1NUAA

Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
390
structure length
382
Chain Sequence
NPTKISILGRESIIADFGLWRNYVAKDLISDCSSTTYVLVTDTNIGSIYTPSFEEAFRKRAAEITPSPRLLIYNRPPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENAETILKAVRREVTPGEHRFEGTEEILKARILASARHKAYVVSAGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQLMFNMALDGPKKKIVLLSAIGTPYETRASVVANEDIRVVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE SYNTHASE
publication title Ligand-induced Conformational Changes and a Mechanism for Domain Closure in Aspergillus nidulans Dehydroquinate Synthase
pubmed doi rcsb
source organism Emericella nidulans
total genus 137
structure length 382
sequence length 390
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1nuaA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nuaA01
3W5SA 4RGQA 1XAHA 3QBDA 5HVNA 3JZDA 1VHDA 3BFJA 1SG6A 1NRXA 3OWOA 4MCAA 1TA9A 1RRMA 1NVAA 1NUAA 1JPUA 2BL4A 3ZDRA 1O2DA 5EKSA 2BI4A 2GRUA 3RF7A 5K8CA 1XAIA 3HL0A 1XAGA 1NVEA 4RFLA 4FR2A 1KQ3A 1NVDA 1JQAA 3ZOKA 1XAJA 4P53A 3CE9A 1NR5A 2D2XA 1NVBA 3IV7A 3QBEA 1JQ5A 1VLJA 3OKFA 1XALA 4RGVA 4QGSA 1OJ7A 1DQSA 5BR4A 1UJNA 3OX4A 5FB3A 3CLHA 1NVFA 3UHJA
chains in the Genus database with same CATH superfamily
1GHTA 1TLLA 3GCDA 1OLSB 5JZVA 5ALYA 1L4UA 4ZZ0A 4YUAA 5IAEA 3ZWDA 1FDWA 4Z5XA 4LNUB 221PA 4OX9B 2CMFA 3GLFB 2HV8A 1F0KA 2GGSA 2OZPA 1NN5A 3DVQX 3IJEB 3QKSB 1UL1X 1U9ZA 1VKHA 2ZW9A 4K3UA 3USZA 4PC2A 1FW8A 2ZJ7A 3H8VA 3FI0A 4I81A 5LA6F 1QZZA 4IH1A 3TR6A 2ZQ5A 1RHRA 4XLZA 4YGXB 4UC0A 4YRAA 1KEUA 2X2PA 5AT1A 4PX5A 3UEOA 1Q6YA 1OFUX 1AUVA 1K3FA 1WXIA 3GQBB 1A8HA 1TVKA 3R7DA 3O82A 2WF6A 2GFIA 1UMCB 5KYYB 5KTPA 3ZE7A 3GCWA 4DV4B 2OM6A 1UDXA 3PYMA 2PCJA 3N2IA 4ZOLB 2GAOA 5D7BA 1A71A 3TOXA 2PL1A 1SKBA 1R9NA 5CDFA 1JDPA 1M74A 4AMYA 4KNVA 4YRIA 1Z5GA 4TPKA 5EXXA 1IN8A 4IVPA 4FGSA 2PUDA 1H2BA 1VTKA 5GGXA 3T0GA 4E4TA 1OZ0A 3SZRA 4MQ4A 3RUPA 3WHLA 4J49A 4G5YA 3ZN2A 3N0RA 2EX0A 4FLMA 5E6RB 3WKEA 3I6IA 1YS9A 5TX7A 4IO1A 4O4LB 1UBKS 4TM7A 1N6NA 3I5UA 4ZT5A 2F1IA 2IYEA 3C5WP 4YREA 3RTGA 1LQUA 2F3PA 1XYVA 3S1LA 1PAUA 5LDHA 3FNGA 2JDID 4NLLA 1DI0A 2C1EA 3EMVA 3VU9A 2BFFB 3RNOA 2HIGA 3AB3A 4YR9A 2GQ0A 5L3QB 2VF8A 3U3RA 4F4CA 2AQIA 2BFPA 3IMFA 5GADl 4K0KB 3ZOZA 2WTNA 3IT0A 1RRKA 4RS3A 3SF8B 1DQNA 3K92A 1KK1A 2FFRA 4RE5A 3ZW7A 1CZHA 1FNSA 2Z56A 5LLSA 3KKQA 3ZZUA 3L49A 5LYJF 4TWAA 1TF5A 1ZN7A 3NEJA 1TYCA 4M9RA 2JGNA 3IB3A 4S35A 3DV9A 1XQVA 2IIVA 3EGDB 1HDIA 4BFSA 1JU3A 1XZLA 3E8MA 4CR8A 3FSGD 5CM8B 2C84A 4FGWA 4IX1A 5DGDA 1WE2A 4D9JA 5IAAA 2RONA 2DR2A 1RAEA 1ZCZA 3BIWA 2ZCVA 2VP9A 4GSYA 5ALMA 2H8GA 1G64A 1BE0A 3IPLA 1W47A 4EG8A 3IOEA 4OBWA 2HQRA 4UHEA 5JMPA 1Q0TA 1G5PA 1KTVA 2ZFUA 2D1QA 3FVTA 2E4UA 3P32A 1YUMA 3CBQA 5AVOA 2DPHA 2VTVA 1DTEA 3ILYA 4GM1A 3WNCA 5AM0A 3CW9A 5DX0A 1HH4A 4YUXA 3AR9A 1H6CA 5LMNB 2IHNA 4URHA 1E6WA 2ZAGA 4PSUA 1RRPA 1DO8A 2XOEA 4IFIA 5CNIA 3MD0A 2QTHA 1DLIA 3PT5A 3LDUA 3A04A 2ODPA 4LE0A 4EJ2A 5AW1A 1CY6A 3ZE0B 5JAIA 2D1RA 4FFPA 3U9LA 2YWBA 3QBEA 4RGBA 1AA9A 2NQ2C 2A58A 4XPIA 2WFLA 1E8DA 2BIFA 4CR6A 3IEMA 1P39A 4Y8VA 5CIYA 1YDMA 2W2KA 5JPIA 4K6OA 4K87A 2GUWA 2YYSA 1ARZA 3LLSA 5F7XA 3LPDA 1ZCAA 3OM0A 3H7IA 1RFLA 1BAPA 3VC7A 1JVSA 3BXGA 3KV1A 4V0ME 5JQGB 3BRWD 3WA6A 2WMDA 4JASB 4RA6A 3EJWA 4D74A 5DSXA 3WHPA 4BO8A 3ODGA 4LRUA 5BUZA 1M0EA 3NATA 3K16A 2AMFA 3KTAB 1QPGA 3FPAA 5EIBD 2W37A 5HBRA 2E49A 4UTPA 4B7UA 1JF8A 2JD2A 3LC2O 1MOSA 4ND8B 3LQQA 5C53B 2X40A 4KFCA 1ZMOA 3B12A 1T91A 4CEHA 2JJ1D 2WYVA 1C1XA 1LLQA 2PZMA 1QE3A 1UOQA 1USKA 1AHNA 2YH2A 4WI1A 4FUTA 2O06A 5HRCA 4P22A 1U9IC 4WOPA 2OWEA 4W7HA 3FJOA 1ZGZA 3CCBA 2WHRA 4KO8A 1A88A 2WKWA 2GHRA 4G1CA 5G4KA 4U2DA 4RMIA 4UOZA 2GNOA 1MC4A 2XI4A 4D9CA 2VA8A 5DHAA 3BT7A 4C4TA 3QH4A 3X2FA 1R0SA 2XTAA 3PNMA 3RARA 1U8UA 1X7XA 3CWQA 5EINA 1W1UA 1D9ZA 1YJBA 2IZ1A 5KDLA 3QEAZ 2O4UX 3OU7A 1PE0A 4UBLA 2XNHA 3AYXB 3VTAA 1W73A 2WVAA 2XCSB 2YZMA 1N8SA 1BDBA 3H17A 5LQNA 3M9WA 4IKOA 2P3OA 2WF5A 2F3UA 3V7FA 3HWWA 3DBRA 4AQ7A 4EQ6A 1JQ3A 4LZPA 5FLXA 3TVYA 4R2HA 5J63A 4AMGA 1K7YA 1YB2A 2RB4A 3AV0B 4QVGA 1R8XA 2H1LA 3ILXA 1NIPA 4I50F 4U2KA 3W0LB 3QTBA 2VI5A 5KNLA 1MQAA 3GUHA 5BRNA 5EKDA 3DR5A 1G2QA 2JFGA 3WVNA 2QQ5A 1QFSA 5FOWA 3ZXSA 4AKEA 3UQZA 2I54A 1XRMA 2D8MA 3NM5A 1XLTC 1AV7A 4FHFA 5FYQA 1AXGA 1P9WA 3PDJA 2J0EA 4BC0A 4B8WA 1W85B 4UHJA 1IVSA 4BQPA 2WUGA 1B76A 5FQOA 1G0OA 4G0YA 1C3EA 3EZ6A 2J1LA 5DJ5A 3B9QA 3N5CA 1SOUA 4X5OA 2D1FA 2OO7A 1QK4A 3MFYA 5ALWA 3E27A 2QAGB 3SDZA 2HWUA 1RVDA 1QO0D 3BZBA 1USUA 4JC4A 4BAUA 1YKFA 1PJBA 2L0XA 1JTEA 3L0ZA 3OZIA 3S27A 3L92A 4P98A 3RIYA 3HDHA 5DBEX 3G2PA 3CBGA 4GG1A 3B6JA 3T99A 1D8TA 4DXDA 1EUYA 4HZUB 3GWGA 2GAJA 4TTSA 1ZK2A 2Q9CA 2AKAB 2H6EA 1E6MA 1I2AA 2AJDA 2QN1A 3TH5A 2DH5A 3BXFA 3GUCA 1KAEA 4QNRA 3LCJA 1YVEI 2YY7A 4C22A 3KELA 2NZ8A 4PX9A 3MT9A 1N6HA 1VJ1A 4KB5A 4BAGA 1DDOA 3R7SA 4HEA6 3I09A 2HNAA 4GM4A 5JHGB 3EEBA 1UQUA 1TQ6A 4XQCA 8LDHA 5KSOA 1SPBS 4IP0A 2OYRA 5BW8A 2WJVA 1AKUA 3C4JA 1F0PA 2O7SA 4NV3A 3VVBA 4K9DA 1P9LA 1SOAA 4WXRA 1DCTA 3FHTA 3GFGA 4E2FA 3LQ4A 6LDHA 2VEDA 4QXMA 4U2FA 3NNSA 4PANA 1II9A 1IATA 4HX5A 