1E4VA

Mutant g10v of adenylate kinase from e. coli, modified in the gly-loop
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Crystal structures of two mutants of adenylate kinase from Escherichia coli that modify the Gly-loop.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(phosphotransferase)
total genus 74
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e4vA00
1JI0A 1M7GA 1OF1A 1XEWY 5FTNA 2A7QA 2XSZA 3UIEA 2IS1A 1AS0A 4MRNA 4PQYA 4B76A 3W8RA 1QHXA 3QKUA 2RGCA 4YXWA 1E0AA 5JHGB 4KBFA 3AGQA 1MRSA 4NYMR 2GZAA 3PITA 5LPNA 3C41J 3N5CA 3Q7PA 1JR6A 3ONWA 1KHTA 4URWR 3NDBB 4XSHA 1Z0FA 4QBFA 1XPUA 2O0KA 5TV2A 1K6MA 1N5KA 3B9PA 4A15A 1ZC4A 1IJEA 4UQOA 3CWZA 4F91B 1GRQA 1E1RA 4M9XA 3DHWC 2ZITA 3EC1A 1MT0A 3ZQJA 5DO9A 3VU9B 4DCTA 3AVUA 5EZ6B 5FPSA 1X8JA 2ZETA 3TSZA 1GNRA 3ZIAD 3DPUA 3DKPA 2YWEA 3S1AB 4V0OA 2D62A 3BFKA 3VR5A 4HLDA 1W2HA 4G0NA 1W5TA 3K1JA 3U4QB 1X8LA 1G6HA 4AC9A 1W0KD 1SGWA 1TNDA 3AH8A 1ZC3A 1FUUA 3NH9A 5AR1A 3WMEA 3O8CA 1IBRA 4CZ2A 1D2NA 2C9CA 3CZQA 3K0AA 4IDPA 1G18A 1ZVQA 4JBWA 4M1OA 3RSLA 5F2EA 1KDRA 1CR4A 2ZTSA 4JZKA 4PHTA 4WZAE 1ZUIA 2FSFA 1LFDB 1TL7C 1YZKA 3K9LA 1NLZA 3IQXA 3BGWA 1KSHA 3GJ0A 3MWYW 2ZI7A 2VEDA 1G5RA 1OYYA 4Y0AA 4BFUA 2ORWA 1EK0A 5CITA 4DB2A 4AY2A 2IYZA 4XIGS 2BOVA 2XAUA 4PAQA 4D25A 4HB3A 2P67A 4MYHA 3T1TA 2QPTA 3NEYA 2AL7A 5AWFC 4EJSC 1XXHB 3A58B 3CF0A 3EA0A 1IN5A 4TT3A 4BZPA 3VAAA 1VECA 3JZMA 3QKRA 4PFSA 3TAHA 1NSTA 2P6RA 2FFAA 1QF9A 4O3MA 5EP2A 1W2GA 1ZCAA 4ZI3A 2Z5FA 1RIFA 5DYIA 3U44A 2QP3A 5JS7A 4DCNA 5H1YA 4ZDKA 3PIRA 3QXJA 4JVSB 4TTPA 4KVAA 1N5LA 4Q9JA 4OBEA 2IEZA 4EKDA 1BYIA 4U02A 3BE4A 3NC0C 1WBDA 3B60A 4RD4A 3VR4A 3ZZ0A 3VTKA 4DIDA 3THOA 1RYFA 4LJ6A 1S9HA 3C5CA 4LC0A 4XTRA 3ADCA 1TF7A 3EPKA 2NMVA 3NTUA 5E95A 4N0EA 4RZXA 2GXSA 1SVWA 1Z28A 5EE0A 2A9KA 2A5GA 1RRFA 1XFAA 3QJYA 5H68A 1VYUA 3OIWA 2GEVA 3NG1A 2XXAA 1ZM7A 1QHIA 1KAOA 1NBME 4Q7MB 2HT1A 1IHUA 2EQBA 3SBDA 3K8YA 3I72A 4M9QA 4BLOA 3TUZC 1Q1ZA 1SXJD 1EG7A 3E70C 3ADBA 4JLOA 4RZUA 3C7KA 2CNWA 1NG1A 4A6XA 1KK2A 2HXYA 4QGHA 5M04A 3FTQA 5CJPA 4GMXA 4BRUA 1HT1E 1OIXA 1VKJA 1EFRA 3K70C 3RLFA 2HLDD 3LW8A 2W83A 2Q3HA 5K8LA 1J90A 2QAGB 3K0AB 2Z0MA 1P72A 4IKEA 1SVIA 3BJIC 1BIFA 5LD2B 5C4GB 3EWAA 1XP8A 3ZDQA 2ODBA 2WOOA 1KIMA 4JKIA 1G8YA 3QG5A 3UG7A 1MO4A 2GA8A 3RSOA 1XJCA 4KYUA 4LPSA 2ZJZA 4GMDA 2FU5C 2LKDA 3BAFA 1QG4A 3KX2A 4C2UA 1NVXQ 1FPMA 4XVQA 4AD8A 1UKYA 1DBSA 2PZFA 5CJ2A 1K5GA 4ZIRA 1KKLA 3T5DA 3VR6A 2F1HA 5HZHA 2MMGA 3K53A 2PCLA 3QKSA 3UXMA 1YR7A 3SHFA 3ND9A 2KWIA 3AGPA 4YC7A 3QKRB 3V4FA 5ELXA 3D3QA 1HQCA 1XTIA 2WJGA 1FMLA 2GDJA 1VIYA 4II7A 3W6PA 2QG6A 3CIOA 5BW8A 1U0HC 2Q0HA 1VCOA 3E2IA 2CCKA 4KAXA 3CPJB 2YOGA 3GEEA 4NYJR 4DLVA 3QPWA 4K46A 1J8YF 1JR3A 1CTQA 2D4HA 2RCNA 2BBWA 2OZEA 3TGPA 1XTKA 3PXGA 3IEVA 1PLLA 1XD9A 1H8HD 5JWHA 2IYLD 3RYTC 3GJ8A 3P26A 3WYFA 3LQQA 4NCKA 2NGRA 4JLVA 3GP8A 2GBLC 1FOEB 1XTQA 1D2EA 4B44A 3X1WA 4BQSA 4DRZA 4KITB 5F9HA 3AM1A 1GL6A 1YR9A 3J81k 1XRJA 5CB6A 3ZD6A 1M2OB 3N2IA 4OI1A 2ZR7A 3HU1A 1C1YA 3T1OA 4HZUA 4PPGA 1SKYB 3T35A 1Z0AA 4BEBA 3W6OA 2DR3A 5FTLA 5GJWC 3L0SA 2OXRA 1YZLA 1F2TA 3LDAA 2XXAB 5C1BA 1EESA 4DDTA 5J4LA 4MKFA 1Q20A 3H0KA 3A36A 3E5HA 3IBGA 1Q3HA 2WWGA 3AP2A 3ZD7A 3BB4A 5CIQA 3B9QA 2IYRA 3WNCA 1VDZA 3C8UA 1G3IA 1XPRA 4PANA 5JEEA 1PZNA 3O8RA 3PEWA 3IGFA 1GTVA 1NMXA 3MJRA 2IX3A 4AKHA 4OQLA 4BFYA 3V4RA 4HDCA 1IAQA 4ASUD 1P9RA 1E2GA 1OKKD 2IYVA 2ZPTX 2RAPA 2WZQA 1GG2A 2IUSA 1D2MA 3H2YA 1OYWA 1EX6A 3AF1A 3VHXA 4D82A 4QBIA 2ERXA 3PEUA 2XJ4A 1QVRA 3UWKA 1BH2A 4AKEA 3CRW1 1ANKA 3DEFA 1VG9B 3TW4A 2OBMA 1KI9A 3TRFA 1D6JA 2UZIR 5KPDA 2ZRPA 3CRMA 2CHGA 3L8ZA 2AD5A 1P2TA 5DGXA 3HYRA 2ZXUA 5EP1A 3PVSA 2FPLA 4UNPA 3KJGA 4ZO4A 3A1TA 4MH0R 2YNMA 4PC1A 3ZIAA 3QF4A 3WRXC 2JLRA 4N0DA 4YDHB 1C4OA 1NBMD 2GAOA 4M22A 1VCNA 2JJ8A 5FPYA 1AK2A 3ZVNA 2QM8A 2YWHA 2O8BA 2OG2A 1OXTA 3C5HA 2F3TA 1UBFA 2QAJA 5FTMA 2DFLA 2FGJA 4D2IA 5SZKB 3QKSB 4TMTA 1UEIA 1MO6A 1E2QA 2DCUA 1Z6TA 3VR2A 2P5TB 3F5FA 1YZUA 5EXTA 3ZQ6A 4NDZA 1KK3A 4JSYA 3CNOA 3D8BA 3CKLA 2JEOA 1E2KA 1E1QA 3LFUA 3VHLB 4B71A 4TQUS 4QM6A 4A8JC 5BYKA 4OQFA 3DZDA 1LS1A 4IFEA 3QIAA 3LH5A 3NXSA 3T15A 3TR0A 4XVUA 3DKVA 1OXUA 4F93B 2J87A 3CNLA 2GXUA 1RE0A 4LC1A 4Z8XA 2A5YB 2B92A 2YOFA 4IOJA 1COWD 2ZRDA 3W9YA 1NKSA 4LJAA 2E1RA 4M2LA 2WJHA 2W00A 3CB4A 4MGZR 3KFXA 3NDPA 4RD2A 2ZE6A 3QF7A 1ZNXA 4FI3C 1GL7A 4PHHA 4US2R 1KO7A 5B2ZA 1YZGA 2QGZA 4M1WA 5SZIA 4TL9A 1N0UA 5BN3A 1UF9A 1E99A 4HZUB 2ZRGA 1XX6A 4JL6A 4OI2A 1DPFA 2VIIA 3BH7A 4UNNA 4GP7A 3QEOA 2P3SA 1XPOA 1F2TB 1AGPA 2ZR9A 1CEEA 2ATXA 1YKSA 5H70A 3PUWA 1UDWA 5FH9A 3KKQA 2VLIA 1OE0A 1FNMA 421PA 3GJXC 3A1SA 4IOLA 1TQ4A 4LWZA 1W47A 2XB4A 3KB2A 4BLSA 3NC1C 2XNDD 2XOKA 2YC2C 4V0MA 1N5IA 4IEIA 2WWYA 4MUAA 4BWYA 3I73A 5DLQC 2CCGA 1NJGA 3I5YA 5HPYB 2BIFA 3U5ZB 1Z8FA 3TQFA 1RW4A 2CLDX 721PA 4GNKA 4YMVA 1QHHB 2WJJA 5JI2E 3H1TA 4KFTA 2ZRKA 3B5JA 4YXWD 3HP1A 3QQ5A 2V9PA 1RFLA 1T4GA 2XJ9A 3IUYA 3LVRE 2G3YA 1JPNA 1Z6YA 4ACAA 1QDEA 3GLGE 1XZQA 1OH8A 2REBA 4OJKA 3QF4B 1M1YE 4RCYA 1XCGB 3W90A 4DUGD 5JWRA 3CZPA 