA 1LPNA 3G0BA 4AB1A 3WJ2A 4OU5A 4CIAA 4UBMA 5JATA 4U2CA 1YAHA 2EDAA 4BYMA 4XJVA 4C88A 5ALJA 4MEBA 5AICA 3ZI7A 2O7RA 5ALMA 3M82A 1MO2A 5ALZA 2W6CX 3H04A 4FHZA 2WIKA 4BAZA 3GZJA 4E11A 2HFJA 4OPMA 2HIHA 3BJMA 5A6VA 1HLGA 4OU4A 4KYVA 1C7JA 3H2KA 4L0CA 4X95A 1VA4A 1GT6A 5AP9A 1EA5A 4N5IX 2JGJA 4EY7A 3WMRA 5D6OA 2RHTA 2WKWA 2PBLA 1MU0A 2ZYRA 2WLSA 4Z49A 2VSQA 1YA4A 4B0OA 3AILA 3QMWA 4G1FA 1QIIA 3AZOA 3WKDA 3FNBA 4IH9A 4LXGA 4LKOA 1BN7A 4GDMA 5E4YA 1SCIA 1QLWA 4MJ3A 4Y7DA 4PV7A 4CG1A 1ZJ5A 4X6UA 4UPDA 1WB4A 1F0NA 3FVRA 2AJ8A 1ZI9A 2Y2VA 3WWEA 3IUNA 3E4DA 2I78A 3G8YA 5A71A 4OYYA 2QXUA 4AZ3A 2XUQA 2PX6A 2PU7A 4M0EA 3GROA 4UHHA 3T52A 2WHQA 3ED1A 4KAFA 3OURA 4OYLA 1RYYA 1IZ8A 3Q0TA 1WHTA 5JD6A 1UOPA 5AM0A 4LXIA 1VE7A 4BRSA 2WHPA 3BIXA 4J0JA 5I8PA 2W22A 1E8NA 5FXMA 1XQVA 4MXDA 4AX4A 4DLNA 1MAAA 2YXPX 3V1KA 3BE8A 4KJXA 5HF9A 5BWBA 1VXRA 5A7HA 1A88A 3WL7A 3HRHA 5FPQA 2OPHA 4J0IA 4ZI5A 1U2EA 1B6GA 3A6ZA 4B9AA 1XZEA 3DYVA 4MQLA 2P8SA 1DT3A 3ESAA 1QOZA 2I3ZA 2WIGA 1QE3A 4GLBA 4BP8A 1TCAA 1BCRA 3WIOA 1LPMA 5HZGA 1OXMA 3F98A 3H1AA 4ETWA 5EIEA 4ITVA 5LKAA 4X3CA 2XQGA 5HCUA 3WI7A 2XQKA 4Q3OA 3O4GA 4OB8A 1XROA 2XB6A 4BTVA 3V1NA 5AJHA 1LPAB 5AKYA 1ZGBA 4PW0A 2O7VA 5E4JA 4ZREA 3AIKA 3AUKA 4H7FA 4Y2YA 1UWCA 1Y7IA 2XI4A 3BWXA 4JNCA 1LPPA 2E3JA 2XMBA 3WK4A 1L7QA 1VA5A 3VJMA 3G02A 4X00A 3SK0A 5ALNA 4X7BA 2K2QB 4RPCA 3F67A 2XE4A 1BCSA 5CRIA 2XUAA 4N8EA 1WM1A 3IIIA 3STTA 5EHNA 4J0DA 2D5LA 4WDQA 1QIFA 4K6HA 2I03A 1R88A 4AO7A 1MX1A 4FBLA 4BC0A 3ESDA 5ALTA 3BJRA 2XUKA 1E89A 2WILA 4FFVA 3WQHA 1DT5A 1UXOA 4GEGA 2XUOA 4KACA 3PUIA 4H7JA 4DM7A 3I2FA 2HADA 4FNGA 1VKHA 1MNQA 2JGKA 3E1GA 3V9AA 3OTQA 3R3XA 3QVMA 2HA7A 3IB3A 1GKLA 3C43A 1CUFA 4H7DA 1YAJA 3IULA 3MUOA 3F9CA 4H7EA 1DINA 1TCCA 5CXXA 3PF8A 4BVKA 1W6RA 4F5ZA 2QTBA 3WZLA 4RNCA 1MT3A 5C8ZA 4OUKX 4RE6A 4B82A 1XZCA 5ALSA 3WK8A 4JYPA 4YK7A 3ZLTA 4BDTA 3VJLA 2RONA 3F8SA 4BDSA 4CG2A 4ZGBA 4E15A 3G0IA 3WKCA 4IHAA 3R40A 1BEZA 2GBCA 2HU8A 2B4KA 1NX9A 3WK7A 4U2EA 4BATA 4PSDA 3O4JA 1VJ5A 3PUHA 4E14A 1UKCA 5I7UA 5DJ5A 4WFJA 4G4JA 4WFIA 1QIHA 5IVKA 1CUCA 4L72A 5DTJA 3BXPA 1GPNA 2OAGA 2BUCA 3CCBA 5ALXA 1M33A 1EVEA 2H1IA 4BZZA 3HXKA 5ALVA 3BF7A 1XFDA 3MGAA 1AQLA 2X8BA 4JYMA 3C45A 3HEAA 5A2GA 1CV2A 3R0VA 4NS4A 5EIHA 2PPLA 2J4CA 2B9VA 3RKSA 5A7FA 1XZHA 2PSEA 5HK8A 2IX9A 3C87A 1CPYA 4U2GA 1TK3A 1MX5A 4P92A 1R4ZA 4P93A 3C6BA 4H7KA 1EK2A 3HI4A 4TPKA 4QLOA 1D07A 3IUMA 3KD2A 2FX5A 4YX9A 4H18A 1ISPA 3FYUC 2H9YA 4X90A 1J1IA 3D7RA 2XUDA 1XRMA 1VOTA 1GQRA 4BCCA 3W9UA 1CUHA 3EQ9A 1SFRA 1N1MA 5BOVA 4K2AA 4GBGA 4X6YA 3FAKA 1NU8A 3DKKA 5ALGA 2VEOA 4B83A 3PI6A 5HFAA 5LLSA 4QZVA 1XQXA 4OD0A 5IVDA 1YB6A 4P08A 5HF8A 2JGEA 1DQZA 1OCEA 1R1DA 2Z8ZA 2XDWA 4C6HA 5FLKA 2QZPA 3B3QA 5CURA 1TAHA 4QDUA 1EHYA 3I2KA 3H2HA 2WFLA 1UKBA 5DYYA 2AXEA 5LZ5A 5CT8A 5A62A 1PJAA 5JANA 1XZGA 5KREA 2WJ6A 4K6KA 3HACA 4FFWA 5CH3A 3GUUA 2OLEA 3L1JA 1UOQA 3W2TA 2QOEA 2ZYHA 1P0PA 1N8SA 1JFRA 4B7ZA 4B6GA 1ODSA 5AKGA 2UZ0A 4XWGA 4BVLA 5DWDA 5IH7A 4C87A 3ANSA
chains in the Genus database with same CATH superfamily
1U2GA 2XY4A 4JCOA 3OZEA 5K3CA 1XRSB 2RI6A 4WESA 2J32A 4LRUA 4WCFB 1Q5PA 3PL1A 4CCAA 3OQIB 1DXHA 1R3DA 4QXPA 1JDJA 2D2IA 4TRJA 3V2GA 4AMZA 4FFMA 4ER3A 5JSFA 1QC5B 2PR2A 2C3MA 5FFFA 3S4YA 1BG6A 2VNKA 2ZRIA 1AUPA 4TKVB 1MV5A 1AD2A 2YWGA 3P0FA 2V54A 5HJ2A 4J4BA 5AD1A 3MT0A 2PA0A 1TPZA 1GRRA 4CG0A 1ESDA 4EATA 1OWNA 4DA4A 2OPBA 4L4RA 2KPOA 2R85A 4Z54A 1KTIA 5FUMA 3K9BA 3QKWA 3SEQA 5D84A 3AESA 5A5DA 1TOAA 4NJEA 2XMRA 1H5QA 3NVDA 4WXPA 3LVRE 4Q3BA 2A0FA 2P9JA 3KFLA 3MCVA 1NN1A 1GY8A 3NH9A 4TGLA 4FHDA 1HE8B 1WQ4A 4IV5A 5CT6A 4W99A 3RANA 4B0PA 2HIGA 3DAYA 4J91A 4O2RA 1R8QA 5TRTA 4DHWA 2OAQ1 3CNHA 2E6KA 1BWSA 1RR6A 1ECJA 3DV0B 5CPFA 2O50A 4F96A 4NV3A 4H1TA 2J0VA 2AF3C 2W2XA 1IY1A 1KY5A 3C3AA 1JJIA 1MH1A 3R2JA 1SXJE 2HOQA 2QTVA 4JBGA 1Z2NX 3JR3A 5E2BA 2VDRB 4V0MA 3MCZA 4D43A 1AKWA 1M83A 1OY1A 3V4LA 1XNGA 4JAVC 2XZTA 4JKOA 4XDGA 1Y3DE 5J40A 1PKXA 2JRLA 3DDHA 1BD4A 1G6Q1 3IPAA 4DZTA 5F3DA 2GYYA 2P67A 3M7IA 1VB3A 4CETA 3EEFA 4R2KA 4KO8A 1XKTA 