4RJTA 4CKZA 1TLTA 2QUAA 3ON5A 1DIBA 4FHCA 5DLPA 2IV7A 1XEXB 1YRLA 2BGNA 2QTLA 4I19A 1DJPA 1LTHR 3MTEA 4P4GA 4TYPA 4FM9A 2W2TA 2M9MA 3F6RA 1K4MA 4U4AA 4MRAA 4FMDB 3FWZA 2J07A 2BZ1A 3N8IA 1Y4ZA 4N3AA 3DMDA 1PL8A 1QVVA 3D3WA 1ODCA 2ONKA 1KA9H 1IXKA 3TXAA 4UASA 2I8CA 2AE1A 3GYGA 4NPHA 2H5EA 3CO5A 1SQSA 3S40A 4CMIA 4PBTA 3D2BA 1Y5LA 2QVLA 4INJA 3R76A 3ML1A 2O2HA 3NHSA 1G4AE 3AU8A 1O5OA 1OHHD 2ORWA 5K0SA 3GJYA 4D6PA 2BFEA 1N2EA 1H9AA 2PKEA 3TB4A 1PKXA 1DADA 1DAPA 2XJ9A 4LYEA 3RYIB 1LW6E 1Y0BA 4E5DA 3BD6A 3HH8A 1Z26A 5FOUA 3TRIA 4A6DA 2RGNC 3CRQA 4W99A 3AHGA 1FFBA 2AMLA 1E94E 1VSTA 2PZKA 2E1RA 1QZXA 4NMMA 4R5HA 1NQOA 4G26A 2QGFA 3EDYA 1D5CA 2FF7A 3Q6IA 2VDLB 4JL6A 1HZZA 4F9EA 4C78A 2O3JA 2ZSDA 1T24A 1YA8A 3PU6A 3SXUA 3NHWA 3W9BA 3G2HA 4WECA 1N0IA 1ZONA 1MB2A 3NOVA 3DLHA 1EFVA 1FK8A 3C7CB 1IJEA 1GSHA 2PT6A 3IVXA 1GUYA 3CH6A 3RUHA 2OQIA 3NW9A 4XFJA 2YFQA 1NV9A 3B1KA 3QVWA 4XD7D 1FX0B 1TEHA 1MJHA 3W6UA 5B5SA 4MI9A 4E31A 3LGXA 3MRVA 3PDIA 2VPYA 3E61A 1O03A 3ER9A 3R6DA 4R2XA 5T8KC 3IBSA 2MYUA 1PD0A 5I9LA 4PBSA 4TV8A 1UFRA 4JYAB 4L28A 2BHNA 5AVXA 4RVOA 5G0SA 3TDKA 1GUDA 1VMIA 2CW5A 4QT4A 5BUSA 4DQKA 1ZRSA 4UMVA 1P80A 2VL7A 2ZJ8A 1ZJ5A 3KL4A 4EVSA 4AY6A 1E79D 2QLLA 3X1DA 2FFJA 2Q1UA 2RGEA 3UBTA 10MHA 1SCKA 1N2GA 2DBYA 3AVOA 2X4IA 1IZZA 3F6BX 3HJNA 4ZU3A 2PE5A 2FUNB 3BH7A 4ALIA 1R18A 1U9YA 2G7ZA 2VSYA 3I6QA 2O0HA 2HUNA 4H3HB 1J4AA 2MSWA 4LGVA 1L3CA 4U7JA 4JXXA 1JQJC 4ZZ1A 3EVNA 1N7IA 2ILTA 3UENA 1AZWA 1RLIA 2WKPA 3H3XA 3TPCA 1UKCA 3EIUA 5KNCA 3DC2A 5JXGA 3MPOA 3DHVA 1Q7TA 1DC4A 1RACA 3O26A 5EYPA 5C7OO 1JR4A 2D2VA 2Y9MB 5ER6A 7GPBA 5JAOA 4N40A 4GPBA 1X0VA 4RNDB 2R8RA 2SNIE 2WFAA 4YP0A 1AGYA 5AKEA 1UIMA 2GEUA 3FFXA 4JODA 3UWPA 4DM3A 4ZYUA 4WDQA 4RCZA 3ESXA 3ZKAA 3TZHA 4G25A 4UUMA 3SC2A 5FUYA 3B6MA 4AP5A 5CFLA 4GW3A 3A6ZA 2CNLA 3A6GA 4PBRA 1DFIA 2B4RO 3D0RA 2ZUSA 2WHQA 2CKMA 4GX5A 4EVRA 1WP9A 1FUYB 5HF5A 3VU0A 5DTMA 3GLQA 4AF7A 2HWKA 1G2PA 2WV7A 3HYLA 4LA4A 2JHPA 3A1SA 4G5FA 3Q5GA 2GM5A 2YS7A 4LMAA 4BVBA 2O9JA 3RYCA 4M9UA 5HOQA 3IL2A 1J0DA 2D13A 2XODA 4OJQA 3LF1A 4BNNA 1DZ3A 4EFMA 4JI6B 4WERA 5HZMA 5BPHA 3PJGA 4PRLA 4ESEA 2YV1A 4XIFA 4B3SB 1Z6AA 1V11A 2BEVA 5BN4B 3LRPA 1W4ZA 1C4OA 1EK1A 2WW8A 5EE9A 2UVPB 3WGOA 5HZHA 3C5CA 5IMSA 2P5SA 5AJYA 1IUKA 1KDPA 2E0IA 4QJBA 1AURA 2JVIA 2KS6A 3EG9B 3LY7A 4GR9A 4LI0A 3CUWA 2Z8YA 1NJ5A 4OFXA 2OOSA 1E8MA 3AKYA 3BE6A 3GVIA 1JDUA 4HPJB 4CLOA 2XBUA 2VPIA 2YOGA 1Q1EA 5D1HA 4N41A 1Q77A 4TMVA 1J8VA 2XMRA 4QDUA 3MWGA 4LGMA 1MABB 5HQ3B 2H7CA 5CD9A 1M7BA 2JEOA 5ECDA 4DMLA 1GPKA 4PG6A 1PN3A 3PEEA 1F8YA 1H66A 3CN9A 2NGRA 2GXUA 1QIEA 1RLTA 4DFDA 2IH4A 1AGPA 3DMRA 3GRUA 4HNHA 4BMSA 1L5QA 1V41E 1ZUNB 1Z68A 1QFJA 4ER6A 3WWZA 4IDEA 4NVRA 3FKSA 3EMKA 3REGA 4DLXA 2Q5JA 4OQZA 4TTTS 1LPAB 1QO7A 3KUCA 3PD7A 4N9QA 3RBXA 4IBOA 4AJPA 4YMLA 3T4XA 2EWMA 3AG5A 1KAMA 1XZAA 2AD5A 2J5KA 3PJFA 3W8EA 1MDBA 4Q4JB 2Z5LA 1F9AA 3C6MA 3ZWQA 5KB3A 3K9GA 4K88A 1FXWF 4OEHA 4K1LA 2Z2JA 1JKMA 3T8YA 2B34A 2QE7D 2V7XA 4OO3A 4MUGA 4DLZA 3ZD9A 5LXTB 4D26A 1JYEA 3H6GA 3EGEA 3K4PA 4N54A 2FZVA 2Q9UA 3DMYA 4FDTA 1LEHA 2CZGA 4RPIA 3SEFA 9ABPA 1RAIA 2H0QA 2YZNA 1A9PA 3C8DA 3HKDA 4BDTA 7AT1A 3LL7A 3AWIA 1RI2A 3K2IA 2NO7A 4XX0B 4CQMA 4EHKA 4DZTA 4PYMA 1T26A 4P83A 3FMPB 3FPSA 3JASB 5FYDA 1GPMA 1IBRA 2DQ4A 3ITEA 3R20A 5HHTA 5KMGA 1PW7A 5DYIA 3JD0A 2JVJA 2VJCA 1DC8A 4FCTA 4TUYF 3I3SR 4ZYYA 2CYAA 4S05A 2XDYA 3H1TA 1Q57A 1VCHA 4NONA 2WT9A 2ZE7A 3VR4A 5JU6A 1DKRA 3RT1A 3KB8A 1DL5A 3OKFA 1H5QA 1P73A 2IKQA 2XWBF 1I30A 3C5EA 5EXPA 1Y9ZA 5BXQC 5IT5A 3NU1A 1EP9A 1FTWA 2RJ3A 4PQFA 4UD2A 1GGMA 4Y1RA 2JEYA 4RORA 2FQWA 3TJZA 5CAEA 3C39A 2GN9A 2JD1A 2XJ4A 2R97A 2FPSA 3GBVA 1YBAA 3R5JA 5DM4A 2Q6VA 4WXPA 1PZEA 3NONA 3L6EA 3STVA 4O4HA 2HKIA 1RRVA 4KAJA 3KU1A 2C3PA 4DV2B 2FJUA 4TMFA 1L5VA 5BUCA 3OIGA 3ICCA 5TQ2B 4EJ0A 3ZHTA 1NE7A 3HCFA 5J5VA 4C07A 5M7EA 2YJ4A 5T6BA 4XOIA 4C05A 4LEIA 4V02A 3PJDA 1G60A 3U39A 2I7VA 3WG9A 3OG9A 4AJOA 1R0KA 1MFPA 1SC9A 4WFJA 5K3FA 4OLBA 3FNBA 3R75A 4F5WA 1W8IA 1DX9A 1I1OA 1XU7A 2RH8A 2B61A 2HMSA 3D8TA 4CPDA 2JLXA 5AKLA 1P2DA 2GBGA 4MYUA 4OVKA 4B43A 1RYNA 2QS9A 3ABQB 5CBPB 1VJGA 4ONEA 3DAGA 4N5NA 4QPZA 1U98A 1KRWA 3UHOA 1AIPA 2JL1A 2BHLA 1RJ9B 2VBGA 4L16A 4MR7A 1A9RA 1TO2E 3JYQA 5J43A 5EP4A 7MHTA 5DCYA 3OMXA 2X4DA 3L8CA 2Z6UA 2PVCA 1Z4KA 2N47A 3MA0A 3GLGE 2JI6A 3NZEA 5G0WA 4AM8A 1GCIA 1EVYA 3E3OA 3BL5A 2IS4A 3L0OA 4M7RA 2PDAA 9GPBA 3L0DA 5C37A 2J59A 4UVGA 3AIOA 1S2NA 3NFYA 4WKPA 5CXXA 3OT1A 4A23A 5KTYA 1Q7CA 3ZU4A 5J4YA 1C8LA 3HR8A 4R0MA 1NZJA 4ZAFA 3GLGB 4FD3A 1DIHA 3KLOA 4P3KA 3FDXA 4DMRA 3CGWA 2O5EA 3C41J 2AI3A 5K99A 3ETJA 3PIIA 2AWOA 3PGMA 4BRSA 3ABZA 1ETUA 3HJHA 5IJ0B 3UAXA 1DKMA 3QLJA 1RAFA 4RK6A 3LNTA 2GMWA 1NSFA 3E6AA 4DR2B 1G4HA 3DEJA 2ZBGA 4GXTA 4N49A 4G1UC 2IYFA 1Z0AA 3IPCA 4RJJA 2RE8A 2QRVB 1IJKA 4JXZA 2WD8A 3FTNA 2OZVA 3G7NA 4XARA 4EDHA 5A9RA 2EKDA 5HZKA 4QJ4A 5A2GA 2HDHA 4AYXA 4MQMA 3HR7A 1PTKA 1W5SA 2ZRJA 1TQ4A 3FHCB 4Y0VA 3F73A 2ICAA 4OUDB 4NCNA 2P6RA 1OI3A 1FYXA 3IMEA 1TKBA 4YC7A 4BJ5A 4O2BB 3WDMA 3UK6A 1B15A 3D54D 4DLAA 2ZAYA 2FZLA 3V2IA 4ABYA 1D2RA 1SKAA 5FR1A 3FCCA 4UFNA 