1E4VA

Mutant g10v of adenylate kinase from e. coli, modified in the gly-loop
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two mutants of adenylate kinase from Escherichia coli that modify the Gly-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(phosphotransferase)
molecule keywords Adenylate kinase
total genus 74
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e4vA00
2Z43A 1OH8A 1A5TA 5DIFA 1CP2A 4NTZA 2PZGA 1TX4B 4HAWA 1KKLA 1R8SA 2GBLC 4KHZA 4LSGA 4QHSA 4AKEA 1OV4A 3CH4B 1JXOA 2OUKA 1GITA 2GZHA 2RAPA 5TMPA 2CCKA 4AYWA 4KVAA 4MRPA 5DI3B 3CX7A 4TMZA 3FHTA 3UMRA 4TMKA 4TYWA 1N5IA 3CIOA 2OAQ1 1T6NA 1D2NA 4TT3A 2WJYA 3AVOA 4GSYA 4TTRA 1CR4A 1QHYA 1IAQA 1W49A 3PUZA 4KSBA 1NBME 2BWJA 2ZS7A 2YJTD 1RW4A 2XAUA 2VA8A 1II0A 1P73A 5HE9A 4AURA 3E70C 4D4KA 1FP6A 2A5DA 1P9NA 1AK2A 3GMTA 4NDZA 3SC3A 4WZ6A 1SVWA 2P2LA 1YKSA 4LJ8A 2X19A 4OQFA 3L43A 1II8B 2VHCA 4YDHB 1ANKA 2JDIA 1FX0A 3TSOA 5LD2B 1NN0A 1GG2A 2WZQA 3DVLA 4IOLA 4B73A 4WA7A 3UG6A 2AKAB 4BECA 3TSWA 1AKEA 1AS2A 1GL6A 1M7HA 2WKPA 3VR1A 3SE0A 2ZI6A 3KKMA 4U7DA 4MH0R 4P33A 1QHIA 1U8YA 1W47A 1S9HA 2CCJA 3SHWA 4PXAA 4EFLA 3M0EA 1F2TB 4HLQB 1CKEA 2ZR7A 3B2EA 4M21A 4C0QC 3OEHA 1Z6AA 4IEIA 2OFXA 4Z8XA 1AGPA 5EQTA 4LJ5A 2QP4A 3G82C 1J8YF 2XTNA 4IDOA 1Z08A 1E9CA 1T8TA 2CK3D 2ZE5A 4KSCA 3K0CC 1DPFA 4V0LA 1S3SA 4ESVA 5A0FA 3K0EA 3QENA 1SKYE 2C5LA 5C4GB 4LHZA 5HR5A 5JHHB 1UBCA 4BFWA 2IK8A 2ZJOA 4RFSB 5J4LA 3NBYC 2XB4A 4Q18A 4EKDA 5J4VA 3T1TA 3VR2A 2YWFA 2QE7D 4FCWA 1N6LA 4BFZA 1UEIA 1GL9B 3UMFA 4DSTA 3OEHD 4DCSA 4S35A 2ANBA 4G5OA 1PLJA 3VR3A 3W3AA 1LB1B 1SKYB 1G3RA 1M7BA 3B82A 2R6AA 4NH0A 1CR2A 3B1VA 3PXGA 1E9AA 1ZCAA 1ZUNB 3CRQA 4TL6A 3U2QA 4B33A 4Q1CA 4Z8YA 3RRYA 4Q4HB 1IBRA 1FNNA 2QAGB 1DO2A 4NBSA 1OW3B 3EPLA 5CITA 3KQHA 5E4FA 2WJIA 2ZR9A 4IVRA 1M7GA 3TR0A 2JDID 5EJEA 3EW9A 2YVUA 5E7IA 2ZRGA 1KY3A 3GJ3A 3L82B 3FE2A 4MA4A 4Q5IA 2UZIR 4W9MC 1ESNA 1M8PA 4LYHA 4JVMA 1E2NA 5GJWC 2ZRPA 1Q1ZA 4C30A 4LHWA 5KNCA 4IOMA 5LPNA 1LVGA 2WIAA 2XITA 4DEXA 5JFGA 3QPVA 3U4QB 2GXAA 1ESMA 4QKQA 1S3GA 2ZREA 1ZC4A 3EPJA 4M1SA 3VNVA 4N0DA 3IIJA 2GEDA 2IX3A 4B3FX 3GLFE 3VHXA 5KSOA 6Q21A 2AK3A 2GK6A 1E9DA 4GP7A 3QG1A 1WF3A 3O8BA 1Q3HA 1DAEA 5J4YA 4LBZA 1E2LA 2ZQ5A 2F6RA 1JBKA 5L3RA 4DWJA 1E2GA 2GEVA 3X1YA 3RRZA 3ZJYA 621PA 4B44A 1F48A 3WNBA 3RRNA 2XZOA 1VIAA 1XTRA 4IVQA 1OFUX 5G3ZA 2AHOA 4OKSA 3H2YA 3O8DA 1Z28A 1KI1A 1W0JA 3H84A 1S0UA 3SN6A 4A9AA 4URUR 2WBLC 4LUCA 1GILA 2MSDB 4QL3A 4GFDA 4MKFA 5CB6A 1CLUA 1T4GA 4GMXA 1JEEA 3WMGA 3AF4A 2QRZA 1OLOA 2ZRNA 3KFXA 1IONA 1KHTA 1IY0A 2PZEA 1FW6A 5F9HA 3SS8A 1N6PA 2FFBA 1YQTA 3LVRE 1MRNA 3PR1A 5KTYA 5CIQA 4G1UC 5JLJA 2ZRKA 1X6VA 5IDVA 5JCPA 1XMSA 3QXHA 4HZIA 3T15A 2J0QA 1KO1A 4BRWA 3OE7D 1QBKC 4AKGA 2VP2A 3R9XA 2FWRA 2G0NA 4TYQA 3GJ0A 2V7QA 2XX3A 3LBNA 2H16A 5FOWA 1Q22A 3NEJA 1SVLA 1DE0A 1G41A 1JQLB 2OAP1 5JS7A 4FD2A 2GAAA 2DY1A 1WXQA 3PV0A 1JR3D 2LKCA 2ZYUX 3RS2A 5BN5A 3THXB 2Y8EA 3QOFA 1G16A 3X1ZA 2IYUA 2EWVA 2OXRA 3JZMA 4B34A 1DAFA 3OFND 3H0KA 4FIDA 3WXMA 2C99A 4KAXA 2QL6A 2O8CA 3THOA 3BE4A 1VCIA 2EFDB 3ZZTA 1TPZA 1Z5ZA 3ZS8A 4F4IA 5IRCD 1NG1A 2VSFA 1ZW6A 4EPWA 1OHHD 3KB2A 2J0UB 1TEVA 1L4UA 3C15C 3FKQA 4US1R 4QBFA 1OXTA 2ORVA 3I73A 2YC2C 3QUSA 1Z2CA 2ZRFA 4KFSA 4CDGA 1W4CA 1WE2A 3IIMA 1KO4A 2FG5A 2WJVA 3KX2A 1NVVQ 3I5YA 4PFSA 3NEYA 2IYXA 5EE9A 4DIDA 2FU5C 3LLUA 3SEAA 5SZJA 3EPHA 4N1AA 3VU9B 4F91B 2N1BA 4JIMA 4NZYA 2JLZA 1GRQA 3AVPA 4RKEA 3CRW1 5KPJA 4RZ3A 5AWFC 2J45A 1YZNA 1KNXA 4E5UA 4HSEA 5AJYA 2ERYA 1NLFA 5CLLA 1W4AA 3L0PA 2MSCB 2CNWD 3BBPA 3LBHA 2GXUA 1US8B 2F1JA 3NBXX 1Z07A 2G0TA 1GL7A 3FMFA 3MWKA 2ZI4A 3A37A 1F6BA 3EC1A 1G5RA 3HYTA 3TLXA 3VX3A 1E2QA 1U0LA 1XBTA 4JYCA 4AIIA 4V0MA 1W2GA 4G0NA 4XSHA 5ANRB 3AM1A 2C9OA 1P72A 1S96A 4ZCLA 2BKEA 4N3NA 1ZU5A 4PAOA 3K0CA 4FMBB 4LV5B 3DZ8A 4BEBA 2AXPA 2V54A 4UXJA 5JBQA 1G3IA 1CJMA 5HCIA 4LCBA 4RZUA 5AJWA 4QNMA 3JVVA 3AH8A 4I99A 1NVWQ 3OIVA 1XNJA 3WP0A 2REOA 2VHQA 3R8FA 4XWKA 1A2BA 4D4JA 1K6MA 1OFTA 1GRNA 4PZYA 1BIFA 4B43A 1N0WA 4XVQA 2AN9A 1UKEA 2JJ1A 5AUPB 2P67A 4HDOB 4R2IA 1E4YA 4Q1BA 1OH7A 1D8TA 2UVQA 3K9GA 4HB3A 5HKKD 5FBQB 1N6OA 4Q1AA 4PC1A 3GEEA 2V9PA 3EZ9A 3I8XA 4H1UA 3CM0A 4MYTA 3LAWA 4XVRA 4DCNA 4JJKA 3WRYC 1EX6A 4D0GA 3NC0C 3OZXA 2WM9B 5J40A 3MWJA 4LYJA 3ZS9A 3OHMA 4P0TA 1KJZA 2EVWX 2BBOA 1VG8A 4I1SA 2XNDD 3AKDA 2VL7A 3NDPA 5H70A 1XTQA 3ZVNA 1II8A 1RYFA 2CLCX 4Q9KA 3KQKA 3KKNA 2JLQA 1CR0A 1P5ZB 3QBTA 4ZIRB 1J7KA 1XD9A 3PUYA 2B6HA 1IHUA 2QM8A 4M0LA 1A2KC 4R9UC 4F4JA 1H8EA 4FMDB 5GJCA 5DSZA 2E87A 5KPDA 1FZQA 1AQYA 1JNYA 5DNYB 4DKXA 4EPYA 4E07A 2ZETA 2QPOA 3E5HA 1VG9B 3IQXA 1WBDA 1QRAA 1AIPA 1CULC 2VIIA 4P4UA 5FOUA 4WZAE 1L2TA 3DM5A 4UNNA 3U3RA 3W9YA 4B3GA 3BERA 3IPXA 4DBLC 2Q3MA 2AD1A 3N5CA 2F1HA 3AP3A 4HB4A 5C18A 2F3TA 2GETA 3K70B 3HP1A 3WRXC 5L8VA 2Q9CA 3KUDA 3OFNA 5KHOC 2GXQA 4EFNA 1MKYA 4V0OA 3A1SA 3BRWD 5KNDA 2IS2A 2QGNA 2Q3FA 1OF1A 4P31A 4NYMR 4E03A 1W4RA 2W58A 5EE1A 4P4SA 1JR3A 2FDCA 4BPBA 3N70A 2A5YB 4FWTA 3Q7PA 1H65A 3KQNA 4LGMA 2CK3A 3DM9B 2DR3A 2BVNA 1DAIA 4X8LA 5KDDA 