8ABPA 1OQAA 2GXQA 2UV8A 2CNWA 3IJ5A 4NCKA 1W0KA 1HE2A 3KJZA 2ZB4A 2WE8A 1DNPA 1YCHA 3GC6A 5BUCA 1DG3A 1SK8A 3QFCA 5DFAA 5CBKA 3DE5X 5JIBA 1G8YA 4L7VA 3HGMA 4Z1OA 3PQ5A 3G23A 4WGGA 1HT1E 4YXFA 2IPLA 2PKXA 3VSCA 2XQVA 1M2VB 1OBOA 3C1UA 4K03A 2Z2XA 4KQGA 3KKKA 3H9BA 3K9WA 4R9VA 4R6WA 2E89A 4GSKA 3TTXA 4EQ6A 1PJBA 1Y8RA 5JAOA 2YFKA 1CJUC 1JDTA 1O9GA 2H1RA 3NTXA 1RWMA 1J1UA 3FYHA 4EF4A 2ZTLA 4DC1A 1V96A 3FHJA 5EP4A 1BEUB 5HZHA 4JJFA 3VZSA 2V7VA 3FPJA 4IMRA 3EDCA 5ICMA 2BR3A 2ZJ8A 1ZRMA 5CVDA 2QG6A 1FBNA 1WHSA 5AW4A 1Z15A 1WP4A 1U1DA 2HMUA 2QTMA 1U1IA 3ISJA 5AW6A 3TRHA 2ISQA 4DC0A 1U04A 4WESB 5KKAA 5K8LA 4BO0A 2F4VB 2X0JA 4QQFA 1RXUA 3B9RA 4IHQA 3UHOA 3VR1A 2IOFA 1JJAA 1F06A 1A8SA 1Y9ZA 2P0AA 2HDOA 4U7JA 1NL3A 4WY8A 4V0QA 1KTVA 2NO0A 2X9VA 4DLBA 5JFGA 5MN5A 1ZH8A 4UHFA 4U7HA 2FR8A 3DEZA 4Y2JA 1KBQA 1GGJA 2Y27A 3EIOA 2FFHA 5A05A 3S68A 1U7XA 4ESEA 4KXQA 1EX9A 1DTSA 4Q05A 4UXJA 1I7PA 2XF8A 3P9KA 4RKRA 3VVLA 2VT6A 5T67A 1E4OA 3TZLA 5IM4A 1QUFA 3EF0A 3HG7A 5CFNA 1B76A 5M29A 1N78A 2IS4A 4MJXA 3GLGA 1NFRA 1Y37A 2PZJA 4G97A 4WKBA 3TR6A 1VC2A 1VG1A 4ZCLA 4LX0A 2OQIA 4NJEB 5G2OA 4URZR 2QE7A 5DW3A 3TQOA 1ZXXA 2HCBA 1XIVA 5ER6A 2OXTA 3ZNNA 4YCCA 1C50A 3KQQA 2J9RA 3KVOA 1RM4A 3CR3C 4H4DA 4F1JA 1CNMA 2EVWX 5GWXA 2GHQA 4PO1A 2Q3EA 2VP9A 5AVSA 2WIDA 1XNRB 3W9SA 4G56A 4RH3A 1KO8A 5EFOA 2WV7A 3NUZA 1UM9B 4BCBA 3X2SA 3FM9A 2WTAA 4RNDB 3D4PA 5DBEX 4LY0A 4ZVLA 2V5VA 3WBKA 3CUWA 1KU6A 2YW9A 4CW7A 3LDUA 1WSBA 1JV2B 4GYJA 4BNTA 4RLQA 5TPZA 5K6TA 1OE0A 3BULA 1C7RA 3GOQA 1O95D 3EZXA 3UJ7A 2G9VA 4JKIA 3I6BA 5AW3A 3OMXA 4Q1BA 3VNVA 3IEIA 1CD5A 3AF0A 4DQDA 2M9MA 1XCMA 4C6SA 1PSZA 3DO8A 3L82B 4ZCRA 2G80A 1JTVA 1N6LA 3BORA 4NECA 3PDJA 1DRVA 5CR9A 3SIXA 1L8QA 2G25A 4X64B 4HQNA 4TRMA 1FJGB 4A8HA 1RMQA 3KR0A 1AMOA 1SC9A 1OH6A 1OGYA 3UFXA 2IGTA 5HEKA 1R74A 2YINC 3VDRA 3OM9A 5GTDA 1IH8A 1C2YA 4P35A 1MQ8B 1GGMA 1ELOA 5IMBA 2IL1A 2BFCA 5DSTA 1XQWA 2DYKA 5KBYA 3RUEA 1U7UA 3CLVA 4YAFA 4EQ6B 3GBSA 1SY7A 1BGXT 1VJ1A 3CQ9A 5B6PA 3CUEF 1S2IA 4OMFG 1MENA 1Q19A 1WA5A 4C08A 2VWHA 4DLYA 1O6FA 2XYPA 4GD3Q 3AO0B 1BN6A 4G84A 4BQPA 5JRDS 3E27A 1ORHA 3KM0A 3L8FA 2V58A 4GL4A 4W5WA 5ALOA 2B8NA 2V96A 3BA6A 1T26A 1WD7A 4J0QA 4JY7A 1O94D 1WHSB 4OHXA 2E6UX 2VRWA 4PQEA 4AXBA 4EHJA 3BJZA 4MGKR 3QVSA 2KM1A 2OK7A 2VJMA 3D3NA 3PYXA 2WU4A 5HQ3A 2OD9A 3PFIA 2EJWA 4R2IA 2Y6VA 3UMCA 3ADOA 2C5HA 1HFWA 2ZBRA 3FVTA 4UUBA 3RC3A 2YIDA 1Z2EA 1BU8A 4BXOA 4UULA 4XM1A 2ZJ4A 5HKLA 4D9CA 4Y2QA 2O1SA 3X1YA 2CDCA 5FADA 1C14A 4W5OA 3R75A 3H0KA 3ZY5A 4FGUA 3CCFA 4GEKA 3CKMA 1EFKA 3P7MA 4I9HA 1DOAA 2ADMA 2ON6A 1RI3A 3VC3A 4B31A 3DGEC 4E1VA 4BX3A 5C7IO 3K9NA 3C7AA 1RLJA 4C20A 1FQJA 1AVTA 2GEBA 3DQZA 3EBLA 3L49A 4FMDF 4O2AF 4ENQA 5BUSA 3UAWA 1MOPA 1U0BB 5I7OA 3BH0A 3KKMA 5IDQA 1ZQ1A 1NVMB 2XVMA 1ZXLA 1ML3A 2OBBA 4H0CA 3ZE0B 1S96A 2C3OA 2ZJOA 3NBXX 4LCBA 1K0FA 4E2XA 4A15A 2BY4A 4MS4A 2GZ3A 3DVAB 4PQFA 1EIZA 3NHFA 3HLYA 4DBZA 1FW6A 4NXMB 2AYZA 4TN1A 2JI7A 2WIJA 3P52A 4ID3A 3EPLA 1C8LA 3FOEC 2YHIA 3B70A 1MLDA 3PHHA 4R31A 3D2CA 1N6RA 2ZB2A 2FOIA 4P0PB 2NNLD 5K0FA 2EERA 1P7YA 2QX4A 5BNFA 2ZRGA 4HR7A 4Z7QB 2XKJE 3E3LA 3BWBA 3NOVA 4J0EA 2QUZA 2G5GX 4UJ3A 2YJZA 4RVDA 5EJ6A 4U3JA 3OJFA 2ZAYA 2X7HA 4NC9A 4PAOA 2EC5A 3UJDA 5GM1A 3V55A 3LWNA 3VYVA 1KDYA 1GQFA 4ZWNA 5K4AA 1U0NA 5ICSA 4D79A 4BFVA 2FMIA 3H99A 3SD7A 2IIPA 3ILSA 4PF1A 3WK6A 5KYXA 2RMKA 2B34A 2FDRA 2GD6A 2JAWA 2Q5CA 4FTWA 4OQYA 3UFXB 3OSUA 4CM9D 5AVTA 4BNZA 3RUFA 5HTOA 1ZRSA 2J87A 3EOBI 3R3HA 4LECA 3T1HB 2AJDA 2C9BA 2BFCB 1Z29A 2OCLA 2Y1FA 4Q3EA 1HR0B 5CM2Z 3DEAA 1OFVA 5K3DA 2GEUA 5EUBA 4MA0A 2OHFA 4TVKA 3VI3B 1TM7E 5CW1A 3HM2A 2DKNA 1T3SA 2C2ZA 2MOKA 1P9WA 1ECCA 4JK3A 4GQAA 4UFOA 1F8UA 2B35A 1NSFA 1DX4A 1V7CA 4R9SA 2QVLA 3IDFA 1GGFA 3K2BA 4L4SA 4XR4A 3BWDD 1L1QA 1L4YA 2QN8A 3DMNA 3EMDA 4RD1A 5CHYA 1J42A 2C5BA 3IXLA 2O57A 1TA0A 4KXUA 3ZXIA 4DPMA 1R8SA 1RE1A 1N9ZA 4FC6A 4KG7A 4X8MA 4B85A 2VJMB 4ZOLA 3LH5A 2HAEA 4FMCF 2EJUA 2J3IA 3KRTA 2NUBA 4GBED 4UAVA 2RHHA 5HQ3B 5EHZA 3RS8A 3HJHA 3S8EA 2GHRA 3BQ9A 4RL6A 1WUIS 2BEVA 4PFQA 1SKQA 3DXXA 