3EQ6A 3R9KA 2KE5A 1RQ7A 5JMWA 3AUYA 4QBFA 4BB0A 1QK3A 2GSWA 1JT2A 2FZEA 4ICIA 1IH8A 1BA3A 5AVZA 2CYCA 2CNWD 1R0RE 2E18A 3Q9LA 1SIOA 2I78A 3SVLA 3BDVA 2PL3A 1NDHA 4RA9A 4MUYA 1R9GA 1GV0A 2VRCA 4AY3A 3QF4A 1N4DA 4C0QC 3I61A 1GNSA 3IQEA 4BTVA 4DA9A 6NULA 4LKRA 4RPKA 5HKBA 1SUWA 1UM9B 4DSAA 1ZJJA 2D7CA 1TU0A 4RY9A 1AUPA 1X7GA 2JI8A 2YYZA 4RK4A 2EWVA 4IIFA 1US8B 2GN1A 1Y8QA 2WU8A 3T6KA 1RM4A 2B8NA 3OCZA 3RK4A 3UB4A 2X8WA 2GR9A 5A5VA 2VIIA 1JHOA 2R2GA 1CT9A 1DRVA 1UPXA 1IN5A 2GKOA 4I6JA 5IS2A 4IXWA 2Z6QA 3ZQKA 4RF2A 4XVQA 2BGKA 1N2XA 1SC1A 1P0PA 3CLKA 4WDRA 2V0GA 1V1MA 4R2KA 3RU7A 4D7AA 3VR5D 3NIWA 1IU9A 4I9FA 4BU0A 1U8YA 3FNIA 1RABA 4QYIB 4ZVMA 4C4OA 3MELA 3PPVA 1XVIA 3DDWA 2AN1A 2X5NA 2OHGA 3PX2A 3R3SA 4G4GA 2GO1A 5IWCA 4XWYA 4ZXFA 3VR5H 4CLHA 4HVLA 1KZ9A 2P6OA 3RFXA 5JANA 2QB5A 2OCAA 4R2MA 2NVUB 4ETMA 4OHOA 1FNMA 1KYVA 2GT1A 4GDMA 3SSOA 2ZYDA 4M1TA 1T4MA 3T95A 2DGDA 2R00C 2NSYA 4RD3A 4FSXA 1HA3A 1PFUA 5MN4A 3KPWA 4P58A 1SUSA 2Y0BA 4YO8A 4FR0A 3TOVA 4Y2JA 4QFMA 4PFSA 3KJEA 3K1JA 2BF7A 5A02A 2YUIA 1GITA 1XN4A 3K8ZA 1I01A 3GPCA 1XJWA 2CL6X 2ZAOA 5B4UA 5IZ4A 3M4YA 4LJ9A 3B6ZA 2FFAA 2C3MA 5C8YB 1E62A 2QY6A 2GD0A 4HGYA 4XH9B 3F7TA 4DG5A 5CA1A 1I2CA 2OZEA 2GYYA 3C48A 3RSQA 1SHZA 6Q21A 1MR3F 1QYWA 4IZ6A 3UJBA 3B51X 5FPKA 3OC0A 3O8OA 2V9CA 4JKIA 1VA5A 3T5BA 1TQ8A 3INRA 2BFDA 2VQ6A 2EC5A 3SC4A 4UJ3A 1CJTC 1RNLA 1XVUA 2AQHA 1D04A 2PPVA 2CEAA 2J30A 2PEYA 2ERCA 3BMQA 3KOUA 3Q3IA 2H4FA 1NTOA 1TYEB 1XFAA 2RKOA 2WAXA 2Z4RA 3AM3A 3IQXA 1PTJA 4MQFA 4PIPA 2FZ4A 1V1RA 4QUIA 5A4KA 1Y6GA 4CM3A 4C87A 2I3AA 3ORQA 4C5BA 1MJGA 1K9SA 3G9UA 4BVFA 1NJ1A 2ZIZA 4TTIA 1C3LA 5A4DA 1PFGA 4G1VA 2DBZA 1DC3A 1CUBA 2AX3A 3T1TA 4TTPA 2WK1A 4Q48A 4CG0A 2DFTA 5JEDA 1P91A 3TMAA 3K9HA 5I7EA 2O19A 4ZOQI 2I1WA 3L4KA 1EUCA 4HV4A 2FHSA 4MKHA 3A26A 3AONB 3RO7A 4G9BA 4GMXA 3HL4A 4I8DA 1Q6ZA 2ZYVX 4URUR 2QBYA 3DKKA 2ZIXA 5K0CA 4YROA 4ZK6A 3MCZA 4UZSA 2GB4A 4DKJA 1H2ZA 2Y2UA 1NBEA 3S44A 4H7KA 4TWZA 2RG1A 2EKZA 2Y3IA 1ZXBA 3DV0A 5JPDA 1M2OB 4C4SA 2A9QA 1XD8A 1E2JA 1L8AA 4BQNA 3C6BA 3X44A 4PYOA 4PLGA 5DYNA 1MO6A 1NP6A 3O7MA 5FWNA 1P0MA 3DE3X 1KC1A 2N9UA 2WPDD 3DAYA 1D2EA 1YRWA 2V74B 1ZY2A 2VPPA 4ZVOA 5B3KA 3AJDA 1E4YA 1ZD1A 3ZYCA 1WG8A 3MVEA 3U40A 3EGCA 4P3XA 1KS2A 3AIKA 3AXTA 3IIEA 3WB9A 1U2QA 4FDVA 4K03A 4OHVA 2ZE5A 1FFXA 3BD9A 4MQ6A 3NDBB 3BIOA 3CRNA 1AHPA 1WZ2A 3AOGA 5AJVB 3I8OA 4M0CA 1IM2A 2BFAA 1E7MA 2WE7A 3WYAA 2IP2A 3O47A 1QGZA 2F1HA 5BORA 3MWEA 1M2VA 2YBEA 1GAJA 4RZSA 3SWWA 3OJXA 4RVFA 3VSEA 4KQJA 5E7JA 1KI6B 3RC2A 1GCUA 2X42A 4JLPA 2JGLA 3IOMA 1FTSA 1GGKA 1LJUA 2W9XA 4EUKA 4DCUA 3BD8A 1GTJ1 5K6TA 1NLZA 2PZFA 3FROA 4IJWA 1XPOA 1PQYA 3P96A 3KXKA 4PYQA 1E1RD 5CVVA 2WVGA 2O57A 2YIDA 3FUVA 4X62B 4RTPA 3Q6MA 3A1DA 4X3OA 4RO0A 5ITVA 5KBYA 3ETLA 2PLAA 3SQNA 1QH8B 1ES9A 1AF4A 1WQ3A 2I3GA 2W2QA 1EFUA 4BUCA 3V8EA 4QU8A 5HUQA 2ZREA 4GKVA 4RTMA 3KDAA 4IRMA 2IXEA 4C14A 5K8CA 3F9IA 5IANA 4QOJA 3ZDZB 5LZ2A 3PXAA 5C1DA 2PXHA 4EHAA 3R74A 1NFFA 3LCVB 3E8SA 3PQ6A 4ZDWA 2OPBA 3TNLA 3NAMA 5I45A 4DDTA 1O8CA 4CNQA 5E0OA 1X86B 4RHTA 3RC9A 4PAMA 5CITA 5TPZD 2DHEA 4UPVA 5IUJC 3H65A 2GYWA 3MT0A 4EO9A 1F4PA 1KYZA 2JGFA 2XVYA 1EBFA 1DKQA 2QRNA 3KOZA 1H9BA 3O3MB 4KVAA 4Y18A 5J2UF 2QRLA 2IK8A 4TV9B 2I6GA 2F43A 2Q0QA 3AVXA 4B3RB 2FV8A 3OLZA 4B6PA 2C2MA 3HB0A 4NOKA 4KPFC 4Q1DA 4RCVA 3CN7A 3JQ7A 2NXJA 1DT5A 4JCCA 2EBUA 2GZHA 4N7MA 5TMDA 2R8YA 1ICIA 3W5DA 3DXZA 1ZIPA 5BWBA 4KQMA 3HWRA 2DM6A 3JD3A 4WBNA 4HB0A 3SICE 3CLSD 4EA7A 5BN1A 4JT4A 4BWFB 5HS6A 3ZCPA 4PGFA 4HDSA 5H3LA 1LDEA 3CG4A 3HCPA 2WSIA 4Q1EA 4TROA 1XZGA 4CM8B 1W8DA 5KOJB 1ZOLA 5B3LA 3OX4A 2KSQA 1H0RA 3ED5A 4Z2AA 3EPHA 5EP1A 5FCDA 4MLZA 5JC8A 4MIOA 3IMGA 1V95A 3A2MA 4FYJA 4G09A 5DHTA 4W1SA 4AP9A 5BW4A 1ZWLA 1LX7A 4UTOA 1DEOA 2OESA 5DN9A 4FONA 3M49A 3FHLA 3KNZA 3HZHA 4JJ6A 1AMUA 1KRXA 3H4IA 1ZITA 2VQFB 4B74A 2FWJA 4ZI7B 3EDQA 2IOFA 2XB4A 4NZYA 5ESWA 4IOLA 3HK2A 3ZHCA 1DCKA 1ZPDA 5DISB 3L7CA 1G5RA 2F62A 4X1KA 3Q2IA 3ZGOA 3CKLA 5DHRA 4EI9A 2B98A 1SUBA 1U0TA 2HLNA 4YJ3B 4Y9SA 1EWVA 3DFIA 3PPYA 2LV8A 3V4LA 5CXQA 4QGSA 4BGIA 3C3KA 3CVUA 5F4BA 3DO8A 3KWMA 1QLHA 2PS0A 5FIUA 5CEEA 4B71A 2WNSA 4RGVA 1E20A 2KBEA 2QMZA 3G8BA 4BO0A 4K9QA 4JBHA 1ANKA 4IJMA 2PVPA 4YUYA 5LQUA 4NJEA 2AB0A 2XQVA 3AO0B 3GPBA 3UFBA 3W2FA 1A8IA 4B3GA 4PG4A 3KCQA 4N03A 4FWBA 3LDAA 5EZYA 1UR5A 3BWMA 1XMQB 2ZRGA 1QRAA 4S0XA 3L4SO 4BFVA 2JGIA 4R1MA 3D8RA 1W0KA 4BFZA 3ICPA 3D2CA 3AEUB 2O0KA 3GZJA 3Q0EA 3RD5A 4CTJA 2DETA 2HJRA 4NECA 3EXG1 3P8ZA 4FLFA 3HRKA 3IHLA 3ZWBA 2DTEA 3QW2A 4PZAA 4X7PA 4C1BA 5TEVA 5BVHB 4KPEC 2FDRA 5B2FA 5LDDC 5GY7A 2P9BA 1U4SA 4DA4A 1RI5A 3L8YA 2VHWA 4D57A 1L5WA 3TUZC 4F4JA 1T0UA 1U0LA 1BHO1 1G8AA 4KIJA 5FPSA 4TS3A 2Z1NA 4OFZA 2GPBA 5A4AA 1W5EA 3MJHA 1W0CA 3SEAA 2Y68A 4MW0A 2QI9C 2E48A 3NAGA 4PTZA 4WNIA 3MMPA 1PR6A 1Z0IA 2FG6C 2GD2A 2HJHA 2WWTA 3IX7A 3ORYA 1IHPA 4W7IA 3ZWVA 5AQ1A 2YWGA 2B7LA 4OP3A 3GVCA 3H11B 4BNFA 2F3TA 3DF9A 4EFNA 2B4QA 2HPVA 1WCIB 4I9NA 3NCHA 2QMOA 3S81A 2C1ZA 1WNTA 2ZB8A 4ND6A 2IJGX 3HI6A 4US0R 3FDFA 5EHGA 5EMHA 1DG3A 2QD3A 3PVCA 1A7UA 4N7RA 4TXNA 2QTNA 1V7PC 3TW8B 4YFVA 5FOTA 3PUIA 3QUTA 