3T4UA

L29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWILDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L29I Mutation in an Aryl Esterase from Pseudomonas fluorescens Leads to Unique Peptide Flip and Increased Activity
rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase, hydrloase
molecule keywords Arylesterase
total genus 103
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t4uA00
5C8ZA 4XVCA 5LLSA 1CUWA 1YCDA 4RPCA 5JD6A 4I4CA 1TRHA 3I6YA 4EBBA 3STUA 3I1YA 4HS9A 3SWWA 3H1BA 4FOLA 4Y2XA 1BS9A 5HK8A 2ZJFA 1K8QA 3WZMA 1NX9A 4Q1VA 3HRHA 4BCBA 1JJFA 3FCYA 3WL7A 4G5XA 5ALJA 4UFPA 3STTA 4H7FA 3WK4A 5ALGA 1LPNA 1UKBA 4H7JA 1XZCA 1A88A 2OCGA 2FJ0A 3G0GA 3ZWQA 2WJ3A 1ZI8A 3DKKA 1PFQA 1QONA 3WIBA 1XRMA 3G9XA 2WKWA 2RHWA 4J3JA 2VT7A 2J3QA 2WG2A 1QO9A 4ROTA 5AIBA 4EY8A 5K3EA 4J0DA 1UOOA 3RK4A 2O2IA 1D07A 3GFFA 2BGRA 3DYVA 4QLOA 1EA5A 1VE7A 1QIKA 3VJKA 1JT2A 3EQ9A 4CCYA 4AZ0A 4OB8A 3BE8A 1HLGA 4DMKA 3D0KA 4Y2JA 3C6XA 1LPAB 5AOBA 1Q0ZA 2WFLB 4EZIA 5K3CA 4K6GA 1ODTC 4U2CA 4JEIA 4QA9A 2PSHA 4B85A 3ZPXA 1GPLA 4JH0A 1BCSA 4BVLA 3DS8A 5JD4A 2E3JA 3KDAA 2VSQA 1BCRA 4XJVA 1W75A 3D5EA 5AI0A 5JATA 1XQWA 4UPDA 3YASA 1UZAA 1UKCA 1E3QA 4F0JA 4KR0A 3OOSA 4FKBA 1U4NA 4JYMA 3L1HA 3HC7A 3FLBA 4G4IA 5ALVA 2HHAA 3TEJA 4UBLA 3F8SA 4UHHA 3M83A 4FFWA 2GZRA 2FX5A 4W63A 2I3ZA 3C45A 4FLEA 2YXPX 1QIHA 4QEKA 4WCVA 1ZD5A 3PFBA 4Z49A 2XQIA 3WZLA 1Y7IA 1B41A 3DOIA 1CFJA 1E5TA 3WK9A 3S8YA 4C6HA 2XI4A 1VXOA 1GXSA 4W1RA 5AKEA 4H0CA 4A5SA 1Z68A 2X76A 3C6BA 3B12A 3HJUA 4FTWA 4KAFA 2HRQA 2QTBA 1YAHA 2XB6A 4Y2YA 4CIAA 3E3AA 2EDAA 1YR2A 3IB3A 4MQMA 1F0PA 3ZV7A 1QIGA 4CG1A 2ZYRA 1AQLA 1GT6A 4BRSA 1YS1X 4Q05A 7YASA 1IMJA 3QMWA 1MT3A 1P0MA 2O2GA 5I8PA 4BDSA 5ALNA 2HA0A 5A2GA 2HA7A 3V1KA 2QT9A 4BBZA 1F8UA 3GROA 3QMVA 5E2IA 2WG0A 3ESCA 2H7CA 5CMLA 1CEXA 2PBLA 2WSLA 4UHDA 1TIBA 3A6ZA 3WMRA 2B9VA 3H0CA 2YYSA 1C7JA 4DSZA 1EK2A 1EDEA 1A8UA 1WM1A 2X5XA 3FYUC 5FV4A 1JFRA 4GBGA 1G5FA 2AJ8A 4QDTA 2GBGA 5EIEA 5AKIA 1KEZA 5JAHA 2JEZA 3CCCA 3O4JA 5JZ9A 2JGIA 1CR6A 2QXTA 1UOPA 1H23A 2XMDA 1MAHA 5K3FA 3P2MA 5CT5A 1ZI9A 3QPAA 4AX4A 2WUEA 5AIAA 4C01A 5ISMA 3ED1A 2WFLA 1ZIXA 1SC9A 4PQEA 4H7HA 4L72A 4B9AA 4RE6A 1BN6A 3F96A 5CT8A 4DIUA 5AOCA 4H7DA 5FLKA 5IVIA 4WFIA 4IH9A 1R1DA 1USWA 1P0PA 1FFAA 1EINA 4EHBA 1UK8A 5A71A 1QGED 4S0XA 4Y2RA 4HRYA 4LXGA 3H2JA 4GDMA 3EF3A 5AKXA 2H1IA 1WCYA 2JGKA 2XUHA 2XUIA 1N5RA 2EDCA 5LZ5A 3A2NA 4FBLA 2PM8A 5FPQA 5LP1A 5AM5A 2ROQA 2ZJ7A 4KRYA 2FJPA 1OXMA 1G4HA 2CKMA 2QRUA 4OSEA 2H7XA 1GGVA 1QE3A 3B3QA 3OM8A 2OCKA 1PJAA 5FRDA 3F67A 3BDVA 1AC5A 3KD2A 2ZYSA 4GLBA 3NWOA 3Q8WA 1DQZA 4W1SA 2R8BA 4LXHA 2HA5A 3IDAA 5ALXA 4B0OA 1XZIA 5BOVA 3E1GA 3WL8A 4XIIA 4BP8A 3C87A 3BDIA 4G8DA 5HF9A 4ZREA 4MYSA 1N5MA 2ZSIA 2HDWA 4AB1A 3M82A 5SYMA 4MYDA 2C7BA 5IVKA 4X90A 3Q0TA 3WIOA 3KSRA 5DTJA 4C4YA 1CUCA 4C89A 3JW8A 4CG3A 2BJHA 4BCDA 2HRRA 3OG9A 3WWCA 1VJ5A 3ICVA 2JGMA 4LXIA 3DOHA 2D5LA 4Y2UA 5EIHA 1ZD4A 4BVJA 5HKBA 1VZ3A 3IUQA 2QVBA 5DNWA 1G42A 1XZEA 1P0IA 4AO6A 1R88A 1QLWA 2WU4A 3KOOA 1U8EA 5K3FB 5DYYA 1MJ5A 3AUKA 3OURA 4IH1A 4X3CA 1LNSA 4PV7A 4PF1A 2WLSA 4I3FA 3I2GA 3I2FA 1CQWA 4HVTA 2AJDA 5JADA 2OCLA 4Q34A 4KACA 5HZGA 3VXKA 4B82A 4Y2SA 1CUSA 4I19A 4DNOA 3STWA 1WB5A 4N8EA 4FFVA 1QFSA 4WFJA 1CLEA 2B20A 4MWTA 4MJ3A 2QOEA 5CH5A 4B84A 1XQYA 2GYWA 1J07A 4KYVA 3IUNA 1ZGCA 2HFJA 2XUOA 1J1IA 2HADA 4BDTA 1BU8A 3C8DA 4DMHA 2PKYX 1R3DA 2D0DA 4HXGA 2ZYIA 3D2AA 5T4FA 1M33A 3V1NA 3BF8A 2FUKA 2XUAA 1CUBA 1LZKA 3R0VA 4B80A 5DNVA 2XUGA 1QIIA 2PU5A 3I2HA 3OTQA 4X95A 4J0CA 4HAIA 1CUZA 1TCBA 4FNMA 1ZIYA 5CXUA 4KE8A 3G0IA 4L3WA 1YASA 3DKRA 2HIHA 5ALQA 5AKYA 4AMZA 1FFCA 5JZBA 1YA8A 4FNGA 1LZLA 3M3DA 4DNFA 5EGNA 3TRDA 3DLTA 4PSUA 3VJMA 3O0DA 4GXNA 5ALYA 3DL7A 3F9CA 5EFZA 1GKLA 1CUHA 1CUUA 5JYCA 2DHDA 5AP9A 4KJXA 4GECA 2DCMA 2ZSHA 3ZLTA 3DL4A 2RHTA 3STYA 4EA6A 5D6OA 1CUVA 3TGLA 3AILA 5IVDA 1ORWA 3HZOA 3FAKA 5ALKA 3HEAA 4WDRA 5KREA 1BN7A 3IA2A 4CFSA 3HYSA 2Y1KA 5J3JA 1MU0A 3CXUA 2VJDA 5AM1A 1L7QA 4X7BA 5BV7A 4F60A 4J0KA 5HF8A 1JU4A 2O2HA 2WUFA 3FWHA 4OB7A 3D59A 5JAPA 3GBSA 1YB7A 2R11A 1J2EA 2QM0A 5DWDA 1H2XA 4EUSA 2C0QA 3IBTA 3WKCA 1LBSA 1EHYA 1FJ2A 4ZI5A 1BE0A 2CJPA 2XUDA 2XMBA 1JJBA 3I6ZA 1U2EA 3NOXA 5AK5A 1AKNA 4NS4A 4CI9A 4TVKA 1BEZA 5AM2A 4QE3A 1CUFA 1IUNA 1UK9A 1FSSA 2Y6VA 4O08A 3EBLA 5EHNA 2XMRA 1SCIA 5ALZA 4BC0A 1DWQA 2VQ6A 2QJWA 4X00A 1X2BA 1BROA 1WB6A 2QJRA 2CZQA 3I2IA 3T4UA 3H18A 1XRQA 2UZ0A 4E14A 1XROA 1CPYA 4RE5A 2OGSA 2ZYHA 3DCNA 2XE4A 1QIDA 5CRIA 3PI6A 1XZGA 2PL5A 1FFDA 1UWCA 4EB0A 1B6GA 2WIFA 3IUJA 3WA6A 1EX9A 1QOZA 3R3UA 5HF5A 1XFDA 1NU6A 4OYYA 5A6VA 3EQ8A 4OU4A 2WFZA 1R9NA 5ALWA 3R3XA 2DHCA 4FLFA 2WTNA 1VA4A 1SCKA 4GEGA 3UMJA 2WQZA 3LLCA 1QJ4A 4RGYA 5AJHA 4B9EA 5AO9A 3SC2A 5AI5A 3AZPA 4QDZA 4HZGA 4X85A 5LZ9A 1L7RA 3IUMA 4PSDA 3STXA 3FNBA 5AK4A 3IURA 3LIPA 4H35A 1UK6A 2ZJ6A 2AXEA 2OQVA 5BWCA 3K2IA 4G4GA 3L1IA 2PSDA 5ALIA 4QDOA 4UHFA 5K3AA 1PV1A 4N5IX 3VKFA 2Z3WA 1C4XA 2Z8XA 3DDUA 4YPVA 4PW0A 1IUOA 5ALUA 4BP9A 4WY5A 3WWDA 1YAJA 3W2TA 5HFNA 1QTRA 5CT4A 2QUAA 