3T4UA

L29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWILDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, hydrloase
molecule keywords Arylesterase
publication title L29I Mutation in an Aryl Esterase from Pseudomonas fluorescens Leads to Unique Peptide Flip and Increased Activity
rcsb
source organism Pseudomonas fluorescens
total genus 103
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t4uA00
3G9XA 1K6EA 3VJKA 1K4YA 2WUFA 2QRUA 3DKRA 4J03A 1QO9A 2Y2UA 2OGZA 1XZJA 2GYUA 5AI5A 4KRYA 2JEYA 2IIVA 1K63A 2XT0A 2Z3WA 5SYMA 1YR2A 2Q0XA 1ZGBA 1FFEA 3ANTA 3IA2A 1SC9A 5EHZA 5CT5A 5ALZA 3D0KA 5D3ZA 4DNQA 4X7BA 3I6MA 3DNMA 3VJLA 2I78A 1WPRA 1AURA 4M0EA 2CKMA 4QDTA 3B12A 1P0IA 3N2ZB 3C6ZA 2JGFA 1UZAA 4MQLA 3W9BA 1UKAA 2XUDA 4EBBA 3D3NA 3WZMA 4DMCA 3SWWA 1G4HA 4UHDA 1LGYA 4U2BA 4X94A 1E89A 2BUAA 4DSZA 1XQYA 1VA5A 4C4ZA 2WFLA 3RARA 3A2NA 3W05A 4BDSA 4GI1A 1XZLA 7YASA 3WJ2A 3ZPXA 4BB0A 4CCYA 4N5HX 3DCNA 5D3KA 3NWOA 2CMFA 3WIBA 4HS9A 1CUUA 3DL7A 2HA2A 4OUKX 3STTA 5JYCA 3ZLTA 4P93A 3WZLA 4MEAA 5JAUA 1W6RA 5ALFA 5JD5A 2XMQA 4UBLA 1LPAB 2WHRA 2XMSA 5ALVA 1W75A 1XRLA 1BRTA 3QMMA 1W76A 2XQFA 2WG2A 2ZSIA 4G8DA 4N5IX 4Q82A 4ZV7A 1JJFA 5AM3A 3S2ZA 2DQYA 4HXGA 3OC0A 1EX9A 2PSDA 1QTIA 1CUVA 3WL6A 3WKAA 4FFVA 3V1KA 5E2IA 1EA5A 4LXGA 1C7JA 1LBTA 1CUZA 5AKHA 2ZSHA 4MYSA 4C88A 3G9UA 2XUJA 2XMRA 1UOPA 5I7UA 1XZGA 4FNMA 4M0MA 2AXEA 4BBZA 4DYHA 4B81A 3I2KA 1O6FA 3C8HA 3A6ZA 1VXRA 1HPLA 1C4XA 2QUBA 4K5QA 1CQWA 3M81A 4A23A 2XMZA 5BWBA 3CCBA 2ONCA 5HCUA 1L7RA 2C0QA 5FRDA 4NMWA 5AIBA 3KWFA 1XRQA 4GXNA 4KACA 2O7RA 1XQWA 3AILA 1XROA 4DLNA 2WLSA 2XMGA 4YK7A 4F60A 4X93A 3H0CA 1MN6A 5LKAA 2XUGA 5E4TA 5AHXA 3WK9A 2VT7A 1USWA 1HBJA 2HFKA 5E4JA 2WIKA 3TEJA 2IITA 3QBJA 1TAHA 1UT6A 4OPMA 4A16A 2PU7A 2PM8A 5C8XA 4FOLA 1CUDA 1ORWA 2G5PA 1Y7IA 4QDOA 3D5EA 2ZVDA 4ITVA 1U8EA 3EIOA 1YCDA 1UOQA 2VA9A 2RONA 4J0JA 4N8DA 1FJ2A 2WIGA 2QZPA 3O4IA 2HDWA 4NZZA 1UK6A 3FLBA 3IVMA 4PNZA 5FOQA 2VF2A 4Y2JA 2QT9A 5AIAA 3D2AA 4EY4A 5A2GA 3STVA 1LPSA 3BWXA 5LKRA 4G9EA 3F8SA 3CXUA 4I3FA 2UZ0A 5D6OA 3P2MA 2ACKA 3AZQA 4HXEB 3IUMA 4C01A 3FCYA 4Y9SA 1A7UA 1MNAA 1Q0RA 4WCVA 1P0MA 4IH4A 1CEXA 4UUQA 5K3FA 5IVDA 2B61A 2JF0A 4U2FA 1CV2A 4BRSA 5DTIA 3E1GA 3IUJA 1AZWA 3F96A 4A5SA 2C4HA 4W1SA 1PJAA 1W52X 5K3AA 2HU5A 5LP1A 3A70A 5LZ4A 2XQKA 5AKLA 1QO7A 4X95A 4H77A 1GPKA 4TGLA 1E8DA 2WUDA 1DT5A 2DR0A 5BWCA 2W22A 5LYYA 5AKJA 2VSQA 4QE3A 4UBJA 3AIOA 4IH1A 5ALHA 2H7YA 1IZ8A 5AICA 5AOAA 3ESCA 1XKTA 2P8SA 3O9MA 4EZIA 1GQRA 4FWBA 1XZEA 2RGUA 5AM0A 5C7YA 3ZLUA 4HZGA 1G42A 4XVCA 3I2IA 2DCMA 3QPDA 1FFCA 3KWJA 4RE6A 4WDQA 4EY5A 3ED1A 1CUJA 3AINA 1ORVA 1CUHA 4FMPA 1ZI6A 2XUHA 5IVKA 4CG2A 4Y7DA 1AKNA 3K2IA 2VEOA 3DDUA 4KE8A 1S8OA 4YPVA 5AP9A 4RGYA 1ETHA 4ZREA 4QZVA 5EIEA 2LIPA 4GW3A 3RK4A 1BCRA 2QVBA 3I6YA 2QMQA 1R4ZA 2I03A 3FYUB 5T4EA 3BXPA 1QIJA 1CQZA 5AK3A 2VTVA 4Q3LA 4QDZA 2Z8XA 1R88A 4HAIA 3CN7A 4OB6A 3FLEA 4PW0A 2Y6VA 4H7HA 5LZ2A 5T4BA 4BVJA 1UXOA 3O4JA 5A6VA 2WQZA 1QGED 2WG0A 4IH9A 4G9GA 5HK9A 3G8YA 1F0PA 5AH0A 3IDAA 1AGYA 1DWOA 4KRXA 4X6XA 4DMFA 4AX4A 4BE9A 2Z3ZA 4FKBA 5F4ZA 1JU4A 4B0PA 1DU4A 5EHNA 3QZUA 4UPDA 4B85A 5ALEA 4PSCA 2JGKA 4X71A 4LYEA 3IUNA 3STUA 3EBLA 1VZ3A 2RHTA 1ISPA 3O4HA 2HU7A 4WFIA 4E14A 1GKKA 4AMZA 4HTAA 1XLWA 4JYPA 4KJXA 5ALNA 4DGQA 1XFDA 3X3HA 3F9CA 1BU8A 5A7FA 2PL5A 4B83A 3H2KA 1BROA 5T4HA 4BATA 3VXKA 4BZZA 4HRXA 4MXDA 1EVQA 1YB7A 1SOMA 3DEAA 2Y1KA 2HA3A 3C8DA 5CT6A 2ZJ7A 1Y7HA 3H1AA 3HLKA 5DLPA 4GEGA 3H2GA 3BL8A 2HM7A 1NU8A 3I1IA 5AKKA 3NGMA 5HF8A 3CCCA 3PF9A 3AZPA 1GZ7A 3MGAA 3JYHA 3QYJA 5ALKA 4N8SA 4PQEA 1CFJA 4LXHA 3L1IA 5ALWA 4KAFA 2BFNA 5BOVA 1ACJA 1YB6A 3NOXA 2WKWA 5JD6A 4PO3X 1JU3A 2VJAA 2XUKA 5CMLA 1WM1A 5EFZA 5FUMA 1QIIA 4QNNA 1CIJA 1ZIYA 1TRHA 3TGLA 1E5TA 1N5MA 5LIPA 1K8QA 3WA7A 4EB0A 1SCIA 3HEAA 3MUOA 1NU6A 5CBKA 4X6YA 2ZYIA 2WFZA 2WUEA 4UBIA 3I2JA 4C4XA 1BE0A 2X8BA 3D59A 4Q34A 2O2HA 1CUFA 2XQIA 3G02A 2Y6UA 2HIHA 5AKIA 3WKBA 4U2EA 5ALDA 4E15A 1ZD3A 3HI4A 3WYDA 3WKDA 2HRQA 2JGIA 4J0HA 1YAJA 2C5FA 4GDMA 2VAXA 3WWEA 2XQJA 1MAHA 3PFBA 4UBOA 3WK7A 1AUOA 1DX6A 5AK5A 5IH7A 1AMNA 2YYSA 1XZFA 4C87A 1DQYA 5ALTA 5HF5A 4AZ0A 3AIMA 1RP1A 1U65A 1BN6A 4FDMA 4FLMA 4V2IA 5ALGA 3BIWA 1GKLA 3HRHA 3V48A 3WIOA 4ETWA 1DTEA 1TCBA 5T4FA 1QFMA 2W6CX 2ES4A 1EK2A 1WB5A 1CUYA 4DTCA 2WJ3A 4X91A 3AJAA 4RNCA 2BCEA 5K3DA 5AI4A 4X00A 1DQZA 3WMRA 4H0CA 4ZGBA 4AN0A 3WL7A 1W1IA 3FYUA 1THTA 2RAUA 4DNFA 3DYVA 4OU5A 2JBWA 5EGNA 5SYNA 4E11A 4HVTA 2IX9A 4G8BA 2PSFA 4K2AA 4XX1A 3KDAA 1QONA 4OSEA 4DSAA 3PUIA 5AI9A 4IHAA 4KR0A 2AJCA 2X76A 3QVMA 3ILSA 2WHQA 5AI6A 4MWSA 3D4LA 1QLWA 1U4NA 3FWHA 1B41A 4CG3A 2QR5A 4B0OA 4BCDA 5AM4A 4C6HA 1JFRA 1CUCA 1YS2X 2OGTA 3H2HA 2G5TA 3QMWA 3HXKA 4JNCA 2ORYA 5LLSA 1Q83A 1CUWA 4JH0A 5ALQA 1UK7A 1QIMA 5KWJA 1MX1A 4AXBA 2PSEA 1YS1X 1ZGCA 1HLGA 2VJCA 4J0CA 3PDCA 4BP8A 1ZI8A 3I28A 2J3DA 4Y2RA 3PUHA 4FNGA 2VJBA 1HKHA 1UKBA 5FPQA 1IZ7A 4TPKA 2DHCA 3E4DA 1QIDA 2PVSA 3H2IA 4H7FA 3HYSA 2JGLA 3WL8A 4GWLA 3R41A 4Y2SA 4UHCA 3PFCA 4Q05A 3FSGA 2G4LA 2HA0A 5CXUA 1TK3A 3V1NA 