1YDGA 4GZ3A 4WW0A 3ZDEA 1VE6A 3QPBA 4DREA 3V9PA 4EAAA 1OLSA 4LXIA 3NANA 3REOA 1JYFA 3RAGA 5MDHA 2P5YA 2PX2A 4LNUA 2IX9A 2ZT7A 4LV5B 1SKUA 1ZINA 4I55F 1NXOA 4R1SA 4DWWA 3GLFA 5IXSA 4TRRA 3OKCA 3QKSA 1S3SA 4LFBB 3OX1A 4UNIA 4YP5A 5ILQA 5LYYA 2DG2A 4LF7B 2VTKA 4LDZA 4EH1A 1VE7A 2CMKA 1J33A 3MCWA 3NYQA 4J7CA 1YI8A 3G0GA 4KG7A 4H3KB 2Z2YA 1K7FB 4K9PA 4I3GA 3UMVA 4RULA 1B2RA 5I4BA 4CGZA 2I7CA 4L15A 4BFLA 6GPBA 1BC5A 4MRPA 2IYPA 3L8GA 4L22A 5FADA 1KBZA 2ODWA 3AR2A 3ZD8A 1IDOA 3GQBA 2HMTA 1PZMA 3G88A 4UDNA 1OFVA 3EOAI 4YMIA 3VHXB 1JHZA 1H0SA 1ULTA 3O3NB 1UMCA 1J2TA 3N0XA 4ZREA 4EB6B 5KYYA 1A5AB 1EQUA 4ZOLA 5K0EA 1ORRA 1YA6A 1M5UA 1NOJA 3SAJA 3IHWA 4D0RA 1T3HA 2XGJA 4PLYA 1NR7A 3TOCA 3MAAC 2X3UA 4X6YA 5KWEA 1OD6A 1O2DA 1KQFA 3PHCA 1UT6A 1CX9B 4ZHQA 3HL0A 4IV8A 5A3SA 1S2LA 3LPNA 4MMYB 3RYCB 1OGYA 5CH5A 4DT1B 4OB6A 2VHZA 1ZU4A 5E6RA 3IPYA 1IZ9A 5FTNA 4XVCA 3NWJA 4J3NA 3GGJA 5AJHA 2DQSA 1YH3A 1YU6A 3DR3A 1LPPA 4JYCA 4O4LA 4WLOA 3TSAA 2WU4A 1E1LA 2C58A 2VNJA 4FYPA 1EWRA 2CXPA 2GCOB 4I6GA 4LDNA 1CDZA 2J3HA 4QUEA 5DKFA 3MERA 4EHBA 4ERXA 3TCNA 2HSGA 4LJ4A 2OV3A 4KP7A 4F8JA 4FB4A 2VAVA 2FSSA 2BFFA 4M37A 4XW2A 1ZK1A 5L3QA 2VTEA 2X76A 1GCGA 5K1ZA 2VAWA 5MN5A 1AU9A 1I7PA 2ZBRA 3BFJA 4EATA 5LSAA 1XEWY 3JWPA 1XT6A 3SF8A 2AQ8A 1OIWA 3AKEA 1CZOA 1ENYA 4M88A 5CDUA 1RYMA 1RIIA 3IPXA 1KKMA 4N76A 1PLKA 1UK9A 3ZDCA 3EGDA 4BC1A 3DM5A 3LYUA 1Z0DA 5IPFA 4J16A 3L7AA 2C3UA 3WQBA 4R3WA 2G76A 1QHGA 3VU1A 3HU1A 4HX9A 5CT5A 2DSNA 2NTNA 5ER9A 4C0WA 3A25A 2ADMA 2P78A 4HRAA 3RIEA 2YC2C 2JJ2D 5A7GA 2NT3A 2B8WA 2IS6A 3LYAA 1SAYA 3EBLA 5AUQA 3F5SA 4Q1AA 4D44A 3KKLA 1N2BA 2YN0A 1QBKC 3OY7A 3BH6A 3WK6A 4S1TA 4HLUA 4BVKA 1YR6A 2ZYGA 5L6LB 2Q3LA 4HXGA 1DCMA 2ZB7A 4UTVA 2EX4A 4OSEA 4PZCA 2A4KA 3KVRA 1KS9A 4JLKA 2X86A 3F98A 5IRCD 2XBLA 3LUGA 3ACCA 3A9TA 1QOQB 4WV3A 5E7QA 4AKIA 3BJZA 4JYBA 3DZIA 4KWTA 2VP4A 2GUGA 5A5DA 1HRDA 1UODA 2VEOA 1Y5MA 2LDBA 2QGNA 2Z5FA 3QVTA 4QREA 1T0IA 4EVIA 2IBSA 3EF3A 4QL3A 5J23A 2QAJA 1ZK4A 2M1XA 1V3UA 2Z9BA 3FOZA 1U5BB 3NO4A 4DLLA 5COBA 4Z1MD 5JZSA 3CWZA 3UXEA 1R6AA 3GRKA 4EA9A 3B20A 3U3ZA 5D1NA 3V9AA 1Y1RA 4EF6A 5JQGA 1HDZA 4EUSA 5JVDB 4NMHA 3ND5A 2W70A 2G7MC 1O6GA 2ORVA 3ISTA 1QRDA 3KTAA 5C31A 4FYHA 4KNWA 2AMYA 2WTAA 2JI7A 4B6OA 3HEAA 4U7WA 3FSGA 4GIBA 4ND8A 3VOAA 5CMLA 3O03A 4Q4HB 1VPLA 3IRVA 2EKQA 4OP2A 2IYYA 2HA5A 4QGBA 1K06A 2ONCA 3V3KA 5CJ2A 1V9LA 1IY1A 2FE4A 4LRWA 5CCDA 4UBOA 4V0MA 5KNDA 1RXVA 1V48A 4B6GA 1YFJA 1DHTA 3JQAD 3UWMA 1UBUS 5JS7A 2Y1DA 3DO5A 1WXWA 3GIWA 3CINA 3GVPA 2WIDA 3TIIA 3LX5A 3K2BA 5ES3A 4KMSA 1U7XA 3QX9A 1T2CA 4QODA 4Q21A 1Z17A 4ZV4A 1DCFA 1XZMA 1O97C 5JWRA 1KXJA 5D5HA 2LW7A 1WNFA 2GEJA 1NNUA 3H9BA 3EVGA 3PGJA 1AB5A 4BMDA 5CB4A 1P4RA 2PHZA 3R5TA 4DXHA 4ZQHA 4KJZA 4DWVA 3KT3A 2BJWA 5E95A 2QW8A 4NI5A 3W2EA 4CDRA 1LLDA 4V0QA 5TJ9A 1W59A 1GRRA 2CJYA 3V8MA 1T1GA 3W3ZB 3KWLA 1HXHA 4UBMA 5B12A 1E7WA 2BEKA 1U80A 3GUZA 1OBVA 1T0JB 2M1ZA 2NO1A 1F0YA 2WG0A 5A5FA 2YY6A 2G1JA 4JP1A 5ILGA 3R7LA 4EGSA 3DDZX 3F90A 3CNNA 4EB3A 1WSAA 5H3CA 4F6CA 3PD0A 2DWOA 3BRWA 2GBPA 3U3DA 4LRSB 3RUIA 2NP6A 3H1BA 2XDQB 2XYHA 3HYNA 2I7DA 4NCHA 2AYYA 1GRVA 3BUSA 4QPPA 1O54A 5DWVA 5DOVA 4IINA 4OFBA 4PIMA 4B4OA 1V39A 2JC3A 3TE7A 3WYGA 3CPHA 4JJ4A 1KAQA 1PNTA 3MJDA 4ZCQA 1TO6A 2JJ1A 2PV7A 3BRCA 4OCZA 3L79A 2ZS7A 3HDTA 2Y1EA 1XAJA 2HJVA 3O1HB 5NLLA 2YW2A 3R4CA 2BI7A 3JQAB 3DZCA 1UDRA 1XRRA 4K2HA 4MWBA 1Q17A 4UULA 1U0EA 5FI5A 1JBEA 2QAGA 3I32A 3QVSA 5L7WA 1OV4A 1SCNE 4O33A 1CRZA 4UEQA 4D0LB 4RNCA 2RHBA 3MOGA 4B3JA 4C7JA 2QVZX 4G41A 2Q4EA 2MSDB 2IYNA 1FYDA 1NYLA 3N59A 3PGA1 1BYIA 2XKAA 1VXRA 2CHEA 1OZAA 1FA9A 1IPEA 1HWYA 1RC0A 2HYDA 2VG8A 1AN9A 3FFAA 3QXXA 4HZUA 4F2GA 3ZZNA 1MD9A 4RELA 3TQTA 1P60A 1KSJA 3HJBA 4U7TB 2GPJA 3L1KA 4HXYA 1AUQA 2V97A 2Q3EA 3H04A 3LQFA 4GPAA 3JR7A 4RD4A 3VMMA 2VRNA 5CFMA 3T7AA 3DFFA 3W2GA 5JCXA 1IEXA 4EFDA 4BNLA 4JBGA 2HPAA 4TMTA 3MWKA 4RL6A 5TXGA 4DLNA 1W25A 1ZM7A 2J3DA 4IJKA 4NZOA 1BWRA 4QX6A 1NZFA 5B4VA 2B1QA 4FNAA 5I7FA 3GNTA 2ZJOA 1K7EB 4DQDA 3Q0TA 3QHAA 2VBFA 3MLBA 1RT9A 2JGJA 2G9VA 1FP1D 3ICOA 4LBZA 4OLFA 5ENDA 3FVVA 1XEXA 3SU8A 1EDOA 1XQ6A 4QT0A 5KYKA 4D92A 1HTTA 3EXIB 2XR1A 1EWYA 3E0QA 1CUYA 2RH9B 2CXTA 4GSKA 4L2IB 4QDKA 3ILHA 1K4KA 1GUAA 1ULAA 1VSUA 3IPRA 5F7ZA 5DNYB 4TWIA 3RSCA 5CK4A 1QRRA 4Q9LA 3ROGA 2PZBA 4PO3X 3KEFA 1DFGA 3CR8A 1ECLA 1TUBB 1M2JA 4PO1A 1CUJA 4IW3B 1VBFA 1R0WA 3VTZA 5EFZA 2FETA 4G9EA 3CVXA 2UV8A 1XTUA 3G79A 5DLDA 3NASA 4H3VA 1LXCA 1Z4JA 3RYIA 3DAHA 1EJ0A 1F1BA 2D6FA 1TQHA 1SVLA 2I99A 3QSGA 2C00A 1L8QA 3QPCA 2H2HA 4J2HA 4JH0A 1YGYA 1ZNWA 1XKQA 4HDKB 4O25A 5DLQC 4C5AA 2QHXA 3WTCA 4LY3A 4Y6LA 4J4HA 3V4OA 4L9WA 1YFLA 4PQEA 1GZHB 3BCRA 1GFIA 3DBOB 3O4GA 1TXGA 5AW8A 3D02A 3LHIA 4OQLA 3ZKWB 3VSCA 3AJAA 4MIEA 1YGPA 3DAPA 3P9SA 1E5XA 1X7DA 2JGMA 3OIWA 2Z09A 5F5LA 4Z4EA 5HCUA 4N3CA 3BKWA 2CGEA 2Y8EA 2WYIA 1H69A 2H1FA 1R10A 1FX0A 1XCPA 4ASUD 1WVGA 3DZGA 2PRZA 3EDRA 4A5OA 2P75A 5G4LA 2C5SA 3R6GA 2VDOB 5DYGA 4AUMA 4D1YA 1JEAA 3G6WA 3R41A 1AUOA 1IJBA 3ZHOA 1W34A 3LZCA 4K9MA 1MRNA 5IBRA 4CUZA 4YMHA 2B1GA 1MENA 3HCOA 4OU4A 2WUWE 4PVDA 2D1YA 2GYVA 4RZHA 3SX0A 