1TADA 2GVZC 1N0VC 1XCMA 2E9SA 5FBLB 3AVVA 1QRAA 2YC4C 2FH5B 2VP5A 3RRZA 2ZJ2A 2Q3MA 1JEEA 2O8BB 1KJWA 2RGNC 3IPXA 1K5DA 3FDIA 3KL4A 1NN3A 2BBOA 5JJKA 2LKCA 3U2QA 4ABYA 2GCPA 3Q8XB 1KI6A 2ZE5A 4QXAA 3TJZA 4IRUB 1CJVC 2AK2A 1XJ0A 4IOMA 2N46A 4TMKA 5AUOB 1P62B 4Q48A 3KJEA 1G291 4OHYA 1T5IA 1VMAA 5CYPA 4BEJA 4MRRA 1G3UA 4RD3A 5TARA 5FI0B 4HDQB 3MAAC 1Z2CA 4TL8A 3T34A 1G1MA 5AUPB 2VYFA 4KFUA 4EUNA 4DXAA 1XEXB 2Y8EA 1G3QA 3L0IB 4O2LA 1CJKC 2WKRA 3MJHA 3GLFE 4FWIB 3UANA 1U9IC 5BN5A 2CHVA 2ZRCA 1NVVR 1IXRC 1VG0B 1TTTA 1A82A 4DSOA 1P9WA 1YVDA 2JASA 2RMKA 2B6HA 1Z07A 3RRNA 1W4RA 1W5SA 2DY1A 4V0LA 4DLRA 1XMIA 3GLIE 4Q9IA 2GJ8A 4BFTA 1UBEA 3QBTA 1FW6A 2IXGA 2CE7A 3CX7A 3HU3A 2OO7A 3LLMA 2XGJA 4DSTA 1RRGA 4P4SA 2PLFA 1KTVA 1LV7A 2QEQA 4DKXA 1FUKA 1MABA 3AVPA 3U61B 1H8HA 1A2KC 1O3YA 4DCVA 5EE1A 4N3NA 4KBGA 4F4CA 3PJRA 3CRVA 4LCBA 2F1RA 2VQSA 2J0UA 1R4AA 4O0MA 2GAAA 3NBFA 3TBKA 5FOUA 4HAZA 4Z1MD 3LNCA 2EFDB 1ZUNB 4HAYA 2JLZA 1SHZA 1G8HA 1BKDR 3KKOA 5CLLA 1OXSC 1E9EA 3AKYA 3CF6R 1AQUA 3P20A 4GBMA 4PAOA 4YDSA 4R9UC 1WMSA 1U81A 1W49A 3B6EA 4LV5B 4PQRA 4CEJA 4LDJA 2JAQA 4K8OA 4ZI2A 2EYQA 3LD9A 1HV8A 5G53C 1TU4A 4JT4A 5FOTA 2CE2X 5JI3E 2GXAA 2O8EA 2QPOA 4JMPA 4MITA 4ASUA 4TMWA 1OKKA 3VKHA 4OK6A 3X1YA 1L7VC 2VP0A 4QNRA 4CIDA 1KMQA 4B73A 3W3AA 2WKQA 5KSYA 1PLKA 2WWXA 1HURA 4URUR 1E98A 1KOFA 1TU3A 2D2EA 3QKTA 2MSEB 2DFNA 1KI6B 4LHXA 2JLXA 2KSQA 2ZU6A 2ZRAA 4Q1BA 2P0EA 2EFGA 1R7RA 1N6NA 2BM0A 3IKJA 2OFXA 3THYA 1Z0JA 2NG1A 4BFXA 1NBMA 3KJHA 3BFVA 3OIUA 4HB2A 3AF2A 3IEUA 2QMOA 3KQNA 1XMJA 2GTPA 2EVWX 2V6IA 4MQBA 2Z83A 3RNLA 3RWMB 4A4DA 1E4YA 1X6VA 2VHJA 5L3VA 1KDTA 3EAQA 2ZS9A 3EARA 4KODA 4LJ5A 2C8VA 1DAGA 1PV4A 1GKUB 4D0NA 3A4NA 5DN6A 4TMVA 2C77A 4LUCA 3S1AA 4B3CA 3SI7A 4TZ6A 4PAMA 1QHSA 3W3ZB 3IO3A 4LI0A 2IYWA 2WTUA 3OF5A 1S3SA 3U3JA 1E2HA 3QPUA 1JALA 2A5DA 1MABB 2C2HA 3TVDA 5DYGA 4Q19A 2BEKA 1IJFA 1DAIA 2PZEA 1FMJA 3QENA 2MSCB 4FMCF 4HI0E 2NTYC 4GOJA 1COWA 1UPTA 4E22A 1OJLA 3QXHA 3VX4A 4QM7A 1XD8A 4OKSA 4A36A 1KJYA 5FR2A 2E87A 5L3SA 2H18A 4BFZA 3VMFA 2J0UB 2PEYA 1VTKA 3VR3A 4ZKEA 2D7CA 3SJCA 5A4JA 5FUWA 1IXZA 5IDVA 4DEYA 2ZIAA 1I4LD 1W1WA 5CK4A 1CJTC 3WYAA 4AG5A 4CDGA 4HAUA 1U2RA 2C99A 1AZTA 4Z51A 4QC2A 3RS2A 1HH4A 1DTSA 1E9DA 3AVXA 1D8TA 2VF8A 4US0R 2OLKA 3A4LA 3T1QA 4ZCMA 4AYTA 2GJKA 4A0HA 3A37A 2OILA 1DE0A 1T8TA 4GDFA 2WVJA 3FFBA 4QHYA 4CEJB 4UNQA 2ZAMA 4DLTA 5GADl 1E2MA 2Q3FA 1QBKC 2IS6A 1U0JA 3Q7QA 1N6KA 5JBQA 3THWB 3UMFA 1WXQA 3QUSA 1ZM4A 2XNDA 4M0LA 1IY1A 3K0FA 2KBEA 2F1JA 4P4TA 5G3ZA 3SFVA 2F43A 1P7CA 2WMNB 4FIDA 4URYR 4BLPA 1NP6A 5B64A 3NIBA 5KOYA 2DWPA 5TB5A 4Q4HA 4L16A 4LYFA 3R9WA 4I1SA 3RRMA 3R20A 4JS0A 4C0KA 5BYJA 1G6OA 2AWOA 2WHXA 4B34A 1ZW6A 3LO5A 5KDOA 3EA5A 4RD1A 1II8B 4JLAA 3GFOA 2IK8A 2XTMA 3W34A 2QL6A 1F6BA 2HDNB 3PV0A 3QVVA 1KY3A 5KTYA 2FZ4A 2GEDA 2IXFA 5L8VA 3THYB 4DUGA 2LWIA 1CS4C 1NVUQ 1OHHA 1E9CA 2RB4A 3CH5A 3PUZA 4S2EA 5C18A 3ZVRA 1ZM2A 5KSPA 1AN0A 2OBNA 1IN6A 2IWRA 5KYKA 4YMWA 3U3OA 4DLXA 1TMKA 2YJTD 2QROA 2ZRNA 4M1TA 2GETA 1SHKA 1PJRA 4UKDA 4PPFA 1N0WA 3GJ3A 4NYJQ 1VIAA 4MGIR 3VKWA 2R2AA 2AR7A 4HYYA 2G6BA 1GRNA 2V4ZA 1XTJA 3MWJA 2H7VA 2ZRIA 2CL0X 1UFQA 5E7JA 5HTKA 3SQXA 2ZSDA 4ZV4A 5B57C 3GFPA 5FOVA 1EWQA 3IO5A 2QAGA 2C03A 2GCOA 4WW0A 1QVAA 2ECKA 1ZNZA 3L43A 2HXSA 2FN4A 3RRYA 1YJ5A 1E9AA 5IRCD 1GDDA 4F7WA 5JCPA 4FD2A 2RGDA 4LPKA 2R65A 1QHGA 4YMTA 4V0NA 1E1QD 2AHOA 3FGNA 2WBLC 3V9PA 5L3SB 1WB9A 2FMXA 2NO1A 5LB2A 2BMDA 2VHUA 4PPNA 1NNEA 5F9FA 4B48A 3QSYA 4XWKA 4FWTA 4P3YA 2A3RA 1YR6A 4ESHA 4NYIR 1ZD8A 1R0XA 4FMBB 3B1XA 3ECCA 4FMCB 4LX0A 1E69A 4UJ5A 3L0OA 2QN6A 1YQTA 2OCBA 5FL7D 4IFBA 1TUEA 1OW3B 1X8KA 4Y0VA 2NO7A 3LBNA 5IF9A 1VG8A 5KU1A 1XMSA 2JJ2A 4KFRA 4NZYA 1XMVA 3ETLA 4D0LB 1ZYUA 4YLGA 3T5GA 1YZTA 4RFVA 2H17A 2X1VA 4JT2A 3AP3A 5IHPA 4LBYA 3NBYC 1CKEA 5KO2A 3AP1A 5EP3A 2OM2A 3K0FB 1OB5A 3B1WA 4Z1MA 1OH5A 4CEIA 3OESA 4L9SA 1WF3A 1XD2B 2F43B 1JQLB 4H1UA 3CRQA 3SJZA 4Q4HB 3C16C 2RGBA 2GF9A 2ANCA 5JRJA 1UKZA 3WP1B 4GSYA 5EE9A 3RHFA 4CW7A 1SXJC 2D74A 1H8EA 2XOKD 1LY1A 4V0KA 4Q00A 1GUAA 1KO5A 2IYTA 1EFCA 4L15A 4WXRA 1JQJC 1NMYA 2JIZD 5DSZA 1Q1QA 4FW9A 1E2DA 1ZIPA 4BLTA 5GJVC 1DO2A 1J7KA 1R10A 3LXXA 1R0ZA 3CBQA 1Y63A 1N6PA 2CVFA 3LQRA 4MKHA 3RWOA 1ZD1A 3SNHA 1NJFA 4W5WA 4AURA 2OXCA 2O5VA 5EQTA 4KJZA 4V03A 3T61A 1R0YA 5G3YA 2BC9A 4QOSA 5BQ5A 2QTFA 1SVSA 2VHQA 3NWJA 4RKFA 4IJMA 2G83A 3VKGA 4KHZA 3TSWA 4OJQA 3NEJA 3E1SA 3HR7A 3EPHA 1NN0A 3OHMA 4FCTA 5G40A 1UM8A 4Q7LA 1W0JD 2J3EA 1W36B 3WMFA 1GIAA 2IUTA 2ZQ5A 3O8DA 2ZJAA 5HKKD 2CMKA 1FP6A 2GCOB 2I3BA 1Z5ZA 1S4QA 2C9YA 2R8RA 3UPUA 1X1SA 1S96A 4KYIB 2JLSA 3PUYA 5FPKA 1N6HA 1TQDA 4HLUA 4NE2A 3GLGA 5CK5A 1KZGB 1FTSA 1R0WA 3VFDA 2BMJA 4EFLA 4NMMA 1UBCA 4MRVA 5CLQA 1DG3A 5E7IA 4RZ3A 3H4MA 4PSAA 3R8CA 2NIPA 3NH6A 4LBZA 1W46A 4IDQA 1E2PA 2FGKA 5FTKA 3TVTA 4LJ9A 1U8AA 4IVRA 1AQYA 2PJRA 5J4KA 1ZMXA 1S2MA 4HAXA 2IUUA 3BH6A 4ZPXA 1HEIA 1M8PA 1GWNA 5LBIA 3EIEA 1FP7A 2QY9A 1IN4A 4ON9A 3GCGA 4TLCA 3RABA 2ZI5A 3AKCA 1M34E 1VCMA 1OSNA 2G88A 4BZQA 2F55A 1IY0A 1IQPA 5KDDA 4PXAA 