1E4VA

Mutant g10v of adenylate kinase from e. coli, modified in the gly-loop
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two mutants of adenylate kinase from Escherichia coli that modify the Gly-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(phosphotransferase)
molecule keywords Adenylate kinase
total genus 74
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e4vA00
4PQFA 3BERA 4KCGA 5GJWC 1N6RA 4P31A 1IXRC 3VX3A 3AVVA 3RWMB 3A8TA 1A5TA 1HE1C 5M04A 3E1SA 3VR4A 2KJQA 4MKFA 1Q12A 1R0WA 3NH6A 1CBUA 2VP5A 2CCJA 2J45A 2N46A 3K9HA 1EFRA 4XD7A 4L15A 3WYGA 3CX7A 2OBNA 4C0AC 3C15C 1TPZA 5AUQA 3CRQA 5JI2E 1OH5A 5FI0B 1RRPA 1OFIA 1W4BA 2NPFA 1QHNA 3WHLA 5DYIA 5E7JA 4CEJA 3MG9A 3IBGA 3U5ZB 1GP2A 2IS2A 4Q9HA 5JEEA 2ONJA 3KB1A 3TUIC 4F38A 4M9QA 4R71A 3BS4A 3TW8B 2IYYA 4UJ5A 4DT1B 5L3VA 4M9SA 4M8NE 3V00A 2GCNA 4EUNA 5EQTA 1T3SA 1NG9A 1QHHA 3VFDA 1XJCA 5F98A 3WNBA 3NEJA 2XGJA 1TU3A 1FQKA 1AS3A 2VO1A 1S4QA 5BYKA 2DWOA 3OIWA 3E70C 4IVRA 3FYHA 3SJAA 3DOEA 3UWOA 3DVLA 3KZ1E 1W2HA 4JLMA 3TQCA 1Q1QA 3VKWA 3I62A 1KDPA 4ITRC 3R20A 1T0HB 4V03A 1N5KA 4LBVA 5GVRA 1DAKA 4DCSA 4DWJA 1GVNB 2VSOA 4ZV4A 1PLKA 1L8QA 1S3SA 3LFUA 3AGQA 1YHNA 2YC2C 3IIMA 3TRFA 3MWJA 4LRWA 4DDUA 5JWOA 2AX4A 5BXQC 3SNHA 3HU1A 2BVNA 4OI2A 2G0NA 4AKHA 5TDHA 3OFND 3LX5A 5F2EA 1XCPA 1YQTA 3I72A 3W6PA 1NLZA 2BEJA 3NVAA 4WXRA 4EAQA 1US8B 2OT3B 4PHFA 5H70A 1N25A 1NBMA 2XEXA 1N2CE 2GJ9A 2JJ2A 4R9UC 2RH5A 3DOFA 1KZGB 5K8UA 2G0TA 1RYFA 5DE3A 4A82A 3U7FB 1QDEA 3X1XA 4LJAA 1E98A 2CJWA 3QKRA 3WP0A 5DIFA 1E96A 1RKBA 4B6FA 1P9NA 1DO0A 2BM1A 2C96A 2YINC 5EE5B 3DM9B 5DI3B 1S9DA 3IO3A 3VAAA 3RSOA 2QY9A 4R2IA 2P2LA 1SKYE 3CO5A 4AY2A 2QORA 2A2ZA 1XTSA 1ZC4A 4HUQA 4A4DA 2CL7X 3PCRB 3FFAA 1D2MA 4A2WA 4OHXA 2G77B 4O2RA 3Q3JB 1IOZA 3QPUA 1M1YE 1US8A 4MRRA 3AVYA 2HLDA 3HJNA 4GOJA 1GTVA 1GITA 1R10A 1I2MA 3LLUA 1UKYA 2DY1A 4Q9JA 5CK4A 4DLRA 1G20E 5KPJA 1S1MA 4C4PA 1BIFA 2ZYUX 3QQ5A 2FF7A 3GJ3A 2FJUA 2FA9A 1NBME 4CYMA 3EPKA 1KMQA 2ZRPA 2C78A 3KUDA 3TKLA 3EASA 2IT1A 1R0ZA 3L2OB 4BFZA 1IONA 2ODBA 3BFKA 3SU8A 1GRRA 3UKDA 2IUTA 4EPRA 3O47A 4TL9A 1GM5A 2XB4A 3KFXA 4F91B 3A1UA 1AKEA 1FQJA 1Z8FA 2A9KA 4Q19A 3K0CA 5LB4A 1G8GA 4P4TA 2WSSA 3RRNA 2D4HA 4NZYA 3ZDQA 4A92A 1CJMA 3L0IB 2Z4SA 4RD3A 3R7WB 2PCLA 1GL6A 2ATXA 2QU8A 3I61A 2ORVA 1R5OA 5FPTA 1M7GA 1G3RA 3W8NA 5KTYA 2IHYA 1Z08A 1E2JA 5FL7D 3LA6A 4DXAA 2FV8A 2UZ3A 1P4SA 4KVGA 4HUTA 1FX0B 1C1YA 2CDNA 4IDHA 1W49A 4D82A 1XEWX 2ZE6A 3RDPA 4QGGA 2GEUA 4GT1A 5HR5A 4Q7LA 4I99A 3W8RA 1N6OA 1G3UA 3SDZA 2R65A 3VR5A 3KUCA 1EK0A 2H1LA 2XXAB 1JAHA 2E87A 3IQXA 3THWB 3K1JA 1N6LA 1QF9A 1XMIA 3PUWA 5FR1A 4AKEA 4OBEA 3LO5A 4H1VA 2ZAOA 2SHKA 4OQNA 5KSYA 4I81A 3I8XA 1WBBA 3NC0C 2J0QA 2J7KA 5P21A 2BJWA 3OF5A 3THOA 2GBLC 1QHGA 3IILA 1BMFD 1WMSA 2HYDA 2JEOA 2QTFA 2BEKA 1G4AE 2W6JD 4Q66C 4Q7MB 3UMFA 5AR1A 1KDTA 4JVNA 1D2NA 1NVWQ 4JJKA 1MO4A 2HLDD 2J46A 3AUXA 4US2R 2ZITA 2XXAA 4NPHA 2JCSA 1ZD9A 2QP4A 2J87A 5EXTA 1IBRA 5C2JB 3C8UA 3L0OA 3TE6A 2ZUDA 3VR2A 3F3YA 1Q20A 4KSBA 2QP9X 4HDCA 2ZI3A 3B5JA 4N0EA 4NH0A 1XXHB 5C46F 2WSMA 221PA 3EZ2A 1NMZA 3IUYA 1AN0A 1DO2A 1SVKA 3ZH9B 2FFQA 2XAUA 4DCNA 3CZPA 4A0GA 1DELA 4DSNA 5JECA 4NHOA 2ZTSA 3B1VA 4WW0A 2Z83A 1T8UA 3OHMA 2PJZA 1AJEA 1AA9A 4QOSA 1VHLA 2GJ8A 1KI7A 1NSFA 2F9MA 2RCNA 3OE7A 4GZLA 3GLIA 1TX4B 4ZCIA 1AS0A 1TNDA 2BM0A 2FG5A 3BORA 4MA4A 2ZR0A 3N70A 2OBLA 2RAPA 2P6UA 4TYPA 5JWRA 3RRYA 1VTKA 2WAYA 2OM2A 3SS8A 4AG5A 1NG1A 5JJIA 3BB4A 421PA 1TF2A 5IDVA 1P75A 3OEED 1C9KA 3GFOA 2H8KA 4L16A 4YQFA 2C03A 3PENA 4BFSA 1RRFA 3W34A 4OYHA 4OKSA 4OHWA 2CVHA 1ZYUA 3B9QA 4LV8B 1IN4A 2GHIA 4QBFA 2E1RA 2UKDA 1JAIA 1JB1A 3M6AA 5LD2B 1Z07A 4MKHA 3WHKA 4TL7A 4C30A 4M1TA 2ZI5A 1SVSA 4K46A 4QXAA 1AZTA 1J7KA 3NBFA 4NTZA 5FBLB 2WJIA 4TT3A 3VTKA 2I1QA 1T3LA 1XXHA 1SHKA 3ZZ0A 4ZI2A 2Q9AA 3R9IA 5JFGA 3R9XA 5AJYA 1X1RA 2BIFA 1XEXB 4FMDB 4F7WA 3K70D 3QF4A 4Q21A 5A4JA 2VIIA 4WZAE 2ZE5A 121PA 2OFXA 4R7ZA 1XTQA 2CK3A 4TYQA 5KDDA 4URVR 3U6KA 1SVWA 3TQFA 4WBSA 4BEJA 1V5WA 4BFUA 5CLLA 2ZXUA 1D8TA 2OFWA 2V1XA 3Q85A 4QRHA 5E4FA 1Z22A 4FMBB 4CGZA 2D7CA 1VDZA 1H65A 2O8EB 5CM8B 2GTPA 2IYUA 2ZREA 3B82A 3HYTA 5JRJA 1IXSB 3KKNA 2ERXA 2ZJOA 2EWWA 1E9BA 1D2EA 1G5TA 5F9FA 1X6VA 4BFYA 2F6RA 1OW3B 4B2IA 1YR8A 5JMTA 2J0SA 4M1MA 4WAUA 3PJRA 3CLVA 2QN6A 4XSGA 4WA7A 1OHHD 2ZRAA 1CF4A 1MO6A 2ZJ8A 1G7SA 3X1WA 2ZSBA 4RZUA 4KFRA 2YZ2A 4LUCA 4JMPA 2DBYA 2IUUA 4OQMA 2ZS7A 821PA 4HUQB 3GJ5A 4CVNA 2GVDC 2FPLA 4JL6A 2V6JA 3AKYA 1S2MA 4BZPA 5GJBA 1N5JA 5L3RA 2RGGA 3GLFE 3RABA 4HZIA 3CF6R 1NVXQ 3KQHA 1TQ4A 1OKKA 1S3GA 3K0SA 3N2IA 4S35A 3LQQA 2FSIA 1UFQA 1E0AA 1KI3A 1KI6A 4KFTA 2JJ1D 3A1SA 1DBSA 1UPTA 1ZBDA 2FSGA 1NN1A 4QJ5A 3TR0A 1QG2A 2R8RA 3EWAA 1VYVA 2FX3A 3EPJA 4AKIA 2A5FA 3QVVA 1XPOA 2ZI7A 4IXNA 1Q21A 3I8SA 1S9HA 4Q4HB 3LDAA 4CIDA 1Q1BA 1KDOA 4MGKR 3RNLA 1FNMA 3EA5A 1G7CA 1FUUA 4KVAA 4D4LA 2KB0A 4KLZA 2PZEA 1II8B 4E07A 4Q00A 2R2AA 2P5SA 4AIIA 3T5DA 2QE7D 1ANKA 4WVFA 3EZ9A 4KYUA 4TMVA 1FPMA 2BHRA 2QGNA 1P60A 3DKPA 1A82A 1KSFX 2X2FA 3O8DA 4G5SA 4DLYA 4XWKA 1G19A 