1E4VA

Mutant g10v of adenylate kinase from e. coli, modified in the gly-loop
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two mutants of adenylate kinase from Escherichia coli that modify the Gly-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(phosphotransferase)
molecule keywords Adenylate kinase
total genus 74
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e4vA00
4HAZA 4HI0E 4V0OA 2FSHA 4V03A 3A8TA 3R7WA 1NVVQ 3EWSA 1PV4A 1IN8A 4B3FX 2RGAA 1KSHA 3KQLA 1N2CE 1G6OA 2VLIA 4LHYA 5B57C 1Q1QA 2OUKA 3AKYA 3A4LA 2J7KA 2W0SA 5DI9A 3SFVA 2OAQ1 2FSIA 2MMGA 4L15A 2FG5A 5B2ZA 2G1JA 2IL1A 2KWIA 4B3DA 1CU1A 5AUPB 1P72A 4TL8A 5DIFA 3NEYA 3U4QA 5EE0A 1QHYA 4GMXA 4CYMA 3THYB 4XJXA 1DG1G 2XITA 2FX3A 1IN6A 2FSGA 3EA0A 1EFRD 3RS0A 1G9XA 4CEIB 3BH6A 4D26A 3A6PC 2HXSA 3HPRA 3QI2A 2OBNA 2QAJA 3A1SA 5E95A 3THYA 5BYJA 5KU1A 4PHTA 1MRNA 1ZVQA 1ZC3A 4X8HA 5D3QA 2WJGA 2IWHA 1N6PA 2CNWA 2CLDX 5DLQC 4DLWA 3WBJA 4KFUA 4WW0A 2BVNA 2A7QA 3ZD6A 3AVTA 4MKGA 3Q5EA 4QHTA 2G0TA 1GL7A 4NTZA 3CRQA 3H0KA 3LAWA 4MRPA 3DEFA 3W8RA 4GP7A 4CVNA 2VRWA 2NPFA 1R5NA 2GJSA 2D06A 1K6MA 1G3UA 2GF0A 3CX6A 3N2EA 2F1HA 2QE7D 1L8QA 1O87A 1YZNA 2WIBA 3CNLA 4JVLA 5EP1A 4MDEA 4EJSA 2QAGA 3FTQA 3U3RA 2FZ4A 3I92A 3PENA 1GL6A 1IN5A 3CM0A 4BECA 2KJQA 4LRWA 4KSCA 2BCJQ 3AUYA 3SFZA 3CRVA 2VA8A 4TMTA 1NN3A 3I32A 2GXAA 4ESVA 1ELOA 3VU9A 2I3BA 5J40A 3P1JA 4QHSA 1JALA 1OIXA 2CL6X 4M53A 4LHXA 2OSBA 2J0VA 4NZYA 1GILA 5FPYA 1IOZA 2F1IA 1KI6A 4LV5B 4EAQA 3PEVA 3T1TA 4TLBA 4B2PA 1NKTA 1E1QA 1E2HA 2HUPA 1U81A 3PUYA 4N0EA 5K8LA 3BS4A 3HPQA 3ZD7A 1NVVR 4CEHB 5IK2A 1RC8A 1Z28A 5AUNB 2ZS9A 2X1VA 4QJ4A 1EFUA 3K70B 1T3SA 2UZ3A 4TTRA 2CEAA 2NOAA 3AP2A 4C0QC 1NN0A 4MRNA 4O0MA 5EE1A 2AWNA 3B85A 4JL6A 4B35A 4DC9A 2RGNA 3AVUA 4W7SA 3TE6A 4WZ6A 2CVFA 2NGRA 5FR2A 1AKEA 2QAGC 2HT1A 4ACBA 1EG7A 2A30A 1YKSA 4MYTA 3SE0A 3LVQE 4C0BA 5IHPA 1KI2A 4F91B 2R6AA 3E70C 4JJZA 1D5CA 3A1TA 3K70D 3MUFA 2LKCA 1LFDB 1U90A 1VKJA 1QRAA 1US8A 3O47A 4XTRA 2C95A 3ZH9B 1EFCA 2XGJA 4ZDKA 2DFKB 3K09A 3RRMA 5KYKA 5L3SA 2LKDA 1N0UA 1SVIA 3RRYA 3NDPA 5HR5A 2EFCB 4TMXA 4C9BA 4EPTA 2J7PD 5EP2A 3BE4A 1G5RA 4FXPA 1OPXA 3ICEA 2ZYWX 3KQNA 3W9YA 1HQCA 2BKEA 3DOFA 2J0SA 1T0HB 1Z5ZA 5CK5A 1P62B 4DLTA 1M7GA 4P32A 1W5TA 1TAGA 1JAIA 4BUJA 4BZPA 3C15C 4GDFA 3KQHA 4FD2A 1Q20A 4ZI3A 1KI4A 2F9MA 2WWWA 2CK3D 3BC1A 4UNPA 2R6CA 2FV8A 2FSFA 1CR0A 2RGNC 3I1FA 4I1UA 1AJEA 4NE2A 1P5ZB 2OO7A 2BM0A 3FMFA 4OHWA 1KO4A 1VCMA 2PZFA 4GPTA 4LY6A 1JEEA 3IGFA 2KI5A 4FMCB 2QRNA 1CKEA 1KI8A 3MFYA 1E2KA 4QGFA 3RDPA 4RD4A 2PT7A 1DVRA 1E2GA 2D7CA 3B9QA 3M1IA 4C2UA 4OQFA 1RIFA 1W36C 1G8FA 5F2EA 2FFQA 1E9BA 2ODWA 4QNRA 1DAIA 1Z0KA 4P4UA 1VG9B 4TL7A 3QNUA 4B74A 3IPYA 4PR0A 1KI6B 1XF9A 3BB4A 1E9FA 1GTVA 4XWOA 1KHTA 1WA5A 2FZLA 1G8HA 2QROA 3CF6R 2Z5FA 3CWQA 3NVAA 3VR3A 3T12A 1GNPA 2P5SA 5DO9A 1JQLB 1COWA 4KFTA 4IJMA 3NEJA 1XEXA 1D9ZA 5HE9A 2GCOA 4ZDWA 4QG7A 4ZCMA 4GOJA 1NVXQ 4HEJA 5LPNA 1Z63A 4TYNA 4OJKA 1T5IA 2Z83A 4WIAA 2KBFA 1UM8A 2NG1A 2XZLA 4QFMA 3CO5A 3H84A 3MRSA 3JZAA 2C77A 1E4VA 3CWZA 1FTSA 1OE0A 2CK3A 2FGKA 4MUBA 3RS7A 1S4QA 1W4CA 1Q21A 1SVLA 2V9PA 2XAUA 4Q1BA 2WIAA 4U02A 4I99A 5JWHA 3QKSB 1F2UB 3A1WA 4IDQA 1U0HC 4TN1A 4A92A 3KB2A 1CR2A 3NBYC 2B8TA 1ONBA 2JCSA 2OAP1 1IQPA 5SZJA 1E79A 1EFRA 1Y63A 4P4SB 5JMTA 2FMXA 4G1UC 5AUOB 1PVOA 3FKQA 3FPAA 4C0KA 4TMVA 4YMTA 1E69A 4HLCA 5CDFE 3F3YA 4Z8XA 2W58A 2VTKA 4NKRA 2NIPA 4RZXA 1D2NA 3VNUA 4IFEA 3K0SA 1OW3B 4KV9A 2QAGB 4DLZA 5K8UA 2A5JA 2ZRMA 5FL7A 2O8EB 2ANBA 5FBLB 4A0FA 3FFAA 4LJ4A 2RGCA 2ZXUA 3GP8A 2QP3A 1RYFA 3KJEA 2IYQA 2OEPA 4O2LA 1KGDA 4QRHA 3OFND 4CDGA 4L8GA 1UBCA 4DLVA 5TMPA 1II9A 3TKLA 1XTIA 2HDNB 3C41J 1UDXA 4Q4AB 1NKSA 1COWD 4D80A 4GT1A 4FMBB 1D2MA 3BGWA 4M0LA 1OYYA 2G1KA 4LUCA 3NC1C 1DAFA 3VHXA 4BASA 1ESNA 1Z8FA 3CH5A 4Q4AA 1LNZA 2PEZA 5CIQA 3SHWA 3T5DA 4IVPA 1SQ5A 4IHQA 3WNDA 2XZOA 4WBSA 1NG9A 3SYNA 5KDOA 1XZPA 2GEUA 1G291 2QBYB 5E7MA 1TNDA 2ATXA 4NYJQ 4BE7B 4CEIA 2IC5A 4HAVA 1S8FA 1G19A 3CONA 3QE0A 4JLKA 3W34A 3RLFA 4DKXA 3TGPA 1TF5A 2IXEA 5C4MA 2FA9A 3OZXA 1J8YF 5FOVA 4M9SA 1NN5A 3BWDD 2WWYA 4EPXA 3GFOA 4RCYA 2XJ4A 1D8TA 5F98A 5B30A 5FFMA 3LV8A 2Q0HA 1XDBA 4TT3D 3WY9A 3L0IB 2ZJZA 3HWSA 4AD8A 1HT1E 4FW9A 3GQBA 1TEXA 3D31A 2QA5A 2ODNA 4GNKA 4NHOA 2VHCA 3GJ4A 3TUZC 1J70A 2QI9C 4C30A 4E22A 3R9WA 4Q9IA 4LGMA 1P7CA 3UMRA 1PZNA 4A9AA 3LBNA 3O8DA 5DGXA 5LB4A 5CITA 2WJVA 4HLUC 1AK2A 1L2TA 2D2FA 3T1VA 4TWZA 1E2QA 5FOWA 1PJRA 4EPWA 1KZ7B 4C4PA 1OJLA 5F9HA 4PAMA 5DHAA 1TPZA 5L3RA 5DSZA 1YHNA 1T9HA 2JJ2A 5SZHB 2D3WA 4LI0A 4A4DA 3OEHD 3S1AA 3GJXC 4MUAA 2BKUA 4QGHA 3GLFA 4Q1CA 1TQDA 4W9MC 1C1YA 1DADA 3X1ZA 3H2YA 3P27A 1XP8A 2XJ9A 2BOVA 1L4YA 4MQBA 3AP1A 3SU8A 3REGA 3IHLA 3CIOA 3T15A 2AHOA 2AXNA 2C2HA 3TQFA 2YYZA 1MRSA 2QT0A 3LXRA 4O25A 3TVTA 4Q18A 1KMHA 3N70A 2NO7A 4JLMA 5HPYB 4QNMA 3IO3A 1XEWY 4A1FA 1SKYB 1KK3A 3TMKA 2QMHA 1G3MA 4JBYA 4V0MA 3C5CA 1IY2A 4H1UA 1P9WA 1RRGA 4IDOA 2ZRPA 4JLBA 1VMAA 3CNNA 1LW7A 2HJGA 1KO7A 1Q3HA 2JLRA 4JL8A 4Q66C 5G41A 2RGXA 1Q0UA 1S2MA 1VECA 4M1KA 4OQXA 1FMJA 