3ZCRA 3WGTA 3Q40A 4UHBA 1U7TA 3SBDA 3AM1A 1JVBA 4I1OA 3JAWA 3X3HA 5TF4A 2D0PB 1MGOA 1DKOA 3WICA 1NQWA 4Q6WA 1IWOA 4DY4A 1U7ZA 1GKUB 2AA3A 1NBMA 2DT8A 2KJQA 2PL1A 3L7AA 3PC7A 2XUHA 1WPQA 3M3PA 4YV0A 1ITZA 1GXSA 2GPTA 4KWHA 2H85A 3TVTA 2H2WA 1NJ2A 4B6RA 1A3CA 1GUAA 2X86A 3C7DB 4IVQA 1BTOA 2E4WA 4G36A 1TZKA 4DEVA 4TWRA 2P7IA 4ZEXA 3GGGA 1M5TA 4D7AA 2XLBA 1B6SA 1CJVC 4QTXA 2M1XA 4UZFA 4M9CA 5IN5A 2BGUA 3PPYA 4HQ6A 4OI1A 4WUVA 3RUPA 4F06A 3KHKA 4BO1A 4HB4A 1AMNA 3B20A 1UM8A 3DBIA 2HLNA 4HMQA 4P5EA 2VOJA 3UV7A 5KTNA 1JDPA 3NIWA 2DF8A 2YHIB 3HHEA 1E58A 1C1HA 4FT2A 4M3NA 4FS8A 2ZUSA 3CSDA 3ZCTA 2X0KA 3G5MA 4KLRA 2VF4X 4M21A 3RC1A 4IIXA 4REMA 3V8PA 3GMSA 2QMEA 4IOJA 4KN8A 2PJRA 1T4MA 3M1IA 4QBHA 2FPKA 3DULA 4GYWA 1CEXA 1G8KA 3KVRA 2Y1XA 4YJ3F 1C3VA 2PLAA 4QLAA 3K3PA 2V1UA 1OWLA 2NOAA 5EWJB 3GLGE 4DCTA 3CZPA 4NH4A 3QU7A 521PA 2B7CA 2W8BA 1DC7A 2IQIA 3OY7A 4PFJA 2H0QA 4NU8X 1FJXA 4GP9A 5TR9A 1CTQA 1SN7A 4M87A 3V8VA 3ND9A 1NVWQ 3C14C 1NZDA 3OHPA 4J8PA 4CYMA 5BYJA 1Z6AA 3AP1A 4TL8A 2PXXA 1Q7EA 1PX2A 1VFPA 1NMEA 3FBTA 1JALA 3O47A 3DM5A 3HZOA 3BWYA 3FSGA 3K35A 3W7AA 2R8RA 5IT4A 2AG5A 3WL5A 1QQBA 2BSAA 2J30A 3RDPA 3BMCA 3SDSA 3B89A 4YR9A 3MAJA 1RLMA 2QMOA 3NBMA 4IRXA 4QUJA 3O9ZA 4F04A 4UTRA 4LZAA 3OE1A 3E6AA 1MW9X 3A26A 3MG9A 4EUSA 3QVTA 5C1DA 2DRIA 2Y4OA 3AR6A 4FIDA 3AB3A 5KOIA 5L40A 1KJJA 1WB6A 4IZ6A 4RF2A 2DETA 3H2IA 1A9XA 4MV3A 2WYHA 4N49A 1PFGA 1RAHA 2GM3A 4ZU6X 2NV2B 2XCQA 4ZOLB 1USWA 3F7TA 4RIFA 3DB1A 3KSAC 1IVSA 4IIBA 2HNAA 5EZYF 4UUAA 4AMUA 4BMCA 4S1TA 2BGWA 4RD6A 2XLCA 3HO8A 1ABFA 2JS7A 3JAWB 2V5AA 1OLOA 4F85A 3QHQA 4NPAA 3A2NA 3EG5A 3K16A 5BN5A 3IIJA 2Z95A 1RT9A 2Z3WA 3ZHOA 1WDTA 2H4FA 2OXEA 4DV5B 2YFHA 1KEWA 1GEEA 2FW1A 2BVNA 4HLQB 1GQ2A 1GXSB 1FP1D 5C1PA 3O2NA 4HDKA 4FGSA 3UENA 1E3DA 1QFYA 3P96A 5HIMA 4BECA 4KPYA 4IL5A 1RAEA 4QM7A 2RGXA 4HP8A 3CXUA 4R68A 2FEOA 4FMBB 4G0QA 4W5QA 3VHXA 4CIBA 2FRDA 4BNHA 3OEHD 3CLHA 1EUCA 1VLMA 3ENWA 1L5SA 5JV5A 1JG6A 1KNXA 1JLRA 2QDKA 3O5AA 2B99A 5FRDA 1KHTA 3HJTA 3MAGA 1ONBA 2FPPA 3J81A 5LB2A 4BLOA 5CIYA 1ZNQO 1TUEA 4HWOA 4N54A 1GADO 3BE4A 5F73A 3OQ1A 3BXFA 4JL8A 4MW9A 4UDOA 3W05A 5KWVA 1SUBA 3D4BA 1M0WA 1U81A 1D5WA 4NE2A 2A5YB 3I42A 1KRXA 2CMFA 2DFTA 2D5CA 4JC0A 4V2IA 4DIBA 2Q3FA 3NO4A 4CM7A 2CVZA 3FDIA 2WT9A 1SCNE 4WL0A 1TQ2A 3AJEA 5LMZA 5JD3A 4DW8A 5ECYA 4YXWD 3OESA 1JHXA 5KYKA 2CVHA 4YRAA 1SU6A 3TMAA 2IYLD 2XHZA 3RFTA 4B34A 4PX9A 1TAGA 5AVWA 4KUEA 2Z3VA 2W8BB 5EOVA 1ILEA 1IAQA 1N9GA 2QUIA 5K01A 1AHNA 1TFRA 2UYGA 3RBXA 1L6RA 2NO1A 5I9SA 4JSYA 4G0MA 1ZA1A 4HAYA 3K0CA 4XLLA 4UU0A 5AKIA 5AKZA 5CDHA 5K0CA 4HNVA 1LTHR 2PQ2A 2QUHA 1B1AA 2XBLA 3NYWA 3NYRA 3JVEA 3QKSB 1CUAA 2QB5A 5AW5A 4EELA 4KXVA 2IEAA 3TKAA 2AZTA 5I5EA 3ESCA 3BMCB 1Y7HA 2YVQA 4NBSA 4TTSA 5KNBD 4UD2A 3CA8A 3I3OA 4FPXA 4Q3DA 1DZIA 4ZAXA 5TGDA 5K0EA 2DTXA 1E3MA 1LJ8A 2ZSFA 3CX7A 5FA8A 4BVAA 2HA2A 1Z5WA 1KR2A 3PHBE 1J9EA 2WJ4A 1OTHA 1PK7A 1A9XB 1RRVA 1SVWA 4I2NA 1JYEA 3IHWA 4R1LA 3U19A 3GLUA 3ZTYA 4HXYA 4RQTA 4BUJA 2QRUA 4YRPA 4MW2A 1FNCA 4BO6A 1I33A 1PL7A 1JA9A 4XEHA 2PV7A 3BFVA 1H1DA 1QIJA 4N41A 3OF5A 3ZHRA 1C1XA 1VE9A 2MSNA 2ZCVA 3VOAA 3ZHCA 1Z6ZA 2ZI7A 4RYLA 4R54A 1IZ7A 3IAUA 4DADA 1BFUA 1FUEA 1EFUA 2ZYVX 2ZIAA 4EYOA 3KD3A 5GADl 4RETA 2V5UA 4JB8A 5JXJA 2WNHA 1WDWB 1YOVA 2JA1A 3OH8A 3PQCA 5BSGA 2QAGA 2OHVA 3V80A 2DHDA 1NTRA 2C2GA 1L7PA 5EMKA 1R6UA 2YQ4A 4E5UA 3GPLA 3FVVA 1US8A 1IUPA 3QXGA 1EM6A 3VHXB 1ZQ9A 4KXNA 3BDAA 4FN5A 4LHWA 5AVXA 1EUCB 4IG4A 1G7CA 3HVHA 4U7TB 4KPEC 3LAWA 3VV2A 1LK5A 2OOKA 1F38A 4COKA 2C5LA 3PQ7A 4BJ6A 4C0LA 5B1EA 1OBFO 2IPXA 2NU7B 2FPPB 3ZDZB 4DKJA 2IYTA 3CINA 2O0MA 3O91A 3D2BA 2QLFA 4RH0A 4LSGA 4EHNA 1FS6A 3G5AA 2ZPAA 4FIZA 5CDTA 2W6OA 1F48A 3T9AA 1JPJA 4L8YA 1TK2A 4YJFB 3H3XA 4JODA 1ZK4A 4R83A 5HM8A 1LXCA 1SKMA 2H2DA 2YN2A 1GNVA 2GCEA 3DE7X 1HFEL 3PC6A 4F2HA 4QOGA 2A4KA 2C82A 1X1DA 3CISA 3Q9NA 5HCIA 4WD3A 1N0UA 3BC1A 4X60A 4ARUA 5HXAA 1NBME 2BE7A 1JQEA 4BNIA 5CEFA 1SULA 2JI9A 3CY6A 3JALB 4TTVA 4D98A 4YIKA 4CKXA 3UATA 3IRUA 3ILXA 1N9GB 2P2NA 5FOTA 2QWXA 2VUTA 1NLFA 3N0RA 5H83A 