4Y0VA 5D3QA 4MRNA 4HB0A 3U3JA 3AVWA 4BFWA 1ZINA 1MABB 1YZUA 4LZZA 4N3NA 3BJIC 2ZRFA 4UNSA 4D4JA 2CLSA 2NO7A 3LWNA 4KU4A 4ABYA 2IEYA 4LOAA 4F4CA 1G7TA 4UJ3A 1TMKA 4HDQB 2RGXA 4C0HA 1S8FA 1NVVR 3TH5A 2AHOA 1G17A 1VG8A 3FHOA 3K9LA 5K8IA 4C7OA 3RAPR 2PMDA 4FCVA 4PAQA 2BJVA 3GCGA 1N6HA 3CNNA 1E69A 1Q3TA 2G88A 1CP2A 4OQFA 4HLQB 4L9WA 1RE0A 1SGWA 3LW7A 1UAAA 4DRZA 3R9WA 1L2TA 3EIHA 3TLXA 2VBCA 3FPAA 1U0JA 4LHYA 4OK6A 2GK6A 3OZXA 1ZU4A 4TLEA 5B30A 3NH9A 4B3DA 3CNOA 4LJ8A 6Q21A 4QBGB 2QM8A 3GLFB 4JVSB 2XJ9A 1U0LA 4TWZA 2IYTA 4XTCS 3SHWA 2CNWD 2RGNC 1XRJA 2WWWA 4KSCA 2ZU0C 5B57C 5EJEA 3FDIA 4NU0A 5CB6A 1HURA 4M2LA 4AYWA 1AZSC 2D06A 5FOSA 4DCUA 1E0KA 3BXZA 1E9EA 4BRWA 5L8VA 1KI4A 4G01B 4DSUA 2QQ0A 3CB4A 4IOJA 2VRWA 3EA0A 1P2SA 4PC7A 2O8CA 2IYSA 3GJ0A 4L8GA 2FSFA 1ZCBA 4RD6A 3PITA 1SVMA 2G6BA 1EWQA 1P2UA 3RS5A 3CBQA 2XSZA 4Q7KA 3ECCA 2OAQ1 1KI1A 1KAOA 3THWA 1M34E 2YVUA 4QG7A 2CNWA 3FTQA 3GLHA 4XWOA 2ZR7A 4Q48A 3D7MA 3K70C 3BFVA 4A2PA 1FUKA 1KY3A 2QAGA 3L8YA 1Z2AA 5E3HA 1W36D 3ZD6A 3SR0A 1E2LA 3MFYA 1TF5A 3QEOA 2A78A 2WKPA 3NHAA 3B9PA 3PG5A 5C4GB 4Q4JA 3LXRA 2WZQA 1KJZA 3LVQE 5AJWA 2ZSAA 2V7QA 1Z6AA 5CM9C 2W00A 3Q8XB 4A0HA 4PZLA 3PEYA 4LPKA 4PC2A 4PO9A 4EJSB 3WY9A 4KFSA 1C4OA 1GILA 4DIEA 1IY1A 4JS0A 3RS3A 1GZSA 2W58A 4NP6A 1O3YA 3FB4A 2OCPA 3U4QA 3RLFA 3T1TA 2WIAA 4YMUA 3LH5A 4CEIB 1RYHA 4L4UA 3SBDA 3ZD7A 1PVOA 1JXOA 3AUYA 4IEEA 4Q1CA 3GLIB 1G64A 2AWNA 5FOXA 4PSKA 2OXCA 3I1FA 3UXMA 5K8LA 1CKEA 1RIFA 5TVKA 4D26A 5D3MB 5DGXA 1GKUB 3Q72A 2C5LA 2NO1A 2RKOA 2FMXA 1ZNXA 1XPRA 3U44A 1RZ3A 2J7PD 2B8WA 5DI9A 1PJRA 4B2PA 4KBFA 4CDGA 4QKQA 1QG4A 3KQLA 1YKSA 2GXSA 4CT5A 1EFTA 5EZ6B 2FEMA 3V9PA 4TT3D 4RKFA 3U2QA 3OFNA 4JL8A 1T5LA 4AWXA 1LB1B 2JJ8A 2XNSA 2HF8A 3GLGA 3X1YA 1AKYA 1MRSA 4F93B 2W6IA 2WWYA 2QTVB 2YHSA 4FXPA 1GNQA 3GJ4A 1JR3E 4PAOA 3QJYA 1X8JA 1G5RA 3W3AA 2IXFA 2QA5A 4Q4AB 3W3ZB 1OB2A 1N5LA 4IOLA 5FL3A 3UANA 3RRZA 1YZKA 2ZYTX 4V0ME 5J40A 4DDVA 2G83A 3CRW1 1WBDA 2CVFA 5FUWA 4FW9A 2Q0HA 2ZU6A 1Z63A 4G5OA 1QBKC 3T1OA 1E2QA 1XEXA 5B58C 3B1WA 2GAAA 2WWXA 3QXSA 4DEXA 1W5SA 1M2OB 2IS1A 1YJ5A 2XNDA 3C14C 1OSNA 2Z43A 1S96A 5IRCD 2CHGA 5SZHB 3P27A 1CTQA 4M1WA 2HJVA 4DCVA 1H8ED 1T0JB 3DZDA 3QNUA 4LWZA 3PEUA 1TUIA 2CLCX 1QHYA 3SN6A 5AUPB 1E9RA 5AJXA 3IHLA 4ZDKA 2GXQA 4ARZB 1JR6A 2ZSFA 4FMCF 5E7MA 5F3WB 2JIZD 1R0YA 1W0JD 4PHGA 3A4NA 3C4JA 3QKSB 2BBSA 3MWKA 2GXAA 1XP8A 2PEZA 5K8TA 1Q44A 4JBXA 1YU9A 4PC6A 4N1AA 5JS7A 1XD9A 4EIWA 2A30A 3NHBA 2BMJA 4M1OA 2GZDA 2L0XA 4HAUA 4Q9LA 1QVRA 1Z28A 4GOXA 4EPVA 5G3ZA 1I4LD 4EKDA 1W5TA 4JLAA 3BB1A 5JLJA 4E22A 2R6DA 5FTJA 3EPLA 2VSFA 4DKXA 1H8HA 2WWHA 3SI7A 2ORWA 2AK3A 2PLRA 3QKSA 3QVUA 5G41A 2GF0A 1U90A 3OIVA 4GI7A 4LV5B 3DM5A 2QPTA 3A58B 1LS1A 1TQ2A 2WIBA 1OH7A 1IY2A 4I1VA 4QGHA 4ZCMA 1IN6A 2IX3A 3CUEF 4PTLA 3UG7A 4IRUB 2GCPA 1GFIA 2W6ID 2ZUBA 1NLYA 4OQXA 4RCYA 4GZMA 5JHHB 4FD2A 1YZLA 4Q4HA 3TNFA 2GRJA 2ZAMA 3AF3A 1MV5A 3LRPA 2GNOA 3FHTA 1L4UA 3T61A 2PLFA 1L7VC 1RRGA 1NN0A 3IPYA 3B8HA 3K70B 4KFUA 4P32A 1SHZA 1U9IA 3A4LA 4TQUS 1VHTA 2ZEJA 3WRYC 5KNCA 4EDHA 4Q4AA 3GJ8A 4JKIA 1MOZA 2GJKA 4M9ZA 1E9SA 4OI0A 3BBPA 1RW4A 1G5PA 4JIMA 2ZYWX 4G3XA 4LYAA 2GVZC 1Z0AA 3VR6A 2CK3D 2PX3A 2ZR9A 1ZNYA 1XDBA 3F0TA 3Q9LA 2MMGA 3K8YA 1PUIA 3KXKA 1Z5ZA 3TSOA 5HCNA 3IEVA 2NZJA 2W0MA 2R6GA 3QG1A 5FOVA 1ZM7A 1JXMA 2B92A 2O0KA 1KNQA 2OG2A 4W9MC 4LJ6A 5B2ZA 3I32A 2IBMA 1JJVA 1U9IC 2RGCA 1SKQA 2HXYA 3SJBA 4MQBA 2C99A 1X3SA 4HLDA 2O8BA 4DHEA 4B75A 5FUVA 1XF9A 1LW7A 1VYUA 2IYXA 2OV2A 3KXIA 4V0NA 3TR5A 1FP7A 1KMHA 3ZVMA 4TMXA 4DJTA 4LHZA 1AIPA 4GRAA 5D3MA 4LV6A 4D4MA 5DISB 1H8HD 4GFDA 4HAXA 3ZS9A 3JVUA 2ZRLA 4YXWD 3B78A 3U7GA 4ILEA 3K0FB 4BASA 5CK5A 2HCBA 3RHFA 2VF7A 5SZJA 2C2HA 3PEVA 3P4YA 4TMTA 4RFSA 2IW3A 2GAOA 4YMTA 1P5ZB 1OIWA 2NPIA 1T5IA 1YZNA 1KMHB 4JLBA 2WJJA 1KO7A 2CLDX 2XJ4A 2QSYA 3RS0A 3BOSA 4XH9B 4IEIA 4PQYA 3SYLA 5HTKA 1FX0A 4B2LA 4KJZA 3B6EA 5KYKA 3H2YA 5KDOA 3EPHA 1AQUA 4RCZA 4CF7A 1GRNA 3MSXA 2BCGY 3ZS8A 1EX6A 2WKQA 2QM7A 3LD9A 5FUYA 4GOKA 1Z6XA 2QGZA 1Z0FA 2Q6TA 4MYHA 2B7BA 4TYYA 3VR3A 2MSEB 3UATA 2ZVQX 4B43A 2EYUA 4DLSA 4GL2A 1KKLA 1P9WA 2C8VA 4V02A 2ZJ5A 4MRSA 4BQSA 4LYJA 1E2DA 4GMDA 1VCMA 4Q7JB 3TUZC 3B85A 1E9FA 1OXSC 3LBHA 5EXSA 4OQLA 4D4KA 3S1AA 5BWMA 4JLOA 3RYTC 1CJUC 3CH5A 3QOFA 4LDJA 2P6NA 1AK2A 4JVMA 1JALA 4EPYA 3I73A 5JSZB 3PEWA 1IXZA 1YE8A 2RMKA 3T06B 2JLUA 5DO9A 1E1RA 2JLWA 1KO5A 1OIVA 5AJVB 3RANA 2QMEA 2ZRBA 1WF3A 4G5RA 3GLGE 1GKYA 1K8RA 5L3SB 5J4KA 4CEJB 2CHVA 4G5GA 2QMUA 4EFLA 5DH9A 5GJCA 4DDTA 2FN4A 1DAMA 3CH4B 1QHSA 4P4SA 3AKCA 1OLOA 2A5YB 4UXIA 4NBSA 5FOUA 1R0XA 1ZNZA 2PEYA 1XTKA 3Q7QA 1MRNA 5J4YA 1G9XA 4BZQA 1G3IA 1RJ9B 3CRRA 4Q1BA 3UPUA 2ZRCA 4QHYA 1TF7A 5EE1A 1P2TA 1X86B 5L3SA 1ZVQA 3CKLA 3QXCA 5KSZA 2H17A 5DYGA 3EWSA 1KK0A 3IHWA 2P67A 1IAQA 2FWRA 2GXUA 2GWHA 3I92A 1EG7A 1E0JA 4EJSC 5AUNB 4ON9A 1E1QD 1KAGA 3AP2A 3CWZA 2QENA 4Z51A 1NL3A 2FH5B 3WRXC 4EFNA 5EZ5A 3ONWA 2AKAB 5IK2A 4F4JA 1Z2CA 3RVBA 2N42A 4LBYA 2ZRKA 1OJLA 3TW4A 4B44A 2H92A 5KPDA 1Y3AA 2I4IA 4C0JA 4DT1A 5IHPA 4W5HA 3FWYA 3QPVA 1MR3F 