4JYCA 3VKGA 2QBYA 1H65A 2RCNA 2EFHB 3W90A 3QEJA 5HCIA 1KIMA 3U6KA 2J45A 1UAAA 1CJMA 1JR3E 3GLGB 2HEIA 4G3XA 4PANA 1YZTA 2GTPA 2DY1A 4KHZA 2FFHA 2OE2A 4AC9A 5DH9A 4FIDA 1AQYA 1W0KA 2PL3A 1SVMA 2IT1A 4Y0AA 4OQLA 3CPHA 3HDTA 3WMEA 4GFDA 1MKYA 2VF8A 1UPTA 3LQQA 2BC9A 4TLCA 4IRUB 1F2UA 3QIAA 3LXXA 2YWHA 3OEHA 4JLDA 2C04A 4PO8A 4Q21A 1ZD1A 1ZM4A 5FPTA 4MYCA 5BW8A 1GIAA 3WRYC 3TAUA 4A6PA 3L8ZA 1NBMA 4IKEA 4Q5IA 1P3JA 1WE2A 1O3YA 5JJLA 3ZS8A 2QTHA 3FMPB 1GRQA 5J4YA 2ZQ5A 3EZ7A 4DDVA 1CJKC 3QF4B 4LWZA 3C4JA 4BFSA 4B44A 4H1VA 4ILEA 5C2JB 5GVRA 3B1ZA 5A0FA 1OXUA 3EW9A 4NCIA 2DFTA 2VHUA 4D4LA 1GRRA 4D82A 2CNWD 3TAHA 1OIWA 2P6RA 1ZNWA 4C7OA 1E0JA 4RD3A 2NZJA 2ZI7A 1W4RA 3CB4A 2W0MA 1FUKA 1WCV1 1M6NA 1HE1C 1F60A 1Z6GA 4MKFA 2JLQA 4EFLA 3K0AA 2GWHA 1W0JD 1E32A 1OT3A 5A4JA 2ZJBA 1GL9B 1GUAA 3CR7A 4W5WA 1G5PA 4LJ8A 1W7AA 2HXYA 4FCVA 1P2TA 1YR8A 4CT5A 3X1XA 4EPYA 4WZAE 4A82A 2DB3A 5EE5B 5ANRB 2J0UB 3UWOA 5JRZA 1N6RA 2QU8A 4LV8B 1P9RA 3CUEF 5AJZA 3W6PA 4A8JA 3JVVA 2VHJA 2NO0A 3AVXA 4RD0A 1HH4A 2IHBA 3QVVA 1Z22A 3SBDA 4FCTA 3GLIB 2V7QA 3IUYA 4IEEA 1FX0A 3TK1A 3I5XA 2QUZA 2XNDA 3BFKA 2GK6A 5HCNA 3CLVA 4D0GA 2BBWA 2KE5A 3HJNA 2ODEA 1Z6AA 2OFWA 1II0A 1TADA 2ZTSA 4URXR 1ZM7A 3RVBA 4YONB 4FI3C 2PJZA 1ZC4A 1QHSA 2KSQA 4DCUA 4BLRA 2ORVA 3ADCA 2GBLA 4M1TA 1VCNA 3SQWA 2ORWA 4B3GA 2QP9X 4PPNA 1E2DA 2J7PA 3SS8A 3SQXA 5DHFA 4Q1DA 1RVDA 1NL3A 1XTSA 4V0LA 3VR6A 5JSZB 1RYHA 3U7GA 3HU2A 3U2QA 3AVPA 2ZRGA 5EP4A 4UNNA 5AJVB 1R5BA 4RY2A 3T34A 2OESA 3FVQA 4LBZA 1KSGA 3UG6A 3TR0A 1LY1A 3QENA 2LCFA 5TXGA 1RJ9B 2FEOA 2F55A 3EAQA 4LJ9A 3RS5A 1Z6YA 2GNOA 3TVDA 1H8ED 3BOSA 4BLSA 2RGDA 1OFHA 1U9IA 2VL7A 3N5CA 2O8CA 1KJZA 2P5TB 1IONA 4IOLA 2JLVA 3CR8A 4KFRA 4DSOA 1GNQA 4RVCA 4QGGA 3T1QA 3W5IA 3GPLA 3AGQA 4MH0R 3GJ5A 1W47A 3GFTA 2XNDD 2FE4A 2ZSEA 4ABYA 3TSZA 1A5TA 1U8YA 2ANCA 4MRVA 3THOA 3LH5A 4G5OA 4M1YA 2FFAA 4PO1A 2JJ2D 2E9SA 1G7TA 1E2FA 1VDZA 2ZRDA 4OK3A 3BAFA 1IXRC 2P3SA 1RE0A 3A36A 2HF9A 3I62A 2VBCA 3B2EA 3ZS9A 3ZZUA 4HSEA 2AFHE 3PIRA 5CM8B 2SHKA 3LLMA 1DTSA 4PC3A 4MGIR 1GWNA 1T8TA 1E0AA 1KAGA 2ZITA 4JJKA 2QTFA 4I4LA 1V5WA 2WKRA 3OESA 5C4GB 3BJIC 3W8NA 1TL7C 4PO9A 1Z47A 5ELXA 2QM7A 2ZJOA 1LTQA 3W3AA 4XWAA 2JDIA 3W3ZB 3ZZ0A 2ERYA 1Z0IA 3IIJA 1Z0FA 3NH9A 4LPKA 1OB5A 2PJRA 3K9GA 3R8CA 1E2PA 5CYPA 2GKSA 5B58C 2WPDA 2XNSA 2ZI6A 4AKEA 4TLEA 4M1MA 2O0JA 4P33A 4OK5A 4HB3A 1R8SA 1AIPA 4HZIA 5EJEA 2GJKA 2P6NA 4Q1AA 1QHIA 3F0TA 5CJPA 4BZXA 2DBYA 1JECA 3R8FA 3K8YA 4JKIA 3OIYA 1XPOA 3WYAA 4LCBA 3FDIA 5DYGA 2VP2A 1L7VC 1E9CA 4RD2A 1DELA 5H1YA 2V55B 3EZ9A 3KJIA 3EARA 4LPSA 2EW1A 2Q9CA 2WAYA 3Q7PA 2PCLA 3U3MA 2QMOA 1WQ1R 4TLDA 1CIPA 2RGBA 3HU3A 1GRNA 4NCNA 3FHTA 2IF0A 721PA 4TSFD 3U6BA 3KXIA 1MABA 2WICA 4A0HA 1OYWA 1E9DA 4WXPA 1BS1A 4Q01A 3ZVMA 2IS1A 3JZMA 4AURA 2ZUCA 2ZRHA 2OZEA 1CF4A 1W5SA 3EZFA 4OL0A 5GJWC 4AKGA 2QMEA 3OAAA 5FR1A 4Z1MA 2MSDB 3KUCA 5AJWA 3NHAA 1BH2A 3L43A 5E3HA 4Q4HB 2OBMA 2H7VA 3IEVA 4R98A 1OH7A 2JLYA 4AYXA 4C0SA 1J8MF 3EASA 3L82B 2HT6A 2NTYC 4YLGA 2GVDC 3RNLA 4F4IA 4CRWB 4J0QA 1HYQA 1SVOA 4IVRA 1FQJA 2GESA 3ECCA 4A8JB 1RKBA 2Z43A 3EPKA 2V6JA 3GLGA 1RFLA 2WMOB 1A82A 1JQJC 4S35A 2V1XA 4JLPA 2DWPA 2ZJ5A 3GLIA 2WWFA 1TQ2A 2XOKD 3MGCA 4IDHA 1LV7A 5J4KA 3EIEA 4IXNA 1E0KA 5HZKA 2FFBA 4GI7A 2GZHA 2WM9B 1BKDR 3FHOA 1R7RA 1W4AA 4OI1A 5E7IA 4Q7KA 2VP4A 3SDZA 2VP9A 5G3YA 3WYFA 1XCGB 2CVHA 1G64A 1YZKA 3P4YA 5TV2A 3K0CC 1E1RA 4WVFA 1U8ZA 3DKVA 1N6KA 4CIDA 4LYHA 4BFUA 4NL4H 2GAAA 1DO2A 2IYWA 3B1WA 3PJRA 4HYYA 1PUIA 2P67A 5JEDA 1P61B 4CF7A 1OH8A 1DBSA 1KI9A 4KU4A 1E96A 5G40A 2D2EA 221PA 4JVNA 1CXZA 2IYSA 3PEUA 4OHZA 2IF2A 4R71A 1NJFA 2JGNA 1Y3AA 2UVQA 2AKYA 1ZIOA 3RYTC 1YZQA 3LBIA 4M8NE 2DCUA 3U44B 4JBWA 1G16A 3HYRA 1FP6A 1T8UA 4UJ3A 4DCVA 2PMDA 2Z6VA 4KCGA 1Z0AA 5DI3A 3GLIE 4NYIR 2JLWA 3FGNA 2B7CA 3Q8XB 2GZAA 2G77B 3ONWA 3TQCA 2O8CB 2XZPA 1JEDA 2C78A 4M9XA 3DMNA 3QXCA 5JJIA 1VHTA 1BOFA 1XD8A 1ZMXA 1XTQA 2GCPA 3Q85A 1ZM3A 3AVQA 1NP6A 2QY9A 3OF5A 5KSPA 1W36D 1ZCBA 3K0FA 3ZVLA 4URYR 1XTKA 1OHHD 4ZPXA 2ZROA 3M4YA 1EFHA 4KI0A 1XD2A 5FBWB 1CEEA 2RGEA 4AY2A 3DM9B 1KDOA 1OFIA 4PQFA 5K8TA 1P6XA 2F3TA 4WZBE 2EYUA 2FGJA 5BN3A 5FPKA 2ZJ8A 3EPLA 2XXAB 2CMKA 3BB1A 3VX4A 4AK9A 5P21A 4PQRA 3QKRB 2FU5C 3KFVA 2VYFA 4PXAA 3DDCA 1E9SA 4AG5A 3U7FB 1G8YA 4Q19A 1G5TA 3B78A 2QRZA 4O2RA 1E9AA 3BBPA 2ZJAA 5E4FA 1E1QD 2VHTA 4Q03A 1LF0A 4A15A 4XTCS 3K9NA 5FUWA 1XXHE 4EQ6B 3MJRA 5FBRB 3GLHB 2X8AA 3QVUA 4LZZA 4WA7A 3B6EA 2R6GA 1BO6A 5E7JA 2WKPA 2W2VA 5CDFA 1H8HA 2JATA 1KO1A 5EE3A 2AFIE 3FB4A 3B1XA 2VSFA 4Z54A 1A2KC 3PEYA 4IOMA 4RFVA 5JSZA 5L3SB 4XH9B 4ARZB 2L0XA 2BJWA 4DUGA 2ZRIA 4BEBA 5IF9A 2O8FB 1MO3A 4B34A 5JZVA 121PA 1VYVA 3AF3A 3VX3A 1IBRA 1G1MA 4XWKA 1G18A 3SN6A 2H57A 1QG2A 2WVJA 1TF7A 1U0JA 3K70C 2JJ1A 1B23P 4EJSB 3EIHA 2ZSAA 2O8FA 3VKHA 1M2OB 4MKHA 5H8WA 2ZJYA 1QZXA 2XEXA 2FN4A 1KZGB 3LRPA 3W6NA 1ZNXA 1GOTA 3AQ4A 3U61B 4KBGA 3LVRE 1D6JA 1R8QA 4R2IA 1N5IA 2G3YA 3CRW1 1XEFA 1XXHA 5FBQB 4DVGA 4F4CA 4ZCIA 4ZCLA 2C98A 5BXQC 4M1OA 1LS1A 4TTQA 1AA9A 3ZJYA 4OI2A 5AK0A 4C2TA 1YZLA 1RRFA 421PA 