1NUAA

Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
390
structure length
382
Chain Sequence
NPTKISILGRESIIADFGLWRNYVAKDLISDCSSTTYVLVTDTNIGSIYTPSFEEAFRKRAAEITPSPRLLIYNRPPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENAETILKAVRREVTPGEHRFEGTEEILKARILASARHKAYVVSAGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQLMFNMALDGPKKKIVLLSAIGTPYETRASVVANEDIRVVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ligand-induced Conformational Changes and a Mechanism for Domain Closure in Aspergillus nidulans Dehydroquinate Synthase
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE SYNTHASE
total genus 137
structure length 382
sequence length 390
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1nuaA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nuaA01
3UHJA 3W5SA 1NVDA 1UJNA 1NR5A 1VLJA 2D2XA 1OJ7A 3ZOKA 3OWOA 4MCAA 5HVNA 1XALA 3CE9A 5BR4A 2BI4A 1O2DA 2BL4A 1XAHA 1XAGA 1RRMA 3CLHA 2GRUA 1JQAA 1NVBA 1SG6A 4RGQA 4RGVA 5FB3A 1KQ3A 1XAIA 3BFJA 1VHDA 3JZDA 1NRXA 3QBDA 3ZDRA 1JQ5A 5K8CA 1JPUA 1DQSA 1NVAA 1NVEA 3IV7A 4QGSA 4P53A 1TA9A 1XAJA 4FR2A 1NVFA 5EKSA 3OX4A 1NUAA 3OKFA 3QBEA 3RF7A 3HL0A 4RFLA
chains in the Genus database with same CATH superfamily
5H3HA 4R1MA 1Q7EA 3H04A 4K6MA 2CXPA 1DG1G 1ZVMA 2OCKA 4NV3A 3TNLA 5JATA 5KDDA 2VDNB 4EG7A 4YPOA 1HDXA 1WZCA 3U7QA 2WYVA 4DLNA 1TM1E 1TQDA 1ZM2A 2EW2A 3AVQA 3EODA 4M7OA 2PA0A 4RY9A 3NG1A 4U7FA 4XYEA 3NASA 3MELA 1Z8HA 4MYUA 2JGJA 4X20A 4ZP1A 2DQ4A 1SOMA 4CKEA 2JHPA 4JI8B 3CGGA 1Q17A 3QF4A 3VKFA 3AM1A 1EGMB 2Y0CA 3UM9A 3N0XA 2PIAA 5F5NA 2XE6A 3SS9X 2O3RA 3AUFA 3KSBC 1JSCA 1JR2A 1RXCA 1XJWA 1ULTA 2GYYA 3Q7IA 5IKOA 3L06A 4G8JA 4NCIA 2YMQA 1SR8A 3QLTA 4DNQA 4GKBA 4JLOA 1LB1B 2O48X 4WOJA 4YRPA 1L5WA 4CFYA 3L4KA 1OLOA 2R6R1 1V45E 3EY4A 4OHUA 1N6IA 2WMYA 4HNVA 4IUCS 1TADA 1JZSA 4O5AA 1R4AA 1YK0A 2OHVA 3PQ6A 3R23A 1NQWA 4XRGA 3U81A 1S2OA 3T1QA 2YUIA 1PCXA 2GAIA 3CLRD 3GRPA 1P29A 2HA0A 1GO2A 3GJYA 3KPVA 4FDMA 1CB7A 1Y7IA 5IKMA 1FRFS 3RVNA 3Q1LA 2BDTA 2YIMA 1LNZA 3U09A 1RBMA 3E6AA 2UVDA 3D7SA 1SO8A 4JI7B 1QXSA 4NZNA 1U2RA 5GV7A 3TTUA 3HCCA 5U4QA 1PJ3A 2I6SA 2G82A 2WKQA 1DRKA 1PZGA 1YQEA 4L16A 3VDNB 1J0CA 2W4IA 3S28A 3GGDA 3TMYA 3NBQA 3FNQA 2R7KA 4JBHA 1J2UA 1P3DA 4MIKA 4NICA 4P3OA 5I8WA 3LHSA 2J0SA 5B7PA 4Q02A 1S4MA 1KJQA 2JZOA 5LZ7A 2ZIUB 3HFGA 4EAAA 2XAAA 3QKRA 2Q62A 2QR5A 3BIFA 2CNNA 3D3WB 4BDSA 2GF2A 4FIZA 5IARA 4Y67A 5IH3A 3R09A 3MOGA 4D2IA 5ISMA 4PIPA 1T5BA 1HXHA 1WO8A 1XJ0A 2J6CA 4LXQA 5PGMA 2V7TA 3EVFA 3I3SR 4PPGA 5ALSA 2NNLD 2A14A 2DFDA 1SXJA 3R77A 2JFGA 5G53C 1DC8A 3O2JA 3KLBA 3L6EA 4DT1A 3CNBA 3L4BA 3G59A 4N4AA 4M1QA 4C29A 1X1SA 4WJKB 2Q3MA 1TQ8A 1UFRA 2QAGB 1AKVA 1S01A 4ZQBA 3PEYA 1OI7A 3F98A 2YY5A 2IP1A 1KZ1A 3C6XA 3FPKA 3LDHA 1YR2A 4LSWA 1KOFA 1ZOIA 2CLIB 3KM0A 4PE5B 5AW7A 4BLTA 5T8KC 4AKTA 5HWSA 3BG5A 2VNIA 1E1QD 2WJAA 3LAWA 2CLCX 5EP1A 3OM0A 2WM8A 4ZO7A 4NZ9A 4IDPA 1L4NA 1P2SA 2BP7B 5EERA 1JB9A 2G5PA 3NIGB 1ECPA 1KDOA 1CERA 2YWJA 3PBKA 4P7JA 4YT2A 4UPVA 2OWEA 3JAMA 1OI4A 4GZ5A 2H00A 1WL8A 4YV7A 5KNDH 2HRBA 3CWQA 1M2KA 4JQOA 1RAEA 4QXQA 5EIBD 2I71A 2XZTA 4CUZA 5ITSA 3QWAA 4LPSA 1BWRA 4P81A 5CB6A 3WFZA 5L3QA 4X95A 4J0EA 1P39A 1X7YB 4FKMA 1NVXQ 2F3SA 3JSAA 1HOXA 2R6ZA 1LKZA 4LN1A 4NOLA 3ZWAA 2YV3A 4BP8A 3PEWA 2HBRA 2XGMA 2MYTA 4N8SA 3IAHA 2DY1A 3UJ6A 4L4XA 5IYZF 1QGUB 3EWNA 4EPYA 2IE0A 4AKIA 1R0SA 4X7BA 3K70D 1WZEA 1NBMD 1TRHA 1LD3A 2OGZA 1P6XA 3GQBB 3NWPA 3N75A 4KVZA 4UAVA 5EQFA 5NULA 1RM5A 3ZX4A 1XL1A 3AETA 1C3XA 3RYHA 5T6MA 1LSUA 3GD5A 3L0DA 4V02A 4WGGA 2I6XA 1W5EA 3L7CA 4P4GA 3SZUA 2O23A 3RVOA 4C0JA 4AC9A 1QK5A 3GMIA 2PM8A 1PS0A 2WUEA 1K06A 1F1BA 5UKDA 3GN1A 4JCCA 3ZGNA 4C5BA 3L4JA 4WDRA 3O4RA 4D74A 2DLDA 3BWCA 1HYHA 1TM2A 2F8LA 2VCYA 3BTOA 1NI5A 1L8LA 2OCXA 2X8WA 1CW2B 3C3DA 3DBRA 3M6VA 3PCXA 5D5HA 4AJKA 2I7VA 2PPVA 3H75A 4IEFB 4L5JA 1FRVA 3IMGA 3PUJA 4QFCA 4X3OA 4X7MA 2GN2A 2VJMB 2C3OA 4LQLA 4QDKA 4OB7A 1YV9A 1HURA 3RSGA 1K97A 3UB2A 1EWQA 1HL3A 3GLGA 4A1OA 2G72A 3OTHA 4H1WA 5AVOA 3K09A 3TRIA 4CQJA 4EYEA 2E82A 4IO0A 4MW0A 3VTFA 5FO0A 4CM5A 2WSSA 3QOXA 1NNSA 4JYMA 2D0DA 1PZNA 2M1XA 1EM8B 5CM2Z 1KVRA 2AL7A 1GIAA 1H2AS 2XGJA 1XNGA 1Z36A 3DULA 3EGVA 3FW1A 4IZIA 4OL0A 5D84A 4IFTA 4GIBA 2QTZA 4IZ6A 5IYZA 1X8JA 1ZR2A 3GNLA 4QQKA 4UC0A 4F2HA 2WWIA 2AN5A 1WF3A 3K6JA 1LPOA 1TTHA 3LF2A 3VVLA 4D6YA 2CZGA 4AS3A 4RIIA 2X5OA 4F2PA 3VC7A 4PZEA 1T6NA 1EVZA 4DLAA 1UPXA 1KF0A 2Q29A 2ZWMA 1A04A 1LVHA 1AS0A 1ARZA 2DJIA 1RXYA 4JHLA 1MOSA 1IQUA 1M2NA 2DH5A 2XKJE 3CEJA 2WRZA 1ZZEA 4MGZR 4BV8A 4DDKA 5AW3A 1JI3A 221PA 2FNAA 2TECE 4MP8A 4K9QA 3O3NB 1J2JA 1E8DA 1USWA 1HT3A 3LWDA 3P2JA 4XPZA 4ZT5A 3TTTA 3W4JA 1XKTA 5HFJA 1KYXA 4URWR 3QKSB 1ZL0A 2Z09A 3KOWA 1C9DB 2I1LA 2ZDHA 4UNRA 1T3TA 2NXNA 2WPDA 3L18A 2BELA 3NETA 3PHJA 3WIVA 4K9NA 2QRUA 4DARA 1BX3A 2JK1A 1RLIA 5KC8A 1ZWLA 2AMVA 3KQLA 4U02A 2A5LA 1JTVA 1NVUQ 4PC3A 3K32A 1NUPA 2BJHA 5SYNA 1YVRA 5K03A 4DJ5X 1R6AA 6ADHA 3T99A 1EFCA 4PAWA 4ESHA 2CFRA 2N42A 4IM7A 1KKLA 5ELMA 5K5EA 1H4TA 1IXYA 2NYVA 1RYBA 3AY3A 1V16A 5G4KA 4UFOA 4HRVA 4DILA 5FWNA 5JJKA 4YQEA 1N33B 1U90A 1SKYE 