2CUZA 2X77A 1RRKA 2PUAA 3CG4A 4XQGA 3R7LA 5B7GA 4MUAA 3TXXA 4KK3A 2RHWA 1M1YA 4MWGA 5E0KB 4NICA 4YRIA 1XZQA 2WKPA 3C6QA 5LBTA 4B80A 4YGYA 3L4KA 4E5YA 3AINA 4H2DA 1OZAA 3LQFA 1JZQA 1E1YA 1T8SA 1AG9A 1SBHA 2HCTA 2LW7A 4YRGA 2C88A 4ALKA 1EX7A 4H77A 4QGGA 3RRZA 2VTBA 2DG2A 3KDPA 3DT9A 4FUTA 1CYDA 2XUPA 5EN4A 3U60B 3VYSB 2A0UA 3NC0C 4QGBA 4X6LA 5HPYB 2VA8A 1LNQA 5CA1F 4KR7A 2ZB8A 4BB6A 4G8BA 4K3UA 1XCJA 2ZSAA 3OTHA 4DJJA 2BH2A 2Q5OA 2VHTA 1GILA 2OCIA 2PZ8A 4I14A 1KKMA 1NYQA 4QU8A 4URWR 4I5EA 5AIAA 2G72A 1KJWA 2L42A 3PHCA 5F1KA 3I6MA 4I8XA 3V42A 1ZJ6A 5IZCA 4PIMA 5ARBA 4AKGA 1C30A 1M1NA 5FTKA 4HN4B 3ACCA 2EWVA 2YV1A 3R7DA 2J9FA 2A67A 4M4SA 2QVCA 4NCNA 4RKFA 3A0UA 3OFKA 2R44A 1BRMA 2GJSA 4H3KB 2XWQA 1Z2PX 3GL9A 3Q6IA 1QFMA 2G8NA 3GGOA 3P9YA 3QW2A 4Z86A 3CO5A 3IP8A 3RFFA 5CXQA 2V3CC 1A04A 3CJRA 4P7KA 5FOXA 4BKRA 2KW5A 4CQLA 1FQKA 2ZCUA 4AXXA 2G71A 4QC2A 4B8YA 1YQEA 1YOVB 2WU3A 3LU1A 1SBYA 3W7BA 4CG3A 4H0NA 4MQEB 5B7NA 2SNIE 2QVYX 1UBCA 3PD7A 2AE1A 3DSRA 2IVZA 2VSOA 4X1YA 3S27A 1EB9A 1ZA2A 2IYXA 1MOZA 4RGVA 4FR0A 3UK6A 3U4MA 2E55A 2IXBA 5CP8A 1KIFA 4J2OA 4EKGA 1XZDA 5JEEA 4L27A 4N3CA 3LMKA 4YTEA 2GYUA 2XBUA 5FHQA 4EFDA 1KXJA 1YZ3A 4V02A 1QXSA 1JL3A 3HCEA 3TJRA 2CBZA 2REBA 2ZK7A 2ZBFA 2FW7A 9MHTA 3QLUA 1G98A 4RDCA 4GWKA 2OFWA 4DXHA 3TBKA 3UB3A 2OHIA 2NXCA 4DJAA 1NVEA 3BX1A 4LFAB 2CXRA 1D2AA 1KJQA 2UAGA 4J3JA 1VLVA 2ZXUA 2QQGA 2VUSA 4Q34A 4S2EA 4U63A 4CXMA 3E2MA 4ROTA 4HT3B 1G8GA 1VJTA 4NPCA 2P77A 3FPHA 1FRQA 4TZ6A 3X1KA 3KQSA 1G7TA 3ZIDA 3IVCA 1AU9A 1K88A 1RLIA 4I3FA 3UH1A 5IASA 1YQUA 2H7VA 4B48A 5I47A 1QRTA 1N33B 1DI0A 3CVYA 1C4WA 3UXEA 3DLPX 1NHGA 4I4CA 5FNVF 1EVKA 4JOQA 5K8UA 3L02A 3EBPA 3GT0A 4RTJA 1X8JA 1IJEA 3JQQA 2HIAA 1TCBA 2QTNA 3CR8A 3KLBA 4J2HA 3BWMA 4UCWA 4X7MA 1JWBB 4WINA 2UVPA 5AKEA 5KCMA 1M1YB 3NVMB 5FR2A 3GPCA 2PS3A 4L85A 3F97A 4NBKA 1GN9A 2NIPA 2VUUA 3R5XA 2W6QA 1FY2A 3QLEA 3PFGA 5EUCA 1XJQA 3UUWA 1SUCA 3ZDQA 3NWJA 2QL7A 1AF4A 3LO5A 4ZU3A 3ZI4A 2VTBB 1HNXB 1Q74A 2R79A 4CMCA 5AVQA 1GL9B 5FPTA 4DGSA 1SCQA 2I3BA 4YO7A 5T64A 3HCCA 4ENPA 3TTVA 4K9KA 4DQ0A 2QR5A 2RD2A 2XYQA 5IJ9A 1TC1A 1UBJS 2X2EA 5AJVB 3QMVA 2XCRB 1P29A 1XLWA 4P2BA 4W1SA 5EP2A 1M1NB 2J3JA 2W00A 1IY0A 1P3Y1 1J39A 3EC7A 4YCBA 1W0JA 3IUQA 5BXYA 2J9FB 2ATEA 2FV8A 2ESRA 4X1KA 5H0IA 3ZW8A 3FZGA 3S8YA 3K70C 2BUBA 4YRMA 1MEOA 1N75A 3BB3A 4N3NA 1C3EA 3E2PA 3AX6A 1U3CA 1VMDA 1J07A 4BVBA 1MMFB 4BL5A 1I7NA 1DKMA 2L82A 2CBGA 4G4SP 4BNGA 2OUIA 3HU3A 1NC1A 4J4HA 4UMDA 3TNFA 4WKCA 3VOSA 1IUNA 3P9IA 3WMWA 2OFXA 2RGEA 3A7DA 1SKBA 2A78A 3RTGA 4LBZA 1ZOOA 1DV1A 1GL7A 3QVGA 5L4LA 1Z62A 1XTTA 1W1UA 2A7QA 2MIIA 3LZCA 4X1YB 3OEYA 4P4TA 4MIEA 1IHYA 1NY6A 1YBAA 2RHJA 1DBVO 4MYCA 3TQHA 3B51X 4BMZA 1B0UA 1QRSA 3M2TA 5TARA 4XTRA 3IMFA 1DDIA 1L7XA 1VSTA 1NVGA 4TXLA 5D2CA 1R9GA 4GZMA 4O4JF 4QTYA 4P58A 3PNVA 3EQ2A 2G5TA 2LTAA 3L4EA 1KMIY 1FMLA 3MD9A 1MVOA 1U3WA 3SBOA 4GOLD 1LF0A 1QYRA 1OZHA 3W1VA 4A5SA 1X2EA 4NMWA 3PGA1 3U13A 3I3SR 1OILA 3TK1A 2G36A 1ND6A 3E61A 3IE1A 1XRNA 4MKRA 3BHJA 2ZYIA 4ENSA 2JCXA 4BP3A 2Z6UA 3OA0A 3U3DA 4DARA 3EARA 3NR2A 3QLVA 4MYDA 1B73A 3DTVB 2B1JA 1DE0A 4YP0A 2NTEA 3DDWA 4J90A 3HHPA 4XX0A 1GN8A 2WQZA 1EINA 2XEXA 3E9CA 1ZWKA 2B1QA 3IPYA 1W94A 2XTNA 3AM5A 3LP8A 2QL9A 3JY6A 3RSGA 5IXSA 4P7BA 3LUCA 3I32A 5CVTA 2QVZX 4EPXA 5JSHA 5CW2A 4EY3A 2UVPB 3FWPA 5CCBA 4U4AA 3OZTA 3TEJA 1FTWA 1W30A 3CH7A 4Q16A 5SZJA 3HXOA 2PZKA 4OHYA 2HWWA 3QUCA 3O31A 2AIRA 3NMUF 3CX4A 3KAQA 3GXBA 4TX1A 1G9SA 1YS6A 1I3LA 1P61B 3HJRA 3KDSE 2PD4A 5FUBA 5F5XA 4FKZA 1XZIA 3ASZA 1GZ7A 4PNZA 1T1JA 4TKMA 1BMFD 5KKCA 2YVLA 4Y6OA 5SZKB 1KGDA 1LSOA 1KHHA 3OETA 2QTCA 3GN2A 2VYNA 3ELBA 3IUEA 4ISBA 2RKOA 1D1QA 2IS1A 5ADHA 2REXB 2YOHA 4RMIA 5DI3A 4E4TA 4HZUB 3FYDA 5CT9A 2GO1A 3L04A 3NFRA 4R0NA 5CJJA 1P2GA 4NYMR 3W06A 7GPBA 1NAIA 4TTAA 5FAKA 5TLSA 3BTOA 2F3UA 1SOWA 1NIJA 3AFIA 3VUEA 2C77A 2IYPA 2OZEA 4QVIA 1OZFA 1A7AA 2I4TA 5E95A 1V16B 2FZEA 4IWYA 1LD3A 3A27A 3JQAA 5GAJA 4Z4GA 4NONA 2Z5LA 2QYOA 4X1KB 1O4WA 1XAHA 4FSHA 1M2OA 4URXR 2V7TA 2IUSA 4WLEA 1JP7A 1XX6A 2XXAA 3KAKA 5T3UA 