1KYIA 2CCGA 3B1VA 2ODBA 1SXJE 2RKOA 5FH9A 1JR3D 4JLVA 3AGPA 5H70A 2ZE7A 1UBGA 5FBVB 2OCPA 4Q4HA 3A58B 2B21A 2Z0MA 4IDPA 2DFLA 2QENA 1NY5A 4G5RA 2CL7X 4RZUA 4D4KA 4KITB 3IPXA 3BRWD 5D3MA 3SHFA 3I73A 3PEWA 2YWFA 1KOFA 5LDDC 1IHUA 4XD7D 4DBLC 2P0EA 1XD9A 4MRRA 4LV6A 2HCBA 3PUXA 2DWQA 2BBSA 3RS3A 3UPUA 1U94A 4F92B 1D2EA 2JASA 1G3RA 2XTMA 4X8LA 3LX8A 1Q1BA 2R65A 1N25A 1GKUB 1ZBDA 3BIFA 2FF7A 3LWNA 4TQ9A 4US0R 5AJXA 1EXMA 4DUGD 1XJQA 2ATVA 3ND9A 4OHVA 1NVUQ 3OEEA 1JJ7A 2CCJA 621PA 4TMZA 2ZYTX 1XEWX 2GZDA 1VG1A 1ZNZA 4C0HA 3X1YA 4DZZA 5JLJA 2H5EA 2IXGA 1JAHA 5TY0A 3GLHA 2GJ8A 5KSYA 4PFSA 2RB4A 1M1YE 1X3SA 4PZYA 1G3QA 1XMSA 1Z3IX 3D3QA 3VR2A 3QKSA 2A5FA 2JIZD 4RJLA 1HTWA 1OXXK 1N6IA 3OFNA 3B1YA 2FOLA 5LD2C 3THWB 2AD5A 4KYUA 4DIDA 1G6HA 5CB8A 2A5YB 3P26A 3PCRB 2XB4A 3U44A 1Z2CA 2MMCA 4TYPA 1N6HA 3KJHA 4PC7A 3PXGA 2ZSBA 2GILA 4US1R 3IBGA 3K09C 5DI3B 4AWXA 3SC3A 1EGAA 1OXSC 4FMCF 3MAAC 4F7WA 4A6XA 4OI0A 2WHXA 3DHWC 1ZW6A 2OCAA 4PHFA 2QT1A 2EFEB 1RW4A 3KJGA 1E79D 4B32A 2IS4A 4HLQB 1UEJA 2R6DA 2QMUA 3R20A 3BH7A 1C4OA 2WSSA 4HAXA 1EWRA 3OEED 1KKMA 5FI0B 2QGZA 4DWJA 1XCPA 4ZKDA 1SKYE 2IXFA 3KKQA 2JLZA 2BMFA 3KFXA 3THXA 5JS7A 1HURA 3CPJB 4A2QA 3MD0A 4Q1FA 3Q7QA 1CJUC 5BN5A 1AKYA 2XSZA 3TUJC 2NO6A 2NMVA 3ADKA 1E9EA 2V6IA 3B60A 1NN1A 2JIZA 4KFSA 4RCZA 2JLUA 5FUXA 1K5DA 1WP9A 1A7JA 2AN9A 5SZIA 4MA4A 4BFWA 4IEIA 4XSGA 2DWOA 3UWKA 2F1RA 3QOFA 3SBEA 1OFTA 1M7HA 1YRAA 2NO9A 2VP6A 4M1WA 4LSGA 5EXXA 3SI7A 3TSOA 2IYTA 4MGZR 1UKYA 3MWKA 1V43A 3CKLA 3ZZTA 3IIMA 1NSFA 3AV0B 1PLKA 2IX3A 2WJYA 3EWAA 4FCWA 3CX8A 3LA6A 2OG2A 4PPGA 5EXTA 2YKGA 3UATA 4I1VA 4RKEA 2FPMA 2ZI4A 1KSJA 2GXUA 1G41A 2IYXA 4GRAA 1CR4A 4GSYA 4TZ0A 3FFBA 1ZUNB 3WYGA 4URWR 2GETA 2IHYA 1N0VC 3ZQ6A 1NBME 4LYJA 3MJHA 4PC6A 3KQUA 4UXHA 4HUQA 4DDWA 2ZJ2A 4RFSA 3WMFA 3RS2A 2B8WA 2OCBA 1KDPA 3SNHA 2KB0A 5EQTA 3UIEA 2WAXA 1XU4A 1P2SA 2OT3B 3AF4A 4U7DA 4B6EA 1XMVA 4HUQB 2BHRA 3I4LA 2X2FA 2J41A 2Q3HA 4RFSB 3U3OA 5CM9C 4GZLA 4AG6A 5KOYA 5FTNA 1G20E 1GZSA 1T4GA 3THWA 1JR6A 5EZ6B 1UADA 1Z07A 1TU4A 1TUIA 3P4XA 3PV0A 5JS8A 4E5UA 2J59A 1AS2A 1SKQA 4XIGS 3MWJA 1JR3A 1KY2A 1NMXA 2GF9A 3VNVA 3BERA 2JLXA 4CT4B 4HDCA 2AL7A 2BWJA 3WRXC 3IHWA 1XXHB 1Z0DA 2ZR0A 3LY5A 4LK2A 2GXQA 3GJ6A 4JLAA 1S0UA 4A2PA 3B82A 3SJAA 2F1JA 4M9ZA 2H92A 2QG6A 4DLUA 1Z29A 5JWOA 4DB2A 1IY1A 2WSSD 2ZEJA 4CEHA 4BLPA 2A2ZA 2WWHA 1NNEA 5EE9A 4XVRA 3V9PA 2IA5A 5KTYA 5GADl 3TW8B 2JJ1D 2N1BA 1KMHB 3QY0A 2RHDA 5EXSA 4B76A 3K9HA 3HR7A 2O5VA 2REBA 3U5ZB 2GBLC 4DRZA 1AM4D 4YMSA 1S1MA 2EQBA 4NONA 4LJAA 3GJ8A 1NIPA 2QSZA 3QKRA 4FWTA 1KNQA 2GCOB 2J87A 4QOSA 5IT5A 2ZSDA 1DE0A 3KB1A 1UJ2A 1P9NA 4R7ZA 2UZIR 2WWIA 3EC1A 1XPRA 5G3ZA 3N2IA 3QPVA 4DDTA 4A0RA 2V8OA 1R10A 2YINC 1HQYE 4EQ6A 4ZIRB 2MSCB 1XMJA 1AS3A 2KBEA 3SYLA 1ZP6A 3QG1A 1OH5A 4ZV4A 1IY0A 2ZYUX 3NBFA 4EKDA 3RAPR 1M74A 4ASUD 3RANA 2QGNA 2QPTA 4LYAA 3W6OA 1W48A 4II7A 4LC0A 1SXJB 3KKPA 4I1SA 3MWLA 4IFBA 3REFA 4D0NA 1TX4B 5FTLA 2QPOA 2DPXA 4QBHA 2CLCX 4PTLA 3D7MA 4G0NA 1ZU5A 1F2TA 5J5CA 4HLDA 4CGZA 2R62A 3Q72A 4DEXA 4KO8A 3KL4A 1KAOA 3WP0A 1KK1A 1G21E 3GJ3A 3LD9A 2YOHA 3DVLA 1GSIA 4PSVA 5HKKA 5JFGA 4W5JA 1OLOA 2MSEB 2Q3MA 1FUUA 4UXJA 2O8EA 5FUYA 1E99A 4HAUA 3UMSA 2YOFA 2PBRA 3KXLA 2H17A 1PUJA 3IILA 4AYWA 2GXSA 1KMQA 1UFQA 3RS4A 5EUMA 2F7SA 3CZPA 2PX3A 4KBFA 4X8MA 3TR5A 3VMFA 4JLJA 4FMDF 3M6AA 1DAEA 1XMIA 2EWWA 3ZYCA 3NWJA 5FL3A 4UNSA 4V02A 5FPHA 1SGWA 1CLUA 4Q9JA 4GOXA 1RRPA 4PSAA 2N42A 1LVGA 3PUZA 2RMKA 1M8PA 2ZIAA 2G83A 3PUVA 3B9PA 2ZRLA 4KODA 4Q4LA 5AJYA 2J9RA 5FOSA 2FJUA 3K0AB 1EX6A 2ZI3A 2WJIA 1VIAA 1X1RA 4HDQB 1VCIA 3C5HA 2WWGA 3THXB 1VG0B 3L0PA 1PLJA 1XZQA 4OK6A 3TRFA 1NLZA 2A5GA 5JRJA 3KTAA 3T61A 1Q22A 1HY3A 1OKKA 4OBEA 1ZUHA 5TB5A 4GL2A 2O0HA 1T3LA 2EU8A 1GDDA 1TQ6A 2FPLA 2TMKA 3SYKA 4BLQA 1T5LA 5CYOA 4IXMA 4PPFA 3RSOA 5K8IA 1U8AA 2ZREA 4B3CA 4QM6A 3SR0A 1WBBA 2Z4RA 1Z6XA 1YR9A 3AH8A 4P3YA 2XTNA 4QXAA 1Q1EA 1ZRHA 3RC3A 4B2LA 3DKPA 4JVSB 4FWIB 3VQTA 4P4SA 1AN0A 2PZGA 1UBFA 4Q9KA 2PCJA 1N5LA 1X8JA 2XOKA 1DS6A 1YZUA 2OILA 4B73A 1H8EA 2IS6A 2JA1A 4QBGB 2ZS8A 1KI3A 1DO0A 2ZE8A 2QE7A 2O8BA 4AKIA 4NYMQ 3IEUA 4OQMA 3GMTA 2FNAA 4L9SA 4MYHA 1ZAKA 1NJGA 2XTZA 3EXAA 5JEEA 1NMZA 3DZDA 1X6VA 3DM5A 4JMPA 1YU9A 1I4LD 5HZHA 2ZI9A 2HV8A 1BYIA 1FP7A 1U99A 3UG7A 1N6NA 4QM7A 3AF2A 5AWFC 3L8YA 2IYYA 4EFMA 1LB1B 1ODFA 1SZPA 2CHQA 4LJ5A 5DYIA 1BYUA 1W1WA 2QM8A 2C9CA 2VSXA 2ZRAA 5LB2A 1B0UA 1GFIA 3QPUA 3B7GA 1UEIA 2GA8A 4TL9A 3HR8A 3MCAA 3LQRA 1NIJA 2ZSFA 1Z08A 3R7WB 3F5FA 4M22A 5J47A 4HB4A 3VU9B 4PHHA 3T5GA 4DLSA 2Q21A 2ZS7A 2C99A 2VHQA 2YWGA 2ZRJA 5IDVA 1TEVA 2GHIA 1Z6TA 2X77A 2GEVA 4Q7LA 4ZDIA 5HTKA 2GJ9A 2H1LA 1T6NA 2I4IA 3AVVA 2BEKA 1RZ3A 1Q44A 3UANA 2WSMA 1DPFA 3LNCA 3I8XA 4EDHA 2H18A 3LO5A 3NHBA 4NBSA 3C16C 4QHYA 2QPAA 1R0YA 4JZKA 5L8VA 4MDFA 4BEJA 2IUSA 1G4UR 4G5SA 5DN6A 3WBKA 3FE2A 4LJ7A 3BK7A 4DLXA 2GVZC 2EFGA 4B6FA 3K53A 4YDHB 1GAJA 3QQ5A 1GITA 3A4MA 4PQYA 4Y0VA 4ZI2A 1VHLA 1PLLA 2IEYA 2DYKA 3QPWA 3V4RA 3A37A 4OQNA 4IW3B 2IYVA 3NC0C 1KK2A 2WWXA 3KXKA 4LHVA 4LYFA 4M21A 2PEYA 3RWOA 