2ESRA 2P6UA 5M3BA 4AXXA 4M8LA 4TYQA 4BCCA 1MENA 4DKJA 3MBIA 5AUOB 2WM3A 1HQKA 3LRXA 4IXDA 4CUJA 2HCJB 4DSUA 2F1HA 3OUZA 3PTZA 4HGNA 3ND7A 4K5QA 5BSUA 3JTEA 1VZ2A 3KP1A 3E9EA 4RJTA 1FUUA 2ECKA 1EGAA 1TZMA 3V9AA 5AKJA 3CF6R 4HWKA 2C83A 4BX9A 3EDQA 4WLUA 3FLBA 3C15C 4LOLA 4FZVA 3O0TA 5BXYA 2EW1A 1KEZA 3OCWA 1OPRA 4UNPA 1IUPA 4PO8A 4UDYX 1GXSA 3RUAA 3AF0A 3WKDA 3ZCPA 3G8CA 4POAA 5CA0B 3I62A 2IYPA 2AYYA 4MICA 1E1QA 5EWLA 3UUEA 3HU5A 4DQVA 4DY6A 4L4RA 1ZITA 4DWOA 3M2PA 3AERB 1T0HB 5IUKC 2O4CA 4LMBA 4DUGD 4YRAA 5CB4F 2XF2A 1L5YA 4JU9A 3VR5A 4QNNA 4DWWA 3AQIA 5E6UA 3UTDA 4KITB 5GIPE 1LI4A 1ZA1A 1P9OA 1Z7WA 2RGNA 2VUIB 3CPHA 4H4EA 4MWZA 3RK4A 3VTKA 1E9VA 2AFHB 4QUDA 2DPMA 3PXDA 5EY5B 1EFRD 1OU0A 3FB4A 2BEWB 2XQFA 4RF3A 3DWGA 2V03A 1O54A 1YBVA 4V0SA 1OJLA 2R62A 1NHGA 4A8JC 4PLGA 1ECJA 4DDTA 4DQXA 4P4UA 3ZTTA 4L76A 4UXJA 2A9PA 2FN9A 2PIDA 1IJFA 1WKVA 2R7LA 2ZYGA 3L5OA 4KWEA 4ZA2A 4PNZA 2AH5A 4R0MA 3FCEA 3VC2A 4MAMA 2GJKA 3K70B 3RE1A 4NC9A 3HJTA 3ZH9B 3HHEA 5DLYA 1EUQA 1FXUA 1OFGA 2C2ZA 3EN0A 2HMUA 2I3BA 2VF7A 4P98A 1EFHA 1YZKA 4J3NA 1B73A 3SHQA 1Q0SA 3PLAE 4FI3C 3FOZA 2WTMA 1NC1A 2ANCA 1WEKA 3P4XA 4J9UE 2CNLA 3ZUPA 3DWFA 3HI4A 1U5AA 1DKLA 2Z2YA 4J4TA 1PEDA 2PL9A 2PQ6A 1LLQA 2RGUA 5BW4A 1R6DA 2FV8A 4PRLA 3T7TA 3ORYA 2KBFA 4GFDA 2EIXA 4BATA 3TGPA 1K6IA 4P58A 3UHOA 3VBEA 2G28A 4KCGA 2BKXA 1AKEA 2ZSIA 1QGAA 4WL0A 3GDHA 3QJYA 4I9GA 4X1IA 3SAJA 4CJXA 2C59A 3AEYA 5IDXA 3Q6MA 3BMOA 1QGOA 3EGOA 5DTRA 4V2UA 2EEZA 1UEJA 4UUPA 4IVRA 1F8FA 4OQFA 1L7NA 4XCQA 2A33A 2J4FA 3O8DA 1V3VA 3B82A 4GYWA 4JKYA 4ACBA 2QRKA 2RKOA 1TQ6A 1Q57A 4M9ZA 4POOA 2CT8A 4RLQA 2C57A 2H31A 3ZHQA 4ND8B 3G9ZA 1UDXA 3BCRA 2ST1A 3HRIA 3P5BA 4FP9A 4MWSA 4TYPA 4ALIA 5BWLA 1Y63A 3AV3A 4MW9A 5A71A 2IZ7A 1HYEA 3HKEB 2QRZA 2ZP1A 2JFUA 4US1R 1E1CB 1SU8A 4JLJA 1P5JA 1P5RA 3K0SA 4FW9A 4EAQA 3FOWA 4CR7A 3PP8A 3UPTA 4EB3A 4XQ0A 3F3YA 4RADA 2OZEA 1BYUA 1YS1X 2BZSA 2HQ1A 4FB5A 1VYTA 4LF8B 2ZPAA 5MDHA 2ADFA 2R3SA 5EQDA 3KE8A 2C3YA 2IOFA 4WMLA 3MZ0A 2GAOA 1E77A 3SZ3A 1R6UA 3UKDA 4DL9A 1DDIA 4WHMA 4LUCA 4PW0A 4JUAA 5BSTA 5I7UA 3VO9A 1A96A 1Q12A 1P18A 3H83A 3H9CA 3WJ7A 3KLOA 1GARA 3CLUC 4Z9XA 4JITA 3X1XA 4YV2A 1BD4A 1OXXK 1C7QA 1GR0A 2XYPA 4Z1MD 2ZTSA 1UUFA 1VP9A 4RZ2A 4UU1A 3KB2A 1Q0LA 2CWWA 1E2IA 1I7PA 2IXEA 3QVLA 4ZOCA 4D4MA 3WGKA 3GQBA 1EWVA 3KAJA 1EFLA 1V8FA 3W06A 3K6SB 2Y67A 4JLPA 2CNDA 2FPPA 5BR8B 3K94A 1W25A 5KYTA 1N2SA 2I2XB 3BJZA 1FK8A 2H5LA 3PKIA 2G6BA 3KO8A 1UAYA 3NW9A 5GJWC 1RLJA 4ZYXA 4A5SA 1IPEA 2XAUA 1WDLA 4CMEA 5JADA 3KYCA 4EY5A 3KR1A 2BFEB 3BFXA 3U56A 2G1KA 2BC9A 2HF2A 4KPGA 3MPUA 5FL7D 3UXEA 3K2BA 1KDYA 3UXHA 2QMYA 3TKAA 1UJMA 4WCVA 1W0JA 2QVXX 3QZUA 4BP1A 4QATA 1C7FA 1P7CA 2YYSA 2PY6A 4A4DA 4BFLA 4FFMA 1N5MA 1GDTA 1OCEA 4BC1A 3ESZA 5GV8A 3TIFA 3ZXSA 3BB4A 4F4DA 3EXHC 5LUAA 2XRFA 2ZOSA 4HEQA 4IUDS 2VG8A 2XTAA 3EA5A 4MHOA 3W5BA 1U28C 2XUJA 1NX6A 3KNZA 4YASA 1WABA 5JHGB 3G2PA 1Z4PX 1C9YA 2GJ4A 3QXCA 5D87A 3K2IA 4Z51A 1QRSA 2K87A 2VDVE 2P2LA 4L74A 2RONA 2FR8A 5DIZA 1GZ5A 2A6PA 2ZB3A 4P0PB 1IN8A 1KGDA 4MS1B 4R9SA 4OU5A 3TQCA 1U4NA 3H0KA 1O58A 3L0ZA 3A9VA 2FDXA 3TVDA 3N8KA 4RVHA 1GA4A 1DBWA 3ZXIA 3PSAA 1PTJA 4IV0A 1H4VB 2P7IA 1XEXA 2IYAA 4M1KA 1IOZA 4WZAB 2YZGA 2H54A 2QTHA 4HS4A 5J40A 4BMYA 5A4JA 1DKUA 4B45A 1U04A 4KQ6A 4G6ZA 2PT7A 1BHO1 3CT4A 3U4MA 4OM8A 4JL5A 4CQNA 3R0JA 2H4ZA 2FEOA 1VIMA 3IP3A 5ALZA 4BNZA 4D9HA 3I09A 4X7RA 3CU5A 3SXJA 1JKMA 3INNA 3O1JC 5KWSA 4CEIB 4L8LA 4FJ1A 2FAXA 3LPAA 3F7NA 1EFPB 1ZMOA 2GJ8A 2K4MA 5E6RB 4ECAA 2MSDB 3MA0A 3CZ4A 3UAXA 4EY8A 1MC5A 1Z35A 2J8ZA 3ZLVA 1MOZA 1YVEI 2DUMA 2YWEA 1H1DA 5F12A 1XTKA 1US8A 2WAOA 4YCCA 1IBLB 3DFMA 3U7QB 1QH1A 4U0KA 2JH3A 4ZODA 1R8YA 4EKGA 5D85A 4B1FA 3E03A 4NMLA 1UBEA 1YFZA 1Y98A 1E0KA 4ND4A 3K9BA 4GX5A 4JBYA 2JJ2A 2Q21A 3WHPA 4WIAA 4FU0A 1NG1A 5FUWA 4HI0E 4L3VA 5J43A 2C7QA 3GZNA 4DG8A 2EW8A 4NLLA 1CUIA 5G3ZA 1V11A 2VP9A 3AY6A 2YL2A 5JO9A 3M5CA 3FBTA 4MZDA 1GAJA 1WKCA 1Y81A 4ZVTA 4BMVA 5LBIA 1ZN2A 4YROA 3D8NA 5FBWB 2Z2ZA 4YJ2F 5K6AA 5DASA 2CLHB 4TYNA 2GN0A 3JQAA 5ECWA 3SSMA 3TDMA 1C1DA 3EZLA 3FR8A 3I3OA 3ICOA 3NDRA 1L5ZA 2JCYA 3AP3A 5B6IA 1TTTA 4Q01A 1OWNA 2HCRA 5DRTA 4EJFA 5C1IA 3UIEA 1NYTA 4AJ9A 4FSXA 4TKUA 2AFVA 5D7NA 1YMVA 4H7HA 2VA8A 3OTIA 3RBXA 4BZPA 5IJ0B 2FYTA 2J59A 2QTAA 3NAQA 2PS0A 2V8BA 3AOEC 5ARDA 4AG5A 4CVNA 1RMQA 1ESMA 2CLEB 2IUUA 3K20A 3PQ3A 4LDJA 3BWYA 3RJZA 1P1JA 1II8A 4RAQA 4YA6A 1Y5NA 3E70C 3FPJA 1PJAA 1RJFA 1Z74A 4WKNA 1WMFA 4BNUA 4UQLA 1ZPDA 4CQMA 2PUFA 1LF0A 3KG2A 1YF3A 1XZPA 1D2MA 1CUHA 1VJGA 1EUCA 3NUZA 1GKIA 2CB0A 1IN7A 2P4HX 4ZAZA 3WIEA 4WZBE 2GZSA 2LCQA 2WYIA 3B1KA 1AGRA 1M7HA 3IBFA 1U0HC 5GWXA 5EXDA 1W36C 3CHYA 5AKHA 1HEUA 2VPZA 2VZLA 5ALKA 1KDVA 4BTEA 1ACJA 1QE3A 4ABTA 4PFKA 4Q4JA 1BGWA 1Z5VA 3PR3A 1I5OA 1YRLA 2SECE 4GG1A 4JXJA 4N7MA 4G2NA 1AY0A 2Q2OA 3PS9A 4Q4CA 1ZUIA 3P9NA 2COEA 3L1HA 1BXRA 2HPAA 4FILA 3RROA 3VHQA 1PJ8A 2BEVB 1OHHA 1CVLA 3B5IA 1R6BX 3UKOA 2YV1A 3O1IC 1Z6QA 3VH4A 1SH7A 2QW0X 4NAHA 1I51A 1NJ1A 2CKDA 2CGEA 2DPLA 2ZWPA 3BIXA 3KKNA 4NS1A 3OC0A 4OSEA 3DCIA 2GNOA 2XH8A 4TUYF 3GWGA 1THTA 4Y9RA 4ALNA 4S1VA 1R4NA 4F9GA 3A6DA 