4DSAA 2V96A 2H9YA 2DR0A 3FBWA 1MX5A 1SOMA 1ZGBA 2PPLA 2DQZA 1ZICA 3PUIA 3FSGA 3JWEA 4OCZA 1XQVA 1FFEA 5AK3A 5ALRA 4YASA 1ZJ4A 1YS2X 2JBWA 1UT6A 1JKMA 4HTAA 3FLAA 1MO2A 4D9JA 4CCWA 4FBMA 3X3HA 5ALDA 3BXPA 3WWOA 4B83A 4B6GA 5FKJA 2IIVA 1VA5A 3IIIA 1W52X 2I3DA 1E89A 5HF6A 2WU3A 2DQYA 1TQHA 2XMQA 3HI4A 4OPMA 1ZJ5A 1E8MA 1JMKC 4U2FA 4KRXA 1HBJA 1XRNA 1NU8A 3CN7A 3DQZA 3RARA 3BF7A 4F21A 4BC1A 2QKYA 2Y2UA 5CBKA 1XZAA 1ZOIA 5T4HA 4CG2A 5AOAA 1WOMA 5BWBA 1XZBA 1LGYA 4EY5A 3PE6A 1XKTA 5T4BA 3C6YA 3R41A 1JI3A 1GPNA 2HU5A 2HM7A 2OXEA 4WFKA 2XMZA 3F97A 2OGZA 2C5FA 2HA6A 4C4XA 2BGNA 3E4DA 1RYYA 3AZOA 2Y2VA 4JUIA 4BVKA 1K4YA 4L0CA 5IKXA 3I2JA 5AKLA 3E0XA 2BUCA 3QITA 2CUTA 2V98A 4C4ZA 1MNQA 5D3ZA 2GBCA 4WJLA 3DD5A 4MQLA 2W22A 1UXOA 4J03A 3W05A 5AI9A 4ZXFA 4G8BA 1W1IA 1MPXA 1MX9A 4Q3OA 5KWJA 5AI6A 2IX9A 1EDBA 1F6WA 2VT6A 4W9RA 1AURA 4BZZA 1QIFA 5JARA 1EB9A 5HKAA 2XUPA 4ETWA 4ITVA 4WDQA 1E8NA 5ALFA 1BRTA 5EHQA 1EVQA 4X6YA 4BB0A 4H7IA 3I28A 2VF2A 4Y2PA 4K6HA 4RNCA 5HCUA 3WKAA 1GKKA 2ACEA 2HU7A 5JD5A 1TKRA 5CH3A 1VZ2A 2P8SA 4XX1A 2PUJA 1CIJA 5AKJA 3ESDA 4LKOA 5D7BA 2HU8A 1QFMA 1DQYA 4AMYA 4Y2TA 1XZFA 3ESAA 4Y7DA 3F98A 5CT9A 1YSCA 3W04A 3PF9A 1XZDA 2G63A 1R4ZA 2OG1A 2XQKA 1LPPA 1XZKA 2DSNA 3DEAA 3HSSA 4AN0A 3GZJA 1XZJA 4BAUA 3G8YA 4P9NA 5LZ8A 1N8SA 4Y2VA 2K2QB 3U0VA 4LYEA 3C8HA 4X97A 1T4MA 5LIPA 3V1LA 1DWPA 4BTVA 3D4LA 1CUEA 4MEAA 1XZHA 3AZQA 2PSFA 2QUBA 4G8CA 1AZWA 1GQRA 4LIPD 3QZUA 2VEOA 1E66A 1OCEA 3G9TA 1YB6A 3O9VA 1MTZA 5ALEA 1LPOA 4UUQA 2XUFA 1Y7HA 1EH5A 1CRLA 1JMYA 3IVMA 3D2CA 2PUHA 4BTLA 2ACKA 1DWOA 3BWXA 3W9BA 4QDUA 5AKKA 2J4FA 2XT0A 1Q0RA 3WKEA 4KE6A 1HPLA 2O7VA 2Y6UA 2OGTA 1CUDA 2G4LA 5EIAA 2VTVA 3H2GA 4HXEB 1XZLA 1HL7A 5A7HA 3ICWA 5I9IA 4PSCA 4IH4A 1VLQA 2AJLI 3OPMA 3U1TA 1LBTA 2GYUA 5FP0A 2RONA 4DMCA 4J0HA 2HL6A 1BEEA 2ES4A 5HK9A 1KU6A 5LZ7A 3WK5A 1YA4A 4X91A 5E4YA 1TAHA 2DHEA 4INZA 1UFOA 5SYNA 1XRRA 2WILA 5A7FA 5EHZA 5AKGA 2Q0XA 3H2IA 4H7KA 3AIKA 3C43A 4UBKA 1IVYA 3KWJA 3QPCA 4X92A 4IO0A 2ECFA 4CCYB 3QBJA 5ALSA 3DYIA 5A7GA 1Q83A 3STVA 3C5WP 1QTIA 2WJ4A 1JU3A 3QYJA 3EQ7A 3BL8A 3MUOA 2WIDA 4UHBA 5DYTA 3W06A 4G1FA 3S2ZA 2Z5GA 4ARBA 5C8VA 5LZ2A 3KWFA 2PSEA 1MNAA 3R3ZA 5LKRA 3M81A 1ZD2P 3LS2A 4UBJA 4OYLA 4P93A 3G0BA 3ESBA 5K3BA 4QLAA 1SFRA 1A7UA 3PDCA 3BJRA 1TCCA 1LPSA 4QDXA 5ALLA 1N1MA 1R9MA 3QVMA 3H2KA 2XMGA 3R3VA 5FOQA 2BAGA 4U2BA 3HLKA 5HFAA 1I6WA 2QXUA 3SX4A 3ILSA 4K2AA 5ESRA 4EY7A 2WM2A 5YASA 1EXWA 2OPHA 5E4TA 3LIIA 4N5HX 5LKAA 4H18A 3OC0A 1A8QA 3NGMA 2YH2A 1XZMA 3FOBA 3B5EA 1QO7A 3K9BA 4UBMA 1H2ZA 3A2LA 1CUAA 4M0EA 2XMSA 4DTCA 4N8SA 1U65A 3HACA 2BCEA 4Q3LA 2EEPA 3V9AA 4U2GA 4BE4A 2V9ZA 4TPKA 2J3DA 4GI1A 3D7RA 1K63A 4PO3X 2OLEA 2Z3ZA 1QIMA 1H22A 2BKLA 5LYYA 2VJCA 1ODCA 4Q3KA 1RWQA 5JAOA 4N8DA 5HQ3A 5JIBA 1A8SA 3N2ZB 3AIOA 5ALPA 3VISA 4BZWA 3C5VA 1H2WA 5ALOA 1X70A 2WIGA 4G4JA 2WG1A 4X94A 1XRLA 2PX6A 1L7AA 3RM3A 4E15A 2HFKA 4DNPA 5CT6A 1W76A 4H7EA 2XQJA 3W9UA 4BCCA 2CBGA 2XLCA 5EI5A 3GELA 2WHPA 2PVSA 3G0DA 3FLEA 2VATA 3DJYA 1K6EA 1THGA 1E8DA 3G9ZA 3FSGD 1W4LA 5DTIA 1ZD3A 2BFNA 1UOQA 1WHTA 2OCIA 1EDDA 4X71A 3HXKA 3CCBA 2ONCA 3FVRA 1MN6A 2HA4A 2YASA 4UBNA 4QWMA 3PF8A 1AMNA 1XQXA 3VVLA 4QWWA 3GUUA 1J06A 4BRZA 5HQ3B 4KE7A 4NVRA 2GZSA 1WPXA 1HKHA 2H7YA 3PUHA 5I7UA 1GZ7A 2XQFA 3MUNA 4OB6A 4JNCA 3MGAA 3BIXA 1R50A 3CN9A 2HA2A 1AGYA 3LP5A 3QMMA 4NMWA 1ISPA 2WHPB 3R40A 4BYMA 5FDFA 3WJ2A 3BJMA 4AQDA 1CUIA 4LYDA 1HDEA 2W6CX 3H19A 3KXPA 2JF0A 1VOTA 5LZ4A 3D2BA 4Y2QA 1CQZA 3A2MA 3JYHA 3H04A 4ZV9A 3DNMA 4BATA 2VAVA 5E4JA 3GA7A 5DYWA 5AM3A 1OILA 2JGLA 2WFMA 2V97A 3RKSA 4C88A 2QR5A 1AUOA 4YK7A 4UFNA 1S8OA 3I6MA 3VVMA 1C7IA 2ZVDA 3FYUA 3FVTA 2XQGA 1WHSA 5KBYA 2GYVA 3AJAA 3EIOA 2QS9A 2XUJA 1RP1A 5H3HA 3K6KA 5FUMA 2WHQA 4EY6A 4X6UA 3WWEA 2C4HA 4GHWA 1IUPA 2WUGA 4F5ZA 3WKBA 1CVLA 2AJBA 4C87A 4J0JA 2OAEA 2VJBA 1P0QA 1LPMA 4QZVA 2JGFA 1CUJA 5D3KA 4GW3A 3O95A 4DMFA 4W1QA 1JJIA 4XWGA 4OU5A 5AKZA 5AI8A 4ZGBA 3HABA 5AH0A 4W1PA 3QM1A 4FLMA 3AINA 4ZV7A 4DYHA 1CUGA 3A70A 3WKDA 3FCXA 4BAGA 2CMFA 2VA9A 1GPKA 4FDMA 2WHRA 2C0PA 2CEKA 2RIPA 1MAAA 5CTAA 4X93A 3H2HA 2XDWA 4P08A 4B7ZA 3AFIA 3H1AA 4L9AA 4KE9A 4MXDA 3SK0A 1ODSA 3G9UA 4IHAA 3R3WA 4NZZA 4A23A 5C81A 3QPDA 5CW2A 3G02A 1XKLA 4M0MA 2JGEA 3FYTA 5K3DA 3D3NA 1ACJA 1EB8A 1DINA 1EVEA 3O4HA 5CH8A 2WIJA 1FFBA 1LLFA 4LHEA 1KU0A 1WB4A 1Q84A 5K5EA 3WWPA 1WPRA 4ARAA 3R3YA 5JAUA 4MEBA 5CURA 2XUKA 4FMPA 5AKHA 1CUYA 5AK6A 5JANA 5KWIA 1VE6A 4KEAA 4G9EA 1T2NA 2WTMA 2VAXA 3VJLA 4ZRDA 1Y37A 4H77A 4BE9A 5DJ5A 1THTA 2IITA 3QH4A 4ZWNA 3V1MA 2WUDA 1XLWA 5C7YA 1AX9A 2WJ6A 3H17A 1UKAA 1IZ8A 5AM0A 5F4ZA 4CIBA 1O6FA 3RLIA 4A16A 2PSJA 2JIDA 4JYPA 3WL6A 5ALTA 4AXBA 4P92A 3ANSA 5ALHA 2HA3A 1CUXA 3L1JA 4FWBA 4M0FA 4J0IA 3T52A 4YX9A 3MVEA 4KAAA 1XRPA 1MX1A 1DT3A 3WYNA 4QNNA 1SCQA 3FYUB 2XMCA 2NW6A 3N0TA 2I03A 2O7RA 3G7NA 1DU4A 2JGJA 3WYDA 4DNQA 4UHEA 1QZ3A 1K5PA 3ANTA 3C70A 2WIKA 4UBOA 3VDXA 1DT5A 4B81A 3ZI7A 4GWLA 4DGQA 4AZ3A 4J0GA 3V48A 1HQDA 2CB9A 1DX6A 4DLNA 1ETHA 1VKHA 4Q82A 4U2EA 1XLUA 1O6GA 5JZSA 3O4IA 4UFOA 1IZ7A 5JALA 