3GLFB 3K53A 5JSZB 1DELA 2IYTA 1SHZA 4CEHB 4QGGA 2G9NA 3A1VA 3AKEA 1II9A 4PAQA 3RSOA 4BGDA 1XTSA 2J59A 3I92A 4GOKA 5AUQA 4D2IA 1N6HA 1ZM4A 3IEVA 4JLNA 5CDFE 1E9EA 1G5TA 4LBWA 4B75A 2BDTA 1E79A 4C7OA 4A2PA 3LQRA 2RGXA 1KMQA 2DHRA 1XMJA 5FOXA 4WW0A 1MABB 3RSLA 1DOAA 2GESA 3IQWA 2PBRA 1Q3TA 4ZDWA 2XXAA 3RNLA 1T0HB 3WHKA 2OM2A 3PITA 4B6EA 4BLOA 2O8FB 2ECKA 2FOLA 4DDWA 2CL7X 2HUPA 1RKBA 4LBYA 2DYKA 3X1DA 5KUTA 3MGCA 2ZUBA 3K09C 5BN3A 1OXVA 1NMXA 4R2HA 1W36D 4A8JA 3SBEA 1HTWA 3RABA 2KBEA 1A7JA 4AI6A 3L8YA 3L0IB 2ZXUA 4ASUD 3SU8A 2A5GA 1E2HA 2BJWA 2REXB 3HR7A 4M9SA 4EDHA 5EUQB 4H9GA 1R0ZA 2RHMA 1F60A 4UQOA 4PTLA 5AJZA 3UANA 4A0RA 3KJHA 1JPJA 2V55B 2Z4RA 4HLUC 4A2WA 4R98A 4IXMA 2J46A 2YZ2A 5GVSA 2Z6VA 4RCZA 1Q57A 3RS0A 3IPYA 2R6GA 4GPTA 5F98A 4JL8A 3QJYA 2ZANA 3K0AA 4TLBA 4KFTA 3I61A 2QROA 4PX9A 1VG1A 4PANA 1IXSB 4OJQA 3A4MA 3T1OA 1A82A 4PC3A 2B8TA 3U3MA 1UBFA 1R5BA 5HPYB 4TTPA 1W4BA 4M1OA 1N6KA 1D2EA 1HEIA 4CEIA 2JA1A 3AUXA 2WOJA 5BN4A 1AS0A 2KE5A 4P4TA 2GAOA 1KAGA 5JWHA 1Q1EA 4RKFA 1X86B 4QC2A 4PPNA 3BJIC 4B3XA 2P6UA 2Q9BA 4MDFA 5IK2D 3C5CA 3ZQ6A 4KLNA 1G7RA 2X2EA 2HLDA 2VP0A 4D6PA 1FNMA 5K8TA 1EESA 1KK1A 4QG7A 4IOKA 3QKTA 5EXTA 3RLFA 4FINA 1ZIOA 4JVLA 3B5JA 2WJHA 3RYTC 1HURA 2YWEA 5AK0A 1J2JA 2V6JA 2CLDX 2GJAA 2OCBA 5K8LA 5H8WA 2JLRA 3CO5A 5FPTA 3JVUA 3PUXA 2QA5A 4ACBA 5BQ5A 1WB9A 1TTTA 2IXEA 4OK3A 1Z0FA 3TUZC 1TF2A 1N5JA 5C4MA 1AJEA 3IILA 4DLRA 3LFUA 1ZCBA 4IDQA 5B64A 1QVAA 2OFWA 2CEAA 1NSFA 3MJRA 3K1JA 1NN3A 1HUQA 1XWIA 4Q1DA 4J0QA 1E0KA 1JAHA 2VP4A 2QP3A 3EZFA 1N3BA 4GRAA 2IEYA 2BM1A 2QPTA 3VKWA 3QPWA 4BUJA 2Q9AA 2OCPA 2PJRA 2CL0X 4WIAA 1OIVA 3VR5A 1N0VC 2D74A 1O3YA 4JLJA 4G5GA 1VG0B 3I32A 2J0UA 4HATA 4YMWA 2D7DA 2AKYA 2KJQA 1R7RA 2HXSA 2PCJA 3NKVA 4HAXA 1XCMA 2BC9A 1NP6A 3DKVA 1ETUA 1X8KA 1C4OA 2ZRIA 3KQUA 1G3MA 1AGRA 3G0HA 2IA5A 2HXYA 3WBKA 2GZDA 1T3SA 2OV2A 4NHOA 5LBIA 3K70C 4IRUB 3THWB 3GJ5A 2O8BB 1NY6A 3O8RA 4OQNA 5FPYA 2GVZC 4NCNA 2V8OA 3SBDA 1Z8FA 1RRGA 2W83A 4PHGA 1XPUA 5BYKA 3AVYA 2YYZA 3HR8A 4FXPA 4UNRA 2FH5B 3PG5A 5HZKA 1XRJA 4KITB 2KI5A 4B74A 2D2EA 2C2HA 4HAVA 1NVXQ 3M4YA 3L2OB 4FW9A 3DEFA 4LHYA 4FMCB 1T5IA 3KTAB 5BW8A 1SGWA 3NIBA 5CLQA 1US8A 4BLTA 4C0AC 5DN6A 5J4KA 1E2JA 4DLYA 2BBSA 4LJ4A 4AWXA 2HLDD 2TMKA 2GNOA 4Q7LA 4UXHA 4MDEA 4OK6A 3PEUA 1OSNA 2A2ZA 2WIBA 5H1YA 3CZQA 1OXUA 4FCVA 1VYUA 1E1RA 3U44B 2NO1A 2CHVA 2JCSA 3BFVA 2QZ4A 4KI0A 3CLVA 4M2LA 1G18A 4UNPA 1GTVA 4YXWD 5TB5A 3EWAA 3UWKA 3TW8B 1OH5A 1DO0A 3GLIA 4JLVA 5J47A 3ICEA 1I4DD 4LX0A 2YHSA 3PENA 2P3SA 5FFMA 3P27A 1J90A 1OJLA 1PLKA 2QT1A 1W0KD 4LJ6A 1LS1A 2F55A 2HEIA 2JLSA 4OQMA 5HKKA 3KQLA 3TH5A 1U8ZA 4XTRA 2YC4C 1BO6A 2ZI9A 2ZRCA 1VHLA 2VHUA 2JJ1D 5KSZA 1YU9A 2F7SA 1Q20A 5FTLA 3P20A 5BXQC 2QNRA 1KJWA 2ZAMA 5TARA 2ZSBA 2XOKD 1NKTA 2PCLA 4MUBA 4Q4AA 3U6BA 2YWHA 1BH2A 1GWNA 4ASUA 1R0WA 1IXZA 2GZAA 3FHOA 3I1FA 4ZKEA 1XP8A 2WICA 4TLDA 2WSSD 3KXKA 2DFNA 5ELXA 3OIWA 3AGPA 3VMFA 3WMFA 4EJSB 1KGDA 3NBFA 2BMFA 2J0SA 2A9KA 1EFTA 2JAQA 3GJ4A 5L3QB 2WKQA 3GLGB 3TW4A 1FL9A 1LFDB 4L9SA 5FI0B 1I2DA 2WWFA 3GFOA 1P61B 4K46A 3QXJA 1RRFA 3MLEA 1RJ9A 2ZE6A 1X8LA 4KVGA 5G41A 3U6KA 1E79D 1NLYA 3BFXA 3ONWA 3QQ5A 1S1MA 2Z4SA 1SXJB 4UXIA 5CM8B 5JCZA 1U94A 4KCGA 4LC1A 4RFVA 1CJTC 3GJ6A 3QI2A 2QPAA 2CHGA 3R20A 1KNQA 4DLVA 3QEJA 5FBRB 3ZIAD 5JS8A 1RZ3A 2FSIA 1Z0DA 4CEJA 1E2MA 2JEOA 3MSXA 1U90A 1BMFD 4G3XA 2BCGY 4LC0A 4ZI2A 2Q6TA 5JWOA 2DWPA 2JGNA 1MRSA 4OI1A 3WYGA 1OB2A 4DLZA 3ECCA 2QTFA 2W6JA 4Q4JA 1S9DA 5DH9A 1G8FA 3NXSA 1G21E 3WYFA 3AB3A 3TGPA 3ZZUA 5FI1B 3A1UA 4B32A 2W6ID 5KSYA 4A36A 2ZS9A 3IO3A 1YJ5A 1D6JA 1COWD 1Z6TA 3LXRA 3BH6A 1E96A 1OHHA 3CZPA 3CX6A 4V02A 1IN6A 3WNDA 1FFHA 2IYSA 2X2FA 2BCJQ 2JJ2D 5FTMA 1UPTA 5AUOB 3ZD7A 3B6EA 2I3BA 2WVJA 4EQ6A 4AY2A 3U5ZB 1COWA 2GF0A 4NCHA 4ZI3A 3BH7A 3EIQA 2ODWA 3DO6A 4PC7A 3BD9A 1GKUB 3GLFA 2F1IA 5JSZA 2PLRA 2MMGA 5FL7D 1ZNZA 3GJ7A 1DEKA 3LX5A 3EWSA 1CRPA 1ZRHA 4TSFD 1CR1A 5DE3A 1EFHA 4D80A 2AL7A 2WJJA 1MO6A 4PC2A 2W00A 2XZLA 4URYR 1YRAA 4Z54A 4XIGS 2QEQA 4QGFA 1J8MF 1KOFA 2H57A 1XX6A 1Z22A 3VR6A 2JIZA 4HI0E 2VP6A 4TWZA 1MABA 1U9IA 1Y63A 2A78A 3B9QA 4KJZA 4TLAA 2WKRA 2ZU6A 3QPUA 3SFVA 2GILA 4A2QA 4DSNA 4JLOA 4YMTA 3WP1B 4QOSA 1G4AE 3GLGE 2IUTA 3GEIA 4X8OA 2O8EB 4O3MA 5KYKA 2OE2A 4A8JB 4Q1FA 2XTMA 4DUGD 3DOEA 1Z47A 4KBFA 5DYIA 3EXAA 2OO7A 3PCRB 4DCVA 2JATA 5FBLB 1R0YA 5TV2A 1T8UA 1G17A 3QKRB 4NPHA 4NCJA 3AF2A 5FUWA 4AYXA 4BWYA 3REFA 2IEZA 3TUIC 1W46A 4NL4H 3CNOA 4Q48A 2E9SA 3L0OA 1W36C 2C9YA 1C1YA 3P4XA 3U3JA 1KI6B 2VH5R 1ZJ6A 3NHBA 1WDTA 1SVKA 3P26A 4ZCIA 2QQEA 2PEYA 2B7BA 1GKYA 3K0AB 4M53A 1JPNA 3AP2A 2J7PD 3ASYA 1M74A 2GCPA 2ZUDA 4IVPA 1TF7A 1AZTA 3B1ZA 2G88A 3CUEF 3GLHB 5J5CA 3EPKA 2VP5A 5TDHA 4LPKA 5C1BA 1OE0A 3SDZA 2F43B 3FKSD 2FNAA 5EP3A 1RRPA 3W8RA 4MKGA 3TJZA 1KK0A 3FFAA 4B76A 1U8AA 1BYUA 4JSTA 2AXNA 3FFBA 4LWZA 4Q02A 1SXJD 2Z5FA 3TMKA 4L9WA 3RDPA 1PZNA 1JXMA 2VEDA 3CB4A 3CNLA 3PQCA 4PC6A 2NTYC 1QHHA 2F3RA 2CLSA 4KODA 1D2MA 4DUGA 4QHTA 2GCNA 4DSOA 1QZXA 1RYHA 3KJEA 4CZ2A 5KDLA 4JMPA 1UKVY 4RZXA 3K8YA 1RRCA 1XD2A 2LCFA 