1E4VA

Mutant g10v of adenylate kinase from e. coli, modified in the gly-loop
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase(phosphotransferase)
molecule keywords Adenylate kinase
publication title Crystal structures of two mutants of adenylate kinase from Escherichia coli that modify the Gly-loop.
pubmed doi rcsb
source organism Escherichia coli
total genus 74
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e4vA00
3S1AB 2DWPA 2IWRA 1MO4A 3QENA 3EXAA 4M21A 1G19A 4B48A 3G0HA 2WKPA 4X8OA 4TL6A 3SC3A 4XTCS 1XEXA 1KZGB 2O0KA 4DSOA 2IS4A 5KDLA 2QGNA 1GWNA 3WYFA 5BWMA 1CR0A 1P72A 2FJUA 4TTRA 1XX6A 2O8EA 1CRPA 1P6XA 1HT1E 1P73A 2CL0X 2RGNA 3PEWA 3SFZA 3SBDA 1EFRA 1KMHA 3Q5EA 4P4SA 3NDPA 2IWHA 1P60A 4Z51A 4AKEA 1FUUA 2DFKB 3LWNA 2OXRA 2ZS9A 2FE4A 3Q72A 4Q66C 3SS8A 3WNDA 2VTKA 4M9QA 1UFQA 1L2TA 3ND9A 3CNLA 3U3MA 3ZQ6A 4E07A 5JJLA 1GP2A 4KODA 3SJBA 4JMPA 3BFXA 4MYTA 1VHLA 4U00A 2X19A 4JSTA 1KSGA 2J0VA 3GMTA 2HEIA 5AJXA 4K81B 1NJFA 1NVVQ 2J45A 4F93B 3EARA 4RJLA 4XJXA 4JLNA 3PFIA 2O8FA 1EFTA 1AS0A 4TQ9A 4QBIA 1KI6B 3P1JA 4L4UA 3A37A 3TLXA 4YQFA 2C04A 1E2NA 5DN6A 3WMGA 1DAMA 1U2RA 3BH7A 1MABB 3R7WB 4JT4A 3H86A 2ZJBA 5G3YA 2FSGA 3PVSA 3U7EB 2E1RA 3U61B 1X8KA 3MUFA 4PHTA 2R6CA 1DBSA 2D7CA 1E2JA 2WSSA 4LHZA 2A3RA 3K09A 2KBEA 2AX4A 4Y0AA 2FH5B 2QEQA 3RC8A 4OJQA 4HZUB 1XCPA 5DYGA 5JLJA 1FTSA 2OO7A 4CEJA 4BLSA 4CEIA 2Z4RA 4JL5A 5KNBA 1Z0DA 4IOKA 4B71A 3Q5DA 2QTVB 1ESNA 3ZZTA 4XWAA 2CK3D 4BECA 3X1ZA 2A9KA 1XEWX 1NN5A 3U5ZB 2FX3A 1JI0A 1R0ZA 4YMVA 4Q7KA 4QC2A 1S0UA 2P0EA 3FOZA 1UDWA 4UNQA 1KGDA 3BGWA 3UMRA 4PFSA 3L0PA 1MH1A 3P27A 3I8XA 1IY2A 3EZ7A 3T15A 4ZKDA 1RRPA 2H92A 1A2KC 1G6HA 3ECCA 3GJ8A 5IK2D 1VIAA 2YOGA 4IXMA 5F98A 2ECKA 1GKUB 2ZYTX 1WXQA 4F4JA 1RRGA 2DYKA 1XMSA 4EPWA 4WBSA 2JJ1D 2DB3A 1OT3A 1XEFA 3EIHA 3CH4B 3ZD7A 3IBYA 2H16A 121PA 3NXSA 4YDHB 4CYMA 3QVVA 1M34E 3LVRE 4WZBE 1DO0A 4R2HA 3DO6A 2VF8A 3QBVA 4QM6A 2O0HA 4MQBA 1NBMD 2B8WA 2HCJB 1JBKA 1Z0IA 1FX0A 3B60A 5LD2C 1KO4A 2QBYB 2GTPA 4QM7A 3TSWA 5HKKA 1AKYA 1KHTA 1J2JA 3IBGA 2EFEB 1JAIA 5DI3A 2OE2A 1SKQA 1J99A 1EG7A 1W4AA 1S9DA 5F9HA 4PC1A 4P0TA 3OZXA 3I72A 1E2EA 2BJVA 2YOHA 3B1WA 2VHCA 3W5JA 1SXJE 5DHAA 1IOZA 1E79D 3NBFA 5CM9C 1KK3A 2RGDA 4JBWA 4Q5IA 4A2QA 4N1AA 2QAGA 4YMWA 4ZKEA 2ZRGA 1Q1QA 3BJIC 1L4YA 1JPJA 2PLFA 3T1VA 2O8CB 5JCZA 1CR4A 4NCHA 3K0CC 5EJEA 3GLGB 2AD5A 1YRBA 1ZM3A 4BLQA 3JVVA 1G5TA 2OILA 1G7SA 1BMFD 2ZXUA 4JLMA 2VLIA 3HPRA 4GZLA 4MUAA 4WOPA 2BCJQ 3R8CA 1VTKA 1II0A 2GF0A 4CEHA 1YHNA 5P21A 4D80A 3REFA 1E69A 4FMCF 4QOSA 4XWOA 2W6ID 3P4YA 4URXR 3I3SR 4HLUA 3K1JA 2ERXA 1MRSA 1OSNA 3U2QA 2C98A 3K9LA 3TK1A 2ZRNA 2QP9X 1NLYA 4ASUD 4A36A 1F48A 3OEHD 1U99A 2YWFA 3MLEA 1KI1A 2F43A 4CF7A 4QKQA 1X3SA 1BH2A 2F7SA 1AIPA 4ZI3A 2MMGA 2DFLA 1NSTA 4TWZA 2OBNA 3LNCA 2KSQA 1VCOA 1FOEB 3GLHE 1FNMA 3RNLA 3SNHA 4KU4A 3BBPA 4EJSB 4LDJA 4RD2A 3M6AA 1G291 1SVOA 1D6JA 3ONWA 2A5GA 1IAQA 2ZRCA 4RY2A 3SHFA 2ZSDA 4PC3A 5J4KA 4GP7A 3AKEA 1M74A 3QKSA 3NTUA 3GLFE 2WJJA 4HZIA 2RH5A 4OHXA 2PEYA 3K9NA 4MGYR 1SHZA 1CTQA 4AIIA 1M2OB 2QPAA 2ZUBA 5DGXA 2XOKD 4JLJA 2IYVA 2FPKA 1DAHA 2I4IA 2N42A 4HUQA 4LV8B 4C3ZA 1JNYA 1VCNA 1Z6AA 5F2EA 4RD3A 2Q9AA 1XP8A 4TQUS 3X1WA 4BGDA 1RKBA 3B9QA 2ZRAA 3AVTA 2QM7A 3BIFA 2QMEA 2FMXA 3NC0C 421PA 5DSZA 3LBIA 3VR2A 4V0MA 1U8AA 3RS5A 2VEDA 2WKQA 1DADA 3MJHA 2JLSA 1R5NA 5H8WA 4AKIA 3B9PA 3X1DA 2H17A 2PX3A 2WPDD 1HUQA 3AKYA 4JIMA 4QGHA 3JVUA 5EE0A 5IK2A 4AYTA 4JLDA 2OLKA 2X2FA 1K5DA 1RW4A 2QG6A 2NZ8A 1U98A 3PCRB 2J1LA 1Y3AA 5JHGB 2FZLA 4D2IA 1GOTA 1CR1A 1UADA 5FOSA 3FB4A 2GWHA 1VG8A 2ZI9A 1MO6A 3CH5A 3KQNA 3U6BA 3QQ5A 4QRHA 3EPKA 1Z2CA 1ZAKA 3EWAA 1E9SA 2WZQA 4ZV4A 2EFGA 1OHHD 1GL9B 2XZOA 3I32A 1NBMA 5CYOA 3QPVA 2JGNA 2ZIAA 1Q57A 1US8A 4C7OA 4TMXA 1IXZA 4PX9A 3OEED 4MDFA 2GDJA 2XTMA 2UKDA 3NH6A 2QMHA 1N6IA 4CT4B 3R9WA 2P2LA 2W0SA 3KQLA 4CIDA 4DBLC 3QXXA 4XWKA 4URUR 4O2RA 4TMZA 4AK9A 3H1TA 3ZQJA 4LK2A 4M1TA 4DT1B 4OBEA 4FCVA 5SZHB 1GUAA 1UBEA 4TQAA 2EWVA 2O8DB 3HYTA 4WZAE 3W6OA 1X1RA 1EK0A 2ANCA 4O2LA 3TH5A 3RANA 3U4QA 4MYHA 1U0JA 1J70A 5KPJA 5C18A 3K0SA 2QROA 1E2FA 1NN0A 4C30A 2FGJA 3LQRA 1KI9A 1NL3A 3P32A 5AJYA 4W7SA 1G16A 3CRVA 5EE1A 3TVTA 1CBUA 1E4VA 3FGNA 4WXRA 2C95A 5JSZA 1N0UA 2ZRHA 4TYWA 4LUCA 1I4TD 1K8RA 1BMFA 1XMJA 5J47A 1SXJB 2EQBA 1ZCAA 2BMFA 4IDPA 2V54A 5KHOC 4DCNA 3WHLA 1EXMA 3F5FA 5H70A 3DZDA 5FUXA 3EPHA 2QQ0A 2NTYC 1LS6A 1WRBA 5AUOB 4DCUA 4TTQA 3CNNA 2N46A 1GNQA 1R7RA 4PZLA 3OHMA 1MO5A 1LW7A 1QHHB 1M8PA 2UZ3A 2VP6A 3KUDA 2WJVA 4HUTA 2ORVA 1VG1A 1CIPA 2Z83A 2CJWA 3OEHA 2HLDD 2EWWA 3IQWA 4H1UA 4URWR 4KBFA 1MRNA 1T8UA 1BOFA 4LCBA 2OV2A 3RSOA 4G0NA 1NNEA 3AVQA 2GESA 3GLIE 1G8YA 3WMFA 4Q4JB 1P9RA 2QI9C 5K8TA 3I5YA 2GXQA 4TLBA 4CT5A 1FQJA 2BMEA 2ZE7A 1CJTC 1ZW6A 2WJHA 4IDOA 4OQLA 5B58C 3GFTA 1TF7A 1N6OA 3DOFA 2EYQA 2VF7A 3KL4A 4ZDIA 5FBWB 1TTTA 2FV8A 2DR3A 2CVHA 4TLAA 3C4JA 4C0KA 1E9FA 1C9KA 4ZI2A 4L15A 1P2TA 1D9ZA 5L3SA 3FHOA 4JLOA 3DM5A 3ZYCA 3U3KA 2C03A 2RGNC 5C1BA 1IJFA 2XJ9A 2P6NA 3EZFA 3QXSA 1MV5A 5FPSA 3NH9A 1D2NA 2XOKA 2YC4C 3AVVA 2GXSA 