1XLVA 3WQHA 1DX4A 1QIEA 4KAJA 1ZI6A 4AO7A 4BAZA 2C58A 4OUKX 1X2EA 3IULA 2OAGA 1ACLA 2VJAA 3UUEA 5JASA 5A62A 1W6RA 4IQ4A 1G66A 2BUBA 5T4EA 4G9GA 2OQIA 1F0NA 3WK8A 1DTEA 3G0CA 2QMQA 5IH7A 4E46A 5AHXA 4Y9SA 2RI6A 3UUFA 3I2KA 2XUQA 3PICA 5EHXA 5AICA 1EK1A 2J4CA 3WK7A 3ZLUA 2G5PA 4FHZA 4HRXA 2DFPA 5FPPA 1GQSA 3WK6A 2GBIA 2XLBA 5DNUA 3ZLVA 2C5GA 2X8BA 3NUZA 3PFCA 3WL5A 3BIWA 4AN1A 4E11A 5C8XA 2JEYA 5IVHA 4X6XA 2LIPA 5CXXA 2QZPA 3O4GA 5ALMA 1ORVA 3LCRA 5AM4A 4J7AA 3WJ1A 4TGLA 4V2IA 4EY4A 2GBFA 5AI4A 2RAUA 1VXRA 2B4KA 3WI7A 3WLAA 1TCAA 5FXMA 2G5TA 1EI9A 3O9MA 2I78A 3TJMA 3AIMA 4DM7A 2RGUA 1QIJA 4PNZA 5DLPA 4K6KA 2PU7A 1H2YA 1UK7A 4UHCA 2B61A 4HXFB 4OD0A 1TK3A 4WY8A 4UBIA 2BUAA 1LPBB 6YASA 1CV2A 4B0PA 3C6ZA 3WA7A 3I1IA 4AO8A 4U2DA 2Z8ZA 2AJCA 4MWSA 4K5QA 2ORYA
chains in the Genus database with same CATH superfamily
4EYKA 4Z0NA 4JITA 2LIVA 4B6SA 1TJ4A 3KJQA 3M5DA 5HS6A 3FUWA 1OTYA 1Z0AA 3PEYA 3PHHA 1E2HA 1CZHA 4YRZA 2BHRA 2FG5A 1YCDA 2Y77A 5DULA 2JFOA 3SYLA 1KI9A 3FB4A 1UQTA 4LJ5A 4RPCA 4C5CA 5K3SA 4EG8A 1RSZA 1VSQA 1TRHA 1K7EB 1E7YA 3STUA 3ICPA 4G4SO 3I1YA 4XUGB 3SXPA 1LCIA 3OJEA 4HS9A 1NUQA 1OFGA 4OFWA 1RVDA 3H1BA 4C2TA 4IDBA 2OKCA 4Y2XA 1BS9A 1IHOA 4KV9A 4I6GA 4M0PA 1SC6A 2RHRA 1YZTA 4QUEA 2X9NA 2HQBA 4L8LA 1KWKA 1NX9A 3D4IA 5K4AA 3HRHA 3CBGA 2QJFA 1OGJA 3ZXYA 4MUBA 3VZRA 4TWIA 1LDMA 1D1QA 4DCSA 2RARA 16PKA 1D4FA 1RNLA 2R47A 4DMRA 5J2UF 5ITWA 121PA 5ALJA 5BN5A 3RIGA 4OGWA 5EUQB 4BNKA 4UVDA 2WE7A 4DLSA 5DM70 3STTA 3FHCB 3H5OA 4MA0A 1Q3TA 2IEGA 4HJRA 4EP1A 3C8ZA 3DWFA 5CYOA 2JCVA 4DY4A 3ZX4A 5JNUA 3IR5A 4C7KA 3ACDA 2HJSA 3JZIA 1UEJA 4WN9A 1D4ZA 1MC4A 3OU7A 1UKBA 2PX8A 2QAGA 2MCFA 3ER9A 1YDEA 4K6CA 4M0CA 4CPDA 1KDTA 4CKWA 5ED4A 4F06A 3VX3A 5JO0A 3C4VA 3C98A 4MQ5A 2AFVA 2QTVB 1IEVA 3R3SA 3DBLA 3ORRA 2FJ0A 3EEBA 3G0GA 2WDPA 2JHCA 2WJYA 5KNCA 5LMCA 3SZOA 1ZI8A 3E18A 3ASUA 2X6TA 2BE9A 3PXBA 3WIBA 2XCLA 4A0RA 4HQOA 4J3JA 2XYQA 3DE2X 5D3MA 1NR1A 3UMVA 2AR0A 4A15A 4OMDA 2J3QA 2WG2A 3GJRA 1RZUA 4GX5A 4ZC8A 4CDNA 1IY9A 3BMOB 5GQSA 1IAVA 1QO9A 4ON9A 3UPTA 1Q1EA 4EQ6B 1QK5A 1UIRA 3CLUD 2XSZD 3L82B 3O8OB 3WGLA 4MQEA 4RTQA 1NRWA 3ZQKA 4OMFG 2CLIB 4QARA 3ZWPA 2IYPA 4Y6GB 3KFXA 1U90A 2IEAA 4FFSA 4QQNA 4DDUA 4AZTA 2KYRA 1YFJA 1T9BA 1GAWA 3GFFA 3K53A 3SJUA 1DKMA 4PINA 3RWBA 1STOA 3PX3A 5FI0B 2A3NA 5CHEA 3P2JA 2NVOA 1H4VB 3NDRA 4DV2B 4JBIA 2F43A 2JK0A 4Q47A 3VJKA 4MDHA 3M5WA 5JFGA 3ODGA 1YBAA 1BKSB 3NJRA 3U9TA 2FWAA 5IJ9A 1NJGA 1KH2A 2V7VA 4EFDA 4ZVVA 1E58A 1IE3A 2W4QA 4B76A 4DMKA 1MZPA 1JN0A 3OM9A 3C6XA 1S2OA 5J58A 2EJWA 2Y1LA 1GKYA 2Y92A 3J7TA 1BMDA 1TEVA 3CKLA 3NEPX 3F5FA 2I4RA 1DWUA 2ILVA 4JS0A 3U3DA 3RRJA 3V1YA 1TM5E 2QR3A 2K4MA 2I4NA 1JG3A 3V9AA 3MA0A 1DHTA 3PT9A 1NI4B 2NSHA 4CM4A 3ZJUA 2GBLA 3M1LA 5IDQA 3EXIA 2Q6VA 1LSUA 2OB1A 4ZOEA 2UXDB 2D7JA 3ZPXA 3FROA 3EEIA 4MA5A 4EJFA 4JR2A 3SZUA 1RE1A 3R7FA 4BVLA 4QUDA 3SC4A 1YQXA 3E15A 1JR6A 4D3XA 2G9UA 4GNKA 5L3SA 1OT5A 3A6LA 3O84A 5E6UA 2DBYA 4J4TA 4MWBA 1Z0IA 4C7OA 2WD7B 1BCRA 3KUCA 2W48A 2GEFA 3D5EA 3LOQA 4CM8A 1JX6A 3LE8A 4LZZA 1XAGA 3JVEA 3E9YA 1ID8A 1XQWA 3RS5A 1ZEMA 3WB9A 3WR5A 4MITA 2GD0A 3YASA 4F84A 5BQ3A 5CIYA 4JI7B 4PZEA 5GONF 1W8DA 4EPTA 4F0JA 3OOSA 4FKBA 1W49A 1U4NA 1IQ0A 1U7WA 1XBTA 4JYMA 4YXWD 4H7PA 3B2EA 3UM9A 1SBZA 2HHAA 4JNKA 3MWGA 3IKTA 2PMWB 2W43A 5E7IA 4UBLA 5JXWA 3HVHA 1QZTA 1CR2A 3QTLA 4RDHA 5AVKA 3TRKA 4YIHA 4FFWA 2ST1A 3FMVA 5KYUB 1ZM4A 2GZRA 3LCUA 4ND8A 2G5CA 4L9WA 3GEPA 1AKVA 1V2HE 1X0XA 5CB4B 3U7QA 1R4NB 4IDOA 1CNEA 3O8OA 1KRHA 1VHLA 1S3IA 1LTHR 1LX7A 1I9CA 2P30A 2E4UA 3GNSA 1N57A 5KNLA 2VHCA 3KQKA 2ZUVA 1Z22A 4P35A 1H0SA 3NC1C 2FI1A 3FSEA 5E4FA 4JASB 5HE8A 3HWSA 4BX2A 5LBIA 3DOIA 1DAHA 4L27A 1CFJA 2VRCD 3C3EA 1QAOA 3S8YA 3OA2A 4G0PA 2HT6A 4RZ2A 1SHJA 1IIBA 3E5NA 3DW3X 1EQAA 3AY0A 3OLCX 2DBQA 1AQNA 2PH1A 2MMGA 3GXBA 5EESA 4IDHA 5IJZA 3KEOA 1SPXA 2CFRA 1UMDB 1HF3A 3HWWA 2G07A 4MVJG 2QX6A 4XIJA 3PITA 3C3PA 2XNKA 1DPFA 3HJUA 4TV9A 3T3OA 1IJKA 4KAFA 3EDMA 1A9OA 3KPVA 5IXJA 4ZA2A 2RBGA 2HRQA 3MAAC 5HZMA 3NNNA 2QTBA 3BL6A 1DG9A 4QAJA 4XWYA 5E6RA 2EDAA 3X1KA 1OBHA 1T9GS 1W35A 1F0PA 1RYFA 1FDUA 1T9GR 4CG1A 1EBUA 4IVRA 2ZYRA 1GT6A 1P1RA 4GQBA 4KQCA 4CCAA 1M2OB 1X86B 1W96A 5KINB 1G7SA 1RC0A 3ADKA 3IMEA 4L8VA 4HDMB 5AJZA 5FHRA 1P0MA 4MRAA 2CNNA 2H7VA 1EFRD 2B8JA 3FRIA 2BD0A 5ALNA 1JEAA 1SIBE 2QVXX 1K0UA 1JQEA 3B70A 1F8UA 3HDVA 1ZCZA 4K7JA 4TWBA 2MU1A 5DM4A 4WXYB 4KGDA 4LSMA 3K6JA 5JY6A 4JLJA 4JUAA 4MA4A 2H7CA 3QYPA 4M6WA 4HVLA 2IP4A 4G8JA 1B0PA 4PFSA 4Q16A 4TM7A 5CMLA 3IEUA 3T7CA 1OPXA 1U3GA 3M2PA 3EGOA 3EQ2A 2GR9A 2NUBA 2WSLA 1UBOS 1XEXA 3A6ZA 1A9RA 2ATVA 1XXLA 4F7WA 3AXTA 1AD2A 1C7JA 1HE2A 2ZVJA 3ZTWA 4HR7A 3UNXA 4DSZA 1TJ3A 1PL7A 2Y4OA 4EZEA 1YZQA 5ARDA 1EDEA 5T5QA 1GFSA 3GRCA 1M1YE 2H4XA 3TNDA 1NN0A 3VNSA 1PLKA 1QQ6A 2PZ8A 1VHTA 4GBGA 5MF6A 4RCZA 2AJ8A 1GA1A 3RRYA 4P7BA 3N6XA 3VHXB 4B7XA 2EX1A 1IZ0A 2BM0A 4MV4A 4OLHA 2ZR8A 3RE1A 5LA6A 1F1BA 1P2FA 3WLJA 4BV2A 1TM3E 3ICEA 4B6RA 1WHTB 4AY3A 1W85A 4RJ2A 5LMZA 2WD9A 1QP8A 2GF9A 1I7NA 4FFRA 3PC8A 1RFGE 3WFZA 1U80A 2P6NA 3FZNA 