2GZDA 1YE8A 4I1UA 2OLJA 3GLFA 2W6ID 3QY0A 1OH6A 2CXXA 2ZS7A 4EPRA 4PC7A 4CEIB 2ATVA 4IEEA 4LSGA 5B30A 3PEYA 3SE0A 4IDOA 4HAWA 1HY3A 1R5NA 3SYKA 3W5IA 1JNYA 2QQ0A 3K0CA 3GLIA 3QE0A 4QGAA 5AJVB 3TKLA 2KE5A 3GLHB 3MGCA 1NY6A 4C9BA 1G20E 1CULC 3GMTA 3RS7A 4HAVA 2IC5A 2EFCB 1OT3A 4C0SA 4BPBA 5F98A 2AD1A 4DWJA 1E6CA 5CDFE 4BASA 4RY2A 3K09A 4JL5A 1JPJA 4HEJA 1Z6AA 4A0FA 1IXSB 1II0A 3VX3A 2X2FA 4EIWA 2G1KA 1W44A 3RANA 2BCGY 3F0TA 3BK7A 4C7OA 4ESVA 3I4LA 2BMFA 2OV2A 1Z22A 3A1VA 1G8FA 3UK6A 5CYOA 3SQWA 3GJ5A 1RVDA 2FF7A 4QL3A 1NN1A 2QRZA 1N5JA 5J47A 3I92A 2CBZA 3OAAD 2D06A 2XTNA 3QEJA 1FTNA 3F3YA 2QGNA 1ZCBA 4NP6A 4B47A 2CK3D 2O0HA 2QQEA 4DLUA 2Q6TA 2B7CA 4Q18A 3RS5A 1Z0IA 1QHHA 3FMFA 4NCHA 3I3SR 5HE9A 4MDFA 4B32A 5FUVA 4CF7A 5KUTA 2ZE7A 1CRQA 1P2UA 2H57A 3GLGB 3AEZA 2WOJA 1T0JB 2Q9BA 2RHMA 3P32A 3GPLA 4CGZA 3B13B 3A1UA 4QJ5A 5JECA 4AKGA 1MV5A 4LOAA 2PT5A 1W4BA 1E0JA 1KKMA 4BLQA 2FSIA 1HTWA 2IXEA 4KVGA 1KGDA 1RJ9A 2OAP1 521PA 4E09A 3X2SA 2H8KA 2F9LA 1J99A 1JECA 4LBWA 2GXQA 3G82C 1A7JA 2HT6A 1D9ZA 2JGNA 4URXR 1U98A 4B3BA 3FKSA 1E9FA 3JVUA 2ZUDA 1DO0A 1V5WA 4LJ4A 2XZOA 5DN6D 3GQBA 1BO6A 5EUMA 3AB3A 3K9HA 3KQHA 2VF7A 3ZJYA 4DJTA 1ZM3A 3PQCA 4GFDA 1EFTA 3VR1A 3ZS8A 4L4UA 4Q1DA 2HF8A 5E3HA 4W9MC 4FCWA 3EASA 1R2QA 2KBFA 5KNDA 1AKEA 1OV4A 1XEXA 2HUPA 3GLFB 4MRSA 4WA7A 1RYHA 3FHCB 4B33A 3MRSA 1IOZA 4EPYA 1L2TA 5HZKA 3QPVA 2RGAA 4RD0A 2IT1A 2WSMA 4D4KA 1NG9A 4C0HA 1OIVA 2YV5A 2IYSA 2WPDD 3GD7A 2NZJA 2W0MA 4HUQA 2QE7D 3GLIB 2HF9A 4JBYA 1WDTA 4M9SA 5FL7A 2GK6A 2VSXA 4LBVA 2QMEA 4GT1A 5AK0A 3TLXA 4QFMA 3L82B 1D9XA 3GLHE 1I2MA 2P6UA 1GVNB 4G5OA 4PX9A 5TY0A 3GEHA 5GVSA 4UNRA 1LB1B 2IF2A 4Q1EA 2PX0A 2YWGA 1T6NA 3B82A 3RAPR 4DVGA 1YU9A 1ZNWA 5K8TA 1TEVA 1SVLA 2HJGA 5BXQC 2C5LA 2FFQA 2QORA 3DMDA 2VSOA 3LAWA 2CLSA 2ORVA 1II9A 1KSGA 2GHIA 3WHKA 5IT5A 4C7OB 1TF5A 1AGRA 2QNRA 4W5JA 4OHZA 1AJEA 4C0JA 2VH5R 2AWNA 2W6JD 1JJ7A 1KZ7B 4KO8A 4PHFA 4M1MA 2WJIA 2J0QA 4MKGA 2ZE8A 3SJAA 4H9GA 4WOPA 5JJLA 1WQ1R 2D3WA 5C2JB 4QRHA 4DDUA 4OQXA 2JIZA 3GJ7A 2YHSA 4GRAA 3PG5A 4EJSA 2OT3B 4IVPA 3RS0A 4OYHA 1F3OA 4X8LA 2ZRBA 1NL3A 2QTVB 2WWHA 1N3BA 2IWHA 3VQTA 1R5BA 2G1JA 4RSGA 3QVUA 1Q3TA 1G16A 2ANBA 2IHBA 3X1XA 1L4YA 5L3QA 1G5PA 1B23P 4QGFA 5KPJA 3CPHA 3DOFA 4ZCIA 2XZLA 1OHHD 2FJUA 1FX0A 1XBTA 5AJXA 1RJ9B 4JVNA 2QAGC 1U8ZA 2ZI4A 4J0QA 4TYYA 4QG7A 4W7SA 3LX5A 5TDHA 1W0JA 2REOA 2UVQA 2ZROA 2R6DA 3B1YA 5HKKA 2UZ3A 2B8TA 4NH0A 2V54A 3O47A 3THXA 2BWJA 3Q5DA 2XX3A 1Q1EA 2W2TA 4MA4A 4FXPA 3OEED 2ZSBA 1P73A 1PVOA 4QGGA 3U3RA 2G0NA 4CT5A 3W5JA 4Z8YA 1W36D 1I4TD 4GP6A 4OHVA 5HR5A 4OK5A 2QU8A 4TL6A 4YMSA 4LJ7A 1EGAA 3HR8A 3AF0A 2PMKA 3I32A 2P6NA 1Z6XA 2FNAA 3ZLJA 2C98A 2IF0A 3KB1A 2B7BA 4US1R 1P2VA 4PC2A 5HCNA 2O0JA 5FUYA 5DNYB 4TWZA 4L9WA 2CJWA 3MFYA 3EIHA 4I81A 5TMPA 4A9AA 3ZYCA 4Q1FA 1CIPA 4Q01A 2IEYA 5TXGA 5KDLA 3TW8B 4HUQB 3H86A 1VPLA 4Q9KA 3SEAA 1GITA 2JCSA 2ZS8A 1ZM9A 4QBHA 2EYUA 3DL0A 3IPYA 4BECA 1E79A 5DHAA 4KU4A 4P33A 1U90A 2HV8A 1G64A 2Q9AA 3CW2A 4GOXA 1WE2A 1X1RA 2JA1A 3RS3A 4C0QC 1U8YA 2W6IA 3FVQA 3CM0A 1KDPA 2W58A 3SBEA 1NRJB 3UWOA 1Q21A 2A78A 4EPVA 2ZJYA 4EDHA 1S8FA 2JJ2D 2AXPA 1G7RA 1R6BX 4NYMQ 3U3KA 3CNNA 2QA5A 3ADDA 2GKSA 1AIPA 1E2JA 4NU0A 3RDPA 4D81A 1UAAA 4DSNA 3CR8A 2PZGA 1E9SA 5J4YA 2VO1A 4GOKA 1D5CA 4Q9HA 2QI9C 1W4CA 3IHLA 4BRWA 5IK2D 4HLQB 5GJCA 3MWKA 2HJVA 2A5JA 3SYLA 4F92B 3BERA 3DDCA 2OFOA 2NPIA 4EJSB 2JATA 1VYVA 3K9NA 4NPHA 1BOFA 4C0AC 1NIPA 4P0TA 4TMXA 4MUBA 5EE3A 1H8ED 4RZ2A 4QJ4A 2ZRJA 4XSGA 3P4XA 3EWSA 3MWLA 3QXXA 4XWOA 4Q1AA 5KSOA 4U7DA 1OLOA 2GNOA 1A5TA 4UJ3A 5AJYA 1HT2E 821PA 3THWA 2IBMA 5L3QB 3P4YA 1RKBA 2PX3A 3DMNA 3KKPA 2A5FA 2P5SA 2ZREA 1FX0B 3OAAA 4PZLA 2ONKA 2FX3A 1E0SA 3A1WA 3EG5A 3LXRA 2CK3A 3JVVA 4B3DA 2C78A 2J7KA 3B1VA 1GILA 2AFIE 1ZU5A 1RRPA 1NLFA 3Q72A 2V6JA 4BE7B 3Q85A 2V1XA 2GBLA 1G7TA 3FPAA 3ZS9A 3LLUA 1X3SA 1J8MF 4B74A 1XTRA 4I99A 1BYUA 5E4FA 1II8A 1HUQA 4Q02A 3IIMA 1P6XA 2QT0A 2WV9A 1S1CA 2ZI6A 3UATA 2OHFA 4C4PA 2WWFA 1Z0KA 3AUXA 4F4JA 4AWXA 1WRBA 3KUDA 3R9XA 2G0TA 2FDCA 4WXPA 1KK0A 1XZPA 1G5TA 1X86B 1EWRA 1IM2A 1OFHA 3FWYA 4NYIQ 4RFSA 2NQ2C 2EFHB 4HZIA 3CWQA 2ONJA 2O8DB 2CL6X 1E9RA 2QUZA 1T8UA 4KCGA 4DDWA 1JXOA 2GJSA 3C14C 4XOIA 2PCJA 4QHSA 2CJWB 1OXVA 2AXNA 3AQ4A 4CEHB 4D6PA 5JJIA 5B58C 1IONA 3X1ZA 3CF2A 4UXJA 2Z4SA 3IIJA 1GKIA 2Z43A 5A0FA 2H5EA 4LYAA 5FOXA 3EXAA 2CCJA 3GFTA 2ZVQX 3IQWA 2WSSA 2RGGA 3KKNA 3D7MA 3K70B 4IDHA 3G0HA 3FMIA 3NVAA 5JZVA 3WBKA 4UXHA 1N6OA 1TAGA 1L8QA 2YOHA 2F3RA 3B78A 1KY2A 4FMDF 1EX7A 3K0CC 1WP9A 2GRJA 4JYCA 2FA9A 4LY6A 2HCJB 1F5NA 3I1FA 3OEHD 4WIAA 1H65A 2WPDA 5JRZA 1AA9A 1AM4D 1E2IA 4KLZA 3OE7A 2QTHA 3C15C 2OEPA 5AUQA 1Z29A 2QE7A 1Z08A 4OI0A 4LGMA 4WAUA 2IYYA 1Z6GA 4ILEA 4MGKR 1JXMA 1DAFA 2Z4RA 3BD9A 4FCVA 4A2QA 4B6EA 2PJZA 1OPXA 3REFA 3WXMA 4DLWA 4EPWA 3K09C 4TYNA 2GCNA 3N2EA 2BBSA 3B85A 1ZNYA 4AG6A 1LS6A 1T9HA 1TQ6A 2PEZA 3U6KA 3OFNA 3SR0A 2EW1A 1T3LA 1CBUA 1TX4B 1F60A 1NIJA 2N42A 4NCJA 3U60B 1S1MA 4AI6A 1KI3A 4A92A 2J5XA 3RVBA 3PUVA 5EXXA 3W8NA 4D80A 2YVUA 2WWIA 4DHEA 1XU4A 1S3GA 