4HAUA 3FHTA 5BQ5A 1PLJA 1UF9A 4MKHA 2ODNA 3U7HB 2CCGA 4LPSA 3FYHA 3CWQA 2CLDX 4I81A 2EFHB 5HE8A 3F3YA 3AKDA 4DDUA 5FPKA 2DWQA 2GZAA 521PA 2XXAB 4B76A 3HDTA 2ZI4A 4TMKA 1W5SA 2HV8A 2GAOA 3IPYA 4TSFA 4EFMA 3PEYA 4GMXA 2R65A 2ZYVX 1AS3A 3BORA 4A0FA 1X8JA 1T91A 4MYCA 1E1RD 4LHXA 2WPDA 3DMNA 1G18A 3EC1A 1H65A 5FOWA 4CVNA 2YHSA 1NKSA 4TMTA 4GT1A 4II7A 1CU1A 4RD1A 1G3MA 2RAPA 4KYIB 5ANRB 4NYIR 4DIEA 4ZCIA 1ZINA 4US2R 4M1KA 1A1VA 5TB5A 1P9NA 4TN1A 1Z0KA 3NVAA 4HB4A 2ZREA 3TIFA 1Z0AA 2Q0HA 1DS6A 3KDSE 2BDTA 1FZQA 3K09C 3LH5A 4IDNA 4OQFA 1ZBDA 3T12A 3CRRA 4HAYA 1HH4A 1GILA 2Z43A 4KO8A 3I8SA 2MMCA 2VP9A 4HB3A 4HLCA 2KB0A 3BERA 3HYRA 2NO9A 4ZIRB 2A78A 2VIIA 3AP1A 3HP1A 1NIPA 4US1R 2V7QD 2VL7A 1JR3E 3SE0A 2HUPA 4C0SA 1TU4A 1OXTA 5EP4A 4NHOA 3UATA 1DTSA 3AVWA 3E70C 2DY1A 1T3HA 2JDID 3AUXA 3T35A 2OUKA 2QMOA 1G3QA 4PC7A 1ZNXA 2C9CA 2CCKA 1JEEA 2ZR0A 3A1SA 4KVAA 3M4YA 2ZUDA 1OH6A 2PZGA 3P4XA 3PIRA 3Q8XB 5JI3E 4DVGA 1PUIA 1W7AA 2JLRA 2CBZA 3F8TA 4Q47A 2GVDC 1G7RA 1F2TA 4QFMA 1U9IA 1IN7A 3FFAA 4PZYA 1ZIOA 5EUMA 5FI1B 1XRJA 5HE9A 3RRYA 3UWOA 2O8BA 4KSBA 1XDBA 3W6PA 2GCPA 3TR0A 1VMAA 3UKDA 3T61A 4UXHA 1XD2B 3HU1A 3K0FB 1U0HC 4GPTA 4YMSA 1QZXA 4IDQA 2RGGA 2BMJA 1KNQA 1HA3A 3I61A 4DLTA 1E2KA 2BBWA 3NEYA 5J4VA 2D7DA 4EKDA 1FMLA 2QPTA 3NIBA 4FMBB 1Y63A 4JVSB 2HLDA 2XAUA 3THWA 1E0AA 1PVOA 1SZPA 2X2EA 1XXHA 2Q3MA 1ZUIA 4NP6A 2I3BA 2PCJA 2IXGA 1IONA 2QP4A 2NGRA 3OF5A 2YWHA 1TADA 1YR6A 3AF2A 3GEHA 1E2PA 2PL3A 2GA8A 1I4LD 1VYVA 5H1YA 2QAGC 3RLFA 1DAIA 4RZ2A 1N6NA 3BB4A 2QP3A 2ZRMA 1Z08A 3ZVLA 2OAQ1 1N5JA 2A5FA 2ZI5A 2ZQ5A 2ZM5A 4JYCA 1WE2A 1R10A 3W8RA 3WMEA 2FSFA 1IJEA 4TYPA 4FD2A 1XD8A 1UKYA 4A6XA 1W36B 1E0SA 3BE4A 1ZCBA 3RRZA 621PA 2QA5A 1OF1A 4LYFA 5SZJA 2ZE5A 4OJKA 3AF4A 3KXKA 4FWTA 3VNUA 2NOAA 3D7MA 1XCGB 2AL7A 1QHXA 1EWRA 1G4AE 2P5TB 1KI2A 2AD1A 3QXCA 4HLUC 1JAHA 4QGAA 2QRNA 4G5GA 3HU3A 4YXWA 4PPNA 4Q1DA 5FUYA 2V3CC 4Q1CA 3AF3A 2F9LA 3V4FA 3B1VA 8OHMA 2YWGA 2QZ4A 1R6BX 2F55A 4GDFA 4M1SA 3SYNA 1C4OA 1IN8A 1HE1C 1VDZA 2WMOB 2JATA 4BZPA 4UKDA 3LVQE 4WW0A 3SEAA 2ZRKA 4ON9A 5KYKA 5EXXA 4KVGA 5E4FA 3FTQA 5FL3A 5FBVB 5BYKA 1NN1A 4EFLA 2C2HA 4CDGA 2WWXA 4I4LA 1E9RA 1T5LA 2H5EA 4TMVA 5EP3A 2IC5A 4ZCLA 2W00A 1YRAA 3K0EA 1R4AA 4KFSA 3SJCA 4BASA 5FOXA 3NHAA 3U3RA 4JVNA 4LY6A 1FMJA 1ZC4A 4DCVA 3AGPA 5KNDA 1TQDA 221PA 2PMKA 3ADBA 3KQHA 1D2EA 2V7QA 4J0QA 2OXCA 5K8IA 1VG0B 4AY2A 1G3UA 2I1VB 4NTZA 5HKKD 3LX5A 3C8UA 2JDIA 4PO8A 1N0WA 3PUVA 4NCIA 3W3AA 4QNRA 1G8PA 3A36A 4Q4AA 2NQ2C 4KJZA 1EX6A 1YZUA 3VR4A 1G3RA 3T06B 4OHYA 4DXAA 1L4UA 4JS0A 3KB2A 2EFCB 3IIKA 4Q7LA 4LJ7A 2OM2A 5JWRA 1KAGA 5EE3A 1Z6XA 4MGZR 1IN4A 1VCMA 1Z6TA 4H9GA 2BCGY 1DG1G 2LKCA 2G9NA 2FPMA 1SHKA 2HCBA 2IYYA 3THYB 3VU9B 2G1KA 4AYWA 1GNPA 3WNCA 4B2LA 4I1VA 3EX7C 4DCTA 5IT5A 1Q0UA 3QKUA 4Q1FA 1QHYA 4LHVA 1XPOA 3BH0A 2AKAB 2CE7A 2LKDA 1Q1ZA 1Q44A 5CDFA 2GCOB 2GETA 2R62A 3TW8B 5JS7A 2FGKA 5A5GA 1FPMA 2FSHA 3UWKA 1DG3A 1AZTA 4B32A 2OESA 1KJYA 2VP5A 3VQTA 2GILA 1P4SA 2XX3A 3MSXA 2C8VA 4IVQA 3GJ6A 1JEDA 3ZS8A 5CITA 2WHXA 2FF7A 3THXB 1KSJA 1E0JA 2ZJ8A 1JB1A 4JYBA 1GG2A 4NYIQ 2Z4SA 3OESA 4HZUA 4MUBA 1WDTA 2R44A 4IDHA 3PUWA 4B47A 3I73A 4HEJA 2EYUA 2R6DA 4DJTA 4IKEA 1SKYB 4RKFA 4M1MA 2QUZA 4OI1A 2BVNA 2V9PA 1ZJ6A 2VP2A 4NL4H 2OBLA 4PQFA 4TTPA 4A4DA 2ORWA 2DHRA 3TAHA 1AQYA 1T3LA 2BBOA 2XZLA 2NPFA 3C15C 5CB6A 3IPXA 4RFSA 1QHIA 1CF4A 4V03A 3KFVA 4JLKA 4JJKA 1SVMA 1K6MA 1E2MA 1RJ9A 1P75A 3HWSA 2IYSA 4YLGA 4ACBA 2QORA 3OIWA 3BC1A 2CE2X 2DPXA 4B2IA 1TQ6A 2O8EB 4EAQA 1F5NA 3BD9A 4D4MA 2OHFA 3D31A 3KKMA 3NWJA 4LPKA 5LDDC 2MSDB 1KMHB 1P7CA 1UDXA 4K8OA 3U3JA 3BB3A 3CM0A 3RHFA 2CDNA 2QAJA 4HB0A 4B3FX 2V4ZA 3TUJC 4DSUA 1ZM2A 4F4CA 1T6NA 3IUYA 3TJZA 1Z63A 5FI0B 1OLOA 1OXVA 2J7PD 2OCAA 3N5CA 4QJ3A 5L3QA 3GJ5A 1OIVA 2QNRA 3ND8A 4DLSA 3QF7A 3BS4A 2C77A 3CR7A 2WTUA 5FR2A 4FIDA 1II8A 3B7GA 3ETLA 3VKWA 4LJ8A 4B3CA 4DB4A 2AHOA 1DAEA 2QTFA 1JR6A 4LZZA 1EX7A 4UNSA 3ADCA 1QHSA 2WJYA 4OHWA 1RFLA 3OE7D 1ZC3A 4MH0R 5E7JA 2G0TA 4P33A 4BUJA 1Q1EA 3EASA 4LRWA 2FFHA 5B64A 3W90A 3V4RA 3IHLA 3QKRA 3AVPA 4CRWB 2KJQA 1MO3A 4V0ME 3C14C 1E1QD 4CEIB 3HR8A 1Q22A 5G53C 3VX3A 4WA7A 3KUCA 1NLFA 4PO9A 1HQYE 1KI7A 3L0IB 2V55B 2XEXA 2A5DA 3I92A 4U5XA 2B21A 2CL7X 2ZSAA 1ZM4A 2GK6A 1DE0A 5DI9A 4BZQA 1U94A 2IYQA 4KV9A 3DPUA 3L8YA 3JZMA 5FOTA 4OK6A 1CJMA 5F9FA 3QUSA 4JSYA 4FN5A 4ESHA 1XEWY 1OIWA 1CR2A 1J7KA 1KKMA 1NBME 2C9OA 2FU5C 2O52A 2RCNA 3AP2A 4LBZA 3WRXC 1YE8A 4AD8A 1S8FA 4KHZA 4KLZA 3VX4A 3W8NA 1WF3A 2AWOA 1NMYA 5A0FA 3NKVA 4C4PA 3IEUA 4IOJA 1FNNA 3MFYA 2ERYA 5JHHB 5AUQA 3EZ9A 1G17A 3NBZC 1W0KD 4IEEA 2W2XA 2GRJA 2D74A 3K9HA 2R8RA 4P4TA 2AN9A 4Q7MB 2YOFA 1G9XA 3AVXA 1EFHA 2Q3HA 2PMDA 1E2HA 4Q9JA 4DLUA 3HR7A 5AJVB 4OI4A 3C41J 4EIWA 4R2IA 3SQXA 1BS1A 2GK7A 3CPEA 3WY9A 2QY9A 5EXTA 1E4YA 5CIWA 2VPPA 1QG2A 4DSNA 4C0JA 3QSYA 3RS7A 1G5RA 5G40A 1IXSB 3LA6A 4HAXA 2H1LA 3MWKA 4Z8YA 4R7ZA 5DI3B 3WBJA 3CPHA 1DAGA 2PJRA 2WJIA 4LYHA 4Q00A 1U9IC 5CJPA 2KWIA 5UKDA 4AWXA 4A8JC 2CLSA 2HDNB 4RD6A 2GJ9A 3UPUA 1G8HA 1SVWA 2IS2A 1R5BA 5BN4A 2QAGB 2J0SA 4LJ6A 