3JQAD 3TVYA 4C7MA 2O1WA 3NANA 1Y4DE 5HIAA 4M21A 1RKUA 4L8WB 1WMFA 1Z3IX 3PR2B 1P1CA 3VO2A 1YR9A 3D8NA 4MYCA 4W8HA 1KS2A 4BBJA 1E32A 1QKIA 3AUFA 1OR8A 1UOPA 3BK7A 4UTPA 2XMDA 2F43B 4JOQA 5LOVF 1XPOA 1MAHA 3E5RA 3MFQA 5IC5A 1OIWA 5L3ZA 2ANBA 4QTYA 3BZWA 3H3FA 1RKVA 3QXJA 2WAYA 4ITRC 3CO0S 2B5WA 4TV9B 4TTSA 3TOSA 4JI8B 3NHLA 3IHLA 1NXOA 3FUCA 1ZI9A 4CM9D 3T0IA 3T5GA 2G4CA 4AX4A 1IC6A 3AEXA 4FC7A 4L6AA 1QYVA 1SXJB 3NHUA 2XODA 2XGOA 3AG5A 3D0RA 2ZJBA 2WFLA 4A10A 1FLAA 3THXB 1OFTA 4YRNA 5EWMA 5FOWA 2ZU0C 3UAZA 4D82A 4H7HA 2Z6VA 3PYMA 2P90A 4PM4A 4ZI2A 1ABFA 2EFHB 2C7VA 5KB3A 1L5HA 1OH6A 5B7NA 4XUEA 3IPRA 2PFGA 2Q9CA 1NJSA 3CR3C 3MQ4A 5E2AA 4IS3A 3S28A 1Y48E 4F9FA 1TZKA 1ZD8A 2ET6A 4H7DA 5FLKA 3S5UA 3EXHC 2EVWX 2RGRA 3A4LA 4EHFA 3KOUA 1PWZA 4ZEXA 3N7TA 4WFIA 3ELYA 3EAFA 3PRYA 2OZEA 5GOTA 3SP1A 2A88A 1FFAA 1N9KA 5CVUA 1ML3A 1PD0A 4NMHA 3OJWA 2Z2IA 1KYWA 1M2WA 2KI5A 2FW1A 1EINA 3ANMA 3JASB 3KPWA 3RSGA 1GAEO 1OFHA 4R9VA 4ZCLA 2VYQA 2YJ6A 3A9RA 3O0TA 4FNAA 4O63O 4S0XA 2QENA 4XX0A 1EGQA 1P0CA 4LXGA 1SKBA 3H2JA 3RTAA 3JZFA 4GAEA 2HK6A 3T7EA 2Z04A 4ZAYA 5B64A 3NATA 1IG0A 4AMGA 3VO9A 4MS1A 4R69A 5F1OA 4M37A 1OWPA 1ZFNA 1DAEA 1QHNA 3FJOA 1R0BA 3GDOA 1S6YA 3NDPA 3O2JA 5DM2A 5TR9A 5BSTA 1DV2A 1VFNA 4B6JA 3LWDA 5JCXA 1JDZA 2PZAA 3HU3A 4HMQA 5LZ5A 4B3HA 3UT5B 1BGWA 1G8AA 4RMJA 1CHNA 3A2NA 1TAUA 3DE7X 1JJAA 4FBLA 5FPQA 2BFBA 1VGRA 1OROA 2CMDA 2ROQA 4U7TB 1OB2A 2HSJA 1OBCA 3WLNA 4Q3NA 5JY1A 3C16C 1HNXB 3GEIA 1TK9A 3U4HA 4WA7A 1OH8A 1UBRS 4MICA 1E79A 2ACWA 2CNWD 3HXPA 5FAKA 5KYYB 4OSEA 4OFXA 3JQPA 2FR8C 1DC7A 3TFQA 1U4SA 2PO5A 4ZDKA 1K97A 3V8QA 1Z4NA 5A4MS 3NT2A 5E9WA 1NI5A 4RV4A 1DIHA 3V80A 1PJAA 3D7NA 2AHRA 5FRDA 3LQKA 4LF7B 1E6EA 5G0WA 4DXDA 3ASVA 3G68A 5F64A 2NZVG 1DBIA 1PK9A 4R05A 3OMLA 3RUAA 1GXSB 4PICA 1PEYA 1DQZA 3EGEA 2JI7A 2H5IA 3B3GA 1M8KA 2OZLB 3T0GA 2H85A 4UNSA 5JPIA 1HGXA 2ZIEA 2R8BA 3GLFB 4KRGA 1SU7A 3HCNA 4KG7A 4ZHQA 2HA5A 4YMWA 3VC3A 5K8LA 4UUBA 3I04A 2SICE 4JFAA 1O97C 3MGKA 2AN4A 1DC5A 2C4NA 1XZIA 3GZ4A 3NHYA 4H3KB 1XMJA 5EMLA 4ES6A 2XZPA 5JRDS 2PYDA 3WL8A 1EA7A 4M9RA 4BIMA 1W5AA 1NI3A 2FVXA 4J0EA 2FQQA 3FA2A 3QBTA 3DMHA 1BE6A 1EFVB 1E9SA 2G25A 2JCXA 4I8XA 2IF2A 4PGMA 2E48A 3T3HA 3SEQA 1BAPA 2H18A 1ODJA 2IHJA 1M34E 3TMAA 3NIDB 1E1DA 3KAPA 1X1QA 1OMOA 4G8DA 1Z0UA 4EBFA 1QGZA 4J1TA 4V39A 2Q2WA 3JQ8B 4IDPA 2W6JA 1EWYA 2BFFB 3QKUA 3QWIA 4QL3A 5IAEA 4TT3A 3VM6A 3O21A 5IXSA 3QKRB 1GR0A 1JJVA 3P52A 1AF7A 1M6VB 1GLVA 3WG9A 3M82A 3CTMA 1NMZA 1O87A 3GLKA 1QF9A 4JELA 2QN7A 3Q3CA 4I50A 2W2XA 4Z8YA 3FTFA 1FU8A 5IVKA 2GTHA 3W2IA 4BLSA 2EATA 2YJGA 1HSZA 4NZ9A 5FCDA 3CEJA 1X13A 2Q9BA 2A30A 2VN8A 3IAEA 4KIGA 3CLSC 4NWIA 4QOHA 2F64A 4ENUA 2AZMA 3WIOA 4UUPA 4OQEA 3JQ9A 2OBYA 3WSVA 1F4LA 1P7VA 2F2TA 3MQ2A 3PNKA 4GGOA 3O7WA 4NNPA 1N36B 1NW8A 1ZJYA 5KTYA 2W4IA 1KXJA 3K3PA 4P2BA 2WNIA 1OSNA 4PLWA 1JEQB 2IFTA 4E5KA 1MC5A 3F4BA 4L22A 1X15A 3BJEA 3QLJA 1ZGZA 2Y68A 5KQLA 1V3UA 4NEGA 4IZIA 4ER3A 4UJ5A 2FEPA 2EG5A 4PHTA 2YUTA 3UOAB 3K8ZA 2OE2A 4R3WA 1JEOA 3ENKA 3LVBA 4OBWA 1W85B 4XB6B 2DCUA 3S4YA 1JKJA 3HBAA 5HOQA 4DZTA 1YRBA 1UBCA 1E60A 1VZ3A 1K88A 1WXFA 2V7PA 3QX7A 3WGNA 1IBKB 3W5UA 2QMZA 2RFLA 3IUQA 5DT2A 2V5UA 3HCAA 2EBWA 2PYZA 3REGA 4WOJA 4D4GA 2JHFA 5DGXA 5HCIA 5AVYA 1K8XB 3L7NA 4PAQA 4F56A 3OIDA 4MRMB 4Z53A 1YIDA 5DYYA 1XPUA 3AUKA 1VJ0A 4X24A 4I66A 2C9MA 3BMCA 5D5PA 1EGVB 2BCJQ 3TLMA 4AY4A 1JHAA 1PRYA 3GLVA 3U7GA 3CW8X 1SXIA 2QNIA 2BYTA 2Q4OA 4NSNA 4PG4A 5JXJA 1R0RE 1H9CA 1N6IA 3I2GA 4TOIA 1G20A 2R62A 4CMJA 3DOEA 3MTAA 4F5DA 1REQB 5FBRB 2AJDA 4Q34A 2OAQ1 1XEWX 1RWWA 5KC8A 4NCHA 2IPXA 1SHLA 3MIIA 4NFLA 4YRAA 2GSDA 3DZIA 3MWDB 5DIZA 4Z54A 4IMPA 1ND5A 3R7SA 4IEIA 3BOSA 2CNLA 1L8XA 4IOJA 1SBTA 3E1KA 1RTKA 1IN1A 4Z9XA 1T13A 3STWA 1UXKA 1WB5A 5F9MA 3ZIDA 1XFAA 3Q3IA 3SEZA 4BN4A 1ND6A 3KTAA 1VE1A 1F6BA 3LDFA 3HPQA 1E61A 2B20A 1NTRA 1P4JA 3BXEA 4K81B 4PQRA 5HSGA 4ZT5A 4LF5B 5LJLA 1WZEA 4P4SA 5CH5A 4EQZA 1W4RA 3DVQX 1XQYA 1Y3DE 2GYWA 1HH4A 1R10A 1J07A 2O8NA 4I8DA 1O9HA 4RQTA 1H93A 3GJ3A 1V8OA 4Q7QA 3IBYA 4ZT4A 1YZUA 3QI2A 3SHWA 3K1AB 2XF2A 5D84A 3BFKA 2Q07A 4JSTA 1XTBA 5D8DA 3T12A 4HAZA 2CC2A 4INJA 3NIBA 4QXOA 1WVIA 5BPHA 1D9ZA 5DSZA 3ZBUA 3I04M 2A84A 1BU8A 3IPAA 4ZI3A 2AR7A 1GZVA 2CHVA 3AHIA 3CKKA 2BGTA 4YJFB 3HR8A 4KB5A 3BFJA 4XXHA 1CULC 3BX1A 1ZVQA 2ZJ1A 4DLVA 4HXGA 1C4OA 3LXXA 1P29A 1R0YA 1AXRA 1HM5A 3QKSB 1SJ9A 4HQFA 5K0LA 2NU8A 3QEAZ 2DEUA 3EIUA 2P2DA 2ZYIA 3V4VB 1Q16A 1I2CA 2RHOA 5T4FA 3NHZA 1GUZA 1VDZA 4DGSA 3BDAA 1JKJB 3GO4A 4CR7A 1GCIA 2ZPTX 3LUGA 1Z63A 3RU2A 4CHGA 3FKJA 4CTNA 4EGCB 2XE8A 5BO5A 3PWKA 4YCBA 4OHRA 4B09A 4B80A 2XUGA 4QOSA 1JG2A 4ILKA 3OTQA 1LWOA 1V1RB 1Z2DA 4NEHB 5FUQA 3PX7A 3PFNA 4HYQA 3A9CA 4QBKA 3RF6A 1PJ8A 4QRHA 3ZJYA 5CG1A 4PC2A 3MHPA 4FNMA 1ZIYA 4MUHA 3C6KA 1L4YA 4KXYA 2WM8A 2FR8A 1PSZA 4AZVA 4KFSA 1IDN1 2B94A 2ZREA 2HK7A 3AG6A 4XVHA 3WMEA 3DKRA 4E7PA 1NFFA 1U8AA 3EYAA 2HIHA 5TRTA 5ALQA 3DWIA 4COOA 3UKOA 3LX5A 1QE0A 4RF4A 4AMZA 4LCJA 4D02A 4FFBB 1EP3B 4B87A 1FLNA 1S0UA 1YA8A 1QVZA 3Q10A 3U7HB 3R7WA 1LZLA 1B6SA 3DMPA 