4G5QA 1VCNA 3CKLA 3H86A 2IW3A 4Q4LA 3RS4A 3R9WA 1IXRC 1GKIA 4OBEA 3VQTA 3D7MA 1QG4A 4US0R 1AZSC 1BYIA 5JEDA 3MG9A 4A1FA 2C77A 4FMCF 5FTJA 4DCUA 1IN8A 2C04A 3EAQA 1UEJA 2QAJA 2WTUA 1AS3A 4OQXA 4PO9A 2XJ4A 4GOJA 2BJVA 2OHFA 4OQLA 4TZ0A 1T3LA 3SYKA 1VCOA 5JRJA 1Z6XA 4QBGB 4UNSA 1XPOA 4C2UA 2C95A 3AV0B 3LWNA 1SQ5A 3HPQA 1O87A 1X8JA 4BLPA 1CBUA 1SXJC 3LVQE 4HZUA 3GFPA 4M1KA 1TU4A 2BMJA 2QM7A 5KU1A 1TEXA 2QTVB 1EFUA 1XEWX 2ZJAA 4DB2A 4DRZA 5DO9A 3B78A 3FOZA 3PUWA 5EZ5A 4BASA 1NN5A 2AK2A 3AEZA 4G5SA 3BB3A 5DI3A 2XZPA 1GSIA 3KFVA 3TR5A 5IF9A 4NYMQ 2FFAA 2J5XA 1OXSC 4QGAA 1NRJB 3VKHA 2GJ8A 1G7TA 1XCGB 4XD7D 3TAUA 2VHJA 5C46F 4QGHA 4MUAA 3V9PA 3THWA 4ERNA 2W6JD 5KO2A 3PEYA 1N6NA 2H17A 1XMVA 4PO8A 1TMKA 1ZD8A 2WWIA 1FOEB 3TAHA 2ORWA 3W8NA 2IWRA 5EP4A 3T5GA 3FGNA 1WCV1 1ZD9A 5LB4A 3HYRA 2JLXA 1JAIA 3V00A 1KSJA 4C0SA 2V7QD 4HLCA 3AF1A 3BORA 5EE0A 4ZKDA 1MO5A 5D3MA 2OXCA 1VPLA 2HT6A 4C0JA 5FUVA 1YZTA 1E0JA 3GJ8A 4WXRA 2J87A 4I1VA 2BOVA 4MKHA 2SHKA 5FOTA 1Q0UA 3J81k 1XTJA 2ONJA 3K0FA 3LY5A 1G4UR 1ONBA 2Z83A 4WAUA 2BKUA 2ZTSA 2IUSA 1CJUC 4V0NA 3U44A 1NF3A 3IUYA 2YWGA 2VSXA 3LX8A 3L8ZA 2HCBA 3PEVA 3ICQB 1N5LA 4TYNA 1IN7A 4US2R 2N46A 2O0KA 1OXXK 4DIEA 3N2EA 4G01B 3NC1C 1G6OA 3GLIB 2QG6A 4NU0A 2WSSA 1D9ZA 4Q1EA 5EP1A 5CM9C 4MGYR 4B3CA 2GEUA 4OHXA 4RD2A 1WQ1R 2C03A 2GCOA 4TT3D 3FMOB 1W0JD 4M1MA 5TVKA 1Z3IX 4ZDIA 1QHGA 4NE2A 1GOTA 3W6OA 1CIPA 2GJSA 3H1TA 1KMHB 4AD8A 3CW2A 1XZQA 4PAMA 4UJ3A 2O8DB 4Q4AB 3UMSA 1B0UA 5CYPA 3I8SA 1RPZA 2XSZA 4TN1A 1A4RA 4DDTA 2ZSFA 1W7AA 5FR1A 1LNZA 1GP2A 2G6BA 5LDDC 5KDOA 3LDAA 4KU4A 3CPHA 4EJSA 4NYJR 3BB1A 1N2CE 3R7WB 1DAKA 5K8UA 3VKGA 2R65A 4QJ5A 3UPUA 1E1RD 4WBSA 5P21A 1T9HA 5CJ2A 5JJLA 4JBXA 4DDUA 3B13B 4ITRC 2PT5A 1YZGA 3T1VA 2G3YA 3AKCA 1DAGA 5DHAA 3K0SA 4MYCA 4OYHA 3GLHE 5L3SA 3DMNA 1XXHA 3UKDA 1LF0A 1EX7A 1U9IC 4Q19A 4C2TA 1GZSA 2NO6A 1V43A 2JLUA 2L0XA 4F4CA 1VYTA 4JLBA 4BFUA 1P7CA 1OFIA 1E2IA 2RKOA 4IEEA 2ZI3A 1GNPA 4MKIA 2JLYA 3TKLA 5JI2E 2AWOA 4HB0A 1Z0IA 4WVFA 2VF7A 3ADKA 3SZRA 1P9WA 3ZYCA 3MD0A 4OI2A 1KO7A 3EIHA 3A4NA 4MRSA 4XJXA 1SXJE 3FVQA 3Q3JB 1MH1A 2QT0A 4W7SA 4B35A 1SULA 2ZRBA 3A6PC 1YHNA 2ODBA 2ZI5A 2EWWA 3VHLB 3NG1A 4A82A 4Y0VA 3FWYA 2OFOA 1P60A 2QMOA 1GIAA 4LYFA 4PO1A 4C3ZA 2I1QA 1FUKA 3QXXA 4AC9A 4PZLA 3TE6A 2OLKA 2IS1A 2PMDA 2GKSA 2MMCA 3LRPA 2RGNC 4LI0A 1TUIA 2X8AA 4HDQB 4LBVA 3NDBB 3TSZA 3D8BA 3TK1A 1NBMA 2PEZA 1OKKA 3E1SA 3LLMA 3Q5DA 1I4TD 5DYGA 1KK3A 2FEMA 2NZJA 3S1AA 1N25A 4PSKA 4R7ZA 3EG5A 3TVTA 1LY1A 1UJ2A 4Q21A 1XU4A 2PX0A 4DSUA 4C0KA 5EXSA 1SVIA 4O2RA 4I81A 4TQ9A 1WMSA 4AKIA 4N0EA 1G8YA 2ZJ8A 4RD3A 5DGXA 5JRZA 3QF7A 4IFBA 4JSYA 5FUXA 1IY1A 1W5SA 3JZAA 3AUYA 1NVUQ 3BFKA 4GL2A 3KXLA 3BH0A 2B7CA 1PV4A 4LV6A 3AVTA 1E9FA 4AYTA 2EFEB 1XFAA 2FZ4A 4C0LA 1J99A 3RWMB 3PJRA 1Q21A 4V0KA 8OHMA 3CR8A 4PPGA 2ZJBA 4Q7JB 1KYIA 4NP6A 2OZEA 2WWWA 4LK2A 1FX0B 5G53C 2CHQA 3NHAA 1JB1A 1MR3F 3U60B 4A92A 1Q1BA 4PHHA 5FOSA 3THYA 1XEXA 3Q7QA 2ZSDA 2R44A 3U7GA 4G5RA 2O8CB 2X1VA 4F7WA 2QI9C 3K70D 4BZQA 3U7FB 1EGAA 4U02A 3R8CA 4A0HA 1P3JA 4QJ4A 4GI7A 2XSZD 3QKSA 3AVVA 1P2UA 2ZEJA 4HEJA 4AG6A 3T61A 2FSFA 5CJPA 1IN5A 1F2TA 2YKGA 1NY5A 2DPXA 1KZ7B 1NSTA 1SHKA 1KJYA 3ND9A 4LJAA 2F43A 3OAAD 4NKRA 4C9BA 2UKDA 2N42A 1P2SA 3ZD6A 4KLZA 1XB2A 1ZD1A 1FMLA 4GOXA 1TU3A 5IT5A 2FJUA 1XD8A 4NYIQ 4CGZA 3IEUA 2KWIA 521PA 4DJTA 2IF2A 2J7PA 1QHSA 3ADBA 3NH6A 3MFYA 5B57C 3QEOA 2RGEA 1ZNWA 4RFSA 2WWXA 3FB4A 2Q21A 1GVNB 1T0JB 3C8UA 1HE8B 2HCJB 2AX4A 5CDFA 5EP2A 3EASA 2VSOA 2WOOA 4P3YA 3W6PA 3T35A 1UAAA 5AJXA 4KXFB 4LZZA 4JL5A 2UZ3A 1E2KA 3HU3A 4OHYA 2OG2A 1HE1C 1XTIA 4W5WA 3CH5A 1HQYE 2JJ8A 4XWAA 3RS7A 4Q4HA 4HDCA 1AN0A 1LS6A 1WA5A 5AJVB 3REGA 4DLTA 5B30A 1YR8A 4AK9A 3GCGA 3ZZ0A 3WNCA 5E3HA 5GJBA 2RGBA 1R5OA 3WBJA 1P9RA 1G3UA 1ZMXA 1OYYA 2P65A 3ETLA 5H68A 4E22A 4M9XA 4JLMA 4HZUB 4KYIB 3PFIA 2FFHA 1AM4D 3Q72A 2ZYTX 3DZDA 1P6XA 2R8RA 3M6AA 4ABYA 2HJVA 3KB1A 1NMYA 1E2DA 1GDDA 4Z1MD 1ZINA 3U4QA 1KSGA 1KI4A 3SFZA 2EYUA 3FMIA 4TSFA 2OBLA 4XD7A 1DG3A 3RHFA 3UK6A 5CB8A 3TRFA 4URXR 2LWIA 5FL7A 1S1CA 2ZIAA 3LW7A 1R6BX 2A3RA 3RC3A 5J4HA 1HH4A 2BMDA 5FR2A 3WMEA 5KNBA 1UM8A 1KI9A 2ONKA 4Q03A 2DWQA 3P4YA 3C16C 4XSGA 3LO5A 2IYQA 4HUTA 2EFGA 3G5UA 2ATVA 3B85A 4LRWA 4W5HA 5AUNB 3RRMA 2OESA 2GF9A 4JLAA 5JWRA 2AFIE 3W90A 1XPRA 1OIWA 2IHYA 3BWDD 4A4DA 2W2XA 5AR1A 3GJXC 3QE0A 3AP1A 3CX8A 5UKDA 5F2EA 1MV5A 5JHGB 1E69A 2O0HA 4D82A 5EUMA 5D3MB 4ZIRA 4EJSC 2REBA 4BE7B 1HA3A 2ZE8A 3TUJC 1EFCA 3GQBA 5TXGA 3VFDA 4ZV4A 1TF5A 3X1WA 4CF7A 3HU1A 4DVGA 821PA 2PLFA 1EFRA 4RD0A 3MJHA 1T91A 2WMOB 2OEPA 3SNHA 3SJCA 3SI7A 2ZI7A 2R62A 4QRHA 2NMVA 2IWHA 5HTKA 2H7VA 1F3OA 3KKQA 3O8CA 3UXMA 3LV8A 4BFXA 1E3MA 1PVOA 1KI7A 4MRRA 5FTNA 1MT0A 1U81A 2WSMA 3SYNA 2IC5A 2DCUA 3V4FA 1KKMA 4MGIR 2GA8A 3V4RA 2B21A 4HLDA 2OBNA 3QF4B 4K81B 4JLKA 3IKJA 1E2EA 4MYHA 2ZJ2A 4PQYA 721PA 2FX3A 3DPUA 1BOFA 4JVSB 3T12A 2O5VA 1XJ0A 3U7HB 3DKPA 3EARA 4Q7KA 2WMNB 1FPMA 1FUUA 1Q44A 4EUNA 4L15A 4GT1A 3LBIA 2IS6A 1AKYA 2CL6X 2HF8A 2ZRDA 3THXA 1G8HA 2IYLD 3IGFA 1S4QA 2RB4A 2GHIA 1KI2A 