1TIBA 2C7BA 1BH2A 1OI3A 4CEHB 1T0BA 1YZUA 2LCIA 3EYAA 2RHLA 1KFKB 4K26A 2Q46A 1N36B 2AVNA 4U7WA 4AYWA 3RYIA 4D9JA 1N4DA 4R01A 5A3QA 3KUDA 3SHWA 4AN0A 1FMCA 3DKIA 3FCYA 1B2RA 3QVGB 5ALWA 3WZ2A 5JHHB 4ZRDA 1PFWA 4ZFNA 4EZBA 4X7PA 1LCIA 5F2OA 3MLAA 3IFSA 2VS1A 4DIMA 4E46A 2ZSEA 3GEHA 3UY4A 1MX9A 4A8JA 2O3QA 4ASUD 3E3AA 2JLQA 5KPDA 1WXQA 5IKOA 4CIXA 3S0JA 2JW5A 2OO5C 4MW5A 5AUPB 5HIKA 1DMRA 2LIVA 4HNQA 2BTEA 2K5UA 3CH5A 3Q88A 1GNQA 1FP6A 1WPXA 4ZP1A 1M1UA 3FUXA 1HTBA 3DMGA 1FP4A 4MWOA 4BNYA 3NT4A 4FFBB 2GBFA 3P27A 4BQOA 1BC5A 1E1KA 4EAAA 4W7SA 1DPGA 1JMKC 2BMDA 4KFCA 4QOSA 3M3DA 3G0DA 1XEWX 5FTWA 2HBZA 2AN4A 3GFFA 3OCJA 3O8OA 4B3CA 4FX2A 4ZYVA 4Q15A 1O58A 5KSYA 3R9WA 2ZJ7A 1Z7BA 2WHYA 1UC4B 1JE0A 2Y6UA 1WAMA 1FRFS 2BFFA 4DLAA 3OVMA 1YKSA 3IOEA 4AY4A 1SUIA 3LT0A 3BCUA 4Q1EA 3L0SA 1UDAA 4I1SA 1EP9A 2E18A 2F62A 3EH1A 4FYXA 4O33A 3S3TA 1PGJA 4W5RA 3NHMA 1YK0A 3AVOA 4GWGA 3V8NA 2Q2VA 3UJCA 1V11A 3BTVA 1CDOA 1UMDB 5IG2A 1Z35A 4URYR 2QYSA 3WNQA 1RYZA 1G8FA 4G65A 4IDOA 4DHEA 1KJZA 1OZ0A 3H8SA 4MTCA 3QG1A 4ZI7F 5JCZA 1DJPA 2C9OA 2XODA 3DFZA 4Q9NA 3WHLA 4C05A 3K2EA 1RZ3A 2P9YA 3SJAA 2GN2A 1RYHA 3BH7A 5KSWB 5L6MB 4JUCA 1Y8CA 2C97A 3VR4D 4DPKA 5K4HA 2WPDD 2XYRA 3LX5A 1EB8A 4W9MC 2V7EA 1ISGA 3SYMA 1N6OA 4KE8A 2C2BA 4HUTA 2OAEA 3TF5A 1WP9A 2FRVA 1T9ZA 1YVDA 4U1RA 1QV9A 4F3CA 4QYXA 4O4HA 4FC7A 3LXRA 3MELA 2QW1A 1DTWA 1NP6A 1VXOA 3AERA 1WXDA 3HMKA 1HT3A 2Z1NA 1JHVA 3JQCA 3MERA 3PLRA 3Q7TA 4O4LF 1O03A 3ZE7A 5CFPA 3DWGA 4W6ZA 5JZSA 4TSKA 5GM2A 1GZ4A 2OK8A 3AUJB 4Y2XA 3JQAB 5JVDA 3IBYA 4YIHA 3WLNA 3DTTA 3AF3A 5K8TA 4CL8A 2A9RA 1J56A 4M76B 4RY0A 3DMYA 3GCGA 3FMOB 4UNIA 5DLPA 2Z9CA 2MT9A 3HU2A 1OROA 3SN6A 3NKLA 2O19A 5F98A 4RADA 1E9RA 1XPRA 2PKQO 4TMTA 3PR2B 4DWOA 5KMGB 4ESVA 2PQ0A 1DARA 1N2GA 3M34A 3GJZA 4G1BA 2IY8A 4JHLA 4KR0A 1PK9A 2UXBB 4J75A 2H7XA 3TGLA 2NSDA 4D6YA 2A0XA 3QSGA 4PR0A 4PSVA 5DNWA 4OCZA 5LNK6 3U09A 1DUSA 3MJSA 3ZQJA 2ZP1A 2FWNA 4YLEA 2XGGA 1OWOA 1XWIA 1R16A 1RRMA 2OBNA 2PJZA 2ZYGA 3RLIA 2ZW9A 5D51S 5TE9A 4K1LA 1SCJA 4PCAA 4TMXA 2IYUA 2HHCA 3ZE1B 4BIMA 4LSWA 4PTYA 3ZUGA 1ODIA 2R6FA 1EG2A 2M6RA 2M6SA 4JEHA 4N65A 1P1IA 3RV4A 5TIIA 4BE7B 1YE5A 5DISB 4I1PA 2W71A 5HP4A 4IQ4A 4ZYZA 3ZV6A 1FP4B 2C99A 4KHPB 1E5QA 2JF0A 5BT9A 2JH3A 1SKAA 4KGDA 4RYDA 3WYDA 2AZXA 1V8ZA 1GPKA 1SKUA 1ZIPA 2P9EA 4I8IA 4WXYB 4M0MA 2XEDA 3O8OB 4WNIA 3RS9A 4AKSA 4ZK6A 3IQDB 2C4NA 5D5PA 3OE7D 3UW1A 4KI0A 2OD2A 2BFFB 4PBRA 2D4AA 3HR4A 1F1JA 3UK7A 3V8MA 3LECA 3U9LA 3JTEA 2PUDA 4DMKA 4EHFA 3JQDA 5AI5A 1LI7A 2C3PA 1XYYA 3MQ4A 4Q1VA 1LBTA 2I3GA 3M6XA 5C34B 1EGQA 4A3SA 4C4YA 2OKCA 1AS0A 1BHQ1 1M72A 1SIBE 1XRJA 2PKQP 1H6BA 2HYIC 4MCJA 1Y3HA 1ZK2A 5AI4A 2DHCA 3VO9A 1OGJA 3QXSA 4KYIB 1SUPA 2F3RA 4MRRA 4ZQEA 4BZXA 5L7WA 1TU3A 2QW8A 4TVOA 1WU7A 2FUCA 1GPJA 1BJKA 1BKDR 2ZWPA 4H59A 4R1TA 3WWCA 5C8DA 1WHTB 5AKXA 1I0LA 2C7OA 1JVSA 3A3NA 3GUYA 1SBNE 4QSMA 4E21A 4W7HA 4YO8A 4ZQHA 1KJ8A 3I9NA 2HJ9A 3JAKA 3HWSA 1NXOA 5IYZA 1RVDA 4YJ2F 1IRXA 4GGPA 4G0OA 4UBNA 3LY9A 3I58A 4UHDA 1PJ2A 5L3ZA 2GXAA 3D3EA 1DTWB 3OT4A 1OJLA 3Q3JB 2VDKB 1TMKA 1PG5A 1UBLS 3AQIA 4CKCB 4PWYA 1ANKA 3CTPA 2NZWA 1BXZA 3LVBA 3P0RA 1AKMA 4FMCB 5JVDB 2QQ0A 3SBXA 2O6HA 4PNPA 3WV5A 2C04A 3D0RA 3B1XA 2A4MA 4GC9A 4LMAA 1OXXK 1UBKS 2Q21A 1E1RA 4MGIR 1NN3A 2EOAA 3B1KA 1GR1A 2XRMA 1LH0A 3BGIA 3PJRA 1XRRA 3MS2A 2PYIA 4PCVA 4QGHA 5D1HA 3I1YA 1T1EA 3L93A 2ZWOA 2IF0A 3H19A 5DXFA 2FJ0A 1V8BA 4MA5A 4M38A 1QBKC 3DKVA 4O08A 3ZLVA 4B8WA 2PIAA 1CUVA 2QD2A 5GJCA 1Z6XA 2QM7A 5ARCA 4AFNA 1E4VA 1Y82A 3M1AA 2OCDA 3PYMA 1XVTA 4P3YA 4QXRA 5BV1A 1GT91 3KYJB 4RK7A 3WKEA 1JA0A 3KG2A 5IUNC 4Z51A 1GUBA 2CL7X 4CHGA 2CLMB 3AV3A 3K0FA 3TLGB 3WLPA 5KOHA 1QH8B 4WA7A 3BWCA 3WMEA 5C80A 1RDFA 4RF3A 4OFZA 1JNXX 2PGOA 1WSWA 3IBFA 1W1IA 1BROA 4CEIA 4GGMX 3UW3A 1L4HA 1MAHA 2FX2A 2XMSA 2QMYA 3CE6A 1J7KA 3LI2A 5A03A 3WP0A 2ZRFA 4A0QA 5B2EA 2PFSA 2HL6A 3WLRA 1L5MA 1X1CA 2VUIB 1P2SA 1LRLA 2ZJYA 3LRTA 4AP9A 4BFUA 2P68A 2PQ6A 5E2IA 2IE0A 2DBZA 1ICEA 2X0RA 3BIWA 3D0OA 3ENKA 3MCWA 4BVHA 4D8YA 2I2FA 3HZZA 5CEJA 5LLTA 2Q27A 1CEYA 1G6OA 