1DG3A 4BFZA 3R9IA 1HA3A 1P73A 3CRRA 1OXTA 4C3ZA 2C9OA 2AWOA 2W2TA 4TQUS 4AI6A 2VF7A 1KNXA 1YRBA 3NH6A 4S2EA 3KUDA 3BFXA 3RABA 2VQSA 1F48A 2YC4C 3KKMA 3ZGXA 3CF2A 4DCTA 2QTVB 4ZKEA 4BQSA 3Q5DA 5FTJA 3QBTA 3UMFA 1JNYA 1FTNA 2BCGY 2RHMA 4ACAA 4NP6A 3QXHA 1NG1A 3OAAD 4Q48A 4UNQA 5A5GA 1GP2A 5G53C 2V1UA 5FTKA 2QNRA 4OI4A 4KSBA 4D4JA 1XPUA 2F6RA 2J5XA 2HCJB 1P2VA 3Q9LA 4P4TA 3A1VA 3GLHE 4GZMA 1N3BA 5IRCD 1Q1ZA 2OHFA 2FPKA 3I5YA 1EWQA 2V3CC 4M9QA 2V7QD 4F4JA 4ASUA 4X8OA 1YVDA 4Q1EA 5CLLA 5F3WB 3TLXA 2Q9BA 3FWYA 5M04A 2YC2C 2PZEA 3T06B 3C8UA 3KKOA 3IQWA 3UXMA 3QSYA 3DMDA 4QBIA 1ZJ6A 2QL6A 1R0ZA 2WJHA 4F93B 1CJTC 4LHZA 1AGRA 2AKAB 4N3NA 4OYHA 1J90A 3LDAA 1VTKA 2ZAOA 4ERNA 3MSXA 4ITRC 2OFOA 3GEIA 4HZUB 5HKKD 4IVQA 2B6HA 2J0QA 2D62A 3PFIA 2NO1A 3AF0A 4QBFA 2JAQA 4JIMA 4WAUA 4C0AC 1OIVA 1K5GA 4QJ5A 5JHGB 1E2NA 1MO4A 5TARA 4HZUA 4XVUA 2PX0A 1XTJA 3BH0A 5KNBA 2AK3A 4KVAA 4DEYA 4G01B 5L3VA 2Z4SA 2ZRCA 4DJTA 3K0EA 3E1SA 2QQ0A 1CRPA 3AKCA 4JT2A 2ZETA 2ONJA 4PC1A 4MRSA 1IJFA 1GG2A 4JS0A 1CRQA 2REOA 1WDTA 2N46A 1N5JA 4DIEA 2OCYC 1I2MA 2XB2A 2C96A 4Z8YA 3ICQB 2YNMA 6Q21A 5JWRA 3LX5A 1KK0A 5F9FA 1L4UA 1E2MA 2BV3A 4GBMA 4LJ6A 3QBVA 3ZQJA 2PH1A 4CEJB 5CIWA 2ZI5A 1SHKA 2OBLA 3CZQA 2ZVPX 4JVMA 3X2SA 1JXMA 1UKEA 4R2HA 3DL0A 4TLAA 1JPJA 1F2TB 4KLNA 2H16A 1AZTA 4L4UA 4C0JA 4CEJA 2YWEA 2ZPTX 1U98A 3KX2A 4KXFB 2CJWA 3GLGE 3QF4A 4URUR 5C1BA 2PMKA 4Q7JB 3VR4A 2J46A 2ONKA 2A5DA 1W46A 5AR1A 3VAAA 2OXCA 3VTKA 2ZANA 5CLQA 2IK8A 1XTRA 1FL9A 4QKQA 1AZSC 4D2IA 3ASZA 1Q3TA 4PX9A 1G4AE 2UKDA 4YDSA 4FMDB 5J4HA 1MOZA 3MWYW 5DISB 5GJBA 1CP2A 4KVGA 4PSKA 1P2UA 1GKYA 4OJQA 1QBKC 5L3QA 2GJAA 3QXJA 4HB2A 4YXWD 3P20A 3SEAA 2CBZA 1W0JA 2R44A 2GK7A 3S1AB 5FTMA 3NIBA 1AGPA 3IIKA 1ZD8A 1J7KA 1OXVA 5DE3A 2NQ2C 5FOUA 3SOPA 3DPUA 3WHLA 3E5HA 1AQUA 2IWRA 2H8KA 4TT3A 3L0SA 3AKDA 1G7SA 1J99A 4M2LA 4D0LB 1KI1A 2JEOA 3RSLA 3TSWA 2Q6TA 5JI2E 4HATA 1HUQA 1W49A 3ADBA 1KY3A 2WOOA 4AIIA 3CBQA 1LF5A 5DNYB 3QKUA 1IXZA 1A1VA 3LW8A 2IUTA 4MGYR 2G9NA 4LDJA 2GDJA 4EUNA 4WOPA 1XD2B 2O8DA 3VR1A 4US2R 4EPRA 2VIIA 4QGAA 2FEMA 3FMOB 5EXPA 4EJSC 3NDBB 4POAA 3WNBA 2BJVA 2GRJA 1Z0JA 3L0OA 1CTQA 4NMMA 1OV4A 2CE2X 2ZR7A 1G8PA 4GOKA 3SJZA 3RRZA 5KPDA 5TVKA 4TYQA 1YJ5A 1OF1A 4LHWA 4LBYA 4QC2A 1A2BA 2YVUA 4QJ3A 4MGKR 3TH5A 3GJ7A 1J2JA 3B5JA 5IK2D 4P0TA 1ETUA 1ZD9A 4L5BA 4RZ3A 2QN6A 1OHHA 8OHMA 3AB3A 2ZRBA 1F6BA 1TTTA 4Q47A 2OFXA 4TYYA 2WTUA 2YHSA 3WNCA 3CW2A 1G17A 1E2EA 4DHEA 2O52A 2FH5B 2Y8EA 1JBKA 2IW3A 3NKVA 4RSGA 2O8BB 5BN4A 2VP5A 3RWMB 1IXSB 1R2QA 4HAYA 3CRMA 1E2LA 2G0NA 4C0LA 1NVWQ 1KO5A 4JT4A 3K9LA 4NPHA 4NU0A 2ZU0C 4ON9A 2ZUDA 3O8RA 1FZQA 1P75A 3TBKA 1OFUX 1UKVY 1R0WA 3TUIC 1N6LA 5BYKA 1AS0A 2CHVA 4HUTA 5BWMA 4XD7A 4YMUA 3K0CA 4Q9LA 3NXSA 5EP3A 3PG5A 1M7BA 3QXXA 3FMIA 1JI0A 2XX3A 1M34E 2IYZA 1KSFX 3QEOA 1HE8B 2R6FA 4EIWA 2EYQA 3KDSE 1E3MA 4BFTA 1S3GA 4C7OB 5FL7D 2GAOA 1XRJA 3I61A 5JCPA 4YC7A 1SVKA 1N5KA 1CULC 3VKWA 4D25A 3FOZA 3CNOA 3K0FB 1YZGA 4V0NA 1N6OA 3AUXA 2ZRNA 1GKIA 1EK0A 4FINA 5JJKA 2V54A 3QF7A 5FUVA 1G7CA 1YR6A 2F43A 4JSYA 5KUTA 4G5QA 4JYBA 2IUUA 1NMYA 2ZU6A 3GCGA 2CL0X 1I4TD 4DLRA 3FHCB 2DFNA 2OV2A 2WJJA 2DHRA 2K5UA 1T91A 2PLFA 4B48A 2PT5A 3L2OB 4HB0A 4JL5A 4B3XA 4R9UC 1UBEA 1SVWA 3ZDQA 3UK6A 2J0UA 4DDUA 5FPSA 3AEZA 2AD1A 1XFAA 2EFDB 4DSTA 1ZIPA 3B8HA 3PVSA 4U00A 3RHFA 1TU3A 1BIFA 1SVSA 2VH5R 4BLOA 3G5UA 2O0KA 4LX0A 2WOJA 4LC1A 3AP3A 4PPQA 4E03A 3KKNA 4WXRA 1T3HA 4DCSA 1MV5A 2D4HA 2VP0A 4M1SA 1XWIA 1Z06A 2WMNB 2PLRA 4PAQA 4PZLA 3QG5A 1UKZA 1NRJB 2NZ8A 2G88A 3IO5A 3SZRA 2ZRKA 4ZO4A 4A2WA 3KQKA 1YQTA 4YXWA 1WMSA 4UXIA 2BBOA 1JXOA 1QHHA 3SJBA 1QG4A 2IYLD 4KYIB 1KO8A 1S96A 3ZLJA 2JDID 1GM5A 4XVQA 1R5OA 1P4SA 2CCKA 4N1AA 1XNJA 2I1VB 2BDTA 1QHHB 3WHKA 4TZ6A 5KO2A 1FOEB 3DO6A 4P31A 3KZ1E 2WPDD 3C7KA 3G0HA 1FNMA 1FNNA 4Q4JB 2QZ4A 2J3EA 1DAHA 3GLFB 3Q3JB 2JLSA 4KLZA 2HYDA 5KDLA 2WBLC 1N0WA 1RJ9A 5KSOA 3LFUA 3NBXX 3TJZA 1E2JA 4LJYA 4Q4JA 1P60A 1YR7A 1VIYA 3MLEA 2ZR9A 3WP1B 4BZQA 4A36A 4HLUA 1JJVA 4DT1A 4K8OA 3U60B 3QKTA 5EUQB 2R8RA 1VYTA 3AVWA 1IN7A 1IJEA 2BBTA 1FW6A 1S1CA 3FKSD 2HLDA 2YJTD 3D6TB 2R9VA 1W4BA 5KNDA 2BMEA 2HJVA 2AXPA 1IAQA 3I3SR 4NCJA 3LBHA 2A78A 4E07A 4B47A 1OH6A 1TUEA 5C18A 1G3IA 4BPBA 2B92A 2IBMA 2F43B 2XXAA 4F38A 1QVRA 2EWVA 3BD9A 1T0JB 5D3MB 1W2HA 2D7DA 1S9HA 5C46F 1ZUIA 4Q00A 4U5XA 4B2IA 1IN4A 4FN5A 4AKHA 5JHHB 3H4MA 4IOKA 3X1WA 1ZU4A 1WXQA 4H9GA 1W2GA 4NH0A 2BMDA 1JPNA 4JBXA 1MH1A 1R0XA 3WXMA 1NSTA 2ZM5A 4I1OA 4O3MA 4EFNA 1BMFA 1U2RA 3TNFA 3AM1A 5HE8A 1FX0B 2FWRA 1TMKA 4MITA 3BXZA 5KSZA 3RRNA 4V0ME 2QSYA 5GJVC 3WMGA 1KDTA 1OKKD 1NF3A 3C14C 4IDNA 1FQKA 1MT0A 3MMPA 1XJ0A 4JKYA 4QL3A 5FOXA 4M4SA 4NDZA 4YMWA 3GJ0A 1XJCA 1WF3A 1KKLA 1W0KD 2ZVQX 1CJVC 2CJWB 1U9IC 4ARZA 2WV9A 1OB2A 4W5HA 4Z51A 1MR3F 5CJ2A 4DSNA 3PUWA 2X2EA 3U7EB 2HLDD 1X1SA 2OXRA 2VPPA 1E94E 2IYRA 4TYWA 2YOGA 2A3RA 4URZR 2E1RA 4NCHA 3EPHA 2CLSA 4K81B 1KJYA 3OIUA 2CDNA 4DCNA 3EC2A 2RAPA 5L3QB 1HV8A 2Q3FA 3U7HB 1WRBA 1K8RA 1XX6A 5KNCA 3ND8A 4I81A 3OHMA 4NYIQ 2IEZA 1Q12A 3PQCA 1NLFA 2A9KA 2BEJA 1DAMA 