3FYHA 3QY0A 1SVOA 3RS5A 1TAGA 1UADA 3A1WA 1TQ6A 3MCAA 1E94E 2PJZA 3EZ7A 3K09A 5GJVC 1G8GA 4CEHA 3OAAA 3SR0A 3R7WA 4YONB 2GJ9A 3B60A 4JZKA 5HE8A 3UWOA 2W0MA 1YZKA 4URVR 4O0MA 3UG7A 3GFTA 2AR7A 3EZ2A 1Z0KA 2I1VB 1CU1A 1IJFA 1NJGA 1NLZA 3FPAA 4HUQA 4IDHA 4ARZB 1PUIA 2C8VA 3DOFA 2QU8A 4HB2A 3T5DA 5JEEA 4RCYA 4JLDA 4IHQA 4YXWA 2JLVA 1YE8A 4JBYA 1IQPA 2G1JA 3C5HA 1KTVA 3ZH9B 5JJKA 2QMUA 1YR9A 3CF6R 5FUYA 5FOVA 1E2FA 2P5TB 5KOYA 4JS0A 1U99A 3R9IA 1HT2E 4L8GA 4E09A 1OIXA 4K8OA 2DBYA 2JIZD 3VU9A 1XTKA 5C2JB 1M6NA 2VO1A 1L4YA 4UNQA 1JQJC 2FEOA 5DN6D 2RGAA 3F3YA 3S1AB 2BMEA 3F0TA 2BM0A 1E1QD 1P62B 1IOZA 2IXFA 2V1XA 4ZDKA 2QQ0A 3WY9A 5E7MA 3F5FA 3QVUA 1T5LA 4HYYA 4EPRA 2DB3A 1PJRA 4A6PA 4U00A 1E0AA 3W34A 1LF5A 4HLUA 2H8KA 4CW7A 1N6IA 2JJ2A 3AF3A 4C4PA 4EPXA 4XVUA 2OLJA 2C98A 2FGKA 3SJZA 4PHFA 2AWNA 3TBKA 2D06A 3WYAA 4Q9HA 4CEIB 1SVMA 4WZBE 3DHWC 2ZE7A 1R2QA 4B47A 4OL0A 4NCIA 2P0EA 2RGDA 1Z63A 3U3OA 1DTSA 4FN5A 2HV8A 4TMWA 2VYFA 2IL1A 4QNRA 4QM6A 4JKIA 4GZMA 4NCKA 3PEWA 4KFUA 4L16A 1KDRA 4NYIR 2QTHA 3IBGA 4B2PA 4B6FA 4TL7A 2A7QA 3AVQA 2BEKA 3E2IA 1ZYUA 2BHRA 2JLWA 1W2HA 2ZR0A 3ADCA 4X8HA 2VTKA 1EG7A 2PL3A 2QP9X 1UKZA 2FSGA 2WJGA 2ATXA 2FPKA 2DFLA 2EFCB 3T34A 1FMJA 3OEED 5EZ6B 5FBVB 1NIJA 3ZQJA 4QJ3A 3Q8XB 2BIFA 4IJMA 5HCNA 3AQ4A 3AVUA 1KDTA 2H5EA 3MMPA 3LNCA 4URWR 4M9ZA 2RGNA 2FPMA 4D81A 3TQCA 3B9PA 4D25A 2D62A 2NIPA 3A8TA 4Z51A 2D2FA 3RS3A 3B1YA 4TMXA 2CBZA 3IIKA 3THYB 4X8MA 1XEXB 2ZRAA 2B8WA 4GDFA 4RD6A 2WWHA 2YOFA 4M9QA 2Q3HA 4PR0A 2OBMA 4D26A 1IM2A 3LXXA 3FDIA 5IK2A 3QKSB 1DAHA 4B2LA 4GBMA 1VECA 2OT3B 4D4LA 4ACAA 2XOKA 1JI0A 1R10A 4I4LA 4ON9A 1B23P 2ZS8A 3C7KA 1VTKA 4JVNA 3Q5EA 4M8NE 1E98A 3SJAA 5JJIA 3NBZC 4QBHA 1XJCA 3U7EB 1UBEA 2GK7A 5DISB 4Q01A 4QM7A 2QBYB 2OILA 3U61B 1G291 1D5CA 2E1RA 3CPJB 1KI8A 3P1JA 4RD1A 1OFHA 1J70A 1CEEA 5G3YA 1W0KA 1WP9A 4OHVA 1RE0A 1TADA 3LA6A 4WXPA 1NI3A 2ZJYA 1YR7A 2XEXA 3EIEA 2GVDC 3MWYW 1EXMA 4OI4A 1ZC3A 3D31A 2NGRA 4MGZR 4UKDA 3U3KA 3B7GA 3I4LA 2GWHA 1VYVA 1Z2AA 2FZLA 3KTAA 4DT1B 3HU2A 2XB2A 3EC2A 4P4SB 2FGJA 1ZM7A 3RVBA 1GNRA 1NVVR 1E6CA 1N6RA 5FPSA 1QDEA 3W3ZB 2ZRJA 5F3WB 1XMIA 2VPPA 3VNUA 1FQKA 4YMSA 1KAOA 1UKYA 1DS6A 4EFMA 2NO7A 1YZLA 1WRBA 3KJGA 4DEYA 1CRQA 1H8HD 3KKPA 2VRWA 1ZUHA 4OI0A 1K5DA 2DFTA 1YZQA 4PSAA 3IO5A 4BRUA 4DXAA 1K8RA 2IYRA 3LH5A 4M1YA 4C7OB 3HWSA 1DG1G 4KO8A 2IS4A 2Z0MA 3TNFA 4ILEA 1V5WA 1KY2A 2W2VA 3KL4A 1JR6A 2PZFA 1ZNYA 3ZGXA 3OEEA 1NL3A 1Y3AA 4U5XA 4XH9B 4XTCS 2LKDA 4BLQA 2XXAB 4DCTA 1OKKD 4Q66C 1QVRA 2NPFA 4YQFA 4V0ME 2ZPTX 4NONA 5GVRA 3SHFA 2O8FA 4FWIB 3IHWA 5E7JA 4LHVA 1E4VA 4H1VA 1QHXA 1U2RA 4TLCA 1PLLA 2NG1A 2QE7A 2ZRHA 1Z0JA 3AGQA 2B92A 2J9RA 5DLQC 1G64A 1Z83A 4BZPA 1G6HA 1HYQA 4A6XA 2YV5A 3EZ6A 2CVHA 3I3SR 5LD2C 4TMTA 4YMUA 2YOHA 2RGCA 1G1MA 2BV3A 3LW8A 4FCTA 1G7CA 4QXAA 4BQSA 4CT4B 5FTKA 2OCYC 3C14C 3FTQA 4L5BA 2IUUA 2BEJA 2H1LA 5A5GA 2QRNA 4D0NA 5KSPA 3W6NA 1ELOA 3BXZA 1NKSA 3MAAC 4JKYA 3VX4A 1G8PA 4Q9JA 4DB4A 3GLGA 3X1XA 1M2OB 3NTUA 3ZVLA 4F93B 5A4JA 2QGZA 3M1IA 3MUFA 1EK0A 3D3QA 4M1TA 4OHZA 1Z6GA 3AVWA 2F9LA 1RJ9B 1AQUA 1L8QA 1ZM3A 3P32A 2VLIA 4KFRA 1KSHA 1UBGA 3HJNA 2CDNA 4M4SA 2GRJA 4JLPA 4D4MA 5JECA 5JI3E 3ZDQA 2V6IA 2G83A 1F2UB 2AD5A 1KI3A 1U98A 1YVDA 2HDNB 1H8HA 1E1QA 3CF0A 1E32A 4IKEA 1G9XA 2QY9A 3W5IA 2R2AA 1OH6A 5M04A 2RMKA 1OYWA 1XEWY 3TQFA 4IOJA 1H8ED 5K8IA 1VDZA 2FMXA 1GNQA 2OSBA 2WAYA 2CJWB 1IJEA 2KBFA 3I62A 2ZYVX 3QF4A 5DI9A 3L0SA 1U0JA 2ODNA 2GBLA 4TL9A 3D6TB 3QVVA 3EA5A 1L7VC 3BIFA 1KSFX 1W1WA 2BBTA 3CR7A 3DDCA 4MGKR 4LOAA 4IDPA 1XEFA 1JJVA 5GADl 2WV9A 3GP8A 1X1RA 3NWJA 5FL3A 3SYLA 2FPLA 2C9CA 3CRVA 2IHBA 2ZSAA 4EPTA 1KO5A 2CE2X 2HYDA 2RCNA 2VBCA 4RY2A 3ZLJA 2VF8A 4Q7MB 3CPEA 5CIWA 3GPLA 1TQ4A 4XWOA 1GUAA 1HY3A 1F5NA 1IY2A 2CE7A 2ZYWX 4TQAA 2D7CA 1SKQA 2R6CA 2CCGA 4OHWA 5CK5A 1CJVC 4JL6A 3CRRA 3OF5A 4DDVA 4PQFA 4Y0AA 2ZAOA 3VAAA 2HYIC 1KDOA 3DMDA 2ZJ5A 2IYZA 4LHXA 4TYPA 2R6FA 4HUQB 4OJKA 4YC7A 5EXPA 4ARZA 1N5KA 2NQ2C 3CNNA 4M1WA 1JR3E 1KO8A 1P4SA 3IHLA 1EWQA 1P75A 5TY0A 1EWRA 2QN6A 1M1YE 3LD9A 4BFSA 2WPDD 2FSHA 1UF9A 3GEHA 3ADDA 2QMEA 4MRNA 421PA 2VHTA 2WHXA 2QAGC 4QFMA 4B71A 2GJKA 2O8BA 4C0HA 1PUJA 2QUZA 5JZVA 3UIEA 1ZM2A 2XNSA 3FMPB 4MYUA 4POAA 4Q47A 4F38A 2ZROA 2ANCA 4DHEA 4P32A 4TMVA 4HAUA 2PMKA 3OESA 4TQUS 2ZSEA 4ZDJA 4UJ5A 4C0BA 2W2TA 2D3WA 2GXSA 3A1TA 1Z06A 2A30A 2K5UA 3AKYA 1EFRD 3KJIA 4BFYA 4LYAA 2YOGA 1A1VA 3SQXA 1JECA 3IBYA 1KI6A 1W44A 3X2SA 4LDJA 4YLGA 3K9HA 1E0SA 4DLWA 1RIFA 1WBBA 5B58C 4O2LA 3W5JA 1NN1A 4DLUA 3A4LA 5LB2A 4FMDF 1E2PA 3GLHA 1ZU4A 3QXCA 5BYJA 1DADA 1FQJA 1E9RA 5EE3A 1NNEA 2EQBA 221PA 1CTQA 1HV8A 4BZXA 5D3QA 3O47A 1P2TA 2P6NA 5CK4A 1GFIA 2FE4A 3B1XA 4LV8B 3CONA 3UATA 1DARA 2CVFA 3Q85A 4Q9LA 3WHLA 1NIPA 1VMAA 2FN4A 3BB4A 1YZUA 3QKUA 4GMDA 4RD4A 3I72A 4BLSA 1Q12A 1RVDA 3CWQA 3TVDA 1ZNXA 1XCPA 4Q00A 5CYOA 4GNKA 1GAJA 1SVSA 5DHFA 4TZ6A 4A8JC 3RWOA 1XD2B 1P2VA 2VQSA 4MRVA 5FPKA 2IYVA 1JALA 1FP7A 3EX7C 3ZVMA 2RH5A 2I4IA 1G3QA 4BLRA 1TQDA 1QF9A 2IXGA 4Z1MA 3TIFA 1I2MA 1T3HA 3CWZA 4F92B 1RC8A 4PHTA 1BMFA 3AF0A 