1XTRA 2Y1GA 4N5NA 1PQ4A 1CQPA 3PGMA 2AFRA 1DIAA 4GLJA 2Q62A 1D03A 1Y3CE 2Z09A 4KFRA 3H4MA 3DDCA 3AF2A 3HJUA 1GITA 4R1MA 4TUYA 3Q7EA 5GY7A 4GLOA 1QK5A 5KJCA 1D6NA 2A0YA 1WXEA 2JH9A 3VU9A 1RKQA 2ZI5A 4JV5B 1DGQA 4MQBA 1SOVA 3LDFA 1J23A 2NU9A 4PC3A 4MROA 3SE0A 3QIAA 1PSDA 2JHFA 1Z0ZA 2P2CA 1JJVA 1X3LA 3AC0A 4JBNA 4R8MA 4LXTA 4ZKDA 2WZDA 2C4TA 1CW2B 4M22A 3W7VA 5IYZB 1OXBB 4CLRB 1UDBA 1N77A 4TWJA 2Y05A 1J2EA 2JIPA 1U8EA 1H4QA 1KERA 3EQ7A 3P32A 3RG8A 2OZVA 4GR9A 1POXA 1H6AA 1V5GA 2QTHA 3HDGA 3EZFA 3LF2A 2ZSUA 4IG9A 3F49S 5IJ0A 1I7SB 4KAJA 2XWSA 3MOSA 1P17A 3PUWA 3PLNA 4IIUA 4W9NA 1AJEA 2FSGA 3W2IA 3P9QA 5FPKA 5JNRA 3O8CA 1FZQA 1RYEA 1VBFA 1TLLA 1P5RA 4J6EA 4KZKA 1KQ3A 2UUPA 3PE6A 1ECGA 1U4NA 5IH3A 1TU0A 4ZAWA 4F4CA 3N58A 1P72A 2M1ZA 2WJWA 1DBPA 4MX8A 3ZH9B 4U2BA 1G19A 1S3IA 3EB9A 3HYTA 4F84A 1T24A 5JWRA 5K0TA 4O0MA 1U7OA 1FLNA 4L57A 1DADA 3TDMA 1RXEA 3QFHA 2FPXA 2IEYA 4GZ5A 4KMSA 3FKSA 3DLHA 2IZ5A 1V48A 1ADCA 2ORWA 4CODB 2ZAGA 5DYGA 1NULA 2X23A 1EH5A 1T9AA 4KRXA 5CVEA 3HNRA 1M7BA 5I01A 4AF6A 5KX5B 4JGIA 1QGAA 5EZQA 3C85A 3O8NA 3GLSA 2PT6A 1GSOA 1KVUA 5KOHB 2VVTA 3AFOA 1OLSA 4Z0TA 3I34X 3WL4A 1NXQA 5I7VA 4CEIB 5JTTA 3UPUA 3G7SA 4R2HA 4OBBA 5JAQA 2ZI6A 3C39A 2IYRA 3RVJA 4EBFA 2GBLA 4Q02A 4AJLA 3DP9A 3FB1A 5MDHA 3SC4A 5KNDA 1Z4LA 4KI7A 1ZW1A 2J9XB 5FOSA 4R7TA 4B2IA 1DXYA 2XA1A 1BYUA 1TFUA 2PRZA 1T91A 5AXBA 5JLAA 3AK4A 2WZCA 3ETHA 4CIYA 3W4JA 1XMOB 4RVSA 1Y3AA 3H7IA 1Z3IX 3MUFA 4HLNA 5FWXA 2FQ1A 1C4KA 2HCRA 1S2LA 2OZPA 2Q6TA 2VDMB 5E1MA 5HTKA 4DYHA 1SIWA 2X7XA 1PZXA 3GRYA 1JECA 1IEXA 2JGMA 1VGQA 1EWTA 4NYIR 1E96A 5J2UA 2C4WA 2O2IA 3ESXA 1OTYA 4X1OA 5AOAA 4OJQA 2WT8A 3RBZA 1D0SA 3VU9B 3BM5A 1SOMA 4KJZA 2CZQA 1CQJA 1M5UA 2IYYA 2Q0QA 3QKRA 5HQJA 2FW6A 4MWZA 2NU9B 1XTUA 5JY1A 3V46A 1P6QA 2YC2C 5KU7A 2A1TR 1NLMA 2DQZA 4IWXA 4ZMRA 3MINA 1KAEA 3CLTD 1FJHA 3LBFA 1QORA 4Z4HA 4GKBA 3E7FA 3SC3A 2QUJA 5KQMA 4NMHA 3TECE 3C5WP 1R2QA 4H1UA 2IWRA 1CWUA 4M54A 1E0AA 3C15C 4XQ9A 4FWTA 3RVLA 3EQ8A 1T4CA 3CNLA 4DMUB 4AG6A 3C3YA 2ZFUA 3PFCA 4ZAVA 4CMKA 1F2DA 1UKZA 2BM1A 1O6GA 4Q4CA 2JJ2A 4NX2A 4TS1A 2XT0A 3HP7A 1T8PA 2VPZA 5E6RA 3DHNA 4ZZ0A 1L8LA 1HNZB 2JFHA 1XVAA 4Y9SA 1DS6A 1YDFA 1E0JA 3QUAA 1LDMA 2NVWA 1AV7A 1KC3A 1P5HA 4BVJA 1DO0A 1GPMA 2LE0A 6REQA 2J7PD 5AQ1A 1TX4B 2EW1A 3H18A 1EGMB 5JT1A 2X1MA 4I66A 3GJXC 2HMAA 1QIEA 3DR5A 2N47A 3ZDDA 3ZYCA 3HFSA 4G1CA 3W5JA 3NEPX 4EUNA 1HOTA 3ICVA 1E8MA 1ZAYA 1UJMA 1ZCFA 1F6DA 1CF9A 5REQA 1VM6A 3U3RA 3EF3A 3PWKA 1NVFA 3G1UA 4AJOA 4H1WA 5AM3A 4F4JA 1U0FA 2JGNA 3U9TA 1XZJA 1G5QA 1K86A 1Z73A 4Y7CA 5T4EA 1NV9A 2QRVA 1XEFA 1WW2A 3KE8A 5F52A 3UT6A 2NP7A 3GZNA 4J16A 1AQ6A 1CCWA 4YMGA 2ILVA 3I12A 2QN7A 4NDZA 1GYRA 5GIOE 2BFPA 2E37A 5BV0A 1XZAA 1V1JA 3BDIA 4IZIA 1X70A 1F4LA 2QORA 3E35A 4WZBA 3MIZA 1YJQA 1KETA 1SBTA 5E7IA 2VAXA 3O9MA 2PUTA 3OCZA 4OLHA 3B2NA 3NM5A 1P7VA 5TDHA 3RUAA 4RJTA 3EDQA 1PGPA 1PWZA 5EJ8A 3LHSA 1T9DA 2B82A 4AZSA 2Y1WA 2EAUA 2XAAA 4OA8A 4XKJA 1XB2A 1G7SA 2N42A 2ZATA 4A0SA 5FWXB 4H35A 4AQ7A 3MXOA 1OI4A 3P9RA 5IJWA 3EZGA 2ZIFA 1QHSA 3QYPA 2P6OA 5D7BA 3N39C 5AK6A 2MCFA 4MK4A 3ZU3A 5ICEA 3L9XA 3ZWKA 3N75A 3EVNA 2DWCA 5DLQC 4OIFA 3VR5A 4DMGA 1Q7BA 1YUNA 3NIGB 3O2SB 4JMLA 3CKKA 3U31A 4MB0A 3I1JA 3WYEA 2AOVA 1QGED 2XVXA 3V1UA 3ZLBA 3HJFA 1CQJB 2JD0A 2FPRA 3QKRB 5FBLB 1J70A 2K4MA 1E5XA 3ZPXA 3AR3A 3L79A 1IOZA 2JKVA 4OP1A 3V5NA 1KZ4A 3DBLA 4KCGA 4E6PA 5KOJB 3L77A 2CLDX 2FPLA 4KVAA 4F91B 3MINB 1WNFA 4AT1A 1AKTA 1EZZA 1XDUA 1NJGA 4HUJA 4BFCA 5CA1B 4AS1A 2PS1A 4H3SA 4CQMB 2D7DA 2HMWA 1PZGA 5B3JA 4G5QA 2NMVA 1PQWA 1YA6A 3WNZA 3SBEA 2I6XA 1RHKA 3D1LA 2OCBA 5TJHA 2Q7DA 1YZTA 3ET4A 1C29B 2JAXA 1RFGE 1SHZA 1ZDMA 1KZ1A 1YFKA 2YZNA 3CPHA 1UBMS 4HPWA 5CJ2A 5CTAA 5I45A 2WABA 4POAA 4PZPA 3HA5A 4ZMBA 3MUEA 4NBVA 3AVXA 4C4XA 1H66A 4QEKA 4X54A 5E6RB 1X86B 2Q5IA 2WTEA 2XZDA 3SR4A 4BGEA 4C9BA 4I5GA 4I1IA 4LF4B 4J0KA 1D9XA 2GERA 5DLEA 1ECPA 2GHTA 4PNEA 2I3AA 5A5GA 4ZPJA 6REQB 5B4VA 4PG6A 1N0HA 3QEKA 3PHLA 4PLWA 4Z3DA 3O0DA 1BMQA 1ESCA 1N8NA 3KHUA 1YQGA 1DO2A 4JZKA 2A5FA 5DU2A 2O14A 3SX4A 4IIGA 3WADA 