3EC2A 4UHBA 1QFYA 4X1IB 5KUTA 1JI0A 1R66A 1HG1A 4B3XA 3LBNA 1KAGA 2IF2A 4QUJA 5EJIA 1KVUA 4GUAA 3VM6A 4B74A 2JI8A 3C41J 2IYWA 3LY5A 4MQUA 2GD0A 1TPYA 2JA1A 3KOYA 3ZHBA 4CR6A 1LVUA 3G8DA 3KLMX 1NLYA 2Q3FA 4ID3A 4MS4A 1IZ8A 2YJ3A 3OUTA 5CGZA 4B6EA 4HV4A 4XVUA 3FFTA 3LPDA 4AZ0B 2FXVA 1A9YA 4QOSA 2P2YA 1ZIOA 3GZNB 2P6MA 3EH1A 1RYYA 5IH7A 1UANA 2WVHA 4ENPA 2HK8A 1VLMA 2NADA 1N2JA 5K99A 3FFAA 1NXPA 5HKKA 2XQVA 4EG5A 1NBMA 1WE2A 4ZVRA 3WGNA 4ZI7F 1DOAA 3MVEA 3ICCA 3KKPA 4N7BA 3IULA 2Y93A 4EELA 3MCWA 3KV3O 3V4SA 3THRA 5AH0A 3WBKA 2B92A 1QH0A 2FPOA 3GPLA 2J3KA 3KEMA 3MS7A 4WVLA 3HB9A 5DHRA 2I80A 2LKCA 4B79A 1PUXA 2JATA 2MYPA 2B4TO 3I32A 5HILA 4OB8A 1HGXA 5A3RA 1Z25A 4RZQA 2YN4A 5JH7B 1KDZA 5CA1F 4A9AA 3BRWA 1YZ3A 1YS2X 1X1CA 3V97A 1L1RA 5JZBA 3AIOA 4FGUA 3VO2A 1ZK0A 3AUUA 1FVHA 3A36A 3NM4A 3I39X 1E96A 1BXRB 4HDSB 2RAFA 4JJFA 4FD2A 4IL5A 1JAYA 4K9LA 4OYYA 2WU1A 5CLGA 3SVLA 2HU5A 3RFUA 4JS0A 4BAZA 3F49S 3QXJA 1UJ5A 4N0PA 4H0FA 2EF0A 1DFHA 5C5CA 1CE8B 1UKCA 1CDZA 4YRBA 1LDBA 2C20A 1X7YA 4A1FA 3P8ZA 4ZJUA 1L9XA 2P2GA 3LG2A 4MRMB 2GO7A 3W7AA 3C2QA 2DFLA 4TM7A 3U7RA 2GHQA 1Y4AE 3EVEA 3NVMB 4MGEA 4HAZA 3UC9A 2OA0A 2O8DB 4M98A 2Q4RA 1B6SA 5KWIA 4IXWA 3IKMB 2CNWA 4V3BA 2YW9A 5D3MA 2B3DA 2EBFX 3N2ZB 1PRYA 2IWRA 4R8RA 1CQJB 1YZTA 2X3UA 5DHUA 1FYVA 1W48A 4LGMA 1XVIA 2PRYA 3QW4B 1JQJC 1FVFA 5T6BA 3NHPA 1W5BA 2HKIA 5KINB 3CPEA 3JAWA 5AYVA 5SYAA 3UANA 1WZ2A 3AGQA 4QJ4A 3AQ4A 1WSAA 4D56A 4AJOA 2W2MA 3L0YA 1ZONA 1IHPA 3DT9A 3SX4A 2QX9A 3ZV4A 3EF0A 4MO9A 2IUSA 5D01A 4C14A 4EPXA 1I94B 1MVOA 4MPDA 3NHUA 1Q1ZA 3QWIA 1ZXXA 1FQJA 2VXYA 3ISTA 1O9BA 4IIEA 3WYEA 2JIQA 3P9XA 4NBSA 5IBCA 2PZBA 1N0WA 5TY0A 3WISA 1SBCA 1ST3A 1AA6A 2WJYA 4KACA 4QYIA 4BCDA 4F8YA 2OZLB 3S2EA 2BTQA 1A7AA 1QE0A 1W19A 1MG5A 1JU9A 1P1CA 3DE3X 1LVGA 3KVNA 3K71B 1HSOA 3EPKA 2GD2A 1GCOA 2QY9A 5KMGB 2IYTA 3W34A 2QVZX 5G0VA 1J23A 1SRRA 3KJFA 1SZJG 2GT1A 4FQ8A 2IPOA 2NSHA 2WHRA 3E5NA 3O3CA 4WN9B 2GGSA 3ABSB 2WM9B 1XLVA 1KO8A 1JXMA 5IYZB 5CTJA 3PC8C 2ADOA 3OLXA 1RWBA 3WGZA 2PS3A 1ZVQA 2CBGA 4XDHA 3EVGA 3THYA 2L19A 1YDEA 2RHHA 5EJ8A 3BVPA 4M38A 2RHDA 3I6BA 3PQCA 2D5CA 3P0JA 3HUUA 1RAHA 3PRHA 3FMOB 1W85A 4XGQA 4RVOA 3T7RA 3G0IA 4Y9TA 2XUKA 5CVVA 2BR3A 1SVSA 2AJ8A 4X1OA 1MFZA 3HJGA 1E6WA 2CDBA 2ORYA 1PW7A 3QVXA 1R50A 4TGLA 3KQPA 5SYMA 3VRHA 5FPKA 1CUBA 1Z37A 2G04A 1B8NA 2P2SA 3KPJA 4AJ4A 2KB0A 3DUWA 4R9UC 2O8BA 2FG6C 5A9RA 1QVVA 4GX2A 4M89A 4FSDA 4FXOA 4C6RA 5EJEA 1M2GA 2BGMA 1BFDA 2D00A 3OQJA 4JNKA 1L4FA 5G0TA 4CKCB 2QUBA 5JS2A 4J7CA 1YB7A 3TG8A 1P1FA 3K0FB 4AYXA 1AVTA 1KGSA 3B1XA 1LRJA 2GLTA 3QIAA 3A58B 4R6XA 2IX3A 2G36A 2XRZA 4UQPA 3HB1A 1P80A 2XE8A 2WU4A 3I37X 4Y3UA 3WHIA 4D5GA 4Z53A 1R3DA 1HUQA 4YRQA 4OI2A 2D1SA 5FPPA 3GLFA 4RHTA 1CWUA 5BUSA 2GPBA 5DGIA 2PMKA 3DBLA 3O8LA 3QTBA 2JHGA 2PUVA 1GN9A 3AEZA 2VJOA 4OAQA 2I7DA 5AOBA 3LVBA 4GGPA 3CZQA 3EEBA 3SHOA 2QN9A 4NJOA 4LGYA 1ZJWA 1J9ZA 2C9CA 4LJ4A 4FFLA 4ECEA 4WK4B 4GSLA 5BR4A 1W36D 3VC1A 3AHFA 3HJNA 1RE1A 1AV7A 1Q1GA 3GEGA 4HNRA 4RKYA 2XI4A 3F6YA 1Y3FE 5EMHA 4QYIB 3CURA 3ZIAA 4U5QA 1G7SA 5IDWA 3UV7A 3BAZA 4PX3A 1W4AA 3NOVA 1PNQA 2ERXA 3COPA 2Z8YA 1L7EA 4RANA 4DR5B 1EFKA 4F46A 1WD5A 3TD2A 3TD9A 2B3TA 1OGIA 1EJBA 4QSHA 2Z8ZA 2JCXA 2BKLA 2O14A 3FTCA 2YJ6A 3OPNA 3Q87B 3PIRA 4NJEA 4DYHA 4WJLA 2H65A 5A4KA 1ZK2A 1XMOB 1GPKA 4RJLA 3OCZA 1P73A 3C70A 1NI4A 4P7FA 4GVXA 4MVWA 1NE2A 4CM9D 1FE8A 2E4WA 2DPXA 4L9SA 5EE3A 3GJRA 5I4KA 5K0JA 4FE4A 1MABB 4EJSA 2DHDA 1T8PA 2AMFA 3BXGA 4EKDA 3PUKA 3ETHA 2B36A 4B73A 1R18A 2FFAA 2HJWA 3AEQA 4DMRA 4ZCTA 4FUQA 3U3KA 4YRTA 1EDBA 3P7MA 1A76A 5JVDB 3W9SA 1DQYA 4IP0A 2IHVA 2WHXA 4QECA 5CK5A 4OGKA 3VUEA 2JEYA 2Z83A 1JLHA 4XLLA 3LQFA 4BXOA 5ES3A 1P2GA 2C7PA 3FPHA 1F5NA 2RHOA 3E05A 2PX4A 4BIMA 1P7WA 1M2WA 3B9PA 1G60A 3KLPX 1KTIA 4NR0A 1GT6A 1WDTA 2XT0A 2OBXA 1WXFA 4JYPA 1L8AA 3R5SA 5IVHA 1KBQA 4GPIB 1RYNA 2R6CA 2JBHA 1VMDA 3M6FA 4YAEA 4TMZA 1OLSB 2XNKA 2QY6A 4Q1DA 4CQLA 1DT3A 1JHUA 2ZJ3A 3DL7A 1PQYA 2Y2UA 3A28A 1JQEA 1J7JA 3PNKA 4DMMA 5K1ZA 1MHTA 3BCSA 3BSYA 3WGLA 2O1WA 4CE6A 3V55A 1XMPA 2ZUVA 4G5XA 4BMCA 4X7PA 4XXHA 3ZJ5A 1RTTA 3QX7A 1DRJA 2W22A 3VDRA 4S0XA 2EJCA 3VX4A 4DTCA 1Q15A 3TZCA 4JDPA 5GQSA 3IERA 4UTXA 4OD0A 5LN1A 2NZWA 4L0CA 1KZHA 3OFND 3RM3A 2W6NA 3X1KA 4BGIA 3LL7A 3RGWS 4KR3A 4W1PA 4Y18A 1QPGA 3IP9A 4ND5A 1EX7A 1C30A 1Y4DE 1WVIA 5AHOA 3I0NA 3WLAA 2Z08A 3L6CA 2ZJFA 1JR3A 4YRMA 3VVCA 3QMWA 3KB1A 3LUKA 4JLMA 4OB6A 4JEHA 2RJOA 4OA5A 4R2XA 2J3EA 2JHFA 3BGSA 4J94A 4LIPD 4MA5A 1IVSA 5HOEA 2BCJQ 4LOHA 2OZPA 2HRZA 3PRYA 1Q91A 2QQ5A 4EHKA 3ENVA 1RZRA 1CUXA 2G4LA 4FSHA 1QRUA 1DEKA 3L0BA 4RKWA 1K7CA 3SEQA 1OT3A 1RP1A 1K7SN 3N5KA 1XYYA 2H1CA 2A0WA 1QWOA 2IU3A 4WPGA 3UJNA 1A9ZA 2G3YA 3CQ9A 1JHOA 3I83A 3G88A 2PO5A 3GFGA 2JKVA 3HGQA 3R6TA 4RO0A 5EMNA 4NBLA 2BBOA 2BGUA 2JCBA 4RWZA 1SG9A 3H8SA 3ZHYA 3UWPA 3LBFA 8MHTA 2DUNA 1R5NA 4M8IA 2A59A 1I3KA 3L6DA 4RCYA 2OGSA 4QQ8A 2Z5LA 1VHTA 5CW2A 4Y6PA 3V3KA 5KTMA 2ABWA 5CFOA 2X14A 2B7BA 2IHZA 4GOXA 4KUEA 4M9UA 1Y33E 3T3DA 1BDJA 1HQCA 2Q8PA 1U2QA 4HGRA 4Q7EA 5KQGA 4OG2A 3ZBTA 2YWGA 5AW1A 5A3JA 1M2OB 1WCYA 4I4TB 4ROSA 1GHTA 5BN4A 