4ZPXA 1HT1E 1W48A 1SZPA 3F8TA 4RJLA 4PZZA 4WOPA 3SJBA 4JT4A 1R8QA 2R9VA 2O52A 4LJ9A 2NO0A 2QAGA 4CIDA 1KDPA 2ERXA 2MSEB 5JMTA 2ZITA 4MQBA 2WWGA 3BOSA 2ZRMA 3HPRA 4M22A 1KZGB 5L3QA 2DWOA 2OCAA 4LJYA 1LTQA 4S2EA 1OB5A 3HDTA 3OE7A 4GZLA 5BWMA 4V03A 3QG5A 4KBGA 2XNDA 1OT3A 4YMVA 4LPSA 2V1UA 5SZHB 4EIWA 5FH9A 3SOPA 2PT7A 1NMZA 3RC8A 1SXJA 1G20E 1RFLA 2FF7A 1TL7C 3OIUA 4CYMA 3T06B 2WPDA 4QHYA 5SZIA 4KYUA 3C4JA 3QSYA 3NH9A 5SZKB 3IDQA 1CF4A 3A58B 1CXZA 3FKSA 3RANA 2QBYA 121PA 4HAYA 3Q9LA 2WWYA 4CEJB 2GDJA 5L3VA 1DBSA 2FV8A 3A36A 4AKHA 1R4AA 2QORA 2FA9A 2BBWA 3BGWA 3LQQA 1YRBA 4LJ7A 3H4MA 4RSGA 1R5NA 4Q4JB 4PQRA 4LY6A 2H92A 4NMMA 4ZCMA 3BC1A 3FHCB 4TYYA 4TLEA 2V3CC 1MO3A 4PPQA 4BEJA 1XF9A 2O0JA 2EU8A 5IHPA 4BFVA 1MOZA 1CS4C 1ZAKA 4RVCA 5G40A 2DFKB 3C41J 4DT1A 1C9KA 1AA9A 1XXHE 3OIYA 4MITA 5F9FA 3NVAA 4URZR 4IDNA 1UFQA 1S2MA 2EYQA 3N2IA 1G19A 3KKOA 4HAZA 1TNDA 4I1OA 4EQ6B 3K0FB 4TL8A 4TTQA 4YDSA 2ODEA 2ASEA 2X77A 2ZM5A 1ZVQA 3KUCA 2G77B 4KV9A 2AFHE 2GTPA 3QIAA 1NG9A 2CNWA 1G5PA 4DLSA 1M34E 2QSZA 2XTZA 1Z6YA 1Z29A 1JJ7A 3CBQA 2J1LA 2C78A 2IF0A 5FBWB 1VHTA 3DL0A 5E95A 5HZHA 2NO9A 3CRMA 1X1SA 2HT1A 1D9XA 4XOIA 1QHNA 1XZPA 4IW3B 3PUVA 2ZVPX 4L4UA 4OK5A 2ORIA 4B48A 2W0SA 2GCOB 3QXSA 5B2ZA 2J7KA 2NOAA 1G7SA 2EFHB 2QMHA 2YNMA 1IN4A 1E9SA 2CMKA 2O8EA 2XGJA 2QSYA 3K9LA 2NPIA 1UDWA 1ZIPA 3ASZA 1KMHA 1S8FA 4R71A 3ND8A 4PSVA 3T1QA 3AVXA 2O8DA 4DZZA 1VCMA 3CF2A 5EXXA 4A0GA 4B3DA 1YR6A 2FFQA 2P5SA 3KZ1E 4B2IA 3BK7A 2ZUCA 4O25A 2RHDA 1E99A 3QKRA 2R6DA 3RAPR 2V4ZA 1NBMD 2A5JA 1TQ2A 4DLXA 1BS1A 3MWLA 2W6IA 3B1WA 4A15A 4II7A 1UDXA 3I5XA 1I4LD 1TUEA 3ZVRA 4DC9A 2WAXA 2ZRLA 5EE5B 2G1KA 2H18A 4CRWB 1ZBDA 2IT1A 4I1UA 2J3EA 5FPHA 2Q0HA 1Q1QA 4GP6A 1HQCA 1U0HC 1KK2A 4JT2A 1Z0AA 1MO4A 3VR4A 4IXNA 4B3BA 1W36B 4PPFA 1FTSA 3KDSE 2HJGA 1F2UA 3ZIAA 3SQWA 2PX3A 1R0XA 2IYYA 3K9NA 5L3SB 1XXHB 1NJFA 2KB0A 3QBVA 2ZU0C 1VKJA 3BS4A 1OPXA 2HF9A 1N0UA 2ZVQX 1CJKC 4IFEA 1GRRA 1QHHB 2CJWA 1QG2A 2EW1A 1ZUIA 1K5GA 3GLIE 4EPVA 1ODFA 3PVSA 2IYWA 2KSQA 4W5JA 2ZJZA 3EA0A 4ESHA 2F1RA 2CXXA 3QNUA 2C96A 2PH1A 4CT5A 2J0VA 4QBIA 1ZP6A 2XJ9A 3KXIA 4D0LB 1DAMA 1E9BA 2NZ8A 2IBMA 1VIYA 1LW7A 3VTKA 1FTNA 4BFTA 1XJQA 1LV7A 3PIRA 3GD7A 1BKDR 1XDBA 4JBWA 1X3SA 1JEDA 4NYJQ 4A0FA 2YINC 4CVNA 4RZ2A 2JASA 3BAFA 4Q9IA 2RGGA 4JYBA 4AG5A 3B8HA 2J41A 1KIMA 2F9MA 4EAQA 1DVRA 3MRSA 2P6RA 2A5FA 1GM5A 2QENA 2VP9A 4FI3C 1W5TA 4JJZA 4ZO4A 2D4HA 1ZM9A
chains in the Genus database with same CATH superfamily
4RU1A 3LI2A 4RXTA 4X6XA 1CP2A 4NTZA 1MF7A 1TX4B 2PZGA 1R8SA 4LSGA 3EVGA 3QTBA 4KHZA 4QHSA 5LQDA 2EL7A 1KEZA 1JQDA 1JXOA 1GITA 1MNAA 2GZHA 3D4LA 3SD7A 4H1WA 5J2UA 4WTOA 1QNLA 1N7IA 3KDAA 2OD9A 4GDMA 1YMQA 3QWAA 1YU6A 3LDHA 3ETHA 4X60A 3V4LA 1N5IA 2R1TA 3EVCA 4ID3A 5IKXA 3HGTA 5E6UA 3AJAA 4ZOLB 1H9CA 1D2NA 3ZZ1A 4GSYA 4TTRA 1CR4A 1QHYA 4DDKA 3IQGX 1YIDA 2AEFA 2IOFA 4IHJB 5EMJA 3DZJA 1TYDE 3B6MA 2NUBA 3QWHA 1P73A 1MAHA 3DBHB 3E82A 4AURA 2FMKA 4QOFA 3ZOZA 2CFSA 3OTWA 5F77A 1P9NA 3AINA 1AK2A 3SVZA 4F2DA 3A28A 5AVSA 2BUCA 3ZHTA 1PQUA 1VP3A 2XE7A 4MKXA 1JXQA 2FTKE 5FWXB 3OOYA 4CHTA 2X19A 4MJ3A 4PIMA 4C01A 1H5QA 3KUXA 3GMDA 4QYTA 1T2UA 5LD2B 4JI7B 1GG2A 3DVLA 4IOLA 2H11A 3NASA 1B0ZA 4B73A 2EEPA 2AKAB 2Q5FA 5BNIA 2HWXA 3PWZA 1AKEA 1V3UA 2ZYAA 5HBGA 2D3TA 3UPDA 4A16A 1RYMA 2C4HA 1SHUX 5KYYA 2Q6LA 4D9KA 4OLHA 2E55A 4MH0R 1K4KA 3I34X 3K3PA 1SQSA 4HJXA 2W2QA 3V8NA 4BU0A 5IAOA 4O33A 4IKPA 4PXAA 4EFLA 4JUCA 1F2TB 1TO2E 1B43A 2PFSA 3CXUA 4OFBA 3B2EA 4L4YA 4MB0A 1MP0A 4OGLA 1XK7A 4QULA 4IV0A 4Z8XA 4ZC1A 4CLEA 2BH2A 3NIDB 3MYRA 3G82C 4ENWA 1J8YF 5FNVF 4IDOA 3O26A 2P8JA 4IR7A 4GKKB 1E9CA 1XQ9A 4V0LA 4YAJA 4ESVA 4B3TB 1VOTA 3FUTA 1JKJA 4L02A 5A0FA 3B7PA 1UJCA 3PQ6A 5IYZA 3DEHA 4K05A 4W7IA 5ALMA 5HR5A 2MSLA 4BFWA 5JHHB 1N2OA 4RFSB 3CF4G 2PZBA 1SUFA 3NBYC 4EKDA 1VI5A 1U8UA 2YWFA 5EJ5A 4G4IA 4C7BA 1N6LA 1UEIA 2CLFB 1QZ3A 3CCFA 4B85A 2IVFA 3TO5A 3GCZA 2XVMA 3OEHD 1YS4A 2GAFA 1GLGA 1IDN1 1MMFB 1OA0A 1QH1B 2DY0A 3LUPA 3W3AA 4CKWA 1LB1B 1SKYB 3RKSA 2F4VB 3B82A 4DR3B 1Q5PA 1F2VA 3I9MA 4YAIA 5HKBA 3CA8A 4BB0A 5TF4A 1KAMA 2BHTA 2HO5A 3JVEA 4IJ5A 4FYKA 4INJA 1HKUA 4U2BA 1AO0A 3CF4A 1ZUNB 3CZRA 3BXGA 2DFPA 2FYTA 2P5YA 3VU3A 4CMAA 4DNXA 5EJMA 4ZVOA 4Q1CA 5IVIA 2A9QA 2AN4A 1IBRA 3QZUA 4JX8A 2H6EA 3MPOA 1T34A 2VDOB 8AT1A 3RI3A 5EKXA 3EPLA 4R1PA 3KQHA 1NW6A 3MTAA 4NG4A 4TTTS 4XASA 3GRYA 5A05A 4Y98A 3M3DA 5B7GA 5EJEA 4R5MA 2G06A 1KEEB 4HNGA 5IUNC 1ZVVA 1DJOA 1Z2NX 4JUIA 4LJKA 1EDZA 1LK7A 3E4DA 3QVJA 2O57A 1TYBE 2R87A 3H5RA 3ILHA 2GA9A 4IIHA 3AL3A 2OHJA 3AERB 4XCVA 2HADA 2AZMA 3E7WA 5CDHA 4IOMA 2J3IA 2XITA 4IIGA 5JFGA 2GXAA 1JAXA 2HCTA 1ESMA 5IDXA 3AHFA 3K1AB 1L7DA 1BX3A 4BN4A 4HDMA 5AMXA 1EGVB 1YRHA 3EPJA 4KK4A 4KXQA 4LF4B 1D2CA 5EHNA 3GGCA 4N0DA 2GEDA 1MAAA 4Q6BA 1AY0A 2W2LD 4AXBA 5KSOA 2I8AA 1YA8A 1E9DA 2CL5A 2NP7A 1ULAA 1Z33A 2Z2JA 1RHMA 4FS8A 5J4YA 3H99A 4LBZA 4XEHA 2ZQ5A 1L5FA 2OCDA 3BTVA 3GEDA 3KKLA 3STTA 1JBKA 4Q7QA 5BSGA 2WQ6A 3CTPA 4ZT2A 5K03A 3PDIB 2GN9A 4IGEA 5BV8A 2F64A 3RWBA 1SVUA 1QVZA 3MLBA 1F48A 4GW3A 3D1VA 