3E5HA 1AGRA 2EVWX 3FMPB 5KOYA 3LFUA 5HZHA 2WAXA 3OAAD 4LOAA 2XITA 4RSGA 2B92A 1BO6A 4I1SA 5HCIA 1YQTA 3PV0A 5F3WB 1CJVC 3RC3A 2JJ2A 4I99A 4MA4A 2ZRJA 4KFTA 4A2WA 1G8FA 4PAQA 4AG6A 2G77B 3B82A 4BFVA 2VP4A 5D3MA 3RS3A 4CEHB 1Q1BA 4GNKA 4IVPA 2AK2A 1AA9A 1Z0FA 1SVIA 2V1UA 1JECA 5L3RA 2JLXA 3PR1A 5J4HA 1H8ED 4LBVA 2ZANA 5CIQA 4TSFD 4OI2A 2XZPA 1NG1A 2WMNB 2GZDA 2F43B 2NO1A 1SGWA 3SR0A 4FMCB 1OFUX 2J7PA 4V0OA 3PEVA 5JFGA 1WB9A 3FVQA 1N6RA 5KDDA 1NG9A 4QJ5A 2ASEA 5L3VA 5KPDA 2ZAMA 3SBEA 4U02A 3WNBA 4BRUA 5KUTA 3U44B 1S1MA 4GZMA 2ZE6A 1DPFA 3W5IA 2CHVA 4MGKR 4OQMA 4JKIA 1MKYA 1TQ4A 4DT1A 1X8LA 3OE7A 3VFDA 3VHXA 3AVYA 3AUYA 5KU1A 2O8DA 2F9MA 1S9HA 2FEMA 2F3RA 1UAAA 2PCLA 1SVLA 5TDHA 3KKOA 4CZ2A 2C96A 2XTNA 2AK3A 3ZVRA 3QKSB 3R9IA 2PT5A 2VHUA 2DFNA 3VR6A 5JEEA 1E1QA 2WM9B 4EQ6A 4DZZA 3CX6A 1F2UA 3B1YA 4HUQB 4TLEA 2ODBA 5AR1A 3AV0B 2YWEA 1OH5A 2QQEA 1HYQA 3LBHA 3QG1A 1GTVA 3F0TA 1Z28A 2XNDD 1E96A 2JA1A 1U8YA 2FZ4A 4NONA 3ZZ0A 1QHHA 4C0LA 1KK1A 1AZSC 1KO1A 4BFSA 2Z6VA 1KZ7B 4XVUA 2IS6A 2ZROA 2GAAA 1DARA 1XB2A 1JALA 3QY0A 4JVLA 4HAVA 4Z8XA 1UM8A 1MOZA 2QE7D 3CPJB 3DDCA 4C0AC 2VO1A 2E9SA 4PAOA 5HTKA 1OJLA 4AI6A 1W0KA 5EXSA 3DEFA 5FTJA 2IXFA 3CF2A 4PO1A 3PITA 1BIFA 3BH6A 1Z07A 2IYXA 1UPTA 4GMDA 3WXMA 1GNRA 3WHKA 1D5CA 3EAQA 1CEEA 4C2UA 4C7OB 1KO8A 2MSEB 3W9YA 1DOAA 3NEJA 5IF9A 4N3NA 1YZNA 1Z83A 2VHQA 5KDOA 2GJSA 4A92A 3QF4A 5JZVA 1U81A 1XMVA 5FUVA 4FXPA 1LNZA 5EUQB 3EIEA 1QVRA 3LDAA 3GLHA 2NPIA 1IN5A 4GOJA 1P3JA 4L16A 2CLCX 4EPVA 1OYYA 4DDTA 1YZKA 2REXB 2VQSA 1BYIA 3FMOB 4G5QA 1F60A 4C2TA 1FL9A 3AP3A 3UK6A 4RZUA 1NY6A 1TPZA 4JLAA 4OQXA 2B7BA 1G7TA 3U4QB 2IUUA 3CB4A 1NRJB 3P20A 4MRSA 4PAMA 5TARA 2FA9A 2CHQA 2VSXA 5CK5A 4M2LA 4NU0A 1Z47A 3GLFA 3A8TA 1P2UA 5FTMA 3OAAA 1E2IA 3KTAA 1G8GA 3CW2A 5JSZB 2ZITA 1ZNWA 1NMXA 2P6UA 4TT3D 3REGA 4B43A 4C9BA 4BLRA 4B73A 2IEZA 5C4MA 4KITB 2GEDA 4FCWA 4Q9IA 1XXHE 1AGPA 4I1OA 4D26A 4RFVA 4Q7JB 2F1IA 2ZS7A 4KXFB 5E95A 2GXUA 5B30A 3FFBA 3LLUA 2C5LA 1E94E 4HAZA 4URZR 3VKHA 4G1UC 1HY3A 2J0UA 1DO2A 5G3ZA 3GFPA 1VECA 5KSZA 2IK8A 3U7GA 1WBBA 4YXWD 2JCSA 1H8EA 1ZUHA 2Q9BA 5FBRB 1P5ZB 4A1FA 1FUKA 1FQKA 2CJWB 3O8DA 5FOUA 1FP7A 4HSEA 4Y0VA 3E1SA 4KI0A 4W5WA 1Z8FA 3BK7A 2NMVA 3KXLA 1COWD 1BKDR 1ZUNB 2OCBA 2PZEA 3DKVA 3K0AA 3IHWA 5AWFC 5J5CA 4FMDF 4ACAA 4F4IA 1NI3A 3A1WA 1S2MA 3JZAA 5FL7D 3CUEF 1LTQA 4RCZA 3T1TA 2FDCA 4WZ6A 3ZIAA 4D25A 1LF0A 4OKSA 4D4JA 1N5KA 2R6AA 2OSBA 5EE9A 4NCNA 3AGQA 1KMQA 3N2EA 5TMPA 1RIFA 2OT3B 2ZJ2A 1VYUA 4BE7B 4BLPA 2XTZA 2QRZA 2V8OA 5JRJA 2ZVPX 4LBYA 3ASZA 3IO5A 4NYMR 4X8LA 4G5OA 2FFQA 2ZJAA 1Z5ZA 5EXPA 5SZIA 1W4RA 1HTWA 4IFBA 2NZJA 1PZNA 3ADDA 3B1XA 4JKYA 1ONBA 1GDDA 4R98A 3TSZA 3IILA 4JZKA 1RE0A 4ITRC 2JLVA 1KK0A 1C1YA 3ADKA 4Q48A 5A4JA 3L2OB 5FBQB 5LD2B 3GEIA 1KDPA 1ZNYA 3M0EA 4B3DA 2VP0A 4H1VA 1KSHA 2D2EA 3PJRA 3L82B 2XNDA 2NO6A 2DCUA 4LHYA 3MG9A 1IHUA 4R71A 3NBXX 4JVMA 4M1OA 2WSMA 4YMTA 1XJQA 1A82A 4A8JA 4PQRA 4ERNA 1CJKC 4DIDA 1KI4A 1VPLA 4DEXA 2P3SA 2QE7A 4N0DA 2ZYUX 4B35A 3A4MA 5B2ZA 4S2EA 3ZZUA 1LV7A 1U90A 4A82A 5J40A 4M9ZA 4QGFA 1N5LA 1NJGA 4DLRA 3B6EA 2A5YB 4GSYA 3LY5A 4LV6A 1CULC 2ZSFA 2HT6A 2OBMA 3SYLA 5DE3A 2IF0A 3A4NA 2WKRA 3KX2A 1RRCA 4L5BA 4PZZA 4D4KA 3NHBA 3RS2A 4E03A 3GLIA 1SKYE 3VR5A 4V0KA 5AJWA 3VHLB 1J8MF 1B23P 2FFAA 3EWSA 2GVZC 1NP6A 3SZRA 1W44A 3EA5A 2WWIA 4R9UC 4EPRA 2EFDB 5TY0A 4Q21A 2B7CA 2XJ4A 1S1CA 2PLRA 5GADl 4BFZA 5AJZA 2ZE8A 5CK4A 2JLYA 4RZ3A 3A58B 3T34A 3V9PA 1CS4C 1QVAA 1F2TB 3DHWC 4HDCA 2MSCB 4GP6A 2AFIE 2ZI7A 1OH8A 4ZCMA 2WWHA 2O8BB 1LS1A 2J59A 2ZPTX 3I4LA 1NMZA 5EQTA 4TT3A 1GAJA 2ZRIA 4P4UA 3U3OA 2ZSBA 2D62A 1IN6A 5BYJA 4XSHA 2HXYA 5AUPB 2J0QA 1XPUA 3B78A 5JECA 1OXXK 1H8HA 3T5GA 1NLZA 1RZ3A 1SULA 4EJSC 5C2JB 1YR7A 1N6KA 3G5UA 2YNMA 3QOFA 1EESA 2D2FA 3CF0A 1S3GA 2B8TA 3QEOA 3CX7A 3DKPA 4MRPA 2GF9A 2F1HA 2LCFA 5IDVA 1TUIA 1ZM7A 5TV2A 1TUEA 4ARZB 2W2TA 3K9GA 2I1QA 2JASA 3LBNA 3TSOA 1NF3A 2IYUA 1ZVQA 4TL7A 2JIZD 1S4QA 1OPXA 1GKIA 4GOKA 4XVRA 3CO5A 5HCNA 1WQ1R 1P9WA 1XXHB 5FR1A 1CLUA 1CXZA 3J81k 4MKIA 1COWA 3QKTA 3IO3A 3KKNA 4KLNA 4Q19A 3AM1A 4IXNA 5FL7A 3SU8A 4M8NE 3U6KA 5DYIA 2ONKA 2PT7A 5J4LA 2IYZA 4QHYA 4Q4HA 4RD4A 3GFOA 2D06A 1AM4D 1TF5A 1Z22A 3MJRA 3X1YA 2VHJA 3O8RA 5TXGA 2BKEA 2WAYA 2DBYA 5ELXA 1FP6A 4O25A 2HF8A 1YZQA 2GNOA 5FUWA 1M6NA 1PUJA 4PHFA 4XOIA 1D9XA 2JAQA 3EIQA 5GVRA 2C99A 2H18A 3IEVA 1W4CA 1QDEA 4UXIA 1FTNA 4U7DA 1II9A 2WWYA 4IEIA 1JR3A 3RS4A 1XJCA 3KJHA 3GEEA 3S1AA 5FTNA 3I62A 2GJKA 1W2GA 2BBTA 2A7QA 2R6FA 4RKEA 1KI8A 4LWZA 2OCYC 1OB5A 2PH1A 2ZU0C 1CRQA 4PHHA 1OFTA 4QHSA 4MKFA 4A2PA 4LV5B 4HB2A 1EGAA 4MGIR 5KTYA 5KSOA 2G1JA 5KO2A 3SQWA 1B0UA 1G4UR 3B85A 4IOLA 2H8KA 3CONA 3LW7A 4NDZA 1I2MA 4D81A 5E7MA 4BEBA 4FW9A 1XD9A 3A1VA 1DAFA 1T4GA 3D6TB 4RCYA 4RZXA 4DDVA 4PPGA 4TYNA 2QMUA 2ZRBA 2CHGA 4Q01A 2REOA 2P65A 3SJAA 2GBLC 3LXXA 4LGMA 721PA 1F6BA 5TVKA 1N3BA 2WWGA 1GM5A 2ZEJA 4KSCA 2QU8A 1TX4B 3VNVA 1D8TA 4Q02A 1I4DD 4K46A 4LJ9A 1KI6A 5JJIA 3DZ8A 4NYJR 5EP1A 4O3MA 2AR7A 2R2AA 3AB3A 4F38A 4DKXA 1KOFA 1N6HA 2BOVA 1LY1A 1MABA 1R2QA 3LV8A 