4PLZA

Crystal structure of plasmodium falciparum lactate dehydrogenase mutant w107fa.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
302
Chain Sequence
b'KAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title An atomic-resolution view of neofunctionalization in the evolution of apicomplexan lactate dehydrogenases.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 118
structure length 302
sequence length 314
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4plzA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4plzA02
3DBHA 5CHEA 3O8QB 2I3GA 3RC1A 4BNTA 1YQXA 1N9GB 4BNKA 1UXIA 1S6YA 1KVSA 2TMDA 1GPDG 2Q99A 1PQWA 1I32A 2GN6A 5IDYA 1KY4A 3DBLA 1LNQA 4IZHA 1NHGA 1YGYA 4DIFA 3SC6A 4RQUA 4R5HA 3FSRA 1NP3A 5KTKA 1BXGA 1A7KA 4YJHB 1C1XA 3GZ4A 4U6QA 2O2YA 4A0SA 4RJTA 3ZU5A 5KNLA 3N7UA 4IDCA 2VZ9A 4TZKA 1DOHA 3M1AA 1M66A 1XCBA 2EEZA 2NU9A 3H9GA 4J3FA 4K26A 3SX2A 1ZCJA 5CEEA 4EGFA 1DLJA 5L53A 2PH3A 2DPGA 1PR9A 1EQUA 4OO3A 4P4GA 1C0LA 4PLTA 3AOEC 4XDYA 3U3XA 3H7AA 2AE1A 1VJ0A 2I65A 2O7QA 3VH1A 3JQGB 3QV1A 1WPQA 1DSSG 1HLDA 2Y67A 3FNFA 4JQCA 4FDAA 3WIDA 5EQDA 3D5TA 4KDFA 2B0JA 4FC7A 2NUAA 3WJ7A 5K9ZA 2OP0A 5KOIA 5HA5A 2RIRA 1MFPA 1XA0A 3DXFA 3LF2A 3LDHA 2UYYA 2OXIA 3OP4A 4PCVA 1KVQA 3AM4A 3ETEA 1H6AA 3V1TC 5IZCC 1ENZA 4XJSA 1O8CA 1Z82A 3DWFA 3OETA 4L8VA 3RC9A 3LZ6A 3IL2A 1R66A 3A4VA 2IEBA 3RUDA 4LMRA 3U4IA 5KIAA 2B83A 1P45A 4IMRA 3PIIA 1GEGA 1U8XX 2DQ4A 2ZB8A 5DZSA 3VKVA 2W4QA 2ZJ1A 1FDTA 4F6LA 3I9OA 4MKXA 3RD5A 1BSVA 1V6AA 1X15A 4OOFA 3VDRA 4DRYA 5T8KA 4FQ8A 4YT4A 1G1AA 3G17A 4BOYA 3INGA 1BRMA 4RVHA 1JAXA 2O3RA 1OI7A 4XGIA 1E3JA 1MXFA 4H15A 4TRMA 1SNYA 3SBOA 3C7AA 3PPIA 1JKIA 1G6KA 2WSBA 4RPJA 2VHWA 3DR3A 4IDEA 1QRRA 1SB8A 2FMUA 1Y9AA 4DMMA 2O23A 1O94A 2CNBA 2QYTA 4IGEA 3W6UA 2W8ZA 3MTGA 1I3MA 1EVZA 1SBYA 2VQ3A 3NT4A 5BNFA 4K28A 3OM9A 4WLEA 4CQLA 3SLKA 2C7VA 2X9GA 1A72A 4OXKA 2Q2WA 4RF5A 5IDXA 3QW2A 4JJFA 3UFXA 5KVVA 4L73A 4IUYA 