3T52A 5DYTA 4BTLA 1YA4A 2FX5A 1BN7A 2BAGA 4LHEA 4EY6A 3QM1A 5FLKA 5C8ZA 2Z5GA 2GYVA 2PSHA 5H3HA 1QTRA 4P08A 5AO9A 2GBIA 3WWPA 4D9JA 4DMHA 3WKCA 3I2FA 4Y2QA 4J3JA 1XRNA 2AJLI 2OAEA 4Y2XA 3HC7A 4G5XA 3WA6A 1R9MA 1UWCA 3IBTA 4CIBA 4ZRDA 2Z8ZA 1LPOA 4IQ4A 4FBLA 1XZBA 4X97A 5FPPA 3PF8A 3W04A 4L9AA 4FTWA 5JD4A 4AZ3A 3ICWA 3C6YA 4F0JA 2XQGA 1ZD5A 5A62A 3AUKA 4EY7A 3GZJA 5AK4A 2WG1A 3QH4A 1AC5A 4FLFA 5AOCA 4BP9A 3LIIA 1T4MA 4UFPA 3R3UA 3BJMA 4O08A 3O9VA 3FSGD 2EDCA 1OXMA 1JJIA 2DHDA 2VATA 4X6UA 2B4KA 1YAHA 4B84A 2BUBA 5AOBA 4CFSA 3WWDA 2XB6A 4W1RA 3WK5A 1XRMA 1ZJ4A 4ZI5A 1VE6A 5JALA 3IULA 3AIKA 1EVEA 2XMBA 1TIBA 1XQXA 4ZWNA 3A2MA 2WJ6A 3STXA 3OOSA 3WK8A 3FBWA 4UBKA 2E3JA 4PSUA 4P92A 1FFBA 3BE8A 3DQZA 4ARAA 1CUSA 3OPMA 4QDUA 3RLIA 1XZKA 3AZOA 5JANA 3C5VA 4F5ZA 2H7XA 3C45A 1L7AA 1A8UA 2G63A 4BRZA 1AX9A 1YASA 4HXFB 3WLAA 3MUNA 5AM2A 4WFJA 4L72A 4QDXA 4ZXFA 1GGVA 4LXIA 2XLBA 1JI3A 2AJDA 4WJLA 4J0IA 3ZV7A 1CUBA 4CCWA 4UHEA 1EB9A 4WY5A 3DD5A 3FOBA 4OYLA 2XDWA 3WWOA 4KE7A 4MWTA 4XIIA 2GZSA 2ZJ6A 2XUAA 5AKEA 4KE9A 1QIHA 3QMVA 4GBGA 1H22A 1PFQA 3E3AA 3EF3A 1KEZA 3SC2A 1EK1A 5ESRA 1VE7A 3M3DA 1WCYA 5KBYA 1LPBB 2PU5A 3OG9A 2HADA 3H19A 3C43A 4B6GA 5ALRA 1WOMA 1IUPA 2WIJA 4M0FA 4FLEA 3DOIA 1TKRA 1ODTC 3R3XA 2CBGA 4ZV9A 3F98A 1XZAA 3W2TA 3KOOA 2H9YA 1H2WA 5C8VA 5A71A 1F0NA 2BGNA 2WFMA 5DWDA 3Q0TA 1G5FA 1XZHA 2OGSA 5ALPA 3R3ZA 5DYWA 4U2CA 1ZI9A 2PUJA 4RE5A 3R40A 4H7DA 1KU0A 2WTMA 3GBSA 3H1BA 2GBFA 1GPLA 1Q0ZA 5EHXA 4MEBA 2H1IA 2OPHA 2HRRA 2RIPA 4B9AA 3LIPA 2AJ8A 5KREA 1EB8A 1EDBA 2XE4A 3EQ7A 5AJHA 2WM2A 4FBMA 2HA6A 1RYYA 2C7BA 1LPMA 3HSSA 1PV1A 3G9ZA 1I6WA 1MJ5A 5JADA 2D0DA 5ALMA 3DOHA 1LNSA 5JARA 1YA8A 3BDIA 3H2JA 3VKFA 2XUOA 2QTBA 3GUUA 5EIAA 1JMKC 2I3DA 2JGEA 1GXSA 2XUPA 1BCSA 3WKEA 4BYMA 4Y2PA 3FVTA 3O95A 2VQ6A 2WHPB 5YASA 2GYWA 1GPNA 1MX5A 1UFOA 2DSNA 3CN9A 1MTZA 5DNVA 4QEKA 4LIPD 2EDAA 1QE3A 4Y2UA 5CH8A 6YASA 1LZKA 5HK8A 1LBSA 4W9RA 1QIFA 5JZBA 5D7BA 2FJ0A 1EDEA 4AQDA 5ISMA 2HA4A 4NVRA 3UUFA 5ALUA 1SCQA 2OCGA 3PI6A 4ARBA 5AK6A 2QOEA 1QFSA 4QLOA 1GT6A 4OB7A 4CIAA 4B9EA 4CI9A 3VDXA 3G0IA 2QM0A 3IB3A 5ALJA 4HRYA 4QWWA 1EXWA 5K3EA 2V98A 5DJ5A 5JAOA 4QA9A 1MAAA 2XUIA 3L1JA 3I6ZA 2VT6A 4Q3KA 1ZJ5A 1CUIA 3WL5A 4UFNA 5CH3A 5JAPA 3SK0A 5FKJA 4BVLA 4MQMA 4BVKA 1QIGA 5CRIA 1CVLA 3WWCA 4PV7A 4G1FA 1NX9A 5ALSA 3LCRA 3M82A 2K2QB 5JATA 4K6GA 5IVHA 1HL7A 2GZRA 3D2BA 1FFAA 2BJHA 4LKOA 3V1MA 1QIEA 3FYUC 4BE4A 2R11A 2QJWA 1BEEA 1T2NA 1JJBA 2B9VA 1CUGA 5IKXA 3U1TA 5HFNA 4UFOA 1UK9A 3C6XA 3ZLVA 1G66A 4OCZA 1N1MA 1R3DA 5FV4A 1F8UA 2HFJA 2J4CA 2YXPX 2J4FA 2ROQA 3WI7A 3K9BA 3HZOA 1ZICA 1WPXA 1JT2A 4H18A 4JYMA 5HZGA 2WSLA 3DL4A 3N0TA 3Q8WA 5I9IA 3ESBA 4X3CA 5HQ3B 1SCKA 5K3FB 3E0XA 3ANSA 4JEIA 2DQZA 1LPPA 2XMDA 3R3VA 2CUTA 4DNOA 1EH5A 2HU8A 3RKSA 1E66A 4I19A 3LLCA 3BIXA 2OCKA 3NUZA 5AM5A 3K6KA 2QXUA 1EHYA 1H2YA 3B3QA 1N5RA 3GELA 1ZD4A 4AO8A 3SX4A 4LYDA 1XRRA 2HA7A 5AM1A 3H04A 1XZMA 4X92A 4IO0A 1CUXA 2PBLA 3F67A 3STYA 2QXTA 3U0VA 1EDDA 5ALOA 2XLCA 3OM8A 2PKYX 2RHWA 1VXOA 4Q1VA 1R9NA 1Q84A 5AKZA 2FJPA 2XUQA 4UHFA 3KXPA 5HKBA 1WHSA 4XWGA 3VVMA 2XUFA 1MNQA 4FHZA 5HF6A 3IUQA 4I4CA 3FVRA 3HABA 3PICA 1MU0A 4N8EA 4AN1A 3R0VA 1HDEA 3H17A 2WHPA 2ACEA 4J7AA 1XLVA 3I2GA 4H7EA 4EA6A 4DIUA 1LPNA 2ZYRA 4MJ3A 3D2CA 1L7QA 4UHHA 5CH5A 4J0GA 4OD0A 4X90A 4AB1A 3V9AA 5FDFA 2C0PA 5AKGA 4B7ZA 5CTAA 3G0CA 1CPYA 4DNPA 2V96A 1J06A 3M83A 4QLAA 1X2BA 4OU4A 3G0GA 5IVIA 3H18A 3G7NA 4OB8A 4MYDA 2CB9A 1B6GA 4J0KA 3EQ8A 1UK8A 4BC0A 3W06A 4Y2YA 1IMJA 1DINA 4W63A 1TCCA 1BEZA 2CJPA 1FSSA 3G9TA 2I3ZA 5EI5A 3WJ1A 3FCXA 4OYYA 4KEAA 4PF1A 4INZA 3VJMA 4BZWA 2CZQA 4Z49A 3TJMA 4L3WA 3QITA 5ALYA 1QJ4A 1DT3A 4W1PA 5I8PA 1MT3A 1IUOA 4H7KA 4Q3OA 2OQVA 4UHBA 3AFIA 4W1QA 2ZYSA 3BJRA 4K6HA 2GBCA 1EI9A 3EQ9A 3R3WA 4J0DA 3DYIA 3DKKA 1H23A 5CURA 2DFPA 2OLEA 2QS9A 4ROTA 2PSJA 1R50A 4B80A 4X85A 1K5PA 3W9UA 1CUEA 2C58A 2WIFA 4WY8A 1E8MA 1ZIXA 1WHTA 1QZ3A 1AQLA 1VKHA 3UUEA 4AO7A 3DS8A 3GFFA 3OTQA 2XI4A 1H2ZA 5CT4A 2YASA 4Y2TA 1MO2A 2JEZA 3B5EA 4FFWA 1JKMA 3ESDA 1IUNA 4L0CA 4BDTA 1THGA 3ZWQA 1LLFA 2XMCA 2QJRA 5A7HA 1Y37A 1JMYA 1OCEA 3O0DA 3QPAA 3KD2A 1MX9A 5DTJA 1XRPA 2X5XA 5CXXA 4H7IA 3ESAA 1DWQA 5CT8A 4BCCA 2VJDA 5JAHA 2HL6A 4YX9A 5HQ3A 2C5GA 1VLQA 4GECA 1J1IA 5CT9A 1VJ5A 3FLAA 1FFDA 5A7GA 2FUKA 2WU4A 1DWPA 5HFAA 2B20A 2AJBA 1BS9A 3O4GA 3I1YA 1EINA 3LP5A 4EUSA 1J2EA 2HHAA 3STWA 4C4YA 4WFKA 1D07A 3HACA 3OURA 1XKLA 5DNWA 3JW8A 1N8SA 2DHEA 4G4JA 3UMJA 4H35A 5EIHA 2OCLA 1UOOA 3G0DA 1WB4A 2R8BA 5ALLA 1U2EA 2ZJFA 4S0XA 5ALIA 3KSRA 5AKYA 3QPCA 5JASA 1DX4A 2O7VA 1YSCA 2V9ZA 2WU3A 5FP0A 3WQHA 4BAZA 2O2GA 4U2DA 3C70A 1HQDA 4P9NA 3RM3A 2CEKA 4NS4A 5JIBA 4BAUA 4KYVA 1CLEA 3GA7A 5DYYA 1O6GA 3FYTA 3GROA 1C7IA 3R3YA 3C87A 5BV7A 2WUGA 5E4YA 5KWIA 3FNBA 5AKXA 2WFLB 4BC1A 2OQIA 2Y2VA 2JGJA 3D7RA 1R1DA 2JGMA 1MPXA 3S8YA 2WIDA 1H2XA 2BGRA 2GBGA 1KU6A 3BF8A 4CCYB 5C81A 4EHBA 5CW2A 1XZIA 1J07A 4K6KA 5K3CA 2JIDA 3L1HA 4H7JA 1VA4A 2QUAA 2NW6A 1ODSA 4WDRA 5AI0A 4YASA 4BAGA 4DM7A 1QOZA 1Z68A 2EEPA 2ZYHA 2OXEA 3JWEA 3WK4A 2D5LA 2OG1A 