4GFDA 4NE2A 2REBA 1SXJC 5CLQA 1XZQA 3AH8A 2RGCA 5GJCA 3R7WA 1W5TA 1VCIA 4X8HA 4AKGA 3SI7A 5LPNA 2EU8A 5JBQA 2XGJA 2YVUA 1JXMA 3GCGA 4M4SA 1E9CA 4A15A 1M7GA 2ZRDA 4Q4AB 4S35A 2E87A 3BFKA 1E2DA 2YYZA 4LJ5A 1YJ5A 1JPNA 4LYAA 3DMDA 2QN6A 3B8HA 3KKQA 1W46A 1UBFA 4HDQB 2BC9A 3PUYA 3VR1A 5C4GB 2PZFA 2V6IA 2JLUA 1XWIA 3TAUA 3OIVA 4NYMQ 1KIMA 1P2VA 2AKYA 2GJAA 2ZJZA 1NKTA 1M7HA 1E2LA 2IUSA 4QHTA 4AYXA 3WYGA 1XEXB 4DLXA 1KSFX 1HQCA 1AK2A 2W6JA 2ZU6A 4QJ4A 4DWJA 3O8CA 3SN6A 1HEIA 2JJ2D 3KQKA 3PG5A 5JRZA 4E5UA 4UNPA 1U0LA 2ZTSA 1OKKA 3QE0A 2OCPA 3LXRA 4HDOB 1KNXA 4PHGA 1IM2A 4Q9KA 4P4SB 1RC8A 3UXMA 2JIZA 4ZDKA 3GJ0A 5BXQC 3LW8A 2R9VA 1YVDA 4X8MA 2V1XA 3C5HA 4QGGA 1XTRA 1JQLB 2F1JA 2IEYA 4UNNA 4DUGD 2IX3A 2CVFA 2VSFA 4TYQA 4ZPXA 2GCNA 2Y8EA 2HXSA 4MKGA 5KNCA 2QBYA 4NZYA 2WIAA 1E32A 2J9RA 4NPHA 5JMTA 4Q03A 1KJWA 3KB1A 4FWIB 2O8FB 1W4BA 4IRUB 4TZ6A 1KAOA 1RYFA 2D4HA 2A30A 5HR5A 3AVUA 4BRWA 2CCJA 3CX8A 1PV4A 1YZGA 3MGCA 1Z29A 2O0JA 4DHEA 3DM9B 2HJGA 2KI5A 3ZH9B 3OFND 2D3WA 3H4MA 1WBDA 4RFSB 1XTKA 2FG5A 3MWJA 5FPYA 1W1WA 2FFBA 1KDRA 4OHVA 1RJ9B 5FFMA 4JLBA 4L8GA 2XSZD 3KFXA 2HJVA 1TMKA 3ZGXA 4DLYA 2HT1A 2O8CA 1T3SA 4XIGS 5JEDA 2JLWA 3BAFA 3QBTA 4QG7A 4NH0A 3GLGA 4NBSA 4CEJB 3OIYA 2IA5A 1GL7A 4O0MA 3PXGA 3KKPA 2J3EA 3LLMA 1W0JD 2WJGA 3L0SA 4YC7A 2ZR9A 3N70A 1NVWQ 3SYKA 1SXJD 3A1UA 1IBRA 1EWQA 1UBCA 2WIBA 3MAAC 4EUNA 1DEKA 4AG5A 4BLOA 2ODWA 3EW9A 2VSOA 1KY3A 5BW8A 4WIAA 1KY2A 4RVCA 2QM8A 3MD0A 1W2HA 1R8SA 1A4RA 4KFRA 5L3QB 1A2BA 1M7BA 1YKSA 5GVSA 3C7KA 1E98A 1KTVA 2IXEA 4BWYA 3PUXA 4OHZA 2L0XA 4TMWA 2VH5R 3AVOA 3PUZA 4XSGA 1II8B 2AFHE 5DIFA 3BRWD 4ZO4A 5K8UA 5FOVA 1NVXQ 1VIYA 1XTIA 4MRRA 2XNSA 1GVNB 1UKEA 4BPBA 3QVUA 2IHBA 1U8ZA 3NC1C 5LB4A 2ZR7A 2VYFA 4W9MC 1CP2A 3BOSA 2BMDA 1N0VC 2FSIA 4G3XA 2YV5A 4EJSA 2Q21A 1JQJC 2Z5FA 1MR3F 3QKRB 4TZ0A 2TMKA 1SVKA 3CWZA 1FX0B 1SVSA 4OK3A 5DO9A 3RVBA 2BEJA 2ZETA 4IHQA 4A0RA 4PPQA 2Z0MA 1R5OA 1TU3A 4B75A 5E3HA 5L8VA 1T0HB 1RVDA 2BWJA 5FBLB 3RAPR 3IKJA 1JJ7A 1ZM9A 1NIJA 4AC9A 4A6PA 5J4YA 3R20A 5JS8A 3EA0A 4OK5A 1E9DA 5EP2A 4DDWA 4EFNA 4IOMA 1UKZA 2VA8A 3GPLA 3TRFA 4ABYA 1AQUA 5EE5B 1KDOA 3ZVNA 5EZ6B 4BEJA 5HZKA 3AKCA 3KJGA 3TVDA 2AWNA 3SOPA 4G01B 3PQCA 4Z1MD 3TMKA 1ODFA 1X6VA 3UG6A 1ZNZA 5FTKA 3RRMA 5BN5A 3TNFA 3ZLJA 4M53A 2RGXA 2BM0A 1G5PA 1KO5A 2QENA 5FH9A 4LC0A 3R9XA 3U44A 4UJ5A 5DH9A 1GRNA 1OH7A 3I5XA 1LB1B 4POAA 1G41A 4MRVA 4I1UA 4BQSA 3UMSA 1KI3A 4FI3C 4KYUA 3TUIC 1XTQA 4Q1AA 1W36C 3QNUA 5DLQC 2OFXA 4EDHA 2J41A 4LBWA 4BLTA 4BZXA 1G7CA 1IY1A 1Z6YA 3CZPA 3FWYA 4HATA 4L9WA 1XU4A 4N0EA 4MYUA 5LBIA 2H57A 4P31A 4A9AA 4DUGA 3L43A 5CJ2A 4IVRA 1GRQA 2F1RA 5CB8A 5JCPA 2RB4A 4LJYA 2ZJOA 2YINC 3PENA 1G1MA 2CK3A 2GKSA 4PQYA 4B74A 2WICA 2V6JA 4DLVA 4E09A 2A2ZA 3W3ZB 3K70C 3ZIAD 1TAGA 2JEOA 3RDPA 4M0LA 2GXAA 2J5XA 4PSKA 4QBFA 4XH9B 4M1WA 4WVFA 5CLLA 2GBLA 3MWLA 3BFVA 1E3MA 2CNWD 3OFNA 3QPUA 4NYJQ 3WBKA 4QL3A 4UJ3A 1Q3TA 1R0WA 1OFHA 1YR9A 4B6FA 1HE8B 2QT0A 1YR8A 1G6OA 2YJTD 3MRSA 3QIAA 2XSZA 1OIXA 2UVQA 1G20E 3RRNA 1UEIA 2NG1A 1Q3HA 2ATVA 4GI7A 1WA5A 3B5JA 5M04A 2P67A 3DVLA 2IL1A 5D3MB 1W0JA 2JJ1A 2C78A 2IYWA 2NIPA 4C0BA 1TNDA 1SXJA 5CYPA 1T9HA 1XMIA 2ORIA 1ZU4A 1N25A 3FE2A 4JJZA 1Q12A 1ZD9A 1WCV1 2BEKA 3FKSD 3ASYA 3NDBB 4EPYA 5AK0A 4AKHA 1E2GA 3LRPA 5E7IA 2IF2A 1T8TA 4HLDA 4WXPA 3CBQA 2JLQA 3GJ7A 3KXIA 4YMUA 2BKUA 2K5UA 2ZS8A 1X86B 2DFTA 1TF2A 2OG2A 1J8YF 1XBTA 3SHWA 2ZUCA 1D2MA 2C9YA 2F6RA 4LYJA 4BFWA 1LF5A 4UNRA 3EG5A 3NG1A 1YZLA 1DAKA 1E9AA 2OEPA 3K53A 2HYIC 1AJEA 1EFCA 3FKQA 1G21E 4IJMA 4ILEA 3A6PC 1XJ0A 3SDZA 1GITA 2UZIR 4JLPA 4LSGA 4BFXA 4Q4JA 1BYUA 4B3XA 5BN3A 4QXAA 4JLVA 4KBGA 1E79A 1ZMXA 4M9SA 3IIMA 1HV8A 4HLQB 4Q1EA 3D8BA 4HI0E 3ICEA 4TL8A 4OQNA 3KJIA 1W47A 3QPWA 3TGPA 2JJ8A 2CMKA 4JL6A 3THOA 1US8B 3LD9A 1Z6GA 2IS1A 4GBMA 1OV4A 1PLLA 3TUZC 3TBKA 3VMFA 1N6PA 3A1TA 1V5WA 5GJBA 4B44A 1E2QA 4Q9LA 4LX0A 4Q1BA 3RS0A 3LO5A 2QPOA 3WRYC 3TW4A 4EQ6B 2X1VA 2BJWA 1F2UB 3QEJA 4KCGA 1NN3A 2ZRPA 1G3IA 1ZP6A 4B6EA 4BFTA 2IYLD 4LI0A 1S96A 1HURA 4DC9A 1VKJA 4NCKA 1LVGA 3LAWA 2FNAA 3B2EA 4W5JA 1W36D 1Z2AA 1YZTA 3TR5A 4AURA 1XCMA 3TE6A 3CKLA 3OIUA 3WP1B 4DB2A 2X77A 3ZS9A 3B13B 3WP0A 1RYHA 4ZDJA 2W6IA 3IQXA 2PJZA 3SJZA 3EC2A 5FPTA 2XXAA 1R8QA 4DLWA 4ASUA 4BFYA 4NKRA 1F3OA 4Z1MA 4LJAA 4TL9A 2FPLA 1VHTA 4RD0A 4M22A 3K70D 1G64A 1O3YA 1OXSC 2CL6X 2VRWA 4KFUA 4Q18A 1QG4A 4B3BA 4WAUA 1Z06A 1TEXA 5LB2A 1OYWA 3Q85A 2YZ2A 1WMSA 1Q21A 1H8HD 4PSAA 1O87A 3X2SA 3Q3JB 2ZI3A 2RHMA 3VAAA 2RGEA 3CF6R 3I1FA 4HYYA 2J46A 3QXJA 5HPYB 3CZQA 4DCSA 4F91B 2OLJA 4PSVA 3EZ6A 5CM8B 1KYIA 3QF4B 5JJKA 2FEOA 3FHCB 2OFOA 3KZ1E 4W5HA 3GD7A 3GLHB 2IYTA 4A0HA 2NO7A 2IT1A 3IIJA 4F7WA 4URVR 3CRW1 4ZDWA 1ZRHA 1E0KA 4YDSA 1P62B 3RABA 1K5GA 4ZIRA 2RGAA 4MITA 4OL0A 1EFUA 1TL7C 2DWOA 2QTHA 3Q7QA 4A0GA 3GP8A 1GKYA 3ICQB 4P32A 1AS2A 1WP9A 2WVJA 3FPAA 1N2CE 5JI2E 3GLFB 2CNWA 2RMKA 2P5SA 2W0MA 2WOOA 4C0QC 1JXOA 3RSLA 3KTAB 4B34A 3MCAA 3C5CA 4XD7D 1QHNA 1KJZA 3B1ZA 4C0HA 1GRRA 4IFEA 1XTSA 4DRZA 3KQUA 5L3SB 1ZIPA 4JBYA 1N5IA 1JR3D 1M1YE 1W49A 2O5VA 2KBFA 5AUNB 