2BBTA 4P33A 3EX7C 2ZROA 1E2IA 3QSYA 4IDQA 2FGJA 1SXJD 2HCJB 2Z4RA 4AI6A 2H16A 4BFXA 2O0HA 4DDWA 1NLFA 2DPXA 1DAFA 2ZS9A 3DKVA 5TV2A 4BPBA 2YWGA 2HT6A 1YRBA 4EPXA 1XX6A 1A7JA 2P5TB 2OSBA 1XJQA 1ODFA 3CZQA 3GFTA 4FINA 3MAAC 4DUGD 2ORIA 1DAEA 1II0A 4LHXA 4KV9A 4LBWA 3VR1A 1XZPA 4MGZR 4OK3A 1CU1A 3FMFA 3W9YA 4ASUA 2BKUA 2OAP1 4B73A 1Z6GA 4W7SA 1P73A 4DB4A 3SBEA 2OCBA 4C7OB 4KODA 1EFUA 2RGBA 4A0RA 3AP1A 2KI5A 2QT0A 3IGFA 1DAIA 5EP4A 1T9HA 5FTNA 1G4UR 4HAYA 4OJQA 1YR9A 2HJGA 5HZHA 4Q1DA 2O0JA 4MGYR 1KJWA 3QKTA 4G0NA 3LAWA 1ZW6A 4EPWA 4W5WA 1EGAA 3R8FA 4Z54A 3QPWA 4V0KA 3KTAB 3D8BA 4TYNA 1ZJ6A 3WXMA 1J2JA 2ZE7A 2ZJAA 3BB3A 2O5VA 3TMKA 4AYTA 1DG3A 4F92B 2VHQA 4JT2A 2EVWX 4C0BA 4QM7A 2GK7A 1B0UA 1N6IA 4B6EA 1PLJA 1Q57A 1CULC 1UKEA 2X1VA 1FL9A 4JLJA 2FOLA 5SZIA 1N3BA 1R5BA 4ZKEA 4YDSA 2R9VA 3VMFA 5KSOA 2AD5A 1R8SA 4XVRA 1E2MA 1P7CA 3GEEA 3AVXA 1J70A 1TAGA 1O87A 2DWQA 5JZVA 5JS8A 2CMKA 2QAGB 2WPDA 2ZI9A 4XSHA 4OI1A 3WNCA 1WB9A 4WIAA 4LX0A 3GPLA 2ZRJA 5IK2D 1T8TA 2HV8A 5DI3A 3BFXA 1X8KA 1KO4A 1NMXA 3PUYA 1ZD1A 3NIBA 1EX7A 2IS4A 2IF0A 3LVRE 2E9SA 1NI3A 4DC9A 2D2EA 3ZVNA 1W0KD 1KZ7B 3FGNA 1IM2A 4RD1A 4JLVA 4PZZA 1BYUA 5H68A 2F9LA 3P32A 3BH6A 4LC0A 2WPDD 5FOTA 3MWLA 4GP6A 1S1CA 3MCAA 3K9GA 3CPJB 1UEIA 1D6JA 1T91A 1YZTA 4HDOB 4S2EA 1NN5A 3AM1A 4X8LA 3W6OA 3U3MA 2W83A 2D74A 1F48A 1W36C 1E3MA 1GKIA 2GJAA 2J1LA 4LPSA 3IBYA 3L0SA 1NNEA 2FE4A 3G82C 1YR7A 1N0UA 2KWIA 5CIQA 1NVVQ 1W0KA 1LY1A 2CL6X 4PPFA 4U7DA 2JLXA 4EPTA 4RFSB 5L3QA 3BE4A 1R2QA 1ZM2A 3B2EA 4M0LA 4JLNA 4CT4B 1Z0IA 3THYB 3EIQA 3A6PC 2G1JA 1E9AA 3ETLA 1AS2A 4NKRA 4G5QA 5CDFA 1FW6A 3ADDA 1BKDR 4Q02A 3EC1A 2WWIA 1F2TB 1DG1G 1KKMA 1FTSA 2ZRDA 4OHYA 1R5NA 4LK2A 4W5JA 2KSQA 3H4MA 4G1UC 1W48A 2GZHA 4A6XA 4C9BA 1E2FA 4URYR 5G53C 4HB4A 3QXJA 1NN3A 1SQ5A 1UKZA 3EIEA 3HPQA 2QI9C 5FL7A 1YZQA 2C9YA 4LSGA 2RGNA 2EYQA 1WXQA 2QMOA 5EXXA 4MGIR 4M21A 3RC3A 1NSTA 3IDQA 2VP0A 3AVOA 3REFA 4B76A 4KLNA 4BUJA 2J7PA 2DFLA 2REBA 1IN5A 3EG5A 1SXJE 1T4GA 2ZI4A 3MD0A 3IEUA 3AP3A 2JATA 4RZ2A 4BE7B 2ZM5A 4C2UA 1OFTA 2B8TA 3QEJA 1W7AA 1NKTA 1MH1A 3NDBB 2CL0X 3RC8A 3GLFA 3BD9A 4YC7A 1EWRA 1XWIA 5JEDA 3OEEA 2NIPA 1SVLA 1M8PA 2J3EA 2W2XA 2QSZA 4JL5A 2FU5C 4JJZA 3K0AA 1VECA 4TQ9A 1Z47A 2LWIA 4ZO4A 5J5CA 2IXGA 3GD7A 2WJVA 2QPAA 2ZSDA 5ANRB 4PHTA 5JCPA 1LV7A 2VQSA 1KJYA 3QKRB 2OFOA 4TTPA 1VKJA 1R7RA 5JHGB 1HE8B 2DFNA 3E2IA 3ICEA 3ZVRA 3UWKA 4UNNA 4AG6A 1CRPA 1JBKA 1GNRA 2VHCA 5CLQA 5HKKA 2YWFA 5JSZA 3GFPA 3CX6A 1T3HA 3KB2A 2ZQ5A 4M4SA 1D9ZA 1GG2A 1OT3A 2H5EA 4ZDWA 5C18A 2NZ8A 4MRPA 1ZAKA 3X1DA 2RHMA 4OK5A 1CEEA 3A1VA 3V4FA 1U81A 2A5DA 1RJ9A 4WXPA 1Z3IX 5AWFC 5KUTA 4TMKA 3HPRA 3ZJYA 3IPXA 2QBYA 1X8LA 4PC3A 2QQEA 3QY0A 2QROA 4D2IA 1K5DA 1Z6TA 5BN4A 3Q5EA 2Y8EA 1KYIA 4IHQA 2PT5A 2YNMA 1XU4A 1HEIA 2HF9A 2UZIR 3H84A 3VKHA 3VQTA 3ZIAA 2JIZA 1JI0A 2XZPA 2D7DA 2OLJA 1E79D 521PA 4URWR 3SC3A 3ADKA 2XTNA 4IKEA 2ZE8A 1LNZA 3AB3A 1E9CA 4RKEA 4YMSA 2IWRA 3ZGXA 1M74A 3TGPA 2AFIE 3FHCB 1UF9A 2OBMA 1F2TA 2VP9A 3K53A 3LW8A 3CRMA 4PPGA 2NTYC 3C7KA 4HLUA 2O8FB 4LC1A 2NO6A 5CJPA 3UIEA 1VG1A 1ETUA 5KDLA 1A1VA 2K5UA 3KJGA 1CR0A 3FMOB 5GADl 1GIAA 4DLVA 1NRJB 4RZ3A 3D31A 5DLQC 4A6PA 2QG6A 3CF0A 1VG0B 3L8ZA 4E5UA 4MYUA 4Q47A 1M7HA 1WDTA 1IN8A 3KQUA 4TZ6A 1WRBA 5CITA 4DUGA 1E79A 3MRSA 1SVOA 1D5CA 2FFHA 4M22A 2OILA 2BBWA 4O2LA 4O25A 1VIAA 3U3KA 1JR3D 4GP7A 3BC1A 4MH0R 2PMKA 5DN6D 3H86A 2ZPTX 3CWQA 3IO5A 1XMJA 3TSWA 1KK1A 1OF1A 3EZ7A 4NCHA 4A2QA 4NMMA 3O8BA 2O8FA 3CF2A 5AUOB 1NIPA 2P0EA 1DE0A 2OUKA 4V0MA 1OPXA 4Z1MA 1UDWA 1QRAA 3BK7A 3OIUA 2CE2X 3CR8A 4FIDA 3ZVLA 3RWOA 1E4VA 3RSLA 4B3FX 1XCGB 1XD8A 1Q1ZA 1OE0A 5HKKD 2EFEB 2A3RA 2VSXA 4JLPA 4C2TA 8OHMA 2VHTA 1ZIOA 4U00A 5LPNA 4A0FA 4A8JC 1R4AA 1FTNA 1Y63A 4BLOA 2JLRA 3CIOA 1Z83A 1MKYA 4A1FA 1G21E 1E99A 4ERNA 5KHOC 1XTRA 2BMEA 2O52A 5JJLA 5JWHA 2FZ4A 2WOJA 2Q3MA 1NP6A 1KO8A 1B23P 4J0QA 4LCBA 2ZRGA 2AXNA 2XITA 1N6NA 1KGDA 2NOAA 3PFIA 4QJ4A 5H8WA 1GOTA 3AVPA 4TSFD 2JASA 2F1HA 1JPJA 4Z8XA 4TTQA 2RGDA 4K8OA 2QPOA 4CZ2A 3T12A 3KXLA 2F7SA 2GCOA 2YOFA 4M1YA 4CW7A 3PUXA 4HYYA 1OKKD 4Q03A 1SZPA 2ASEA 2GILA 2HXSA 4D0LB 4MYCA 1GWNA 5JI3E 1U94A 1OYYA 2DFTA 3AEZA 1AGPA 4R98A 5A5GA 3J81k 2BDTA 4NCIA 2I3BA 3B7GA 3JZAA 3L43A 3QENA 4TTRA 4NCNA 3WMFA 2AK2A 2QUZA 1OIXA 2QRNA 3DZ8A 3ZQ6A 2C77A 2V8OA 1IQPA 2PBRA 1MO5A 3K0CC 2OO7A 4XWAA 1FOEB 1E2NA 5CIWA 1MABA 3AQ4A 1KK2A 4IJMA 3KKPA 3GEHA 5EP3A 4C0SA 1U8ZA 1DS6A 2DCUA 4NE2A 5EE3A 2JLVA 3LBIA 2VA8A 3TAHA 4Q9KA 2J0UA 3EW9A 1GL7A 5G40A 1BO6A 2AKYA 2NO0A 3PXGA 1XD2A 2PZFA 4QHTA 2YOHA 1JR3A 3K09A 1G18A 5DN6A 5A0FA 2XX3A 1NKSA 4LI0A 2QRZA 2IS6A 1CJVC 1HQCA 3A1WA 5HE8A 3C5CA 3TUJC 5C1BA 1GL9B 4B3BA 2ZJ2A 2CHQA 3SE0A 3F5FA 3WYAA 4BFVA 2V3CC 3NBZC 5FBQB 4PSVA 2VP6A 1CLUA 2EW1A 1KO1A 4IFEA 4OJKA 4RD4A 2YYZA 1COWD 3FMPB 1G3MA 3JZMA 1A4RA 1W47A 3EXAA 4MUBA 4EQ6B 2V55B 1KHTA 1K5GA 2IA5A 4RFVA 4JSTA 1E2EA 2R6CA 3W5IA 3QI2A 4TYWA 3AGPA 3NKVA 2PCJA 3B1XA 1Z6YA 4HLUC 3AVUA 2XOKA 1MO3A 3Q5DA 1G6OA 2EQBA 4JBWA 3CPEA 3RS4A 3AF0A 5FTMA 1SULA 5FPKA 4KBGA 3CX8A 4H9GA 3HU2A 