1TCAA 1CUAA 1A8SA 1X70A 4EY8A 2QKYA 5LZ9A 1W4LA 2V97A 3V1LA 1CRLA 2BUCA 5LZ5A 2WILA 4G4IA 3T4UA 3LS2A 5AI8A 2OCIA 4AMYA 1WB6A 2BKLA 4JUIA 2O2IA 3YASA 4KE6A 3C6BA 1CR6A 2H7CA 5LZ7A 4C89A 3WK6A 2HA5A 4BCBA 4AO6A 4TVKA 3FAKA 5EHQA 3HJUA 3I2HA 3VISA 2VAVA 4CG1A 5ALXA 1XZCA 1ZD2P 1OILA 2ECFA 2OAGA 3IIIA 4UBNA 5FXMA 5LZ8A 5JZSA 4G8CA 1ODCA 1XZDA 3ZI7A 4KAJA 1TQHA 4E46A 1E8NA 3G0BA 1A8QA 3DLTA 5K5EA 1GQSA 4GLBA 4F21A 3IURA 3WYNA 1SFRA 1XLUA 4KAAA 3A2LA 1UKCA 2RI6A 5HF9A 4BTVA 2PUHA 4QWMA 5HKAA 4G4GA 1LZLA 2J3QA 3DJYA 1ZOIA 2PX6A 3VVLA 3F97A 5K3BA 4RPCA 3BDVA 5J3JA 3PE6A 1X2EA 4XJVA 3ICVA 1ACLA 1QIKA 5DNUA 2WJ4A 4U2GA 4B82A 1P0PA 3MVEA 1RWQA 2YH2A 4DMKA 4PSDA 1A88A 1VZ2A 3C5WP 1E3QA 3BF7A 3TRDA 4Y2VA 1P0QA 2PPLA 1IVYA 5JZ9A 1F6WA 1VOTA 2WTNA 4GHWA 4UBMA 1XQVA 1M33A
chains in the Genus database with same CATH superfamily
3FXAA 1LVGA 4NJMA 3RU3A 1OXTA 3DOFA 2FPIA 1VSBA 2UZ3A 4HD8A 5NLLA 4Z7OB 6LDHA 1K6EA 3IPLA 3NO4A 5GV8A 1DQPA 3FF1A 2GNPA 3VJKA 3B70A 5IRCD 2VF8A 1INLA 1WTCA 3DKRA 5DNAA 4F2PA 5AJXA 3FMIA 4KR3A 1COZA 3E4CA 2IXTA 3MSCA 1QH8A 3DR5A 2OGZA 3X0DA 3LXRA 3M6LA 1QQTA 3RQIA 2XRMA 2IYWA 2IIVA 1K63A 2XT0A 2J7KA 4AY3A 1FJXA 3K05A 4HFRA 3PGLA 3HJRA 4DQUA 4DR5B 3IC5A 1ZGBA 3JVIA 2AN3A 3QX8A 1NF8A 5DK6A 4NYIR 4O0LA 2XCRB 1RU3A 1VG9B 1W88A 1M2HA 4HQLA 2NU6A 5ALZA 2RK3A 4R2WA 3D0KA 4CM3A 3P0FA 4QUIA 1LLDA 1Q7TA 3IOMA 5DHUA 2ZREA 2BI7A 4L57A 4X7BA 5C8YB 5KB3A 1JS1X 5F7JA 4NICA 5K8TA 1ZITA 1OLSB 4IHJB 3HS3A 1QJCA 2GKGA 2ZRFA 4KPFC 3FNFA 4ZHQF 1DAKA 4MKHA 2HU2A 1YIOA 2QZZA 4XB2A 3UANA 4BLUA 3NHUA 5C1DA 1RKUA 4MGHA 1G59A 4RMIA 2OPBA 5EP3A 2O8FB 4M0EA 3RTCA 5GQSA 2CKMA 4MDYA 3NWJA 5COQA 5JEDA 4F4JA 3VM6A 1P0IA 1ICEA 2GILA 2J7PD 4NCNA 3UJ7A 5I7OA 1P8AA 3VNVA 1XVUA 1N2HA 2PS9A 1GKIA 3N2ZB 4UVHA 5A05A 1W35A 1P4SA 1G5TA 1YI8A 1ZGAA 3NKFA 4ZK6A 1IXKA 3ANYB 4YV1A 1FUUA 1NAHA 4RD3A 4KYIB 2CXQA 1UZAA 3DT9A 3QI2A 4MQLA 1WWKA 3KOMA 5EMHA 5DHPA 1E3MA 1Z0JA 3CONA 2LR0A 4FFLA 3IP9A 4AJIA 2FSFA 3EGCA 4I4IA 3PJDA 4JZKA 4KLCA 4PCAA 3SYLA 1E9SA 4EO7A 3B51X 3KSZO 4ZICA 5JQGF 3VPSA 4CTNA 3GX1A 1PEKE 1SIBE 1K3UB 4N03A 2CGEA 1R6AA 4HJXA 1OHHD 4UHDA 1HI9A 2PRKA 2VZ0A 3X44A 2R1TA 2YVQA 2ZBRA 1J9ZA 1Y82A 2ZLBA 2OO5C 2IXAA 2TMKA 2VHQA 3FUUA 4X94A 1GL6A 1VA5A 2IK8A 3I8SA 4C4ZA 3GZNB 6GPBA 5L45A 2WFLA 4HADA 1EBFA 1UC8A 2FUEA 3P5BA 4RC9A 2NMVA 1DC7A 2BF4A 4Q6BA 1ND6A 1P5ZB 2MIIA 5J59A 3T3MB 4PR3A 4C20A 2MSLA 3P0IA 1P73A 2P2ZA 1WIWA 3KE8A 3BE5A 4O5OA 3WJ2A 2P2LA 3MD9A 4GICA 4MUGA 4N5HX 4P7JA 3ZPXA 4BO6A 5FOUA 4LZWA 4DRZA 2O3JA 1R6TA 3UMFA 1J8VA 5A4JA 1T5OA 5U4XA 1UAAA 1T5HX 1G8AA 1EP2B 2R1UA 3F9IA 3I9OA 1PTJC 3C39A 1P39A 1T2UA 2WVJA 5FUBA 3KETA 3BFVA 3HL0A 3BGIA 4RAQA 2CMFA 2DKNA 3WIBA 1EVZA 1TTPB 4F9GA 4CI0B 4CF6A 4D4MA 2B4AA 2HA2A 1ZN9A 1LLCA 4GYYA 4M1MA 4KPGA 2DLDA 2IE8A 4P93A 4DMLA 5LBIA 5K4HA 2JC3A 4MEAA 3H16A 3KP1A 2K4MA 4Z7QB 3LUCA 5JD5A 2OECA 2XMQA 3ICPA 2ZT7A 3OIFA 4YHBA 5EYPB 1N34B 2GLXA 3B6ZA 1XRLA 3SY8A 4GC5A 4IJ5A 1BRTA 4ZTBA 4B75A 2Q2OA 2CZGA 3X1XA 1VSQA 5BN4A 3R3JA 4Z9BA 1FFWA 4ENPA 1NBAA 3AKEA 4TSKA 1Z56C 1FMCA 3HEMA 3N2IA 5I5GA 4BMXA 1OX4A 1NJ5A 5KYXA 3GLFA 1VFNA 2JLRA 1ZSVA 2BZ1A 2KBEA 2NSHA 4Q82A 5FHQA 3BORA 4BMCA 4N3CA 1N5OX 3F7TA 5AM3A 2X13A 1EZ1A 3GJ5A 1UJ6A 2AC7A 2VPZA 1MXFA 3ZWWA 4KSCA 4KH0A 3AVWA 3SD7A 3O26A 3S2ZA 1RI5A 1PJZA 1GV1A 4DCOA 2JAQA 3QV2A 1W93A 2JGNA 2I4NA 2PSDA 1X3LA 1WU8A 3WKAA 4F04A 2CDRA 1K6MA 1K06A 2YJNA 3SCZA 2ERCA 5KZMB 2XOKA 4JI8B 1PR5A 4YYEA 1EIWA 5JLJA 1ENOA 2O1EA 4GQBA 1CUZA 1LUAA 1HDYA 1JQJC 4I6GA 1SN7A 4RADA 3RBZA 3HKEA 5FPKA 2XTNA 1K08A 1H1LB 3G9UA 4ACBA 3RAJA 1BCRB 4ESEA 1H6BA 2I54A 5KOHB 3JAWA 2WJIA 2AXQA 1Y4SA 3EYAA 3B1KA 4UW9A 2CNBA 3W5SA 4FNMA 3MELA 2A1IA 4XIYA 1NVUQ 1RQPA 2GPJA 3EVCA 3EXAA 2WWTA 4O2BB 2O05A 2EJCA 5J4HA 2PD3A 1MJGA 2PWPA 4AFNA 1BEUB 4RV5A 1OI7A 3NDPA 1RBZA 5B64A 4Z9FA 4DLXA 1IYZA 3TI7A 1EU1A 5I4IA 1T4GA 2ZFUA 4XR4A 1Q14A 3G59A 1JECA 4RYDA 1FXWF 2IYTA 1VXRA 1JLLB 1SKUA 3D1JA 4MKIA 3DMYA 2QUBA 2D7JA 1KRXA 1TADA 2ORVA 3N70A 4MW0A 2IS4A 4KN6A 3VTZA 4GPZA 2QROA 1I2AA 2FSPA 3IQDB 2YX1A 3W2IA 1NX6A 3B1FA 3U4QA 2P0AA 1EVLA 1OTXA 3BXFA 4N65A 1GUAA 2GHQA 1SHJA 2XMZA 1AO3A 4NONA 3ODGA 5BWBA 5HCUA 4K2HA 3QKRB 4PGMA 1Y1LA 2EWVA 2PZJA 3T94A 4Q03A 4JLJA 2VPPA 1OASA 1SXJD 5JCOA 1EFAA 1SVIA 4BS9A 1MDFA 2PNFA 1P2DA 4UMDA 3ELWA 2XE8A 1MO5A 1B3BA 2Y1EA 1T5DX 3HU2A 4Q9IA 3T1YB 3WLHA 3AILA 1QGUA 4UEWA 2XA2A 2OCDA 1NTRA 2WKQA 2XF2A 3E5MA 5DISB 1DPGA 3I04A 2FMUA 1RI3A 1EFHA 2XMGA 2I99A 3ABIA 3JQEA 3LQ1A 3TLEA 2POQX 4F60A 2OC9A 3IAS1 1MN6A 4L28A 5CCEA 1KEVA 1EWKA 4ZVQA 1QBGA 1GG8A 1KE2A 4IFEA 1E2KA 1J90A 2CNDA 1AXGA 2I2CA 2P6OA 3L6DA 2DQKA 2JCGA 2ZUWA 5EP4A 4WBSA 4AP6A 4FGZA 4NARA 1L5MA 3VX3A 4YMGA 2XXJA 2AN5A 2RB5A 1USWA 4ARIA 1HBJA 1NW9B 3FFXA 4FB5A 1BJRE 3GJRA 1JPUA 1Z39A 4LOAA 3F9RA 2YHIB 4G89A 3RJTA 4DMUB 1WUIS 1WXIA 2AS0A 2N0SA 3L77A 3LGAA 4GFDA 1U0RA 3S70A 3CEAA 2HHCA 4RY0A 2ZU6A 1HO3A 1M1NA 5G0SA 1JQEA 1WQ4A 1TAHA 2CF6A 4YCBA 2VTDA 4OPMA 4CQLA 1OB2A 1V7QA 1GJRA 2PU7A 3OZBA 4NTZA 2D5IA 5FO1A 3LFHA 3UZUA 