4KFTA 3VO8A 4ZAGA 2ZJ0A 2AF3C 3CNLA 4BQFA 1BDHA 2XT9A 1XMJA 1Y1PA 2NU6B 1GZUA 2YWFA 4QYTA 3RKUA 1GVHA 3O0TA 4UEJA 3GEGA 4KH0A 1HTBA 3OZCA 2VPZA 1EG7A 3EYWA 1UDBA 3G8DA 4FZJA 1OHHA 3FWNA 4IUYA 1Z5VA 5AVKA 1RMTA 1NTRA 2W2PA 4ND2A 1PJQA 2P2CA 3TSYA 1W46A 1ULSA 4MI6A 4QICA 4MDHA 3LU1A 4DEVA 3UUEA 2HA7A 3TZBA 4DV5B 3RRZA 4DMMA 1EM6A 2XYRA 1FU7A 1S2MA 1SIUA 4TLMB 2WSYB 4LXTA 1FEZA 3JVDA 1IPHA 1F06A 1JHQA 3KX2A 3IXMA 1TCCA 2CFTA 4Y6PA 2AJBA 4RKFA 1I8TA 5J1SB 2XZOA 4J0FA 3DDSA 3RLIA 1MOPA 2KQUA 3A6HA 3HDQA 4NBUA 5I5GA 2YX1A 5HIIA 4W1PA 3RYTC 4HTFB 4E5VA 3GFFA 2J3JA 2HHLA 3RVOA 2C5FA 4XD7A 5DOZA 1P7CA 2VUSA 5DK6A 1NBOA 2IGBA 1NQTA 2GF9A 4OJYA 1IXSB 3GLTA 4B75A 3FOAA 5TY0A 4C2UA 4ARCA 1B0ZA 4HZIA 3IALA 3LK6A 2BFCB 2W2NA 5CIWA 4DW8A 4J2OA 1CLUA 1YB6A 2PBRA 4G8BA 2Z04A 4Y1EA 4ZQCB 5EI5A 3V7UA 4MEAA 2D2EA 4E13A 4ZI2A 4O4IF 2YQ5A 1YKGA 1E2UA 3PQ2A 2JATA 3HU5A 1V0JA 2R66A 3P26A 4MS3B 3UUWA 5J58A 3L7MA 4KMRA 1P45A 2X0JA 4X1YB 1GG8A 5KTMA 1W581 4G5OA 1ND6A 1BKDR 5DNDA 1M76A 5CYPA 5THKA 4O1IA 5LDGA 1KZ6A 1E79A 2O14A 3AJEA 3QYJA 1UJ6A 1XCJA 2N42A 3DE6X 1XDWA 2JA1A 5EZQA 3RHTA 4BLOA 3PNQA 3JARB 4KLNA 4ZAXA 3Q8KA 4M53A 3VVCA 2GILA 2XNKA 2WWYA 2PXAA 2YCBA 4HG2A 3LBAA 4AJKA 3C1AA 3PGKA 4P81A 1MW8X 4CZ2A 1K3UB 1HSOA 1TX4B 2RCNA 2YXBA 3ANMA 1L4GA 4TRNA 4UJ5A 4ZT6A 3UTDA 5I4KA 2UVPA 3W5HA 1E98A 1N32B 2RHLA 2XXJA 3UXYA 3PXGA 2Q1TA 2ACVA 4KLZA 4FVTA 5CVUA 3GO4A 3EG9A 4A0SA 1YDHA 1AX9A 2CY0A 2WP8J 5KCZA 2VLIA 3PQ5A 2QZ9A 3NBQA 4MI1A 1QE5A 4WZ6A 4HBZA 1NMYA 5C46F 2BKLA 1BJKA 1CZKA 2LIVA 2HLHA 3LP5A 2ZUEA 3KSAC 5F9FA 1SBQA 5HJEA 4TZKA 1PJRA 5CX4A 4HGNA 1MABA 5HQ3A 1U81A 1YQGA 2PQ2A 2JAHA 1WEKA 2H51A 3Q12A 3L9WA 1HSZA 1KJJA 2ADOA 2HMWA 3T52A 3TQRA 4A0RA 2O3RA 3KQHA 1CRLA 3OQJA 3F96A 1DAKA 1R64A 1NOIA 1LY1A 2FR0A 1C7FA 3OZ7A 3AUXA 3IBGA 1ZUNA 4RPLA 3ED1A 5CVJA 4POOA 4URYR 1DWPA 2XB2A 2UZ4A 2HA0A 4A5SA 4NHEA 1LRJA 1XELA 4Q6BA 5J40A 1AQUA 3PXCX 4YXFA 5LU9A 1X87A 1Q12A 5CUQA 1OU4A 2G4VA 3L4EA 4FGZA 3ZX5A 1AO0A 3I30X 2BRUA 4IIEA 4FOOA 4R05A 2IPLA 3DWFA 4DIUA 3JQEA 4GZ6A 2BJVA 3QUCA 3KQWA 4AWBA 1Q16A 2ZRNA 1A9TA 1T9KA 2YIJA 3DV2A 3IDSA 4RY2A 4UUPA 1N6IA 3BMOB 5LXTA 2FKNA 4DCCA 5J2TA 2M6SA 3KQTA 3L7YA 1QG0A 3BJRA 2G9QA 1JEEA 4RHYA 3AUAA 4ZEOA 3CUEF 5FPHA 4NMXB 1Z45A 4YT2A 1KJIA 4O0MA 4XX0A 1F7UA 2O8DA 2C82A 1FZQA 5JSQA 3GRVA 3LOQA 1Y48E 1M0SA 3JASA 4ND3A 1AK2A 1XG5A 4JENA 5BV1A 1JIIA 1MV5A 5F1OA 3P2JA 1IONA 4BIMA 1FVXA 2VQEB 3P2YA 1Q5PA 1DJNA 1POXA 5ALKA 4JQZA 4KGVA 2BKEA 3I2GA 4EYQA 3H83A 3VYUB 4RQUA 1PYOA 4Y7DA 2IYUA 4D9KA 1KI2A 1SK8A 3K9FC 1OIXA 1H5UA 1NYRA 1P7YA 2WLTA 3E4DA 1PJAA 3NHPA 5JATA 1EFPB 4QDZA 1T1JA 3EZGA 4MSUA 2QDKA 4OGKA 5JS6A 4LI3X 4M49A 5FB3A 1YUBA 2PMEA 1EP3B 5C7YA 2DLDA 4ITRC 5BN3B 4ZGWA 2YXNA 1J2UA 1RRMA 2D1SA 5TQ2A 2HWWA 4QOSA 1Y7LA 3D9QX 2ATVA 4JXKA 3IILA 2G0NA 1NVEA 4FE7A 3IP7A 2FZ5A 4GVLA 5CLQA 5GJCA 3THRA 3AMVA 4MDYA 4UFOA 2G9RA 1ZS9A 1E1CB 3SIRA 1ZR4A 2RIRA 2V6FA 2YXEA 5E1DA 5IBCA 2VXCA 4L08A 3M9XA 2D2XA 4ARIA 4TS4A 2QE7A 3GEPA 1ZP6A 1T8TA 5CBPA 3WLRA 1CVIA 4E15A 5C5IA 3G2OA 4D8TA 4NBLA 4C0HA 1YO6A 2ZB2A 2JGKA 4HJXA 3RGWS 1QFZA 3BD7A 1RJ9A 1E0SA 4RLSA 4KZPA 1R6XA 3JQDA 3AHDA 4FI3F 4E88A 1ZKDA 2CFRA 2GEDA 3GJ5A 3TFWA 3W5SA 2J4DA 2XCOA 2OBNA 2OHOA 2X0RA 3OZGA 4M98A 4QEDA 3RS2A 3UH1A 2YVAA 4E09A 1EWQA 3N53A 3F6SA 3BZUA 3DWEX 3DMTA 2GDZA 2YZ2A 2R60A 4Q7EA 2W8BB 1A1VA 1A4UA 1B6TA 2B83A 5IF9A 1F2UB 2QVXX 1KYXA 4LV6A 2AXEA 4P9NA 2PUGA 3LHKA 3SJBA 4TT3D 3DVRX 3LQYA 5KTRA 3A28A 4Y9TA 2HQ1A 5K20A 4QQNA 2XYPA 3V4ZA 4B73A 3SZOA 3WK9A 4GKAA 4GYJA 4K9LA 3Q7IA 1L6IA 3QE0A 2FFBA 3DCYA 1J06A 1GGNA 3KOOA 4HWSA 1CQPA 3GLGA 5CM2Z 4EKNB 2J5QA 1NAHA 3DUFB 4J94A 2XD9A 3L41A 5DK4A 4A3SA 2JW5A 3FMIA 1UPUA 3W5IA 5EPEA 1UANA 5C4IA 4YPVA 2PFKA 1H4TA 2H08A 1QR6A 1QG6A 5JS2A 5BP7A 1GRQA 5T64A 5IJ0A 4E2ZA 3V1UA 3R24A 4EJMA 2FW8A 1DQRA 2M98A 3K96A 4KXWA 2NAFA 3W9UA 5HKOA 3DTNA 5DEIA 4BX2A 3TLMA 3B13B 3GPLA 2QRVA 4HLUC 3G5AA 3C85A 4NWIA 2PIDA 1EFDN 3QXHA 4F1KA 2QYOA 4XB1A 1P5HA 3THSA 3WNZA 1ZGJA 2C4UA 3LCRA 1FDUA 2G3YA 1WXDA 2XB8A 3IQGX 4OHWA 4EA6A 3FWKA 1GJRA 4XQGA 4OB7A 5E4YA 3DG9A 4II3A 2I5PO 4O2BA 3T7CA 4FWTA 2Y93A 4AC9A 3ZGNA 1GSIA 1JRLA 2B36A 1HT0A 2JGRA 1T1IA 5ENZA 1GGFA 2QMHA 4LE2A 3KETA 1AY0A 3OZBA 4QU5A 3RABA 1W9MA 2FSIA 4NS4A 3Q5EA 4MJ3A 4KBFA 4UAVA 3WO1A 4C76A 2GVDC 3KKPA 2M6KA 3LUBA 3KTFA 4PINA 1G7SA 3PRYA 1EXVA 1PX0A 3FWYA 2FRVA 5B53A 1VIDA 2GXAA 1K27A 2C29D 1J56A 2UVQA 4QPCA 1UM9A 2F1OA 3QW4B 4C0BA 4WXYB 3C45A 1N2HA 3M5CA 1US8A 2OEPA 2ZJ3A 2YV5A 3D3NA 2HD4A 3L02A 4Q39A 3UJCA 3UA4A 4EBBA 1MEEA 2RK4A 4UE6A 1ML4A 3IAXA 1TJ4A 4B6FA 2BEWB 2GI4A 1J2YA 1RHQA 4L85A 5AKZA 1JJFA 1XEWX 1I0LA 3A1CA 2XXAB 1SVUA 4G86A 3T5MA 1IBKB 3P0HA 1IOVA 2GF0A 3DB2A 4JS0A 3L05A 4QYIA 5G1NA 1GZ3A 1WHTB 1ULBA 3M6WA 5BSMA 2Q3BA 1I4LD 1MQ8B 2EFGA 1OXKB 3GT4A 3MJ4A 3MB5A 3NEAA 4C0JA 5C51B 3QWHA 5IAJA 3DLPX 1SXIA 2NVUA 4WLNA 5SY4A 2OO5C 3U4HA 4DQUA 2WM2A 1U0OC 1QNFA 2UDPA 1NSTA 3QFTA 4L8WB 1THTA 2NUPB 1LDGA 3GMDA 3LUHA 5D3QA 3QUBA 4OLAA 1DPFA 5BSHA 4IIXA 4D98A 2DEUA 1T13A 3DNPA 1O58A 1ZMBA 1XDDA 4P36A 2RFLA 1QIGA 2EFDB 2JLSA 