3M4YA 4P32A 1ZIOA 5FR1A 3G5UA 2OBLA 4A8JA 1GFIA 1MOZA 3ND8A 4H1VA 2MMCA 4TYQA 2W6JA 1Z2AA 5LDDC 2GESA 4QBGB 3T1VA 1XD2A 1KSJA 4XWAA 3AKDA 2FEOA 4TTRA 4U00A 1U94A 1QHYA 4X8MA 4DLZA 3BBPA 1NSFA 4A82A 3CX6A 3EPLA 4MKIA 1TEXA 4IVQA 1Q44A 1SVMA 1E9BA 1YRAA 2IS4A 1UADA 1W4AA 1KK1A 4HATA 1XEFA 2GK7A 5JSZA 3F8TA 4QHTA 1SXJE 1HE8B 4RCZA 3P1JA 4G5GA 5CDFA 1M7HA 1G7SA 4Q5IA 3ZGXA 3I61A 2ZYTX 3B8HA 4QKQA 1G3RA 4B35A 3WNDA 3KJIA 3NBZC 2W2VA 5EP4A 4RFSB 1GNPA 2FPMA 2FOLA 1M6NA 2GF0A 1DOAA 2ZSAA 2ZEJA 3BB1A 3JZAA 4R71A 2Z6VA 4B3XA 3GJ6A 3K9GA 1N25A 2R6CA 4LYJA 1B0UA 3HYTA 4QNMA 3UMSA 4KSCA 1J2JA 4XTCS 5KHOC 2BEJA 3M0EA 5JS8A 2JLVA 2IS2A 3AVOA 2H16A 3BORA 4Q4LA 4MYUA 3OEEA 3A4MA 4G5QA 5JMTA 1DEKA 2WM9B 4LJYA 2DFTA 2EWVA 5EZ5A 5A5GA 3EIQA 4GZMA 1XJQA 1P4SA 2X77A 2D2FA 3FKSD 2AKYA 2ZRLA 2WJVA 1JEDA 3DM9B 5FTJA 5CM8B 4CT4B 2BV3A 3HJNA 4MYTA 5TVKA 1QZXA 2DB3A 4O25A 2NO9A 2IYXA 1VHLA 1DAHA 1L4UA 1VCIA 5JEDA 3SN6A 3AV0B 2BDTA 2NZ8A 5F3WB 2J1LA 3BH0A 5FUXA 1P5ZB 1DARA 1S0UA 2ZRHA 2JLWA 4G3XA 4UXIA 1T0HB 2ZU0C 2JJ1D 2RGNA 5CB8A 3QBVA 4FMDB 4URVR 1YZQA 4C2TA 4Q4AB 3ZVMA 4BLRA 3ASYA 4PC6A 2CDNA 3DZ8A 4PO9A 3WP0A 4I4LA 4EQ6A 3LW7A 2JLYA 2OCAA 2BM1A 4DB4A 3U7GA 4JL8A 3PUXA 1VHTA 1HA3A 2WIAA 1JAIA 3KTAB 1G8GA 4EAQA 2FEMA 4A8JB 2O8CA 2AKAB 3CLVA 3THXB 1CR2A 1DS6A 4RJLA 5J4VA 2ZSEA 3TH5A 2JLUA 1T3SA 3ADKA 2O8FB 1G17A 5FBVB 5IK2A 3TUIC 2J59A 4G1UC 4ACBA 1U9IA 2D7DA 1SKQA 2IA5A 3CUEF 3EZ9A 2ZYUX 5FBQB 3NKVA 2XB2A 2QSZA 2CHQA 3GLHA 4Q1CA 3WYGA 4Q66C 2MSDB 4X8HA 1NKTA 3ZVLA 2PLRA 5JSZB 4DZZA 1CJMA 1KAGA 4NCNA 4O2RA 2ZSFA 3H84A 4Q03A 2WKPA 4HB0A 1CRPA 4LYHA 4GI7A 2QP4A 2X2EA 2R6GA 2VL7A 1XCPA 5G41A 1GP2A 2GZHA 2DBYA 3D31A 4LHWA 3Q5EA 4ITRC 2QM7A 1EXMA 2IYQA 1CU1A 1GM5A 3NBXX 5JHHB 3IBYA 2JLQA 4GL2A 4BFWA 4CYMA 4B75A 5BWMA 1P2SA 4B3FX 2V7QA 4OHWA 2IYUA 3ZZTA 1ODFA 1PUJA 1Q22A 4F4IA 1UKEA 1TQ2A 621PA 2BBTA 3BIFA 1P9NA 3FE2A 1Z63A 3NHAA 3TSOA 5JCZA 2FZLA 1E96A 2ZANA 2VBCA 4YONB 1DAMA 2TMKA 3FKQA 4NBSA 4DCSA 2HCBA 3A8TA 4PQFA 2R9VA 4BFVA 4HLCA 1LF0A 1KNQA 1IN8A 2CEAA 2V55B 1FFHA 1A1VA 5AJZA 3VNUA 1XB2A 3LA6A 2XNSA 2GEUA 5D3MA 4FN5A 2VRWA 2WAYA 4FINA 1GNQA 3QXSA 1F48A 4G5RA 3TQCA 1KI1A 3SZRA 3T12A 4JKYA 1GAJA 1HE1C 5DI3A 3UG6A 4IDNA 1N6LA 4I1OA 4JIMA 3KQKA 4AYWA 4GPTA 4B2IA 4Q9LA 3ZZUA 3SHWA 2DFKB 2ZUBA 4EQ6B 2LCFA 5D3QA 1E79D 5EXPA 5UKDA 1RC8A 4WZ6A 1P61B 4PPQA 3OEHA 1AZSC 1LW7A 3MUFA 4B3GA 4TLBA 4JLNA 1LF5A 4UNSA 1E4VA 3K70D 4EFNA 1G41A 2O8CB 1XTSA 2BHRA 2QZ4A 3I5XA 1XXHE 2FSGA 2WMOB 1ZU4A 5J4HA 5J5CA 4G5SA 3AUYA 3SFZA 2A30A 4NCIA 2XTZA 4OI4A 1RPZA 3KXKA 2A2ZA 4R98A 5SZHB 1CLUA 4XD7D 4I1VA 3U44B 1GL9B 4Q47A 4RVCA 2OUKA 3ZH9B 1PUIA 5DH9A 2DHRA 1ZAKA 1EFUA 1G7CA 5DIFA 3AVQA 1Z83A 1AS2A 2O52A 3DM5A 4JJKA 4YQFA 3DO6A 5K8IA 2CVHA 4POAA 5BN4A 3UMRA 2FG5A 5DE3A 5JLJA 4P31A 1OXXK 4IW3B 4PO8A 2AK3A 4L8GA 2V1UA 4OQNA 5FFMA 4PSKA 4A0GA 1E3MA 5SZJA 4LHYA 5C46F 2F1IA 2X8AA 1KNXA 2ZRFA 4WZBE 2PMDA 4JLBA 4TSFD 3AVYA 1TUIA 1I2DA 2HEIA 4PC3A 2BCJQ 4F38A 3X1DA 1R8QA 3KKMA 5EE5B 3T06B 3EZ2A 3FMPB 4JBXA 1G4AE 3M6AA 1BMFA 1Q0UA 1KMHA 4MYCA 4TQAA 1J70A 5FBWB 5K8UA 4AYXA 1FL9A 1NVVQ 4TLEA 1W7AA 2VTKA 5GJBA 6Q21A 3EZFA 3N70A 2ODEA 1XNJA 1NMZA 3KQLA 5AJWA 2PL3A 2ZJ8A 4AIIA 1E2NA 2WJYA 3IHWA 3QI2A 1US8A 1BS1A 1T3HA 1CR0A 2YZ2A 1KI4A 3R7WA 3L2OB 4Q21A 2QBYA 2JDID 4X8OA 4RKEA 1CP2A 5D3MB 4A0RA 1XEWX 3LY5A 3LX8A 2OFWA 3CX8A 1ZJ6A 2FFBA 2N1BA 4DBLC 4ZCLA 5DI3B 2QENA 2B8WA 4V02A 4WBSA 3B2EA 2H92A 4BUJA 3FYHA 4M4SA 1Z0DA 2WIBA 3HWSA 5E7MA 2BVNA 4B2LA 3B1ZA 2KI5A 2VHTA 3BRWD 4DEXA 1OH7A 1XDBA 2GJ9A 3R8FA 2ZR0A 4U5XA 2H1LA 3LWNA 1M7BA 1T91A 2WSSD 2GJAA 5EXSA 1IN7A 2AX4A 4ZIRB 3FOZA 2EU8A 2J7PD 1DAEA 1U0LA 1SULA 2V3CC 1W0KA 2CL7X 2HYDA 4JVLA 2PT7A 4PZZA 4EPTA 2ORIA 1Q12A 3TK1A 3K0SA 2YYZA 2JJ1A 2OCPA 1UEJA 3OE7D 3ASZA 2P2LA 3MLEA 4P4UA 4TL7A 3U7HB 2RGXA 4OQMA 5KNCA 4MGYR 5JFGA 1R8SA 3QOFA 2OSBA 4JYBA 2J0SA 1DG1G 2GWHA 3FMOB 3QG1A 4DLYA 3RC8A 3WMGA 1FQKA 1ONBA 4B6FA 4E07A 5DISB 5DI9A 5H8WA 2PH1A 2W2XA 3EC2A 3OFND 1YHNA 3EZ7A 2IL1A 1SVKA 3SJBA 2WWWA 2ZM5A 2RHDA 3REGA 1TF2A 1MR3F 1ZINA 3I62A 4IOKA 2P65A 3MD0A 2OAQ1 4XH9B 3WHLA 2VSFA 4IXNA 5C4MA 1G9XA 1ESMA 1MRNA 4D4JA 4PTLA 4Q7JB 4AK9A 4DT1A 1RZ3A 2ZYVX 3WBJA 4NHOA 3CO5A 4B43A 1N6RA 3OIVA 2ASEA 1SKYE 2FFHA 4D4LA 2KB0A 4URZR 4ZDWA 4M53A 4QJ3A 4HB4A 2DPXA 2WICA 3K0EA 1KMHB 4JJZA 5CM9C 2NO0A 2OCYC 2QMHA 3LRPA 1YZNA 2BJVA 1FNNA 1S9DA 4A1FA 1Q57A 1G19A 1P3JA 2F7SA 3L0PA 4TYWA 2J45A 1US8B 2UKDA 1VYTA 4PO1A 5L3RA 4E5UA 4NTZA 3R7WB 2QBYB 3M1IA 1MO5A 3PCRB 4C30A 3WNBA 1W36C 2YWFA 3BWDD 3KXIA 3PFIA 2XSZD 4LJ8A 3U6BA 2GVDC 2C96A 3MMPA 1PLJA 1CJUC 3BS4A 4GZLA 3BB3A 4A6PA 1KO4A 5LD2C 1QG2A 3C4JA 2PBRA 4L5BA 4OK3A 4D26A 3KUCA 1ESNA 1UDXA 1KI8A 1OFTA 2SHKA 4LRWA 4KI0A 4DCUA 2C04A 3EW9A 4M1KA 3B7GA 1E94E 2ZRMA 1E2FA 5FOSA 2X19A 2XEXA 1ZBDA 1G3MA 121PA 1SXJA 1YR8A 1ELOA 2VP9A 2G9NA 3TR5A 5HE8A 3IDQA 2RH5A 1E1RD 4S35A 3SU8A 1ZD9A 4K81B 2FPKA 4LHVA 4M21A 1Z47A 2HLDA 4JLMA 5J40A 5P21A 1LTQA 2O8DA 1RRCA 2BJWA 3SOPA 3IIKA 2R62A 2AN9A 1KO1A 2R6AA 4ZDIA 