3BORA 3HYTA 3P32A 4RZ2A 5KDDA 2GCNA 2JJ8A 1NY6A 2OM2A 2W2XA 1XB2A 4BFVA 1E6CA 3JVUA 4N0DA 3IKJA 3HP1A 5GJCA 1SULA 4ZDJA 1NBMD 4OHYA 3ZVNA 1DAKA 1ZM9A 3ETLA 1G7RA 4K46A 1LS6A 3ASYA 1BMFD 4PAOA 2OLJA 3OIWA 5EZ5A 1KJWA 3VHLB 4B3BA 4B33A 3MG9A 3RC8A 4UKDA 1NI3A 4UQOA 3EZ2A 2YZ2A 4BLTA 3GLFE 2OLKA 3AF1A 4G5GA 4XOIA 4DXAA 4UNRA 3UKDA 4A0GA 1R4AA 2IYUA 3QUSA 2O8DB 1ZYUA 2WKQA 3IDQA 4JLNA 2FDCA 3OE7D 3ZIAD 1E0SA 2P2LA 3BB3A 3FYHA 3VR5A 2RH5A 3IBYA 4Q9HA 3EA5A 2REXB 4ESHA 1IM2A 1F3OA 1EFTA 821PA 3K1JA 4OHXA 1CR1A 1DAGA 1ZCAA 4GP6A 4LBVA 1E9RA 3PR1A 3VFDA 5FOTA 2ZE6A 3AKEA 5GVSA 1G8GA 5BQ5A 2CHGA 3GEEA 2HYIC 2B7BA 1DARA 4DB4A 4TQAA 4HAWA 1W36B 1H8HD 2VSOA 4BFXA 4EPVA 1X86B 1EESA 3AVOA 3D8BA 1CBUA 4D4MA 1D9XA 3EPJA 4LBWA 2C03A 2GEDA 2X19A 3NBZC 3DOEA 1S3SA 5CK4A 3HU1A 4KAXA 1FPMA 1QHXA 1WB9A 2CXXA 2P65A 5H68A 2C9YA 1US8B 2ASEA 4D81A 2YV5A 3BFVA 4OKSA 1UDWA 1SXJA 4PC2A 521PA 3T1OA 2W83A 2XSZD 1FFHA 3CH4B 5KHOC 1UF9A 1R6BX 4B43A 4BFYA 4TMWA 3M0EA 3U3JA 3V4FA 5TDHA 5SZKB 2W6JA 1VYUA 1C9KA 1E98A 1I4DD 4Q7MB 1S9DA 3FKSA 3LLUA 3OE7A 3ZIAA 3J81k 3QJYA 2BIFA 2WZQA 2V4ZA 2NPIA 1ESMA 2F9LA 4BRUA 4B75A 4V0KA 2RGGA 4BGDA 1QHGA 2BM1A 2BMJA 1XBTA 2W6IA 2P6UA 4HDOB 3CX7A 2G6BA 2R2AA 3X1DA 2ZUBA 4UJ5A 1W44A 3SJCA 3V00A 4DT1B 2AX4A 1CS4C 2ZYVX 4XSHA 1RPZA 5JCZA 1GVNB 1Q57A 1A4RA 5B64A 5LD2B 2I1QA 1JB1A 1E1RD 2AK2A 4Q02A 3R9XA 2HF8A 3DZ8A 1X8KA 2CE7A 3GEHA 5CB6A 2IS2A 2C8VA 3EIQA 4MYUA 1OSNA 3I8SA 1DEKA 1U0LA 4TMKA 4YQFA 3AVYA 3O8BA 4L9WA 2ORIA 4GMDA 4PZZA 4URVR 2VO1A 1WBDA 3U4QB 2DR3A 5KPJA 1SXJC 1ANKA 5J4VA 1E2IA 3B13B 3GFPA 3TIFA 1MO5A 1VPLA 2QORA 2QEQA 3T35A 1KI7A 4IOJA 5LBIA 2QP4A 4KJZA 5JI3E 1RRCA 3E2IA 2ERXA 1VCOA 1HEIA 3KTAB 2ZRFA 3CPEA 1DOAA 4CZ2A 1GNRA 3IQXA 1NLYA 2W6JD 1ZM2A 2QQEA 4RKFA 4BWYA 1HT2E 1XEXB 1SXJD 3TW4A 1Z83A 1EX7A 4ZIRA 1MO6A 1ZINA 3I72A 4NYJR 4DLYA 4AYTA 1E4YA 4L16A 2J1LA 3ZVRA 2E87A 1FMLA 4YMVA 3NTUA 3EX7C 2W6ID 3PITA 4TTPA 4BRWA 3H86A 5AUQA 4PHGA 4MKIA 2ECKA 3CF0A 3U3KA 1TF2A 1XCMA 1VG8A 4RD6A 1X8LA 3OIVA 4NYMR 3F8TA 1TQ4A 1ZNYA 2Q9AA 4LOAA 3G82C 3A4NA 3ADDA 4TSFA 3EG5A 1I2DA 5UKDA 1KDRA 3H1TA 3W5JA 2C5LA 3NG1A 2AR7A 2ZE5A 1II8A 1SHZA 1F5NA 4RD1A 3GD7A 4A8JC 3A1UA 4B71A 5DN6D 2W00A 3QXSA 3LW7A 1QVAA 5FI1B 1QF9A 4JSTA 4Z1MD 3EZ6A 4NCKA 5JECA 1QDEA 5J4LA 1II8B 4JLOA 4E09A 3O8CA 4D6PA 1QHNA 2LWIA 2D74A 2F3RA 1KTVA 1YE8A 5JBQA 4CW7A 2EVWX 4TL6A 1MABB 2VEDA 2ZAMA 4DSUA 1Z2AA
chains in the Genus database with same CATH superfamily
4EK9A 5F64A 3QPAA 2AUNA 2QJFA 1MG0A 4G9BA 3R7WA 2A9QA 1ST2A 4B3FX 4Y67A 2P62A 3CW8X 3WIBA 3GW8A 1QS0A 3EGXA 4ZHQB 4WLFA 4NSNA 1P1JA 2ZIGA 3B3GA 1O97D 2QX9A 1NF8A 3GWZA 4LHYA 5AKKA 2DR0A 4D92A 2C7RA 2X4GA 4G1VA 1AT1A 1OTHA 3A4LA 2W4MA 2JGKA 1JLRA 2FPUA 5DI9A 4YYEA 1AQJA 2G1JA 2PE5A 3LPLA 4KXVA 3ZJTA 5E1OA 4B3DA 2RI6A 1CU1A 2QRVB 5AUPB 5C80A 4C4ZA 4HGYA 4Q37A 1B73A 1XAIA 2GLXA 2QF7A 1P72A 2JGAA 3G89A 3U4QA 4DNXA 4LC9A 4GMXA 1JHMA 1GLGA 1WQ4A 1XRRA 1UZUA 2H1FA 4XJXA 5HF6A 5AO9A 5T3UA 3TEJA 4U5QA 4F4HA 4O2AF 3EA0A 1EFRD 1U6JA 2GLTA 1LI5A 3PXUA 1CP3A 1GPUA 4Z9AA 5IM5A 4CEIB 3IVRA 1G42A 5EHXA 2HXSA 3EGDB 3PLRA 4L5AA 5H9VA 3HPRA 6ADHA 5AW4A 3SXJA 5FEUA 5JSHA 2H4WA 3EQZA 3CV3A 1PFGA 3SF8A 2EZ8A 4PHTA 1ZVQA 4FGLA 2FOXA 4OX9Y 5IMBA 4UBMA 4L4XA 3ASVA 1U3TA 2N9UA 1N6PA 1Z5WA 4UMFA 4UQPA 3PHBE 2BFBB 2J3LA 2GHRA 3G68A 1X7GA 1IU9A 1I7LA 5DLQC 4DLWA 1G20A 1PG0A 3GLSA 1G55A 1P1HA 4KFUA 4G67A 1M0SA 3HJBA 2KM1A 3PC8C 2A7QA 4TLMB 4WW0A 2REQB 3ZD6A 3R0VA 4QHTA 1AUXA 2G0TA 5LZ9A 3RU2A 5AHKA 1RIIA 5NULA 3LAWA 3DEFA 3I9FA 5EQDA 1QCCA 2CXSA 4K5QA 2VRWA 1R00A 2YJ6A 1I1NA 2PANA 3HYSA 3EF3A 2GJSA 3RT1A 3CX6A 2GF0A 4GKAA 4PZEA 4G41A 3UXEA 3WB2A 4EY5A 2QUJA 4HDNA 4WNIA 4UARA 1O87A 3L5OA 1W52X 1PWYE 4LW8A 1WULS 3AJDA 3CNLA 5L6MB 4RPKA 4S1TA 3BN3A 4JV5B 4OHPA 2X41A 4S0XA 5CTJA 1C1DB 1Z2NX 3N7TA 4D74A 4MROA 3JQGB 1CUYA 3KT6A 4B87A 1K68A 4LYDA 2GZRA 3H8WA 4D8VA 1COZA 3EFOA 3IUSA 3KT8A 4IHAA 2BCJQ 2XWJI 3FZYA 3N7AA 3LDFA 4LJLA 4I9FA 4P98A 4KSCA 4QOFA 5AI4A 1WPRA 2YHIB 4QOEA 1GQYA 3A11A 4TMTA 2GXAA 1HBJA 2IRWA 1QGUA 1MC8A 3L8GA 1ELOA 3SJ7A 1IDOA 3E8XA 4QHSA 2VZ8A 1JALA 4HOYA 1HTBA 4KW7A 4M53A 1VPVA 4LHXA 4R2JA 4DG5A 1QG6A 5ED0A 5SY9A 3QHPA 5FPYA 3I12A 4WMLA 4B45A 4LV5B 1SBCA 3FTPA 3JQBA 1UAGA 1QYXA 1K2WA 4J4TA 4B2PA 5F78A 3ZLTA 4OSEA 1XTTA 5CCEA 2B4QA 1YRWA 4ZJYA 5K8LA 3ZD7A 1NVVR 2H1RA 2QQFA 5IK2A 1M1NB 1QUFA 1Z28A 3STUA 5AUNB 2X1VA 1RPNA 3KPWA 3AJEA 3RBXA 3K70B 1J21A 2H4JA 4TXHA 3M83A 4NFYA 1NI4A 2ONCA 5C35A 3PXCX 3COPA 4O2BB 1V8OA 1L7NA 4LDPA 3VPBA 3C1TA 5BQOA 4HYTA 4C0QC 3KVNA 1M1NA 5JCJD 5DM4A 2AWNA 4PYLA 1E5DA 2WIGA 2DQ4A 4DC9A 5JDIC 3TE6A 5I7UA 4IWXA 5FR2A 2C54A 3N0TA 2RARA 3PNMA 2X9VA 4IICA 4TKLA 1DKLA 2ZIUB 2EZTA 3G8YA 3TQIA 2DY0A 1YMQA 3FZEA 2A30A 3PX7A 4MYTA 1I1HA 3QZUA 4Y1GA 2P2YA 4KWHA 1KI2A 3DCNA 2PBFA 1KU0A 1WSWA 4JJZA 4MJXA 1D5CA 3A1TA 2R3SA 1IPHA 4XTRA 4ZA2A 3AI7A 2C95A 2VAVA 3VDMA 2FX5A 2X14A 1MEJA 2VQ6A 3N8KA 4H59A 3X2FA 4CQNA 2J3QA 3PFWO 4F45A 3PRJA 5TJHA 2NVBA 3EBOA 1YL5A 2W2QA 4YP5A 3INNA 1N0UA 3GCDA 