1NMXA 2ZUVA 4RM3A 2QY9A 1YJAA 2ZBQA 1OFUA 1KMHB 2JLBA 5AJTA 5HM6A 3TQSA 3AHFA 1FTGA 2R6JA 4KIGA 3P9ZA 3VI4B 3OP1A 1U8UA 2ZAIA 2MHCA 3Q2OA 5HIIA 2WYIA 4YMSA 4BZWA 1E1MA 2PMCA 3VYUB 2QRVB 2WW8A 4U2DA 3H9CA 2XKAA 1IIRA 1W9HA 4A23A 1Z5NA 3HXTA 3E82A 2VYFA 4BVGA 4YCSA 1F2UA 1P31A 1Q91A 3TOSA 1ISIA 4JEMA 3RTDA 4EI2A 4I4NA 4ZYUA 4DZZA 4QPPA 2CXHA 3L1VA 1S2GA 1PTJA 2HPHA 2JI6A 2XHEA 3PNBA 2QE6A 4K2HA 3FR8A 4BLQA 1QZTA 3BMQB 2JLCA 2QUKA 3D54D 4CKEA 5JSYA 4KSCA 4MUJA 2X4IA 1G5FA 4G41A 1FYEA 1L7BA 3O1HB 4ODIA 5EZSA 3HBLA 2PJDA 4C30A 4YJGA 2Z4RA 3GRRA 4Z9BA 5ADWA 1VKJA 3HUUA 4B8ZA 3IKVA 3KQPA 1QG2A 3OU2A 4AYXA 4LWQA 2EW8A 4OVKA 4BBJA 4ECAA 4EYGA 1LPNA 1NONA 3G0BA 1RXSA 3KIPA 1IN7A 3MGBA 1E7WA 4N3BA 1BE6A 2DBRA 2CDRA 1R5OA 3FFWA 1Z8HA 4OU5A 4CIAA 3HVUA 3P2IA 4U2CA 3NH6A 1YAHA 3VKVA 3CLUD 2ZRBA 1W36D 3BSYA 2Y76A 3HNPA 3Q8LA 4BYMA 1SNYA 3SFVA 4B6PA 4PZDA 1NMYA 4RKYA 3BIOA 5TQJA 4RCZA 4C88A 5J4YA 1QPZA 3B53X 3NHUA 3KJFA 3A6FA 1YIDA 1ZCZA 2RSLA 4Q4LA 2XB2A 3ZI7A 1EJ2A 1O95A 1QG0A 2BFEA 4H08A 4UTPA 4N0DA 1IU9A 1MQSA 2ORVA 1OAOA 3DBLB 3RFUA 1LDEA 2W2VA 3WXMA 2WD7A 3S5UA 1HM5A 5EE1A 1VHWA 2C2KA 3TTTA 2W6CX 3IHTA 3H04A 1PZNA 5A1JA 5EMMA 3TLMA 3FB4A 4BAZA 4ZJYA 5JROA 721PA 2IOHA 1E2DA 1EFDN 4R2LA 5LPNA 3DAFA 3WRYC 3QOYA 2I9KA 1MXHA 2GUWA 3A28A 3I0MA 3JD1A 4JLPA 4NV0A 1YB4A 2H1CA 3E23A 3M6MD 1RMTA 5TMBA 2A35A 4HNRA 2POQX 1AV6A 3RGWS 4N0MA 3P9PA 1KEUA 2HH9A 4ON9A 5B57C 4HDNA 3E9DA 4Q3NA 1ILWA 3CO0S 3R9XB 4WLUA 3A37A 1LNZA 1MW8X 2ODBA 1K3TA 2P9TA 2BBOA 4QFBA 1SG0A 1CU1A 1HLGA 1EFRA 2VK8A 3ODPA 4OU4A 4QL3A 4BNXA 3CW2A 1VJGA 4MW0A 3D8NA 5G0VA 3VZBA 3A58B 5JWOA 4O4IA 3VR3A 4PNHA 3FMVA 4H16A 1QNLA 1O94A 4E5VA 3KWMA 4ZZ2A 3HKBB 5BW5A 5DYIA 3GMDA 3UAVA 2Y68A 4TTJA 4OKSA 4ARZB 4K6OA 2G1JA 1MU0A 2ZU0C 4O4JB 2DKFA 5L8VA 2G9ZA 2BHLA 3S70A 2V6IA 1A76A 2IHZA 4FJ2A 4FZRA 3GJ5A 5FO1A 3AH8A 4I1UA 1F2UB 5FUQA 3KJNA 4REOA 3GRKA 5AVYA 2B0JA 3JRNA 4FZJA 4JR2A 2GK4A 3TSYA 4ZU1X 3M70A 1GZHB 4LDZA 5TPWB 3IL2A 3KPJA 5DX0A 3TCNA 1OLXB 1U7DA 3AR4A 1UCFA 4UEKA 3H9UA 4CKEB 3N2EA 2I4MA 3DE1X 3MJDA 3M3HA 1IWPB 4G1FA 1QIIA 4BMYA 1TM3E 5L3SB 4OHCA 1UODA 4PLZA 4P3OA 4WADA 1L4MA 4YJGB 4RLSA 5F1YA 5J63A 2P6UA 4AMVA 1UR5A 5AFSA 4GDMA 3GLIB 1UP7A 1SCIA 1HQKA 1L5FA 1QGUB 3OUUA 1JR6A 1UPCA 1C1DB 1HE1C 4L9RA 3FTDA 4XAQA 3VAZA 5K99A 2BI8A 4MGHA 4PV7A 4XSHA 4AJNA 4LMBA 1SK9A 2F67A 2P2GA 4LZZA 1WXXA 1KP2A 4GE3A 4ZZ3A 4HLDA 1T3TA 4CBVA 3HJBA 1ZI9A 4ZALA 1OXSC 2RIRA 3I05A 1RYMA 3F90A 2BFEB 2NV6A 4NZPA 4DNXA 4JJ4A 1N92A 5BNIA 2QLJA 1U2DA 1N0WA 3PDIB 4ZT5A 4OYYA 4EP1A 4QUDA 3ESYA 4GIBA 3ZCXA 2DT5A 3EODA 4M0EA 1UBSB 1G8SA 2EFGA 2I7VA 2VYVD 3GROA 1CNEA 1Y6RA 3QUTA 4WVLA 4WZBE 2WA1A 3Q8MA 2WB4A 3I2YX 4JLNA 1V1MA 4AAYA 1T9BA 4WRRA 5I8ZA 2FMHA 2HMSA 4I4TA 3PKZA 5JO0A 2E4AA 4OYLA 3W1WA 5E7MA 3Q0TA 4MPRA 2HHLA 5EE5B 1JXOA 2PD3A 4JVOA 5BURA 4CIWA 5U9CA 1YDHA 3Q10A 3H2SA 4HDNB 2ALJA 3AEUB 4HEA1 3U49A 2F3TA 4IFEA 3L18A 1WO8A 1FVXA 3BMOA 3KOWA 3PNMA 4LXIA 1TT5A 4B76A 4CM1A 3B2EA 4RELA 2Z2ZA 2YMMA 2C3UA 3H5WA 2VXCA 5K7SA 3ENQA 1E8NA 4OI4A 4A36A 4MXDA 5C3UA 1O5IA 2D1RA 2ZJ0A 1XTBA 2E49A 3KB2A 3LZ6A 3M2PA 2GWRA 3N8KA 2QT1A 3ZHZA 2CNNA 3EA5A 4DR6B 1ZPDA 4YV7A 3ADCA 1FF9A 4LRWA 4CMEA 1X9HA 3BBPA 2KLBA 4ZRMA 3ZDRA 3KOMA 3A1CA 2QPOA 2QJFA 4Q4HB 2X6RA 1A50B 4CL3A 5CFRA 2IWHA 4FB4A 3SYTA 4IDAA 5THKA 2RGAA 4E08A 3A2KA 4ZD6A 2WM9B 4FINA 1KIAA 3EDMA 2OPHA 2NACA 5CGQB 3A1DA 1GGKA 2LDBA 1QVRA 3ONFA 4FJ1A 4BLTA 4F11A 1BOFA 1GUDA 3HYLA 1Z5PA 2XB8A 2DLDA 2VP0A 4LZLA 4WAUA 1JHMA 1RC8A 1G8AA 3THWB 1CVRA 1MDFA 1AQUA 2DBVO 3VNUA 1R12A 4QEZA 4DIOA 4QBIA 3QHPA 1JKJB 1QBGA 4JB3A 3T9CA 2YV5A 2CJWB 1RFLA 3UA4A 3L7NA 3ZWWA 3THXA 4JI0B 1A9RA 2PPVA 2R62A 1KPGA 3OLQA 3W3AH 4HKTA 1G41A 1G0OA 4BQSA 3CX3A 1W93A 1ORTA 1GHTA 2D2VA 2F1IA 2P8SA 4GI3A 3REFA 2D54A 4RPKA 5KTOA 3ESAA 1GTL1 2OAP1 3IV9A 3SM9A 1QOZA 2I3ZA 5B5SA 2H4XA 4KGVA 2IYOA 2GNAA 1E4YA 4M1EA 4ZI7B 2ZRHA 4P32A 3ZDXB 1TCAA 1WV0A 2IYZA 4BLUA 3WIOA 2HPVA 2WE7A 5AUOB 1YKGA 1OXMA 1PQPA 3HDQA 2IY9A 2CD9A 2N1BA 3DMTC 2X13A 3C41J 4ITVA 5LKAA 5TJ9A 2PR7A 