3D9QX 2Y0BA 1XTRA 2IYEA 1O0BA 4MRAA 2QJWA 3CLKA 3EZYA 2BFAA 4OKSA 4L8WB 3D0QA 1U1FA 1FDRA 3I9V1 6REQB 4CKZA 1VLHA 2BFCA 1KI1A 1C4KA 2ZPUA 1G8MA 5BVHB 2R8PA 2VJPA 2WBLC 4N3AA 5CW2A 5EVJA 1VB5A 4I55B 4LQCA 1AU9A 4GFDA 1CLUA 5F51A 1YHZA 1GQOA 3L04A 5BVGA 5B6PA 4G0PA 3IJRA 3QVKA 4UHJA 1R4ZA 3LOPA 4FYJA 4X7BA 2GPAA 1JEEA 2QVYX 6LDHA 2QRZA 1KZ9A 3H2SA 4TTIA 2FPRA 3M89A 3KLMX 5E0OA 1GZVA 1IY0A 1V7CA 1QE0A 5F9HA 1QV9A 1CVIA 1N6PA 3JQQA 1NBWB 1ESDA 3PR1A 5BSFA 2WHYA 5CIQA 5K5EA 2G8NA 3V46A 1UPXA 3AJEA 1Y9EA 2IHNA 2FSSA 1C9MA 4L22A 2PFKA 5IDVA 1TJYA 1JWLA 1RKXA 3GPDG 4HZIA 1NW8A 1KO1A 2R97A 5JT1A 5JY6A 4XB1A 4JY7A 3AU8A 4D8TA 2G0NA 1SEVA 2B4QA 4NBNA 5LA6A 8ADHA 2Z9CA 2N75A 5HUQA 2V7QA 3SF8A 3LBNA 2HLHA 3GT4A 3ICWA 4XB2A 5EFZA 3NHUA 3DV0B 2OCXA 2BELA 1VKNA 5JQWA 3AF6A 3D4NA 3FDJA 1JQLB 1IHOA 1IZ9A 4CQNA 4FD2A 3VPCA 3OFJA 2DBRA 4FDLA 1N2JA 5I5GA 5F3RA 3TR6A 1BN7A 4RIIA 3JASA 3ZW8A 2WABA 1H6AA 1HL3A 1O95D 2ZYUX 4O8CA 5IKOA 4X1YA 1Y1LA 3T9CA 3DLBA 4F6RB 3U80A 1G16A 2J9FB 4WFJA 4UBKA 4R1NA 1XKXA 2WU0A 1Z18A 2CLOB 4KZKA 1HK7A 4HC4A 4B34A 1DAFA 1QF6A 3WXMA 3H0KA 2C99A 3P71T 4ALKA 5KKNB 1FTWA 5IUKC 2G1AA 1VCIA 2O8CA 1VSQA 1Z12A 2JHPA 3KYCA 1Z5ZA 4H3VA 5IRCD 1RWNA 2B7LA 5EHZA 2V7VA 1MN6A 3PRJA 3QWIA 5BNFA 3CPSA 1OHHD 3IL2A 1I6MA 2ZBFA 3LQ4A 1CY2A 5C3MA 3SIPA 3F5QA 3C15C 1BEUB 1V95A 2ZWMA 4OFWA 4B9EA 4YJHB 3DR5A 4D9GA 2GCGA 4GC5A 3ZHYA 3URMA 1XDSA 2A9FA 3NDIA 1W4CA 1WE2A 3IIMA 1AGYA 2PWYA 4BRSA 2KPOA 2RH8A 1D1PA 1WVGA 3S5UA 2F8SA 1YC5A 2UZ1A 1SB8A 1N2CA 3TLKA 3SEAA 5SZJA 2WSBA 3YASA 1YV9A 3GUHA 4GX5A 2RC6A 3EPHA 3G9UA 3VU9B 2Y76A 5MDHA 3AVPA 3I5MA 1XRLA 2ABWA 3I0MA 3ZBQA 3I2JA 2J45A 4LFAB 3WWYA 3SKYA 1QH9A 4ND7A 4JVOA 4PLVA 3WTCA 1O0CA 1GPBA 1NLFA 1CUGA 2ERYA 2RBGA 5A2QA 1AUQA 3BBPA 3OZCA 3L7CA 4JCOA 2K2WA 2XBMA 1D4OA 2PH7A 3Q11A 1RAAA 2F1JA 4KB5A 2PS1A 5T57A 1UWKA 3BG5A 2ZJFA 2G0TA 5CAEB 5HGXA 2FMFA 2ZI4A 3MWKA 3UYKA 3HYTA 4KQ6A 1E2QA 1U0LA 1NJSA 4FEYA 4NICA 4WE3A 1W2GA 2I3GA 5E7QA 1CUZA 3T7CA 5BY2A 5HRAA 1G8JA 1EHCA 2E4XA 1S96A 1SMKA 2NYRA 4UBNA 2PMWB 2FE1A 4OQEA 4FT4A 1AXRA 4HH1A 4O59O 2LUOA 2V54A 1N0HA 4H0NA 4HGNA 5JS2A 5JBQA 5HCIA 1NWHA 2AFIB 2VCEA 4LCBA 4RZUA 4QNMA 5AJWA 4REOA 1KA9H 1JI3A 2IOQA 3TVYA 1NT2A 2FZWA 1GD1O 1XLTA 3DOCA 2JJYA 4HWPA 2XUOA 1XNJA 4G37A 4WFQA 1CWUA 3WP0A 4PYKA 2H4WA 2J6CA 2V8BA 5GMOA 1ZY2A 4IG9A 1UBNA 3RGGA 4D4JA 3T5CA 4AT1A 1C3JA 3B52X 4JEMA 3EMDA 2JH3A 3SK0A 4IGAA 4OLJA 2JJ1A 3AY3A 3MIZA 3ZK8A 4CKYA 3NAZA 1EXWA 3OQ6A 4WK0B 5DXJA 1MIOB 2O23A 3NKLA 3ON5A 4H18A 4M7OA 5HKKD 2P7IA 5FBQB 5A62A 1UC5B 4PNEA 4DV7B 3MTEA 3I8XA 4LY3A 1YACA 4Z3DA 3ZWBA 3WIVA 4I14A 2ZLBA 4LCJA 5LBUA 5IXSA 2BF4A 4JJKA 3WRYC 4QTTB 4D0GA 2XUHA 3FGPA 2WM9B 3UXYA 4BNYA 5DOVA 3QFSA 1K8XB 1J6UA 3ZS9A 1U8EA 3CX3A 1ZRMA 2WQ7A 2BBOA 3C6XA 2LW7A 5L6MB 2NSJA 3AKDA 3FM9A 3NDPA 1ZJ5A 1XTQA 1Y89A 4L76A 1Z88A 2QX9A 4NPCA 2WD7B 2EL9A 2HIAA 4U7GA 3ZX4A 5AI4A 2VHEA 4B3JA 3HNRA 4WGGA 1NBEA 1NF9A 1XQXA 2GPYA 4EMUA 1UJMA 1CR0A 1P5ZB 4HHEA 3RFFA 1UXHA 4MS3B 1DGQA 2M98A 1SVNA 3T3OA 1KQPA 1D0VA 3OICA 1IULA 1XD9A 2C8LA 3K1YA 3PUYA 2B6HA 3CNHA 4HN2A 4P80A 3WBFA 4BVJA 4I9NA 4JU8A 1QIEA 5DIZA 3DUFB 4F5ZA 5FFFA 5SZIA 2CZCA 5DSZA 1GYPA 1ODSA 4MB2A 4DZTA 1IOVA 1FZQA 4DBLE 5A3SA 2I7TA 1JNYA 1FVFA 2FN7A 4DKXA 5DNYB 1Y3IA 2IH4A 1CG6A 3PHHA 2J8ZA 1Y4SA 3GIWA 2E82A 3NVDA 1VG9B 2AZTA 2GLTA 4RK7A 1PK8A 3T7DA 1TI7A 3VJLA 4MCJA 4B6SA 4EY5A 1QRAA 2GBPA 1CRWG 5KTTA 3ROPA 1PW7A 4BNVA 4WZAE 2MOKA 2CNLA 3U3RA 3C5EA 2VJMA 3BERA 1WKBA 1T1GA 2JFQA 1O9HA 1NDHA 1QDUA 3UCXA 4HB4A 5C18A 5C7LO 1VHQA 2PN1A 2GETA 1XQYA 3HP1A 4MQFB 3WRXC 4J0CA 1K08A 1R1DA 4WKCA 2E4VA 1W5BA 3OFNA 4LXQA 3A70A 2GXQA 4EHKA 2ZXEA 1NQUA 4O4LB 5HOEA 1M0EA 5KNDA 3BRWD 3OKCA 4M37A 2FN3A 4YRQA 1J23A 1Y7PA 4PLHA 1QFYA 2HK9A 4RLQA 4EVIA 1I6KA 5FNVB 3PYMA 3SDBA 4P4SA 5KSWB 3CEMA 3JCZA 5IJWA 2FDCA 2FP4A 2B4RO 5F3DA 2UZ0A 5F2OA 3HDJA 2XKAA 3V42A 2DR3A 3QOYA 3UBTA 1Z5NA 3IQHX 5MGBA 2BVNA 1WZIA 3EG9A 2IE8A 4AZVA 4BNMA 5KDDA 1Y1QA 4YRFA 5JSZB 2IYTA 4CEHB 4QGGA 3ILXA 3H65A 3EGXB 3IOEA 4O1IA 5ALKA 4LA4A 4PZDA 2WM3A 3RSOA 3FWKA 4DNPA 4BO0A 2B69A 2J59A 2QVBA 1EZ4A 5AUQA 4D2IA 5BN1A 4BNIA 1N36B 2IOFK 1T9AA 3PJGA 4FNOA 2Z3VA 4JLNA 4FFDA 1YL7A 2XA2A 3TLEA 3G5LA 2JIOA 2QRLA 4A2PA 3DC2A 1RKUA 3O4IA 4NV0A 1XMJA 1DQSA 1JSCA 3DGEC 3QEMB 5JO9A 1ENYA 2ON6A 2PBRA 4M0UA 4ZDWA 1TC2A 1NT4A 3RNLA 4B6EA 1QQAA 4NCBA 4FIZA 2O8FB 2G0AA 2FOLA 2ZIXA 4BEBA 2CL7X 1RKBA 2AW3A 3DKIA 2DYKA 4LBYA 3EY9A 3PXDA 3WWOA 4RO0A 3OZFA 1XLUA 4LZOA 4NK4A 5TMEA 1OGYA 2UXCB 1DP4A 2KBEA 2OG1A 3RABA 5B55A 1USKA 3ST7A 2ZXUA 3L0IB 4ASUD 4EO9A 2PUAA 4V0QA 2J4CA 3NS7A 2H7CA 2JCXA 1AB5A 4GQAA 4M9SA 4MI1A 4EMTA 1ZDMA 3C2QA 3WJ7A 1QIFA 1S2DA 1T4BA 2DWUA 3L1IA 1F60A 1D07A 2V55B 2W2KB 5EZSA 1WCIA 2Z4RA 1SY7A 3FCUB 1L8AA 1S89A 3DTYA 4PX3A 1X92A 2YZ2A 1NBIA 4TLLB 2GM4A 4RCZA 4UPDA 3IPYA 4UU7A 5H0IA 3M9XA 4OJMX 1XELA 2C5FA 4H2DA 4BNFA 1NTOA 1OC4A 2BR4A 4KFTA 1JDZA 4MLPA 1I4EB 2QROA 3KVYA 4ND5A 1VG1A 3O84A 3PQ2A 4KTVE 1KARA 4L07A 4MXDA 4PSDA 4R8RA 3T1OA 4PC3A 4UVEA 1UBFA 