2CWDA 1EAYA 1GTG1 2QT0A 2VRCD 4JB8A 2VP4A 4CI0B 1CFZA 3DKIA 1YZQA 3R44A 8ADHA 3GBPA 4AI6A 2FP4A 4I2NA 1A5AB 2I1VB 1T13A 1VKOA 2OCYC 5IUNC 4RZUA 1WUJS 4Y1GA 4UAJA 4COKA 5KU7A 2WSMA 3EVBA 1DI0A 1NJ2A 3TW4A 3O84A 1QIKA 1M6YA 1TD1A 1OD6A 3CEMA 3EQZA 3HDHA 4DEVA 3U7GA 1CYEA 1G5QA 2PFKA 1Z6XA 3FTPA 4LTDA 4R0NA 1CZLA 2C04A 3F3KA 3IUYA 4EGQA 1XELA 4BNIA 2O0KA 2QX8A 4DM3A 1AD2A 2HWXA 3R9WA 3FZGA 1E59A 2YDXA 3PC2A 4MB6A 5BYKA 2J5XA 3DF7A 2VBCA 4L4ZA 4LYEA 5HKKD 4FOLA 3ACCA 3OLVA 4L4YA 1W6UA 1D2GA 4I3GA 4ZO6A 4O33A 4ZI2A 3QU9A 3FCOA 4RKFA 2HQRA 4WK0B 4E3WA 4GMHA 1U1GA 1WLSA 1RCFA 3WK9A 4GXRA 4ARVA 4RK7A 2Q0QA 5AUNB 5EMMA 1PJ4A 3SDZA 3ROGA 4CKCA 1I2CA 4QDZA 4Y2PA 2XMDA 5LLTA 4I1VA 3ZY2A 1U31A 5LBUA 3ZJUA 2WINI 4N3GA 3ZU6A 7YASA 1V26A 5FBVB 4QBIA 3RHSA 4EH1A 1BMFA 1DEXA 1EFPA 3ANLA 3X43A 1P0PA 1Q7CA 2MSCB 1TIBA 2WUFA 5E2IA 3MJTA 5C80A 2D8AA 4MWEA 5AOCA 1YS6A 3JXEA 3MD9A 4EVIA 3KEQA 5C8ZA 3VR6D 5H70A 3CNHA 5BORA 2FETA 3CJTA 5CT4A 1C1DB 4C07A 1QVAA 2GRAA 4PLPA 5F98A 5HA5A 4ESOA 2H1HA 3V4ZA 3AFMA 3S27A 3ZW7A 2YZMA 3MAJA 3CUYA 4FGKA 4NARA 4CKXA 3M82A 2IEIA 4MCJA 4G9GA 2GFQA 4KZKA 3WRYA 4KYVA 1VE7A 5HK9A 2WF6A 5IXSA 1SAYA 1G9XA 2D2EA 1THZA 2FPGA 2Y77A 3RU9A 2CDAA 5KO2A 4HXEB 3T7CA 5CX4A 4A0FA 1JFLA 4RA9A 3SMVA 1J0EA 1ISSA 4K8RB 2VZEA 4LOJA 4YWJA 2V7QA 4AIRA 3HVRA 5DX8A 3IILA 3LI2A 1US8B 4X84A 2VP3A 1IK4A 3BXXA 3G79A 1OAOC 1AT1A 1REQB 3GT3A 1U80A 2AXQA 2ETXA 1NJ5A 1XHFA 1G18A 2JH8A 4PCVA 3C39A 2SCUB 4RBNA 1Z5WA 4P2BA 1GL3A 3PHCA 3C5HA 3EUFA 2GSWA 1G8FA 2BMJA 2IFTA 2H6EA 1YUBA 4HN9A 3EEFA 3DNFA 1NBHA 2PH7A 1X7XA 4U2GA 2YY6A 4W5JA 1YB1A 5JAUA 1DTEA 1VL0A 2A94A 5J5VA 4YALA 5LWQA 1VHLA 2ODQA 1UP7A 3H2KA 5AJZA 4YCSA 5L3RA 3RSOA 5IBQA 4TLBA 1PJRA 4ZQHA 2HOQA 3A7DA 1W1UA 2WOOA 4JC8A 1Z7EA 1KI9A 2XZPA 3I8SA 4KQIA 1YO6A 3GNQA 1S7CA 4KQGA 2XV1A 3A1TA 3R7FA 4NAVA 3G13A 3GRZA 2FOXA 2X1LA 3RFCA 3QK7A 4E08A 4R98A 2QAGA 1QK4A 1OQAA 5K9ZA 2NP7A 1UIRA 2G83A 2W58A 4F4IA 4ZOEA 5BWBA 1V9SA 5FH9A 2Z3WA 3X1MA 3UCFA 1ZHOA 1JG7A 3BX1A 5KTSA 1IBSA 2GAFA 3B9QA 4UM8B 1B1CA 2PX6A 4U0JA 4YMHA 1Q95A 4D3YA 2XB6A 1TVMA 3U13A 3ZHOA 1M76A 1E6KA 3A37A 5LZ8A 4G1FA 2ZYTX 1H94A 4WACA 3W9UA 4RL6A 3JWEA 1NVKA 1FDVA 5I7RA 4QHSA 1FA9A 3EVZA 4NYJR 3HSYA 2G4VA 4UVGA 4DLWA 4Z4HA 4AUNA 3ZBUA 3QFFA 1A8PA 1UT8A 1VJTA 2TMKA 2OV6A 3BE5A 3CRRA 2H5JA 3GRRA 3ONEA 4ZV7A 3RUIA 4CKBA 4WOPA 4U7DA 1YIAA 3D7LA 1XDDA 2GLXA 3IJRA 4ZAGA 1FFBA 2B69A 5K3AA 3RWBA 3SEFA 3V7WA 4MJ3A 2FFJA 1V1MA 3B7WA 4D9JA 4D9IA 1WB9A 4OMDA 1GYQA 1H6AA 1U0OC 4ZYLA 1LV8A 4JX8A 3HO8A 3U62A 4MV3A 1FU8A 1SC4A 2BSQA 2AFHE 1KEEA 5AW5A 1C4OA 3OF3A 2AZ4A 4ZCQA 3ZWKA 4BNYA 4NMXB 4O6VA 4ZYUA 1XMSA 3VR4H 4FFOA 4J1SA 4LBVA 1VG9B 3PUWA 3L0OA 3L7NA 4HGOA 3SN6A 1LDNA 2ZSEA 3TCKA 4GAEA 1D5WA 1M3SA 3JWJA 1QU3A 4EFMA 2R44A 3T4UA 4DB2A 1ODJA 1W85B 2FPPB 1NN3A 5TQVA 3E9QA 4DA7A 2BN4A 4ISBA 2VPPA 1SKBA 4PZAA 3FD8A 3QWFA 1N3YA 2PUHA 1XQ1A 5F3RA 1J1UA 2GOYA 1X7HA 3CLKA 1X3SA 4R0VA 1S89A 4P34A 1P19A 4DQUA 4WXMA 5TPZD 3IOEA 2KBEA 1W7AA 1B15A 4MSUA 3UAWA 3URKA 4RMGA 2ZGVA 4ZIRA 1Z06A 4ICIA 1UZLA 4M7RA 3AUAA 3DXFA 3I12A 1MHPA 4GH5A 5H5JA 2PGLA 3PU6A 4YJ2A 4UJ3A 5C1BA 2GZHA 4DE5A 4MCAA 2GRJA 2GM9A 1DJPA 3PE6A 3ANXA 4OGWA 5LP6B 4Q4HB 3ZIAD 5BSHA 2VK1A 3U7FB 4QVGA 1OILA 4RCVA 2B8JA 4XQ9A 3IT0A 2X4GA 1PJQA 2O2EA 2WAAA 4KJZA 1KQNA 2PH3A 2GM4A 2PZ8A 1J8FA 4U1RA 3DMRA 4L6AA 1C7RA 1PZFA 3I1FA 3BH0A 2E49A 4EHDA 5GAJA 2YVKA 1LTKA 4NBTA 3F4BA 3HVKA 4L0MA 4CIXA 1P8AA 1BAPA 5FPSA 1KI3A 2I33A 3LO5A 4M1WA 2QX4A 1ODKA 1NV8A 3UT5A 2GK7A 1OKKD 3KSAC 3ER8A 2H18A 3EVNA 4XJVA 3SKYA 3UGTA 2NTJA 1WV1A 3B1VA 2A1UB 4Z4IA 2XGGA 3NAZA 1XFDA 1QJCA 1XO1A 1XVUA 2O2ZA 3U0VA 3NCTA 4C7OA 1ESDA 1Z5OA 2A88A 4R8MA 2PGIA 4UTNA 3GHYA 3KYJB 1RI3A 5ALJA 3VH2A 2O3QA 3MGCA 3R7LA 4IDFA 3RTDA 4J7XA 3ZXUB 5IVKA 1HE8B 3AEKB 1RAGA 1G8AA 3IBGA 3LUBA 3OJEA 2W2PA 5T4HA 3PC6A 1PLKA 1WW2A 2YWBA 3EF1A 4EGAA 4Z6KA 1WQ3A 1S2LA 3TPFA 4EI8A 2QRJA 1DJOA 1IZZA 1RVV1 4EPRA 1RRVA 1RRFA 2XWBF 3A6LA 4KK4A 4MMXB 4UEKA 3TS1A 1TAUA 2CXRA 1GRCA 4Z2AA 5DGCA 3L8ZA 5DF1A 4HAXA 3V7UA 2V7UA 2BBTA 1KRWA 4Q34A 2WI8A 4P08A 4ZEMA 1IRIA 1Q14A 2GEDA 2XVZA 3WNVA 1GPBA 2BF4A 1EGQA 4AMUA 2ECFA 2IH2A 2WF7A 1CIJA 3OZXA 5K6AC 3P94A 2ZJ1A 2JJQA 3LX8A 2A58A 3IBTA 4BV2A 3EC1A 5M5BA 4W1RA 3LWZA 1YNOA 3LGAA 4MV1A 1O97D 1DWUA 1HEIA 4QU0A 3OETA 4U6NA 1SXPA 1E5DA 3MINB 3HZZA 3NKLA 1HNZB 3FFBA 1LLUA 2OK7A 5CYFA 1R5JA 5A7GA 4O4LF 3P9RA 5JNTA 3THOA 2V58A 2P11A 2F90A 3TQOA 2VP0A 1L5GB 4QUBA 2NSLA 1Z29A 3CRVA 3GGPA 5TIIA 1RM4A 3TOVA 5JS1A 3FN4A 4CEJB 1NN1A 1JDVA 4NNPA 5DSZA 5FWXB 1JG6A 3LRPA 4GZ6A 1UKAA 2DWQA 3KKKA 4R83A 1COZA 2OD7A 4JJKA 3EVTA 1GZ4A 3ROKA 3UWSA 2O9JA 5CB0A 3JVDA 3FUXA 1DLJA 3AUKA 2AG0A 1Z7BA 3D7KA 3H18A 2EFYA 4DCMA 5CCXA 5HP4A 3UV3A 2BGJA 3OURA 4WOBA 2PX2A 3F2IA 3A4TA 3VQTA 5JSQA 3IPXA 1JHYA 1T1EA 4YK7A 1EHCA 1IWBB 5JXGA 3CR7A 4ENSA 2H9AA 4C4TA 2R5WA 3HXQA 2RGDA 1D04A 4BQIA 5HHTA 4XI9A 4W7HA 1KAOA 2WIGA 1ZLXA 3FI9A 2F59A 3IALA 4O02B 4JP2A 5D3KA 1CP2A 3ED1A 2B0CA 1AB6A 3SYTA 3PA8A 3URMA 3HTXA 4C89A 4XPIA 3F74A 3OT4A 3BDAA 4PBTA 4TV8F 5E1MA 1QANA 5AVUA 4B6RA 2QSYA 