4KXFB 4TLDA 1JJVA 4LHZA 5ANRB 4NKRA 4CEHA 3CPEA 4ZDJA 3AVWA 3BOSA 3TNFA 1JAHA 1GRRA 3PENA 3SS8A 3NHBA 3HDTA 2J0VA 3EZ6A 1CXZA 1E2LA 4C0BA 4JSTA 2BKEA 1NLYA 4BFSA 5AUNB 1JB1A 1F2UA 1JR3E 3I8SA 1HQYE 5FBRB 3KZ1E 1K8RA 3OZXA 1KDOA 2BKUA 1N2CE 2QPAA 1P75A 1ZUHA 3AF4A 4HDOB 4Q4JA 2NOAA 4TQ9A 1MH1A 1MKYA 2XZPA 2DYKA 4AKIA 4KLNA 1WA5A 2NO6A 5FPTA 3MCAA 3SYNA 1OIWA 4C3ZA 4DT1B 1Y3AA 1CF4A 1DVRA 3GEIA 2ZI9A 4TN1A 4XD7A 1E0KA 3LBHA 3U7FB 3FHOA 4ARZA 2C95A 2VPPA 3SC3A 2YKGA 1Z3IX 4TT3D 3FFAA 2QP9X 2ZI3A 2ZJ5A 4IHQA 2VHCA 3TAUA 1JBKA 4R7ZA 4KSBA 4TYPA 4D0GA 4LV6A 4EFMA 4N1AA 1IY2A 2F9MA 4LV8B 3ICQB 3O8BA 5CIWA 5JWOA 1LNZA 2F6RA 1KSFX 2L0XA 1ETUA 2VP4A 3DOEA 1R5OA 1NI3A 3TMKA 1TPZA 4M9ZA 4LK2A 1SQ5A 1E32A 3IILA 4PSVA 4TSFA 1G4UR 4MDEA 2ZJOA 3KDSE 5DHFA 1I4DD 2G77B 3PEVA 1AS3A 3VNVA 3WY9A 3Q9LA 3KXLA 2XITA 3TE6A 3KQUA 1OB2A 3WRYC 4C0LA 3ICEA 4JLKA 5HCIA 1A2BA 4XJXA 1KI2A 2FWRA 1VG1A 4HLUC 5FPHA 1UJ2A 2V7QD 2RKOA 4G01B 4OHXA 1GKYA 4TLAA 2J41A 1CR1A 1WBBA 4EPXA 4D4MA 2QRNA 2FV8A 2BMEA 4BZXA 4CRWB 1NN5A 1SXJB 2J46A 3AKEA 4Q7KA 4YMUA 2R44A 2ODNA 2WAXA 4M8NE 1SZPA 2GILA 2CLCX 4JLJA 4RD6A 5FOWA 1ZRHA 2V8OA 2Q21A 4IXMA 2JDIA 3I8XA 1C9KA 1N6IA 2I1QA 2R6FA 3EX7C 4DLSA 5KNBA 1M74A 1P60A 1OFIA 2C9OA 2ZUCA 5GVRA 1U99A 2HYIC 4JLPA 4PZYA 2ERYA 1G8PA 2IHYA 3D6TB 2CNWD 4PR0A 2ODWA 2W0SA 4M1YA 3L8YA 3LBIA 4DC9A 1SVOA 3MSXA 1EFRD 2REXB 3QXCA 2I4IA 3LV8A 2OESA 2ZJBA 3BC1A 1ZP6A 1G21E 2NPFA 1F2UB 1EFHA 1XWIA 4MRPA 3Q3JB 2ZVPX 3V00A 4LZZA 2J7PA 2ZYWX 1KI7A 2J9RA 2DWQA 2I1VB 3VU9A 3KFVA 4Q4JB 2RGEA 3U3MA 4JLDA 1T5LA 1AKYA 3CRRA 5FI1B 2Q9CA 3CR7A 4ZKDA 1NY5A 3P27A 4M1SA 3SDZA 4TZ0A 1LVGA 1O87A 2DWOA 2EFEB 2K5UA 4TMZA 1E2EA 3HU2A 4A2PA 3U4QA 2FE4A 2AFHE 3DVLA 4P4SB 3A6PC 5LB4A 1Z06A 4OL0A 4ARZB 4B2PA 1KJZA 3TUJC 3BXZA 2VP6A 3RC3A 4DIEA 3W6NA 1Q1BA 3TIFA 3FHTA 4WVFA 1WCV1 1NVWQ 4Q4AA 2YINC 4TTQA 8OHMA 1YRBA 4PHGA 4NL4H 2VA8A 4BGDA 3BFXA 1DADA 1GZSA 3UKDA 4CVNA 1MO3A 2QT1A 1JR3D 2VP2A 4NONA 1W48A 3CH4B 4XVRA 4DSUA 4E03A 1GSIA 5EJEA 3KTAA 1GOTA 1A4RA 1NF3A 1V43A 1KYIA 3QNUA 4Z54A 3LVQE 2KJQA 1KO8A 5KSZA 3EPJA 3HPQA 4KV9A 4R2HA 4V0ME 5FL3A 2QSYA 1QHNA 2B21A 3GJ4A 3RS4A 4JVMA 1XXHA 2ZAOA 2O8FA 221PA 2IW3A 1DELA 2FSHA 1XF9A 4HSEA 1HYQA 3PR1A 3FB4A 2QMUA 1DAKA 1FQJA 1UBGA 4ERNA 3U7EB 1OFUX 3OIYA 3R9IA 4A2WA 4DDVA 4KFSA 3MG9A 4R2IA 3AF3A 2OE2A 2O8EB 2EWWA 3HPRA 5EUQB 3AVTA 4HUTA 4W5HA 1FZQA 3CONA 1UKVY 1BMFD
chains in the Genus database with same CATH superfamily
1YIDA 4AY5A 4RETA 1XEWY 3OMLA 3ZQUA 3ZXYA 3AEKB 2XSZA 2IS1A 3I1JA 4AECA 4PQYA 2IZ6A 5AXDA 5TVGA 1QHXA 2I54A 3GFQA 3OQ6A 2EJBA 3QKUA 3PS9A 2CXSA 3GGCA 1N2SA 3V48A 3UUEA 3F4LA 4IEFB 4KBFA 2EZ9A 1MRSA 2GZAA 3I2FA 1Y1TA 3PITA 4UHDA 1A5SB 1DDGA 3T5CA 3KNZA 2FUCA 1XPUA 1JIXA 4BN4A 1K6MA 3B9PA 3FR8A 4JQZA 2PSSA 1ZC4A 1SC3A 3KVVA 4MV1A 3SIXA 1Q1GA 3CWZA 1GRQA 4JBGA 1A72A 3QPDA 4KJXA 3PTAA 1THGA 4NS1A 4WSOA 2CDBA 1MT0A 3EB9A 1JJAA 2QHXA 4RWZA 3VU9B 1FJHA 2ICAA 1MB3A 3U4IA 3FSJX 5FA6A 5K0LA 1X8JA 1EFAA 2FR8C 3GAFA 1Z56C 1GNRA 3CJRA 5EWJB 3E61A 3YASA 2HLNA 3BM5A 1TMYA 1EUCA 3FPBA 4QVIA 5KOIA 1NT4A 4V0OA 5AI6A 2D62A 4JJ8A 3VR5A 4MR8A 3RJZA 3FVWA 3BXPA 3DPIA 4HLDA 3V7WA 4J94A 3V8EA 3ZXXA 4CLOB 4JI0B 1FVOA 1G6HA 2AUNA 4W4TA 4H4CA 4AC9A 3MTAA 4H16A 1YI0A 4CMAA 3FWZA 5FJIA 4D98A 3G9TA 3K0AA 2FEKA 4IDPA 4MCHA 1G18A 1GQOA 5BSKA 4B82A 1ZVQA 3ZE7A 4M1OA 2J30A 5JADA 2PDAA 1KDRA 1WO8A 4WZAE 2H52A 3TPZA 2I03A 3WGZA 1MDBA 4DKJA 2FSFA 4MVJH 1LFDB 3K9LA 3JATB 5ALQA 1V3TA 3GFGA 3RVJA 3A6FA 1VE7A 3EOZA 3S5JA 1KSHA 3GJ0A 3JWEA 2ZI7A 4I9FA 1G5RA 1OYYA 2OFPA 3O6VA 2ORWA 3E58A 1PKXA 2P75A 5CITA 4P36A 1PBTA 4XIGS 2BOVA 3U13A 1I7PA 4WVLA 4AY2A 4D25A 3L77A 4HB3A 4DYHA 3NRBA 3QXGA 3OJEA 1Y6FA 1V7CA 1L4EA 1JSRA 3O74A 3TS1A 3T1TA 3OZUA 3CMMA 1H2EA 2VK2A 4EJSC 1XDUA 4NV3A 3QVMA 3H3JA 1Z4QA 5HK9A 3U4HA 2PR7A 2C2XA 3X2EA 2DUNA 1CDDA 1JWBB 2HNKA 3H87A 1FFYA 5F77A 5A3SA 1EM6A 1VXOA 2P6RA 1UC4B 1FC0A 4ZU6X 3OJXA 2WYHA 1ZNQO 1R0LA 2IEIA 5DCYA 4YCAA 3LUHA 3EQ9A 4M8IA 4H3HB 4Q3DA 5H1YA 4RGVA 2NV6A 2XZDA 3QXJA 3SCZA 1GRVA 1I0LA 1YHZA 3FXAA 4JVSB 5BRNA 3I6YA 2GZ3A 2FMHA 5HHTA 4GNRA 3N8NA 4OBEA 2V03A 4U7WA 4EHHA 2YV4A 1BYIA 2XUDA 1IVNA 3OZDA 1JKFA 3RRBA 3BE4A 3FUUA 3GJZA 3KYCB 4UMVA 4RD4A 1QFYA 5JO0A 4LWQA 4CI0B 1K5PA 4KQWA 4XTRA 3LUCA 1CERA 2B35A 3NTUA 3WBFA 1DC7A 2B4QA 3WFJA 3VKUA 4RZXA 2NTNA 4RPHA 3O38A 1XFAA 4MOWA 2VDVE 1X1BA 2I2FA 3KT8A 5A05A 4M38A 1IM8A 2F8SA 4Q3BA 4BEVA 1XC7A 1DC8A 3W4IA 3EQ2A 1QHIA 1KAOA 1NBME 2BFEB 4V3BA 1SA0A 2QW0X 4IQFA 3AR8A 1EZZA 2B69A 3IPLA 4ZVOA 4GKKB 1SC1A 3I9NA 2C8KA 3EGVA 4MLPA 2CXOA 4A6EA 3VBEA 2BLLA 2EQBA 3SBDA 3K8YA 3ZUPA 4M9QA 1WMFA 4LZPA 1Q17A 3OQNA 3HZZA 3AH8A 1Q1ZA 3TYXA 4L9RA 1EG7A 3E70C 4RZUA 3EW7A 4EEXA 1NLUA 2I6UA 3RHTA 2IHTA 5KTRA 5M04A 4QOEA 2JZCA 2EFYA 3FTQA 1VKJA 3OF2A 4B3IA 2V6FA 4QZVA 1RJGA 1R6AA 1XL0A 2FUNB 3GT4A 1N9KA 1U7XA 4XGIA 1J90A 4CG0A 1LSUA 1N5RA 4XUDA 1VJ5A 2R6R1 2BYTA 1BIFA 2AW3A 2YS6A 4GPEA 4QRIA 5I4IA 1XP8A 1T36A 1VKNA 1NUQA 4QU9A 1KIMA 3QG5A 3D81A 3UG7A 3KV3O 3RSOA 3SXJA 1QH1B 