3T7SA 3RVPA 3TLYA 2C8JA 4Z5XA 3A6HA 1EDDA 4OA8A 5FV4A 3CBGA 3BFJA 1RI3A 1WV1A 3DEYX 4EPTA 2AQIA 1PW5A 1JBQA 1G5RA 3EIXA 5EP2A 3ZBTA 2H48A 1L7PA 5B1YA 1Z7GA 3KQNA 2I91A 5FQNA 1H3FA 1YE5A 2G07A 3WLMA 4F06A 5HF8A 4L3OA 2FPRA 3JD1A 3RT7A 4YT8A 4DV7B 3LPDA 3NV9A 1V2GA 4J0EA 5CK5A 3WL3A 4BAUA 1TVKA 4BLVA 3RBAA 3QWFA 3DQQA 3DVAB 4YASA 4QAQA 4E5PA 5JAPA 1JAIA 3L6DA 5FHRA 3QGMA 5GZ6A 2C5SA 4BUJA 4GX0A 3KQHA 4FD2A 1U2PA 4YJFA 1AKRA 5IJZA 3V42A 3I1JA 2CK3D 1ORHA 2Z9BA 4LXGA 4P7JA 3ZNOA 1GR1A 3BPSA 1AJEA 4JJ6A 3TOZA 1EWKA 2OO7A 2BM0A 4AF6A 3FMFA 1VLMA 3H9EO 4GPTA 2FETA 1JEEA 4CKXA 3IGFA 2KI5A 4FMCB 1Z26A 3D1JA 2IX9A 1V7PC 4N0PA 4Z0TA 1E18A 1T8YA 1E2KA 3RDPA 1NT2A 1QS0B 2ZXEA 3EGXB 3G79A 1F12A 3OD1A 3B9QA 3M1IA 5FLYA 2X2OA 5AXBA 1RIFA 2EP7A 5L45A 4YO8A 2QVGA 3FVTA 4B3JA 3AR5A 3EGIA 4O08A 4WXEA 1UP7A 1DAIA 1G63A 2PXXA 1VG9B 1P2BA 5JXHA 1DTEA 1XF9A 2JFQA 3MQ4A 1L4LA 4DCJA 4XWOA 1THMA 5B3KA 1BEEA 2D0DA 5K3EA 4H7FA 1G8HA 1UIRA 2QROA 3CF6R 4OREX 5AKXA 1E1DA 4WKGA 4MI3A 1JFTA 1F1JA 4G24A 4DMLA 2P5SA 4FOPA 1YA6A 2OGWA 5DO9A 3BE8A 1JQLB 4AP6A 2CFSA 1EDOA 3DFMA 2H29A 3C6BA 1D9ZA 1E61A 1B8UA 1RBQA 1SU8A 3C2QA 3NEJA 4WK0B 5AT1A 2PX2A 1NR1A 1NVEA 4GOJA 1NVXQ 4HEJA 4DJFC 4TYNA 3IQFA 4OJKA 4W9RA 4WESA 2EJVA 1ISRA 2P3OA 2CW5A 4PZAA 4W7HA 2KBFA 5BVHB 2P6PA 2NG1A 4K9LA 1VC2A 1Q7GA 1J2TA 4G63A 3MRSA 4CM1A 3JZAA 1E4VA 2C77A 2IGBA 1OE0A 3CWZA 1B1CA 4O4JA 5C1OA 2X3FA 5KYWA 2M6KA 2XNJA 4L1KA 4L7QA 1AGNA 1RCUA 4ZYVA 3MT8A 6GPBA 2Y0EA 4DZRA 2WIAA 3RB8A 1KC3A 1U04A 2JVKA 3FWNA 1NQVA 4I5FA 4I99A 1F2UB 4DREA 2NXJA 4TN1A 4IHJF 3KB2A 3W5HA 4A92A 5LM3A 1BVHA 1ONBA 3MCZA 2QB5A 1E79A 1I3NA 2FW1A 3HDQA 3M1LA 3FCXA 3SAJA 4MAFA 1OI4A 1RCTE 3MGAA 4G25A 4XX1A 3FPAA 3C7AA 4GQIA 4U0KA 2FX2A 2J09A 2PMCA 1G66A 3OM9A 4HDNB 2HSDA 3AUJB 3FA2A 4Z8XA 3ROMA 2VTKA 1I01A 1U8TA 3OUUA 1Z2DA 4FFSA 3CINA 4RZXA 3HI4A 5CVUA 5ALRA 4M8LA 3QEKA 2XQVA 4KV9A 2IBTA 2EOAA 4N5HX 1BS9A 4TVOA 5K8UA 3GHHA 5IKOA 3LLSA 5FL7A 5G0WA 4A0FA 3FH0A 2M9MA 4LJ4A 1ENOA 2QP3A 3GP8A 2QI9F 2YS7A 2CLHB 2IYQA 4YV0A 2AX3A 1EFPA 4WOCA 1SHUX 2G4LA 4C87A 1Q14A 3N8IA 1T2CA 3A2NA 1UBCA 1ODSA 1T8SA 3ZZMA 4Y2YA 5DDIP 3IOEA 1JLLA 1NUHA 2VQFB 1ZI8A 3C41J 2JCYA 5F1YA 2O8NA 3TD9A 3L06A 5BV8A 8LDHA 4FR0A 5HTOA 4R2KA 3R7SA 2HHCA 9LDTA 2E4VA 4FMBB 1QH8A 4TLDA 4XDZA 2G1KA 4LUCA 4UVIA 4E7PA 2OYSA 4WCFA 3EEIA 1PVVA 4O02B 2JNWA 1X1TA 1RLJA 3FZNA 4BAZA 4Q4AA 1LNZA 5LWHA 4D6YA 3SHWA 2Y6VA 4MMZB 3S5JA 5BMOA 7AT1A 1EBFA 4IHQA 3P8ZA 5I9SA 4WBSA 4F71A 1B6RA 2GEUA 3CURA 3G2NA 3A25A 1G291 3PZBA 2O7QA 5E7MA 5AOVA 3DWEX 3MHPA 4B5KA 1T9AA 1K7XB 1L0BA 1XHLA 1CIVA 4CKBA 5IPFA 4CEIA 2I7CA 5I7FA 1USVA 1BOOA 3W34A 4JD5A 3PXBA 3E9RA 4AO7A 2G82A 1BGVA 4BHTA 5FOVA 1DXQA 1SZDA 2O1XA 1NN5A 2WWYA 1MB4A 3DAFA 2XJ4A 1M6WA 2G17A 3G59A 4YJ2B 1ZUNA 3O1HB 3COZA 1PL6A 1V0JA 3L0IB 4I55B 2ZJZA 1XCBA 3HWSA 4EI2A 1TRHA 1QX4A 3GQBA 4GL4A 1TEXA 2GYYA 1UPCA 1D1QA 4AZSA 5HIIA 3WAGA 3NAMA 1AGYA 5BO5A 4B0PA 3IAS1 3OX3A 4NHOA 1FTGA 2VHCA 3L7OA 1J70A 3TUZC 4E22A 3L8DA 3R9WA 3DEIA 1WUTA 2H52A 4A9AA 1EG2A 1H2XA 3LBNA 4CODB 3JPYA 4MCIA 2AS0A 1K8YB 1KZYC 5GGXA 2H1VA 3AHJA 4OGLA 3IAAA 4YGYA 1L2TA 2D2FA 3BGDA 2G06A 3T1VA 3ZIUA 2E85A 5IWAB 1V6SA 3WLPA 1PJRA 3C6QA 5TMEA 1ECPA 1MENA 3WLKX 4QICA 5EFOA 3UFXB 1VJ1A 1EK6A 3ZHRA 4PAMA 1JQ5A 2BFEB 4JQCA 5DSZA 1T9HA 4OP2A 2D3WA 4U2FA 2P9YA 3S1AA 3CZ4A 4DJJA 1L3CA 3EXEB 2IY9A 3W9UA 3VISA 4ALKA 2ONZA 2R48A 5J43A 4NOJA 2VHYA 4ZPJA 3DFUA 5A4MS 4Q12A 3VU1A 3VGJA 1SXIA 3BWMA 3I6ZA 3TG8A 2Y92A 3H1FA 3C3JA 1HSOA 5LU8A 4MDHA 3IHLA 3CIOA 2VRBA 1BHSA 2AXNA 2FMFA 2VBIA 3FRIA 1SQ6A 4O25A 3GNSA 1SJ9A 2HHLA 2WIJA 4N48A 4RY9A 1PUXA 4LRYA 4ZYLA 1J5XA 4CG2A 1N5MA 1RQPA 2PR7A 1XEWY 5AJUA 3RFXA 1PR0A 4A1FA 4C88A 4L57A 5A3JA 1VBFA 2D0OB 1P17A 1JG7A 3PD1A 1XZJA 3P45A 2XYPA 1KZHA 3PGMA 1XVUA 2YCLA 4GO1A 4CKWB 3ONNA 3LUKA 5ISMA 2N1MA 3L7YA 1HYHA 2ZRPA 4LFCB 3CNNA 1FJGB 4RVDA 1LW7A 2RHTA 2WM3A 4PYNA 1DQSA 3TOCA 2NYVA 2RGXA 3D8RA 4K2HA 1S2MA 1VECA 3L7JA 5TQJA 1FMJA 3LZ6A 1T0IA 4HEA6 1ATZA 4UBOA 1H65A 3W90A 4NJEA 1SG9A 3UMCA 4XVCA 1Y1KE 3M9XA 2QTMA 5H59A 4N0QA 2HEIA 4QVKA 5LYJB 4A6EA 3FRHA 1HRDA 3F7MA 4CTKA 2R60A 1L5NA 2WU0A 4LHSA 2Y76A 1KYXA 3VI3B 1W0KA 2KPOA 5KYWB 2PL3A 1SVMA 1YVRA 2IT1A 2JLAA 4Y0AA 4BQPA 1NLMA 2QN7A 2C97A 1AQIA 2G7MC 3CPHA 3FPHA 4KN8A 4ZD6A 3DOJA 3BX1A 1MKYA 3PPVA 1UPTA 2ES4A 2BC9A 3LQQA 3SZ3A 3DHYA 3LXXA 2B2NA 2D5BA 3WSTA 1NDHA 3JQQA 4JLDA 4MS3A 3BCSA 4O4HF 4PO8A 3UOAB 4ZI7A 2IS6A 3IDZA 4R54A 2NZ2A 4HNSA 4RCVA 3L8ZA 1TK3A 1X7HA 2H6EA 3W8DA 3W05A 2P1DA 1KU6A 4J4BA 4II3A 3TKYA 3C6MA 3RUFA 3ZS8A 1CY1A 2AJLI 3A9VA 3E48A 1CV2A 1H6BA 5IW8A 4BP9A 2WE7A 3A10A 4HRYA 4MJ7A 1JLSA 3T1NA 2DT8A 1R15A 1A98A 3EZ7A 5J4YA 2IU6A 3TLMA 2Q5FA 4LWZA 1C8BA 4BNTA 2A58A 4IUCS 4JC5A 5C2JB 2A88A 1ZK3A 4NCIA 2ZG6A 3GVCA 3BWVA 3IOBA 1OIWA 5KC8A 3UGKA 3D02A 4CHTA 4RD3A 2ZI7A 2J4CA 2O2EA 2ZQYA 3TL6A 3SFTA 4DLLA 1T1IA 3WIEA 2YXBA 3AOGA 1XQ1A 1NFFA 1F60A 4BJ3A 1IHYA 5CX4A 3OECA 1L3BA 2GO1A 3PXXA 1N2ZA 4LOKA 4IKOA 2JLQA 4C6RA 4DY6A 1FUEA 2BAGA 1YT5A 2O2IA 3X44A 