2XQGA 5HCUA 3QY9A 5KHOC 1EE1A 3O4GA 4MVJD 4O1HA 4IILA 3L0OA 4M1ZA 1JB1A 2FB9A 4W82A 4BTVA 5AJHA 1LPAB 1IXSB 5AKYA 3PXUA 1PR1A 1ZGBA 4N7MA 1V1MB 2CHFA 2O7VA 2VAMA 5FLEX 4MVJM 4ALMA 1XPJA 2WM3A 2P4HX 3D4IA 3B82A 3VO2A 1UIRA 1USIA 4I4TB 2W4MA 3NATA 4ZOCA 5U4XA 2C9ZA 1E7MA 4IDPA 2I33A 2WF6A 3BWXA 4AJ2A 2GJ9A 4HAXA 3ZWBA 2XWPA 2G6TA 3WK4A 2IT1A 2H16A 4ML3A 2GO7A 2DSTA 2JPDA 1PFUA 5EIFA 4Q1CA 2M6KA 1YZGA 1AKEA 1C9MA 1CY6A 1A4UA 1L4KA 1TVCA 4TLCA 3VKHA 1FOEB 4CHTA 3S55A 3UMVA 4X7BA 3X1WA 3LPNA 2K2QB 5CRIA 4G37A 1BCSA 1E5VA 1NQAO 2EF1A 2YTZA 2IKSA 3T54A 1P8AA 1JLKA 3V6LA 3EUWA 4A4DA 1TW2A 4OHWA 3STTA 5IZ4A 1EFPA 5TXGA 2D5LA 4WDQA 4OEHA 2I03A 5KU1A 2ZJ5A 5FLYA 1RHMA 4AO7A 3TSCA 5BN3A 1QX4A 1BFDA 1OD6A 2LRHA 2V0NA 3WQBA 4YLGA 4O0LA 3ESDA 1UJCA 4LNUB 4BX2A 4N7RA 1WJGA 3FNIA 3PB3A 5FFNA 1W85B 2DC1A 1XDSA 2WILA 3N8GA 3R0ZA 4UW9A 5FWAA 1F3OA 3HS3A 4JVSB 2QMHA 1W4ZA 2A14A 2KSQA 2BP7A 4ZDJA 5AUNB 1I7LA 3GLFA 2W6JA 2HMYB 2G8LA 5BSFA 3LX6A 1K8YB 2FW9A 3I83A 2XUOA 1GL6A 4KACA 2Q2OA 2ZIVB 1P80A 3IPRA 3AU8A 2G7MC 4P81A 5AYVA 5BSUA 4B6FA 1X9GA 1N7IA 2E5FA 4C4PA 4FNGA 1C0IA 3E1GA 4ZAFA 2Y92A 2PXCA 1T29A 2GCGA 5IAJA 3ZG6A 4DV3B 3UHAA 5I4KA 2H5JA 1ZXBA 3G13A 5DP2A 4WK2B 3OEHA 4Q7JB 3I5AA 4IMIB 4QUBA 4C2AA 4RZHA 2HA7A 4HEA6 2B1GA 3W5UA 4ES6A 1O3YA 1Q44A 2DQSA 3IDSA 4FFSA 4GGOA 4H7DA 5FI5A 3TQTA 5ADVA 1JLSA 1QCCA 2KB0A 2SBTA 2IU6A 3IULA 4OAPA 2FMFA 3KVYA 2ZI9A 3L8EA 3RKUA 1Z38A 3CPEA 3RK1A 5JU6A 4BVKA 4DF3A 1SPXA 1KA9H 2BKVA 3O1LA 1NV8A 3DA8A 3WZLA 4HNAA 1JYSA 1PUIA 2BM9A 5DM4A 4ZEOA 4XDHA 1YJ5A 3R7SA 4E2WA 2RH4A 4JT9A 4OGLA 4OUKX 2VDQB 4RAOA 4B82A 1IXYA 3NBQA 3LE8A 4JBIA 1FU7A 1C3XA 3U39A 3EC2A 4MWBA 4P34A 1Z2OX 1ZESA 4YXWA 3SJ7A 3E03A 4COOA 3IEKA 4EMUA 2VL7A 2Q99A 4YJ2B 1WU8A 2WNIA 4IX1A 3Q7SA 4TLMB 2IGBA 2OYSA 2RONA 4Y6GB 4XOUA 3LC1O 3AV0B 1WMDA 2H54A 3CWQA 3G89A 3I8XA 3OOHA 1V7ZA 1Y1SA 3LKVA 5CLHA 1RAFA 3CEMA 2YW2A 3C3MA 2WMDA 3FIUA 4G0ZA 2VJPA 2AC2A 1QRAA 2BHSA 3AR7A 4I9NA 4FFDA 1GTZA 3AHHA 1ECLA 3D7SA 3G2PA 5T8KA 4BMOB 1KH2A 4CQJA 1IHOA 4E15A 2A9KA 2IIBA 1FW8A 3G0IA 4IMPA 4UVGA 4ZHQB 3R40A 4KWIA 3BERA 5JJ5A 2TRSB 4CLDA 2UZIR 1KRWA 3HR8A 2JAPA 1N7HA 1NR7A 3AI1A 1BCSB 4X1IA 5JE8A 3EMKA 3BXGA 1Q7TA 2Q6LA 4NCXA 4NZYA 4EO4A 1BEZA 4IF6A 3EC1A 4NK4A 1PEKE 1NX9A 5SY4A 1L8AA 4DCGA 2HV8A 1EFPB 1H0RA 1SQ5A 1VYHA 3ICOA 4FSDA 4BATA 5AW7A 2OMEA 1ZIOA 1JQAA 3QE2A 3F4KA 3VR6D 5B3AA 3LUAA 2YY5A 1SXJD 5BN3B 4PYJA 2P1ZA 1TB4A 4C7MA 4D41A 3CEAA 1UXIA 3LC7O 4RSHA 1M8GA 3K1JA 4UXIA 1D7AA 2OESA 4GXTA 1ISJA 2YWJA 1Z0IA 1CS0B 2BP7B 2I6TA 4DYVA 4KXMA 1M33A 1YDGA 3R0QA 1YL7A 3A05A 4OXRA 5B2ZA 4AG3A 3T5MA 4I3GA 4DILA 4KYTA 2YQZA 1Z4PX 1ZEMA 4GI5A 3TE6A 3KHSA 1JAZA 4NE9A 5KTRA 3BF7A 3HWWA 1JQ5A 3PUJA 2I1VB 4YMHA 1DKUA 1QO0A 1VP9A 4WFQA 5E3IA 1T2FA 4FVTA 3C16C 4AK9A 3VU1A 1YJBA 4JYMA 3S5JA 2AN3A 3PR1A 1Z2DA 1VFNA 2WIAA 3OCWA 3UQZA 2Y8EA 1KH3A 3F5DA 3WMFA 4DN6A 2O2DA 1PNQA 1I4OA 2VQDA 2V4ZA 1XMIA 3GYBA 2WPNA 2PPLA 2GZDA 3N9IA 2IE8A 4JT2A 4IZHA 4RKWA 3R8CA 4EI8A 5FFMA 1S5PA 4C76A 1Y48E 4B4UA 2IYQA 3ER6A 3RKSA 2OLKA 3MMZA 3K71B 1HRDA 2PSEA 3OLXA 1WDLA 2W70A 5HK8A 3EXHA 3LDGA 3FTEA 4RMNA 5JCJA 3VSEA 2J45A 4BO2A 1LW6E 4HNAB 3SGLA 3OKAA 4KWCA 3V3KA 1PT9A 2D2XA 3CZ9A 3ED5A 2WJZB 4M8KA 4ZDIA 4OHUA 4H7KA 1BXGA 3WSWA 4FUQA 2XNHA 2WNSA 3H1FA 3BVPA 4TPKA 3LXXA 1YCFA 5CVUA 1MJGM 3JXEA 3IUMA 4J2TA 2VSXA 3NBYC 3AHIA 5SICE 1M2FA 2QYHA 3MHPA 3TIGA 5KTYA 2B92A 2FX5A 1V3TA 2A9JA 2CK3D 4PLCA 4N9QA 1Z37A 4E7OA 2HRDA 5CD1A 1NASA 5HIAA 1CP3A 3LP6A 1ISPA 1WZCA 1TRKA 2GKSA 2H9YA 3EAFA 3ZKWA 1VP3A 2B5WA 1BGVA 1J1IA 4IZOA 3HKCB 1XRMA 1MBZA 1VOTA 4MRPA 2NZUG 1XVLA 4XRGA 3TRKA 3V1YA 2YNMA 1P60A 5EG5A 4EGQA 1H1TA 3PPIA 3C3BA 4IIEA 5TQ2A 3W9UA 2FZVA 4C2BA 2CJXA 4LSMA 5K3SA 3BTSA 4UAUA 4EVQA 2OY0A 2FSVA 4K2AA 4PYQA 1ZINA 3KJXA 2YWCA 4PYOA 1KI1A 4M1QA 3OOJA 3OJEA 5I6DA 5FLXA 4XPIA 1EBUA 5GZ3A 2YYZA 2PT7A 4REQA 5FCDA 1T5TA 5HFAA 4B83A 1Y9AA 5LLSA 4BY9E 2IBMA 5DW0A 4MIKA 1QM5A 1X74A 1MG0A 1V0JA 1A5ZA 2VWPA 3E9ZA 3VTFA 3V4RA 4MPTA 5HF8A 5DYNA 1GFSA 4V0LA 2OYCA 1U1CA 3OIWA 3N1UA