1XJCA 2XCOA 5IARA 2HMSA 3VPCA 2P9BA 2LKDA 3BAFA 3KX2A 4DR2B 4C2UA 4BZZA 2RJ3A 4JQOA 4XVQA 1BD4A 4E30A 1HK7A 1QCZA 1VXRA 4MDHA 4D8TA 3E3AA 1YZVA 2PZFA 3PC6A 4J7UA 3KQTA 4J9VA 1WSWA 1UK6A 4ZIRA 1IVYA 3KWFA 3FLAA 3JVIA 4DILA 4P08A 3W78A 4CM1A 1AT1A 3VR6A 1V16B 1CY7A 2JNWA 3AINA 3COVA 1T2NA 2QN7A 3K53A 2PCLA 2I22A 5ALIA 1KZ1A 1YR7A 3EWIA 1T2EA 2KWIA 4RTJA 2P5UA 4R9NA 5K3FA 3A9CA 1GR1A 3H19A 1IBKB 1Q6ZA 3G2IA 3O4VA 4D41A 2P90A 2GDJA 2KS6A 3BE6A 3D5EA 3F7TA 2QG6A 4TKZA 3N2YA 3W6PA 3KKKA 4X7MA 4ZOLB 1HGXA 1PWYE 2C0QA 3E2IA 3RSFA 2ERCA 3CPJB 4NYJR 5AM3A 4CIXA 2ADOA 1E4EA 1N4DA 3QPWA 1U0TA 3PJDA 2D4HA 2WIKA 1IN1A 3IAM6 2BBWA 1UPFA 1I32A 1LVUA 3TGPA 3D3JA 1JG3A 2J4FA 5JWHA 4KH0A 3WQBA 3ROXA 4KE9A 1VLMA 2X3FA 2GOYA 2I8AA 3AI7A 2HSJA 1TD1A 2O2ZA 3LQQA 2NGRA 2RFLA 1JMVA 4FFPA 2O4CA 4RPJA 7ABPA 2IOQA 3LYAA 5ILOA 2AJLI 3VGJA 4BQSA 1V1JA 5LUAA 2PUTA 1XRJA 4R0MA 2X9VA 3L7CA 4Q6WA 1VFNA 1HT0A 2VHVA 3GLUA 4M9CA 5FOQA 4Q34A 4PLTA 1GPYA 3T1OA 4PPGA 3M6XA 4BEBA 2GGSA 2DR3A 4GHWA 4EGSA 3NFRA 4P80A 3ETCA 3JW8A 3W79A 2W90A 4W1QA 5BUZA 1A9XA 3ISTA 3BWMA 1QYDA 4A7PA 4S04A 2J3LA 2GTIA 1PSDA 2EJUA 5J4LA 1PR3A 3HMKA 1RPAA 3L8FA 2XVYA 1LWNA 4RDXA 1ZHFA 1T5BA 4XM1A 3BB4A 1YQWA 3I5AA 3C3DA 1D1TA 4EMUA 1A77A 3NIWA 1UKCA 4FDAA 5J58A 4DMGA 1EGVB 1M8JA 4AWAA 1UUFA 3IGFA 3STTA 1MJNA 3PCTA 5ADUS 5HJEA 2WU3A 2RE8A 4F21A 4YI3A 4AB1A 2OECA 4NV0A 3N2GB 1VPWA 2LNDA 1J5XA 1E2GA 4EYOA 1HDCA 2RAPA 4LDPA 1JQBA 5DTQA 5DM60 4AF6A 3V46A 5LDHA 5AHOA 2WUFA 4PZCA 2B1QA 1T0BA 2XYPA 2ERXA 4QBIA 3MUOA 2PFGA 2EJVA 5M2QA 3DEFA 3TRFA 3ZE1B 1DC4A 1ETHA 3AJRA 1D6JA 4FYWA 2UZIR 4HGNA 1P0IA 2A1UB 4MR9B 2PIAA 1R0CA 4R01A 4ZVLA 5KPDA 5CCXA 1IK6A 3L8ZA 2AD5A 3PGLA 4MWZA 5LVAA 4FM9A 1ADFA 3H9EO 3GDHA 3PVSA 4UNPA 3GJRA 1CQIB 3A1TA 1B2RA 3LE8A 4NQRA 3M5WA 3KD2A 3QF4A 1V48A 1X7ZA 4GOLD 5THQA 4AG3A 4J16C 2AEEA 4XD2A 4M22A 4Y2HA 1VCNA 4ECEA 2AZ4A 4KPUB 3RT9A 5T5QA 4ND8B 4N47A 2Y27A 3IDSA 2ZWPA 1DIOB 2YHBA 1PBNA 1SCNE 2QM8A 3BJMA 3BSFA 3C5HA 1UPUA 3DE6X 2PUWA 3E5RA 2JZNA 5JBNA 2ZYRA 3MD9A 3RG2A 2F1OA 3FPGA 2NV0A 4TMTA 5GMOA 4EBFA 5KYGA 1E2QA 4XEHA 3VR2A 1P80A 3LWBA 2P5TB 4QTUB 4R7GA 1YZUA 4IDGA 4F3RA 5EXTA 4M9UA 3CH7A 4WESB 2IFTA 3QI7A 3TI9A 1AHPA 1E60A 3GJQA 1JKIA 3GXBA 3U0VA 3ZLTA 3BIWA 3RWBA 1NONA 1X7YB 2QTMA 4B71A 2AIRA 5IAEA 3KUUA 3ORFA 2G04A 3CXUA 2R48A 3DZDA 2EFJA 3EXHC 4JGGA 4IFEA 4FFSA 4CKCA 4XVUA 3DKVA 4XWGA 2I7CA 4KWIA 1OXUA 5E0OA 4F93B 2XOXA 4JI3B 3B5EA 1N2CB 2A5YB 4L27A 3O3MB 4YB8A 2WG0A 4MPTA 3F71A 2E1RA 2XCLA 3D8SA 5LC1A 4KLRA 4MGZR 4RVDA 2B98A 3C5EA 3VAZA 1TKAA 2DTEA 4O4LB 2MCFA 5KWJA 3VI4B 2DBQA 4FI3C 2QNBA 2ZB8A 4GVXA 4W8HA 3UHAA 2QX4A 3OVMA 4QQKA 2NVBA 2IEGA 4BB5A 1YZGA 2QGZA 1EZ4A 4M1WA 5SZIA 5DASA 5AW1A 3IV9A 3CLRD 1N77A 1D5WA 1UF9A 3C85A 2BEWA 3K6RA 2C4TA 1XX6A 3LYHA 1MNAA 4JL6A 4C4XA 4DJJA 3FROA 3BH7A 4DEVA 1BXKA 3KHTA 2ZR9A 5I8ZA 2OXIA 3TZBA 1CEEA 4JJ6A 2DZDA 1P4AA 5H70A 2OHOA 2WAMA 5FH9A 1P4HA 2HJHA 1G9SA 3KPYA 4XCVA 2CB0A 3AHHA 4JXZA 1W94A 2IYFA 2O2GA 3AT1A 3A1SA 3DR3A 4P86A 4QXQA 1SY7A 3A9SA 2JCXA 3F6RA 5DGIA 3GGDA 1TQ4A 1W47A 2XB4A 3DWIA 3KB2A 3M6VA 1MU0A 1NUAA 2DPGA 2RCYA 2CYBA 2YC2C 4CFSA 2FY8A 3CJTA 4BWYA 3QBJA 1S8NA 2CCGA 1SXGA 1RD4A 1XLTA 2WVHA 2ILVA 3NUGA 2BIFA 3VHXB 4N5DA 2R60A 1ZUNA 4MUHA 1O6ZA 4B6PA 2V7XA 3BD7A 3KZOA 4RX1A 1QHHB 3WWOA 2VNKA 2WJJA 3H1TA 2G4VA 2H6EA 2RK4A 1MOQA 3I42A 4HYQA 1C7IA 3HP1A 3QQ5A 4F96A 3AR7A 5LLSA 2OAEA 4ABTA 2CUTA 2V9PA 1RFLA 1T4GA 4FYPA 4YS6A 2G3YA 2XLCA 2VT3A 2M32A 2Q5CA 1JPNA 1E0DA 1OLSA 3RS8A 3RV3A 1QP4A 1ECGA 1UPAA 5JSUA 3K2BA 5K7SA 1P6UA 3CPSA 4DV3B 3PD0A 3PHHA 4IMIB 5DLYA 3ROZA 3HO8A 1O6BA 1XCMA 1X80A 2O20A 2YC4C 2FH5B 1RAGA 2X0EA 1Z5GA 2D4AA 2ZJ2A 4TWAA 4L4YA 3BWVA 5KIAA 2VPYA 4KGVA 2EJCA 1GG5A 1I3CA 3IPXA 3IVMA 3ZZMA 3OX4A 1L8AA 4REQB 4BX0A 3FHLA 3KL4A 1NN3A 1EJ6A 2BBOA 2RHGB 3A6HA 3QVLA 1E18A 3E82A 4G0MA 4Y1GA 3VYRB 2HR1A 4X91A 4PVDA 4NBRA 3R9KA 3OZSA 3UF0A 4C29A 1UINA 4IOMA 2N46A 1M5UA 1C7EA 5E9JA 4YREA 6GPBA 2K4MA 5BMVF 5CYPA 1JLSA 5K3BA 4K8RB 1Q5PA 4C7JA 3I2HA 1ECBA 1IDN1 3DDHA 3O92A 4KK3A 5F33A 5I9BA 3VSAA 4HX5A 1DTWA 4AJ2A 4BVAA 4EHBA 5LR6A 1K66A 4G37A 2CZQA 3DXFA 4FGJA 4GYYA 5H9WA 3L0IB 1R0KA 5HOEA 1A9PA 1CUSA 4R8MA 1BMTA 3ODGA 4FWIB 1U9IC 1ULAA 1Y98A 3V42A 4CM9D 4Q37A 4ZYXA 5CB4B 1P1HA 1NVVR 1VG0B 3GEBA 3KD3A 3WHIA 1A82A 1P9WA 1OTXA 3TD6A 2II6A 4XJSA 2B6HA 4GMGA 1Y8CA 5ALTA 1L4BA 2C4WA 4TV8A 5IJAA 3KQKA 3ZJUA 4HQ6A 4DLRA 2CHEA 4OUDB 1JHMA 4AAYA 5AW9A 3TMAA 4A5SA 2WILA 1JEAA 2GBCA 5HP4A 3NHWA 4HWRA 2QEQA 3GH3A 4FFRA 2VRCD 4TLMB 3A9TA 5KQGA 1GAQA 1GHTA 5ED0A 3TLEA 4WMLA 7MDHA 3IMGA 1XF1A 2HA0A 4DJ5X 4ND2A 2GO1A 3AVPA 3U61B 1H8HA 3HN6A 1SOVA 4JJEA 1NX9A 4N3NA 4DCCA 2E5LB 5IJWA 1QYWA 1PP4A 4DW8A 1GQ2A 3UMMA 2WTEA 2CD9A 2F1RA 2J0UA 1NYRA 4HWPA 4O0MA 2GEKA 2GAAA 2XIQA 2A0FA 4LF4B 3GP3A 3KCQA 5CT5A 3ZBTA 4Z3DA 2HHLA 1AMNA 1W35A 3LWZA 4EO9A 2PWAA 2ZQYA 1NXXA 1SKMA 5TJHA 1D1QA 3QA3E 3QTLA 4LX8A 2K6GA 5D5PA 4KK4A 2X13A 3IDOA 5CCEA 4U2BA 1XZNA 1EUDA 4Q9DA 1G8HA 4O4IB 3K6KA 1BKDR 3C8MA 3KKOA 1GYRA 1G5HA 2WM2A 