4PN7A 3TAUA 5JXGA 2VJYA 1CUDA 4WKBA 4U7JA 3RJ5A 5LL6P 3DE1X 2F3PA 3QLTA 2E0IA 4ITVA 3O91A 1SUEA 3SEAA 1YCDA 2A9VA 2GDZA 3V55A 1Z5UA 5HM8A 4GO1A 4N41A 3U3OA 3LL7A 1QH1B 1A9RA 4B3GA 2QDXA 4N8DA 2AA3A 2MR5A 3DB2A 3MBIA 2WIGA 2Y3IA 3B1ZA 3U13A 1SKYE 3O4IA 4C1BA 4NZZA 1UK6A 3ESZA 1D4AA 1C7RA 3LY8A 1GAEO 2QU8A 3OZGA 3PNMA 4HGOA 4IIVA 4YP1A 4IOMA 5FOQA 2VF2A 5IULC 2LWIA 1H2FA 1JTEA 4FI3C 1KJZA 2XPCA 2JIRA 4IV0A 1TK9A 1NF9A 4Q4JA 3BWXA 3OKCA 3L82B 2MSWA 4G9EA 1C1YA 3CXUA 3EY9A 1NQXA 5CW1A 3TRKA 1DCMA 1OWNA 4ZYYA 3EOAI 3GQBA 4JYAB 5K0BA 5D6OA 4Z0HO 2QAJA 1NG9A 3P2MA 4CKCA 1KAHA 2ACKA 3E84A 2AFRA 4PIMA 5DVZA 3IUMA 4DHWA 2WW8A 3N2YA 2YUIA 4HWGA 1U2GC 4FYMA 2YC4C 1JI0A 3L2OB 3ZWDA 2H31A 2XCQA 3H1TA 2R5NA 5KQMA 3JYQA 4LSGA 4GL4A 3U7HB 3CEMA 3QJYA 1F4LA 4CMCA 2GZ1A 4IH4A 1CEXA 4MB2A 4UUQA 2EKPA 5K3FA 2IBMA 5DCUA 1UOEA 3O82A 3PE3A 2V3CC 5ECWA 1N7HA 5EJ5A 2NU8A 2AN1A 4D5GA 5CNMA 2FI1A 4HX2A 4YRKA 3BSYA 3MWLA 1PFUA 2I5PO 2QGZA 2V7VA 4WLVA 2F59A 5FWXB 1UMDB 1JR3A 4BRSA 2GN1A 3U60B 1TC2A 2I76A 5DTIA 2JGRA 3EEIA 3E1GA 4KVGA 5G2OA 3SX0A 4AUKA 1JHRA 3FPFA 5JNWA 3E2PA 1U8UA 1DFHA 4A5SA 4CM8B 3EGDA 4JKOA 4EYQA 3JRXA 4OF4A 4MVJH 4DY4A 1U8ZA 4YAJA 2VSNA 2C59A 1QO7A 1L4FA 5DNYB 3EFEA 4AUNA 1AKRA 1Z29A 2NU9A 5HMMA 1NOKA 3UOAB 3OLWA 3GEIA 3O3CA 4QBHA 2EWMA 4H77A 2OL4A 4TL9A 5EEHA 1U7UA 2JKYA 1H3FA 1YZQA 4QYMA 1N2JA 1Y4UA 1Z28A 1CULC 5I7WA 3M5WA 1DT5A 3OOHA 2W22A 5LYYA 1FA9A 3N5KA 4LXUA 4D8YA 4QE3A 1GNRA 1DKPA 2AQIA 3OJLA 2WJAA 3OZIA 5ALHA 1A4XA 2CKDA 1Y5RA 3SG0A 3UOWA 2JJ8A 3GEPA 2EF1A 2PEYA 1D2NA 3IDSA 1C2YA 4NMXB 3ZGZA 2HY7A 3BD7A 3DTVB 4X44A 1JR2A 3L5KA 3LX8A 3Q1LA 4P7GA 2Z58A 5AOAA 1XKTA 3TSWA 4CKEA 4PNEA 3U44A 2IBSA 3T0FA 3K71B 1XD2A 1FVFA 4LOKA 1RWVA 4IX9A 1HLDA 4Q7QA 5DULA 3VMMA 2FDCA 1XG5A 3ANNA 3MTEA 3V2HA 5B4VA 4ENSA 1BHQ1 1R8JA 3AOEC 3U17A 1FYFA 2I1WA 3U2QA 4N3BA 2WWFA 3ITKA 3CRVA 1IK6A 4QOHA 3V8PA 3ZLUA 4HZGA 4EL0A 3CUSA 4XVUA 5LP6A 4OQXA 1JEQB 1G42A 1IBSA 3FOAA 5EGSA 1Q11A 5CVJA 2F9LA 1JDVA 4DXAA 1MRNA 4AZ0B 1UXJA 4M89A 1FP7A 2HUNA 4EPVA 3TG8A 1IMOA 1D2CA 1OPRA 4XVCA 5JMWA 4M53A 1WXWA 3R0JA 5TPWB 2YZ7A 4J4TA 4E2ZA 4EFMA 3QIVA 4G0XA 3DBLA 3I2YX 3EXIB 4EA6A 1XT6A 3JQ8A 1YTUA 2L82A 4Q4AA 4RE6A 3A1TA 1GZ5A 3OZUA 4NOMA 1ES9A 3ESRA 1ODFA 1WZUA 2QUZA 3QX7A 4CQNA 2X8AA 2ZRCA 1ND5A 1YQUA 4EY5A 3AEQB 3T5CA 1AT1A 4GYWA 3GDWA 3KELA 5I7HA 3MLAA 3EF0A 4HSEA 4F3YA 2XCSB 3BPSA 5LA6A 3U1BA 2X7JA 3WL3A 4A7PA 1EGHA 1OA0A 3IBSA 1UWLA 2R96A 5CFNA 3CZMA 1U1EA 1QQAA 1WW3A 1DUIA 1PVVA 2BW0A 2R6FA 4X60A 2NQ2C 5I4KA 1LX6A 5CHEA 3ZDXB 4KE8A 3KZCA 4YPVA 5FNZA 3PHJA 2ZS8A 3Q8LA 1Z07A 4LYHA 3BTUA 2L2QA 4LQDA 4DBZA 4PYJA 3ITDA 4P5DA 3H1PA 4Z3DA 4CT5A 1ETHA 1RFGE 4I46A 3GV0A 3C7AA 1G7TA 5B3KA 4H1VA 4E7OA 5H16A 5EIEA 5EEGA 5GM2A 2DLCX 1GPBA 5C53B 1E99A 4EG8A 5BWNA 1I4DD 1XK6A 4H3SA 4MKXA 1R4ZA 3H6GA 4ITUA 1KQFA 3BUSA 3BXPA 1US8B 2ZI7A 4BVAA 1OFVA 4AMGA 4YAKA 3GHHA 3LFTA 2Z6QA 4QIHA 5BT9A 1CQZA 5AK3A 4Q3LA 3KVOA 3VZQA 4LE1A 5IT5A 2ISCA 2ZSFA 4CIWA 4MHTA 3DDWA 2AYXA 3C3JA 4GUAA 5J5VA 3KEMA 1RM5A 2ZROA 5BSUA 1NVFA 4RLQA 4L74A 4LF5B 1L5RA 1PNVA 2ISQA 3JYNA 1R6DA 2J09A 4OAQA 2H29A 3OEWA 4OJYA 4FONA 1VLVA 5EUBA 5A4MS 3CS3A 1AQIA 5H8WA 2PZ8A 3IXLA 4V0LA 4AJNA 2KWIA 1UIMA 3BB3A 3U16A 2L17A 2D0IA 4RA9A 2XDQB 3G8YA 5CPBA 4V1CB 3KQKA 3M49A 3BN3A 2MSDB 3ETDA 4BQNA 5K8LA 4R2MA 1CIPA 1WSAA 1ZM9A 4DLYA 3CR3C 2KB0A 1DWOA 2R00C 2RBGA 2QTNA 4KRXA 2Z09A 4LK2A 1PJ2A 2DPHA 5DCWA 3TIXB 3UICA 3V97A 4IUDS 2HMAA 2H1VA 5F4ZA 3KJIA 1SG0A 3D8NA 2C99A 5GGXA 3VHRA 3LE8A 2Q6OA 2OYRA 2OD2A 4Y6OA 1G0OA 5EHNA 3LU1A 2RCNA 3C7DB 2QAIA 2C2KA 5LOVF 1ITZA 3HRKA 2JGKA 3CH4B 3D3JA 3O8QB 4BN4A 4B3MB 4LYEA 3V2GA 3IUNA 3STUA 2DHRA 1V45E 1T8SA 1TVMA 1QZTA 2H65A 3FTCA 2GCNA 5EPEA 1FTQA 3ACDA 1DDIA 1GZ6A 4OUDA 4DHEA 3QTBA 1LC0A 1EWRA 1TPZA 1JKXA 4HAOA 4OBBA 4JI1B 3TE7A 3VSBA 1MTOA 4V02A 5K0TA 5KC9A 5TJHA 1QQBA 1HURA 4M0PA 3S29A 2JFFA 4GZLA 1BMDA 2Q4EA 1WKCA 4WFIA 2BHRA 4G2TA 2QZJA 1B00A 1DHRA 3KPUA 3V8EA 2P6PA 2GB4A 4V1CA 1TRKA 1OREA 1R3UA 3OX1A 3HBLA 4G37A 4J7XA 3VTAA 4CTOA 1D7OA 1C8LA 1ZJJA 3LAWA 4C5CA 4H31A 1Z5ZA 1K4MA 4KQWA 1VE1A 5D1NA 1BU8A 3SHFA 2ZANA 1PFYA 4B83A 2QZ9A 2F00A 5D3QA 3PD1A 4A1FA 1QHNA 4A2PA 5C37A 3D6NB 5MN4A 4BATA 2JHFA 2N9UA 4HRXA 4NSNA 5D85A 3DPUA 4QYSA 1KETA 2Q9AA 3LUKA 2EL9A 4OL9A 1J0AA 1SOMA 2GK4A 3L8MA 3IP5A 2GOYA 1KOLA 1W25A 1IG0A 2YZKA 3H5VA 1IPHA 2Y1KA 1XK7A 4URWR 2EAUA 1V9SA 2NADA 4N6GA 3D0QA 1GG9A 1IZZA 3FOCA 1NVWQ 3KQTA 3P9IA 4MHSA 2ZJ7A 3A28A 4PFQA 1OH7A 3HCEA 3GARA 4F6RA 3NT4A 4MRRA 3GUCA 4GBED 1WQ1R 4KYUA 4XX0B 1HDRA 1K98A 1UKEA 3URMA 3WYAA 3FIJA 1SVKA 1OGJA 4UJ5A 3H2GA 1FNDA 2XWJI 5FYDA 1JDTA 1SA0A 2FETA 2YHBA 4M7OA 2HM7A 4BMVA 1R4NB 3I1IA 2WB2A 4HZUB 3BBLA 1PEAA 3R23A 2GA9A 3WDLA 2FAXA 3DQPA 2ZBDA 3DE3X 3NHAA 4HEHA 4M88A 3AZPA 4S0ZA 2CJFA 4K03A 2GEVA 2A5DA 1NQ5A 3C41J 3DOJA 3JYHA 4Y1RB 3FPEA 5EC8A 4J3NA 3W9YA 4AICA 4Z5XA 5JHHB 5K0EA 4RL4A 1QYDA 4N8SA 4PANA 4JLAA 1OI4A 3CPEA 3EQ6A 1RWOA 3JWHA 4MW5A 3P94A 3ND9A 4RVOA 3VYSB 5D2CA 2GXSA 3VZSA 1LCIA 4BFLA 5GMOA 4YMLA 4JROA 