4DNFA 1EVYA 1JF8A 3KQWA 3DLTA 4W4TA 2OL4A 1V37A 1WSDA 4OREX 5L95A 3WOHA 3AEQB 5CXQA 5HRCA 4FHDA 4RGQA 1GKLA 3KQOA 3T9DA 1NMXA 4OFZA 1CUUA 2Q5OA 4OF4A 5AP9A 3WP1B 5C1OA 3Q1LA 3TSZA 4L73A 4Y0VA 1DBSA 3IJ5A 4EL5A 2C2YA 5DASA 4BASA 2ZSHA 3C1TA 4PG6A 3FRHA 3UWMA 1QYWA 1W9MA 4A73A 1DKLA 2IUFA 2FN7A 2Z5FA 1RMTA 2RHTA 3I1FA 5D6OA 4FKZA 3NIFB 3TGLA 4CW7A 3B1WA 5IVDA 4EVIA 4HLQB 3KJEA 5K6TA 2JL1A 1I32A 3FAKA 5EWLA 2H2GA 2I4OA 1BN7A 1T8WA 3KU4A 1IHUA 1QCCA 3GVIA 1MR3F 3K1YA 1VPLA 3RW9A 5I9MA 3HYSA 5DCWA 3TMYA 5DIFA 2OQRA 4CGYA 3T4PA 1MU0A 1Z0ZA 5IAKA 3WDSA 1BXGA 2YJZA 5EJ9A 2DKFA 1L7QA 1SBYA 1YC5A 2ON6A 3QKSA 3ITDA 2AF3C 3PX2A 4NCNA 2JGAA 2IU4A 5CA0B 1KARA 2D5BA 1GZUA 3K9NA 2ZWVA 4X63A 2QLNA 1ORRA 3HVJA 4J0KA 5EXTA 5BYBA 4DB4A 3VR0A 1WMBA 3JZDA 3DM5A 5EJ2A 4CMKA 3OEWA 1SUIA 4P54A 5MN6A 4L8YA 3FWHA 3M9XA 2CNDA 3D59A 4R2HA 2OXIA 4JP1A 3OLQA 4JHLA 2O0HA 2R11A 1SUBA 3MJCA 2GPAA 2R7NA 3KVNA 4N3AA 3M4XA 1K7CA 2XBLA 3DAGA 3E9DA 3LGAA 4P3YA 1HO3A 3RK1A 3EUWA 4EECA 2GVZC 3BTOA 2PBZA 3VYWA 2YDYA 4RHXA 4F93B 2C0QA 4Q1BA 4UULA 3GJ8A 1L5NA 5LXTA 4GC5A 2HSWA 4N18A 3P2IA 4ACAA 2CB0A 4E5NA 3KEMA 1OXXK 2NVUB 2PDAA 2ORED 3BSSA 1C50A 4DPMA 1EPUA 2CJPA 4BO0A 4F04A 1BD4A 1YKSA 2PLWA 1VLZA 3WAKA 4FCCA 4FOOA 2H1LA 1N6PA 1P7PA 4O02B 3CZQA 4R0VA 5EUBA 2Z6UA 4WOPA 4G0UA 2CHEA 1CRWG 2R8PA 3ZDAA 4HZUB 5FNVF 1LWNA 1AKNA 2ERYA 1IJFA 4MGZR 3DEKA 3WHIA 4L7VA 5ENDA 1N0WA 1E6WA 5D3QA 2WTXA 1NQOA 3A3NA 4PZAA 5E1BA 4B79A 2AZXA 3ND7A 4QE3A 1G60A 4JXZA 1Z6PA 4MB6A 1CUFA 4QUBA 3T8YA 3KT3A 2AOTB 1NVXQ 1TEHA 1UK9A 3D02A 4EX7A 4O08A 3RHTA 1JLKA 4YN3A 1IJEA 4EL0A 2B6HA 2FFBA 3BC1A 4EW2A 1XDBA 1FVFA 4Q9JA 5ALZA 4BC0A 3MF4A 1I94B 3IUEA 4YCJA 1L5QA 3OPYI 3IP7A 4CMGA 5G41A 1CY0A 5THKA 1T9DA 2XGSA 1XPJA 3C3YA 4LHYA 4BX8A 2O8DB 3T4UA 4LVCA 1PUIA 4GG1A 3KVVA 2BBTA 4JJZA 4E14A 3KR0A 2Q5JA 4Q39A 2HGZA 3R20A 4EJSC 1G18A 2IS2A 4MW7A 4QUKA 4XFJA 2DSTA 3SR3A 4ZYVA 1Y9EA 1DDGA 1NXTA 2AG5A 1FSGA 3ZQUA 4GT1A 1HYBA 3VUEA 1M34B 2OYRA 5A9SA 3D8TA 5BW4A 1K7YA 4M8LA 4MUMA 3PI6A 4EFMA 2GS9A 5H81A 2I3GA 3VGPA 3A6KA 2JLYA 4D99A 3ZJTA 1YE8A 1FFDA 4G81A 1X7HA 4MGHA 2FPPA 2WY2D 5F1PA 3TW8A 3WMXA 3VBEA 2VDMB 4C05A 1GDDA 4DRZA 2BH9A 3P96A 3AKZA 1X74A 1EX9A 4XYMA 3N2GA 1UBHS 3OZSA 5BURA 4L28A 4UE2A 1NU6A 1J90A 2CJYA 2XB8A 4NOLA 1OAKA 2G40A 4YCNA 5EIBD 4GUDA 2VOJA 4X1KA 3KVRA 1YONA 5JXHA 4DN6A 4BX9A 3SI7A 3AR9A 2GEDA 2YRXA 1NYTA 3ETJA 2HBZA 1GGKA 2HX1A 2N1BA 3B6JA 3NONA 4O1MA 4D97A 2BGMA 1K2WA 4NU6A 1Y98A 1CF4A 2V45A 4OEHA 3TIFA 5F2EA 2PBFA 3CA8A 3FTQA 3P9ZA 4GEGA 1OVMA 4Q6BA 4RTPA 1WU7A 2AJTA 2VPYA 2WQZA 2BFOA 3QQ5A 3E5HA 1QJ4A 1A5AB 2WEKA 4RGYA 4X44A 4CUZA 5AJHA 1BQEA 1COZA 1ZDMA 3FLMA 3W9SA 1OX6A 2OO5C 2ISQA 2VZLA 4NQZA 5AI5A 4ZZ2A 3OJ0A 4D26A 1PTJC 3JATB 4MVJF 1GYQA 3KBBA 1V4VA 9LDBA 2BZGA 1ULZA 3OEYA 1FX0B 3R9IA 1W2HA 2R8EA 5C5CA 5HQTA 1C1DA 3PBKA 4G85A 4OXKA 4DBLC 3SQXA 4PSDA 3STXA 3HRIA 2R7LA 4JA2A 4XIGS 4EGQA 2HBRA 1FYEA 4PU0A 3WGOA 3V8PA 3I9FA 3LL7A 4DW8A 4PYOA 1NIPA 5IM4A 5C80A 5CJJA 3U56A 1VLMA 1T5IA 3CLKA 4MLPA 4P36A 4EPXA 4CQLB 2JAPA 3LNCA 4G4GA 3L1IA 2PXXA 2PSDA 3NHFA 1U5CA 5DEOA 1VPDA 2BC9A 3EODA 2FW7A 3H4MA 3PDUA 4KJZA 1E9FA 1A2QA 4TT8A 4QJBA 2Q7OE 2XDQB 4YRKA 1U0JA 4GX2A 2OBNA 4Q37A 3PC7A 2XY4A 4KUHA 1IXSB 2PQ0A 1U28C 2XOKD 1KEVA 2QVCA 4OHBA 1KEEA 4PW0A 1FFWA 1WMAA 5CDSA 4F6LA 4GL2A 1PFKA 3DMYA 1VI5A 1UJNA 4BP9A 5CK5A 4ARVA 3CLRC 4OJTA 4ZC1A 4DZRA 3GUZA 4N01A 1DRWA 1REQA 1N1GA 4YRLA 4IOKA 1JDSA 4KQJA 2BF7A 1QE5A 3L1KA 4DS3A 3BXOA 4LVUA 1LW7A 1PWXA 3IEIA 5IC4A 4G1VA 1ZC3A 4ZYWA 4P3PA 3CRMA 1YBHA 3LK6A 1YR6A 5FPYA 2H9YA 5DYIA 2EU8A 1OU4A 2I8LA 2PFKA 1SOMA 4M46A 2DQZA 1UJ4A 3PUIA 5KAPA 4LQLA 2IH5A 2CLDX 4URFA 4XDZA 1L4BA 3OIGA 3OQVA 3PD7A 1M8FA 4ZPXA 3SHQA 4E08A 3ZWMA 1Z4LA 3JQGB 4RKEA 2QI9C 1S3GA 3RS2A 1H8HD 1FFEA 5AK3A 4NU0A 3B1FA 1ZXLA 3SYMA 4P6VF 4TSFD 3PSAA 3C24A 3HKCA 2M1ZA 1QHYA 3MMSA 3IUBA 1UKYA 1EWKA 2A8YA 5CBPA 3W7VA 2GZ3A 4LXYA 3QU5A 1ZJ4A 3WLTA 3ZCSA 2VRNA 4PRKA 3NTQA 4WKBA 1MO2A 3S55A 3L06A 2DZDA 2CFCA 3IQFA 4YQZA 1K1EA 2FP3A 3PQ5A 4IGAA 1IHYA 3EDCA 2W83A 3AHCA 3G13A 4UREA 1ZVMA 1H3FA 4CM5A 4RORA 1CHDA 1NF8A 1JQJC 1VA5A 1BHSA 2CXPA 2BTQB 1RYEA 3EFEA 3IKJA 2A1TR 3P32A 4G0NA 3IIIA 3AVYA 1CERA 1EWRA 2VP5A 3T1OA 5JU6A 1FTNA 1HX7A 1NTOA 4JYZA 3T3MB 4EKNB 3EPKA 1AZLA 5HF6A 2WU3A 2GK7A 1EFPB 2FNAA 5LUBA 4NK5A 5IJ9B 2A35A 4RY8A 1KP9A 1M72A 2V0GA 5DW0A 1J21A 5KOHB 2B8TA 2UKDA 3I52A 1KSHA 2QTNA 3HI4A 1E8MA 3IAM6 2H2DA 3RJ9A 1XD9A 4U2FA 1HE1C 3RSZA 3R3HA 4Z4HA 3V1TC 1T6NA 4ZV4A 1XRNA 3HMKA 2QQ0A 1M0SA 2VHJA 1U04A 2OOSA 2WSYB 4IYJA 2IHZA 4LS3A 4GI5A 4NBWA 4R1PA 5BR7A 1W34A 4IF4A 4KO3S 3RARA 3T1QA 3W4JA 3ZW7A 5KVAA 2E55A 3LX8A 2BFCA 2CHQA 2O9JA 1N32B 4ZVOA 1MENA 1F8GA 2Y2UA 4GM0A 4NJMB 3ROEA 4AJNA 1ZOIA 3QA9A 2F9FA 1PDVA 3RC9A 4A8JC 5LDHA 4CG2A 5AOAA 5BWBA 1N2ZA 1XD2B 4D43A 3H4IA 4V0RA 2GRAA 4M1SA 3RS4A 4B31A 4LWOA 3B5IA 1D0SA 3K0CC 2ZANA 4CL8A 1SXJE 1CZNA 1W4BA 3OWXA 3Q12A 1T1SA 2C4UA 1WSAA 4JBGA 3K8OE 4WV3A 4A8JA 1XDZA 2GEBA 3TZEA 2R0QC 2XBMA 4LJ7A 2OXEA 1KK2A 4UVGA 4JK3A 1UR5A 