1HDZA 5IM4A 2A0XA 3F1LA 1SIBE 1OU4A 4RJIA 2HADA 3SBDA 4CUKA 1ENOA 3N7TA 2JPDA 2QYOA 5AJYA 1KKMA 4AF8A 2CW5A 1X86B 4MI1A 3ZHZA 4LQCA 3N6RA 3LSYA 4LHVA 4B47A 4YMIA 4M8SA 3MHTA 4V39A 1ZX1A 2P3QA 4CMBA 1WUKS 1PT7A 1QDLB 4G0NA 1SQGA 5E3IA 4AD8A 3PYLA 1HTWA 2ZB8A 1B41A 2Q6TA 5JXJA 3PTLA 2JGNA 1G1MA 4FYYA 3FCSB 4NG5A 2QRGA 4D82A 2DBRA 4H3SA 3V1LA 3AEUA 4KUGA 3EXEA 4MB0A 1PHRA 4NESA 1YUNA 2WA2A 4XWGA 3ZW9A 5AVVA 3VHLB 5AOAA 2RC6A 3QRWA 4ER7A 4B6OA 1NU6A 1WIWA 4PC1A 5JNSA 2IHKA 3SZRA 1WU8A 5FL3A 5ADHA 2FCAA 3C4QA 4I6EA 5EPEA 3R41A 1RHKA 1WZIA 3I8XA 2IEYA 3NEPX 2F3UA 2DHEA 5AM3A 2WUVA 1W0KA 1EJ2A 1L5VA 3BB1A 4D0NA 2GXUA 4BX2A 2BM1A 1W9MA 1XP8A 4KQXA 1O9HA 2V5VA 5B6JA 3JZMA 2WIKA 5CYPA 3WIUA 1KJNA 1HE2A 1YK1A 3H9QA 4G4IA 2J67A 3BOSA 3B48A 5LLDA 1RHRA 2VLIA 2FQYA 4D4KA 1L7MA 1V8PA 4M8NE 5CHEA 4CLEA 5A4DA 5JQGF 1L9KA 2JGFA 1AMOA 1DJNA 1H1LB 5F7OA 5DNYB 3AHHA 1RACA 4ZQIA 4JUCA 2IW1A 4MV0A 4QXAA 4B3GA 5BXQC 4FGLA 4QUGA 4KDCA 5E1OA 3GLQA 3Q8WA 4OHBA 1IIRA 4AUMA 3H42B 3W90A 2E4XA 4AK9A 3ZBQA 1DKOA 3HDQA 3FOEC 2HD4A 5FNZA 2GN6A 4OYLA 2H1VA 5EEGA 3QE9Y 2HLNA 1C5KA 3E18A 4ZD6A 1XMIA 1PL8A 1FFDA 2WJIA 4Z54A 1PVOA 3DMTC 2H0RA 1DV1A 3P4UA 4Q48A 4BWGA 3V6LA 5FJJA 4FKBA 4LJLA 4B4KA 4YRCA 4BJ5A 5KQRA 4OPMA 2ZK7A 2H7CA 4L9AA 2B2NA 1PWHA 2OHIA 4S1TA 4WTOA 4BVEA 3O4GA 3V33A 5C7IO 4GOOD 2LXNA 3PKZA 4Q9LA 3DONA 5ALTA 1OFIA 3DE0X 3MUFA 5JE8A 1Q0ZA 1PNRA 5CPFA 5G0UA 1PBTA 1L4HA 4TKLA 3PZBA 2PXAA 2HCBA 3E3AA 3HI6A 4BMDA 1GM5A 3MUEA 4NZMA 1P0QA 2VHWA 2WABA 1ONOA 1KSHA 2Q5OA 4LJSA 1N2EA 1XKQA 4D4IA 1U63A 1L8XA 1XPRA 1VJ1A 2X13A 2FZKA 3I76A 4B81A 3AR3A 5F4BA 1GG9A 1KAMA 2OAGA 1AOXA 2HDNB 3EOBI 3H5RA 6NULA 1WOMA 4DQLA 4ZHQA 1A8IA 3V2HA 3DLIA 4AWAA 4H08A 1I0IA 4EW2A 1JIQA 1RNLA 5L7YA 3NWEA 2BEUB 1MF7A 2AD5A 2BONA 2XB8A 2BKUA 1Y6QA 4I4CA 1BEEA 4Q6WA 1YB4A 5I9TA 4F12A 4EKEA 4MS1A 4RZ3A 3ZE7A 5I4CA 4WLOA 5KC9A 3UGKA 3TOSA 4N5LA 2GMWA 4MVJF 4I3HA 1DU4A 1ZA2A 2XDWA 3CMMA 4F4UA 5JW6A 1DX6A 3KKLA 1A9SA 1PYOA 2GN8A 3INYA 4I2VA 4AKGA 1NRJB 4NK4A 4QBFA 1E5TA 3FUUA 4ZK2A 4V2IA 3STWA 2QPOA 3G7NA 1Z0FA 5K0ZA 3LFUA 4B8YA 1P5HA 5DLPA 1WTCA 2ZBQA 5EYPB 2Q7XA 1TQ4A 3DEKA 3VSAA 1ONPA 4G09A 4J3JA 1KU0A 2JFNA 1DDGA 5JTUA 4KXLA 4WCDA 4ZDJA 2OILA 1HTTA 1RADA 2ZJ6A 4PCLA 1LSSA 3JQAD 3B3AA 4HGYA 3GELA 4K88A 5CYOA 1DEOA 2WWYA 1K08A 4NRDA 1GQFA 1OLXB 4H35A 1Y3HA 4I55F 5BYJA 1JRLA 1NJSA 2GEJA 3S55A 4EO4A 1U3TA 1XJCA 3DDOA 4L0DA 1E6MA 2PWPA 3OPYI 5C32A 3GVIA 1DFGA 2ISQA 4JWTA 3LVQE 2C1XA 3OOWA 1XNHA 4EJ6A 5AM2A 2AZMA 3S7TA 2H2DA 2KPOA 4MRAA 3SXUA 3T3MB 3TRFA 1E7QA 1RAFA 3GK3A 3WNBA 2O1EA 3OTOB 2ZJ4A 4GLBA 4QNRA 4PZUA 4X71A 4FHGA 1FDSA 1RP7A 1T6XA 3D8UA 3HB0A 4ONEA 3VR2A 4OHFA 1WHTA 1I2AA 3HPRA 4QBTA 1O87A 2CLOB 2FMIA 2NT3A 2ZRQA 1NBIA 1BX0A 5DBHX 5FDFA 4HDRA 3R6WA 2VK4A 2HQBA 1KA9H 3HJBA 1JNYA 1ZSNA 2AA3A 4GI7A 3KS9A 1OV6A 5A9TA 2O0HA 2ZIAA 1C2YA 1DO2A 1ZN7A 2XEDA 4MJLA 1QZTA 4BQSA 2JLWA 1Y1LA 3EPPA 4XCXA 5A7FA 3Q85A 5JZMA 4BFWA 1DTWA 3JQQA 3K2EA 3TLEA 4KKXB 4OJMX 4AB1A 3OAAA 4CIAA 5JLJA 4M0MA 1QP4A 5BV1A 1R9GA 2HSGA 4ENUA 5TQ2A 3WAKA 3BM5A 3E35A 3HYTA 4RD2A 2V9CA 1SN7A 1KYYA 4PPFA 4RHXA 3ZXYA 4D3DA 5KOIA 3I5YA 4ZCLA 1K89A 5ADVA 2AQHA 4YH1A 2ZSJA 4ISCA 4E5DA 2C8JA 5JI3E 3JQAB 4QYWA 2EP5A 1QAMA 4NYMR 3UFBA 2ZE7A 3PC8A 5JS6A 4I1PA 2ZCJA 1Q7TA 3ZIUA 5TVKA 1DL5A 4TS3A 2QBYB 5JZSA 1BXGA 4B6FA 3DHWC 2BSXA 1MG0A 5ICMA 3AI7A 2R00C 4INAA 5JVDA 3GBSA 1A2BA 3RK1A 3FGZA 2HSEA 2Q0HA 2FRDA 1DAKA 2G9UA 2ORIA 4OQLA 4CL2A 3ZE2B 3GP3A 3WP0A 2H7XA 2ZYHA 3LP6A 3IUNA 3TNYA 1EZ4A 5AVYA 1ISMA 1VDZA 4NV0A 5BPFA 3TVYA 1N2CB 2XTJA 1X0VA 2GVZC 4UHKA 3TK1A 3WKCA 1MIOB 1U94A 4JP8A 4LSZA 1YBFA 2RKWA 3QA3E 3K9NA 3AU9A 1E66A 2OECA 2P9EA 4MLCA 1ORTA 2R1VA 1IN6A 2I3GA 2R87A 4OXNA 4TTTS 3U4CA 4HFRA 2G67A 3MRVA 4MAFA 4G97A 3SFVA 2JJ1A 3OKPA 2QORA 5A04A 5I01A 4FEYA 4GEGA 4TVBA 1WXHA 3T9CA 1BN7A 3BHNA 1JJIA 1FNCA 3P52A 3UMBA 4KPYA 4IDHA 4TXMA 1BXGB 1GZDA 2WIJA 1V7ZA 2Q3LA 4HTAA 3EXIB 5LNK6 2M98A 3CZ9A 4YJHB 3TTVA 5F23A 4MV5A 3KQHA 4HGQA 3UUWA 4N49A 2H4WA 3E8MA 5LMNB 1SQSA 4JSTA 1KORA 2CHVA 1E1YA 1GPMA 1N6NA 1P8JA 1U81A 3DQPA 1NL3A 5CT9A 2WTBA 2GCOA 3N53A 4RFSB 2YZ7A 1XV5A 2C5AA 1X9HA 1TEHA 1XSEA 3STVA 3E7DA 4DLRA 3ZHUA 1IE3A 4ZDIA 1TJ5A 4GVLA 5EUCA 3OJXA 3HPQA 1ZM4A 1J7KA 2AC4A 5JSKA 1KQGA 2GCPA 1S3SA 1GZSA 1KC3A 2QTCA 5ERXA 3ZHCA 4S1PA 4LDNA 5E0OA 3TSAA 5BQ3A 4UTPA 1NE7A 4GKVA 1NVEA 1ULUA 2OO7A 2UZ3A 1XKXA 2PBZA 2GAJA 4M22A 1E1DA 4O1MA 1CUJA 3I9JA 5J63A 3MUNA 5TGDA 4EF4A 2X9QA 2OFFA 2X8LA 2RH8A 3GCXA 4NP6A 4W7SA 3VR4A 3R9KA 2LIVA 1QTNA 3WGGA 3VFDA 3AGPA 1RKQA 2I99A 4UCQA 1REQA 3K15A 3MGAA 3ZQKA 3U0BA 3WYNA 1JFSA 3CF0A 2Z4TA 3LX6A 2SKEA 3KSMA 2OCLA 1CS0A 2JF0A 2JASA 3FDZA 2ZVDA 5DIFA 5IWCA 5BT9A 1W4LA 4V3CA 2DLCX 3WGIA 2VF2A 3LGSA 5HEKA 4UW9A 3T0FA 3TXAA 3IDSA 3VTAA 2BBSA 1J1IA 3M6UA 3WLJA 3ZQ6A 3SIXA 3T9AA 1E92A 1VLVA 5L45A 3ZTYA 2VHYA 5EXXA 1KDTA 3SIPA 4O3MA 3UJ3X 4EA7A 2V6JA 1YZHA 3BD9A 4Z3DA 3PJFA 1CY1A 1UMKA 1WQ4A 1K68A 1X8XA 2QVYX 2WLSA 3CPSA 1USIA 3EW9A 2UYOA 3H1PA 5GGXA 3ITDA 1T1GA 4RTKA 1FXSA 2QGZA 3KOUA 4H18A 4HYQA 4ZO8A 4B4UA 2OWDA 4CKBB 4HNUA 1UBCA 3BC1A 