2BFNA 4CMEA 2G77B 1XAHA 4DWJA 5EWJA 1ACJA 4BZPA 2O5RA 3FVVA 4CKWB 3OMLA 5CITA 1VPTA 4PO3X 3IALA 1A5AB 1Z6AA 3BMOA 3BSWA 4QJIA 2H0RA 2E37A 3I58A 5EFOA 1Z25A 4MZDA 3MWEA 1XJQA 4POOA 1JHPA 2GM9A 4QREA 2A0YA 1YBMA 4HGYA 5EFZA 2Y9MB 3KOUA 2IEZA 3IP3A 1IQPA 1POXA 1LRKA 5AW0A 3LBAA 1E2HA 1DKMA 3JZMA 1QCDA 3ZY5A 1HE5A 2XAUA 2YV4A 4TMKA 1XCMA 3NB0A 3R0ZA 1RYNA 2R6ZA 5LIPA 3DW3X 1V16A 2ZB7A 3GBPA 3EIFA 4O2LA 2QM8A 4MUYA 1SCIA 4UTVA 5LQDA 4CXMA 3WICA 1PJSA 4M49A 1SC3A 1NU6A 1U7OA 4FFMA 3MNFA 3WSTA 3UA3A 2HCFA 4UBIA 3I2JA 2V6GA 4G24A 1BKDR 1TYBE 2CLOB 5KYVA 4ZCIA 3B8EA 3D59A 3GK3A 1N7JA 1V5FA 2LDXA 1C3OB 3GRCA 5TT1A 1VL0A 2ZJ5A 5FTJA 5BN3B 3HFGA 4IXNA 4R7GA 4XQ0A 3SJBA 3H8WA 2HIHA 4DLAA 4U2EA 3UB4A 1EWVA 2G4CA 3OA2A 3S0JA 1NNEA 1F2UA 1QWSA 3RE1A 1YJCA 2C7GA 2DCUA 1E63A 4BFTA 1Z0SA 1LH0A 1TQ6A 2JGIA 3QHAA 4WSOA 3D0OA 3H5LA 1CJTC 3TNFA 1HTTA 3FY4A 1GCGA 4QQNA 5TDHA 3KU4A 7REQA 4NATA 1YR8A 4HDRA 3U5TA 5LNK6 3RC9A 4GDMA 5HQ3B 2WYHA 2XHZA 4IIUA 3WWEA 3TKYA 3VV2A 3IR6A 4G65A 4RLSA 1BGWA 4Q7LA 1QGZA 3WK7A 3TR0A 2NQTA 1IJEA 1M3SA 2X4GA 3B8HA 2J9ZB 2Z2JA 3HFJA 4YXWD 2REXB 1GAWA 5J1TB 5JE8A 5I51A 2OWDA 1ZVJA 5AK5A 1AM4D 3OQHA 5CIYA 3CPSA 2VWGA 5IT0A 3EVAA 4K1XA 3R76A 1P9RA 5JDIA 2F4VB 1RAHA 3ZE2B 1KRWA 1DAHA 1K2VN 4KXWA 5CA0A 3QLVC 1XKQA 1WHTB 2DBZA 1LF5A 3AY6A 1APBA 1VCIA 1VSTA 4KODA 3BIFA 4P0TA 4TQAA 3C4QA 5KS2A 3NNNA 1Y6ZA 3MJRA 3T4PA 4ZZ1A 1RP1A 3QFHA 1FMTA 3LBNA 3UAXA 1NL3A 5AW3A 4DJJA 1WZ2A 2Z8YM 1RXEA 4P38A 3CBQA 3ZDCA 1ESMA 2PUVA 1KO7A 3O0TA 3ZQKA 4AM8A 2BV3A 4V2IA 2NNWB 1OW3B 5AHWA 1GAQA 2WF7A 3ZE9A 4I3HA 2DRIA 4FDUA 4HNQA 3CINA 1HT0A 1EVKA 1QG2A 4G5HA 1OC4A 4X84A 3ET4A 3ZVLA 1G5QA 5DDIP 3PS9A 3K9WA 1UH5A 1QSGA 2V4MA 1SK9A 4A0GA 3FUXA 3GCXA 1YC2A 2B21A 1GSAA 3OBBA 3K72B 3PCXA 4F85A 1R5BA 4R3NA 3WXBA 3IV9A 4Q7JB 3ORYA 3OPYA 5L8VA 2C96A 3DZDA 1TKAA 2XRYA 4D41A 2WYUA 1N0HA 4FHCA 2QORA 1CUYA 1YZGA 4BWGA 5IMBA 4DB4A 5K1ZA 4AZWA 3AJAA 4IDFA 4JLUA 5K2OA 2M6RA 4D3YA 1AOXA 4RCVA 2BCEA 4RSRA 3TQTA 5E6RA 3PFIA 1MOQA 3BMQA 3JQ7B 3LC0A 4JN6B 4ID9A 4X00A 4OHBA 4ZYZA 3A6EA 5FTKA 4N0QA 1HEIA 1RP7A 1YCFA 2QRVA 3OWXA 4GQIA 1Z6YA 3KFLA 3HCPA 5FJIA 4ZGBA 3K8OE 4PG8A 3I9JA 1S5PA 2WP0A 1THTA 1CJCA 4FN5A 3UFXA 4BLTA 3R8CA 5AVVA 3WHLA 2RAUA 2GERA 1ST3A 1U6JA 2IODA 4L75A 4XYBA 3LH5A 1L8OA 1X19A 2YDYA 4D8TA 3EIQA 4KVZA 1I7DA 1F8XA 3FGOA 2JRLA 1Y1TA 2CJWA 3QK7A 2JBWA 2NO0A 4YJ3F 2SCUB 2IZ0A 1WG8A 3G2KA 2H2WA 4PVCA 4TXLA 3KXLA 1HEUA 4WXRA 2RE8A 4MDEA 2IX9A 4ARUA 2JAXA 4NLLA 2PSFA 3WNDA 1OUMA 4L9RA 5DW0A 4PPFA 5FUMA 2IEDA 2VBGA 3EEBA 3OD5A 1UC9A 2BLNA 4GUDA 5IZ4A 1KYVA 4Y9DA 4ZEMA 4MWEA 3FTPA 4J9UE 3TQIA 3E7PA 3PD0A 3ITNA 4HMPA 2FMKA 3VBCA 2FP4B 3H4IA 3NGXA 4LY6A 4DLZA 3PUIA 4DSAA 1OFTA 1PGQA 5AI9A 1ZN8A 1SZJG 4IHAA 4LVUA 4RDIA 4YAGA 2PHZA 3ACBA 3A1EA 3V6LA 2WHQA 1VMDA 2VN8A 2VL7A 1KO4A 4MWSA 2VP4A 521PA 4JUAA 2WPNA 3PC8C 5G3YA 5B2FA 2DG2A 3RABA 5I3CA 4MS1A 1EP1B 4M9SA 2ZBUA 1SOWA 1NE2A 1F4VA 1TMYA 2VDQB 3PQ6A 1Y48E 3FR7A 4RXMA 4D6PA 3R74A 1P19A 2QR5A 1KYIA 2VNAA 5FNVF 5INTA 2ECOA 4Z1MA 1A7AA 1SUCA 4FXOA 1SXJE 5JZVA 1ZCFA 5IYZF 1IHYA 3VR2A 1PZMA 2B3TA 1YS2X 3UJPA 1I1OA 3OUZA 4NBWA 2O3TA 1RLJA 1Q1ZA 1ZJ6A 2QENA 5FX2A 3I23A 2PA3A 1XX6A 5FT9A 1NN5A 4ENWA 3PX7A 1R8XA 1JE1A 4ZQHA 2CVZA 4ND4A 3QENA 4WZZA 5DBIA 4GDFA 1A72A 2FG5A 3PUJA 1DQSA 3E9EA 4LZLA 1YS6A 2FCAA 4EG3A 3W7AA 2FXIA 5IANA 4KWTA 5ALQA 3ZH9B 2TECE 3D7LA 4EA7A 1H9BA 2A59A 4MA0A 1QFZA 1MX1A 4NP6A 5LKRA 4YN3A 1YOVA 2W4IA 2FW8A 3FI9A 1CHDA 3GRYA 4J0CA 4B3JA 1K7XB 4UKDA 3VOSA 2ZRLA 3BGDA 2ZYWX 2C4UA 2BEUB 3REQB 4DCMA 3I28A 3R5KA 2J0SA 3DLBA 1PWYE 4JFAA 1RWBA 1EP3B 3HJBA 3IH5A 1XELA 4U3JB 4FJ1A 4W5NA 4MQBA 3RUPA 3PUHA 4FNGA 4DE5A 3UGTA 2OD7A 3NNDA 5BMVF 4JVOA 4B6PA 3MGKA 4UAJA 1UKBA 3H5OA 4F3TA 2ZSJA 2XE7A 2ADFA 5FPQA 5F12A 3VHXB 5L3SB 4Y18A 3A9VA 4GYKA 1T6NA 2ZWAA 4NOKA 3D3KA 1LDMA 3E4DA 1UDAA 3PNQA 3EJWA 3NIWA 3EZXA 2E21A 2QMOA 1RKQA 4D0NA 1ZO8A 4ZCRA 5DW3A 3WL8A 3KZMA 3R41A 4F45A 3CF4G 1BDIA 4UHCA 1Z75A 4XWYA 1JX6A 5B58T 2WYWA 4DJDC 1XEAA 4W5JA 3NDJA 4ICIA 3FCEA 1NURA 3MK31 5TEVA 3V1NA 1JLMA 5DYTA 5FWYB 1QXSA 1CRWG 4OXKA 4RVUA 1PUXA 1BN7A 4KFUA 2NUPB 3GD5A 3ADOA 2A33A 4WNAA 3O8NA 4HUQA 2C9YA 4QHSA 1SXGA 4XDYA 1VHDA 1RHKA 2DQSA 2JLCA 3EH1A 4L5JA 1BTOA 4IGFA 2NU7A 3VSAA 2JH8A 2ODEA 3FNIA 5IEBA 3RVSA 3VU3A 3NBKA 4LV5B 2ZI4A 1NW3A 2OO7A 3OT5A 3C5CA 4ZVKA 5EJ9A 3I2FA 1OV6A 3GNLA 5IWCA 3SIRA 4Q66C 1S7GA 4Y2QA 3R7WA 4TLLB 2P5UA 1IU9A 3HB4X 3A04A 1SBCA 3AKYA 2Q07A 2IGTA 1GGMA 2BP7B 4CM5A 2NVUA 1GARA 1O7JA 3CNLA 4G5XA 4DRXA 3W5DA 3BH6A 1IBLB 2W2LA 2RIRA 4RJJA 4CIBA 3LUDA 1K5GA 2FFQA 5ERXA 1I4WA 5GJBA 3C0KA 3K6SA 3QVOA 1RPJA 1LPOA 2H1SA 4DUGA 3EZ7A 4FBLA 2JJ2D 4X97A 3CLVA 3ABOB 4BU1A 1LI7A 4QUBA 4WNCA 2G28A 2GPBA 1ZUD1 4L9AA 3G49A 2JAPA 4IRUB 4RJIA 3U0BA 1ZINA 2HRZA 4YRMA 1NOIA 1JHMA 1GA1A 4ESVA 2GD1O 1JWAB 1FUEA 4KGVA 1MJFA 3ICWA 4F0JA 1IXYA 3DTNA 3ETNA 3NOQA 5IW8A 3VFDA 1CZUA 4DA9A 1FUYB 2XQGA 1IM2A 5A62A 5I47A 2A0WA 3R6DA 1W87A 1T1RA 4D6YA 5A5DA 5JSZB 1KQGA 4M8SA 1T1SA 2AFHB 3CF4A 5AK4A 1S1MA 4CEIA 4URVR 5IXSA 