2QN3A 3GMSA 3OVMA 1MX9A 2C8KA 4C4PA 5JUWA 4R2IA 3IQIX 2A3RA 3L7IA 2CNWA 4JCOA 2ZU6A 1YR8A 3UHPA 2QN6A 1TUIA 3I73A 1K7SN 3KYIB 4BE4A 4HWOA 4TYMA 5KX5F 5C8YA 2K7FA 2C0PA 2FUCA 3QKIA 4M22A 5D86A 2Z3WA 2JFXA 3ENZA 3HHEA 4JDPA 3S2GA 4MUIA 1GUZA 1YFZA 1COZA 3IELA 4NYJR 4QGAA 3OFSA 2QZJA 4M99A 1RWQA 3JYOA 3S28A 1JXMA 2LD4A 3C70A 3ENVA 3MJCA 3ND9A 4IJUA 4K8RB 4KO1S 3L93A 1IM8A 2WJHA 2WDPA 1UKVY 4HGZA 2ENWA 3ORHA 2YFKA 5LWQA 2NVBA 2QAGC 1H2YA 5F2OA 4CF7A 3TG8A 3NTXA 3VR5A 4P93A 4B9EA 1XRSB 1PJ2A 4MGZR 1YJ5A 4KQHA 1GA1A 2GN2A 5B37A 3RC8A 3WJ1A 1NQVA 1LW7A 1O08A 3ET5A 3FPEA 1YDWA 2K2QB 3VKVA 3L6CA 4TT8A 2LCQA 3TCKA 3T1OA 1K2VN 3UO8B 2P11A 2E7ZA 2BD0A 2JHAA 2H2FA 5JTUA 3LW8A 2CXUA 1VHLA 2XZTA 1LLCA 1GPLA 2D0DA 1BS9A 2Z1MA 1Y3CE 2IVFA 3MLEA 3LGSA 3PKJA 3DFKA 5KHAA 3WRXA 2PRJA 3CMCO 3M5DA 5CX1B 3ZWCA 4H16A 2I9PA 2CVPA 4IDOA 3OCCA 3BHJA 1GILA 1HYGA 1T15A 3OJEA 4G3XA 3I8XA 2XE6A 4ID3A 1MJ5A 4M9ZA 4X41A 1UJMA 1VFNA 3KYJB 4KXMA 3U4AA 4ZCLA 3IO3A 4ATNA 1W93A 2XQKA 2WV9A 3T38A 1M2OA 1Z2AA 5J4LA 3RVSA 2NPOA 1QE0A 1KYQA 2QP9X 1XQ9A 3U17A 3EWSA 5DM1A 5TS3A 1GZDA 2GS9A 5CLHA 3BE4A 3T41A 2EZ4A 1QUFA 4NYIQ 3FOBA 2QSUA 3PG5A 5AWFC 4D4JA 1DRUA 5C1OA 4N48A 3SR4A 3HFJA 4FFLA 1GUFA 3QTLA 4LIPD 4C4RA 1VJCA 1Q0HA 2QUIA 1H2AS 5DXFA 4RZ2A 2NU9B 4EM6A 2B1RA 2Y4NA 4QEKA 3SHTA 2HA6A 2ETVA 3KAQA 3DF7A 2DR0A 3C1TA 4MV6A 3CNHA 5FWXA 4RMHA 3VC3A 3T5AA 3IP3A 1HDRA 5CW2A 5EQDA 4NP6A 4R7TA 4YT5A 2PH1A 2HADA 2FPMA 2FX2A 3BEDA 5E38A 3MHTA 1OXSC 4CBVA 1I3LA 3C3EA 3QXCA 1MN6A 4MUHA 3KTOA 1KI6A 2FZWA 2A0FA 3B89A 4L8YA 4DL9A 3HXMA 1RHUA 1KI3A 3CGGA 3D2LA 4LOJA 4M89A 1CQIB 1GFWA 1T6ZA 1YQEA 2Q8QA 1OFUA 5DHFA 2VJAA 3F67A 1F38A 1JDSA 3X1KA 2BSAA 2B0JA 1VKZA 3DFZA 5DFAA 1DXOA 4Y2QA 4B7CA 1M6NA 5IKPA 1S1MA 2C7BA 1KU0A 1QH8A 3HUDA 1YR9A 4NATA 4X3PA 5MF6A 2ORYA 5GQSA 2C5EA 2RBKA 3QKTA 4Q5IA 4YMWA 3JQ6A 1GPBA 3FPHA 5CH8A 3RS8A 3F1LA 2GM9A 4P3OA 3WRYA 1I3KA 2WPDA 3MMXA 4UM5A 3TZEA 1P5JA 3FNHA 4GGOA 4AS3A 3WQQA 3CYFA 1ZVMA 2O52A 1M8FA 3S2FA 2IUFA 2TMYA 3CLTD 4P8RA 2BY4A 4X84A 4BYMA 4JJ8A 4EW1A 1OCEA 3OX3A 3I3OA 4WLUA 1YZQA 1H2RS 1ID1A 2WB2A 4DRZA 3EHEA 3F6YA 3Q3JB 1GXSB 4B6SA 3BB4A 4DNPA 4TV9A 4BNIA 4NPCA 2DFVA 5AW0A 2YJ6A 1KDRA 1CNMA 2GA8A 1WR8A 1YB5A 2JZCA 4J6EA 2P5TB 1RQNA 1JIXA 1QYRA 3FCSB 1ZMRA 3NBKA 5JALA 4RU1A 1YOVB 4QSMA 2WWWA 1E2PA 3FGPA 3P71T 2CMDA 3PL5A 2ZAIA 1VJ0A 4G97A 5ALPA 5J5CA 3S8YA 2X77A 1JB9A 3UTCA 1WCXA 1MEJA 2C61A 2GETA 4H17A 4BQRA 4D4KA 5AK6A 3LWZA 1P2GA 4J6FA 5LIRA 2G8NA 2V58A 2ZG6A 3OWHA 4J8PA 4MIYA 1CIPA 1CEEA 5AP9A 3K9BA 421PA 2MSCB 2O3QA 5DDIP 4R8MA 2O8EB 1S3FA 1E1RA 1QQ7A 1A97A 1RLJA 2JLCA 1H05A 2QTMA 2VHUA 3A4VA 3HEBA 3QJ5A 4CM8A 4BNTA 4JR0A 5KOJA 4ZMBA 2I2WA 4LJYA 4K9OA 4KUHA 4K6MA 4J0JA 1E0AA 4MTCA 4EGJA 4V3BA 3HUEA 2ZUBA 2N46A 1EA5A 1KQOA 4PGGA 1XTQA 2ZUCA 4W1RA 5GPBA 1YD7A 1CP2A 2JIDA 2PVSA 1JNXX 3HVIA 3VZQA 3GV0A 1R6VA 2RC6A 3RKSA 1QF9A 5EKXA 1IBCA 3T06B 4DAOA 3LXRA 1TI7A 3QPUA 4Q02A 5EGNA 2BUCA 4BLRA 1Q0SA 2XUIA 5FI1B 2B2NA 2VSFA 4Q7JB 5TPZA 4D4MA 2D0PB 1BXRB 2PX4A 3MJTA 2H92A 2R2AA 2V3VA 4I1RA 1JFFB 1E5LA 2I71A 4IDGA 1KYYA 4P38A 1MQSA 1R0ZA 4DR4B 3V46A 2XV1A 2HMAA 4G84A 1H9CA 4AU1A 3MJFA 1LVGA 3A37A 4GD3Q 3V1LA 4Q3AA 3LCUA 4JJFA 1U7DA 3DDNA 4A2QA 1ENPA 3BSWA 1HDEA 3JY6A 2V4MA 1W1IA 5JAUA 3THXB 4RLFA 3SYKA 1NW3A 3DVAB 4WOKA 3VQTA 2QN7A 1CQJB 2H4ZA 2K4MA 2CDCA 2AQKA 2LIPA 1XKTA 4JP8A 3EZXA 3AEUA 2IH5A 4KREA 1QQTA 4WFKA 3PFNA 5HRAA 2XVXA 1ZOPA 1MO5A 3QVJA 1B00A 3OMWA 3AUKA 4UM9D 3WXMA 4A10A 5KTSA 4LQLA 4YR7A 2E85A 1ZUIA 3E2MA 4QOHA 2GK4A 3BBLA 5BVHA 4PZ0A 2Q1SA 1WOMA 3TZKA 3AR3A 4PQGA 4HADA 1I4WA 2FOXA 3GHYA 2RK6A 4YB8A 4I0WB 4A91A 4CLXA 4CM7A 2EP7A 1GKYA 4TQGA 3JD1A 4W5JA 1O96B 3WO0A 5FDFA 4CCYB 4R2WA 1ZN8A 2Y4OA 3EVFA 1GOTA 1QMPA 4MVJD 2R6DA 3MGCA 2IZOA 5JDCC 3VOSA 4ACAA 4DIEA 3VOTA 3W8RA 2H48A 3V55A 3ZV3A 1IM5A 4B31A 4A2WA 1GEGA 1Y98A 3H11A 3VNQA 2GBFA 2IUSA 3V8PA 1RZ3A 2WD9A 2GJKA 3EASA 3UAGA 1ABEA 1PK9A 3PUZA 3A32A 1XVLA 3GW8A 3TW8A 1UBEA 4UZEA 1NLMA 1T8RA 4DUYB 2YJZA 3PIDA 4DWJA 4F85A 5MFPA 4RTJA 5ARBA 4WBSA 2IIQA 1M7HA 5I7UA 2BZ0A 1QTNA 2PUTA 2R751 3F8SA 4OKSA 2O8DB 3HLTA 4LCEA 3N2LA 1PJCA 2UYGA 1H2FA 1TUEA 3GFPA 1HDOA 1JPUA 3EBPA 1JFRA 2C5LA 4PYNA 1UP6A 3DDUA 3FY4A 3HPQA 2O3UA 4HVAA 4LSGA 3U26A 3PHLA 3RADC 3FTDA 1MB9A 3LWBA 2VK1A 4KRFA 4GYKA 4MVJE 4UM9B 1ZIYA 1NVKA 4UQLA 1LSUA 3WMFA 1Y37A 2RGBA 4ZTZB 1SKYE 1QTIA 2Q5IA 3JQCA 1Y8ZA 3SQLA 4P54A 1ZAYA 1LNSA 1HV8A 1M1ZA 5JRZA 5L6MB 3VHXA 4W5NA 1DJQA 1GADO 1VJ5A 1G8MA 3AI2A 4LECA 1IOZA 4PHFA 3JZMA 5CTAA 3UJAA 4RTRA 4BVEA 1H1DA 2F17A 1FUEA 1ORHA 3F2VA 1I36A 1IEQA 4RCYA 4IFTA 3SYMA 1B0AA 5JI2E 2HL6A 1JTVA 3UXMA 2XF8A 5DASA 1X8KA 1Z5ZA 3GGGA 1MRSA 5FAXA 1YL6A 3EYAA 4B2IA 4DXAA 3ZE8A 2Q3FA 1JJVA 1SKYB 2GJAA 3G59A 5EJ2A 4ZWNA 1KH2A 5LMZA 4JZYA 5EMNA 3WLQA 3VPCA 1RJGA 1RQ2A 3PHJA 1AUXA 4QC2A 4CV1A 4DT1A 4JOBA 4WGGA 5IAKA 4F1JA 4I4TF 4URXR 2ZTSA 4PZUA 3V48A 3U09A 5ERGB 4E6EA 4O4JB 3UJ6A 4L4XA 1ZM2A 1NMSA 2J3IA 3DXYA 2GCOA 4RVGA 5FPPA 1M75A 5BO5A 1X1BA 3GMIA 3ADKA 2I0FA 4H6XA 3ZWKA 1GPDG 2HGZA 1FYEA 2GHIA 3BILA 4WEQA 1RE1A 3EGOA 2OV1A 1R2QA 3M33A 