1M76A 3MZ0A 1IB6A 1K6IA 1LSUA 4NBRA 1RWBA 4OHUA 3DDNA 1RM3A 2DUUA 3AM5A 1LTHR 1U7HA 3O26A 5DOZA 1FDSA 3TJRA 1GCUA 4XQCA 1GEEA 1HEUA 1ZK0A 3ROQA 4Q9NA 2WYUA 1HDZA 3RUEA 3JV7A 4M86A 3RASA 3AI3A 3UHAA 1ZNQO 2WE7A 1SEVA 4DPMA 1ENYA 3KZVA 3Q3CA 1J0XO 4XJTA 3GMDA 2VTDA 3LLSA 3JQEA 3PJDA 2WD8A 1VL8A 2NADA 1KVTA 1ZSYA 1R6DA 4E3ZA 1UXHA 3SJ7A 3COSA 3KM0A 3K31A 2NACA 4RZHA 1WMAA 3WICA 4Z3DA 3P7MA 4NJMB 1PJQA 2DPHA 4NI5A 1WWKA 3I9NA 4PLZA 2VWQA 2VHVA 2JD0A 2O3SA 1ADBA 4Y6SA 5T5QA 5HS4A 3VPHA 4IGFA 1P1JA 2VHXA 4OXNA 4IZIA 2VRCD 4J2HA 2QHXA 4WCFA 3H9UA 2BFPA 2WEKA 4WJZA 4EJ0A 5B4UA 1T2EA 3PHJA 2Y0CA 5L51A 4OH1A 1ZIDA 1N7GA 1Y9EA 4CUKA 2YDXA 1KYQA 3ITKA 3W8FA 2HMTA 5MDHA 4N7RA 2GN8A 3AK4A 5ER9A 4WPGA 1OBFO 3EK2A 4XKJA 1CF2O 1KC3A 3DB2A 4HFNA 2E4AA 4L4SA 3PQFA 4E5MA 4DIBA 3RUHA 1RYDA 1LC3A 2O48X 1DRWA 1NASA 3PJFA 1J5PA 3DONA 3VVBA 3GNQA 1VLLA 3O4RA 3IMFA 3GRKA 3QY9A 2HCTA 2H5LA 4CM3A 2CFCA 5L95A 2R00A 4TVBA 3DEYX 3V1YA 4RF4A 5C7IO 1GD1O 4XR4A 3ZNNA 1GL3A 5IXYA 3QSGA 4R3WA 3K30A 4NMHA 4CLXA 2X5JO 3RI3A 3WBFA 1UJMA 4AJNA 3VH3A 2QRJA 4FGSA 4YJGB 1ZMTA 2W2KA 3W8EA 1ZW1A 1OAAA 1WLYA 4XYEA 3TDKA 2FPGA 5EN4A 1KVUA 3WGZA 4CM7A 3WGTA 3H5RA 1MGOA 2VRBA 3NGLA 4GAEA 4E5PA 2V6FA 5F5LA 5CDUA 4YRBA 2DU8A 1N2SA 5DN9A 4J7XA 4RQTA 2EIHA 2BFAA 1EK6A 4HNHA 1BVUA 1CIVA 1X7GA 2W90A 3F5QA 4AJEA 3PLNA 4WASA 4TQGA 3HJAA 2Y1GA 2PGJA 4TKMA 4INAA 3IP1A 3BMNB 4R1TA 3SLGA 1DC3A 2HMSA 3ZNOA 1WMBA 5L40A 1O6ZA 2Y68A 5KVCA 3Q2KA 4IPTA 1ZXBA 1Z74A 5KJ1A 4XQGA 4E21A 4QSMA 4BO9A 1PZFA 1K3TA 1FDWA 3G1TA 4BO3A 1A7AA 4A73A 3PQDA 3S55A 1PTJA 4BL5A 2PGDA 1HTBA 2BI8A 1FF9A 2PK3A 4UUNA 1AHHA 4HV4A 1BTOA 4E31A 3VPFA 4NQZA 1VL6A 3AM3A 2OMEA 4N5NA 3ZCXA 2CVZA 4O0LA 3VPSA 2OL4A 3ST7A 2G0TA 3GEGA 1B3RA 3MJCA 1AXGA 4EW6A 1NAIA 2ZB4A 3TSCA 1O89A 5CPBA 4AJLA 4RF3A 2BFMA 4BIIA 3OH8A 3GVIA 3W6ZA 1U3TA 1E7WA 4H16A 2E37A 5FFFA 4GGPA 1JA9A 2GN9A 3GN1A 4YT5A 2CUKA 1YDWA 3BIOA 1ZEJA 2GZ1A 4M89A 2Q1WA 2XPCA 4XD2A 