4ZRDA 4DL9A 1YWGO 1OT3A 1R6DA 3HKBA 4ZVNA 4AJPA 5CYFA 2EGGA 3LHSA 4XEHA 1QH8B 3CR7A 2XDYA 4L8LA 1BDMA 4W5WA 1YBAA 1VPEA 3AONB 3KV1A 3R3ZA 4LJ8A 4RZQA 3L07A 1NNI1 4H6XA 2BTQA 1TAQA 4WJKB 3HBMA 4HWGA 1K7EB 3X1XA 2HM7A 5FUBA 5EE5B 3RBZA 3OOJA 5EWLB 1UK8A 1PNOA 5JRZA 1CYDA 4OOEA 1P4AA 3W6PA 2F9FA 1PNTA 3C3DA 3CRZA 5A02A 4CKBB 3LP8A 2VHJA 1E3WB 3FM9A 1XDZA 1IUKA 1HH4A 1RPAA 5EZYF 4MULA 2CVQA 2W6OA 4IFTA 4NBRA 3EN0A 4MAAA 3RSZA 3UB4A 2PQ0A 1D1SA 2I65A 4RJJA 4UCXA 5FT9A 3GWGA 2DH6A 3OQNA 5CA0B 2PZBA 2CHFA 1FX0A 3U3DA 5BRJA 2QAIA 1LPNA 1NJSA 2QDKA 3OP4A 5FBKA 3EVGA 2XNDA 1UINA 3BFKA 4K87A 5IJ0A 1FS5A 5DOVA 5HCNA 3CLVA 4D0GA 4EG4A 2BBWA 3ENVA 4YRIA 3FCUB 1ACLA 3ZY3A 2FSVA 4LFAB 4BN0A 3ROEA 3GNTA 3H65A 3HJNA 1WABA 4HXEB 5ECGC 4X0EA 4RF4A 2ZZNA 4URXR 4YRLA 1B6GA 1ZOPA 2Z5LA 4B80A 4FI3C 4GPZA 2KSQA 3AYXB 4ADSG 2GM4A 5AESA 4TV8F 5K2OA 3TNYA 4B3GA 1KTIA 3B1JA 1DWUA 1E2DA 3TF5A 3SQXA 1M83A 4UPVA 1CB7A 2J3IA 5DHFA 5K7SA 3U7GA 4Q6BA 5TJ9A 1T5SA 2AF3C 1YJQA 3U4DA 4MVJM 1KAQA 1XRLA 3QNMA 4UNNA 4AQ7A 5CFQA 4RY2A 4LBZA 3UG6A 3C1AA 1DC3A 1MB2A 1PR1A 1VKZA 3BGIA 1DT3A 3AWIA 1K7FB 2AUTA 2HA2A 3LPMA 3RS5A 3TVDA 3K73O 4UE6A 3IESA 1S7GA 1NHGA 1OFHA 4BLSA 5B6PA 4AMVA 4IS2A 4BV2A 3UGJA 3RC7A 4RMJA 1K4YA 2JHGA 3AETB 2CDBA 4DSOA 3GH3A 1GNQA 3HCBA 3A6EA 4EHAA 1T2UA 2HQBA 4QGGA 3T1QA 1NOKA 2GLUA 2J6CA 4BPRA 5A4IS 2VXYA 1H4TA 5JS1A 1GPJA 3L3BA 4YN3A 3R41A 1Y9JA 1P81A 4W99A 2FZKA 3DOOA 4EEXA 2ZSEA 1Q0ZA 1J0DA 4TS3A 5AKGA 2FFAA 3AU8A 3D2BA 2NV0A 4WY8A 2E4WA 1SVUA 4X97A 4NC9A 3O8OB 4I9GA 3D6UA 1VSUA 2JGMA 1RBZA 5ER9A 1UKCA 5HRCA 2Q4RA 5AQEA 2WSBA 3VRHA 4BTEA 2IPNA 1RE0A 1XQVA 4ZOBA 5I3ZA 3I62A 1A69A 3ZS9A 3QE3A 5F7OA 4MHSA 1XHFA 4HSEA 2AFHE 4YTEA 2B36A 2WT4A 3D2LA 4MGIR 3NCHA 4N3CA 4V39A 4ENSA 4CXMA 3NEPX 1Q19A 5BUSA 2O19A 3USZA 4PONA 5C9ZA 1F1BA 5K3SA 2BSQA 3K5IA 4KO2S 1Q95A 3AY6A 3RC9A 1YTLA 2Q2VA 1EE9A 2ETVA 4YEDA 3OESA 3NI2A 3BJIC 4TXJA 1T5TA 1VYHA 3W8NA 3WQBA 4R2XA 3GGSA 4XUDA 5AJHA 3CSSA 4E2XA 4F1JA 4MS3B 3IL2A 4V24A 2QM7A 5BR4A 2WQ6A 5A1TA 4H3SA 3AINA 1MNQA 2WYOA 1Q0RA 4R1OA 3UWDA 1D1PA 3TB6A 3IIJA 5HIMA 5K09A 1P0IA 1OB5A 2PJRA 4ZOQI 1E2PA 3OKFA 3BFPA 5CYPA 3W2IA 3DBIA 3QA9A 1VJGA 1RLOA 5AH0A 4IXTA 1J23A 1TVMA 4M1MA 1BJRE 4OK5A 1A8UA 1C4WA 2W5UA 1R74A 3MINA 2WMDA 3N2YA 4HB3A 1QH9A 4MIKA 3NCTA 1AIPA 3GEBA 5FUQA 1DQYA 3FMGA 5EJEA 1Y81A 5CJPA 5E4JA 3O26A 4ZU3A 1JECA 4EG3A 3R8FA 5HUHA 3N3BC 1Q50A 3JWJA 1O5TA 5DYGA 1QFSA 1PK8A 4RD2A 2YY5A 4JEIA 4ZVPA 4LI3X 4YO7A 3EZ9A 2BGRA 1H9AA 5CMLA 1YRQA 2FLWA 1RXYA 5JNSA 2Q9CA 2YDXA 1XZDA 2RK6A 1VFPA 1KJ8A 1Z7YA 2P41A 2PHZA 3ILHA 2ZTHA 1X15A 2XY4A 4K9OA 3U3MA 1ADFA 2RGBA 2WHEA 3GRCA 4RVOA 1MXFA 1R0KA 4NCNA 3IV9A 2IF0A 721PA 1BMQA 4QT0A 4TSFD 4RYDA 2UZAA 2HC9A 4HQLA 3GBPA 1MABA 4KDEA 4KG7A 4KXNA 4DN6A 4A0HA 1OYWA 5T57A 1YR2A 4ZMBA 7ADHA 1F0NA 1USWA 5FWNA 2VJDA 2Y1XA 5CA1B 1F5SA 4AURA 3LBFA 2AXEA 2ZUCA 4KXMA 3RYHA 4JDUA 3HA2A 1ISIA 1FDRA 4OL0A 4MR9B 1M0WA 1HRKA 4O1MA 1B8PA 1Q2UA 5BWCA 3NATA 1RABA 4Y1FA 5E3HA 4Q4HB 2PH5A 3ABRB 4TXMA 3K35A 2QUBA 1CW2B 1FYDA 1A2OA 3V3KA 2C8KA 4IX1A 5HS4A 1OH7A 4OF4A 3L82B 1ND5A 2R7NA 1XI2A 4F4IA 3GLVA 1SVOA 1T36B 1YC2A 1FQJA 2WD8A 4U4AA 2HBRA 1U6IA 4ZQBA 4ZVLA 1PTJC 2JK1A 3WX0A 3HE3A 1XN4A 1YVUA 5K20A 2IU0A 5C1PA 2WB2A 2ZJ5A 1NNLA 2GI4A 1V3VA 2A14A 2GFHA 1Z0UA 4JCCA 1B41A 4M98A 1E0KA 2VHEA 3RU3A 5HZKA 1L7OA 2GKGA 5F33A 2H54A 5GOZA 3OF2A 1LWOA 5DX1A 3HP4A 4KN6A 3SDZA 2CVHA 1YZKA 2R84A 2JBAB 4P3XA 3L41A 5F4ZA 4EI9A 3DKVA 3IQIX 2CHUA 4BBJA 3EXIB 3H5VA 4BFUA 1P5FA 4B1FA 4ZT3A 2XW6A 2B61A 2YN0A 2JH8A 3DB1A 3KP1A 4IJ6A 4KNYA 2PNFA 2NUPB 3KQQA 5JZBA 4C2AA 3FCCA 1DBSA 1WB5A 2JBAA 2OQVA 5FX2A 3WJAA 4BO8A 1J8DA 2ZKIA 3CVJA 2YJ5A 3FUCA 3NBUA 5LC1A 1CXZA 4R71A 3PEUA 4KREA 4L0DA 4NOMA 4BNXA 3I28A 2JGNA 2WM8A 1ABFA 1D2AA 2CD7A 4UEJA 3F90A 2V6GA 1E4EA 1K08A 5BRAA 4YP1A 4RK1A 3W5SA 4IMRA 1UJ4A 2DOKA 3D1LA 3F9CA 2PMDA 3Q1LA 2F8TA 4MVJF 1Z0AA 5HKKD 4KE8A 2ACEA 3NJ4A 1DTWA 2JFWA 4YV7A 1PL0A 2FWMX 1S2GA 1X74A 3OQBA 4GDMA 3Q8XB 1XL0A 4GOLD 2O8CB 2XZPA 1XTVA 3U62A 4M9XA 3G8AA 1LDNA 3JYOA 3ONFA 3OPYA 1BOFA 3JQAA 2SKCA 4RS3A 1XTQA 1IXKA 1MB0A 3Q8WA 2PUAA 3WMWA 1BGWA 2QY9A 4YRBA 2QUIA 4YT2A 1NJ2A 5JDIA 3IAEA 2LV8A 4DIKA 2VPZA 3D6AA 2PH3A 1W36D 1BW9A 3ZE2B 1MGOA 3GG2A 3ZVLA 2QN1A 5CLJA 2XYVA 5B6IA 3DGEC 3WA7A 2MOKA 1CEXA 1OHHD 1W93A 1IVYA 4PBRA 2ZROA 3M4YA 2OC4A 4KXLA 3DBRB 4KI0A 3SVLA 4FYVA 5I51A 4GWKA 3OD5A 3O3NB 4AY2A 3DM9B 1OFIA 1YQGA 2VJPA 2YIMA 4Y9TA 1D2CA 4UMDA 4KIGA 3E58A 3W4KA 1RKVA 3DD1A 5DN9A 3ONDA 1JEYB 4KR2A 3QKRB 5B4VA 4UOEA 3WLQA 3N2KB 3DB2A 3G8CA 5B1EA 5IVPA 2W2LD 2VYFA 2Z2XA 2Z2YA 4AG5A 4JLBA 4NNJA 1M6VA 1G5TA 3L8HA 3AHCA 1KRWA 1B1AA 1Y3CE 3IT1A 4Q03A 3VDQA 3WJ7A 1J1UA 4K2AA 4XTCS 3K9NA 2QN3A 4RSMA 1P6QA 4UAJA 3CO0S 2DQKA 3RFFA 3T3PB 5K01A 3MJRA 2X0FA 3MTIA 4XB2A 2Y66A 13PKA 2LCIA 4G0UA 4URHA 2WKPA 2PVPA 2W2VA 1NF9A 2I1LA 2JATA 3Q12A 1KO1A 1I1OA 2W6MA 3FB4A 4JUAA 4Q6WA 4EEZA 1TEHA 2Y27A 3PEYA 4IOMA 3BXPA 1QIKA 2QN9A 5JSZA 1ZY2A 4COOA 4ARZB 5L3SB 2BJWA 5TF4A 4IM7A 4DUGA 1R6TA 1MO3A 4ND3A 