2EJWA 4RKYA 3VJMA 3UAVA 1SBIA 2KM1A 1J5PA 5IVPA 1HYQA 3OJOA 1NN1A 2XW6A 3LDFA 3M4JA 2XUAA 4M0PA 2WHXA 3C3PA 3E9RA 5KWVA 4V0OA 2HYIC 4FX2A 3EGXB 2DF8A 4OKIA 1G291 1COWD 4YECA 4CGYA 4C1NA 3C8UA 1Z4IA 4KLCA 3EZ2A 1ESNA 4B7ZA 4Z3OA 1DT3A 1KJWA 3HE3A 5B6IA 3R3ZA 2DU8A 3PB3A 1V5WA 2IY8A 1D2MA 1VPTA 1Y82A 2WHPA 2ATXA 3PL1A 2H00A 1J7JA 3KTDA 4Y30A 1Z8HA 2Q5QA 4BVAA 1QQBA 2JFBA 4OQYA 4W8HA 1RU3A 3F3SA 3E82A 4FXOA 4HNRA 1KTIA 2BM9A 4MW1A 5EIHA 1E9BA 4MKXA 1IY8A 3TTWA 1AO3A 1B14A 2A1UB 2ZIGA 4R9UC 5CEJA 3LUDA 4GGMX 4OQEA 4JGGA 1AM4D 1ZJYA 1FDOA 3B6KA 3A3OA 4NOJA 3VR4H 3TGLA 1Z3CA 4PZZA 1Z2EA 3V00A 2NXNA 3AY6A 3CTPA 3FSJX 2P3SA 2LP4Y 1QVAA 1GYPA 2GN0A 5ALQA 2PWPA 4LY9A 3RTDA 2FZGA 2P9TA 3V1MA 2O0JA 1KDYA 2R8BA 4BVLA 1YJCA 3A11A 4BFYA 4LY0A 3NS7A 3IIJA 5FUXA 1VJDA 2H9YA 3H1FA 4URVR 5C32A 1YS2X 2WOOA 4IUCS 1WF3A 2OSVA 2UYHA 1U5BA 1CVRA 2EKBA 3PEVA 4GR5A 4P4NA 4L78A 3W6NA 5AKGA 4HWPA 1M6EX 1DMRA 4MVJM 5DM70 2DWPA 3BGSA 5LQCA 1X9HA 3LSYA 4TWJA 1H3NA 3H4VA 5JVDA 1PQ4A 5HJ7A 4D6XA 5KPJA 4O3MA 4P0QB 1CJUC 3L1JA 3O6VA 1RDFA 2VCHA 2QLNA 4Q4HA 3WTBA 3FJYA 5LP6B 3PFCA 5LVAA 1G98A 1PG5A 2Q46A 2X5KO 3TX2A 1R9JA 3FHOA 3HCBA 1EXMA 2VUUA 3RSGA 1NNLA 2JJ2A 5IM5A 5FTLA 5JQWA 4UTXA 3CVVA 1NKSA 1DKPA 1VBNA 1ADFA 1BD4A 3BIXA 4OG2A 3ZGXA 5AW2A 2CLIB 3F3YA 5IN4A 1ULZA 1RZRD 3C8HA 1L5YA 5KCMA 5AM1A 2ZRBA 1FNNA 1IG3A 3RIHA 1TW3A 2IF2A 1H94A 4K6HA 4N0DA 3J80A 1PNQA 2O8CA 2VYVD 1SXJD 1BU5A 1TAHA 1HDCA 4RZXA 4RC9A 2FPRA 5G40A 2P8SA 4TZTA 3LCCA 5LLDA 4LGCA 4YI3A 3N1UA 4YO7A 3HKBB 5AFSA 4QSHA 1GFZA 3IQWA 1VL1A 2IIBA 2UUPA 3P0RA 1QIKA 1K88A 4N5DA 3TKYA 4B4UA 1VMDA 2BR3A 2LWIA 3R8XA 5EC8A 2GM3A 2JLAA 1QHSA 1Z56C 2AJCA 2ZXFA 1OGJA 2H8KA 3CPEA 2Z57A 4IF4A 5CFZA 4KWIA 2PX0A 3NVMB 2VHYA 4WL0A 4Z1MA 2WICA 1IHYA 2NTYC 5AW9A 1JW9B 5IC5A 3BFXA 4EJ6A 1TB4A 1YXMA 3RTBA 2DY1A 4B5KA 4K05A 2XDQA 4A36A 4LVCA 1R4NB 2Q5FA 1KFEB 3C4VA 3DH0A 1JLKA 2B4AA 1I3MA 2A94A 4UQOA 3HJTA 3HP4A 4BNXA 3L0PA 1IYZA 2WG1A 3C43A 4IJVA 4M1OA 2II6A 3MWDB 1DUSA 4JYZA 2KLHA 4KMMA 4OOEA 2WYWA 1SXJE 3DBVO 5BPFA 2YVQA 2GCIA 2X1LA 3DFMA 3DYIA 4FP9A 3GAAA 3TRJA 4EJSC 4JSYA 5GZ1A 5JC1A 3JQAA 3X0DA 4EECA 1GAXA 2ZSJA 1E1DA 4N18A 2OQVA 1SQ0A 2G1KA 3NKLA 4CIXA 2OBYA 4PR0A 3D6UA 4ZA2A 5F76A 2DWUA 1RM5A 3QVGB 3QOFA 4QPDA 1NPTO 1C8BA 1DC6A 2X58A 3DQZA 4DR7B 3GXBA 3IUSA 2JH9A 2DPYA 5GTDA 3HEMA 3T1QA 3WLSA 1LBSA 1SXJB 2FVYA 3WGKA 1WZNA 3I45A 5DIFA 2JJQA 1Y5NA 5K4GA 2N75A 4ZC8A 3HKCB 3PIRA 2JFZA 2DPMA 1Z8NA 4G8DA 4K81B 4DZRA 4OQQA 3F49S 4GO1A 2RHJA 1TJ3A 3BL6A 1IZ7A 5I9BA 1EFTA 1SNYA 1TTTA 3WLLA 4G24A 4EP1A 2OV8A 1FDVA 3ZCTA 4X7MA 1SCDA 2P9JA 2YYAA 1YNOA 4FW9A 2PAFA 3DGEC 3UATA 2O3TA 1F12A 2FEXA 4TXHA 3FDJA 2V03A 1KSGA 3SSNA 3BK1A 1SHKA 4JBWA 4OM7A 5I51A 2R7MA 1GL7A 3G68A 3TDNA 3U7IA 1DFHA 3WGIA 5IVHA 4BS9A 3OFJA 3OCWA 4GZMA 2DQZA 4OQFA 1X1QA 1LPMA 2UZIR 4HWRA 2X0NA 4GL2A 5HFJA 4DCNA 2GBLA 5LOVB 3CRVA 1E6CA 1OOEA 3FA2A 4KBGA 4UMEA 4WZBE 4ACBA 2ZBQA 1QSGA 3E9QA 2BHTA 1QDEA 1X92A 2BZSA 2NUTB 2OCPA 3EXIA 1SHLA 1J1IA 5FUMA 5IDQA 3WA7A 3KFLA 5IF3A 2X0IA 3OE5A 3T9FA 2W2MA 4L2IA 2HUPA 2MR5A 3M3HA 5CT4A 2DT5A 5HS4A 1DIRA 1NY6A 4US2R 3LKBA 3MBKA 3PUXA 2D7JA 1NM5A 3PRKE 4J3JA 4Y2TA 4P6VF 1CE8B 2ZITA 1L3BA 3RSLA 3CLRD 3TSOA 1H2XA 4U5XA 2P1ZA 4WZBB 2GPYA 4BJHB 7YASA 2NU7B 3DL2A 3Q9UA 1CQXA 2H4XA 2NTEA 3IVGA 3KC2A 5EESA 3GROA 5LMCA 1JHXA 3VZPA 1LFAA 4GOJA 4YDRA 1MFZA 1Z2OX 4A8JC 1FJGB 4BWYA 5BWCA 4GQBA 4ZVLA 3WS7A 5IT4A 4HDKA 1U0SY 4KGDA 3RRBA 13PKA 4GGPA 5LA6B 2F8TA 1D4AA 3PP8A 5H7XA 3B1WA 1Z25A 1T5OA 4YMVA 2FB9A 2Q6KA 1U3DA 3NTOA 1QHEA 4IDFA 5F23A 3V32A 3ZVKA 2IYLD 3R5SA 3ZKWA 2R8OA 1TM7E 3FPCA 1WCV1 1GAEO 1TU4A 1U65A 3HDGA 1UWLA 3NVDA 1NF8A 3WZLA 1YDEA 2WG2A 3ZLUA 2FN8A 1Y34E 4MV7A 2NU8B 3O5AA 2WR8A 1PKEA 5G0VA 4E12A 1UT8A 4P32A 1Y6JA 3NHAA 4JROA 5CCBA 4ZD6A 1WXGA 4Z0PA 3IQHX 2BSXA 4BQSA 1ZVQA 1AZTA 2SECE 3OESA 1QU2A 3I8SA 6YASA 4PYIA 2ZGVA 3V2HA 3GB9A 2GBCA 3DWGA 5AVUA 2BONA 5ELXA 4WKOA 3L2OB 1E7SA 2XCRB 4FFBB 3ETNA 1GNTA 3LI2A 3R8CA 2BBSA 2NU6A 5H1YA 1OWLA 3ZK9A 3R3XA 3JVIA 4R7GA 4JBNA 5E9WA 5G0TA 5K51A 2NUAB 2F6RA 2HDOA 5BMVF 4OAPA 2GEVA 2IYSA 2P4UA 4JBYA 3A1NA 1ZM4A 3DCNA 2FSGA 1DEAA 4LJAA 3CNEA 2R62A 2GXQA 2XXBA 4R0VA 4WVLA 7MDHA 3RASA 1AOXA 8ADHA 2HJ9A 5BQPA 4C2AA 4F06A 3MCTA 4QUKA 5DI9A 5LYJB 2NSDA 2XLBA 2XWPA 5T4BA 3ZQ6A 3BVPA 4KZKA 1Q0ZA 1MVOA 1OZFA 3I2IA 3C3JA 1CUGA 2FDXA 4U9HS 4RVUA 4C4ZA 1JIQA 3PKZA 4NBKA 1Q92A 1D4ZA 2BW0A 2F3RA 2JCXA 4FC6A 4MJ7A 4N39A 4KR2A 4FNGA 1AKRA 1C81A 1GPAA 2FQQA 2QQ0A 3PNVA 1JR3A 3RRXA 3WGZA 5A0TA 1Z7WA 3ZHRA 2FMTA 3ASUA 3RBAA 4Z9AA 4HTFA 5DYTA 1E92A 1E9AA 4K9NA 2H5JA 4S1NA 1MNAA 3VR1A 1E3EA 1GNQA 4ASUA 1O5IA 2EFHB 3MFQA 1R3UA 3PGLA 3NNDA 1RJDA 2NVWA 4FT4A 4EW6A 4G1BA 2FR8A 1Z0ZA 1KJNA 2AXPA 2CL5A 3QKWA 2H1OA 2BFCA 1SG9A 2QXYA 3T3PB 4EI7A 1WV0A 1KGSA 2CUNA 3ABRB 1XJCA 3QENA 1N33B 3KKNA 1DB3A 3C98A 1VYTA 2KBFA 2BTQB 1DAMA 2VHCA 4MEBA 1PBTA 4MS3A 4P4UA 3GIDA 4X1YA 4DIMA 1BVUA 3BULA 2OHHA 2J67A 4DNFA 3E81A 4CVNA 2W58A 3KQNA 1C3JA 4OMFG 3RRNA 4DG9A 3RS3A 2P2NA 4ENTA 1KXZA 3W5JA 1FCJA 1FJ2A 2VT2A 2AFHE 3ZCRA 2IXFA 4RF3A 3FVQA 1NMQA 1SA0B 