2ZI6A 3U4QB 4P0TA 1SKYB 3CM0A 3EZ6A 1RC8A 1J99A 2XTMA 2IYRA 2AL7A 1NMYA 3SFZA 4RSGA 4FN5A 1P62B 4HAZA 2OESA 1YR6A 2ZANA 1E94E 1YVDA 2CE7A 3GEIA 3H1TA 2WSSD 1DTSA 1GUAA 2G9NA 4A8JB 1XD2B 2VLIA 4YMWA 1JQJC 1KI8A 3X2SA 2DR3A 1OXXK 4D6PA 5B64A 3QE0A 3BWDD 1E9DA 5TMPA 2CCKA 5E95A 4ZDJA 2R62A 3WMGA 1W36B 2RGEA 4LJ4A 2XZLA 3ASYA 2EFGA 3JVVA 3N5CA 3AF1A 3K09C 3QF7A 4C0KA 3REGA 3PIRA 4PHHA 3LLMA 2HYIC 3EZFA 2CJWB 2CEAA 1E2HA 2AXPA 2Q3FA 3BIFA 3SHFA 2N1BA 1DPFA 1TEVA 1G16A 1T6NA 4JKYA 2IF2A 3MMPA 1YRAA 1TQDA 2F55A 1R8QA 4IDNA 5GJVC 1WQ1R 5LB2A 4I1UA 2JLYA 1P6XA 3HDTA 1BOFA 1U8AA 2KBEA 4A36A 4GPTA 2A7QA 4PAMA 5BN5A 2FZLA 3NBYC 4PFSA 3LY5A 2WTUA 5BW8A 4NYIR 1E2PA 4WZBE 3NXSA 4US1R 4DLTA 1HQYE 4KHZA 2AWOA 1E2GA 5KNDA 2W6JA 4I1SA 3KDSE 4LJ9A 2V7QD 1G3QA 2O8DB 4LJ5A 4WZ6A 1OB5A 3QXXA 2FDCA 3ASZA 2EFDB 4QNMA 4QC2A 4PSAA 1BMFA 3DEFA 1HA3A 2J59A 4ZIRB 2OHFA 4M9XA 4ASUD 5LD2C 2RHDA 2B21A 4UKDA 3U3OA 4GBMA 3KFVA 3B1YA 1ONBA 4B3GA 1QHIA 3QG5A 2YKGA 2BC9A 2QAJA 3LNCA 4AD8A 3DMDA 5CB8A 4AURA 3T1QA 1GNPA 3SYNA 4B3CA 4CEIA 2XNDD 4MITA 1QHHB 1W4AA 2AFHE 2FFAA 2WV9A 2C98A 2O8CB 2FPMA 1IY0A 1XFAA 5C4MA 4FWTA 2KBFA 3U61B 4DEYA 4PPQA 1J90A 1Q3HA 3CR7A 4DLWA 2ONKA 4XVUA 2JLQA 2QL6A 2VF8A 5UKDA 1NIJA 1XNJA 1HV8A 2WJGA 1I2DA 2HEIA 2GDJA 2A5GA 1RFLA 2I1VB 1DARA 4DZZA 1H8EA 1XJ0A 2F3TA 3U7HB 1P3JA 3AH8A 1CR4A 3WNDA 3SEAA 2QEQA 2PX0A 1E4YA 1G8PA 4UXHA 2BOVA 2VP2A 4H1UA 1CXZA 4TL8A 4JZKA 4HAVA 3W6NA 2H7VA 1TTTA 2BCJQ 3D6TB 3NWJA 4N0DA 2ZJYA 5J4HA 4DVGA 5ELXA 4BLSA 1TQ6A 2FNAA 1FZQA 1GDDA 1DEKA 1VPLA 1W4RA 2V54A 1OFHA 4GNKA 4NONA 2C9CA 1TL7C 4Z1MD 3G0HA 2DYKA 4ZI3A 5CJ2A 2J41A 1OHHA 3G5UA 4IW3B 2WAXA 4B35A 3HWSA 4PO8A 3KL4A 5EXPA 2ZVPX 4ARZA 1J8YF 4D80A 4YONB 2ZRIA 1XEFA 1LF0A 1W4CA 4HLCA 3W5JA 2YWHA 4XVQA 4FWIB 3QBTA 1K6MA 1HH4A 4LY6A 4L5BA 2REXB 2Q21A 2ZETA 1G8YA 3KX2A 4KAXA 4Q4LA 1PZNA 1II9A 3PQCA 4NCJA 3AKDA 1RVDA 2EFHB 3BRWD 3U6BA 2GA8A 1PLLA 1Z06A 2OXRA 2ZJBA 3KJHA 2FFBA 4TQAA 2IHBA 2NO9A 5FFMA 2AN9A 4JLKA 4LBZA 621PA 2CBZA 2DFKB 2JDIA 1N0VC 1NY5A 1G1MA 2ERYA 4D25A 3NC1C 3WYFA 2GZAA 2BKEA 3GJXC 3WP1B 5FR2A 5SZKB 2IWHA 3UK6A 1ZMXA 5KNBA 2JLZA 1BYIA 4OL0A 3RS2A 5CDFE 2LKCA 3QKUA 3BAFA 3LQRA 4PZYA 2QP3A 5DHFA 2V9PA 2FGKA 2Z0MA 1XZQA 5EE9A 2XB2A 1KDRA 1KI6B 1KSHA 1ZP6A 2ZS8A 3AVQA 4QL3A 5E7IA 3PR1A 2ZRNA 4ACBA 4DLUA 3TBKA 1WE2A 4D81A 1F5NA 3K0EA 3M4YA 2WOOA 3U60B 5JJKA 4Z8YA 4M1SA 2REOA 1A2BA 1ZUNB 3FKQA 1KK3A 3WMEA 4C0QC 2P6RA 3CNLA 1AM4D 5KU1A 1G41A 1W2GA 4LGMA 3SJZA 3P4XA 4B74A 1U0HC 3OEHD 4TLDA 1NY6A 3NBXX 1W46A 2VEDA 3W90A 1II8A 3V4RA 3C5HA 4MYTA 2QMHA 2OCYC 3QUSA 2V4ZA 1XMVA 1I4DD 3FFBA 4YLGA 4XTRA 2OE2A 5FPHA 5TB5A 1XTJA 2A5JA 1N6PA 3GJ7A 4URXR 3FMIA 1M6NA 2BBOA 4F4IA 3CPHA 4GMXA 3HR8A 4QBIA 1OXUA 4PC1A 1Q0UA 1KSJA 2ECKA 3LV8A 5EUMA 2QT1A 2IYWA 4DLZA 1JPNA 2P3SA 1IHUA 2OZEA 3I4LA 2IL1A 4Q5IA 1F2UA 2WJHA 3TVDA 4HATA 1NBMD 2W2VA 5J47A 2QAGC 2ODNA 2XOKD 3CW2A 5KO2A 4BLRA 1S0UA 3FOZA 3A37A 4TL6A 1KIMA 1J8MF 4ESVA 2YC4C 2DHRA 1CJTC 1DOAA 2O8EA 2C9OA 1UM8A 2YJTD 2OCAA 2FEOA 4Q01A 3LBNA 2QE7A 5GVSA 2KE5A 3MUFA 4DLXA 3U3RA 1ZNWA 4IDOA 1PV4A 1F2UB 1ELOA 4AK9A 4NDZA 1EFRD 4XD7D 1WCV1 3GLIE 1EESA 1GAJA 3T15A 4UQOA 4TMZA 5KSPA 4D0GA 2JDID 1LTQA 2GEVA 4Q1AA 2ATVA 3MLEA 1KNXA 3AKEA 4L9SA 1I4TD 4D0NA 4QFMA 4C0LA 4IDPA 2BWJA 1SVIA 1U2RA 3B13B 4RZXA 3KJEA 1QHXA 3FVQA 2WWFA 4BEBA 3VHXA 1HT1E 3HP1A 2CXXA 4LJYA 5EE0A 4A8JA 3IKJA 2FPKA 2NMVA 4TLCA 721PA 2MSCB 4OHZA 2AD1A 1G6HA 1ZM3A 1Z0DA 4PXAA 2TMKA 3Q7PA 1XEWY 1NF3A 3EARA 2PL3A 1JQLB 1UKVY 1VIYA 2YOGA 3SYKA 4EFMA 4QHSA 4AKGA 2ZYVX 1DAHA 4QBHA 1SXJC 2ZIAA 2VHJA 5KOYA 4CEHA 2ANCA 4UNPA 3VU9A 4JLDA 2WVJA 3DDCA 1GSIA 5HE9A 1XMSA 3TVTA 2F43A 4BLPA 3ICQB 3NTUA 4O0MA 4PO1A 4QGAA 4UNRA 3CONA 4GSYA 1M7BA 5CYPA 1XPUA 4M53A 4V0LA 3X1ZA 2PJRA 4DB2A 3KKQA 5FBWB 5FBRB 3M0EA 4Q4JB 3U7EB 2JAQA 1P9RA 4HB2A 2F1JA 1HY3A 4LJ7A 4HSEA 3U44B 1F60A 3ZYCA 4ZIRA 2JJ2D 3SZRA 4B33A 2O8DA 2VYFA 4QM6A 3B1ZA 4M1KA 5HCIA 1ZC3A 3RRMA 1P72A 2R44A 2ZRMA 2WJYA 2AR7A 2IYQA 4KITB 2XSZD 1WA5A 4YMVA 2ZSEA 3L82B 5HZKA 1F3OA 5DNYB 1RPZA 4KYIB 1LF5A 3T1VA 2D2FA 2DWPA 1A2KC 1F6BA 1OV4A 4B34A 3ZZUA 1DVRA 3C41J 4CRWB 2WM9B 2QTHA 3P26A 2PH1A 1VMAA 2C95A 1YZGA 4EJSA 5FPSA 4ZKDA 3VNUA 3GLHE 3ZLJA 4TMWA 2WHXA 4E03A 3AVTA 3HR7A 2MMCA 1JJ7A 4NYJQ 2D3WA 2X77A 3PUZA 2PT7A 4BFTA 3TSZA 1ZCAA 3A4MA 3DPUA 5L3QB 4URUR 5FBVB 3O8RA 3I3SR 2HUPA 1N0WA 1ZM4A 2EWVA 2ODEA 4Q18A 5TARA 3M1IA 2Q9BA 5FOWA 1QVAA 1RRCA 5BN3A 4NYMR 4TSFA 1CR2A 5FTLA 1ESNA 3KQNA 4Y0AA 4IFBA 4AYXA 1CR1A 2WMNB 1XTIA 3ADBA 1TUEA 3MGCA 4HZUA 4NYJR 4GDFA 5EUQB 4X8HA 4LYFA 4O3MA 5FUXA 1CJKC 2XZOA 1FMLA 2D62A 3NG1A 1AQYA 4JBYA 4B47A 4HAWA 3IIKA 3THXB 1U99A 2GF9A 3VKGA 1V43A 2EFCB 1FFHA 5F9HA 5LDDC 4I4LA 3DMNA 1W44A 1VYTA 2LCFA 2WBLC 5J4VA 4AC9A 2G3YA 1SXJA 1TU4A 1ZIPA 3BGWA 4BECA 2ZUCA 4IXMA 4DSOA 1UJ2A 1ESMA 4Q9IA 1UBCA 1UEJA 1BH2A 3QF4B 1G8FA 3UMRA 3K0FA 2H18A 1E6CA 4X8MA 1OXTA 3ND9A 3KKOA 3TIFA 4JSYA 2IEZA 4V0OA 4FMDF 4MRVA 4BRUA 4MDFA 2GETA 1ZUHA 2JLSA 3KJIA 3N2EA 4KI0A 4DBLC 4X8OA 1U8YA 1CIPA 