1C1DA 4UM9D 5E3IA 1LDYA 5KTKA 1YZFA 7YASA 4Y6RA 1PQWA 3W9BA 1D2EA 1NYLA 1TIKA 3N0WA 2WJ3A 4LE2A 4PN3A 3TCNA 3IB6A 1AS0A 5JWHA 2GAOA 1KAGA 1E6EA 3KZXA 5E0KB 4RKFA 3NI2A 1X86B 4GGPA 4YRCA 3NHWA 4PPNA 5JXWA 1Y37A 1G2IA 2XHZA 3VMMA 4RDXA 1IEXA 3QLUA 4R68A 2VKTA 5LOVB 4KLNA 1V71A 4QQ8A 3EEQA 3F6PA 3WGGA 3OQNA 4R81A 5K8TA 1WBBA 2O2EA 1EESA 4QG7A 4EZEA 1FYXA 4LN1A 4DV4B 3TRDA 3PYXA 4CNBA 5IVDA 2IBTA 4NBWA 4OPMA 4JVLA 2WJAA 3B5JA 2WJHA 2GQ0A 4EO4A 3L7JA 4YCAA 5LM3A 2YWEA 3G2MA 1A8IA 3O94A 1PI3A 3WLOA 4ZMRA 2VNAA 5A4KA 3L1JA 2BSXA 2JLRA 1BHQ1 1M6HA 3PUXA 2QA5A 4K3UA 1TTTA 1DXQA 4MVCA 3ZHQA 4OK3A 1Z0FA 2ZTLA 3FIJA 5EZYB 4EECA 1JLRA 4KSYA 2IU3A 4DL9A 1GRVA 4JA2A 1AJEA 3LNTA 3P5SA 3HJHA 4IDQA 2OPHA 3IESA 5BURA 1ZI8A 1NSFA 3MJRA 1F4LA 4MPTA 5BOVA 5IABA 2VP4A 3MJ4A 3WGVA 3AUSA 3ZDXB 2QP3A 3KWMA 1WCXA 1M6VB 1NYQA 2FN9A 2FPSA 4KQEA 2W42A 4NMWA 2E4WA 1Z2DA 2WK1A 3GCDA 3K5HA 5FLXA 2VN8A 4D8XA 2A33A 2O3UA 4NJEB 4RZSA 1Z4LA 2Q1YA 5PGMA 1ECCA 1DRWA 1M5UA 1J22A 4X45A 2D74A 1O3YA 1P0FA 2JK1A 4L6IA 3CJRA 4G5GA 4L72A 4GM1A 4HATA 4CDRA 1Y0BA 1KR2A 3PC8A 3WIOA 2R85A 3LHIA 3NKVA 2AI2A 3KNZA 3V4VB 1NP6A 3VUEA 1HE3A 5FUQA 4A6DA 1X8KA 3G0HA 5HGJA 4ARBA 1Y1PA 1PE0A 4GR5A 4HWSA 3SZOA 3NGXA 4NHOA 5HKLA 2CB9A 1EXDA 4XGRA 2QTMA 3THWB 4C2AA 1BWQA 4JI8B 4K8RB 1U3GA 3P9NA 1X87A 5ALGA 2GVZC 1G8KA 1JVBA 4U2EA 4CI9A 1K1EA 2XNCA 2AMFA 2V8OA 5AHKA 4DJJA 3ZHRA 4XGIA 2GFHA 3C3KA 3EEYA 3LQYA 3HR8A 4LZLA 3PG5A 1RPNA 1B8UA 1ZXLA 2D2EA 1GGHA 5I3CA 4MROA 4UCXA 4OO3A 4DFDA 5L4LA 1U1CA 4BN5A 4FW9A 1A04A 2FMHA 5ALRA 3AY6A 2XUPA 3LCUA 3KTAB 3LLSA 5JYBA 5DGCA 1KS9A 3NIBA 1US8A 4BLTA 1PJBA 5TC4A 1E2JA 4CM6A 1NULA 4KR9A 2BBSA 1SIWA 4LJ4A 2NNLD 2VQ3A 3ABOB 2COUA 2HLDD 3V8BA 4AWXA 4PN7A 5HRUA 4Q7LA 3CH7A 3ODGA 3P2OA 3RYCB 4DIMA 3AIKA 4LX8A 2A9PA 5B7PA 1H2EA 1QGYA 1RTTA 1OXUA 4JLUA 1QONA 2I3AA 2QN9A 1ODCA 3PGJA 5JSQA 3U44B 1R6XA 3R5TA 2QZ4A 4M2LA 3CLVA 5I7SA 3B70A 5HFAA 3WMRA 5TB5A 4YXWD 1N7GA 3ZK9A 5ALLA 4DCPA 2GYVA 4DQLA 4HNQA 4FK8A 4M6WA 2NYAA 3GLIA 4MQ6A 2JB9A 1I4DD 1O2DA 3VKUA 5EKTA 1EE2A 5CCBA 1GDTA 1L5WA 2ZB7A 5FWDA 1ADFA 1R0RE 4GX1A 3HCRA 3MCUA 5FFMA 5F4ZA 3OU2A 2QT1A 5I9LA 3FCAA 3PQDA 1Q84A 4W1QA 4QPCA 3SS9X 3H3FA 3KQLA 4TXHA 2VPTA 3U4DA 1X80B 3GP5A 1K8QA 2YC4C 1U5BA 2SKCA 2VWQA 2GAIA 2ORYA 1PJTA 2WAAA 1EUZA 1Q20A 1OA1A 3N2YA 3P20A 3L4EA 4GNRA 2HNBA 3EFBA 2JAOA 1NJ6A 4EG1A 2PCLA 2ESRA 3ZCRA 3MYYA 2R1VB 3IAAA 1K7YA 1QMGA 4FE7A 3OWOA 3KXKA 2DFNA 3E81A 4ER3A 3QEBZ 4P98A 1E18A 2ARKA 4TV9F 1UJBA 4FR5A 2WT9A 4R9RA 2QX4A 3LU1A 1CNEA 2J0SA 2BMFA 4FP9A 5ESRA 4J07A 1EFTA 2JAQA 2NXWA 2LE0A 2ECOA 4CMIA 4K6CA 1BMQA 4ZVNA 2Y1WA 1N4DA 1NP3A 2FW1A 3GFOA 4X20A 2R8XA 3SDSA 1YS6A 3NANA 2ZE6A 1BHJA 2G71A 4OBBA 1A4UA 5G41A 3U6KA 3BFXA 3COVA 3ONWA 3ECSA 1O4VA 3MWFA 1WPQA 4KAJA 1IIRA 2C20A 2X13A 3QHAA 1CEYA 1Y82A 1SHJA 4R8MA 2PUJA 1XWWA 3NOOA 3WYEA 4RFVA 2PGOA 3WIUA 2XMSA 5COBA 3D2AA 3QI2A 1JZQA 5LLDA 2R8BA 1X7WB 2CHGA 3GGGA 1KNQA 5YASA 3FROA 2BONA 1GSOA 4XIJA 5JS8A 3BCUA 2FSIA 2I8LA 2ZVJA 3H11B 2J08A 1E2MA 3OM0A 3K8QA 3KQVA 2JEOA 1QIIA 3ID6C 3N7UA 5FTWA 5DBEX 1OYVA 1XZFA 3PD0A 4KQHA 2Q6TA 3TQTA 5JWOA 1W52X 3HKEA 1IHYA 1V11B 2I67A 4N8DA 4QBKA 1MRSA 4FZRA 3ROXA 5I4IA 4PLTA 4D4HA 1QFZA 2K7FA 4D6YA 3LL4A 5CT4A 3RVDA 3SXPA 3WFJA 2HMAA 1MJGM 3NXSA 1G21E 4NY1A 1ZGJA 3PS9A 4I9GA 4OOEA 3C39A 3ZZUA 1QCYA 3TGPA 3DFFA 2FW7A 3A1UA 3QU5A 4G4JA 3U81A 2YWJA 3WI7A 4L5YA 1COWD 3CGWA 3ESZA 1R3DA 1AHIA 2PMCA 1JDNA 3AWIA 2JJ2D 5FTMA 5DLYA 4WLNA 3LYHA 3BWXA 1MQ9A 1UPTA 5B3JC 3ZD7A 1DBIA 2LDXA 1UAGA 2WVJA 4HMPA 4IO0A 4Y0NA 1JYSA 2GF0A 3A6ZA 1XOIA 2PU7A 2QTWB 3IUJA 4I5GA 3X2EA 3F2IA 5A3JA 1UXJA 2IH5A 4P83A 1MDFA 4CMJA 5HBRA 3GLFA 1UPFA 2F1IA 4RADA 4S1WA 2MMGA 4V24A 2ZT7A 5FL7D 4BWFB 1ZNZA 4DZRA 1A3CA 2I7CA 4GAEA 1CR1A 2SKDA 3AONB 3KU4A 5DE3A 3UH0A 1JIKA 1MO6A 5TMBA 3WYNA 4U5QA 3KYIB 2WJWA 3CR3C 3GLRA 4ZYTA 2JGEA 1KOFA 1ST3A 4Q7EA 4RYDA 1AD2A 4UVDA 1I4OA 1Z22A 1DPGA 4HI0E 3BTUA 1HI9A 3HZOA 3BEOA 1FTYA 1MABA 4KJZA 2A78A 1QS0A 5DYWA 5B58C 2FEXA 4QA9A 1QP8A 1WTCA 3QK7A 2NU9B 5ITZA 3U37A 1AGNA 1J24A 2BEVB 2XPCA 3LHSA 4NU5A 4R2WA 4DUZB 3IVXA 4M46A 4QXRA 1GT91 1Y3BE 4O02B 1ZOPA 3DDNA 2GYYA 3GEIA 4K9LA 5TS2A 4DLBA 4EBBA 1P5JA 4GOND 3T52A 1K7CA 4MR9B 1T8RA 3MMZA 4GOOD 4WBNB 3FYUB 3WL5A 3M83A 3O82A 4GM4A 3DOEA 5EQDA 1EP1B 3W77A 3O3CA 4OGGA 1WB5A 3QLEA 4YLEA 2JATA 1SHLA 3H1AA 2VRCA 4YPVA 3QKRB 4X93A 2W6CX 1WU8A 4C4OA 3UHAA 3AF2A 4O08A 5EZYF 4AYXA 1W46A 2JFHA 5TPWA 3FZEA 2C88A 4UOQA 5AFSA 5AVXA 1ZH0A 3L0OA 2JIPA 1X7ZB 3L92A 3DG9A 4ZHQF 4XFKA 3VPBA 1KI6B 2VH5R 5EYPB 1DCFA 2GX6A 3KT3A 2Q2NA 5AK4A 3NTQA 2PJDA 3GMIA 3KSAC 3LC1O 5DZSA 5AHOA 5FF9A 1WZCA 1XUOA 1KYVA 4IVPA 1AZTA 3GLHB 5JCOC 2ZYSA 2JFBA 2XDAA 3KYBA 1DKRA 4Y2HA 4CR7A 4KQGA 4ETWA 3ABRB 3F49S 4MMZB 5LJIA 1NW7A 4EG0A 3FKSD 2FNAA 2QR5A 3B9RA 5EP3A 1RRPA 3W8RA 1K7FB 3CUSA 3O7MA 1J9ZA 1Q2XA 3BGIA 1U8AA 4DMGA 1BYUA 2AXNA 5AIBA 1PFUA 1SXJD 4UBJA 2ISSD 3TMKA 1MGPA 2P1DA 3CJTA 1PZNA 5CBKA 2I7DA 2NTYC 5J1TB 3VJRA 5JAOA 2CLSA 1IJBA 1D2MA 3RU9A 5D51S 2IZ5A 1QRTA 1SQ6A 2A1TR 