3BGWA 1A2OA 4UM9D 1E3SA 4CCYB 2NMVA 2WYHA 1W2HA 1V3UA 1P17A 2YS7A 4QASA 4E7OA 1G8YA 3HXKA 4KIWA 4ABYA 1KEKA 4RTRA 3DBHB 1T9ZA 2PKCA 4GZMA 5F1PA 5IVDA 3CX7A 4BWVA 3COZA 1UAAA 1E2HA 4B44A 3WIDA 1VCMA 2GN1A 1BFUA 3IP5A 1KIAA 4Q24A 1NF9A 3GG9A 4N9QA 1E4OA 4UASA 1QORA 2J3JA 3CKMA 4EGCB 4FS3A 4KKVA 3V8VA 3AHEA 1N2OA 4F5YA 1NLFA 2NNWB 3HBJA 2PR2A 1ZGHA 2VAXA 4NBRA 1RABA 3CVYA 2C7OA 4KFSA 3HKDA 1QO0D 4MGYR 1NSTA 4XLTA 1SIWA 3DKVA 2WSIA 3EISA 5G41A 4KPFC 1KH3A 3CC8A 4OLJA 5B1DA 1I7DA 3KPUA 1ISJA 3OP4A 1YA6A 1FDTA 3E2MA 5KOHB 4HB0A 4XYGA 3SICE 4OIFA 1VHWA 3L4EA 4YRZA 7GPBA 3CH6A 2RGYA 1JJ7A 1O08A 3GFTA 4OK3A 5T67A 4PYRA 3W6ZA 2JI6A 5AWFC 3JQRA 3GLIE 4UUBA 1PDWA 4AMYA 2ZJAA 2D13A 5BSKA 2X3YA 5JCZA 1RRMA 1NMZA 2ATXA 1EDDA 1Z5PA 3UHFA 5A4IS 3VZQA 3OMXA 1H2FA 2VQ6A 4FYMA 4I5IA 3VKVA 3RU7A 1JEYA 2H06A 3BB3A 1GNLA 1VL2A 4UMEA 5LIRA 1J49A 1NLUA 2I2AA 1KXJA 1I3CA 1BGVA 1XZNA 3JAWB 4NWIA 4ZCPA 1BVUA 3IIJA 3N59A 3LU1A 3U7EB 1Z9BA 2W2KA 3QLVA 2X5JO 3F4LA 4J4BA 3GIDA 4L07A 2JFXA 3A70A 3FTEA 3RT7A 4Y2YA 1CQJA 4ES6A 3G5LA 1NKVA 5FQOA 3EXG1 5CH8A 1ORVA 2ENWA 3CFYA 3JQ8A 5A3QA 1O77A 2PKXA 3R20A 1T2NA 4O2BF 1CC1S 2DERA 2VDLB 1Q1AA 4KEAA 1Y3IA 3QHQA 3GRKA 3OOEA 4LDQA 4O29A 3VNAA 3WGYA 3LK6A 1JDBC 1PT9A 1NJ8A 4Q3DA 2CCJA 3GDGA 3RS0A 3ABQB 4RVUA 1Z8FA 2XOKD 2BGTA 4ESVA 4O59O 3IDOA 4H6VA 3JZDA 5DTMA 3WDLA 5F76A 3G5UA 3I4FA 2I2BA 3AKZA 4FWTA 2EBUA 5HRCA 1S8NA 3QFTA 3U3JA 1Z2CA 1Y8RA 3OQBA 4JSRA 4MIOA 2F43A 3B3GA 2W0SA 5ER9A 3X0DA 4DM4A 4MVJI 1ZLYA 4B80A 1PFVA 1Z8NA 3GOQA 4U2FA 2O7QA 3HV0A 1CZUA 4TV9B 1RBZA 4E4TA 4OI4A 1RYDA 2AFIE 4RXUA 1QK3A 3WB1A 3A6EA 1G3UA 3N5CA 1IUNA 2H1IA 4M1TA 4AX8A 4B3SB 3IHLA 3IUSA 1YKGA 4AXBA 4XWTA 1AKUA 1ZIYA 5ADWA 1N0IA 2IDJA 2V5UA 3C3WA 3LC2O 4WKGA 4OGLA 3M6XA 3QF4B 3EXAA 1TUEA 4YCAA 3ZN2A 1KSFX 4BB6A 1Q83A 1F51E 2ZIEA 4V0ME 3UMGA 2HSDA 1TJ3A 4KTVE 2QGNA 4NCXA 4WE3A 2B20A 4N01A 2JANA 2WVGA 3UWMA 3MGKA 1C30B 4KO4S 3CIOA 5ADUS 1OH6A 1XTRA 1Z0SA 3DJYA 4NDAA 4G41A 5DNVA 3IBSA 3QPUA 1TYZA 4DG9A 2YMPA 3ZWNA 1AHIA 3S2ZA 4L2IB 4NG4A 4JR2A 3SBEA 5FFFA 4DTIA 4PQRA 1B6RA 2DYKA 1M6NA 1K6MA 2O7NA 3L46A 1QQBA 1U7XA 2PK3A 1JIIA 3K35A 3MPOA 4TTIA 3QFCA 4V0RA 1HI9A 4BQPA 3HB7A 1NN0A 4JI3B 1ZIXA 1YC5A 1XB2A 3D2LA 4WWHA 5BOVA 1L3BA 3RJ9A 2DU8A 3KD3A 3S70A 4GI3A 1JDPA 1J9EA 4XH9B 3RH0A 1A1VA 3N2NA 1ZW1A 3OT1A 2X7HA 4EUSA 3REQA 1HEYA 2JLAA 3IEKA 1E7WA 3I5MA 1F60A 2FQQA 3GWZA 1BXZA 1XEWY 4DIOA 5DXJA 2GARA 1OZAA 4GKAA 4RIEA 5KTKA 1NUAA 1DKNA 2QM8A 5FX2A 1KY3A 3FVQA 4R5HA 3V80A 2ZFUA 3VZDA 4CIVA 4GSYA 4LI3X 1I01A 2HEGA 1T8SA 2BEWA 3JD0A 3WGUA 5CFQA 4JI4B 2F1OA 4ETIA 1ZKDA 4MP6A 3WAJA 3I30X 2XMBA 1YDWA 4GDFA 1H0SA 2GTHA 3T54A 1PEYA 1CHNA 3COYA 3DT8A 3IQHX 3VU1A 2VIIA 3PCRB 4PHGA 1NXVA 9LDTA 1PUJA 2POQX 4PR0A 4S35A 2NUAB 1IB6A 4EY7A 1VLHA 1GFIA 2PZGA 4KMRA 2ZUTA 3ZWYA 1ZMTA 2QZZA 3B1WA 4IXNA 2OAQ1 3H9UA 1TYDE 3IT3A 2GEVA 2FSUA 3HKCB 5IKPA 1C41A 4NONA 2W00A 2F9MA 4HLUA 4HS9A 2OEPA 5ALPA 2OL4A 4JBGA 3PQFA 5FWXA 2IPAB 3N2IA 4AQDA 1GV1A 4DUGA 1B3BA 1GGNA 4YAOA 2A7QA 3FAZA 4QUKA 2M6KA 4UBNA 2M6LA 2O5VA 4KNWA 3QE3A 4M83A 1I3NA 1U8XX 3O6VA 3AM5A 4LMAA 4UE6A 5BN1A 5JJLA 2H2AA 3CZPA 2C5SA 4L72A 4NH4A 1F4VA 3A32A 4MW6A 1LBIA 4HO1X 5FI1B 1KK2A 4MOWA 3W9BA 2ZRNA 1NF8A 3EZ7A 4WA8A 3I9V6 3VR3A 3ZE1B 2VRNA 1M8FA 4ALJA 2GVDC 1NI4B 4C0QC 4IMPA 1EUYA 1Z5GA 4BPRA 4CWAA 2YV2A 3R9IA 5JU6A 3OZCA 2X58A 3FNIA 1YZLA 1Z0DA 1G291 1E63A 3L04A 4Q82A 3R9XA 3CA8A 3QE2A 1RLMA 4NYIR 5IULC 3R8FA 4CM8B 1HMPA 4R8SA 3WWZA 1HNXB 1MDFA 1TC1A 1KI8A 1GN8A 3W5HA 2EFEB 4RKEA 1JLSA 5CA0A 4AZSA 5IJ9A 3GC6A 3JX9A 1R8SA 1M33A 4QT0A 1KH1A 4RD6A 1WPGA 3R24A 3P4YA 2PZJA 3KAKA 1E69A 3JYOA 4US2R 1XTQA 2DFKB 4PINA 2RFLA 5GP1A 4BN5A 2W9XA 3I01M 2GRUA 4CMKA 1Q0RA 1JQ3A 3MYYA 4K6CA 4LJ6A 3HGMA 4ZT3A 4P82A 4LHXA 2CEAA 1X9GA 4DCSA 4W8GA 1Z28A 4FOSA 3VKWA 3PNVA 3EFBA 3F97A 1XZQA 3OEYA 1BJRE 3P32A 1XRPA 1D6JA 4YDQA 1V5IA 4MVXA 2A5YB 3C6QA 2A1UA 1CKEA 4NQRA 3LUAA 3RAJA 5L51A 2B9EA 3FNGA 4X9XA 2QLJA 4AT1A 1Z45A 4F11A 2GHTA 3HABA 2CXQA 4I8DA 1T4MA 3MJEA 4ND3A 2BFCB 4MCIA 5G40A 2HZ7A 3VDXA 1B76A 3IAXA 2ONKA 1BGXT 4LGVA 4DR3B 2W6MA 4JI1B 4RGQA 3H2YA 4DF3A 4JEUA 1PFYA 1YRQA 1IG0A 5ECYA 4WUTA 5FOQA 3SC2A 2XODA 4MO2A 4LK2A 2W6OA 1F2UA 2PMEA 4RQUA 1QQAA 3LUDA 2B8EA 4HDNA 4PWZA 3DBRB 3WO1A 4EZIA 3RAEC 5B4UA 2X0IA 5FD8A 4Q03A 5GPBA 5DZSA 1PD1A 4MWDA 5AK0A 1P4RA 2E6UX 1H1LA 3TZ6A 1EEHA 2IHBA 3BWEA 5CLJA 1OY1A 4BYGA 1F20A 2OB1A 3PCTA 1TCUA 4LRSB 2X3FA 1FYFA 2VJNA 2YASA 3BRSA 4Q1VA 4YRDA 4YR9A 1V5GA 2CJWA 3PQDA 5CDSA 4DRXB 4OXYA 2DZDA 5ENDA 4C78A 3G5TA 3M1LA 3Q7RA 4L15A 1UMBA 1GILA 2F4VB 4UNQA 3ROMA 1NBOA 1ESNA 2IDZA 2QTWB 4KIGA 4RDXA 5J1TB 2X7JA 1YQGA 3FYHA 1N9KA 4LF7B 2VWQA 4KFTA 1G98A 3X2FA 1KYZA 1S96A 5EZ6B 3GLHB 4FCVA 3DBIA 3W6OA 1IDOA 3EDOA 3ZW8A 2F43B 1VDMA 3PD7A 2VEOA 3OA0A 1IOLA 2DHRA 3JQPA 3M3PA 1DZ3A 1KMCA 4K86A 2P75A 5E4TA 1U3DA 1Z3IX 1A50B 4QE3A 4IJQA 1N6OA 4U7PB 4R1LA 4P4LA 4EQ6A 3F46A 3IA2A 5E7QA 1NRIA 4WOCA 1O0SA 3QNWA 5BNZA 4LSGA 3KU1A 4EG3A 4UPEA 1OFUX 4PPNA 1W47A 3KFXA 4R31A 3FOCA 1T0IA 1U8TA 2BZGA 3NFRA 4FMDB 4XIFA 5DEOA 5EI5A 2LD4A 4AULA 5KTTA 