5CD1A 4KXUA 1ORHA 3LP6A 1U3DA 2BLLA 2W6ID 4QO8A 3G2JA 3TM4A 3QF7A 3FNHA 4EQZA 2C9DA 2OQRA 3U9TA 3QEAZ 1AKYA 1WBJB 2OUIA 3H1EA 2LVBA 3LBHA 1S9DA 2XCIA 1DXYA 3W8FA 5T7BA 4PRLA 3FSEA 2GPAA 3NEAA 5HOEA 4RS4A 2GN6A 4XXHA 3GFQA 4DRYA 2FEOA 5KJ1A 1P2TA 2PMBA 3WY9A 3E9MA 1OSNA 3CIOA 4BRUA 1FSFA 1ENZA 3ZWOA 5JH7B 2NAPA 2VK2A 3SEZA 4E5YA 2EDCA 2VDKB 4YCNA 3AUUA 3TJZA 1L0BA 1NSTA 4BKUA 1Y4AE 2I87A 5C8YA 4PYIA 5CDGA 3UJCA 5KOYA 4P6VF 4GI5A 4X6UA 3LNTA 3KK0A 3E05A 3DMFA 1J7KA 2JA1A 1U28A 2BUBA 2PX2A 1FU4A 4YB8A 1JJVA 3WBJA 4CFSA 5BOSB 3P96A 4FPXA 1A7KA 1L8LA 4LJ4A 1Z7EA 2AKAB 3D64A 3LZ6A 1A9TA 4KMOA 4WY2A 3WK5A 3QBTA 3ZWBA 4W8GA 4JBXA 3GLHE 3ZE6A 4AYXA 1KYZA 5EXEA 4WZAA 1XU9A 4ZI5A 3RFXA 1VE6A 4YR7A 6PFKA 2F1OA 1Q19A 4G41A 3RAPR 2PT7A 5JALA 2NP6A 1EVEA 5IM4F 4I08A 4JVMA 3L93A 4ECEA 1QK3A 3OI7A 4KXNA 1XTRA 1SCDA 4RJLA 3C48A 3FBWA 1RTTA 3RBXA 3OF3A 4UBKA 1DBRA 2GPNA 4U0KA 5FBZA 3X1ZA 1J23A 1CP2A 1VLMA 2H1RA 3QX9A 1QO0D 4LGVA 3TD2A 3DQZA 1E2IA 3HGMA 3P2EA 4TMTA 4EATA 1A8IA 5EP2A 1T2CA 3NW9A 4EI9A 4KUHA 3QQ5A 4BFVA 2K7ZA 3C5VA 1A5ZA 1N6IA 3TZBA 1QPGA 1A8UA 2YV5A 5TGZA 3LCVB 4FHFA 2I3AA 2G1JA 4HR7A 4J1TA 4FYYA 1YASA 3ROEA 1CS0A 5AM2A 1SUWA 1NOJA 3A3PA 4QDXA 4ZXFA 4F1KA 4GGPA 1GGVA 4KTTE 5IJAA 1ZM4A 3ONVA 1G3UA 3I73A 2GNOA 4HDOB 4LXIA 2XLBA 1ZU4A 3OJOA 4GOLD 3WGVA 4IWXA 1JI3A 5CHYA 1YC5A 4UXJA 5ESWA 2A0FA 1BH6A 1P4RA 1LJ8A 2Z6AA 4C22A 1ARZA 4HNUA 4YAUA 1YCHA 1IJBA 1QOQB 5HW0A 2Z2XA 1WX1A 1B4DA 3NMUF 2GM3A 3D6HA 2CFCA 2NPIA 2JFUA 1U0BB 3NIGB 1FDOA 1HYHA 1ZCJA 2XDWA 4AG5A 3TLGB 1Z6GA 2O1XA 2OV8A 1RHQA 4OH1A 1W48A 3N3BC 4IY1A 1I1NA 2BMVA 3TW8A 1UMCA 4UU1A 3KPVA 4H6PA 4L5IA 2ZJ6A 3H87A 1VG8A 3I4LA 2AOWA 1WCIB 4YMHA 1GPAA 5ESXA 4EGFA 1IE3A 1FPMA 1W5FA 3W5AA 2O07A 3TN7A 1PJ4A 2HF2A 3QMVA 3EDCA 5BQOA 3G2LA 3OM9A 4J0EA 4DR2B 1AZTA 1CY4A 1YZUA 3B53X 1EIZA 1GQFA 1O94D 1Z0AA 5EJFA 1DBPA 4HB2A 1AIPA 3RYIA 3EF3A 3AO0B 3R9WA 4JJGA 3A4VA 3PE4A 4XQ9A 5FOSA 1R6UA 2RKWA 3SQOA 3T3DA 3GA0A 3DDCA 5JXJA 5D86A 2QVZX 3DR3A 1ZBQA 4FOOA 2JFPA 1KE1A 1X1DA 1SG9A 1VKNA 2PR2A 1FFXB 3ZCPA 1LPBB 2ZIXB 4MIKA 4PG6A 4QHTA 1J33A 4L2IB 4RENA 2Q7XA 5F23A 2LGJA 4A1OA 5TPZA 5FUVA 2P5SA 3TIFA 3W6NA 3ZIAA 1JR3D 3ER8A 2BEKA 3TO5A 3WRWA 5BWLA 1VPVA 2CD9A 1QWOA 5ADHA 3HWX1 4PTLA 1JIJA 4I55B 3GW8A 2MCFA 3VPCA 4EZEA 3G6WA 5SY9A 4MQUA 5HIMA 2D2XA 1Z2OX 1OD6A 1UBLS 3R3XA 5K6RA 3NANA 3SYMA 2F17A 3F98A 1XZAA 4X62B 3GRVA 4YJHB 1U5BA 1HSOA 5BR8B 3KOOA 1C2TA 1H1LA 4BKOA 4F11A 4DJ5X 6AT1A 2X9VA 2ZWOA 1JDSA 4IDPA 5JG7A 1KOFA 2BGNA 1QK5A 5EWLB 1Z6ZA 4XGNA 1U2RA 4HNSA 3FGZA 4XIGS 1YMUA 3L0DA 1X80B 1ZNQO 2LDBA 3EVEA 3PXXA 1G5FA 1NVMB 1F6DA 2PH3A 3FWYA 3MRVA 3ETGA 4H59A 4J16C 3K92A 4IIHA 4O2BA 4ONEA 4W99A 2PRYA 5K0ZA 2OGSA 1CNFA 4PXSA 3E7WA 2W6QA 2FY8A 4QYWA 4MPJA 1I5OA 1JZQA 1F20A 4BFUA 4X7PA 4HVCA 4OP3A 3KKQA 1WXEA 1QAOA 2FOIA 2ZIUB 3K16A 3QVGA 3AVQA 2DWOA 3GU3A 1LJLA 4X3OA 1JXQA 1ZI9A 5DYWA 4BNHA 3L4BA 4F46A 5LR6A 1KO8A 2VK8A 1A95A 1KSJA 4C4TA 4JV5B 3NC4A 1JLLA 4RE5A 3RSCA 2C0CA 2I6TA 5EIWA 1I6KA 1E2JA 2XIJA 3AB3A 2HPAA 1WXFA 2GK3A 2P30A 3LT4A 3MMNA 4H3KB 3RHFA 1WMSA 3RUEA 1SQ0A 3RS7A 4YUYA 3PDWA 5J2UF 2JLUA 4BO8A 3DH0A 4UNQA 5LM3A 1ICIA 3SFZA 2WJJA 4NPAA 5EOVA 3ZW9A 4FGUA 1JVBA 4K87A 3W6UA 1O0CA 2IF2A 4JI0B 1WXXA 1QGDA 4C1NA 1NQOA 1N2SA 4IF6A 5B4TA 1WE2A 3HYNA 2QSUA 4KWIA 3I6BA 5CGQB 3QNUA 4M7RA 4AXXA 2RKOA 2J5QA 5AR1A 1UPBA 4W82A 2PRIA 1EB8A 1EDBA 2HQBA 2Z2ZA 2WM2A 1PDWA 1XL0A 2GVNA 2BM9A 1M2FA 1L5YA 2HA6A 4KFRA 4LY3A 3WL4A 4F2GA 4L3OA 4KIUA 5KU7A 2QTRA 2PZGA 4KK4A 1ZIPA 2A78A 1RYYA 2FCRA 1GZHB 4FE7A 2C7BA 3ROKA 4ZHQA 1RRCA 4PHFA 1IHXA 3A1FA 2IFTA 3FDFA 4FEGA 4IR7A 4NPCA 2V7QD 1I6WA 3AC0A 5C4GB 4PYRA 4MARA 2D0DA 1U80A 1SIWA 3K09C 4WNIA 3ZXXA 5JXIA 1XU4A 2Y1XA 3AY3A 3DVLA 4QD3A 4RXTA 3UAGA 1CE8A 2WA2A 1IXSB 1E20A 1UFRA 1XHFA 2FFJA 4R8SA 4TVOA 5FOTA 5JARA 4EG1A 2Q2VA 3VKFA 3JD1A 3VR6A 2YHIA 3MWGA 1K8YB 3BWDD 4WN9B 1JQAA 3A1DA 3GJYA 4QOSA 3PG5A 4U8HA 5TMDA 3ZHYA 3U9LA 2FP3A 4ALNA 4JLDA 1J1ZA 3D8RA 4BL5A 5E1DA 5EIAA 2TRSB 2C07A 5C9ZA 4HGPA 2H4ZA 5SZKB 3PNOA 4P4UA 4DV1B 1A50B 2JGEA 1IOVA 3SSNA 4DM3A 2ZIFA 4L4ZA 4E6PA 2CFRA 2I65A 5HILA 4BYMA 5ITZA 1R0LA 4JXKA 1ZLYA 2AX4A 1UAYA 2YNMA 1ORTA 5D5PA 3IIMA 1DIHA 3CIFA 1HMYA 3O95A 5FAKA 5GZ1A 4Y3UA 5YASA 2ZE6A 3IKTA 3P9CA 4EG6A 2HLHA 1V2HE 2GYWA 3LO8A 4I14A 1O2DA 4JLNA 2CDCA 5EIOA 4DT1B 3W77A 4E2XA 2X2FA 1KORA 1NVAA 3S7ZA 1X1QA 1AY0A 2B5WA 1ETUA 4EL5A 1W0KA 3OLYA 3PQ8A 1N36B 1VLJA 2XF8A 5IFLA 2C7RA 1CK4A 3SJAA 3W4KA 2FQQA 1W0CA 1QVAA 4RK5A 4RJ2A 5CH8A 1SBNE 2I1QA 2QX4A 2Y92A 4FCTA 4FFRA 2D6FA 4QTXA 2R97A 2UZAA 3HVRA 1PS0A 2R1VA 3IOYA 1NQVA 3ADDA 1EK5A 3L1VA 4X54A 2FJ0A 1DDOA 2JKZA 3PT5A 2BFAA 4DJEC 1IOWA 4YECA 4CMBA 2I4OA 4ZRNA 1L5KA 5IBCA 2ACVA 2DM6A 4TL6A 4WK0B 4AQDA 2V6BA 3G9QA 4FE4A 1W9MA 4DC1A 2H7VA 2JVJA 13PKA 2Z08A 5GZ6A 1M67A 4J75A 4FU0A 2AC4A 5B7NA 2BSQA 3O2SB 3PI6A 3JS5A 3ZVRA 3KHSA 2WPDD 4HQOA 4J0QA 1E62A 3DTTA 3ED5A 3GAZA 4YP9A 2FOXA 1MOSA 1RJGA 1RVV1 3HBNA 3CZRA 3E9NA 3P4XA 4RZ3A 4CIAA 3NJ8A 5FA5A 4EB8A 4N76A 4FYXA 2OHXA 4D4GA 3E23A 