5JH7F 1HOTA 1GCGA 2FQ1A 2HA6A 4ZTUB 1KE2A 3KKOA 1JAIA 1DUSA 2BGNA 3HDJA 4ZVPA 1AO3A 1MF7A 1U0OC 2NWQA 2XKAA 1MFPA 4QU5A 5JS8A 3AZOA 1C0IA 3K15A 1ABBA 4DV0B 4FYVA 4BVKA 4LOJA 3BQMB 3LGSA 5DN9A 2FWMX 2FCAA 4AKGA 4L0CA 4CEIA 2G08A 1E92A 1PFVA 5TQ2A 3D1LA 3QITA 4IV8A 3OQHA 3RU9A 2HJRA 2O4UX 1FRVA 2V98A 3BD6A 4BBPA 1M2JA 5KAMA 4RENA 2YXDA 4KRFA 2QN3A 4NDAA 1RXSA 1ZP6A 3CB2A 2NTJA 3KUKA 3L7YA 1A1SA 1JHRA 1E7MA 4JJFA 1P2BA 1PJCA 4M4SA 5H4HA 1CZKA 4K40A 4YAGA 5JZOA 4MQLA 4X8HA 3C7CB 3LECA 3VC1A 1FFYA 3R1IA 5KTMA 1KVTA 2WPDD 1I1NA 4CEJA 1WRBA 5KS2A 2OVFA 4DHWA 1R5JA 3K4QA 1WCV1 1GUBA 2XTNA 4JQSA 3KT6A 1GU7A 2QYSA 3NBQA 4G8BA 4MCJA 4NPHA 3T0FA 3A1NA 2IHTA 4FB4A 4CGZA 4Y9SA 5K9ZA 4OHKA 4RMIA 5CD1A 4NHOA 4Z7QB 3RIYA 1BD3A 4DUYB 5AI6A 2KB0A 2IX9A 1EDBA 4A8TA 4JX8A 4L5AA 3PNPA 1F6WA 2VT6A 5KOHA 1ULBA 2G67A 3JATA 1AURA 4IWYA 2QL6A 4B35A 1EUCB 1I3NA 4HLDA 4M9SA 2Q9UA 4ZXPA 1K8RA 1ZSVA 1RM3A 4NXNB 5L45A 2AV6A 3K72B 3OTIA 1NT4A 3AETB 4O4LB 1XX6A 1NR5A 2ZRDA 2BKUA 1UBKS 3IHTA 4ITVA 5B4TA 4IDAA 4PX5A 1Q7EA 1EVQA 3ISJA 3PRJA 1Y34E 4PGHA 4X6YA 1SOUA 4URHA 2J3EA 3K5PA 2ADOA 2XXJA 3KJGA 2DBZA 2Q5EA 4R01A 5EXXA 1KY4A 1L5OA 3WRWA 1OZFA 5IFLA 1QVWA 4CCSA 2HJGA 4F3RA 2OUIA 1T6YA 4MKFA 4FHFA 5JJLA 1L8LA 3EVNA 3CLTC 3L3BA 2XB2A 2IDZA 3JSAA 4DDWA 3RJTA 5EKDA 5JD5A 3BHJA 1TKRA 1JAXA 2BEVA 4FZ5A 4OJQA 2P9EA 3RH0A 1DMRA 3LPLA 2MIIA 3H1EA 1C7EA 1JDNA 1YHZA 2P68A 4XX1A 1IRIA 3ZDRA 5C5IA 2X40A 3Q1KA 2XWPA 4KFUA 1RT9A 3ZD8A 1ODKA 4LKOA 3W5CA 4MIYA 3H1GA 4OA8A 1DOHA 2HU8A 2P5SA 2VJOA 3HXLA 3KKKA 3WY9A 5JISA 3U09A 2J4DA 4KIJA 3L05A 1I6LA 4AMYA 3LI2A 3NC4A 3OKFA 3UJHA 3ANXA 3N6VA 1BXZA 5G3YA 4WKGA 3RT7A 4QYIA 3F98A 4AUMA 1GGMA 1P91A 1GAXA 1T29A 3PXUA 5MHTA 3LXMA 4TMVA 2QR2A 3U3JA 3ZXSA 5HM8A 1R12A 4ZYYA 4WK4B 5BRNA 4KWTA 3JPYA 1ILEA 2GD2A 1UKZA 2D74A 2HC9A 2OBMA 2FPIB 5L6LB 4PIMA 2OT3B 3L8YA 3IELA 3MNFA 1HURA 1Z9BA 2QTRA 2FWRA 2WZQA 3C3MA 3F7TA 3LU1A 3FDFA 1DKOA 3PE4A 1WCIB 4CL3A 3HSSA 1KO8A 4BNXA 1SBNE 3RVMA 4HUJA 1PR3A 1Q1ZA 1V5IA 4QEZA 4B2IA 1ISHA 3W79A 5AVVA 2QMUA 2FPRA 1A50B 5FUWA 3G8YA 3MILA 1BZYA 2V7QA 5CVEA 4NS1A 4MR7A 1ID1A 2YV3A 3RC8A 4IJKA 5DBGA 2K2QB 1T1JA 3U0VA 4JLAA 5F76A 1F5NA 1QS0A 1EFLA 4MUJA 1PN3A 3SLRA 3FWZA 3R44A 3EY9A 1V45E 3O3MB 4ZOLB 2X6RA 4JI3B 5A06A 3HCEA 3HEMA 2IDJA 4TKLA 2ZIUB 2BI7A 1D2GA 1NATA 1SG0A 1ULAA 3GYGA 1OFUA 3D4LA 4U9IS 2O5EA 2ORVA 3THSA 2D1YA 1S96A 4MEAA 1GTL1 1VBKA 3A1UA 2IS6A 1WXDA 3L0PA 4PQGA 3AZQA 2MSLA 2PSFA 2VQSA 3KLPX 4CUJA 1VKJA 4IMJB 5D00A 2DULA 3T9BA 3QZUA 4BQPA 2DT8A 1ZSNA 2J9FA 3ZCPA 5JI2E 2XSZA 4GOKA 2GB4A 2VC2B 1W6UA 3O26A 3HUDA 3DB1A 1XNRB 1GOTA 1LPOA 3C14C 4UUQA 2GHIA 1X6VA 5AQEA 1Y7HA 4B1FA 4G0VA 1E9BA 1XTTA 2Z56A 3HB9A 1XKQA 1EH5A 1JMYA 3IQWA 3QBEA 1YGPA 1S7GA 4OJNA 3H5AA 4F91B 3F5MA 1IN4A 3JRWA 1UC9A 3LP8A 5UKDA 5KQGA 4PR0A 4E4TA 3N0WA 3NT4A 1GPBA 4DC9A 1HK7A 3DE5X 3HFRA 2UYOA 4QDUA 4W5JA 4ZEWA 3NDBB 2DQKA 3D8RA 3WKEA 4IJ6A 2O7VA 3L7BA 2CFOA 2Y6UA 3LY5A 4R2WA 1CUDA 4Z4QA 1NN1A 1WWKA 5EIAA 5SV2A 3RRFA 1A4XA 3D6FA 1KKMA 4N9QA 2C99A 4XYEA 1Z8HA 9MHTA 2PGAA 4WE3A 4E1AA 3U4CA 2GESA 4R5MA 1HL7A 1Z5OA 1F3OA 4JUCA 4ZKEA 3PPIA 3PSHA 5A7HA 3QXSA 1NG1A 3O73A 2I5PO 4BKQA 2HOQA 4Z2AA 4F86A 3NTXA 2PLFA 1BA3A 4PSCA 2QV7A 4HSGA 4EYEA 2QVLA 4XLZA 4TUYB 3QHQA 4AJ4A 4HB2A 3A1CA 2NU9B 2XCSB 2JLVA 1LBTA 5FP0A 1OU0A 3H9QA 5K0TA 3PV0A 4GEKA 1NXVA 4P4SB 5HK9A 1U3VA 4ZANA 4ND3A 5LZ7A 1CX9B 1Q50A 5EP2A 4BNJA 1PUJA 3EULA 4HATA 4RKRA 1QS0B 3VKVA 3EVZA 4EG1A 2V3CC 1I13A 2DVMA 1ZRSA 3LM8A 5J2TA 1ZO8A 1JP7A 1MC8A 2VDRB 5EE0A 1MH1A 1C0PA 2RC6A 4YUVA 3VNQA 3ZWOA 3GLQA 4P3OA 1DKRA 5IRCD 1E9VA 1XRRA 3ND6A 3QKIA 4MV7A 2RC5A 3E4CA 3T7DA 4EEZA 2Z98A 1JDVA 1KEKA 3D0QA 2WWRA 4P4UA 5AKGA 2ZJZA 1CTQA 4IO1A 5KHAA 1UH5A 3QNWA 3H5NA 1ZR4A 5DRTA 4AW9A 1ECJA 1KS9A 2VDOB 1OIVA 4XLTA 3ZV5A 3OEED 5CCBA 3G8AA 3AERA 4ECAA 2CCJA 4MEJA 2PE5A 4EA8A 2ECFA 1Z29A 4CCYB 3NUGA 4BFCA 1E1QA 3PL1A 3RFXA 1J9EA 2GM9A 5E9JA 4RM3A 2GTIA 3GAFA 3EZ2A 4MJ7A 1U94A 2PMFA 3FBTA 1MHPA 1IPEA 1Y1SA 3E3MA 3K9WA 2PLAA 4N3BA 5TSDA 4PN7A 3MWKA 4K0KB 2Z2KA 3BGWA 3D81A 3QUTA 2WWVD 2W00A 3H5RA 1DXOA 3K9HA 3INGA 1YDGA 4R2XA 4ZAGA 1G5IA 4ER5A 3ZDBA 3WJAA 4OHVA 5K6AC 4B3FX 3UMSA 1QH9A 1NI4A 4Q6WA 2XRZA 2FEXA 2Q4EA 1Y81A 2FPUA 3TDMA 3V2GA 3MUOA 1XR3A 3OF5A 2Q1XA 3M2TA 5DYTA 2IY7A 2HH9A 3QX3A 1PZNA 4G1FA 3X1WA 1UQUA 1SVLA 3PEFA 1MEJA 3KWFA 3UJ8A 4KX5A 2CVQA 3QTBA 5GJBA 3VHRA 3R3ZA 4LY0A 4E0BA 5BSHA 1MT0A 4TS9A 3T3NA 5LKRA 1C3JA 4H4CA 1KJQA 2AYYA 2QTAA 3LS2A 4QUJA 3TVDA 3NX4A 2AOXA 3GPDG 3OUUA 5EJAA 4OYRA 1JDUA 2QQGA 1A95A 2YY6A 2G9VA 1IUKA 2PXAA 4L0QA 4LBZA 2AOWA 4LGYA 2PPVA 2QG6A 2WPDA 1SFRA 4L5YA 2ZI3A 2ID8A 4DLPA 3IIMA 4FGKA 2EP7A 3RFVA 3USCS 3OE5A 3DLAA 4WEQA 1YVEI 1TCCA 2XEXA 4BB6A 1UKEA 3DE0X 5BUSA 5HS4A 1NHGA 5ALLA 4DMMA 5JRJA 2VNIA 1MG0A 1N1MA 4PZ9A 2F3RA 3QVMA 3NRBA 1X7YA 3S2GA 5FOQA 4JI1B 4KXLA 3LUKA 2BAGA 2P9GA 3ZZ0A 1TIPA 3G1UA 3HLKA 4LCEA 3KSMA 5B2ZA 1ENOA 3CMMA 4TMFA 2VTBB 5PGMA 3SX4A 2Z2ZA 3U7JA 1GZ6A 1NY6A 3EQZA 5EMMA 3CVWA 2BFCB 3LPNA 4YJ2B 5LYJF 1P4HA 1W94A 2RHDA 