1FP6A 1P2VA 4ESHA 1ZRHA 4JVLA 4PR0A 3OAAD 1IN7A 2RGAA 2GBLA 4II7A 3QIAA 4ZDIA 1HTWA 3SFVA 3P1JA 5CYOA 1FMJA 1DADA 2R6AA 4TZ0A 1COWA 2GCOB 4IVPA 4BLTA 4LYHA 1E2KA 4HB3A 4P4UA 5BYJA 1Z0KA 3KQKA 1KY2A 4ZCLA 1XXHE 3I5XA 2OLKA 3VU9B 3AF4A 3LXXA 2J5XA 3TJZA 1VCOA 2F3RA 4C3ZA 3A1TA 2PZGA 4I1OA 3NDPA 2LKDA 1R6BX 3B60A 1ZD8A 3OAAA 1G7RA 4A9AA 2IC5A 1W0JA 3MJRA 3PUVA 5BQ5A 5JCZA 1OYWA 4Q1EA 5HPYB 2X2EA 1JEEA 4JT4A 3OESA 3O8CA 1LFDB 1Q22A 3C16C 1IJFA 2G1KA 4XJXA 1VG9B 3MJHA 2B7CA 4RVCA 1VCNA 4IVQA 1XB2A 1NJFA 5TXGA 3UMSA 4TLAA 1CS4C 4E09A 5JBQA 3FKSD 2W0SA 2VH5R 2GKSA 3HU3A 5DHAA 1EFHA 1G291 3BH7A 4UNQA 1IJEA 4TLBA 3GLGB 2H57A 4LHVA 4KXFB 4JYBA 2RB4A 1WP9A 1NJGA 2XTZA 4OI4A 4U5XA 4BLQA 4RJLA 2WMOB 5J4LA 1FNNA 2QZ4A 1SXJB 2BV3A 2GJSA 3A36A 5AK0A 4DIDA 2MSDB 2V1UA 3T34A 3ADCA 4BWYA 3T5GA 1XBTA 2B6HA 2VPPA 3CRVA 5EP2A 1ZM9A 3BH0A 1EFCA 2J9RA 3R8CA 2F1RA 5DSZA 2O8BB 5JRZA 1Q1EA 2IK8A 2IYZA 4JYCA 1GRQA 3S1AB 3FKSA 1KI2A 2IYLD 3NEYA 3T35A 1ZUIA 2HDNB 2DB3A 1OXVA 2ANBA 4PQRA 5H1YA 3KTAA 1NVUQ 3TK1A 2UVQA 3SOPA 1VCIA 3EC2A 4MKIA 1QZXA 4PX9A 4QNRA 1KTVA 1N6KA 3TAUA 2VP4A 2Q3HA 3AV0B 4R2HA 1CRQA 4Q1FA 3WBJA 2YV5A 1UBEA 3ND8A 2VTKA 3VNVA 1HT2E 4MKGA 1KSGA 3THYA 3PV0A 1KI9A 4B3XA 3HYRA 4EQ6A 2OEPA 3FE2A 3SQWA 1Z29A 1AGRA 1TEXA 1E0SA 3L0PA 5FH9A 2F1IA 4HEJA 2VHUA 3H0KA 1D9XA 4US0R 4KO8A 2BMFA 2V6IA 4LHWA 2JGNA 1LS6A 3R7WA 1HYQA 2Z5FA 3SJCA 2J0VA 3GQBA 4NL4H 1P61B 4TN1A 3ZQJA 3IIJA 1JEDA 5G3YA 2EU8A 4A15A 4FMCB 5AJZA 4CEHB 2Q9CA 3EAQA 5FPYA 1X1SA 3DO6A 1Z0JA 3AF2A 3ZZTA 4QGFA 1XCMA 3SQXA 4WOPA 2ODWA 2GESA 2IUSA 4B71A 5IF9A 4IOKA 4MUAA 1OH6A 5LBIA 1OH8A 1OFUX 2CCGA 4FCWA 4BZXA 1LVGA 3GJ6A 4K81B 3DHWC 4RY2A 1W1WA 2X19A 4NCKA 3E5HA 1ZU5A 3KKMA 4NYMQ 2NQ2C 3GP8A 3ZIAD 1U98A 5EP1A 1E32A 3GMTA 3D3QA 4P3YA 4ACAA 4XOIA 4HZUB 4YXWA 2QBYB 1JNYA 4UXJA 1BS1A 1MT0A 2X8AA 3RS7A 2WICA 1E1RD 5FI1B 4XIGS 3K0AB 4B32A 2WWGA 4QJ3A 3OEHA 3VHLB 2W2TA 1UBGA 4RD2A 4B48A 4DSTA 3GLHB 2ZJZA 2BMDA 2NGRA 2WKRA 5IT5A 4HI0E 2F43B 3PVSA 4FCTA 3VX4A 2QNRA 4YDHB 2ZRHA 2JA1A 2C04A 3P20A 1UADA 2YWEA 4ZPXA 4BGDA 4OHVA 2J0UB 4POAA 4P4SB 3WBKA 2R6FA 2P65A 1UDXA 4IOMA 1DAGA 2IYVA 2JJ1A 2VL7A 4NYIQ 4PANA 1EXMA 4U02A 3F8TA 1JECA 3I5YA 5TY0A 4RD0A 2Z6VA 3QBVA 2HT1A 3OE7D 3MWYW 1PUJA 1TADA 3K9NA 3UG6A 4MDEA 4FI3C 1G8HA 1L4YA 5FTKA 1HUQA 4DCTA 3QXHA 3OIYA 3LX8A 3IQWA 1E1QA 3DL0A 1KOFA 2GEDA 2NG1A 4URZR 3THXA 2IXEA 4PPNA 2FSHA 1UBFA 1N5IA
chains in the Genus database with same CATH superfamily
1O94A 3BERA 4Y2GA 4CIXA 3L6OO 2BLNA 1N6RA 4X94A 4PONA 3RROA 4CNQA 1PO7A 5DN9A 1DC4A 3SWWA 2FN8A 1A5TA 1U3CA 3F3MA 3NC4A 4FSHA 3ZQKA 3E1SA 3F3KA 4EY5A 1ZCJA 1IN1A 1PYOA 1CDEA 1NULA 1Q12A 2BR5A 1CBUA 2I2BA 1F7UA 4PLFA 3BF7A 3EOZA 1Y82A 3K9HA 4XE5A 2CFIA 1GPNA 1PNQA 3L6CA 5TT0A 2CKDA 2WFLA 2OBNA 3NQ41 3DYVA 3PYLA 3TZ6A 4C0AC 4LXGA 2BL4A 1TPZA 3JQGA 3EQZA 3ZD9A 2XGOA 1FFGA 3CG4A 3CRQA 2NUAB 4GRIA 2PGXA 3EEQA 4R9VA 2NPFA 1W4BA 3VYRB 4YUXA 2YASA 3MYRA 1TAHA 3QITA 1QIEA 1UKCA 2HSJA 3ZBTA 4CU5A 2IS2A 2A59A 5JEEA 5AHOA 3VAYA 1GV0A 3ESBA 4O3FA 4EL0A 4F38A 1JQDA 4R71A 5JAIA 4UJ5A 4M8NE 4MCHA 3V00A 3WV4A 1QHHA 1XJCA 1ADGA 3J7TA 1FFSA 1PS8A 2XGJA 3ZKWA 2QL9A 1AS3A 4R1LA 3TWOA 4HY3A 1XZNA 1DHRA 3AUTA 4GO1A 4LY0A 2Z8YM 4OUDA 2PAFA 2C84A 3OIWA 3ZNQA 5MGBA 1PYGA 4NBNA 3FYHA 3JAMA 4EJ2A 3DVLA 2YJ5A 3EQ7A 4RV9A 1W2HA 5B3JA 4N41A 4HYQA 5AW7A 3LC7O 3TQCA 4OO3A 4QDZA 1UBMS 4E2FA 2K6GA 3VKWA 3ORRA 3QW4B 4QTTB 1T0HB 2YZNA 4V03A 4K3VA 2DH5A 4XDYA 5GVRA 1GVNB 1ZD2P 2R60A 2VSOA 4XR4A 3WYBA 2UUPA 3BMCA 1AKUA 3CRZA 3LFUA 2V5AA 3UK1A 1O2DA 1BXGA 2YC2C 3IIMA 3Q0IA 3TRFA 4ARBA 5IN5A 4MWDA 4L4SA 2AX4A 1QFJA 2V5VA 3MJFA 1D7AA 2Z2JA 3HU1A 1NYLA 4HFMA 4X3OA 4MW1A 3T7RA 1AXRA 1O96A 3OFND 4BNDA 3LX5A 3QMWA 4P0QB 2H00A 2YFYA 3I72A 3W6PA 3MTJA 2BEJA 2YQZA 2HSWA 2O59A 3E9CA 4RTSA 2OZVA 2OT3B 3AJRA 5DBOA 4HGNA 3ROTA 1NBMA 1EDEA 4R0MA 1N2CE 2N1MA 3EQ6A 3ZYZA 2GJ9A 1UKBA 1KYWA 1QUEA 3GARA 3DOFA 3KSBC 3L7OA 2G0TA 4B87A 3U7FB 3ZW8A 2I8AA 1QDEA 2HGSA 2BGUA 1JFTA 4CQMD 3TL3A 3VOTA 3T3MB 1E98A 3TJMA 3WP0A 4URFA 1U80A 2NV0A 4PYQA 3FOWA 5J1TB 4D99A 3A1NA 3OLXA 2YJ4A 1DO0A 2YINC 3EEYA 5DI3B 1S9DA 1OVMA 2I8CA 4XZ3A 1CHDA 2C8JA 4X1YB 4EP1A 5FI3A 2RGRA 5A2GA 2P2LA 1SKYE 2Y1CA 3M1YA 2G70A 4RWZA 4YN3A 2XXBA 5MGNA 2WAAA 2QORA 4HWOA 1MP0A 3ICVA 3T9CA 4GF5A 1YF3A 1IRXA 2DHQA 1XTSA 1GG8A 2CMFA 1MB2A 2JIBA 5F9MA 3AINA 1QZUA 2BFEA 2IU3A 4OHXA 3L05A 1Z12A 1WHTA 3WJAA 3TZLA 4OU4A 1I51A 1AUOA 4GOJA 1GTVA 4A23A 2C7OA 2GZ2A 3GZNA 2GEFA 2DY1A 2ZIUB 4MQEA 4Q9JA 4JOSA 4DLRA 1A4UA 2JB9A 3D4LA 3IIEA 4PN7A 8ATCA 2MHCA 5IAOA 1BIFA 1OC2A 3HXQA 1PQ4A 2FF7A 4LDZA 2QIPA 5EIWA 3HCPA 2IDJA 2ZRPA 3ZX4A 3T9BA 4EEXA 3KUDA 1V3UA 3AFIA 2OV3A 3JYHA 4KX3A 4TXMA 4HF7A 3SEQA 1Y4AE 5FPPA 3K9CA 3UK2A 2FWNA 3IAM6 1PTKA 3D0RA 3DHNA 3SU8A 3ESCA 3KDAA 3VU1A 1SZDA 10MHA 1QO9A 2BUAA 2R7MA 2X9QA 3CT4A 2QD2A 2XUZA 3F7NA 3IMGA 3O47A 3JQ9A 2XB4A 3ILVA 5HQTA 1FBTA 3AEQB 4Z3OA 1QLHA 1FQJA 1RPAA 1Z8FA 3D7LA 3OOWA 4OXXA 3VTZA 4DPMA 3OZCA 4Q19A 1POWA 4UAJA 4QLBA 4ECAA 4P4TA 2WSSA 1ZVJA 3PQ4A 