4FHGA 1JJAA 4G1BA 1KI1A 3P9QA 2CZCA 4GIBA 2ZI5A 4IVQA 5FWNA 4B9EA 1UJ5A 3QYPA 1FW8A 4KK3A 5J2TF 4ZCLA 3TWOA 4B40A 2QM0A 5C2JB 4FZ5A 5ALJA 2PDAA 5H7XA 3KHKA 1Q12A 1UMDA 3Q3HA 2JGAA 4XYEA 5U1PA 2I7DA 4Q4DA 3ZHOA 3KUKA 5I9NA 4GKAA 5L95A 3V3KA 1ZOSA 3IIKA 4DEYA 5JAOA 1UP4A 3HNOA 3UUGA 1X7WB 1B43A 4QA9A 4CUZA 1JNYA 4LDRA 4TT3A 4BV3A 4NU5A 3RVBA 5HUQA 2PUGA 3JWPA 1TQ8A 3I6ZA 5JI3E 4NYJR 2E9SA 2P77A 3ONNA 1XDBA 5CCDA 4IAOA 3NHRA 2EZ4A 1SPBS 3ER6A 3I01A 1ZXXA 1D09A 3E48A 3MERA 3W8NA 1YB5A 2QR2A 2J9FB 2RJNA 3A3NA 4LZZA 4UFNA 2XAAA 2VZLA 1C14A 3GOHA 3SE0A 5JAPA 1ZN7A 2FSVC 5EE9A 5FKJA 1H94A 4Q9AA 4BVKA 3C3XA 1RYHA 4X1IA 1SEVA 5CRIA 2HK9A 3TFOA 1F51E 2GWHA 4HDMB 4EGAA 1PL6A 3PRYA 3O2JA 4LJSA 5BV0A 2RK4A 5CVCA 1I32A 4PV7A 1OC2A 2J6IA 1YRYE 1KQOA 3ASVA 4G1FA 3GVHA 1E6EA 3NJ4A 2X86A 4JHXA 3H9EO 5CG2A 2ECQA 2WT8A 16PKA 4GPBA 4M9RA 3LCRA 4MMYB 1YVUA 1VM6A 5F3RA 4C6SA 3MTBA 5HUJA 5JOQA 1B3RA 1CZLA 2HIGA 4D9FA 4K6GA 3DL2A 2G07A 5B58C 3PTZA 5IVHA 3KBOA 1WKVA 1N32B 1U11A 4OH7A 3QGMA 3F4KA 2ZK7A 3AFNA 5LQNA 1KGSA 3KZKA 3V1MA 4ZGWA 1IBCA 1QIEA 3PR3A 5CDTA 3FOFC 2WDZA 3FBTA 3R9XA 1MFPA 2DFDA 4XDHA 3LRXA 3BL6A 4XVHA 5LQUA 1PG5A 1JEQA 1W4BA 3RS2A 2PBZA 2EFEB 5GIOE 2N1BA 4B33A 2B9VA 1TT7A 1CUGA 3ANXA 3IBGA 3MUFA 3KLPX 4M1YA 1OFUX 2XE6A 2FLKA 1XRJA 3OCJA 3Q1KA 3DEZA 4EX7A 4BO5A 1E3IA 1WABA 2HJRA 3EXIA 3O38A 4LRQA 3Q2IA 3PDUA 3O75A 5FJJA 4URYR 1XTJA 2IWRA 1L4NA 2E4VA 2H1WA 3AEQA 3CO0S 4OCZA 3ZLVA 4TLDA 1N1MA 4RLHA 1FYEA 5E1MA 4I6JA 2FEMA 5LNK1 3RUDA 3PEFA 4NU8X 1NN3A 1UP7A 2OD9A 3VC3A 1N3IA 2V6FA 1ZKDA 3A1WA 3NBQA 3NXKA 4F4UA 5A06A 5HS6A 5FV4A 4A5OA 2R60A 1VYVA 3ROFA 5FOXA 1GCOA 4A4DA 1Q17A 2F1IA 1IB0A 4TTRA 3D31A 3R4VA 1MG0A 4M98A 5ED0A 1ZK3A 2OFPA 1W2WB 1KRHA 2A7QA 3SJ7A 4TKUB 3PIDA 3HZOA 1T9BA 2P91A 3VAAA 5THXA 3WLJA 4RCZA 2RARA 4XVRA 1H8EA 1JT2A 1RBMA 1Z5PA 5M2QA 4DKXA 1EGAA 4X3CA 1P9OA 2BEWB 2CFOA 4QUJA 4FJ2A 2PZKA 5GPBA 1QZZA 1NQAO 4ZU1X 3ZU3A 1E5XA 3GFGA 3ANSA 1MC1A 1NJSA 2C9BA 1LPPA 1TKCA 3CR7A 2XMDA 3ONFA 4FDLA 4YMVA 5IABA 3F1KA 1TAGA 3LC7O 2FA9A 3EG5A 1SJ9A 2EGHA 2R86A 2O0HA 4F3KA 1X0XA 3FPBA 1DMSA 5KAPA 2J6BA 1RC8A 2OWEA 1EH5A 2HU8A 2HMTA 3RWBA 3RKSA 5KNLA 4RV4A 3EQZA 4HDCA 2NAFA 3LLCA 3BIXA 3AL3A 1PI3A 1T0BA 3OQ6A 3IXQA 1N25A 2VTBB 5L6LB 1Q7EA 3NUZA 1OGIA 1ZWKA 2G1KA 1BVRA 3RASA 4ZEVA 3DMTA 2G0AA 3G17A 3PNLA 4I1UA 2WE8A 1YO6A 4J4BA 2E4ZA 4ZAXA 3A3KA 4D25A 4KO8A 4E94A 3JR7A 3MINB 1ML4A 1V6SA 4MO9A 2QXUA 3IE1A 1H2YA 4I5FA 5EQJB 2ID8A 2GBLA 1E1CA 2ZUSA 5CX1B 3CX8A 3GR6A 2QY9A 1NBWB 2OC4A 4KYTA 1EKXA 3HGTA 1PV2A 3CMCO 2R9VA 3PHBE 3SX4A 1XRRA 4PAGA 3C8MA 2VSFA 3USCS 4YCJA 5K4AA 1SKBA 2IZ5A 4BJ1A 3FHOA 4D44A 1XZMA 4G0UA 4I5GA 2ZATA 4IJKA 3EVZA 5JBQA 4A8TA 5TEWA 1H2AS 5KCMA 2HZ7A 4C7XA 1JHDA 3UT5B 3I5XA 2ID7A 1S3FA 3UY4A 3QU9A 2H8GA 2RG1A 5E2AA 4DZRA 2PBLA 3KBBA 1NT2A 3STYA 5KX5B 3OUUA 1SBYA 1E6MA 1JQLB 1EDDA 2CLFB 2FGKA 3CLSC 3SEFA 3U0VA 1KIAA 4B8YA 2GGSA 2ZI3A 3EIUA 2VJLA 3PLNA 4PZDA 5WRFA 5EJEA 4XSVA 4M54A 4Q1VA 4IVPA 2XHEA 3VO2A 3LT0A 3GMIA 1JXOA 3EPJA 4UHFA 2G06A 2C5HA 3GT7A 4JBLA 4KG7A 5KNCD 1NY5A 2V9CA 1WXHA 2WM3A 4QG7A 4WOCA 1QQ5A 4MGKR 3V1TC 3ILYA 2P7HA 3MJTA 3OQJA 2OVBA 3IUQA 4I4CA 3O1LA 3RRYA 3RYTC 3BXHA 4D8WA 4FMDB 2IHKA 4GMKA 4G0QA 4OYRA 3BRWD 3B9PA 4MUJA 2W8BB 3PICA 5B1DA 4UUAA 3TZHA 4AN1A 2UXDB 5FD8A 3DBRA 4ZTZB 1HT2E 1HDEA 3G8AA 3C5HA 2H4YA 2ZDHA 4DCJA 2CNNA 1T36B 2ATEA 1TZBA 2WHPA 5HPYB 3THXA 2NZYA 2GTPA 2Z6UA 1NTOA 1YE3A 1EE9A 3NFYA 2E6KA 4RM3A 3CKMA 4MJ3A 3N2KB 4UJ3A 3S44A 3GF4A 2O8NA 4BLQA 1KJ8A 3Q88A 4PZYA 1L7QA 2G80A 3CX7A 3PBKA 4MV6A 5THQA 2VRWA 3ZDQA 5EZYB 4J0GA 5KMGA 1JDUA 1UBUS 4OD0A 4X90A 2C0PA 2CUZA 1ISJA 2HQSA 3LI2A 3G0CA 1R4NA 4MWGA 1U8AA 1N8TA 5CTAA 4X8MA 3QKSB 4WRRA 5JVDB 3M83A 4Q1BA 3SZGA 3NATA 1SM4A 2QMHA 2OE2A 2ZYGA 4UEKA 1FS4A 3EOZA 2LP4Y 1PN3A 3FX2A 4L5BA 5EPUA 5ICEA 2DR2A 2QRGA 4JDPA 1CZOA 1NPTO 2VPXA 3FUCA 3H7AA 4Y1RA 4B17A 2QIPA 1T4CA 3QU4A 4EKDA 3DHNA 1NV8A 1UKYA 3C8UA 3OCWA 5F1YA 5BSMA 2CVHA 5BUZA 3H18A 2Z2YA 4NEHB 1R74A 2OBMA 2HK7A 4MYDA 4ESHA 1VL6A 2BRUC 2CK3A 4HAUA 3RC7A 5FADA 2O2ZA 3FVWA 5CLGA 3WLEA 2DUJA 3HFSA 3OZWA 4OBWA 4BC0A 2VDNB 5F77A 3AETA 1M6EX 3GEHA 1E2BA 2AMJA 3BD9A 3QXGA 1PR2A 3O4FA 3N0RA 3LVFO 3G88A 5LLDA 5B5SA 5AVYA 2V7WA 1MD9A 1M2EA 1NKVA 4W63A 3SXJA 3QEKA 3TBKA 2O2CA 2XD9A 5AXCA 3OX4A 1TEHA 3OE7A 1EM8A 1S2GA 2CJPA 2EG9A 1AHIA 2FW0A 1MUUA 3VYWA 3Q98A 1E98A 5FV7A 3BAFA 3RS3A 4PAWA 3W5IA 5JV5A 3SQXA 3HXMA 5BRJA 1G21B 4U7DA 1TX4B 5E0KB 5CEEA 4X61A 3A4TA 2CZQA 3PJFA 1ZOLA 3GCWA 3PNSA 4IUBS 2GN8A 1NM5A 2PQ6A 3QITA 2E5LB 2ZZMA 4DCTA 2O5CA 4LDQA 1TM2A 2GK7A 1C3OA 1FQWA 1OZHA 3F0TA 1I94B 4L8LA 3P4UA 4F5DA 3ZDYB 3DVAB 4UHBA 4Q7EA 1I5RA 2V7TA 1KMHB 2OZPA 3H75A 2H06A 4K6HA 1M1XB 3IO3A 1B1AA 4CQMD 3OHSX 4KO4S 1ZRHA 4FX2A 2IS1A 3AF2A 2E2WA 3EQ9A 3ZN2A 3RU9A 4BHTA 4XGIA 5KNBH 5GADl 1PT8A 3AY0A 3GPCA 1FRNA 4OXNA 3R9KA 1IRIA 2PAAA 3DYIA 4FD3A 4IWYA 3UB3A 2QQGA 2EZ8A 3VH2A 1L5VA 4UCFA 2AC2A 4TMYA 5IK2A 3L6BA 5EMLA 2ZR8A 2NVBA 1ZK4A 5DHTA 4ROTA 3EIHA 2UDPA 3EDOA 2ZVQX 4AJHA 4CTMA 1KYWA 1TUGA 