4YONB 2WV9A 3KJEA 2J7KA 3RYTC 4D4LA 5IHPA 3BB1A 4D82A 1XTJA 4CW7A 3G82C 3W6NA 3V00A 3MMPA 1VG9B 3CIOA 4Q9HA 5B57C 2J0UB 1NVVR 1XD2A 2WOJA 3K0FA 3T1QA 2W2VA 821PA 3K0CA 1SQ5A 3CRMA 2RHDA 3FKSA 4NMMA 1FW6A 3GJ4A 1OHHA 4US0R 4Q4LA 2ZAOA 1XFAA 2GEUA 1J90A 2IW3A 2ZJYA 1ESMA 3EPLA 3OEEA 4M9XA 4UQOA 2LWIA 1VYTA 2G6BA 2BM1A 3K0AB 2P6RA 2YKGA 2VHTA 2QGZA 3UMFA 2HF9A 2IBMA 4B3GA 1XZPA 5EZ5A 1ELOA 1XNJA 2ODEA 4FCTA 3HPQA 1E9BA 1P2SA 2IUTA 3A4LA 1XF9A 5GJVC 2Q6TA 2ZRLA 1PLKA 3CLVA 4FMDB 2KE5A 5IRCD 4G5SA 1L8QA 1DVRA 1KDTA 3AF1A 4V0NA 3CNOA 3QG5A 1ANKA 3K8YA 3WYAA 4D6PA 1A5TA 4ESVA 1ZD1A 2AXPA 1GIAA 3GJXC 1P61B 2GZHA 2SHKA 3ZVMA 4DLZA 3DL0A 2G88A 2WBLC 4MRNA 2G83A 2ATXA 5K8LA 2J87A 1S3SA 5DHFA 2Q9CA 5DNYB 1QRAA 2GHIA 2QL6A 3GQBA 1NY5A 4LC1A 4QNMA 3VR3A 3R8FA 3TKLA 2ZVQX 3E2IA 1TQ2A 3EPJA 1HT2E 4JT2A 4CGZA 4G5RA 4L9SA 4B2PA 2WWWA 1OE0A 2X8AA 2OFWA 1E6CA 1QBKC 3L0OA 4XTRA 4TLDA 3Q7PA 3TQCA 2F3TA 4PC6A 4ARZA 4EPXA 1KKLA 1GFIA 1KO7A 1EFRD 4HAWA 4URYR 4BFUA 4D0GA 1IY0A 1ETUA 1GSIA 1OW3B 4EPTA 4A8JB 3CRQA 1CKEA 3DOEA 1OXUA 3HJNA 4B33A 5JWOA 2Q3FA 5CDFE 4TLCA 3U7FB 1AN0A 2XB4A 2B6HA 1JJVA 3H2YA 2WWFA 3T1OA 1ZD8A 3FMIA 3T5DA 4MDEA 4JL8A 1UBGA 2W6JD 2QT1A 5C46F 3BWDD 4P3YA 3PEUA 5SZKB 4M1YA 3RWOA 1E99A 3AEZA 1R0YA 1AKEA 1OKKD 2BV3A 4JBXA 2IHYA 2ZYWX 4PTLA 2PEZA 1NVUQ 3AF0A 3UG7A 5DN6D 4D0LB 2VBCA 3GLIB 3THWB 2W58A 3UIEA 4PC2A 3ZD6A 4XVQA 4V02A 3ZJYA 1T5IA 1UJ2A 3BXZA 2A5JA 5GJWC 4PXAA 1UEJA 3FDIA 3TQFA 1OB2A 4TYYA 2ZRFA 5D3QA 3NBYC 4GL2A 2WSSD 4PPFA 2JLZA 2OAP1 3EZ2A 5KSPA 1OFIA 2PBRA 4LJ4A 4OI0A 3QXHA 2N1BA 1CJUC 4LHWA 1X1SA 2RGBA 2EW1A 1I2DA 1YU9A 2ANBA 1NSFA 2FOLA 5FTLA 2QSYA 3GJ3A 3QI2A 4QBGB 1LFDB 3N2IA 4KAXA 4PANA 4PR0A 4UXJA 4XD7A 1ZU5A 4FINA 3CR8A 1GZSA 3K70B 1E1RA 3D3QA 3H84A 5G41A 4E22A 2QSZA 2ZI6A 1R0XA 3LX8A 3C16C 1Z0JA 3ZDQA 3O8BA 1RRFA 2ZJ5A 5DISB 2GEVA 3IGFA 4Z54A 2BHRA 4V0LA 2HYDA 2R6GA 2PX0A 2YC2C 4DEYA 1DELA 1ZYUA 2BIFA 3FMFA 3THYA 3VU9A 1A7JA 5H68A 1E9EA 1IXRC 3UANA 1T0JB 3H0KA 3L8ZA 3AQ4A 1TEVA 3QJYA 1Z3IX 3U60B 1QHGA 5JWHA 4OYHA 2H7VA 2ZSEA 1IQPA 2IYRA 2W83A 2GCOA 2NO0A 3IDQA 1QF9A 3RWMB 1PJRA 3HU2A 3P26A 3W34A 1W48A 2CXXA 4GRAA 2RKOA 3X1XA 1V43A 4QBHA 1L7VC 2ONJA 4GOXA 4Q4HB 2AXNA 3VKGA 2GJ8A 3SFVA 3THXA 3Q9LA 1Q20A 4NCJA 2FN4A 4F92B 1N6LA 3M1IA 1MT0A 1KK2A 4IW3B 4D0NA 1UKVY 4DSTA 2XB2A 3VTKA 3O47A 3LQQA 3GLGE 2BBSA 2OZEA 6Q21A 5KSYA 2FWRA 3MWYW 1FFHA 1XPRA 1RPZA 5FPHA 2G3YA 1GL6A 2G0NA 2CEAA
chains in the Genus database with same CATH superfamily
1W6RA 5AFSA 5JSFA 3N59A 1U63A 1G19A 1JMYA 2WKPA 2A58A 4TL6A 1IJKA 3H3JA 4BHTA 2O0KA 3R76A 4BNZA 3RS9A 2F8MA 2VHEA 2GN8A 4BNWA 4DCJA 3KSMA 1P72A 3HCOA 3UXYA 3LO8A 2AFIA 4CIWA 4X24A 2Q6LA 1A1SA 4S1OA 2CL0X 4MA0A 5CT8A 3SFZA 1N5OX 3ETGA 1GV0A 3NDPA 1DU4A 2VQ3A 2GBPA 1RCUA 2WMDA 1QZZA 3DOCA 5BY2A 2QG9A 4KQCA 3LWNA 4H3KB 4QUIA 1RTTA 2QLMA 1PO7A 3EC7A 2ZS9A 4Q66C 3GPDG 3P96A 3CE6A 3SKYA 2VYNA 4YYZA 2B4AA 4M9QA 2P9HA 4E07A 3F5QA 3GUYA 2EDCA 3ZNQA 4D46A 5ALVA 1Y7HA 2P41A 1F06A 1Z0SA 4GU5A 4EB6B 1VHLA 4D99A 4LJSA 2IIVA 3UHFA 5B6IA 1HDZA 1R66A 3QELA 1P7WA 1KFBB 2ZUWA 3D6NB 2ZJ4A 4HGOA 3STTA 2O2CA 3HN2A 4XJXA 3MWFA 4FFBA 2GYWA 2O8FA 2CFSA 3R3HA 3OQVA 4QBIA 1KZ9A 1KI6B 2HQBA 1SU8A 2QV0A 4L4UA 1T2CA 3KLOA 3TLXA 4YQFA 5BW4A 1E2NA 3OTOB 4F3NA 1V37A 2RB5A 3V8BA 3RV4A 3OZCA 2BE9A 5AKXA 2NXEA 3FUTA 1F9EA 2AG5A 4EHDA 3Q7EA 3MUFA 1DBSA 2A3RA 3ITDA 1JRLA 3VSCA 2XYRA 1WETA 4Y0AA 1N9ZA 2FH5B 3KAQA 2HI0A 1TYDE 3H7AA 4I9HA 4ENPA 4HZUB 3RC8A 4QQNA 2OO7A 4FFSA 4RF3A 4BLSA 1Q95A 4JL5A 4MVCA 4RLQA 2DX7A 1Z0DA 1NVFA 3FCXA 3Q5DA 4IXTA 5KNBA 1ESNA 3E1KA 3PDUA 3ZZTA 2CK3D 4ED9A 1YS4A 5EKSA 2A9KA 4D3XA 4BNKA 1WPGA 2FX3A 1JI0A 3OP1A 3ZHZA 4DCGA 4HFJA 1KFCB 4WE3A 1XMXA 3OZFA 3A11A 3JWGA 4QQ8A 1KGDA 4IR7A 3VTZA 2JFNA 6LDHA 2LBPA 3L0PA 3HUEA 1CYEA 1CNEA 3ANTA 2H2AA 3I8XA 2X4LA 2I55A 5E9JA 4BNIA 2GZ2A 1KVUA 3D7NA 3EZ7A 4UFOA 1O9HA 2OY0A 3PPWA 5CXUA 2H92A 2QN2A 3WQHA 5GM2A 1G6HA 4M0MA 3ECCA 5CXQA 1RQRA 1VIAA 3WWPA 4HMQA 3K72B 1C3EA 4B8WA 1UBTS 3FCCA 2EJCA 1QIMA 3SX4A 1NYQA 3VAYA 3JYQA 4MW2A 3VZQA 3ZTTA 4DYDA 1RRGA 2DYKA 1XMSA 2IPXA 3CKMA 5CVEA 4EFKA 1RKVA 3CH4B 3MTDA 1PK7A 1DWPA 4WOKA 4ZC8A 4RYLA 3NXSA 3DC7A 4AX4A 4DANA 2OENG 2EIHA 1M34E 1KEPA 4CYMA 1JLLB 4N82A 1PBNA 5EMNA 4I1PA 1H0HA 2I66A 3PP8A 4X6LA 3R1IA 2COEA 3RVPA 1NBMD 1ZVVA 2B34A 1QYXA 5AKKA 5KCZA 3CJTA 3NHMA 3LL4A 4OMFG 1GA1A 4RSHA 3RYHA 4FNMA 1MTOA 5IZCA 1KO4A 4NSNA 2PPLA 3DFUA 3CSDA 5HKKA 1FVOA 1YIAA 4IF6A 3L6CA 4YP6A 2A35A 1JHAA 1HNNA 2EFEB 4HQLA 4P3PA 5A9TA 2BMAA 4RE5A 5TC4A 3WO0A 1J99A 1RWNA 1K3FA 3OZTA 4M99A 4OL9A 5FP0A 2G5PA 2PVSA 4PC1A 2PWAA 3OBBA 3OZXA 1BHO1 1VXRA 1PF7E 3QUTA 5M3BA 2E4ZA 3CZ4A 2H1WA 3HDGA 2X5KO 3ESAA 3HI6A 1WD7A 5IT9A 5F73A 1FMFA 4HZGA 2G5GX 2ZG6A 4Q5IA 2QAGA 1VDMA 3B48A 1E6KA 3OBIA 2ZIFA 1Q1QA 4YMWA 4LNUB 3WJ1A 3G7SA 4POOA 1E89A 1FRZA 2A0XA 4QLBA 5K3BA 1D5WA 1D6NA 1TKBA 2C7OA 2O8CB 2Z9DA 2VSQA 3WB1A 3K0CC 3ZGLA 5KOHB 3G9UA 4FK8A 3AEXA 3KQQA 4M7OA 2IPNA 2NVBA 4XQEA 5D51S 4ZAVA 4ETNA 5A5VA 4YCNA 1PRYA 1WEHA 2QXUA 5TNXA 5LQDA 