121PA 2X13A 3AF3A 1VDMA 1WD7A 4WTOA 4XWKA 4BMXA 2OZLA 2XR1A 2YY7A 5E2BA 2WVJA 3VZQA 2XMGA 1DNPA 4CM3A 2JJ1A 2XUKA 4G26A 1XQYA 1U3WA 2XMCA 3BGSA 1EVQA 4MLPA 1U7DA 3GXOA 2ZAGA 3VKHA 5H9WA 2ZJYA 1AHHA 1NC1A 3CW9A 4MWGA 4MW9A 4QFCA 2XEXA 3HEAA 3I01M 3LRPA 4BDSA 4G65A 4KXWA 2ZIFA 4JYZA 3JRXA 3AQ4A 2EBUA 1P0QA 4ISBA 4C4RA 3LVRE 1D6JA 3WDKA 1R8QA 4D4IA 3T7KA 4F4CA 1X7YB 4ZCLA 2C98A 2Y77A 1WAMA 2X6RA 3I2YX 5BT9A 2HHJA 4J4HA 4TTQA 1RXEA 3QLUC 2WE8A 3QUTA 2OENG 4OI2A 2Y1LA 4PSCA 4RABA 1YZLA 2HL6A 2LP4Y 3BMOB 3KQSA 5CLIA 5JJCA 1T6ZA 2FPWA 2Q1WA 5LL6P 3NHLA 2GBPA 3B1VA 2ODBA 1Z6ZA 4DJAA 5FH9A 2CNBA 1JSCA 2C2MA 1A7AA 2QRVA 4JLVA 1ZSNA 1Y4UA 3X1MA 5FBVB 3R3XA 1N0HA 2BKXA 4FFDA 4PGHA 4UHKA 3PR2B 2B21A 4EZIA 1NW3A 1QKKA 1CUCA 2DFLA 5TE9A 2BDUA 4AZ0B 2WHPB 3JQ8B 4G5RA 4RZUA 4UASA 4KITB 3IPXA 5D3MA 3EQ8A 1MMFB 4F8JA 3PEWA 2YWFA 3WK9A 3DZBA 3SKYA 1HC7A 3R3UA 3PX2A 5J5CA 3RFVA 4CM9D 2FRXA 2HCBA 3ED5A 4OMDA 1QIEA 5EZYB 1Q7TA 3DQZA 1MQAA 2Q5CA 1W29A 3WOVA 1CHNA 1U94A 1V41E 1XRMA 3HGTA 2UXCB 3KYCB 1PZXA 2HFKA 3QLVC 1Q1BA 1G60A 4TQ9A 2RC6A 3TIGA 3VU9A 2KYRA 3IDAA 1B6SA 5EFZA 1XJQA 4ZZIA 3HVJA 2BEUA 4LVOA 4DF3A 3R5TA 5LDGA 4YXFA 1PJSA 4I46A 1U0OC 1NVUQ 1W59A 1X1QA 3K6KA 3WV4A 1UBSB 2ZYTX 1BDIA 1XEWX 4C0HA 1VG1A 4BX9A 3M5DA 2XOEA 5JLJA 2H5EA 5F9MA 2IXGA 1JAHA 1U2EA 4JP2A 5TY0A 3GLHA 2BFCB 3I05A 3DKKA 4PX3A 2NSDA 3FI0A 2DTEA 1GPH1 4Z9FA 3JW8A 1W8IA 2PRYA 2YZ7A 3D3QA 3EUFA 1U2TA 4KQ2A 3USES 2J9GA 2GYUA 3BWYA 3VR2A 1HDGO 1VI5A 3QKSA 1NW7A 2R86A 1HTWA 4UW9A 1OXXK 3T9FA 2WNHA 5E9JA 1I9GA 1N6IA 3DUWA 3B1YA 5KIAA 4WXMA 2KQUA 1TJ3A 3PRKE 4FSHA 4Q7QA 5H3HA 4DIDA 1G6HA 2GAJA 5CB8A 5HSGA 2NP7A 4ZQIA 1VXOA 3II6X 3KKZA 5EYPB 3U4AA 1Z2CA 2MMCA 4NG4A 3WI7A 1UZAA 3BEOA 4EHIA 4F46A 1V8PA 5HIKA 3IBGA 1J0CA 5DI3B 3AJ9A 1EGAA 1Y8RB 1YA4A 1TCUA 4FMCF 3MAAC 1J7JA 2XXBA 4Y3UA 3Q3IA 3U0VA 3ZWAA 4TS9A 1XRNA 1CUXA 2NU6B 3BCRA 4RDCA 1JHQA 4X1KA 4F7WA 4OI0A 1ADBA 1MUUA 2YWJA 2EDCA 1QP4A 2OCAA 2DFDA 2QT1A 4PHFA 4AZ3A 4J94A 2I80A 3K96A 4EI8A 1RZVA 1E79D 1A1SA 2F90A 3EDRA 4YUVA 4XWWA 1JZSA 2R6DA 1ZONA 2P6MA 3LT1A 2CXQA 4KGXA 4FVTA 3GXBA 5ADWA 1DRJA 5CFOA 1C4OA 4LY0A 1N7HA 1EWRA 3OEED 3OM0A 1KKMA 4Q15A 4JITA 3EEOA 5FI0B 3GRAA 4PZ9A 5JAHA 4DWJA 1XCPA 3HL0A 2JJMA 3KKQA 2JLZA 3U16A 1HURA 1I6WA 1OWLA 3CPJB 4A2QA 3PL5A 4N49A 3W4JA 1CJUC 1Y9EA 1UT6A 3NGLA 1TUBA 3FIJA 5IXJA 2XSZA 1G6KA 1GPNA 1KQ3A 2NO6A 4G09A 1KP9A 3ADKA 5IYZB 2H1OA 4W5QA 4UVEA 1NN1A 2FR8C 2JIZA 1RE1A 1M2NA 1WP9A 2CVOA 5SZIA 4GI3A 5AW5A 1BC5A 2ZUEA 2DWOA 2PZMA 3MWFA 2OBFA 2WM2A 4KNWA 2C2BA 4M1WA 3U9TA 2V74B 3DE2X 3NKFA 3SI7A 2V7WA 4NWIA 2QTCA 3L0YA 3ZZTA 3AV0B 2PYIA 2C42A 3TEMA 5EY5B 5BWOA 1MJGA 2YR0A 3RW9A 1XQWA 4ODIA 1OWNA 3I9KA 4RHFA 1DV2A 3WFZA 3DEHA 1CIJA 2FPMA 3L6UA 2GXUA 2IYXA 2CDCA 4H7IA 1CR4A 2C3PA 3FBGA 3FFBA 3IKLA 4ZO6A 4JI5B 4J07A 3HKCA 1VHQA 1N8SA 2XGSA 1N7IA 3ORSA 4HDRB 4O5AA 1N0VC 4P82A 4U0JA 5J5VA 1B15A 2IIPA 1NBME 3ZQ6A 3MJHA 3B3QA 5KYTA 2WTAA 3TTSA 5KKNB 1BD4A 4HUQA 2IHKA 4QOIA 4UXHA 4PF1A 3T52A 4X3CA 3ZW9A 5D1HA 3FCOA 1J8FA 3WMFA 3RS2A 3SNHA 3QITA 2J6BA 4YY3B 1JYEA 5EQTA 3CLSD 4ITUA 4FFNA 5BMVB 2N47A 2VXBA 1H1LA 3AF4A 4NQZA 2NUTA 3SOZA 3G9ZA 4OBBA 1ULTA 3T1HB 4NPCA 2ALJA 4R9RA 5E38A 1WR8A 2X2FA 5DNCA 4UEOA 1IPFA 3OZDA 4RFSB 3U3OA 4F85A 4F6CA 1DFHA 1MA0A 1WF6A 3D2AA 4KQIA 3HCNA 2OZKA 1AB5A 1CEQA 2NADA 3V8PA 1Z07A 1TU4A 5K6TA 3P4XA 3EVBA 4RQAA 4NR0A 1DTWB 3ZXXA 4E5UA 3RVMA 4B6QA 1AS2A 1SKQA 3U7QB 4H3VA 3CKMA 1U0RA 2J5QA 4ZP1A 2GF9A 4QVIA 2ZT6A 1IMOA 3ZX4A 3LPNA 3DBLA 5DBOA 5KTRA 4HDCA 2WDZA 3EXFB 1PT7A 2BWJA 2F3PA 4YLEA 2EKBA 1Z3CA 3V4SA 4EGCB 2XEDA 1VSQA 2AEMA 1XXHB 5DM1A 3UKJA 4LK2A 4JLAA 3U49A 4ZOLB 1S0UA 2YJ4A 1H3NA 2FUG6 3TW8A 3WL7A 4D6XA 5EKSA 1N2EA 5KJ1A 5KNBH 2EAUA 5EERA 5PNTA 3ZY4A 4B3HA 4BLPA 4X9XA 3AG5A 4BBPA 4I9HA 1NV8A 3UH0A 1RYZA 5DPMA 4HNHA 4BOYA 2OD2A 3Q7IA 1OZFA 3PC7A 4JC4A 2DX7A 2HMAA 2I0FA 1IQUA 1QTNA 1OZHA 1W96A 2B25A 2O5VA 2ILTA 3FN4A 1PR3A 3HR7A 2GTIA 3C8DA 3EDMA 3LQFA 3I8OA 5DLDA 4LY9A 4YMSA 1QIIA 3TMYA 4CN9A 2JLCA 1XRQA 4FGWA 4IQFA 3SX2A 4LFBB 3PJFA 3GJ8A 2QSZA 4GG1A 1Z4MA 4CL2A 1CQPA 2AG1A 2J87A 4QOSA 2NVWA 5IT5A 2R8YA 4DR5B 2ZSDA 4PLTA 2VWGA 2E6UX 2IPLA 4FBLA 3RIEA 4UNIA 2EG5A 1P9NA 1P5RA 2JI4A 2NO5A 4GH5A 3OA0A 2WWIA 5BSFA 3N2IA 4FE4A 3K9BA 4DDTA 5IC6A 2C2WA 2W7TA 1OOEA 1OX4B 5KYVA 2C4TA 1R10A 4OA5A 5H16A 4Z2AA 3CLRD 4DR1B 3E05A 2IOQA 4JKOA 2E5WA 4PLZA 2RI0A 4Z9BA 2JD2A 3Q8LA 1Y6GA 3M7IA 2ICAA 4DOMA 1G8JA 2Q6KA 3P9ZA 4ZV4A 3LUCA 3C45A 1QCYA 5BSRA 2ZYUX 3NBFA 1M74A 4ZV7A 1IUPA 2QGNA 3G2JA 2QPTA 2ZCUA 4DXHA 5L40A 4LYAA 3GT0A 3L0DA 1SXJB 1TKBA 3KYBA 4I1SA 2AC2A 3ZWDA 3EPPA 4DY4A 1KR5A 1HX7A 3BYZA 4QBHA 3HHEA 4MO2A 4I5DA 2OKGA 4K9DA 4HLDA 5E9AA 4XYLA 1NRWA 3Q72A 1LKZA 5K3DA 4LTMA 1KAMA 1YHYA 2VT3A 4DDMA 4FB5A 3GFSA 3GBSA 4M8SA 3V32A 5L4LA 1KK1A 1VMDA 3F1KA 1EP9A 1KPIA 3OURA 3E2PA 5JFOA 3LXUX 1W5BA 1SC6A 2Z4TA 3RR2A 1GSIA 4WKBA 1RM3A 5FORA 4W5JA 3O3CA 4AMZA 3M6LA 5EJFA 4BO2A 5BQ3A 1Z33A 2MSEB 3LJKA 2BFNA 1TDJA 4RK5A 4MARA 5CHYA 1FUUA 5A7GA 5J1SB 4HAUA 2YOFA 5FYQA