3UMMA 2JAHA 3EXEA 4B4OA 1NKVA 2RGEA 2Z9CA 3BWDD 1XEFA 5BVHA 4KXNA 1UJCA 2QSUA 1IWOA 2X8WA 3T5MA 1TM7E 3SR4A 1J2JA 1EXWA 1OI4A 2VHEA 4RY9A 5CDFA 1WUYA 1TDJA 4JJAA 5LKAA 1Q0LA 5G1PA 3RVKA 1JWLA 2NUPB 4BQEA 2UAGA 3SVTA 2HJVA 3PI7A 2VNAA 3OC0A 1YKFA 3R24A 3FNGA 2NAFA 1A8QA 4CF4A 2FPLA 3DCJA 3ZUPA 3CX6A 3EG9B 4O4HF 1A9QA 2QLJA 1N3BA 4LJSA 4AECA 1YZLA 1G9TA 1TZCA 1K68A 2AN3A 3MOSA 5F7OA 1A5BB 2O8BB 3PFHA 2TYSB 3P0HA 4MTCA 2PGIA 2R1UA 1Z6AA 2A9RA 4RC9A 2PZBA 3QTTA 3CE6A 1V6AA 3HACA 2QY9A 5LDDC 4FWTA 4D6YA 5FOXA 1LLQA 2EEPA 4U8GA 2CNBA 3OJCA 1QX4A 3IEKA 4QU8A 5DCLA 4ZT6A 4IOMA 2IZ1A 2H11A 1HV8A 4TPKA 4NCKA 1N25A 3SJ7A 4JLDA 1DC6A 4RK1A 4YHHB 2EZ9A 2P35A 2DLDA 1UBSB 4CEHA 1P9NA 3W5BA 3ELDA 4QXAA 5DW3A 3DHVA 1IBMB 3WAJA 1QZUA 4MPTA 2Z3ZA 4DUZB 3LQ2A 4GPEA 2AZTA 2GBLC 1QIMA 1V8ZA 2X8JB 2OUKA 3EGCA 1B0AA 3SZ3A 4PC3A 2O5CA 1E2NA 2E6KA 2ZXEA 3N1UA 1W36D 3W5JA 3DUFA 2FPXA 3QE3A 4PC6A 5KVQA 5LYYA 3CS3A 1NDUA 3QVJA 1BOOA 3QBDA 1QKJA 1JHPA 1RWQA 3EVDA 4MQFA 5JAOA 4L3OA 4ND7A 1QHHB 2LKDA 2A3RA 1A8SA 3TI9A 3FRJA 3TCKA 1PQWA 4TVOA 5HJ5A 4Z4IA 4WZZA 5M3BA 5T57A 2AH5A 3ZIAD 4C03A 3TX6A 2QLFA 4OJMX 5LB4A 2WIGA 3KQVA 3WE7A 6REQA 2NP6A 3ZV3A 1J70A 1XRLA 1LDYA 2C97A 4M8NE 1U98A 3K73O 3GRVA 3MQFA 3URKA 1T9AA 5KJ6A 2FFQA 3RM3A 4E15A 4RX1A 4PYJA 3DSRA 4KMMA 5CT6A 4BS9A 1RAEA 3EJ6A 2IYLD 3BWBA 1WV0A 1WUKS 2XQJA 4OGKA 4URZR 2XA1A 3GGPA 4S3MA 4Y67A 2ZR0A 5JVDF 4Z4FA 2DFKB 4G5HA 3L7OA 2XLCA 5EI5A 2PUGA 4YCLA 4F4JA 1IHDA 2FVYA 2FY8A 2Y0PA 4DM3A 1SA0A 1U0SY 4IXWA 3CRZA 4F6RB 3G2HA 3M4NA 5F77A 1O0SA 1US8A 4FUQA 3DEHA 1E8DA 3CM0A 1SBCA 3S68A 1KR5A 1W4LA 3AI1A 5DTRA 4LZAA 4ZYTA 4DBZA 2YW2A 2WABA 3V7WA 1VHWA 1ZD3A 2NUPA 2Q28A 1BQ4A 1U1FA 3P4YA 2VNJA 1UOQA 4X71A 4F9EA 1JLRA 3E48A 2IGBA 3M5PA 2UYCA 3CCBA 4ATNA 3P20A 3E58A 4OKSA 1KL7A 2OORC 3P9QA 5L4NA 3K20A 1I7QB 3V4PB 2M1XA 4C0BA 4CMCA 1EHCA 1QBGA 4LC9A 4QQRA 3AL0C 1TU0A 4PSKA 1SWVA 3JWGA 4CE6A 5CFMA 2XJ9A 1USKA 3VKHA 3GL9A 3FDIA 2IXFA 4MDYA 4PLVA 4LYYA 5CHYA 2YASA 1Z4IA 4P31A 4UBNA 2A5DA 1R15A 3TQOA 1N2IA 4W5WA 5MDHA 3WGIA 3VI3B 1V1RA 4GS5A 5C1BA 3HP4A 5KYKA 2FPSA 4N7MA 5FWNA 2Z8YA 1QG0A 3GZNA 2OP1A 4RYLA 5I8ZA 2AWNA 3EYWA 1XN1A 2CXTA 4PLPA 1YR8A 3LX4A 2I2DA 4QWWA 3GD5A 3RODA 3VVLA 4R0MA 5LBUA 4JQOA 5MN4A 1QFYA 1UQRA 2PMCA 2VYFA 4CQJA 5FTWA 3N8KA 2G3YA 2YZNA 3JU3A 4OG2A 4XD7A 1S8FA 1U1CA 4IV5A 1QP0A 1M8GA 1U3WA 1ZJZA 2X14A 3ASYA 3GJZA 1FVOA 3LA6A 4RLSA 3SFZA 1ZD1A 1IPFA 2W2TA 2VR1A 2CUZA 1U2ZA 3DUFB 1DL5A 1DADA 1ZZEA 2VKTA 4NVRA 4UQLA 5IULC 3ZK8A 1NVTA 1VC2A 4G65A 4NYIQ 3WGTA 3FOCA 2Y1FA 3BN3A 3R5KA 1XZPA 1LXCA 5K8TA 4JD5A 1KH3A 3ZDQA 3DTNA 1SBHA 3B51X 1N7JA 2RMKA 3MGAA 3OZGA 4M9ZA 1R50A 3THYB 1XGKA 4HNAB 1OXVA 4U1RA 3QOWA 4EUEA 3NVMB 3QYFA 1FX0A 1YHNA 1Z38A 1AGYA 1M74A 2Y4NA 2ZJOA 3EZYA 3G2QA 3DVLA 2ZG6A 4YT8A 4GWKA 1U8UA 1RAAA 4D9HA 3D3KA 4N54A 3ZV4A 2FDRA 4RZHA 4NMWA 1Z0DA 2O2YA 2IYRA 3E9CA 1YJAA 3EK2A 3TECE 3D2LA 1V5EA 2XTAA 3JQQA 4F6RA 1IN6A 2IS4A 1I30A 1GP2A 2XMPA 1EZ1A 1PDWA 3NUQA 3WJ2A 4FX5A 1AUPA 2C5EA 3I58A 4QQKA 1H85A 3EDYA 3I05A 2X0EA 3NGXA 1CUIA 1IZZA 2QRZA 4BB5A 5ITSA 3H19A 2C83A 3H05A 2D7DA 1VOTA 3IKVA 5HBGA 3PC6A 3BWVA 2PUFA 3MJTA 2Q7DA 3WGKA 1BXGB 1J24A 3DMGA 2P7HA 1TFUA 1X38A 4ER0A 1FUIA 1KR2A 4PLFA 4EUKA 1WB9A 3KSAC 2CL6X 1CR4A 1E9AA 4LGCA 4BATA 2P6PA 1OXKB 4GQAA 5DHAA 2IV7A 1PKXA 4L8FA 3RSLA 1P60A 3K70D 4TYWA 3R23A 4FCWA 5FYDA 2WFMA 2JH9A 4C88A 4E4YA 1A9ZA 2X41A 3REQB 2AB0A 3BFPA 1OLUB 4GOLD 3I6MA 3OEHD 3CLHA 1U3UA 3PDIA 2R25B 1B8VA 1YDWA 2DFDA 3LXRA 2HMWA 3FVTA 2JGDA 3QVVA 1O96B 3PYLA 4NENB 4E12A 1NBEA 1JILA 2BFMA 4UDOA 5KBYA 2GYVA 1VRCA 3M6AA 2OO3A 4TUYA 1AQ6A 2WAOA 2VP2A 4C2BA 2C2BA 3FFBA 3QPUA 2A78A 1NVFA 1R0ZA 4KAXA 3ZCVA 4ZQHA 7AT1A 3QPWA 4RJJA 3H65A 3E61A 4G5FA 4QHTA 4WADA 2QS9A 4HDMA 4WZBB 2ZCJA 2HCFA 2XUJA 2W58A 2NUAA 2ZUSA 2FSHA 1EE9A 3G6WA 3LUJA 3WNZA 2X0IA 3CZ9A 4R68A 4R8MA 1SUCA 4MI1A 4NBLA 2CV2A 2G0TA 2GNOA 4F8EA 1XN4A 2C4HA 3MTIA 4GHWA 5HUJA 1VDMA 4UJ3A 4F5ZA 3WKBA 1MXFA 4YP7A 3KB1A 3PR1A 1KDVA 1E2KA 1GU1A 4GMDA 3J81k 4J0JA 2F1JA 1WLYA 1BRMA 2GM4A 2ECOA 3AL2A 2JIMA 4E22A 5FPTA 1LPMA 2Q3HA 2A5FA 2YFQA 1TJPB 1C8VB 4A0QA 5HJ7A 1WUTA 2R5WA 2VBGA 3EZFA 3UHOA 5I4CA 3ONVA 5D3KA 4ND2A 4D46A 5BMVB 1MO5A 1RP7A 4BPBA 4RA6B 2HO5A 3DONA 5B7PA 1UBEA 2H65A 4P4LA 3MLEA 1EFTA 4FJ2A 4W7SA 4XWGA 2OWEA 4OU5A 1T43A 3FHJA 4EDFA 2FEMA 3T5CA 5K0EA 4NCAA 4ZGBA 4NBNA 2DWPA 5AH0A 1VB3A 1TVMA 4JGIA 4W1PA 5LYJA 1Q0TA 1YDFA 2HJWA 3CWCA 4GKJB 1J1ZA 3C3WA 3GEGA 3PQFA 5B3JA 5EJEA 5CM8B 1KTIA 2X23A 1KTVA 4BNNA 1N77A 1LSOA 1GA4A 5KJEA 1KI3A 4LV8B 1J0DA 5AHWA 1Q20A 3GV0A 3WKDA 5A6SA 3LFUA 3EISA 3IERA 1GPKA 4FDMA 4UM9D 3OPVA 4YRTA 5FUXA 2C0PA 1FPQA 2FV8A 4BLUA 3VNUA 5HXAA 3CSDA 4OUDB 4FFDA 5F5NA 1MAAA 1NW6A 4IX9A 2WVGA 5CTAA 4A0GA 1QVAA 3ZK7A 1NM5A 2IYWA 3TM4A 4MVWA 5IPFA 2XDWA 3M49A 4P08A 4B7ZA 5IJ0B 4P1ZA 1RWOA 3ETNA 2TS1A 2ZRAA 3GCWA 1VI6A 2ZVQX 1FNBA 4TL6A 3VMMA 4AXXA 1WKCA 5BW6B 2VLBA 5K0GA 1Q3KA 3JV7A 3RR2A 3TOZA 1M0WA 2SKEA 3K2BA 5KOJB 5KX5B 4MGEA 2QTLA 4AUKA 1WSWA 4QQ8A 4BVEA 1ESCA 1G4AE 3RQSA 4X3PA 