1M0WA 1T5BA 2PM8A 5CX1A 4IX9A 3JVVA 3TB4A 4BLQA 4W5OA 1QQTA 4C08A 3LUGA 1ZCZA 3COZA 1Y42X 2Z9BA 1L8XA 4GZLA 4LWPA 4JUDX 3V80A 4WFQA 4MUAA 2OV1A 3G2HA 1UT5A 5C5DA 1VTKA 1II0A 2DPMA 2HK9A 3A9SA 1I2CA 3HVIA 4M0FA 5IYZF 1YCFA 3ZWMA 4D3DA 4TZTA 3VOTA 4D80A 2EIXA 2EZ4A 2HTFA 2F17A 3P2OA 5J1TB 5KNDH 5FLXA 1P1CA 3D3NA 1GEEA 1QGUA 3F6CA 4ZANA 4BYMA 1IK6A 4R1MA 1M2WA 4UHJA 1Q7RA 1MRSA 1H4VB 1OSNA 3JQ6A 1LSSA 2P9GA 5H81A 3TK1A 2QP9X 5IYZA 2XWBF 1OXKB 1F48A 3NHUA 3FJ1A 3QYJA 1XGKA 1SIWA 2F43A 2PO7A 2XA2A 3FFXA 1BH2A 3HJAA 3TLBA 4QKQA 2NXNA 2MMGA 1XZAA 2XWSA 5KJ1A 3NHLA 4UM5A 1IZ7A 4GNRA 1DHRA 2C4TA 2OBNA 5EWLA 3DOOA 3GX1A 1VL5A 1Y98A 2Q0QA 3LNCA 3EMKA 2ETVA 1FOEB 3N2LA 2ID7A 3I2JA 4MPPA 5FI5A 5HF9A 4EZEA 4LXHA 1FNMA 2YXDA 2HUNA 1UP6A 3IOCA 1IUNA 3LT2A 4RD2A 1MA0A 3M6AA 2JD2A 1Q0PA 3I2GA 4KRFA 1GG5A 1D6JA 1QIFA 1DMRA 1RWOA 1NZJA 2DGDA 2EL7A 3ONWA 4PNZA 4BQOA 5AK6A 1L5HB 2BI8A 1L8LA 1R0SA 2C31A 2X8BA 2CLEB 2P8SA 4JITA 3AKEA 1PR5A 1M74A 4ZTUB 3KBBA 2DE0X 1I4WA 3VO9A 3NTUA 4Z4IA 4RSMA 2ONZA 2PHZA 4UEKA 2FZKA 1IG3A 1SHZA 2DMRA 4MGYR 3CZAA 4UM9D 4JC0A 1CTQA 4KMOA 2QPAA 5JC8A 5DGXA 2PX5A 4CM7A 3HVRA 1AHHA 2W5UA 1W8IA 3O8LA 4JLJA 3NVDA 4I6JA 5KYWB 2IE8A 2N42A 4L08A 4HUQA 5T8KA 4XYLA 3USZA 1M2NA 1YQWA 4RD3A 3TWOA 3ZYZA 2RI6A 4L6IA 3EDCA 2EG9A 3FNIA 3FSEA 4WV3A 2WIDA 4KI7A 3X1WA 1M5TA 3CZCA 3B9QA 3WGQA 2QM7A 3BIFA 2QMEA 2FMXA 2FN9A 3W5SA 1A71A 2E0IA 2H11A 2XVZA 5DSZA 4NZPA 2I99A 3MGBA 3RYCB 2VEDA 2WKQA 4RUKA 1DADA 1T8WA 3GUCA 1ZK2A 3IJRA 3KV3O 4AKIA 1Z37A 2K7FA 1FS5A 2WU1A 2PX3A 4JIMA 4QGHA 5AKHA 3WHIA 1TAHA 2Q0SA 3IERA 3JVUA 4QU9A 5F9MA 1NBEA 4JLDA 5HILA 2OLKA 4AMVA 1K5DA 1RW4A 2DQKA 1E1NA 1E58A 2HWUA 2QG6A 3FOWA 3T54A 3H0EA 5BV1A 4DJJA 3UAWA 3R9XB 3VSDA 1A8PA 3MT9A 4ZQBA 1UADA 4YDQA 1SVNA 1VG8A 2IEIA 1PBTA 2XGGA 4QA9A 5NLLA 5HRUA 3OWHA 4JZYA 2HY7A 3U6BA 5HGJA 3DQPA 2P2YA 3EFHA 5JDIA 2QR5A 2WZQA 4ZV4A 5LLSA 5TF4A 2IHKA 1GL9B 4H7IA 3I32A 3C3KA 1C9DB 2OHGA 2PVPA 3EW7A 2ZIAA 3ORYA 4GRIA 1US8A 2FP4A 2IFTA 1OLXA 2HIAA 4I19A 4TMXA 5FFNA 5B4TA 3S8MA 2AFHA 1BVYF 7MDHA 5ENVA 3OEED 2W6QA 1PYOA 1SOMA 3MERA 1C7QA 4HAIA 2GDJA 2WDZA 2XTMA 4JXJA 2FFRA 5CNMA 5A0VA 3H2GA 4QYMA 3U13A 2QMHA 5MF6A 4UMFA 1LQ2A 2HA2A 5KWJA 3R9WA 3FZYA 4WZBB 2TMDA 2Y1GA 4G2NA 1YR1A 1UJ4A 3QXXA 4CIDA 3DV0B 4FEYA 2PUFA 2V7WA 1EXVA 1NW8A 4AK9A 2XLBA 2O59A 3ZQJA 1EUQA 2RHGB 2I4RA 4DG8A 2BP7A 1DQYA 5E2IA 3Q1LA 1QFMA 1UBEA 2LV8A 4HNSA 2EWVA 3OD5A 4IQGA 4TQAA 2AHRA 3MD9A 5JANA 1SRQA 5ECDA 4XLLA 1J70A 1U7UA 5IJAA 3M9WA 5C18A 5KPJA 3K0SA 1AHIA 4J0EA 4MPRA 3VBEA 2AFVA 4YRKA 4OQQA 2RGWA 5PNTA 4C30A 1KI9A 1VMDA 5FFFA 3BZWA 3CRVA 4OU4A 3CCFA 1V45E 4HX9A 1ICEA 5B7NA 4PF1A 3FGNA 3WMRA 5IFKA 1U3UA 1HBJA 3ZW7A 2DQ4A 4EHHA 3GG2A 4TYWA 4HWTA 4D3ZA 1A5ZA 1J0DA 1XMJA 1AGNA 2FDRA 1SXJB 2IKQA 3M49A 1VSVA 3R3SA 4L6AA 1XOIA 4UHKA 3QK7A 4FDTA 2V54A 4G9EA 3UJCA 4ENRA 4L57A 1GPKA 3DL7A 5D1NA 4G23A 1T9AA 3HCWA 3SYTA 2G4CA 3DZDA 2UUCB 2Q3JA 4EHAA 2WUEA 3R41A 1LS6A 2DEUA 1NI5A 2VT3A 5F64A 1VJCA 5F4BA 3CNNA 2Z04A 1PJ4A 1ZEMA 2V98A 4MP3A 4Q3EA 2FCAA 4KG7A 1JEOA 1MO5A 2E1PA 3OKFA 3KEMA 3R7AA 5A0TA 4ND1A 4NESA 4OQEA 1JHRA 3ZHXA 1T2DA 2BGNA 5F76A 2FW6A 4JK3A 3OEHA 2HLDD 4JGGA 1W88A 1JEAA 2NP6A 1V9LA 1CZHA 3IQWA 3MIIA 1MRNA 4G0NA 4RPLA 1N4DA 5DSTA 2VXBA 1H6AA 4MYDA 4Z2YA 3QW2A 4E12A 3ZHRA 2I2FA 3F6EX 3PZBA 2GESA 4R0VA 3TFWA 3WWYA 3PSHA 3WMFA 4CKBA 1HLPA 2QI9C 4TXNA 1UBUS 2L18A 3GDWA 3GWZA 4MQEB 4TLBA 1K2VN 1NRWA 4J4BA 4DC0A 5BN3B 2BMEA 2ZE7A 4Y2XA 3RUIA 4PLPA 3H42B 4L7VA 1K27A 3BTSA 3V4PB 4DPKA 2PXXA 4HTAA 3R9KA 1Y48E 4ECAA 3FVTA 2KPOA 4RESA 1FYVA 1Z5WA 1FUYB 3UA4A 2DH6A 4HEA6 2QTAA 1N6OA 3DOFA 3IEXA 3OZGA 2VF7A 4J07A 4OKIA 3G0DA 4QARA 4EF4A 3RJTA 2JFYA 5M34A 4C0KA 3RV3A 4L15A 4KXNA 2EGUA 1GKLA 3OPYI 3S1SA 4JLOA 1SIOA 5B7PA 1LBSA 2JEZA 1YQXA 2IH5A 2C03A 2X0RA 3FW1A 3LNTA 4KNYA 2E48A 2P6NA 2Y3IA 3EZFA 5E4JA 4L22A 1ZD2P 1AF7A 4JJ6A 1D2NA 1OX6A 4P34A 5KAPA 3A9WA 1THZA 2DULA 2GXSA 2H7YA 5TQ2B 4HAUA 5E2AA 1PNQA 3FHTA 2Q45A 1UF9A 4KO4S 4MKHA 2ODNA 3KOOA 3H2IA 2CCGA 3FYHA 3HC7A 2WRZA 1IMJA 1AQ6A 1SCQA 2XF2A 4TUYB 5HE8A 4BX8A 4DDUA 4EYSA 1TJ4A 5FPKA 1EK6A 1L4EA 4MKRA 3RI3A 4JUFA 3T7EA 1BXRA 3JRXA 3HN7A 3O4FA 4YGXB 1JHDA 1NFRA 3UFXB 3FN4A 2GAOA 4TSFA 2QVBA 1M1XB 4GMXA 4CF5A 1EFVA 4DRYA 1E5QA 4X0EA 1T91A 4D4IA 1E1RD 2XNCA 3OX4A 2WPDA 1ONSA 1H65A 2J6IA 4RDCA 5FOWA 4FBGA 1IEXA 2GN4A 5H0IA 3EDQA 3KUXA 4I6GA 4X66B 1EVEA 4II7A 1CU1A 2GAJA 4TS1A 2RAPA 3BHJA 4JXKA 5CPFA 1DL5A 1M6EX 2GBCA 3VO2A 4B3SB 3UW3A 3LC1O 1A1VA 3EDRA 5AK5A 1EGVB 1QRDA 2PQ6A 2ROQA 1P9NA 2GUWA 1Z73A 3PE4A 1GFZA 1Z0KA 4TN1A 3NO4A 5TB5A 3UFBA 2VHVA 1JLSA 5F52A 3ODPA 4C6SA 2BZSA 2PUVA 4RBNA 3QZUA 2JRCA 3DXXA 2A1TR 3EGCA 2I22A 5C80A 3DMHA 4BNTA 3LQFA 2RD2A 3RTBA 2Q5LA 2VQDA 4BO1A 1FDOA 3BERA 4D4HA 2CV0A 2HQSA 4N0MA 3R4VA 1J97A 2A88A 1NGSA 1VJTA 1QORA 4UHHA 1DX9A 4ZIRB 2XQJA 5HP4A 5J63A 4US1R 2F1KA 3SE0A 4Q3OA 1HEYA 3UUWA 3IS3A 3T52A 1FTQA 1X7XB 4B6OA 2BH2A 3UXHA 4MVJI 4MB6A 4NPCA 2QYOA 4GWKA 1DTSA 4XW2A 1GCGA 4F3RA 3HNRA 3AUXA 4L8LA 2ZSIA 3T35A 5B7GA 4PGMA 2QMOA 