3QPAA 3ZHRA 3CF6R 5ENDA 1GPJA 1SEPA 1FYWA 3K6JA 4R9UC 4Y98A 4PQRA 1A4XA 1FFAA 2VSQA 1V8FA 3O1JC 4B2YA 4BWFB 4ZI2A 2EYQA 1SCDA 1HV8A 2BLNA 1YDMA 3A4IA 2EAUA 3KUXA 4HNQA 4B6GA 4KPFC 4LGCA 1YS9A 3DH0A 1N0IA 2FPRA 2O8EA 1E58A 1FRVA 3GFFA 4P3OA 5LKAA 2E48A 3NHRA 3PTZA 1T4CB 4ASUA 4TMWA 1OKKA 4BL5A 4MYSA 5TSDA 4IZ6A 4OK6A 3FBGA 1KMQA 4KR7A 2FPPB 4RDHA 4CBVA 3ZDBA 4EEKA 3W3AA 4EECA 5KSYA 1KA9H 2PKQO 2D5BA 1UJBA 5AVTA 2QLMA 1E98A 1KOFA 2D2EA 1E3DA 2QD1A 2UYYA 3AZOA 4E0BA 3OPVA 1KI6B 5F7OA 5GIOE 2KSQA 1CUFA 1Y4SA 2ZRAA 3NVDA 3O95A 2P0EA 1UQTA 5A4MS 4WI1A 5BYAA 5K4HA 4YP7A 1MZPA 1SD5A 3O03A 4QDKA 1XQ6A 5KYUB 3NYQA 3CVVA 1Z4PX 4NMWA 2IELA 3N8HA 1U7UA 4M6WA 1UMBA 3O9VA 4UUAA 2M9MA 4K86A 5ES4B 3THYA 3DV0B 4MINA 1XVAA 4WE3A 1IYZA 3DTYA 3B70A 3OIUA 4HK4A 4C88A 4GR5A 3TKAA 2QMOA 1F4VA 1XMJA 5AESA 3KQNA 5LQAA 1XHLA 3L0BA 2CNKA 2V6IA 3OTWA 4L2IB 4X45A 2QLJA 3DBHA 3OZEA 4KXYA 5DHTA 4NZOA 5KCZA 5EJFA 2ZS9A 2CLKB 4KODA 3GVXA 4LJ5A 4D3DA 3TX6A 1QAMA 2VSNA 1SRRA 1KC1A 4D0NA 1Z62A 4KL8S 3A4NA 5IC4A 4TMVA 5D86A 5DHAA 1MP0A 3JQCA 3LHFA 5BT8A 1ML3A 1P39A 3QLUA 4FGWA 4B3CA 4TZ6A 1EWVA 5EHIA 4WUVA 3KG2A 2IYWA 4M7RA 2X8JA 2H08A 1LBSA 3M4NA 1L4MA 1YRHA 4AKTA 2UZ4A 3U3JA 3ZE6A 4D4IA 2G1AA 3QA9A 1CVLA 3VR5H 3IUEA 1MABB 1RAEA 1J8FA 2BKVA 2VPIA 4Q19A 5DYGA 4ENUA 1YDHA 5K6TA 3L6OO 1DAIA 2YFKA 1FMJA 4MIOA 2MSCB 5AI8A 4QQ8A 1G0NA 3NM4A 4GOJA 2WNSA 1RYYA 1UPTA 2UUOA 3R44A 4GICA 1EAMA 3I28A 3DZKA 2ZYDA 1CLEA 1JSXA 2E4UA 3QXHA 4JGBA 4UTZA 4QM7A 2WLTA 4ML3A 1KJYA 1A8HA 3OO1A 2FMFA 2PEYA 1J0EA 4EUSA 1YQEA 4ZKEA 2D7CA 5TQVA 1YAJA 2EKQA 3SJCA 4U7GA 1E5QA 3C1AA 3P9CA 3QBEA 4EITA 3QVGA 2CDAA 5B1YA 1V6AA 2PGOA 3LU1A 2L42A 2OYRA 4AG5A 1W87A 1P5JA 3L6CA 4CQNA 4HAUA 2B8JA 2JGDB 2PV7A 1OVGA 2WHYA 4Z51A 4ALMA 5CA1B 3WZ2A 3RS2A 3ESBA 1E9DA 5EI5A 1UXGA 1H6DA 3KAJA 3N0XA 1SZCA 4FDUA 5DBGA 2WYUA 3V4LA 2OILA 2VWPA 4FZ3A 1QRRA 2PZAA 3LZ6A 4H59A 1R0BA 4B4OA 1VI6A 4QHYA 4CEJB 2YJ6A 2N0SA 3R3SA 1PEDA 1E2MA 2Q3FA 3VDQA 3W6OA 5HIKA 1N6KA 3EVBA 3PXEA 5TC4A 4N7MA 1XZCA 3OICA 1D0IA 3NTXA 3O0DA 2YJ4A 1IY1A 2D2IA 2KBEA 4P4TA 2PKRA 1HMYA 1XDSA 4MWDA 1ULZA 2F43A 1P7CA 5CW1A 2EXXA 1M2VA 2OP1A 2WMNB 2ZXEA 3BKXA 5F4ZA 1NP6A 1Z5NA 1T9CA 3DNMA 2DWPA 3MCTA 5TB5A 3HSKA 4L16A 1QFJA 1FXSA 1L1RA 1JLRA 2O05A 3E9YA 4RM3A 5TMEA 3R20A 4C0KA 2WAOA 2ZUSA 1DJPA 3U3DA 2WHXA 5TQ2A 3NRJA 3H5NA 1Z73A 1ZW6A 2ACWA 5AKEA 4B34A 4EO4A 4E4RA 4RD1A 5J2TF 3BUSA 1TYDE 3DVAB 5PGMA 2HK9A 3GFOA 4X1KA 1YDEA 3HXLA 4OJNA 1U3TA 2QL6A 2BRUA 1F6BA 4UD2A 4IIVA 5KTYA 1OI7A 2FZ4A 4TRRA 1GTL1 3I6ZA 3C74A 1VJ0A 4GP9A 1JU3A 4O02B 4GSKA 1WXGA 3MTDA 4KNVA 1I5EA 1TT5A 2LWIA 3BMNA 3I9KA 4I14A 2RB4A 4M7PA 3CH5A 4F3CA 2JJMA 2AA3A 3OT1B 4JA0A 5A9RA 2Y05A 3CSDA 1WZCA 4R3WA 1RKQA 3E7PA 1FDWA 2DOKA 3UV7A 4DLXA 5G2OA 3ANYB 4I8IA 4ZVTA 4MPRA 4YI5A 3X3HA 2GETA 3ED5A 5EFOA 3MJDA 3L18A 5J2TA 1WBJB 4INOA 4PPFA 3R24A 4NYJQ 4PGGA 5LU9A 1USKA 4MGIR 1PFVA 3STHA 1C30A 3SM9A 4HYYA 4E6EA 2EKLA 1QIGA 3Q9SA 5I6DA 2Q07A 4I55B 2O3TA 1U3GA 2ZRIA 4HDNB 2DT5A 5HTKA 5JYEA 1PS9A 4R5MA 2ZSDA 3OIDA 4RMNA 1TECE 3PYXA 4CLEA 4ZV4A 3PYLA 3CEAA 5MF6A 1BDHA 2C03A 4N8DA 3DAOA 1C0IA 4RTKA 3L43A 4QU0A 2XRZA 3O94A 5K99A 4ZYWA 3RRYA 1KMIY 1E9AA 1NW3A 3WB9A 5JCPA 1KH3A 3JQBC 1U2DC 1HFKA 2R65A 4OLAA 4JUBA 5JV5A 3SC6A 2VNJA 3FRHA 4ZVSA 1IOLA 3V7YA 1J1ZA 1U5BB 3P0RA 4KXMA 2QXUA 3LQ1A 3RK4A 3VSCA 5L3SB 2JA2A 2NO1A 2M98A 2WC1A 2Z8XA 3HCDA 1KR5A 1X7DA 2BMDA 4YK7A 3MBIA 2OO3A 1JDTA 2HLHA 2VUSA 3QFTA 4H6WA 5F9FA 2NX2A 2VDLB 3GT7A 3Q3CA 3TX2A 2G09A 3UM9A 1FSSA 4XWKA 3GXOA 2PUBA 1EK5A 4FK8A 3ZI4A 2PX4A 4U5QA 2A3RA 1LXCA 1Q7RA 1N1DA 3AWIA 4KBYA 4U3JB 4ESHA 4FT2A 2G9QA 4W1SA 4CT0A 1ZD8A 5KNLA 4FMBB 3DGEC 1NMQA 2FSVC 5D8DA 4YVFA 5CFRA 1E69A 3FNEA 3L0OA 2JHPA 3UHOA 3D8UA 4IHKA 1TUEA 1OW3B 2DRIA 2XH8A 5JJCA 3TNLA 3BDIA 4ISCA 5D87A 1Z25A 3RHZA 4NZYA 1N9ZA 3HUEA 1B00A 1WV1A 2C5AA 3COPA 1ZI6A 1BS2A 3T5GA 1AH2A 3QYPA 3DL2A 4RFVA 4K5QA 2FSPA 4UBIA 4XPZA 5IM4F 5BUSA 2H17A 2X1VA 4OP3A 1I2CA 4LBYA 3NBYC 3FI9A 1CKEA 3K0FB 1Z37A 3B1WA 2R8PA 4S0ZA 3AXSA 4WCVA 4Z1MA 1WF3A 1XD2B 2VUHB 3FLEA 3ZW9A 2PU7A 5HSGA 1SHUX 3DMTA 4MUYA 4DA0A 3QE4A 1PHPA 4YRPA 4CTNA 4Q7QA 1KETA 2DFDA 4BMVA 3F73A 4HRAA 1AHNA 1UKZA 3MIZA 2XXBA 1CUYA 2VWHA 4HMPA 1C3EA 2MSNA 5HQJA 2D74A 4V0KA 5LQSA 1YDGA 3PFCA 3V1KA 1KO5A 3H5LA 2HIAA 5C1DA 1JQJC 3ABSB 5IM4A 4M49A 4JIGA 3G2MA 1S89A 5FORA 3IQHX 2HTEA 5BSUA 3M5DA 3OF3A 3I23A 3KUKA 2E55A 2Z1MA 5C8XA 1JDJA 2FQXA 4FGLA 4NOJA 2J9FB 1MH9A 2CVFA 2VC2B 4JBLA 2R5WA 1KAEA 3F2IA 1DX4A 3STXA 1HYGA 2CF5A 5C8VA 5IVHA 2IPMA 3ZJ4A 1O8CA 5K4AA 4QOSA 1U0GA 3BSYA 3RNOA 3NWJA 3OKFA 4PX3A 2BFBB 4TKVB 4UE2A 2RHLA 2J85A 3DMYA 2X0FA 1MPTA 2BP7B 4OJQA 2D1SA 2CL5A 4RXMA 4QPJC 1HPLA 3V8RA 3EPHA 1NN0A 4FCTA 4Q7LA 5JYDA 1W0JD 2J3EA 3GLVA 5MN4A 1W36B 3WMFA 1RTTA 2ZQ5A 3HG7A 1C3OA 1FP6A 1CQPA 2CMKA 2PRIA 2M6RA 3S0JA 3K32A 2VSYA 3WLOA 4J7XA 5HQ3A 3UPUA 4YMGA 4UZFA 1FYVA 3DDSA 4NBKA 1K2VN 1WABA 5LQCA 3PUYA 1ZH2A 5ALFA 1TQDA 3WGTA 1V11A 4NE2A 3FPKA 5EC8A 3ZIUA 5F1PA 4DYVA 4QWWA 2Z1NA 4EFLA 4NMMA 4KO4S 3PUIA 