1KZ6A 2W6CX 3OIGA 3EAGA 5AKKA 5IAEA 1ECBA 3BXZA 1F0KA 3I5UA 1X1QA 4C04A 1NW3A 3VSBA 5C9ZA 2CHUA 3ZGXA 2JCVA 4OBWA 1RZRD 2G25A 5DWDA 1A4UA 1YONA 3DMNA 5ELLA 5FBZA 1YR8A 1UBKS 5FTWA 1V37A 4IVPA 4N7RA 5JPCA 2EL7A 2HZBA 1YZGA 4BEWA 3O7MA 4DOMA 2RMKA 4PU0A 5D3MB 1WPRA 4FDUA 1TM7E 4KK3A 1HY3A 1VKZA 1E64A 4QGHA 1U6IA 4XVCA 3UG7A 1S3FA 2UUBB 4B09A 4INZA 3SDBA 1YJAA 2PS1A 3GOHA 4FX2A 3T38A 4HFNA 5LVAA 3IVMA 4WASA 2XVAA 1E3LA 4RGVA 1EFRA 1S2DA 3IPYA 4YMSA 3DB1A 1YE3A 3SSOA 4PGMA 4ATNA 4RORA 1UC4B 2F8SA 2FPSA 4BNHA 2A1TS 2YFKA 4C7MA 2EGUA 1VIDA 1TPZA 3BA6A 1ZMBA 5GINE 2HJHA 2XZLA 3QVTA 5HRAA 1R8XA 1WMBA 3DWEX 3HP4A 2YRFA 3RVMA 1L4UA 4YGXB 3RD5A 3H5WA 4P4SA 2V0NA 3BJIC 3GCZA 3DV9A 3GP8A 1FDWA 5LD2C 2CK3D 4BBAA 6CHYA 3ZDEA 1NPYA 3WV5A 1YJ5A 2C84A 2GN4A 2ZI6A 2EWWA 2R6GA 4EFLA 5JPDA 1SVIA 2JFZA 3JTMA 4WN9A 3W5JA 5K4GA 4J0IA 2ZS8A 2YUTA 3HJAA 3IHWA 1ISRA 4YX9A 5JYCA 5MN4A 4OLHA 3PSHA 4EGJA 1SXJC 4ER3A 1CR0A 4GL4A 1H3EA 3CW2A 2PN1A 4IJ6A 4CNBA 2WAMA 4ME6A 3QLUC 3ZCUA 4I5EA 4CL3A 3O5AA 5JSUA 1WMAA 1AJEA 5I4BA 1BDBA 4D9FA 1E3JA 2FPXA 2GYWA 3AB8A 3IMEA 3OX2A 5FEUA 2RD2A 1QSGA 3NDPA 1XZFA 1YDMA 3Q98A 1KAQA 2FFQA 4HEA1 3VNBA 4RKRA 1HWYA 2VAVA 2PSFA 1M6HA 1KI6B 1TU3A 3NT2A 5K51A 4XJSA 1O0CA 2ZTHA 1MGOA 4IDAA 1EUDB 3GL9A 5BR7A 3KYDA 5SZIA 4LWQA 4O4HF 4DCCA 2UUAB 3QVGA 3D3WA 3RTGA 1C4WA 1B43A 4LZLA 2LDBA 4U8HA 2QMEA 2C8LA 2HSWA 1Z2EA 5KEIA 3H9JA 3O8BA 3PWSA 4DS3A 1ML4A 4TTPA 5CFPA 1OT5A 2OD2A 3TQTA 4IQ8A 5AKZA 3T4EA 5F2KA 2VI5A 1ANKA 1CDEA 4LBWA 2QP3A 4KQCA 4MV7A 3TTXA 2XZOA 2R8XA 2ZRBA 4UXIA 1VFNA 3RYCA 1PR4A 3LFTA 4LXTA 4N3AA 2AFHA 3N9IA 3JQ7A 1EK1A 1WXXA 4RELA 4Y2JA 5C7LO 2WE7A 1BE1A 3CLHA 2YX1A 1DRUA 2JAUA 3K9LA 1OZFA 2X23A 1AKYA 3EZXA 4RFSA 4D9KA 4OHZA 1NMQA 2EKDA 2J07A 3I42A 4C3VA 3O8RA 1E0DA 2Q4DA 4G24A 3IQDB 1LA2A 5AJWA 4Z0PA 3SJZA 3Q3JB 1RXEA 2ZTMA 4HH3C 3RT9A 4M0KA 1OIVA 4BKRA 2C5BA 2R1VB 1FLNA 4GRDA 2OOSA 4XDYA 5AK6A 4RTOA 4QDUA 1ADGA 4U7TB 3JWPA 4R71A 1KH2A 4GXNA 5BNTA 1FDOA 2OCDA 1D9ZA 3D8BA 1K66A 2GM5A 4A16A 3CE6A 2DECA 4KPEC 3C87A 2C5EA 3IQXA 2NO9A 5FWYA 1H2YA 1KYQA 2O3TA 4NEHB 3RUPA 3HRKA 4H1TA 1YRWA 3LY9A 4KH0A 2Y3IA 4KRFA 1NW6A 4G81A 4OMUA 2Z6VA 1NXTA 2ZQZA 1WG8A 5FOXA 4FLMA 3WKEA 4MQEB 4OGGA 2VTKA 2YHUA 1SBZA 1TOAA 1WPXA 2HTEA 3CY6A 4QO7A 1E1MA 1XWWA 2YNMC 3CVWA 1KEWA 1D0SA 4DUPA 3TSWA 4MKRA 3K09C 4M7PA 3HVUA 5HQ3A 1J06A 2FEKA 4QJIA 4CIWA 1IH8A 5GJCA 3RRXA 3QLVC 3I9MA 5CFLA 4ETMA 3OKCA 4ENVA 5I47A 1MQ8B 2FFBA 1YGYA 1ISPA 1R9NA 1VPTA 2FN3A 2ID7A 3DL4A 3R6LA 2IZ6A 3Q2KA 5SZJA 4ZMRA 6REQA 1RWQA 3W5AA 1Q1BA 2FJUA 4DZRA 3GP5A 4D1YA 4W5RA 1J2YA 3CSUA 2UXBB 1T36B 3NYQA 4Y2GA 5ENZA 3UQYS 3SQXA 3OQMA 2AMJA 1QOZA 3W6UA 5BW5A 4I14A 4B9EA 1ADBA 2GSDA 2GXAA 3WL5A 2GK4A 3UMSA 2M32A 2ZWAA 3JQ7B 1F48A 1B23P 4IUYA 2QTLA 4B87A 1ZNZA 1CF9A 1G21A 3ZVLA 4ZU6X 1AS2A 4I6GA 1V48A 4B2PA 4CQMB 2C3UA 4BEBA 5HQTA 5KYNA 3C0KA 1O97C 4MV8A 1POXA 4DJDC 4JQZA 3FSEA 1T5SA 3QWBA 4KWIA 3Q15C 4MVJG 1MO2A 1SCQA 1U8AA 5I7OA 1SXQA 1DO0A 4G0UA 1G16A 4I7EA 3LQQA 1EFTA 4PX9A 5GM1A 3ZWPA 1IBKB 2A67A 2JLUA 1I1HA 1OXUA 3B5EA 2VH5R 3QMPA 1Y1QA 4HD8A 1IQ0A 1SOUA 1C81A 3DYIA 4Q4AB 5IWAB 2FE4A 3QEMB 5D7BA 4HDRB 4NENA 1TW3A 1XJQA 1UXHA 4WSOA 4DJTA 1WAMA 4B34A 3MTBA 3O73A 4MRVA 2O2HA 4HATA 5HBGA 2NVOA 2QVBA 4UU8A 3FVWA 3MMPA 2HI0A 1TW2A 5DDIP 4BIIA 1IG3A 2C96A 1TKBA 1T24A 2CY0A 2I5PO 2PUDA 1UIMA 3G9TA 4WVFA 2ICAA 4ZPJA 5KJFA 2VDOB 3IAM1 4LZZA 1E9FA 4D97A 1E99A 1FNDA 2O8EA 2BOVA 1HDIA 1V5FA 2MMGA 2WE8A 3DZIA 2AE1A 1Q50A 1T4DA 2WIAA 3OHPA 3T5CA 4C1BA 3TEJA 4EDFA 3A4VA 5EIEA 3EXFB 2E5FA 3SFZA 2XNHA 2VHXA 2NTVA 4PYKA 3GGJA 4BN4A 1WBJB 5ICGA 4HDMA 1P4AA 1Q0QA 2BMEA 3HJRA 4ZQFA 5K0NA 2VSNA 3E3OA 1WUTA 1PYDA 2C2GA 2XLCA 3AOEA 2J5QA 2JIDA 2PU7A 3CCBA 3NUQA 3E53A 3BGOS 3DO8A 2HU2A 2MMCA 4KVFA 4F93B 1OGJA 3ENKA 3LQ2A 2PBRA 3VJMA 3RKRA 1G9SA 4RMJA 1EXMA 3UGQA 3SWWA 2IXAA 5C0OE 2IA5A 2PMFA 1W76A 4CPDA 4CYMA 4ZKDA 3PDCA 2DQKA 4JIGA 3UYLA 1LBHA 4BE9A 1YB5A 4XWKA 1SNYA 1A71A 2AQIA 1Y3DE 3TZHA 3KHSA 2ZJYA 4PLZA 3FRHA 4HLNA 4LFAB 2YJNA 1JBQA 2WG2A 3OQ6A 5EZYF 1NPTO 2XTNA 3EOZA 1UWLA 3KAQA 1OFUA 4M0UA 4L28A 5DYIA 3HY3A 1EE9A 4BUCA 2DETA 4D8XA 2O8NA 1G66A 2ZSUA 4FHCA 2A0FA 3VHXA 2PKQO 4NCHA 4EO9A 4EP1A 2FDRA 4A6DA 1QVRA 2P35A 5HUJA 5KSZA 2I8LA 1N6HA 3C5VA 2AXEA 2PBLA 3EVDA 2Y0EA 1RJWA 3L82B 1VSQA 5TX7A 3DHVA 2VDMB 5ALYA 2PZLA 4TXHA 2O8FA 4UM7A 3KT8A 4ML3A 3LF1A 1Z12A 1EX6A 2EJVA 4QYSA 4ZQEA 5A62A 1VXOA 2AK3A 5TARA 1BVYF 3IUMA 3L7OA 2C94A 4IH9A 3CNQS 4FR0A 3AUSA 5GM2A 1AXGA 2VDRB 4XDGA 4DQ0A 3PL5A 4TXJA 4DDHA 2PUWA 3ZGZA 3Q10A 5SY6A 4D9EA 3EFHA 3TFOA 1UPUA 4MWOA 2Z9DA 3UN1A 1XZMA 5HIAA 2NSYA 2SKCA 4G9EA 1BG6A 1JG1A 3TLYA 4XASA 4KWCA 3QLJA 4KOAA 3CISA 3NAMA 4RNCA 2BMDA 2Z6QA 3L9XA 4X6LA 2PVCA 4BGVA 1YZVA 3ZKWB 1PV4A 4TYYA 1K6XA 3LD9A 2GZMA 1O3YA 3P20A 5IJWA 5JD5A 3LQ4A 1KP3A 2BR4A 2E0IA 2GM3A 1A9TA 2FWRA 3KKOA 4Q15A 1Q0PA 2K2WA 3KX2A 1XDUA 2WF9A 1UJ4A 1U4SA 4D8UA 2W2OA 3H86A 5IDVA 2ZW9A 1N6RA 721PA 3H0CA 5IMBA 3F1KA 3P9CA 1B1AA 1R6TA 3WYGA 4LKOA 1F9AA 1PZMA 2Y6VA 3ONFA 2E4AA 1T34A 1FFXB 1R2QA 1EIWA 2CXSA 1Y80A 4KJXA 4WBNB 1BROA 2YJ4A 3OY2A 