4PC7A 1ZNXA 5JYBA 4OA8A 3BK1A 3ZGOA 3M4YA 2P8JA 3UC9A 3FZNA 1KR5A 4BO6A 1F2VA 5U4XA 4RLFA 2P2NA 2R5FA 2JLRA 2CBZA 4DARA 13PKA 4H4DA 4ERXA 2GVDC 1UXOA 2H4FA 4OQYA 2UXCB 5JU6A 4Q3KA 3FFAA 4YPFA 5AOAA 3RRYA 5FI1B 4IIDA 1NQXA 3IAEA 1L0BA 4MQ5A 4H7DA 3W6PA 3L7CA 4XA8A 2FMFA 3HMQA 3F47A 1IXYA 1UBJS 4UXHA 2QXTA 1N7IA 1XD2B 2XHZA 3K9BA 4G37A 3K0FB 1JDZA 1JG1A 2J9GA 2I9PA 3PNLA 4GPTA 3FWHA 3AEQB 4NMLA 4E88A 3P9ZA 2OBXA 5CEJA 4IDQA 2RGGA 2BMJA 1KNQA 1JN0A 5C7OO 3I61A 2BBWA 3QYFA 5AW7A 1JR2A 1SQFA 4KXVA 1PR1A 4CG0A 3EXFA 4OHMA 2IHVA 2Y93A 4AKSA 4H35A 1I01A 1UPFA 3BA6A 1P18A 4F4UA 2D1FA 1XXHA 2JFPA 1ZUIA 2Y66A 3NTXA 3TG8A 1B8UA 2I3BA 1IONA 3DZFA 1WMAA 1JILA 2QP4A 4JJEA 2NGRA 2VRCD 4GP9A 4OYYA 1TUGA 2HW8A 3N05A 1TADA 3K9QO 4JUCA 2EKLA 2C61A 3CF4G 4G5XA 2QVLA 1BS2A 2GA8A 2X5XA 5H1YA 2RONA 2QAGC 3WLSA 3WDLA 1DAIA 4CPDA 1TCUA 5FIUA 3GLGB 1DTWA 1PG2A 2EJBA 3KJNA 3FCOA 5F21A 2ZRMA 4UMDA 5JATA 3O90A 4YRJA 2X9LA 3ZVLA 1YXMA 2OAQ1 4AW9A 4WXHA 4JSRA 3S40A 4JYCA 2QJTA 1B74A 2YWBA 3FH0A 4WK0B 2CLHB 2XADA 4PXYA 5K0EA 1FP4A 5AVTA 1VOTA 2ZBFA 4R9SA 3WLPA 1IJEA 1UBRS 4IIHA 4CF4A 1UPCA 1U0BB 1MJGA 1RJFA 1RKUA 1AKMA 1XD8A 4QEZA 4FSXA 1TKCA 3PEFA 3RASA 3L40A 1IM5A 1ESDA 2GHQA 1I30A 2HRCA 2QMZA 3BE4A 3KOUA 4H17A 3RRZA 4BYGA 2Y0PA 4LYFA 5I8ZA 3GH3A 3ZI7A 4ZO8A 4G0YA 3LPLA 5CW1A 4FWTA 2DR2A 2WYHA 1M67A 3EVDA 1Z5PA 4QU5A 2OCKA 3G2OA 1K8XB 1M2VB 3TIGA 2BFFB 3L3BA 2XOXA 4M1ZA 1QE3A 5EMLA 5FUYA 2B2NA 5EJFA 2TMYA 2V3CC 1N2BA 4EHJA 2F9LA 2CV1A 3HFRA 5I7EA 3D4IA 3TOSA 1KJQA 1Y3HA 2UYHA 4FILA 2YWGA 1R6BX 4KR2A 3K6JA 4E4YA 1T9DA 1AZWA 2KYRA 2NV2B 2ZJ7A 3KD3A 1UZAA 2WF5A 4P4NA 4IX1A 1YOVA 4EHNA 3LVQE 4ZC1A 4DCPA 2H59A 3SEAA 4ZQCB 4CETA 5BSHA 2QN3A 4CWAA 5FL3A 3FTQA 2NADA 3I52A 3I76A 2OV3A 4UEJA 3GNSA 3U4CA 4LN1A 1XAGA 5K7SA 4WN9B 2UYYA 4I4LA 4TVOA 1G98A 4BRZA 3JQAD 1K9VF 2H5EA 4F8EA 4JB8A 4TMVA 4ZREA 3LCJA 2CMGA 5EP3A 3VV3A 4ZCLA 2W00A 2XQGA 3QBDA 3K0EA 1OVMA 1VIMA 3WR5A 4HKTA 3SZLA 2WB4A 3GRYA 1HDRA 4RA6A 1S02A 2W4MA 2QL7A 2DU8A 1GPDG 3OURA 4X7BA 2ONYA 4IJVA 4HYEA 3PNSA 5HFJA 4BJ6A 1GPUA 3LBAA 5T8KC 3X2FA 4CMAA 4DCVA 2HR1A 1Y4DE 3FNHA 3GLRA 4CG1A 5BVHA 1D2EA 3UMYA 1YIOA 5M29A 5K8IA 4DR4B 2LUOA 4AY2A 3BILA 3K6RA 4LOJA 2HJ9A 2I1VB 2WVGA 4XGKA 1GZ6A 1PIWA 1VFPA 3A2LA 4WEOA 2DT8A 3LX5A 4YUVA 3VBCA 3C8UA 3ZEAA 1FUEA 1HTBA 1SD1A 3BWXA 4DR7B 1YB1A 2PUEA 1MB3A 1WABA 4QNRA 1NOJA 5LWQA 1HNZB 1FDTA 3P94A 1EX6A 3JALB 4I1RA 5BNFA 2VDUE 1P3Y1 4HBGA 4BX0A 1WCYA 4RL4A 4NX2A 4OHYA 1U0RA 3DTVD 3PE6A 3NS7A 3C5VA 3FSRA 3KB2A 1ODKA 3HI4A 5JG7A 4BUZA 3RUEA 2OM2A 3OJXA 2Y0BA 2B61A 5FA6A 1OUMA 4QXRA 1CQXA 1Z6TA 3PLNA 2LKCA 1T6YA 1IXKA 2XVAA 3KQOA 3MWGA 3OX1A 2QYHA 5PGMA 4X85A 3G7NA 1I36A 3RK0A 6ABPA 1UMCA 4Q3LA 1DQSA 2JGIA 2BEVB 2CVQA 3ZY3A 2CNOA 4EJ0A 2NU6B 3I01M 3WNCA 1F8YA 5CIYA 4W7HA 4R01A 5BR1A 4Q1FA 4TKUB 1QHYA 4LHVA 2JPDA 1MXHA 1PQWA 2C9DA 3IMEA 3GA0A 3VU3A 1XPOA 2AKAB 4KUHA 2JK1A 1HI9A 1Q44A 3EF1A 2C4UA 1WBJB 5CDFA 3G49A 1RWVA 3GNQA 1PEYA 3BL5A 3KOXA 2YH2A 4BU0A 5JS7A 3ENQA 1FPMA 3ZV5A 1DG3A 1ZA2A 2JCYA 4M7RA 1JQDA 3AK4A 4ABTA 2ZZKA 3D8NA 4RVDA 5T4HA 4MP6A 3WB2A 1P4SA 3KQSA 2ID9A 3H5WA 3SXUB 1JEDA 1NTRA 4RIIA 3AOGA 1I1NA 1QNLA 2FF7A 3THXB 4N3AA 1TT5B 3SGLA 5AVVA 3EXEA 5HKOA 4JYBA 4UBMA 1XTVA 2Z4SA 4NYIQ 5IULC 4QPCA 4P54A 1WDTA 1AX9A 2QZPA 4B47A 1Z2NX 2FJ0A 2IHZA 4HEJA 1T1SA 3QVTA 2R6DA 1P0IA 1QQAA 1TMYA 4HMOA 4ZAXA 5J5VA 4P1ZA 2IPAB 3QVJA 3JWJA 2QUZA 2D6FA 4RIFA 1DAPA 1E8NA 2BVNA 3T4XA 3AR3A 3IVAA 3M4ZA 2I76A 4ZGGA 4J9VA 2OBLA 1CUCA 4A4DA 2DHRA 3TAHA 4DMMA 1YJXA 4LEIA 3ZV7A 5DFAA 1T3LA 1XAJA 2BBOA 2UUOA 5F1OA 1RQGA 3K6KA 4MWTA 1EEXB 2GKOA 5HDBB 3RVLA 3U1VA 3G9TA 1FEZA 1QHIA 5AXAA 1WXDA 2OC9A 1AKVA 2V7EA 1I5RA 1K6MA 1R50A 4UHEA 4C7KA 1H6BA 2IYSA 2P9CA 4YLGA 3C6ZA 4Y2SA 3UJNA 2QORA 4B17A 3OIWA 4HN4B 4PVCA 4QOIA 5JFOA 2YYAA 2TRSB 3NKFA 3CO0S 4A6EA 2AJLI 1F5NA 4J8PA 5FHRA 4BO4A 2OHFA 4ENTA 1L4MA 4W4TA 3U3JA 3FJYA 1CRZA 1XTUA 3D0OA 4RETA 1CUWA 1JEYB 2AJDA 5IDWA 1F51E 4W5NA 3EN0A 4UVIA 3U4AA 2IP1A 5DGHA 2C5HA 1MPTA 1VI6A 5ALMA 2YQ5A 4UCQA 4S24A 1U31A 4D8VA 4CKWA 1VBKA 4K6OA 5BQXA 1VJDA 2DQYA 2G1UA 4KR0A 2H7XA 3E8SA 4DLBA 3BF8A 3EVEA 3GJ5A 1U28C 4LXQA 4RXUA 3EG9A 3BXHA 1ORRA 3K2EA 4K1LA 2C77A 1E6MA 3RBVA 3CR7A 5HQTA 3C43A 3TIVA 5ICCA 1II8A 4ZVRA 1WLYA 4XWTA 3O75A 1FW8A 1H3NA 4B3CA 2QTFA 1RT9A 4GGMX 1T6ZA 3S68A 5DP2A 4CMIB 4JR1A 4OHWA 2AMVA 1BN6A 1RFLA 5KYXB 3ROMA 2QLJA 1RHUA 3OTGA 4WVLA 4COKA 4AXXA 2RHWA 3ZEIA 1HZZA 3F7OA 4FGZA 3ZV6A 4P3KA 3ESYA 4UCXA 5IN5A 3AIOA 1P0CA 5B64A 4XWYA 2JAWA 3AVPA 5IC4A 4ARIA 2UAGA 2KJQA 4FYVA 5DGTA 1XRSB 3C14C 3HR8A 4CCYA 3F8WA 3NBAA 2Q5IA 1GRVA 3WGJA 5LWHA 1YK0A 4GLLA 5HMLA 4IMJB 4WKNA 3U3DA 5L51A 3BGIA 5EY5B 2GEKA 1D4FA 2P9BA 1UDCA 4BJ3A 5K6AA 1KFKB 3I1IA 4MUIA 5I51A 1Z5OA 3D4BA 1T4CA 1CEXA 2V8BA 4EG7A 2DXIA 2X86A 4U5XA 2B21A 4R5HA 5KIAA 1RIIA 1LNQA 1ZM4A 4YRCA 1TJNA 2V03A 1T9GS 1WU8A 3GHYA 4ILKA 5AKEA 4C2AA 4YCBA 4KV9A 5EKDA 5EZQA 2ODPA 2Q5QA 5FOTA 4OK6A 3BUSA 1GY8A 1XRPA 4FN5A 1OBHA 4ZOBA 1I24A 4KQMA 2C9OA 2FU5C 1NBME 5KVQA 5IT4A 4PBTA 3F74A 