2Q5HA 1HQDA 4MRVA 5BYBA 3BXHA 2FG6C 1BQEA 1DBRA 1DG3A 2PU5A 4MPPA 2IZZA 1CT9A 3DR5A 1RQ2A 1RHKA 2NIPA 1EA5A 2OBBA 3H4MA 2F3PA 4X1YA 2ZCUA 2RGUA 4MVWA 1E2PA 3AF6A 4HGPA 3G2NA 4JJFA 1UT6A 1Y3IA 5IXSA 4IVRA 5JU6A 2PX5A 2FPOA 4S0XA 5JJKA 5K9ZA 2IUUA 1VLLA 3FYCA 1CDOA 3BH6A 3VR0A 3ROPA 2R85A 3NDRA 4B7UA 3M9XA 2MU1A 1U2SA 2G72A 2IHKA 4FN4A 4LMPA 3UJBA 1FP7A 4X97A 4L50A 5C81A 2QG4A 2R1VB 3AHGA 3M6WA 1N7IA 1DRKA 2CGEA 5E1MA 3RARA 2L17A 2QJTA 4FNOA 3RYCA 1NTOA 2Q62A 2QTTA 4RVUA 4BZQA 2F55A 3KVNA 1ESCA 4ER7A 2XAAA 5CD1A 2XGGA 4OO3A 4ENRA 5DT9A 3ZD8A 4IUDS 5CR9A 2W2OA 4P2GA 1YE8A 4PCAA 1Z2EA 3DE7X 3GLFA 2W6ID 2A9FA 1YR3A 4EPRA 4PC7A 3P2MA 2YMLA 1WCYA 4IEEA 3FOWA 4F71A 5B30A 4AO8A 1OH5A 5G0UA 4IDOA 3MN1A 2PM8A 5EWLA 2BD0A 3D6HA 3RBAA 1HY3A 9LDBA 1R5NA 3SYKA 2P2YA 4XIJA 1O97D 2QQ0A 6YASA 3K0CA 1U4OA 2B1RA 2F17A 2QUKA 5T6BA 3HY6A 2DC1A 4QGBA 4YQZA 2IY8A 2ZJ4A 3I9V1 4ZCRA 4GXNA 2R2GA 2YFQA 1Z2PX 1VPVA 2H2GA 1CULC 3FRJA 3GMTA 4KN8A 4P53A 1JKJB 2CZCA 4MW2A 4BPBA 3PQDA 3VBCA 5AD1A 1YK1A 2AD1A 4QPPA 1WF6A 3AILA 4QYIA 4QOFA 5BR8B 2VZ8A 4F2DA 2VAVA 3K09A 1AGYA 1FTYA 4FC6A 3E2PA 4WCFA 1LDEA 1IXSB 2YHUA 4R41A 1FDOA 3C6BA 1II0A 3RVKA 3VX3A 4EIWA 4GLFA 5KQPA 3PDIB 2ORED 3RANA 3FWNA 2B0CA 3H5TA 4BXOA 2XKBA 4U2FA 4YECA 5DRTA 5EXEA 2PWBA 4BO9A 3UK6A 4V2UA 1SC6A 1W9MA 3M9WA 1E1YA 1LLUA 1DL5A 4MVCA 4NEQA 2PSFA 1GSAA 3MINA 3OAAD 5B4TA 2XTNA 4PYLA 1FTNA 3EGXA 4NP6A 1S3IA 1T8YA 1J0CA 1YI8A 4B81A 4IG4A 2CUNA 2Q6TA 2B7CA 4U7JA 3Q8KA 4FPXA 4NCHA 2E4YA 4RXUA 4GYWA 1M1ZA 3WWPA 1ZN2A 1U7DA 2ZJFA 3UK1A 1Q7TA 1CRQA 4EM6A 3I0NA 2NZUG 2O8VA 3M6UA 4JR0A 5ITSA 3S2SA 4J76A 1O5IA 2JLBA 3QYJA 5J9FA 1XNHA 1YS4A 3F9IA 3GLGB 3AEZA 4LDRA 1ZKMA 1O2DA 2I7DA 2WOJA 2ZB3A 3DOUA 2WFMA 3K3PA 3P32A 2BH2A 1GTG1 5IBPA 3H9BA 2J08A 5LP6B 1E0JA 1E63A 3ILSA 4Z0PA 3UA4A 5C8YF 2AN5A 4HT3B 2IXEA 1B1AA 3F3KA 4KVGA 1KGDA 1RJ9A 1SPXA 4RYLA 1D7OA 4JHLA 521PA 4C0XA 4DMRA 1FMFA 3UEOA 1Z6QA 1AGNA 1J99A 4TKUA 3SF0A 4F97A 2X5NA 4FJ0A 4LBWA 4D9IA 1TRKA 3G82C 1ADBA 3LDHA 1WDMA 2HSDA 3K8OE 4WLNA 2JGNA 4ZHSA 2F2TA 1Y33E 1Z74A 4EYKA 4B3BA 4Q9NA 1E9FA 2H1CA 2X6TA 1LEHA 3ANLA 5BXYA 2X2OA 1V5WA 3H5AA 3TTWA 5DN6D 1ZIDA 1BO6A 5EUMA 1U9JA 3K9HA 4CM8A 3WIUA 3ZJYA 4HNRA 2UDPA 4IYRA 1FYFA 1BN7A 3CKKA 3UOAB 1B16A 3ZS8A 1EFTA 4L4UA 4KXWA 5C8YA 2UUAB 1QE3A 4FCWA 4LMBA 1CETA 3EASA 3QFRA 1QV9A 1Z4NA 4FYKA 4EUFA 2VP3A 1BOOA 5LMZA 2HUPA 4WA7A 4MUXA 2HGZA 4G41A 4LZJA 5DGDA 5A9SA 4FFMA 3D2LA 4EPYA 1TA4A 2RGAA 3CFYA 4RD0A 2IT1A 2WSMA 5SY9A 1NG9A 4H31A 4C20A 2E49A 2YV5A 2IYSA 2XMQA 5A7FA 1Y8ZA 4L4XA 4LY3A 2NZJA 2FR8A 2PWYA 3JQ8B 3VR3D 3Q7TA 2HF9A 4JBYA 3SGLA 2ZBGA 1SUSA 4LBVA 3TTVA 4XX1A 2W2LD 5AK0A 4DCJA 4V1CB 2AOTB 3L82B 3QWFA 1XU7A 1Z4KA 2H07A 1D9XA 3NPMA 3U9LA 3VNQA 2P6UA 3K9WA 4G5OA 5BW5A 1V1MB 2HUNA 4RHCA 2C7RA 3L5KA 1ZL0A 2VDWB 2YWGA 4YV1A 3RTEA 2AF4C 4MQFB 3RAPR 5KYTA 2Z2ZA 5J23A 2OHVA 5JQGB 2QY6A 5F35A 1QAQA 1TEVA 3HEBA 4EP1A 1EDEA 2PQ6A 3DWGA 4S1WA 5T64A 2XUAA 3ADPA 1QRDA 3NETA 4Z49A 4K6GA 2VH1A 1N7JA 4M1ZA 2ORVA 2W6CX 5FWDA 3AEQB 5IT5A 4C7OB 2AT1A 3MS7A 4AUNA 3W9BA 4KB5A 5AHWA 1ATIA 2VH5R 1F1JA 3KPWA 4C0JA 3WK5A 2FQWA 4UVHA 3FJOA 3KR2A 1BVUA 3NHSA 2JIBA 2WFLB 2FUEA 3KBBA 4H9GA 4DLAA 4OH7A 4ED9A 5DNVA 5JJLA 2OSVA 3P9KA 5C2JB 2ZBRA 4DDUA 4FYJA 5H80A 2EZTA 4QXMA 4JZYA 2CN1A 4P2BA 4EJSA 3LFTA 4Z9BA 4OYHA 1F3OA 1RC1A 3QY9A 3N7AA 3V2UA 4IGIA 1L5NA 1TM7E 3AEXA 4DREA 4E2YA 5A3JA 3ST7A 5C1PA 2XWBF 4X1OA 2IWHA 3QVXA 3ZNQA 4HTFB 1R5BA 3IKMB 2FCAA 2XPCA 4RKRA 5IULC 1GV0A 3AHEA 4RSGA 4RTRA 5IUNC 1A27A 2D5AA 3QVUA 3ABOB 1G16A 2QRGA 1SQSA 2BFCA 2OPBA 3OZTA 3X1XA 3N58A 1G5PA 1PJ8A 4H0FA 4RELA 1B23P 4KLAA 3C97A 2VTVA 3LNTA 1GUYA 1FX0A 1XBTA 2LDBA 2QAGC 1AD2A 1U8ZA 5KOJB 4TYYA 4W7SA 3LX5A 1F0PA 1F0KA 4N40A 2NU7B 4EJ2A 2R6DA 1UMDB 4IGKA 5HKKA 2GYWA 4NH0A 1Y5NA 1T8PA 1ZMBA 1XQVA 4MDYA 4AN1A 3Q6MA 2EW8A 4NH4A 5FIUA 5AMXA 3IMKA 3W3AH 4MA4A 5A5EA 1Z75A 1XTTA 1Y8RB 2PZBA 3E5MA 2DJIA 1SBTA 3GX1A 5DJ5A 3KYIB 3T5TA 3ZE9A 4QGGA 4YUZA 1XHFA 1EWKA 3DBRA 3NTQA 4YUVA 1W36D 4GP6A 3SE7A 4MW9A 1V8DA 3EGIA 3PUKA 3OPYA 4B80A 2WA2A 1F8UA 4F4FA 4DR4B 4ZVQA 5GV7A 4CQLA 2XA2A 3I32A 3QTBA 1OXBB 3HACA 3H9UA 3RV4A 1R18A 2IF0A 3F3MA 4FR0A 1G5QA 5DM70 2HJSA 4PC2A 3FLBA 5FUYA 3K73O 5LZ5A 4Z4FA 2QE6A 2HMAA 4JITA 3MFYA 3EIHA 4I1YA 5D51S 3ORHA 4OGFA 3RYIB 1TFUA 3O1HB 2D5CA 2IOFK 3FMVA 3I1IA 4Q01A 4R1OA 4YGYA 2OFFA 5CA0A 1M0WA 1C81A 3L0CA 3MQ4A 3T9CA 1ZHHA 3OWOA 3P52A 4Y3UA 5AXBA 2ZS8A 1J0DA 3TFWA 2WHEA 5L9AA 2NP6A 1SOAA 1YQQA 4RVNA 3F47A 4KU4A 4P33A 3JQAD 2C2GA 1G64A 1UXKA 2Q9AA 3UMBA 5IBCA 1WMDA 4URFA 4LQDA 5BVGA 1WE2A 1U4NA 1KE2A 1WXHA 1OASA 3A7DA 4J0GA 3WRWA 3RS3A 3ZY3A 3KZNA 2CMFA 5KJFA 4OG2A 4ARAA 4C0QC 2JAHA 1XAJA 2BFFB 4FQ7A 3DE5X 3FVQA 1W5FA 1KDPA 2EHDA 2FWJA 3T4UA 3RUPA 3UWOA 2PKQP 4EPVA 3QW2A 2JJ2D 5KTOA 2Y66A 4G0QA 1R6BX 1RYDA 4DSZA 1W85B 2BCEA 3CNNA 4ZEOA 4EELA 1KVSA 2QA5A 2QPLA 5EJMA 3F9RA 2XHZA 4GC9A 2GKSA 1G8MA 2PD4A 1E2JA 3G9XA 2VQFB 1U2QA 4JSRA 5IJXA 2PZGA 3ED1A 3ELYA 5IYZB 2Q1WA 2VO1A 5J4YA 4EA9A 4B09A 5I5EA 2QI9C 3IHLA 2XNHA