1J2EA 1RYHA 3KJEA 4JMPA 4IP0A 2WG1A 3DOUA 3N8GA 4B40A 1TM7E 1RBZA 1X1DA 2H2IA 3EVEA 1CZKA 2IP2A 3CKLA 1YULA 3H86A 4J1SA 1NXSA 2J0EA 2ZULA 3MBKA 1EWTA 4RF3A 4Y2SA 5HQJA 4US0R 3MTGA 2WDZA 3MG9A 1HO3A 4FMCF 2ST1A 4LGYA 5FTJA 1IN8A 3FG9A 1C30B 3NRBA 1ZH8A 3EGDA 4NG5A 3VR0A 5I7RA 5KNBH 1UEJA 4JJAA 5AI0A 1MC1A 2ZM6B 2CN1A 2CNBA 4OQLA 1KE2A 3UENA 4GS5A 3VVCA 4M83A 3K6SA 5T6MA 3S2SA 1VCOA 4QBGB 1C14A 1BNCA 3MS7A 4JGIA 1DEAA 1I7SB 3LWNA 4AZSA 3MJCA 1EK2A 2NXCA 2QL7A 4MV0A 3FOBA 3LF1A 1Y1RA 3MN1A 3HCFA 1CBUA 2OQ2A 3LVQE 4BLPA 2CXSA 2OUIA 3AEXA 3MT7A 5H81A 1TU4A 5HS6A 2JI4A 3L6DA 2UYYA 1HDEA 1S5PA 1L1RA 1EFUA 1XEWX 3JARA 4PTYA 4OGWA 5DO9A 1A8HA 1WCWA 4JJ7A 4AY4A 1M66A 1YRLA 4D44A 4ZVMA 4G5SA 3BB3A 3KWLA 4BNDB 3M5PA 3UCEA 1CEQA 4UEOA 3UT6A 1PS0A 1UPCA 4MIYA 4RKYA 2B0CA 5FJIA 3TR5A 1U2GC 4U63A 1RDFA 3RK1A 3SC2A 5JJCA 1J0CA 3FF4A 4MUAA 4NJOA 4YP5A 1P81A 3O03A 4E5MA 1N6NA 1A7KA 4KE7A 3O8LA 1Q0SA 4ZRNA 1DBPA 2BRUA 1AKNA 2LDBA 3FYSA 4HNAA 2J5BA 3KR1A 2DTXA 1S8AA 3ZCVA 3W8NA 3F78A 3A14A 2IWRA 4CIVA 3UJHA 5CD9A 1WCV1 3KEGA 5LB4A 4PXYA 3ER9A 4HQOA 3S99A 2JLXA 1LPNA 3IQZA 4LF7B 1HE4A 4HDAA 4HLCA 4B9AA 4O4IA 5DGDA 1TTPB 2FSVA 4JR2A 5EE0A 3G2JA 4KJXA 4DAEA 4YBRA 4AZWA 3IEMA 2FDRA 3N53A 1A9QA 2WP8J 2ODAA 3KBBA 2GPJA 4FHFA 2SHKA 5FOTA 3J81k 1RC1A 1SOUA 2R6HA 4LOLA 2I03A 4HDSB 3WB2A 1XVUA 4V0NA 5DTQA 5DW0A 1YK1A 1MCZA 1NRWA 3ABQB 1LD3A 3F46A 3HBJA 2WY2D 3STVA 4Z4QA 2XAAA 3L7BA 2Q3BA 2ZQYA 3L8ZA 1K66A 1XYVA 2HCBA 2XCIA 4MV5A 4EFKA 1OVGA 3CX4A 2NUTA 1FE8A 4E4YA 3SWWA 5J23A 1IN7A 2N46A 4ZN6A 2JK0A 4R1QA 2PQ0A 3TW8A 3N2EA 4RHYA 3PGLA 1JHOA 4NH4A 1T36B 1N9GA 2QK4A 2H1SA 3E9RA 5EP1A 4GM0A 1DJMA 4MGYR 2P9FA 4GR9A 2PX8A 4B3CA 5IJZA 5HF6A 2C03A 4LG1A 4DA0A 3ZH2A 2KLHA 4HK4A 3U4GA 4ZQFA 3HK2A 1CY1A 2AR9A 4RIGA 1Z3IX 4U9UA 2MJLA 3AJDA 2G4CA 3QUCA 4WZBA 4XPIA 4DJFC 2A67A 3VUFA 4LNHA 4V38A 3W6OA 3NWOA 3VDMA 4B5KA 2PAAA 4GQBA 2ZWVA 1XZHA 1KMHB 1Y7LA 1XZQA 4PAMA 1E7RA 2ILVA 3RYIA 2DPGA 2EBFX 1ORIA 1ZK4A 2ZIVB 3DNPA 1RPZA 1TDJA 2TSYB 3I8SA 3VSCA 4XCXA 3O0TA 2D59A 3IP3A 4BE4A 3O1JC 4FX2A 1A4RA 1S02A 1YC2A 2CYBA 3KOOA 1W7AA 5CFOA 1PYDA 5BSMA 3U49A 2ZTHA 2G6BA 5LDDC 5ECWA 5KDOA 4KU4A 3KVRA 1NR5A 5LQJA 2BGGA 3CEJA 5TLSA 1PK9A 1MLDA 2W90A 2VH2A 3TPFA 1OC2A 2PHZA 4QFDA 2DETA 3R7WB 2C54A 2R65A 4BB9A 4C08A 1PO7A 1QGZA 5DX8A 4OSEA 3SSOA 3UPUA 3ZDDA 3ROEA 4BZZA 1T9HA 2I4NA 3BIJA 4MVWA 4D56A 4DA6A 4X41A 3ZE6A 4KOEC 4RMJA 4G67A 3B13B 3BK1A 1FA9A 4P7FA 5KJCA 3EX7C 2PT5A 3GLQA 3T1VA 1IQRA 2BKVA 2G3YA 5EPUA 2AXQA 1OJ7A 2W4IA 1AX9A 1WMDA 2H1HA 3LVFO 4IPTA 2OPBA 4JN6B 4KO2S 2IW1A 4JK3A 4XUGB 1CHDA 1L7RA 5CX1B 3NX4A 1TU0A 2ES4A 4F85A 1TM2A 1EX7A 2QNBA 4Q19A 1BE8A 3GELA 3MWEB 2V6GA 2NO6A 2C2XA 5DCWA 1C3EA 1KYXA 3ZHVA 2EW2A 2O8NA 3UICA 1MU0A 2ZZKA 4BVLA 1OFIA 1E2IA 4IEEA 2P2CA 4HD8A 3P2KA 2YMQA 4D3YA 3IAFA 4HGOA 1P4RA 3DHVA 2JLYA 5HF5A 5LWHA 4WVFA 3T7SA 2LRHA 1KDYA 4CFSA 4UATA 1KJJA 2XUKA 5E1DA 5I9MA 4XYGA 2OB1A 3SZ3A 2P9HA 4LJRA 1K7SN 2PRSA 4U7PB 4XJXA 5HF8A 4YCMA 4IJQA 1EWYA 3Q3JB 4RLSA 4KPYA 5F73A 4JXKA 4W7SA 4B35A 1LI4A 1QWSA 1SULA 3NNDA 4C3VA 4EGAA 4JBIA 1RQNA 1F0PA 2ZI5A 1YFZA 2HHCA 4Y0VA 4UE6A 1WL8A 5JDCA 3A3PA 2X9LA 2OFOA 5DBHX 3CN9A 1PG2A 1U3FA 2QMOA 2XBLA 5GONA 4IMJB 4PO1A 1U2DA 4AC9A 4WEOA 1HTTA 4KPFC 4PZLA 3TE6A 4N3CA 1V9SA 3K9CA 2IS1A 2PMDA 4GGOA 2PS3A 4MI6A 5JOQA 1CZRA 1NNI1 3UC5A 2ZB8A 3I5UA 1R74A 4OQDA 5AM2A 2I6FA 2F9FA 4LBVA 3DL4A 1SKAA 1ZMTA 1MZPA 1YQQA 2YDXA 2PG3A 3TRKA 3HJAA 3E58A 5LYJF 3JWEA 4GXQA 4F7DA 2FKAA 2PEZA 4IYRA 5TEVA 2QVXX 4L0QA 5AQ1A 4I50F 1JEAA 1KK3A 2FEMA 1XZAA 4PSKA 1ZI9A 1LRJA 2OZKA 4K88A 5JNLA 4OXIA 5M29A 1M10A 4EYOA 2WZCA 1PFWA 3ZK7A 1XZNA 2AJTA 3VPGA 1A0OA 1A5SB 2V7TA 1E5LA 2ZIZA 5T4FA 2QQ5A 1YJAA 3A9WA 4I81A 3ER6A 5E6RB 3ZHSA 3M4JA 3ZCTA 4AKIA 4IIVA 4RD3A 5JRZA 1QSGA 2JRLA 3G5AA 4IFBA 5FUXA 2FXIA 3TXYA 1W5SA 1NC3A 2XCUA 3AHJA 3N2NA 4MI3A 5KZMB 3PVZA 1DT3A 2VSYA 3U0BA 2JI7A 3BFKA 3DXFA 2B7CA 1IUKA 1FNDA 4KYTA 1PV4A 2RI0A 1SD2A 4JDPA 4DDHA 2EFEB 2BFNA 1EFLA 1IEQA 1XFAA 2JNWA 2PZMA 3EQZA 2P9BA 1V1JA 1XNHA 2ATCA 3ONEA 3W8FA 3VZDA 1P3Y1 3PJRA 5BPHA 2Q5OA 2R7AA 2H0AA 3CR8A 3HP4A 4HX2A 4PPGA 5FWXA 5ALHA 3CC8A 2MINA 5IC5A 3WJAA 5AVTA 1KYIA 1U7PA 5FA8A 2YVQA 2GHRA 4YP9A 2XRMA 5ER9A 5ALFA 1MR3F 4A92A 1L5ZA 3IT1A 4G1MB 2J32A 1XEXA 4K26A 1OGIA 2G8LA 4CI0B 3RC7A 5A9SB 3U7GA 1L7OA 2YHUA 3ESYA 4I4NA 3KK0A 4XGKA 3ZWDA 4F7WA 1LCIA 5DASA 5IMBA 5IXJA 3U7FB 4L78A 2O14A 2P40A 1E1CA 2C3YA 2XSZD 4JEUA 4JI2B 2WUFA 3FNQA 1FXUA 4HEJA 2LVBA 2V4MA 1QGUB 2JI6A 3DE7X 3I9LA 4AAYA 3IOMA 5CJPA 1IN5A 1B14A 3BMOA 3LA8A 2DPXA 3P0FA 3BHJA 4MLCA 2GUGA 3GNSA 4DIBA 1KJYA 3ND9A 1Z4KA 4LJAA 1BVRA 2WFLB 4O4JA 2YW9A 1M6EX 3ZTTA 1P2SA 1X1TA 1ZD1A 3I1JA 4GOXA 4YP1A 3L46A 5C8YF 4AKSA 3IEUA 4RULA 1NU6A 1AK1A 2KWIA 2C07A 4RANA 3FOEC 5ALTA 1GTSA 2Q27A 1QHSA 3N28A 3OLZA 2JEYA 3ANTA 4IICA 2HKIA 5CG2A 3NH6A 2HEGA 5H82A 5B57C 2DSNA 2G70A 1IPEA 2XD9A 2RGEA 4OA5A 4RFSA 1T3GA 2WWXA 1QYCA 1JEYB 2QN2A 2Q21A 3RTEA 1T0JB 3L05A 1R6TA 1J0BA 1IJKA 1HE8B 3C8UA 3FD8A 4B3IA 4J7XA 1QQ5A 4RMGA