1KHHA 2ZOSA 3X3HA 3VX4A 3OJFA 1H05A 4KAJA 3W8NA 4B7CA 2AWOA 5A0FA 4YCSA 1FYEA 4ZT4A 1OXMA 1SO8A 1FNNA 3MFYA 5EMJA 3IP3A 5JHHB 3G68A 3P0HA 1WHSB 3UMCA 3WXBA 1W0KD 4KRYA 2W2XA 2GRJA 2D74A 4RFLA 2R8RA 2H5LA 1QZ3A 4P4TA 2AN9A 3DDSA 1OX4A 2YOFA 2V7GA 1QF6A 3AVXA 2YMPA 2PMDA 4Q9JA 5EHXA 1MA3A 1VSTA 1UM9A 3DMRA 3QEMB 1U2DA 3KR9A 5E2BA 3IAXA 4G24A 5IC6A 4E2FA 1EFAA 4OI4A 3SICE 3SOZA 3CPEA 5B53A 1UT6A 5AHKA 1UPBA 1E4YA 3QW4B 3RJZA 1YR3A 4UEWA 2BH9A 5KKAA 1IATA 4C4ZA 3MGAA 4DYHA 5HKAA 4CQMB 1VHJA 4S0ZA 4C05A 4JJ4A 4JELA 1UKBA 2CXPA 1N8SA 3NV7A 4CDNA 5CXSA 2PJRA 2WJIA 4IH4A 4LYHA 4ZOQI 2IRWA 4IWNA 4L27A 1D2GA 3F3MA 4DA0A 4RD6A 1YDFA 2F9FA 4RPGA 1UC5B 1ZL2A 1YQQA 4C87A 5ALQA 2EZ9A 2J0SA 3AXTA 4IS2A 3JQGB 4KR3A 1JPUA 3CISA 4INJA 1UAGA 4BMZA 4WCFB 1HTTA 1SZCA 3A27A 1P9OA 1U3CA 3F5DA 5DTQA 3IVCA 1OMOA 1ST2A 2OMEA 2WAXA 3OAAD 3W8FA 3LUJA 4IGKA 3PL1A 4AX8A 1SCUB 5F3WB 1CJVC 3SHQA 1QTQA 1DBPA 1OC2A 3I6IA 3H1BA 4MA4A 4A2WA 4G67A 5JXJA 1PR4A 2JJYA 1N4AA 3Q7SA 4BFVA 2PRYA 1I1OA 3IAS6 3IJEB 4CLDA 3DOJA 4HFNA 1KIAA 4HF7A 1Y4SA 4NENB 4IQ4A 5HCUA 3NETA 1JIJA 3FY4A 3QJGA 1AA9A 1E3TA 1SVIA 3H9CA 1MJGM 2WHEA 2V1UA 1XMPA 2OD2A 3OPYA 3R3VA 4ETMA 1BE0A 3M6IA 3PR1A 3GY0A 3DDNA 1J23A 1H8ED 2FR8A 2AI3A 5LCXA 3MTQA 4K40A 1TUBB 1RWBA 2WMNB 2XZPA 4OI2A 3IEMA 4JI5B 4LMAA 4GE0A 3SR0A 4FMCB 1QM5A 3LL7A 2J7PA 1H42A 3ELYA 5BN5B 2H7CA 3ZJVA 1XZGA 3L8HA 3AFOA 2CYAA 3KVYA 4Z4GA 3C7CB 3SBEA 3WNBA 3S8YA 2GEBA 3BHIA 2P68A 5ETJA 2O2YA 4GZMA 1TLLA 2GD1O 2ZE6A 4PYRA 2XTAA 2MTBA 2FPOA 4DA4A 2Q28A 4JKOA 2W6CX 1TQ4A 5DCUA 3VHXA 2VUSA 1NNUA 3AUYA 4IDDA 5JXWA 4GKVA 3GC6A 4LHEA 2C7VA 4FOTA 4BVEA 2F9MA 3K71B 4F8JA 2F3RA 3KZXA 4KE8A 1O5IA 2PCLA 2XYQA 4MUYA 2C96A 3KB8A 4CZ2A 1V8ZA 1KPGA 3A3KA 4UZFA 3WLTA 2OVFA 1NXVA 2PT5A 4R1SA 5CT6A 4DSZA 3VR6A 1R4NA 2BISA 5L3ZA 3T5AA 4C4RA 4HNAB 4XVHA 2WM9B 4EQ6A 4DZZA 5TS3A 5B1DA 2DVMA 4EW1A 3FOCA 1XF1A 3Q87B 4JOQA 4RKQA 1XQWA 1EUDA 4IUCS 3SE7A 3P19A 2ODBA 3TRJA 4FLFA 4JQYA 2B4QA 5GGYA 1IHYA 3BMNA 2AMJA 4G4IA 1N8KA 3M1LA 4HWKA 2GRUA 2PT6A 1HYQA 4LYYA 2JHPA 4MVJF 4L0CA 4NATA 4D8UA 5IBCA 4JC4A 5K8VA 4EHKA 3AIMA 4AS3A 4G89A 1O96B 1QH1B 4NZZA 4B80A 3W04A 4OHCA 1E96A 2JA1A 3MTIA 1EUYA 1JUDA 1C3XA 1KK1A 1KO1A 2XDQA 2LP4Y 1KZ7B 3NNSA 3WJ7A 3TB6A 4BFSA 2O14A 1QOZA 1C0IA 2ECOA 3U4IA 1DARA 5ILQA 4MVJA 3MYRA 4TV9B 3S2SA 3TJMA 1UM8A 3SS7X 1MOZA 5JVDB 3JYPA 3CGWA 1G59A 3DH0A 4WY8A 2ERCA 2L2QA 3NOVA 3B5EA 2DKOA 3L5OA 5B1YA 3L7NA 3DEFA 4TVSA 1VLJA 1DEOA 3HL0A 4J7XA 1UBOS 3OOWA 1B8VA 2JD1A 4J2TA 1JU4A 4FX5A 3WXMA 1UPTA 1KQ3A 1L7NA 3DLIA 4R40A 1HE2A 2VOEA 3NB0A 3TO5A 4N5MA 3M1YA 3VA7A 4C7OB 3NRJA 5KX5F 4DVJA 3M70A 1RJGA 1Q3KA 1R9GA 5IF9A 3E3MA 3BWBA 3EH2A 5KDOA 3BTOA 1SBNE 1T0UA 5JZVA 4MR7B 5AW3A 2HA6A 3T7DA 1H5UA 3GBSA 4WNCA 3R7DA 1T8PA 1SJ9A 3GLHA 2DY0A 5HRCA 4JCOA 4S1NA 3Q2OA 5K0BA 5KX5A 2I7CA 4C29A 2REXB 3H9JA 5LL6P 5HQ3B 5KOJB 1FL9A 1A2OA 4PNHA 4K0RA 1SKUA 3AZPA 4JLAA 3IAUA 4AJHA 3TPZA 2I80A 1DKUA 3LKVA 1XJ5A 2M98A 4DMGA 3MS2A 4MRSA 3RR2A 2FA9A 4G41A 1O0BA 1IFXA 2A9RA 2OHIA 2CHQA 2QN1A 1NJ2A 1VGRA 3DMTC 1Z47A 3FPHA 3TDKA 1ECFA 3CX3A 4TKZA 4AQ7A 3VO8A 3AX6A 4ARSA 2WT9A 2W6NA 3GUUA 2ZITA 2XUZA 4X64B 4DRXB 4TT3D 3REGA 4UQLA 4B43A 3IMKA 3VKVA 1H2YA 2D0DA 4B82A 4B73A 5C4MA 2OCGA 4DAEA 1CVLA 3FWKA 3ORSA 1V47A 5AKJA 4Q7JB 4EYEA 1Z17A 2F1IA 1P6UA 4WOJA 5B30A 1E94E 4TROA 4URZR 3TTVA 4RHYA 3INYA 3OCYA 2J0UA 5CURA 3OM8A 2GAFA 5G3ZA 4JDUA 3ZY2A 4MWSA 5AM3A 1VECA 4B85A 3V4SA 4DILA 4CNQA 3GR6A 4YXWD 3HEAA 3T4EA 3H04A 3OICA 4C6TA 4HSEA 1TMGE 4Y0VA 5F78A 1BX0A 4QLAA 1BGWA 1AO3A 2IKSA 3HGTA 3E4CA 1ZUNB 1KTIA 1PYGA 3IHWA 1ENOA 2FX2A 2PMFA 3KLBA 2FUG6 1NI3A 4F4IA 5HW0A 3LHIA 3JZAA 3I6MA 1ZMTA 2PSJA 4O4JB 1OZGA 3WK4A 3CKYA 1UWVA 3ZIAA 1LF0A 5HIKA 3W5HA 3UENA 4D25A 2R6AA 4ZQFA 3GJTA 5B2EA 5ENZA 1A8UA 2J09A 1CQIB 3H1AA 2AJCA 1BU8A 3RAEC 1BW9A 3Q98A 3V1TC 1PZEA 1JWBB 4PAGA 4BLPA 4WASA 2XTZA 2QRZA 4MZXA 4F9EA 5SYMA 2AE1A 1OH6A 4HJRA 4OB8A 4RVGA 4X8LA 1T0BA 4NYMR 2ZJAA 4HP8A 1Z5ZA 5EXPA 3WFJA 1EWKA 3ROEA 5HZMA 2H1OA 4ZJYA 3TEJA 4ODIA 1B2RA 4LF4B 2NSHA 1NE2A 1LWNA 2A86A 2HRRA 3EF3A 4YH1A 5IBQA 3ZHSA 2FVYA 3DTYA 3WADA 3HJFA 4FJ2A 3E8XA 1BMQA 1V11B 3QLUA 1L7BA 2VKTA 3TG2A 1WPXA 3ADKA 3R5JA 4RGQA 5BRNA 4J2OA 4BATA 3M82A 1X9GA 4UVEA 2YZ7A 5BT8A 3FBGA 3R3JA 4QU8A 4RPJA 5LXTF 3HY6A 3AB8A 2O1WA 2HGSA 1KEEA 1ZVMA 1MJ5A 2XNDA 3RROA 4V3BA 3W5DA 3CLKA 1G66A 5G2OA 2DCUA 2NU7B 2OLEA 3KHTA 4GOOD 1FK8A 4LHYA 3GRPA 4NE9A 1IHUA 3FTNA 4RYDA 4QYIA 3D4OA 4WBXC 3YASA 1XZIA 5DM1A 4BZZA 2C7RA 4GX2A 3PU6A 4JR2A 1A82A 3G79A 3G9QA 4M6WB 4PQRA 3RIEA 4CCSA 1Q92A 1KI4A 1SC9A 1VPLA 2X4DA 3DYIA 5LXTA 2QE7A 3CLRD 4L85A 2ZYUX 2TECE 5EJAA 3EBLA 1VKZA 1YNSA 4QOGA 4AO7A 5IVKA 3WKEA 5K3EA 1LV7A 2BTQB 4MWDA 5F51A 2JAHA 2PSHA 2QUKA 4M9ZA 1HZZC 2YN0A 1K7SN 2QJFA 2YXEA 5AKLA 3E6AA 4K9MA 4DLRA 4CFYA 4JUIA 3ICOA 3NQ41 2QR2A 1CULC 1HLGA 4Y6RA 1UAYA 1ML4A 3H5AA 1UBSB 4HH3C 2A84A 4U39A 1KJ9A 2HA4A 4CL8A 4MUNA 1UC8A 1YJQA 1CY6A 1AE1A 2ODQA 4QSHA 2DOKA 4JGIA 2H4HA 2LRHA 3RS2A 4DMHA 3H5OA 3OU7A 1AXRA 4WECA 5BYAA 5I48A<