3JARA 4GOND 4Q1FA 3TM4A 2B92A 5JXJA 1B93A 3RVPA 1DE0A 1KMHB 3RVMA 4TMWA 4XWKA 3UJNA 4GFDA 3WFZA 3ZU3A 3K15A 1DBVO 1VM6A 1ZXLA 4D9HA 5AVWA 1AQNA 2VXYA 4C7BA 4LCBA 2AFHB 5IVIA 4L75A 1RBYA 2JFUA 3WGHA 1ZL2A 1SRQA 3OOYA 4XVRA 4F86A 1GFSA 1CUIA 4MRMB 4BX8A 4PNPA 1LK7A 4Y2SA 3E35A 4KXQA 2XNDA 5DYYA 3ZXXA 3GGSA 2GK6A 3PLAE 4BN4A 1XTVA 2VK2A 4RK5A 3FZGA 4B09A 1JAHA 2Q5LA 3HP1A 4GOXA 4MWSA 3CLSC 3TKLA 4KXYA 4RK1A 1XMSA 1CJSA 1I7SB 4YCNA 1Y4UA 1RKBA 1YS7A 2ID9A 3RFUA 1VRVA 1JR2A 2IHTA 4Q4DA 4MYDA 1MPXA 3E9EA 3MQ2A 4KWEA 4BWVA 3OCVA 4QQFA 3SCZA 1NT2A 2I1VB 4EWLA 3Q3CA 1INLA 1JI3A 1DOAA 1E99A 1PDOA 1JHAA 1I2MA 2CFCA 2FU5C 5AW4A 1K5PA 4HH1A 5GMOA 3VPFA 2QTZA 5JSZB 2WF8A 1I4TD 2F9LA 1OTXA 1D6JA 1MH1A 1XUOA 2KYRA 2K2WA 2P90A 2YV4A 4UVHA 1K7XB 1BQ3A 2DHRA 5TF4A 5DBOA 3KR2A 2P9QA 4XVHA 1VHQA 5JFTA 4I50B 3WZMA 3U4QA 1OKKD 2AJ8A 4IGEA 3LUPA 3M4NA 5EUQB 2O7VA 5U4XA 3B5IA 2IYXA 4JI0B 3BC1A 1Q1AA 1JHRA 3BMOA 1KHTA 1UBTS 1KYWA 1ZCBA 2R7KA 3C74A 4J1SA 2DJIA 4P08A 5M3BA 3WIOA 3HZZA 2CXOA 4WWHA 3T3GA 5EP2A 3CF4A 2BVNA 4H31A 3CNOA 3DEIA 2WKRA 1C8VB 2PUHA 2V7QD 3V8RA 3ZY5A 1L5MA 1O9HA 3EIQA 1V9SA 4IH4A 4JFRA 5B2ZA 3RV3A 1U6KA 5DYWA 2X13A 3CZRA 4QOGA 2GXSA 3F4BA 2R1ZA 5L9AA 1D7AA 1TLFA 1H2HA 4UDYX 4BKQA 2QD2A 1PQPA 4GMDA 3NLLA 1PJ3A 5BV8A 1O4VA 2OORA 2QX7A 4HAIA 1POWA 4FKZA 1JFTA 1R74A 3EVZA 4Q3DA 3WYEA 1FDRA 4INZA 3D4IA 4PFQA 1K9VF 1JA9A 1EFPA 1GG9A 4OMUA 3IEIA 3F4LA 5KNBA 3CR3C 3GGOA 3QQ5A 4YJ2B 1TGYA 2B21A 1Q7BA 4WQMA 1MKYA 3ZWYA 5CTJA 5BN3A 3L84A 4BYGA 4URZR 4XKJA 5DH9A 2VDVE 3GC6A 1II0A 1KERA 3C3CA 1TVMA 3W6ZA 1M0TA 1RBZA 2V4ZA 1JXOA 1RPNA 1G6HA 2CVQA 2YMLA 3GG9A 1X42A 3KZXA 3CUYA 3JTMA 2BLLA 4LXGA 5DZSA 4R71A 2MU1A 1YIDA 3N2EA 4ZPXA 2HXGA 4HWKA 2NVOA 4D9GA 5CA0F 2XMGA 4BO4A 2Q7XA 5LPNA 2GPSA 5HKKD 2CWDA 1D9XA 4ZO6A 1TZKA 3AB7A 5GIPE 1ZC4A 3N3AC 3QNMA 4X7RA 2H59A 4Y2YA 4PLFA 4NEGA 1I7NA 1QKIA 3D7NA 1K97A 4AIRA 2A7QA 3K9NA 4RJIA 1H4QA 4P1ZA 3QLEA 3WL7A 1XSEA 3QNUA 3X1WA 2MYPA 4H7HA 4X91A 1BXKA 2MYTA 1LNQA 4PZ9A 3C7TA 1IMJA 1KIFA 1MF7A 3VISA 3O4RA 3WADA 1KWGA 3UG6A 4R01A 4IS2A 1L7PA 1CU1A 2W8BA 2VAXA 2V6GA 1F6DA 5JCOA 1F2UA 3KSMA 4BP9A 2VBIA 3P4UA 2DKOA 3TXYA 1XROA 1WKVA 3AY0A 2QL9A 3ZTYA 4LRTB 4ZIRB 3DP7A 1C80A 3E48A 4R6WA 3CZQA 4HMQA 2JLWA 1Y5IA 1VBMA 1JIUA 2RAVA 4XOUA 3RUAA 2EZTA 3UGTA 2JLBA 1SQ6A 4F3CA 2F7SA 2RHTA 3TD9A 3W4IA 4OIMA 4DWOA 3GDGA 2WIJA 4ZCSA 5K8JB 3DUFA 4QHSA 1RAGA 1OXVA 3RS9A 3GJ0A 2J33A 1E77A 1GA4A 4K2AA 4MPTA 4WAUA 5TC4A 2P0AA 4WRRA 5K0JA 3MTJA 1TM2A 5U1PA 4JI4B 1VGVA 4Y9UA 2CDAA 3WAGA 2Y6UA 1DRJA 4Q15A 3ROKA 1EAYA 1MOZA 2OLKA 3MOSA 2QZSA 5EQTA 4C7VA 1B8OA 3MSCA 1VHJA 1JECA 5A7FA 4D56A 2AF4C 4ZVSA 1KEWA 1J49A 1DPGA 3Q6NA 4AJJA 4HB2A 2XYGA 1VMAA 1YMVA 3H2HA 2WJYA 4B8ZA 3ZIUA 1GLNA 4LUCA 4B2YA 2VJLA 4MQUA 3Q4GA 4JWTA 4E08A 1G5QA 3CS3A 5EZYF 3WIBA 3CZMA 1QGDA 3UH0A 4ZCRA 2HI0A 4ZVPA 3VKHA 3C7DB 3R5HA 4TN5A 2HT6A 3LUJA 3TTXA 4LAFA 1YBVA 1G16A 1NG9A 4LOIA 2JGDB 1W44A 1T4GA 3NB0A 1M10A 4P80A 1SZCA 1WDKA 1L5RA 4Q4LA 3PJRA 3ZH2A 3H8WA 4WSOA 4IS3A 1H65A 4RENA 3JTEA 1RI1A 3FF1A 2YFYA 3GRAA 4NOMA 1OLXB 3AETB 3G8AA 4RVCA 2FPPB 1PZGA 3PD1A 4TT3A 3H16A 2XADA 4ZEMA 2FXVA 1OTYA 4DJTA 3HHPA 3H1AA 5A62A 3HGTA 4UKDA 4XWAA 1RIFA 2B37A 2J9ZB 2RGRA 1GPWB 3C6ZA 1R4AA 5EJMA 2ILVA 1FZTA 4D0SA 2Z6VA 1OX6A 2Z2XA 5ESXA 1QVRA 3BRSA 1B4DA 4QUGA 5EGSA 3EQ8A 1JFVA 4MW5A 3RSHA 4G4JA 2BEWA 2X8JB 1P7ZA 3BG5A 2CNBA 3BREA 4B3TB 2VHVA 2WTBA 3E3AA 3KLBA 4KFRA 1UPAA 4R9NA 1P9RA 4X54A 3DT6A 1WHTA 1XMIA 3LT1A 4LDPA 4ZOBA 3X1ZA 4AZTA 3B53X 4Y6SA 5P8WA 3STTA 3OY2A 2I6XA 3ROMA 2GKGA 1J09A 3NYIA 1P62B 1BDMA 1H2EA 2DUWA 3N9IA 3OPYA 4RPCA 4QBTA 3KVOA 4N0EA 5BXYA 5DP1A 2NUPA 4IGAA 4RL4A 1FRFS 1RCTE 2IOQA 3NNNA 4DZZA 1R5OA 2EIHA 3QBTA 4F93B 2FSVA 2G5TA 3OH8A 2O1WA 2GWHA 4GH5A 5F3DA 4P5EA 5T4EA 4EOGA 2RJNA 1D03A 1U0JA 2EGGA 3AVVA 3K09A 1ENZA 1TE2A 1KJ8A 1TTPB 3D7LA 1DRWA 3I52A 1E64A 3A14A 3L3BA 4BEJA 2QTAA 2XSZD 2G36A 3ZDXB 4CQNA 4M1SA 4UM7A 4IO0A 4B85A 4E51A 2BR4A 2H4HA 1WB9A 2JARA 3ZCQA 1XD2B 2B99A 3N8GA 4UCFA 5IZCA 2OGZA 3R3UA 3NOXA 1SIWA 3GWZA 2R6ZA 3OLVA 3ROZA 1JU9A 1BDIA 2I91A 3G9TA 4PR3A 1Z2PX 3WMEA 1IK6A 1N8NA 1ZNYA 3VRHA 3A1EA 1WP4A 2ZBEA 2WQ6A 2QJRA 3SIWA 1YBFA 1S1CA 1Y1TA 3KK0A 3Q85A 3DL4A 4FOPA 1EESA 1Q91A 4IDAA 3IBTA 4HN4B 4TTJA 4HLCA 1R0CA 1C1HA 1NU6A 2JKVA 1X8LA 5CDYA 3R7AA 1KY5A 2VXOA 5JZBA 3TR5A 1F4VA 3A7EA 2EYUA 2NWQA 3E3NA 4I2VA 2EW1A 5JJBA 1G59A 2ZI9A 3D6VA 1U1GA 2EG5A 2I62A 1WCYA 2EZ9A 4IUDS 5BY2A 7ADHA 1JQAA 1EQAA 1PZHA 3KHSA 4ND1A 4OXXA 5B1IA 1FNCA 2ONZA 4F3TA 4DGSA 3LM8A 2MT9A 5CX1A 3UOGA 3RYFB 3K8OE 4ZFNA 1EFRD 1P8JA 2H0AA 3LLMA 5CHYA 3ZU6A 4JT9A 5AIBA 2VJKA 5L3SA 1IIBA 2Q0XA 1YZUA 3H9EO 1QHHB 4HUQB 5CLIA 1PYDA 3FYUC 4YGYA 5DULA 4MX8A 4F2HA 2W8ZA 3IQFA 3NORA 4KX5A 1L5SA 4HDNB 4IWYA 4FQ7A 1U0GA 3EDMA 1LUAA 2ZJ6A 2YJ5A 1ZUHA 2C3OA 3GD7A 4L27A 3FFBA 5ARDA 1PX2A 3P0FA 1JZTA 2P67A 3AX6A 2PKXA 3E70C 4YS6A 3B8HA 2I1QA 1V8ZA 3C97A 2XNSA 4QTYA 4IKPA 2XRFA 3O21A 4G8CA 1SULA 1TM3E 3DB1A 4RWZA 5GJVC 3HFSA 1OILA 1Z29A 2NU9A 3C3MA 3HVHA 1H23A 3MSXA 4G4SO 4AN4A 3I62A 3QVMA 2E1PA 1NM5C 2WM9B 1NOKA 3BIJA 3GEHA