3ZDQA 4YJDA 1MORA 1MFPA 1IJKA 4M7OA 4F56A 2EP8A 3OQ6A 1EHYA 3LX4A 1WZIA 5ALWA 5K0GA 3FA2A 5FPTA 1G3RA 2OYSA 2IHYA 3K8QA 3PHBE 4Q39A 2JD0A 1RHQA 4JGIA 4RH0A 1E2JA 1FJHA 5EIBD 1KOLA 3DZIA 4IKPA 3S3TA 2HLPA 2GZ3A 2ZZMA 4IRXA 1C1YA 4P7GA 5IKOA 4BGVA 4EGCB 1MUUA 3FLMA 4LXHA 4CJXA 1NWHA 4QUAA 2GR9A 2D00A 3EPRA 2GEUA 1RE1A 4GYYA 4QGGA 5K0LA 1FS4A 5IH3A 3NAGA 2OD9A 4W7IA 3RUHA 1G3UA 3SDZA 2DC1A 4EMUA 1F8FA 2NPOA 4MQEB 3SLKA 4BKRA 4KQFA 2XXAB 2FCRA 2H31A 4LDQA 2WIKA 3R76A 3WKCA 1N6LA 1QF9A 3PUWA 3C3BA 1Y48E 6YASA 1RWWA 4OBEA 3STXA 3B3QA 1M1XB 4U3JA 5EWLA 4CR8A 3DAHA 2ZSUA 4ZHQA 3AI7A 3I30X 4CDRA 2JI9A 2BI4A 4GYJA 3NC0C 4P22A 2ENUA 3S0JA 4ETNA 2DWCA 2Q5CA 3OF5A 5EMLA 4M46A 2GBLC 3IILA 5FLKA 2Q3DA 3THOA 2Q6LA 1X70A 3RTGA 4YRFA 1EUZA 3PVCA 1G4AE 4Q66C 4Q7MB 4F5EA 1SCAA 3U4AA 3LF1A 2DKFA 3VNRA 2J30A 4TVSA 4JVNA 5B6PA 4JJKA 3UO8B 1G2OA 1XZLA 2J46A 2PWYA 2XUOA 1OX5A 1E6UA 2DETA 2H2GA 1RNLA 2FPSA 4ZHQB 2Y05A 2VJYA 3M49A 3BXHA 1CUSA 4NPHA 3R75A 4U2CA 1M1NA 1T2NA 1TTQB 2H2HA 3CHYA 3FFXA 3QVOA 4OYRA 2J87A 3DW3X 4ZQCB 1PFQA 3JVIA 4LOKA 5C2JB 1IEVA 3HCFA 1N5OX 4Z3DA 3HMKA 4JOQA 2W22A 2VXBA 1Q20A 5H80A 4N0EA 1N1GA 1YGPA 1XXHB 3GT3A 3MCUA 4NH0A 2WSMA 5ECGC 221PA 3ANMA 4RU1A 2F3QA 3GUCA 1NMZA 4R5HA 4X7RA 1ST3A 2HU5A 3NIDB 4P08A 2K2WA 2VDLB 4RGQA 4RKQA 8GPBA 1AXEA 1EVKA 4DCNA 3CZPA 4DSNA 2G67A 2Q2NA 3B1VA 2NU9B 4AS2A 4WW0A 2Z83A 1T4DA 3NAMA 2XDYA 3ZV4A 2GHQA 3MJDA 4KRFA 1ZHFA 4IGIA 1MG0A 4RL4A 3AETA 2F9MA 1TVKA 3OE7A 4ZCIA 5AP9A 3SXUB 1TNDA 2FG5A 1DXOA 2NYUA 5LIRA 2ZR0A 4HV4A 2WAMA 1N2HA 2P6UA 4TYPA 1PR9A 3ROMA 3RT1A 1AQNA 2QK4A 4NICA 2BSXA 3SS8A 1NG1A 1JLLB 1YQ9A 3WGVA 1P75A 3OEED 1T4BA 3MGKA 1IXYA 4B9AA 1DC5A 5KX5F 1GPYA 2J3QA 4EHFA 1TW3A 5FPQA 1YUNA 3GXOA 3V32A 1SNYA 1IXKA 3K72B 4OYHA 2C8KA 3EBLA 2GBFA 4L7VA 1TM4E 2GHIA 2E1RA 2YWCA 1JB1A 3M6AA 2ZCJA 3W5CA 5LD2B 5BMOA 2WYIA 2BGIA 4GC9A 4TL7A 2VPIA 2VXYA 1JHMA 4YP1A 4Z9XA 4UM5A 4QDOA 5FAXA 3VTKA 1YAJA 3HDGA 3H5TA 1XXHA 3RIXA 1QO0A 3R9XA 5AJYA 3HJBA 1X1RA 2BIFA 3TL6A 2W8ZA 4LNUA 1THTA 2D1RA 3PGXA 3R5KA 4Q21A 3DMGA 4J0KA 4QUEA 1KQNA 6PFKA 1J07A 4ZQGA 1SOUA 2CK3A 3FCXA 2Q7XA 3NOOA 2WTNA 3DE3X 3GGCA 1P1HA 4KQXA 4EYQA 1P44A 5HPYB 3JX9A 4MB0A 5K6TA 1TIBA 1V5WA 1I7QB 1Z38A 3VDQA 1D8TA 3ICOA 1HI9A 2V1XA 3HFJA 1PX0A 2MYUA 4FMBB 4NZZA 4CGZA 3RKSA 2D7CA 1IIRA 3TW8A 2O8EB 4Z49A 1B1AA 5CM8B 1J5XA 3UT5A 4NESA 2IYUA 3Q8KA 3HYTA 3Q3IA 4JZYA 3SR3A 2PLWA 1RHKA 4CKYA 2QRVB 5K99A 1Z4NA 1I8TA 1D2EA 5K45A 4BFYA 5AW2A 4WNAA 3COVA 4D41A 1VL5A 3FR8A 2I66A 5JMTA 2J0SA 4WAUA 5LLSA 4MWTA 3PJRA 4ZEMA 3FM9A 4XSGA 3RUCA 5ES4B 5JNSA 1HDOA 2ZRAA 1XQVA 4LZAA 2NUPB 4G37A 4OA5A 1SB8A 4DLKA 4LQCA 2FZWA 4RZUA 4KFRA 2YZ2A 1USGA 1EVJA 4LUCA 4YAJA 2DBYA 4G9GA 3IE1A 3L9XA 2ZS7A 4EI9A 821PA 2HA7A 3GFBA 4HUQB 2HMVA 5JTUA 1O7JA 2OZLB 3ZJUA 4UVGA 2GVDC 2QTAA 4JN6B 2WYUA 3JD1A 3B3GA 3GUZA 5D6NA 3ZV7A 3E9YA 2DUMA 3GLFE 4LGCA 4S1OA 4HZIA 2X8WA 3F5QA 1S3GA 3T9FA 1Z7BA 2BR3A 4XW2A 3BRWA 1A9XB 3EJ6A 1BEZA 1KI3A 5U4QA 4C78A 5IH7A 4UMVA 2AUTA 1DBSA 1DC7A 1KPGA 1ZBDA 2FSGA 3JQAA 4NV0A 2GN2A 2L2QA 3NWBA 1AKWA 1WW3A 2R8ZA 2W6OA 1QG2A 2GK3A 1CP3A 2R8RA 3K0KA 1LQUA 1VYVA 3K1AA 2PN1A 3T7AA 4G67A 1YIDA 3BJMA 3RFCA 1SRRA 3PA6A 4IXNA 2GNPA 4WZBA 2HZ7A 1H1DA 1K92A 1XZBA 4U39A 4LKOA 1JVSA 3PQ8A 4CIDA 4DIOA 4RA6B 1IBLB 1U0OC 1KAHA 4K6FA 3EA5A 4QRDA 1FUUA 4R1MA 5E8JA 3BL6A 2JGMA 1E7QA 2PZEA 2WILA 3FLBA 3GW8A 1WNFA 4R2WA 3FB1A 4IM7A 1ANKA 5AW5A 1GSAA 2OMEA 5AKYA 5A04A 1DBWA 4KYUA 5J2UF 1BMDA 1WZUA 2QGNA 1P60A 4ZO6A 3O8DA 1KJNA 2X2FA 3BXOA 4G5SA 5A3VA 4JU8A 1G19A 2Z9DA 5E4YA 4EEZA 5DIZA 2F4VB 3DE4X 4RA9A 3AX6A 3NONA 4ZCRA 4ZC1A 1K9SA 1YZHA 2JFPA 1ZIDA 3I53A 1YZUA 3UUFA 4LZZA 4H4CA 3BJIC 4EHJA 2FETA 2QM0A 4F8JA 3FYUC 3EG9A 3ZOKA 5KJCA 3HXOA 3MTBA 4KU4A 3KHUA 3K71B 4UTXA 1ZUNA 1U0RA 4F4CA 1NZJA 2GARA 2X3UA 5C5DA 1YXMA 4D3XA 1JDZA 3EDOA 3EIWA 4JI2B 1C7QA 4G0UA 1N5RA 3GLRA 1NYTA 1XTVA 4RANA 5CP8A 1RMYA 1QFXA 1VGVA 2YWBA 2BJVA 2H2AA 3DC2A 3DNFA 4QDUA 5JCXA 1SKMA 1N6HA 1E6LA 1CP2A 2A1TR 4MVWA 4OQFA 4TXJA 5DXFA 4LWQA 4KN8A 5CXUA 2BAGA 4G5YA 4Z2AA 1SGWA 1SCKA 1RWVA 2VJKA 3LLVA 4KLAA 3Q41A 3JXEA 1Y1PA 4RVNA 1B8PA 1XQ1A 4NOKA 1NQTA 1X15A 4S3MA 4ENUA 1XTBA 3EIHA 1DAPA 4W7HA 3TLXA 3P0EA 4U7JA 1U0JA 3D3KA 4WZBB 4MS1A 4F85A 3CLTD 3FGPA 4TLEA 2D5BA 3N0VA 3OJFA 5J2TF 5DBIA 1E59A 3OZTA 5IYZB 4DZTA 2F67A 4LJ8A 4PG5A 3EZNA 3G3EA 3WSWA 2ABWA 2IZ1A 4KIFA 5FOQA 1Y98A 2VATA 2VK2A 1GKLA 1SUWA 3TG8A 5HJ7A 5B4TA 1CJCA 3VTAA 1C0KA 1CZLA 1PGPA 1S02A 3LA8A 4UHHA 4UU7A 4XX0B 1MPXA 3DHVA 4XGIA 1XRJA 2O2XA 5EJEA 4EB6A 4P81A 2Y99A 2CKMA 5AD1A 3SG0A 4DILA 4ONEA 4M2LA 1P7ZA 5IANA 4H35A 4MVJI 3BXZA 3OFVA 4Q6BA 3SC2B 1F6DA 1KI4A 2DCMA 1ABEA 4XEHA 3BD7A 1V4VA 3EIXA 1XN4A 3CB4A 3T4XA 1HT3A 2YIVX 3AI3A 4IOJA 2I76A 3TRHA 1Q7BA 1CERA 2D3TA 2RHCA 2WPNA 2X1HA 5A4AA 4PC7A 2YN0A 2V98A 3SK0A 4QPJC 4YP6A 4YRQA 2Y67A 2NP7A 3PITA 3WGTA 3IUEA 1VFNA 1AG9A 3CVJA 4CCYA 1YWGO 4RIHA 1AGXA 2PGJA 2Z1MA 4F3NA 1RPTA 2OAQ1 4GBJA 3THWA 2YVUA 3N2YA 4BEWA 3HDVA 4DV4B 3PNVA 2AZTA 3BIWA 3GLHA 4XB2A 3ZHRA 2ZR7A 