4X85A 4B80A 1H2HA 1Y3BE 1ZRNA 3WQQA 1IJKA 3L46A 4D8XA 4WY8A 4HV4A 2ZAGA 3F78A 4MP6A 1ZIXA 4BBAA 1WHTA 2WMYA 2HBYA 2EBWA 3DBIA 1Q0HA 1AQLA 2IYAA 1LS6A 2J0UA 5JPIA 4AO7A 3LBIA 2A1UA 2I2BA 3BXXA 1FX0A 2H48A 1KJWA 4NDNE 4Z54A 3LPMA 2VBIA 3BKXA 3KJGA 5E6SB 4K9MA 2XI4A 4XOIA 4G23A 1YXMA 4CDRA 3PCTA 2YASA 3CPHA 4PS1A 1VC2A 3ZCVA 5JXWA 3TF5A 1MO2A 3HRIA 5LJLA 3B5EA 3QHQA 3HJAA 1IUNA 4XFDA 2ZRMA 1THGA 3AV0B 1GFIA 2BY4A 3A6DA 3DDNA 2Q6LA 3JQBC 3BZWA 3WBBA 3WHKA 1I7SB 1W5TA 1B0UA 2WR8A 1JMYA 5JDCC 1EJ2A 1A4IA 5A5GA 1NIPA 4HYYA 4F1WA 1M8PA 2PJZA 3LCCA 1SUFA 4H7IA 1DWQA 1L5SA 2P5TB 1HSZA 3EULA 3L02A 3ML1A 3PLRA 4J7UA 2ZETA 3T5AA 3NVMB 4LZOA 1P1BA 3T8YA 2I29A 4IXWA 1YRAA 4LJ5A 5HDBB 4DQXA 1HNWB 1VCMA 5D00A 5JNUA 3JQ7A 3KR9A 4A6DA 4TZ6A 2UUOA 1JB1A 3FCUB 3N8NA 4KN9S 4PQYA 1AGXA 4UHKA 4ER3A 2HL6A 2WA1A 3O9ZA 3T3OA 2PYZA 2VQEB 5HQ3A 1I3CA 1JHYA 1DUSA 4AKTA 3UPTA 2A86A 4HX9A 4TUYF 1JKJB 2OM2A 1ST2A 4HDSA 3IR7A 2Q3HA 1VLQA 3L07A 3Q3GE 1AK9A 4GECA 4HKTA 3E9YA 2E4WA 2QJOA 4Z4CA 3B1VA 5CT9A 1A77A 2GAFA 4MVJF 4J2TA 4B3BA 4G56A 1DO2A 4EJSB 2XV1A 2SCUA 1Y33E 3ANMA 2OAP1 3U7JA 1T34A 1A5TA 2DPMA 1RR6A 2XVYA 4U9UA 1KMMA 3MILA 4AS2A 3ONEA 2YFKA 2IC5A 3I1YA 2HLDD 5BVGB 1GGNA 4FFSA 2F62A 2XADA 4B5LA 1DAOA 4EUSA 1JHXA 2HWUA 1W29A 2P6NA 3MJSA 2P68A 4PGAA 2HHAA 1JVSA 4C4YA 3CVXA 1LLUA 1C7FA 1OFIA 2PL9A 3BXEA 4N6NA 4WFKA 3W7BA 1QX4A 1D07A 4MR7B 3EAGA 5G1NA 1GUBA 4EPWA 5K99A 2C2HA 4JR2A 4MP3A 2G9ZA 1FYDA 2CNWD 3DE5X 1QORA 3QY9A 4KR9A 3CH5A 3A7DA 1LI5A 1L6RA 1RQRA 1U1FA 5DNWA 3U4DA 1N8SA 3SM9A 5E3HA 4A91A 5ABPA 3PPWA 4FC7A 3ETEA 2IPAB 3L8ZA 1WUYA 1E3DA 3UMJA 3K70D 4ALKA 3ROZA 4ETIA 2V3WA 4M0UA 2BFBA 3GJXC 1AZLA 1X9GA 4ZI7F 3MBOA 2NXEA 1NJ1A 5JLAA 1T9CA 1JDJA 4EEZA 3SS7X 4CYMA 2VNKA 1E1LA 3T4EA 1A5SB 2F67A 2HBRA 4FDAA 1X8XA 2OGWA 5C35A 3BX1A 3GGCA 4AIRA 2CD7A 2IYQA 5FPSA 2JLZA 4UVEA 2BF7A 2WU8A 1LVHA 2O7VA 3EXHC 2IIQA 1CC1S 3FPCA 3IS3A 3ZGNA 5IAGA 2WWVD 4OXYA 4AF8A 1HNZB 2AFIA 3SOPA 3BSFA 2GESA 2HXYA 5DHAA 4UULA 2X0NA 3DOCA 1JBEA 2R48A 4GOXA 4MPPA 2I4IA 2WWGA 3F6CA 3OLVA 4U2DA 5FF9A 4G97A 4MUKA 4BBJA 1HQDA 5SY6A 1QFYA 2G0TA 3O84A 1P9WA 2FZEA 3C3CA 4NS4A 4TMXA 4BAUA 5TSDA 1QU2A 3C3MA 4JBGA 3LVBA 4FUQA 4C3ZA 1KMQA 3MLBA 3HKBA 3LL4A 1XXHE 2EZ9A 3QU7A 4IHKA 4JBWA 4M76B 4CG0A 3WMFA 3CJRA 2I6XA 4ZHSA 1QDEA 4X9XA 5IC5A 1W59A 2D4AA 2A9QA 4U3JA 3P26A 2IXFA 5DM60 3DT8A 2HSZA 3BWBA 3VUEA 4FEEA 5GONF 4ZEOA 3T9AA 3WTBA 1EFRA 1QVWA 2OV3A 2YKGA 4BFXA 4Q4HB 3NETA 1C7IA 5D1HA 1DEAA 3SN6A 2VWHA 3LSTA 1TZMA 3EPRA 1PHRA 2QMUA 3C87A 3TMKA 1XBTA 2F55A 3SX2A 2JCYA 3DL0A 3TL3A 2IQ5A 4M0KA 3HB5X 4EDFA 1OX6A 3OCVA 3ZX4A 5A1TA 1FRVA 2CV0A 3DEYX 2VZ8A 3OZCA 5KWIA 1Z8FA 1AF4A 4V0ME 1OLXB 4BB9A 1ZNYA 5DHRA 1EFUA 2FSUA 5CVEA 4QOIA 1FVHA 5U9CA 4I8IA 3K1TA 2BH2A 1G3IA 2GAIA 5FWYA 2C61A 1OAKA 2Y2VA 3LQKA 1FFSA 4MTLA 4HS4A 4C0SA 4PLHA 3C3EA 2YWHA 2JGJA 3FOWA 3BGSA 4UM8B 1R1DA 1SVOA 4Y30A 3ZD9A 4HB3A 3MSXA 1ISHA 2UVQA 3S8YA 1NBIA 1Z4LA 1Z4NA 1SB9A 2BGRA 1GTL1 2CNLA 2IPXA 3K9GA 4OQFA 4TSFA 5ANRB 1KU6A 1HX7A 3EISA 4Y6GB 3X43A 4CCYB 1XMOB 4Z4EA 4AW9A 3UBTA 1Q22A 3D5QA 2A35A 3QLJA 5CW2A 1XZIA 1EZZA 4K6KA 2GRJA 1K9SA 1OKKD 1VRVA 2DFLA 3BJIC 5JO0A 5H83A 2QUAA 5F2NA 3UTCA 3IPAA 1JEAA 2EZTA 2NW6A 2WU0A 5C4MA 2R8EA 3HVJA 3LXMA 3QRWA 3WGNA 3LM8A 3UKJA 3H3XA 1OH8A 4JGGA 5LN1A 1NZFA 4RETA 2AUTA 1BVYF 3OEED 2IP4A 3H42B 1U99A 5TPZD 4RQUA 3ZIAD 4R83A 2BH9A 4NKRA 4UZSA 5C31A 3GVXA 3HA7A 3FDXA 3N2GB 2EEPA 4UATA 3KSAC 1FFGA 2C1XA 4WQMA 1UDRA 3EG9B 3WK4A 4EUNA 2D5LA 3GJQA 3OQNA 4JDUA 1CUAA 4UE6A 1QTNA 1TU4A 1UL1X 4EB3A 2QKYA 1RAGA 2D7CA 1GOTA 2VDPB 3CISA 4PLCA 1GFZA 2RHBA 5DXJA 4UD6A 1GLNA 5EZQA 2V97A 2IV3A 1VMKA 4GXRA 2CXUA 1UM9B 2FX2A 4ND8B 1MOZA 2Q3DA 2FQWA 2HT1A 3BWCA 3LS2A 4UPEA 4I4NA 2AL7A 5FEUA 4PIVA 3LF2A 5JSZA 4IWNA 3MPOA 1FE8A 2X7XA 2O3RA 3GNSA 3PGJA 4HQKA 4OKSA 5EKXA 5HBRA 2NUAB 4AMYA 1B26A 1WB6A 4PLWA 4FSDA 5BY2A 5F2OA 1VECA 3AR5A 1CR6A 3FBGA 1U98A 2RBKA 4AG3A 1E3SA 4R40A 3MGCA 4Z86A 4C89A 4QG3A 3DVRX 1YBHA 4YRBA 2AFHE 3L7DA 3IDQA 3OE5A 1PS9A 4KPUB 4LHYA 4EMUA 5EHGA 1DXHA 4CUJA 3OFKA 3RHZA 1BDJA 1V6CA 3D0RA 3FAKA 3QVWA 4W9NA 2ZYDA 5L3ZA 3DW1X 3HJUA 1P33A 3KL4A 4IMIB 3V9PA 3VISA 4KREA 3QKIA 2E89A 2QJFA 1DIBA 4HCJA 3JSXA 3UK6A 3ZD6A 4YJ3A 3RRJA 4CLEA 1EAYA 1R2QA 3PIIA 1OILA 3SPXA 2P2DA 4O4JB 4ISBA 3VA7A 4WMLA 3T38A 5JZSA 3RS9A 5CM8B 2X3FA 2AVDA 3RRMA 3TQCA 2QD5A 5BOSA 3F5SA 4IIJF 1XZDA 1U3WA 4NFSA 3ZBUA 4MS4B 4UNPA 4NMLA 4YUVA 2PFGA 3ZI7A 5KUTA 4QOFA 3PXGA 1DC5A 1E2QA 3RS4A 5SY4A 4B8ZA 4CETA 3HDTA 4Q9NA 3ZWVA 4EYOA 4PQRA 3PEEA 1UZMA 1SKMA 3M8KA 4I50F 2Y4OA 3ZHUA 2KMLA 3CPJB 5FULA 4EKGA 4OI4A 1Q95A 3KTFA 2WJVA 3K9QO 4KXVA 4YMSA 8LDHA 2RGXA 3PWSA 3O74A 4LYYA 4INJA 1QANA 2ZWIA 3DEIA 3PJEA 1F1BA 2XSZD 3A2LA 4FEYA 4JGBA 1E1RA 1PP4A 4TV8F 5IAOA 4QPDA 1E59A 4QWMA 4W5QA 5EJ7A 4A15A 10MHA 2IVZA 3VR6D 1CQIB 1O4WA 4LRSB 5JEEA 2XGMA 1LW6E 3IHKA 3M6IA 3PL1A 2IH5A 4R0VA 5ESDA 4FCCA 1YB1A 2F90A 3TUJC 1E3WB 2AEEA 2IDKA 3Q10A 3BDVA 4WUVA 3ND8A 3PEWA 5CVVA 1UDXA 2MDTA 4YROA 3WVNA 1S3GA 1WD7A 1CYEA 5FBWB 3DMRA 4I8DA