1RPTA 1U7HA 1KJNA 1L5FA 5AW3A 4AWXA 3NP9A 5EVCA 1EFKA 1SVUA 4TYYA 2W93A 4JOSA 3S29A 1ZK0A 3FYTA 2Q7XA 3D3NA 4DT1A 2OILA 1EB8A 1BHO1 1A8PA 3LQYA 1OFUX 1KQPA 3D6AA 3VGJA 3G7UA 4BWGA 2AMJA 1HT3A 2I6SA 3O4HA 2HJHA 5DBIA 2D7CA 4MZXA 4MZDA 3HB7A 1X1DA 5FJIA 4GRIA 4B3XA 3TD6A 1E4OA 1ZIPA 2DRIA 1QK3A 2OLKA 1KU0A 2WIJA 2VZEA 5CGZA 4YRRA 1CY2A 1UMCB 3HN7A 4UTZA 3ZZMA 4AL4A 1Q84A 4ZEMA 3WWPA 3TKAA 3BB3A 5E3HA 2GVNA 3Q41A 3VVCA 3SDBA 3KJNA 1P9RA 1C9JA 3VYUB 3GF4A 4KH1A 4MEBA 4J1QA 4MRSA 3TAXA 3ZKWB 1G64A 3RB8A 2DKNA 5CURA 2XUKA 1H5UA 4FMPA 3WSWA 1RXWA 3UH0A 1IATA 3GVCA 3LDGA 2J3JA 1DMSA 4I2NA 4BNLA 4ZDIA 4EFLA 5FBVB 3WGHA 2Z2JA 1S4MA 3VSBA 3LNTA 4ZK2A 2XIJA 1Q0HA 4R8RA 3ZD7A 1T2NA 5CLQA 2AXNA 2VDQB 1NRXA 2WTMA 3VKUA 2EQAA 1Y42X 3Q3VA 4RFSB 2O8FB 1VBFA 2OHIA 2REOA 3AR8A 3LC1O 4H77A 4C29A 1SXGA 1FJGB 5HMMA 1E1RD 3G7SA 2Y1XA 4CM3A 2GN6A 2VTBA 5JROA 2HLNA 3VPBA 1G6HA 2CV0A 2WUDA 1T91A 3RFCA 3MPOA 4KQ6A 3T3GA 4CODB 1VJGA 5E1MA 1T0HB 3IUSA 3OCJA 1T3ZA 3F8WA 3ZU6A 1O94D 2IYVA 2I2AA 4M9CA 4H6XA 1XNHA 1RBZA 1T3SA 2YHBA 4R41A 4RZQA 1OA0A 3MT7A 3PEVA 2W2QA 5E2BA 3UG6A 3PQCA 4C7XA 1GTG1 4GGPA 3RFUA 3P9XA 4TTTS 2Y67A 3H17A 4RHUA 4TWJA 4DM4A 5F3RA 1IZ8A 4B2PA 5AM0A 5F4ZA 3QFRA 4ENRA 4CIBA 1R8QA 3OPQA 1UXGA 2D3WA 2JJ1A 2JIDA 3K05A 1PQYA 3PJGA 3ACCA 2X0FA 4TXHA 3GLRA 5EPUA 4ERNA 2BRUA 4ZZ0A 1YZKA 2GLXA 4PZZA 1Q1AA 1AMOA 4AXBA 4WESB 5L3QB 2H4FA 1JDJA 1I9GA 3NVKI 4RTKA 1X8XA 1CUXA 1Z5ZA 2CN1A 2GAFA 2PWAA 3L1JA 3OO1A 3P0JA 4FS3A 2PD6A 1FXWA 2IOHA 4KIFA 3K8QA 3OIYA 1G1MA 3SE7A 2AEFA 1VBNA 3LY9A 3L6OO 1CCWA 2VJQA 5FULA 5IC6A 3PGJA 5I7AA 1UBFA 4GXTA 5J4YA 1JG6A 3ITKA 3O90A 3AU9A 8ATCA 5KX5F 2VBCA 4JVMA 1SU8A 2RI1A 2VDLB 3H5IA 1U8ZA 4FYYA 4MPDA 5AVRA 3B1KA 3OMWA 1Z4OA 3N0TA 5EMJA 2OK8A 1Z47A 3LSTA 4EHNA 1BH2A 2OSBA 5AOVA 2Z2YA 4CV1A 2UUBB 4TV8A 2R79A 2JGJA 3DAOA 2GZDA 1T2UA 3CRQA 1GGNA 3V8EA 4AK9A 4ESEA 4TYMA 4URXR 3VH2A 2WIKA 4HZIA 1RRKA 1T24A 3LL4A 4J76A 4Z6KA 3UCFA 1GR1A 1WVMA 1XMSA 1RXYA 1DC8A 1FS6A 1TO6A 1VPTA 3RREA 4B81A 3L7KA 5BSEA 1ONNA 4DOMA 1B6RA 1B8PA 1JEEA 5AJXA 4QBFA 1AN9A 5EZYA 3ADOA 4GWLA 1SURA 4L4YA 3KALA 2YZMA 4RABA 1CBUA 1FUYB 4HWKA 4GR5A 1TA4A 2D1QA 1YIAA 2QLMA 3DPSA 4FGSA 4I55A 1GN9A 3V48A 2CK3A 2CB9A 1YS7A 1HQDA 1O9BA 1ETHA 4U5XA 5FAXA 1O1YA 1TM2A 2SCUB 4KLNA 5BSUA 5CFNA 4YT4A 2ZVPX 4G5SA 4TMYA 4YMHA 2QMYA 3W3ZB 5GP1A 3C8MA 4RAQA 1XDGA 4ABYA 1ZSYA 3MTBA 5JJKA 5B57C 2LE0A 2WJJA 4YCDA 4L76A 4YREA 4HQKA 1EAYA 1E1NA 2X8AA 3FXAA 4IJUA 4KZPA 5T67A 2HXSA 4UU7A 1U3TA 1V96A 2H1VA 3GZNB 3A1WA 4IQFA 4V3CA 3L4BC 5EGSA 3TUJC 3U48A 1XLVA 2J9FB 1P7CA 5K8JB 1EUDA 5TNXA 1GNRA 4PPNA 3ZE7A 3FOZA 5JBIA 1QRAA 3UK7A 1JMVA 1HE4A 4KAJA 3X1YA 2WWFA 3GY0A 1NYQA 2BONA 2QHXA 5B1IA 1U7UA 4WJZA 4D4JA 2BWJA 4ZYLA 1H2EA 1E1YA 1Z37A 4BLTA 2EW1A 4B3BA 4BAZA 1AF4A 3DB2A 4F71A 3MGBA 4OUKX 2YOHA 3LVQE 5GM1A 1EG2A 2OAGA 2VJAA 5GM2A 3VZQA 3DYBA 5JASA 2HD4A 1K8YB 1KIFA 3C7KA 1QANA 3DAYA 1X9HA 1YI0A 3ABRB 1ZNQO 3IHWA 4LJ6A 4MKXA 3OECA 5EQTA 5HMLA 3ZW8A 1WU8A 1PK8A 4HNAA 3ZHUA 4IQ4A 3IEMA 3VR2A 3U40A 4YMIA 5CX4A 1KGDA 1RQGA 4Z0PA 1J97A 2GDJA 1FMCA 2X7HA 2VWQA 5CAEB 4CKBB 5BNTA 1U3DA 5D3MB 4FSHA 5BN3A 1VCHA 3OEEA 5F73A 5JI3E 5JJCA 4KQWA 5HGJA 3I6QA 5FQOA 3HR4A 2YS7A 4PTYA 2XXAB 3EIWA 3OZEA 5IF3A 4HGOA 2FW9A 2YV2A 1J8YF 3UUFA 3HQ4O 3LF1A 3HBMA 5EHXA 1HZZA 2B8EA 5EJIA 2P6RA 1BXRB 3G8BA 4TZ6A 2FPKA 4BP1A 4DIOA 3DOCA 3B9RA 4AJ9A 2FWNA 3E9NA 1VYUA 3CLVA 4LY9A 4YMGA 2RGCA 3JWIA 3I9LA 1HRKA 2ZB7A 3AFOA 2P9JA 2C9BA 2V7XA 4WOBA 1SUSA 1VMAA 1RQNA 2RI0A 2XLBA 4JKOA 3SIXA 5DNUA 1HDCA 3L0YA 1E59A 2X8BA 2B82A 4HDOB 4WKOA 3WGZA 2XCRB 1OE0A 3HKBB 1F4PA 4UARA 4B34A 4NNOA 3ZVRA 3BIWA 2XR1A 4GVLA 2QJTA 1B2LA 2F1IA 4QO8A 4OHMA 4W82A 5KTSA 3COPA 4RJKA 1PGPA 3PE3A 3CGGA 4YYZA 3C1UA 3DFIA 3LYAA 2G80A 3M3HA 2VP4A 5K0FA 4QIHA 1C2YA 1FP2A 1S1MA 1T9ZA 1CQJA 3QUBA 4O2AB 3A2KA 2FZ5A 2ADMA 4HQ6A 1CY7A 2Y76A 4C4AA 5FWAA 3O6VA 3K0FB 1WE2A 1YZ3A 3H99A 4YJ2F 1QRRA 4J2TA 1T2EA 5J1SB 1KI2A 1QB7A 4EO7A 1NIJA 2O05A 3MERA 2P4SA 4NY1A 4UE6A 1M75A 1AT1A 1NF9A 1I2DA 2PGXA 3MAJA 1JHMA 1X14A 2AW3A 4NHEA 4E1VA 1OZ0A 5CA1F 5C2JB 1QBKC 3RSCA 2CT8A 3H9UA 1A9YA 5IUKC 1OX5A 3HA7A 3OBIA 4MPJA 1BDIA 3D1VA 1C1XA 1BNCA 3LUHA 3QFTA 4M49A 4YWHA 4ALMA 4D9KA 1VB5A 2VPPA 3GZTB 3HPRA 3W5SA 4EPRA 3FKSD 1BX3A 2FMFA 1XHLA 3P4XA 1AZTA 1AGRA 1TCAA 1B00A 5AW0A 5FXMA 4F97A 4LE2A 5EUCA 3D31A 4LYFA 3KLNA 3TJMA 3GR6A 3AIMA 5BRAA 4OQNA 5ELXA 3BWCA 2OBLA 2QD1A 2ZBVA 3PXEA 2RGUA 3LBNA 4KFTA 1H2HA 1QIJA 3FMFA 1FX1A 1NPDA 3EIQA 2ID9A 4DJDC 5DLPA 4K6KA 3GLUA 1GADO 4PS0A 3V55A 3OZAA 5A1JA 1ZZGA 1GY8A 3AHJA 1OTHA 4Z9YA 5IS2A 4OGFA 1HTBA 1I0IA 5D5QA 4FJ1A 3VTKA 4DG9A 4DUPA 3GFSA 3UO8B 2FSIA 3U9LA 4MCIA 1MAVA 1F12A 4GWGA 4LEIA 5BORA 1TK3A 1UFRA 4NZOA 2XGJA 3U3ZA 5KQSA 3LKDA 1N9GB 1LPBB 3MCZA 6YASA 3HUUA 1KP2A 1CV2A 1AQJA 2NO0A 2MWMA 1LQTA 2D1TA 3R5TA 4PHHA 4XIYA 4BV3A 4YJ2A 2ZAMA 4KLAA 3CX8A 4U2DA 4UCXA 3PS9A 2NO9A 2RH8A 2VPIA 2FLKA 2HK9A 3CXRA 5HM6A 1BS2A 1XJWA 3QF7A 1HA3A 4OUDA 2BGGA 1OLSA 4YDQA 4K5QA 3QQPA 4U6SA 3MZ0A 3SM3A 3E82A 3TDKA 3ZWNA