4XWOA 1OWNA 4PRLA 3D7MA 1EJ0A 1FPQA 1Z62A 2W6ZA 2DPHA 3QSGA 3UTCA 3V8MA 5B2FA 3TDNA 1KY3A 4IQFA 4EELA 4ZMRA 1W36D 4I14A 1NF2A 1BEUB 3HL0A 1U31A 4D6YA 1S2NA 2QPLA 2R8YA 2Q07A 2R1TA 1X1BA 1THMA 1QK5A 3FR7A 3DGEC 2MSNA 2ZUWA 2IEDA 3NHAA 1MJGM 2HPAA 3LXRA 3MQFA 4YT8A 4AX4A 1U2SA 3TQSA 2HNAA 4GYKA 1LH0A 1Z6AA 5CM9C 4UQLA 3MJVA 3VR3D 3Q8XB 4GSKA 2IE8A 3PEYA 4ZO9A 4E70A 5CD9A 3WY9A 4BO4A 3BGIA 3K32A 2ST1A 1CUXA 3U26A 1N2XA 3RS3A 2IHUA 2V7TA 5BSHA 1IZZA 1S8OA 3FB4A 4NP6A 2OCPA 4S1TA 3ZHCA 3RLFA 3U4QA 4YMUA 1IY9A 3LH5A 1CEQA 1ML4A 1ODTC 1P0PA 1SCUB 3FG9A 4UUAA 4G5FA 4IHJB 1IVSA 1G64A 1DUVG 4FNOA 4N6NA 4YJKA 3I1FA 1L6RA 3UXMA 3WWCA 2H2IA 1G55A 2FEKA 4U2DA 2WG0A 4Q3BA 2EG9A 5TVKA 3OCVA 5DGXA 4UFPA 5JQGA 1MGPA 2Y77A 2NQ8A 2Y9PB 4CV1A 1K86A 1ZNXA 4MWCA 3E9RA 5KMGA 3ADPA 3GLTA 3REQB 1X80B 2AZDA 1RZ3A 2NSDA 3U44A 1UJBA 1YI8A 2Y92A 1UBRS 1VA5A 1PJRA 2P4EA 4JX8A 3RI3A 2XCOA 3RU2A 4EA8A 1ORTA 5FADA 4QKQA 1QG4A 5LMCA 1U2GA 1D04A 1DTWB 1GUBA 2LP4Y 3VUEA 3VTFA 3ANSA 1VLZA 2W5UA 3LY7A 4IGKA 4CM1A 3WRXA 3LGXA 4RMIA 1LB1B 2JJ8A 5A6VA 2JGIA 2X7HA 1MRSA 5KCZA 2Z8YA 3D2BA 2W6IA 4NBWA 5C7LO 2LTAA 1C30B 1DX9A 5ALFA 3S5JA 4RY0A 4AZSA 3BN3A 3FRHA 3AHJA 1G5RA 9ATCA 1XAIA 2C3PA 2IXFA 2QA5A 1O9GA 5A6SB 3OFSA 1CF2O 4JEUA 2YN4A 3CLRC 4G9EA 4XVCA 1XL1A 2AG6A 3MN1A 4KC0A 2ZYTX 4RVHA 3UANA 2CLOB 2GT1A 5AI4A 2CV2A 1WXXA 5FUWA 4FW9A 3JQ8A 1Z63A 1C30A 3WL7A 1UXGA 5HJ5A 4G5OA 4PCUA 3IMKA 5BWBA 1SBCA 3BT7A 1E2QA 1T35A 1XEXA 5L4SA 3KOMA 1VCHA 2GAAA 3IBFA 1HT0A 3QV1A 5KWEA 2XNDA 2ZJ3A 2ZYSA 2QTVA 2XYPA 2RAFA 1Y3CE 5JATA 3V7UA 4QNNA 4QUIA 4EVQA 3DWFA 1U5BB 3LUHA 4M1WA 3UAXA 5BWNA 4DCVA 1A9TA 1KDVA 1H8ED 1JMVA 1T0JB 3DZDA 3PC4A 3QNUA 3H11A 4L3VA 2V4UA 3PEUA 4NZNA 4OXQA 3IP1A 4O4JA 3MXTA 4BNGA 1OTXA 3AHIA 3WZLA 4MQUA 1TKCA 4QTZA 1NDHA 1E9RA 4I5FA 5TPZD 2BFOA 3BA6A 1I9CA 1JN0A 4HAIA 4UUOA 3SF8A 4ARZB 2I3AA 4HQLA 4MS3A 4E2XA 4RBNA 4KR0A 3GJZA 4PHGA 3ZE2B 2J9YB 3A4NA 4C08A 4LOJA 3QKSB 1Z6QA 2BBSA 1YK1A 2TMGA 4UDXX 5D3ZA 5BORA 2AE1A 2GXAA 1Q44A 3JQPA 4N1AA 4PO3X 3A28A 4N9WA 3ZUPA 2BMJA 2CYBA 2H7XA 3OZWA 4AU1A 4BKUA 5IAAA 4BO0A 5KWSA 4Q9LA 4W5QA 4GOXA 1Z28A 5HF9A 2FWIA 9GPBA 2NADA 2O2HA 1PQWA 3AIKA 4O4HB 2FPWA 1W5TA 1EGVB 3D0QA 4QPZA 3RD5A 2WWTA 1MTZA 4PF1A 1K5HA 2R6DA 5FTJA 5HA5A 3EPLA 1H8HA 3SI7A 1T9BA 4EY8A 3O26A 3QKSA 5G41A 5TPZA 1U02A 2GF0A 1U90A 4HRXA 2XF2A 2QPTA 2XT0A 2C8LA 3A31A 3FPEA 3I04A 4EI2A 3PDJA 3REOA 2GKGA 1OH7A 2UZ1A 4J29A 1O89A 4ZCMA 1IN6A 3CUEF 1RAEA 2HOQA 5C37A 1GFIA 1VJTA 2PVCA 4E21A 2FFJA 1UT8A 4XPZA 1ID8A 3S2ZA 1WJGA 3GRCA 2LCIA 1YZLA 1XN1A 4HSGA 4Q4HA 4DMMA 2I91A 2GRJA 1TA9A 1E8NA 1GFSA 5I48A 4IHJA 1ZY2A 3INYA 2XVMA 4G8CA 5CCBA 2VH2A 3BZWA 3ED1A 5DMXA 1EFPA 3SLRA 3FHTA 1YR3A 1CJSA 3GT0A 2XUKA 1MW9X 4INOA 3NTVA 3D1VA 3T7EA 1NUUA 4PCVA 3A4LA 4D9CA 3GQBB 2CB0A 4QVGA 3T5AA 3E81A 5K0TA 1NQOA 5H3LA 3FOCA 3ZZNA 1HKUA 5LN1A 1I2CA 3QIVA 1EWYA 5EHIA 5FQNA 2KW5A 2FN7A 4EDHA 4JKIA 3P45A 1M6HA 3DCNA 4P92A 2NU7A 4UDYX 1SCNE 1BROA 4ND4A 1G5PA 3T3HA 3FKJA 4LYAA 3CJQA 2GVZC 3GEMA 2HWWA 3UJDA 2CK3D 1VHJA 3VI4B 4R7GA 2FRXA 2ZR9A 4BV3A 1ZNYA 1P8JA 1XDBA 3K8YA 1EWKA 1PUIA 2Q4RA 1RD4A 3NWPA 2CFRA 1YJQA 1ZD3A 2VDNB 3IEVA 1F14A 2YFQA 3NHYA 2CNBA 3CH7A 3I0ZA 2DQSA 3KP1A 3OUUA 4RNCA 3CVOA 5FOVA 7MHTA 3OX2A 2XKAA 3JALB 3FCSB 4IP0A 4F2WA 2OG2A 1E5LA 3MA0A 3ZGVA 5JXJA 3UXEA 4MQFB 1Y3DE 3I32A 3SKXA 1SIBE 1KAMA 1CIJA 1YO6A 3DULA 4KPGA 4DE5A 3FOBA 5ER9A 1T0IA 3IAEA 3AB7A 2XDQB 2ZK7A 1ZJZA 4Y7CA 1UZAA 3IAM1 4ZJYA 1MW8X 1BMQA 4FFLA 1U1FA 2O4UX 2ZAGA 1B4DA 2HMYB 5H4HA 4DHEA 3PHGA 3ZWWA 5HUJA 2JZNA 1K4YA 1E5DA 1LW7A 2H4FA 3GOQA 3KR0A 3KXIA 4HKTA 1DNPA 4MULA 4V0NA 3TR5A 1FP7A 3LWDA 5BNTA 3AOEC 1HL7A 2WRZA 4CDNA 1NASA 5K6AA 4D4MA 3JQDA 3B6JA 2N47A 4JMLA 3I42A 3OM1A 2ZRLA 4NFYA 1KU6A 3B78A 4ILEA 4QE3A 1DAOA 1JR2A 3ZQUA 1Z75A 4BASA 1J56A 1QGED 2HCBA 4TKMA 4JWKA 3M4NA 3PEVA 1XTUA 3ZR4B 1KS2A 1XQYA 4NG4A 4RK6A 1ODLA 4Y1EA 5BNZA 5BUZA 3OU7A 1T5IA 2PDAA 4RY8A 2INGX 4MXDA 2XJ4A 2P2YA 1AQIA 2QSYA 4QOIA 4R2JA 2JF0A 5COAA 4FYJA 4IHKA 5ALMA 2FTKE 3BOSA 5FYQA 3TDMA 2YMLA 4IEIA 4NSNA 1QFMA 1FX0A 2NYAA 5HTKA 4KJZA 3ABOB 3IP5A 4CF7A 2GS9A 4U1RA 1P3DA 2FPUA 2BCGY 2X4IA 3MSXA 5FBHA 1EX6A 4MA0A 2QM7A 5FUYA 5JZSA 2X0RA 1L4EA 1N8TA 1YVPA 3GU3A 1Z0FA 4I4NA 5A5DA 3LTNC 2Q6TA 1WDKA 1KGSA 3CA8A 2W6NA 5H3HA 3ETCA 1V7CA 3R6DA 4B43A 4DLSA 2CFTA 4MRSA 5LQMA 3ENZA 5I8ZA 3UHAA 2HFKA 4Z4EA 3O1HB 4GWGA 1DDGA 1AO0A 1JLMA 2FK7A 4ZJZA 2YUIA 3W5BA 1DEXA 3RYTC 4R9RA 3SC4A 4JAVC 1ZESA 2P6NA 3OKAA 3UENA 1AK2A 1JALA 1PN3A 3I73A 2CHEA 3M5PA 3TM5A 1IXZA 1E58A 2EATA 3OQJA 4HNAA 4FP9A 5DM4A 4ZVUA 2G09A 3BMNB 2BN4A 2OG1A 4ZYWA 1E1RA 4QPDA 5IDXA 1OU0A 1TD9A 4UUMA 4AIRA 1OA1A 4NJEA 1OIVA 1YQXA 5AJVB 5HNKA 2ZRBA 1WF3A 5DX8A 1YL7A 1LC3A 5HIKA 5CJJA 5J4KA 1RYYA 4OIMA 4G5GA 1IHOA 5MFPA 5DH9A 1HDYA 3ESRA 5GJCA 2WUFA 4DMFA 2VOJA 4P4SA 3H0CA 3KTDA 1IUKA 3TCNA 4CMCA 2A5YB 2R7NA 3C3JA 2ZCVA 3F98A 4NBSA 2YY5A 3HJRA 4H18A 4RHEA 2XUGA 5FUQA 2PEYA 2ONYA 1XTKA 3GVHA 3NGMA 4G65A 1P80A 2OGZA 3MJCA 3OBIA 4BB6A 3Q7QA 4QSHA 3GEPA 5JCJD 1U8CB 