5LXTA 3VBCA 3W8RA 5DNUA 3AJAA 3BCHA 3KB6A 3OQIA 3GJ6A 2Y05A 3SC3A 2VPYA 1S5PA 2OGTA 2VC2B 1T5OA 3D0RA 2WKPA 1OWMA 3LCUA 1L7AA 5AT1A 4FWBA 1WETA 3KQMA 4A8JA 1RM0A 2EKPA 3FTQA 4G0MA 2FW6A 2BUAA 4BX3A 1HT0A 2R79A 5BVGA 3AH8A 2ZUUA 3RYIB 3SR0A 2O6LA 2BWJA 3TO5A 5A9SA 2OG1A 5I3CA 1TZ2A 2CNBA 3WWYA 4G0VA 4P54A 1E1RA 1SVWA 2JCSA 2WVJA 1ZS9A 3OCYA 3KRTA 4K0RA 3T9EA 2C7GA 3WOHA 4K6GA 1ZHHA 5BQOA 3PZRA 5A2GA 3U26A 3QOYA 4LOIA 4DVJA 3V4RA 1BHSA 5ALDA 3U3DA 2AB0A 3FOBA 3IVCA 2CXHA 4CCWA 4CLRB 1E1LA 1PAUA 1YR3A 1U7HA 2WKRA 1PWXA 4JROA 3C3YA 3U1VA 4J7AA 3QI7A 1GKLA 1J07A 1GFWA 1L3IA 1YOBA 1XEFA 4CCYA 3ZH2A 4MYRA 4XSVA 2B8TA 2E2WA 4LJ5A 3COJA 2MWMA 3QVSA 3B53X 4JSYA 4BVGA 3FCUB 3IPLA 1OZ0A 3CVJA 3N2LA 4HEHA 4MVJM 5IC4A 3PWKA 4D80A 3A1WA 1ONNA 3R5FA 5HVNA 4C7XA 2O59A 3CM0A 5LQSA 3WIOA 1EVYA 3KDPA 4MH0R 4OJNA 3RK0A 4JCOA 4KFCA 1YZNA 3R5JA 2ERYA 2PCJA 3ZI4A 3C4JA 3G17A 3PEUA 1G21B 2OTCA 4P92A 3GIWA 4PVCA 3VVBA 3LECA 2ECOA 4LJKA 4RKQA 4C05A 1L7XA 5DI3A 1KVTA 1PR2A 3DWIA 4BQQA 2GB4A 2PLWA 5IZCA 2PZFA 4BLUA 3M6IA 1XD8A 5FUYA 2EL9A 5JOQA 2ZRDA 5FLKA 2GERA 2ZRCA 1TUBA 2AZDA 3M83A 2XEXA 4QD3A 2XBLA 1NJGA 1S0UA 4BQOA 4GUDA 4O2AA 4R7TA 2W2VA 3RUHA 4D4JA 3QEMA 4GEKA 1T0BA 2XJ9A 3DZJA 1GUYA 3N28A 3RS7A 5CCEA 1XZLA 2W6ZA 3MWEB 8AT1A 1DG9A 4I08A 4N03A 1DQRA 1ZISA 2DEUA 3GA7A 1O5IA 2G0AA 4YO8A 4TL6A 5LJLA 3WK8A 3TXYA 1NXSA 4HWPA 4P35A 4A0RA 1LZLA 4R1OA 1C3LA 3BMOB 3OZDA 3DOIA 1SVKA 1HDOA 1DQSA 5J58A 5HDBB 1SU4A 2A5GA 1J2EA 2F6RA 2XBUA 3RSZA 1KC1A 3TLBA 1RW4A 4BHTA 3FDXA 4COOA 2Q3CA 1AQJA 1QP0A 3DCNA 3W05A 2AVNA 2Q3JA 2NT4A 1NV9A 1DELA 2PWYA 4N5NA 1VC2A 3K8YA 2P3OA 1FTNA 2D2VA 5JWHA 4KR9A 2BFCA 2GF0A 3U1TA 4L95C 1U9ZA 3QMMA 1WJGA 3N7UA 1IBRA 1RPTA 4Y7DA 3ZCRA 2Y8EA 3PXXA 5JBQA 5DW3A 3HVJA 3C43A 2Z5GA 1E2GA 2PRZA 4FZ5A 4ILKA 1CRQA 2CE2X 1BCRA 2FZ4A 2FZVA 4FI3F 2FPUA 3HN7A 4AMBA 3LLMA 1SULA 3VU0A 1SHJA 3O83A 2IBTA 1NAIA 3PT5A 4XQEA 1W88B 4G36A 1VMEA 2ZTVA 5IAGA 3ZE9A 4FC7A 3K4PA 3Q3VA 4CFSA 1GQYA 3W2HA 2P0AA 4Q5IA 3WXBA 1QTQA 1L6RA 1XVVA 1I9GA 4GZLA 5KHLB 2HDOA 2WIDA 4Y8VA 2J9ZB 2VQSA 3CONA 4H6XA 5FBKA 4KXWA 3H9BA 5C4MA 2VHZA 2D0OB 4LC0A 1IUKA 4LY6A 3R2JA 1X7GA 3AL0C 1QBKC 1YI0A 4BKOA 1WXWA 4BZQA 2Q28A 4KNVA 3SXUB 3ZU5A 4DMKA 1P0IA 3JYHA 5L3SA 2OORC 2GTPA 3PFKA 3OEWA 4R2IA 4ZCSA 1E3EA 1KSGA 4WKPA 2QENA 1N36B 2HWUA 2QSUA 3L05A 1N1MA 3DKRA 1TUIA 4XD2A 1P2FA 3F7MA 2CXUA 3JD4A 4PZ9A 5FBHA 2YN2A 1JMYA 3K0KA 3ZU3A 1GAXA 5FWAA 3ZOKA 1T9AA 3IX7A 2FHSA 4EF5A 3ORSA 3FPAA 3ELUA 5JCJD 1MAWA 1ZN8A 2W2XA 3KSDO 1GU7A 4Z1MA 3BULA 2ONCA 1N9GB 1GGEA 3R8XA 4C3ZA 3DC7A 4GP9A 1KZ4A 1S02A 2P2CA 4WD3A 3DO5A 3IXQA 1XQVA 2Y76A 3L8DA 3M4JA 3QKIA 3AF6A 4AJNA 3HEMA 5CM8B 3L07A 4C0XA 1RQ7A 5CA0F 2PD6A 3OA2A 2P9BA 4N82A 3V7YA 5DM1A 2NXWA 1COWA 2OE2A 3HLYA 4AF7A 2Y9PB 4AU1A 4D79A 2VHEA 1D1SA 2I03A 3MJRA 5AVTA 1LNSA 1QLWA 1FZQA 1RQ2A 3DJFA 5P21A 4AZWA 5KQPA 4OU4A 4CI9A 3RSLA 2A4KA 1DQPA 1UDCA 2HPVA 1H4SA 2PTGA 2BGIA 2W2QA 2HYIC 2AWNA 4GOKA 3MUOA 1OGYA 3BDVA 5EJ6A 5CEEA 1N3IA 4MHTA 1W2GA 3PIDA 5F9FA 5HZKA 1O57A 4E07A 1WVMA 4PTLA 1EMDA 4H7IA 2EX0A 2ZATA 4LISA 4LMPA 1XEWX 3EGXB 5FUXA 3SHTA 4CM1A 4M87A 3J80A 1DIHA 1IY2A 1XRLA 4N6NA 3R1IA 1T6ZA 4U3JB 2H57A 4BVAA 3IEMA 1BVHA 1UXOA 3I45A 1YA4A 1MVNA 2J41A 2NW6A 3FUVA 3H0EA 5C2JB 4GMGA 2AIRA 2DGDA 2IEDA 1SM4A 5A5FA 1CJCA 1FTGA 2W2KB 1L5SA 2HU7A 3AONB 4MS3B 1EG7A 3O26A 2ZZKA 2ERCA 2PRKA 3AKDA 4DPMA 2CFSA 5EJ9A 1I8TA 1IM2A 2NU8A 2ANBA 5EMLA 3LHFA 5JC1A 2PDAA 3ER6A 1M10A 3LE8A 4QOHA 2OLEA 3A2NA 3MCZA 3RS2A 5D1NA 4B3FX 4H6PA 3SC4A 1IUOA 2VDKB 3NXSA 4QTTB 2Y27A 3OOHA 8ABPA 4UUNA 4Q4DA 2O54A 1Z4KA 3KSZO 4ZU3A 1OVMA 3N70A 4JXXA 2O5CA 1CPYA 1BS9A 5LQRA 2YQ4A 3L79A 1J00A 4KSCA 2QK4A 2HJGA 1DC3A 1NI3A 3KHUA 1MRSA 3R9XB 2YIJA 4HOYA 3AEQB 3KLNA 3WLFA 4DLTA 1EVKA 5JEDA 3PFIA 1ESEA 3OMWA 4O4IF 2OVBA 4NHOA 3D7NA 3H2BA 4EG8A 3C8MA 4TN5A 4AJLA 3CS3A 2H5EA 2CKMA 7REQB 2MSLA 3N2EA 4J0CA 3P9PA 2LBPA 3K70C 2GASA 2Q6KA 3RARA 4TTJA 5FI0B 4ZYTA 4DANA 3ADOA 1JQLB 1WXIA 4UBMA 1TJNA 3DZGA 1HT2E 4F7DA 2P69A 3EQ2A 2ZRLA 4L6CA 4NJEB 4AY3A 1AKWA 3LP5A 2P4SA 4U00A 4CLRA 5KX5F 1FYDA 4WNAA 2Y1OA 2W70A 4YIHA 4NIMA 2HN9A 4DA6A 4J43A 1YU9A 1M75A 4L1KA 1K7XB 3CZMA 1ZJJA 2WD8A 4LWOA 1F5SA 3TGWA 4PANA 1YHNA 1I4EB 1MC1A 3KD2A 1T2DA 2RBGA 1AU9A 3AWIA 1K2WA 3VNVA 1SKUA 1EK2A 4GPBA 1MJFA 3W5SA 2C78A 2E6KA 3ANMA 3F8WA 3VHRA 1SVMA 2BGLA 1GAWA 3K73O 4Q93A 5B57C 1PDOA 1XMXA 2Q6OA 1ZH2A 3RTBA 3ILVA 3TX2A 2P77A 1NA5A 1YSCA 1O5OA 3MT7A 1K9SA 4BVKA 1AK1A 5IHPA 3KOMA 4M36A 4MQ5A 4R1QA 4RA9B 1AUPA 1ZD2P 2QD4A 4R5MA 3DF9A 4TSFA 3C5EA 2RK6A 3EHEA 3GLVA 2R6AA 3BFKA 4KLNA 5BVHA 3KEOA 1A9XA 1TF7A 2KX7A 5JRDS 2B5VA 3WGTA 1JT9A 2BZ1A 1EVQA 2WJVA 5J5AA 1A95A 1I14A 3L9WA 5FPTA 3KCQA 4KR0A 3GI1A 1M2HA 2LW7A 1FYWA 3PYXA 4NBVA 1TVKA 4MV4A 4IOKA 4D3ZA 2GBLA 4DRZA 1JG2A 2V3VA 4IHQA 5BMOA 4M49A 1X42A 2KYRA 4ZI7A 4DB4A 3NIWA 4QOJA 4KVAA 4YMWA 4BE7B 3T0GA 3D81A 2I67A 4BTLA 3RAFC 5CITA 2FF7A 4WJZA 2ZROA 1XF9A 1N1GA 2DQYA 3OHSX 3VA7A 2PSHA 4FGJA 1TQHA 1O6ZA 2R8BA 4DCNA 4H1HA 2RE8A 1K7EB 2BFFB 5EG5A 3VPAA 2HIGA 5C8YA 1YZFA 2OMKA 4LTMA 4FLEA 3BHMA 4QYTA 3STXA