4B4VA 1X42A 1ODJA 4CMIA 2V6MA 5DGIA 1M75A 4QHYA 4ENQA 1QDUA 1TCVA 1NFQA 1P2TA 1B8OA 1Z5GA 1ZVQA 1VZ2A 2W2OA 1Q2UA 3WGKA 2H17A 4ZOQI 1KK0A 3IHWA 1TIKA 2VZ9A 1EG7A 2ZYAA 1ZX1A 3FDZB 4FKBA 5BVHA 3CS3A 4EJSC 5C80A 1I01A 4DWWA 4LKRA 1ONSA 3E03A 1O5IA 3D2LA 4Z51A 5EZ5A 4CIAA 3H65A 3LCVB 2ZBRA 4OGKA 4F4JA 3MMNA 1IUPA 3IHKA 4NAHA 3BMOA 1EINA 4H3KB 1QS0B 1ZGBA 2PH3A 5KCMA 5LWQA 4HGRA 3TW4A 2QZJA 4BC1A 3VVMA 3LX6A 1Y3AA 2Y93A 4NENB 4X95A 4C0JA 1OZGA 3GPBA 5JY6A 4AN4A 3JQAD 2RAUA 3FWYA 3O8QA 4JKOA 5DTMA 3WSVA 4D42A 2KHZA 5HM6A 3DTTA 2WF8A 3C3MA 2PYDA 1Z4IA 3ZU6A 3EX7C 4PBSA 2CHFA 2YQ5A 5KTPA 4JI8B 4IDQA 1U7TA 2HCJB 3SP1A 1L8AA 1YH3A 3VX4A 2O0HA 2G71A 4BFXA 4EG6A 5JSUA 3QNMA 1GXSB 4NH4A 4BQEA 4MV4A 5TV2A 3CZRA 5BOSA 1YRBA 4NATA 4ZQIA 3CE9A 1EDBA 4I6EA 5YASA 3T1TA 2PSDA 2EDCA 5MN5A 3CZQA 2JHCA 1MV8A 1VI2A 2BD0A 2ORIA 3G7SA 1DAEA 3V7WA 3P0HA 5K03A 1J97A 3VR1A 1C1HA 1V3TA 1JJIA 1XZPA 1OC4A 4LYGA 4MKXA 3Q8MA 1WXGA 1M10A 4OK3A 3W9YA 4D3YA 2OAP1 1Z6GA 3KDPA 3VZDA 5K9ZA 4CMHA 2XPCA 4C7OB 2ZB4A 1SY7A 3V2HA 1J7JA 4KODA 2RGBA 1O95D 1RJGA 4U6NA 2UYHA 4EBBA 4PBRA 4KKVA 1O0SA 1VSBA 2QT0A 3OT1B 3CLUC 2LR0A 4GMKA 5FTNA 4CIWA 1G4UR 3W05A 2HJSA 4HAYA 2GN9A 2NTEA 3MT7A 2OO5A 1E63A 3UC5A 1Y9EA 4AS3A 3PA8A 4JJFA 1Q0SA 3LAWA 1ZW6A 4EPWA 2QD4A 1EVYA 1FXSA 3AESA 4W5WA 2M6RA 3ZWYA 5DNAA 2SNIE 5IFLA 3UT6A 3W2GA 2PWPA 1XNHA 2KQUA 1W87A 2UUOA 3WXMA 2ZT6A 1JU3A 1BJKA 3DEKA 3WB0A 3WGJA 1MRZA 1UJ6A 4Q3OA 1G5HA 1PFUA 1A69A 2PMBA 2PV7A 2EVWX 2VHQA 3L92A 4JT2A 3VISA 2RC6A 1B1CA 1D2HA 1XYGA 3LPLA 1YAHA 1B0UA 1N6IA 3JR7A 3WNQA 4B6EA 1P4JA 3OCXA 5FWNA 1ABBA 2W71A 3VPXA 5PGMA 1Q57A 2X1VA 2AFIA 3HUEA 4ZKEA 3HHEA 4W8GA 3C4VA 2R9VA 3DL2A 3VMFA 5T4HA 3HKDB 5EJ5A 5KSOA 2AD5A 1WUHS 1EAYA 1JUDA 4YYEA 3C6KA 4GGOA 2Y6UA 5JZVA 2B94A 2ID4A 1ECPA 2ZSIA 4L02A 4MVJH 3FOEC 2WPDA 4OI1A 4PGMA 4HQNA 1WB9A 1G2IA 4WIAA 1GZ5A 2F3PA 4ND1A 3GPLA 1W1UA 4K9SA 3OOJA 4P36A 1UC8A 3L7AA 4PGAA 2GO7A 4OATA 1NQXA 4C7KA 4LJLA 1MCZA 2RBGA 3FGOA 3U80A 3A6JA 1NMXA 3FRIA 3PUYA 3UAVA 2FR8C 3MGAA 3NIBA 2H1CA 2QLFA 2PL5A 3WBFA 3LVRE 1IPHA 4ZC8A 2P9EA 4NOJA 1V0JA 1WLYA 2F8SA 1ULZA 3ZVNA 1W0KD 1KZ7B 2HBRA 5ECWA 6GPBA 5I7FA 2R1UA 3V1MA 5KBYA 1MPTA 2BEWA 4TS3A 4EL5A 3TG2A 1B0AA 1O4VA 2P79A 4B09A 5EKSA 1X7XB 2TSYB 1NNUA 3GDWA 1NJ5A 2WPDD 1A88A 1W75A 3MWLA 1TXGA 1BS9A 4GP6A 1FCJA 3WBBA 2B5WA 2OXFA 4M36A 1CUBA 3U49A 1D6JA 1T91A 3NHMA 1IH8A 1MXFA 2I9KA 1NKVA 2OGTA 3IYLW 3MJ4A 1J09A 1Q1AA 4CM8A 3U4HA 4F4HA 2AF3C 5BUQA 4BXOB 1LDYA 2QLMA 3KYIB 3ID6C 1DQPA 4LS3A 3HVKA 4KQ9A 1TZJA 5I5GA 2BUCA 2FR0A 3RFXA 1V11B 1NNEA 4X45A 4P2GA 4K86A 4BX9A 5H0IA 4I55B 1GLGA 1EXDA 1SJ9A 1W0KA 3NHRA 4HGOA 3MW8A 4JEHA 4XLZA 2G0AA 5JMPA 4DCCA 3JZDA 3FUUA 1X92A 4KTVE 1DHTA 4LWPA 4RACA 4B3SB 1Z0IA 1G9TA 2H4HA 1O5OA 1V8OA 3FPCA 3A6PC 4U7TB 4DV2B 1AS2A 4YFYA 4HLNA 3P94A 4Q02A 1F2TB 1DG1G 1KKMA 1PJSA 4BNNA 1XDZA 1R5NA 4OU5A 3H4MA 4G1UC 3ZHUA 4CM4A 1R37A 1M2NA 2J3JA 4HGYA 2GZHA 4QUHA 1E2FA 4URYR 5JO0A 1BQEA 1IVNA 1R27A 4IIXA 3S70A 4Q3CA 1ULBA 3HPQA 3ZKWB 2UYOA 3S2IA 4LSGA 4JI7B 1ZN7A 3D4PA 1D03A 1KJ9A 4DA6A 3RC3A 4ZVKA 2HQBA 1L1FA 4DMRA 1NSTA 3A3YA 2KPOA 4QG3A 5JANA 1ISGA 3FBGA 4D96A 2O7SA 4B8YA 1KMNA 2CXPA 2J7PA 1AT1A 2REBA 3C1AA 1BE6A 2P9TA 5KYXA 1NF8A 1SXJE 1L5WA 5KTRA 2JATA 3LYAA 5LP6F 1DCKA 4C2UA 2O0MA 2B8TA 1P7VA 3QEJA 4FFSA 3SHOA 4QASA 1OXMA 3WTCA 3HVRA 3NDBB 3T7IA 4XWYA 1DFGA 3BD9A 4YC7A 4A2CA 5JEDA 1XWIA 2ZIGA 3NDJA 3MBKA 3A27A 1U8XX 4UTPA 3HB7A 2D0IA 3QJ5A 1HORA 4JJZA 4Z53A 2AUMA 2NWQA 4D9EA 1VECA 1TPYA 4DA4A 3GD7A 3U4IA 2WJVA 2CZCA 5T3UA 5ANRB 4I1IA 4PHTA 2G1UA 1FLAA 2A1UB 2JA2A 2NSJA 3I9FA 2OFOA 5IAEA 2LIPA 1SU8A 1HDZA 2F4NA 1G0NA 2ISQA 4ZGWA 5JHGB 1TAQA 4KW7A 1F0NA 2I67A 4MDYA 1Z2OX 3U0VA 5B4UA 3NX4A 3N07A 1P9OA 1VLJA 3BA1A 3B9BA 3FW1A 3QKWA 1XV5A 3HCAA 4TTAA 4ZV9A 3RSCA 4N5HX 3UWKA 4D46A 4MRAA 3QWFA 4DBZA 5HKKA 3U19A 4ZZ0A 4N0PA 5HRUA 4JXXA 2JBWA 2OZPA 2F64A 3H2IA 1PHRA 5C18A 3LJKA 2JI4A 4KPEC 2AC4A 3B6ZA 3X1DA 2ZBVA 2GWRA 4YRBA 1SU4A 2JGLA 2VCHA 3WHIA 5DWQA 2BFEB 4PGHA 4KR9A 1CK4A 2BMWA 2PKQO 1NDQA 4ADSG 4ZTUB 3BKXA 4ZOBA 5KUTA 3LIIA 4MYSA 4L0CA 4E2YA 3AR3A 3RAGA 1G38A 4PC3A 4EMTA 3T99A 2HIAA 4Q3EA 1XYVA 3HE3A 4JBGA 3CN9A 1BDHA 3VKUA 4D57A 2PL9A 1KYIA 4IHQA 3TZKA 1O97C 2PT5A 4XM2A 1H2BA 3ELBA 1YB2A 4O2AB 1N2CA 1XU4A 2JGDA 2HF9A 4UEOA 2II6A 3DL7A 5IUNC 1DPGA 1U3DA 4XCVA 1F0YA 4RGVA 4KQKA 1MQ9A 1X1EA 1E77A 521PA 1TECE 2WUWE 4URWR 3SC3A 4C06A 3H2GA 1IB6A 2AQKA 3OD1A 1LNZA 2IWRA 1FLVA 4OB6A 4RKEA 3ZGXA 3WGIA 3AEQA 2UV8A 3WLHA 1V2GA 2NXNA 2J6CA 5F5NA 2VP9A 3K53A 1J6UA 3KQQA 2DECA 3C7KA 1Z4MA 3QE4A 3K73O 2Y2UA 3UIEA 3A9TA 5KNLA 3CTMA 2CY0A 2C0QA 1VG1A 1ETUA 4LE0A 5KDLA 4DJDC 2VYND 3PNQA 1A1VA 1CR0A 2Q8NA 1GIAA 1NRJB 4TGLA 4RJTA 2GUGA 4L7QA 4RVUA 1H1TA 1CUFA 3E0QA 5LP6C 4A6PA 4F2GA 2QG6A 4KB5A 1CSEE 4KAAA 3U4MA 1E9VA 4IG4A 3FSRA 4GLJA 4E5UA 4MYUA 4OMDA 4U7FA 3ZLVA 1E5QA 2AS0A 5T57A 4XCQA 3M6UA 1SVOA 4FDTA 1BDIA 2Z6AA 2Q4OA 1VLQA 4YCDA 4YP0A 5E3IA 1GTSA 1E89A 3A4IA 2CYCA 1FA9A 4MO2A 1N9ZA 5FBZA 5JROA 3CVYA 1ZLYA 1V6SA 3H86A