4H7PA 2QZ9A 3VZSA 3FCOA 1F06A 3WGHA 2DTEA 3V1UA 3VZRA 1L7EA 4TWRA 3ZHXA 3WFJA 4LCJA 4NBVA 2IRWA 5G4LA 1DHRA 4Z9YA 5JAIA 1JVSA 4R4JA 4R51A 3PJGA 1XLTA 3JSAA 4MVJM 7ADHA 4M1QA 4ONEA 2X8LA 4WLFA 4IDBA 2D3TA 1NVTA 3AU9A 4IJVA 1R37A 4DC1A 4CLHA 5TNXA 1E6EA 2X22A 3WFIA 3K6JA 6LDHA 2IYOA 1CQJA 2C20A 3GN2A 2FY8A 4PN3A 3HFSA 3PFFA 3OEYA 1LDYA 1JAYA 1OC2A 3C7DB 1E3WB 3WQQA 2PA3A 4UEOA 4Q3CA 2GDZA 3I9MA 3QWIA 1T2FA 3KSZO 4EDFA 1SO8A 2NU7A 4GLOA 3VH2A 3LSYA 3E18A 5A5FA 1EMDA 2J5KA 3AI2A 4DA9A 3T4EA 3RFVA 3R1IA 4Y6PA 4YJFA 4XQ9A 3VKUA 3FBGA 3DMYA 2FR8A 3DHYA 2WYVA 4CQMB 2AQKA 4ALLA 1YOVA 1LQUA 2P4HX 3H3FA 2G1UA 3ZWPA 1B0AA 3DZKA 1KOLA 4UUPA 5CDYA 3CMMA 1M6WA 2GR9A 3OHSX 2VZ0A 2H1SA 2H63A 2O4UX 2LDXA 3HDQA 4I9HA 5EPOA 1WZIA 2Q49A 3NV9A 3E03A 2EP5A 1NX6A 2UUOA 3DFUA 3I83A 4DLBA 2X0NA 5KJCA 2D8AA 3FRJA 4W82A 1ZO8A 2EJVA 5KKAA 4ALIA 2VYNA 2ZB3A 4YCAA 3ZW9A 3RUFA 3F47A 5A06A 5IFLA 2JCYA 5JDCA 5BSGA 3WQRA 3F9IA 2NWQA 4O1MA 3OSUA 1ZJYA 4Y67A 1U5AA 1CETA 1B8VA 2NLOA 1AN9A 4HADA 4J49A 1YQDA 4CV3A 1T4BA 3OF2A 5G0VA 4GVXA 3NYWA 4BV8A 1IULA 1DRVA 1DEHA 2YFQA 3H4VA 1KY5A 5FWNA 3JYOA 3K92A 2D2IA 3PGXA 5T8KC 4CR7A 4UEKA 2E6UX 3UXYA 4CM8B 4AJ1A 2ZYAA 3U4CA 1HE3A 3KB6A 5IN4A 1H2HA 2NTNA 2B5VA 3E9NA 3OQBA 2Y05A 4PG5A 3EYWA 1QKIA 1IOLA 3AI1A 3GNSA 3DBRA 3GDOA 4MP8A 1CWUA 4ALJA 4WOKA 3DL2A 4D3SA 1MC4A 3LQFA 3SC4A 3QVTA 1OOEA 1ENOA 3B1FA 1N1EA 1HYEA 2GERA 3GH3A 3I52A 3I9KA 1LX6A 3JQ7B 4KTVE 1DIRA 4BO5A 4N5LA 3HG7A 3RWBA 2JHFA 2O3UA 2VUUA 4BMVA 1J49A 1M67A 2ZQYA 1QV7A 3GQVA 3KYDB 4L74A 1XELA 3AUSA 2FWMX 4ZICA 4YVFA 1DHTA 3H5NA 2I6TA 3NEPX 4OJNA 1I2CA 1LRLA 2FR1A 2HAEA 1N92A 4XIJA 1ZSVA 3H9JA 3T4XA 1ML3A 3VTFA 5KWEA 8ADHA 3BTVA 2AEMA 1VRWA 2ZTUA 2EW2A 2JFHA 1NQOA 5FF9A 2WD7B 2Y0EA 4Z9FA 1GAEO 2Q45A 5JNLA 2CMDA 2ZATA 1I8TA 2PH5A 1PJCA 3Q2IA 4BKPA 4AJ4A 4BNJA 1B14A 3E9MA 5CDSA 1K2WA 3HADA 3W4JA 1CEQA 4L4XA 5ES3A 1KVRA 4FFOA 3PDUA 1I24A 1JU9A 1BMDA 3DTYA 1EK5A 1H6CA 3PFWO 1QR6A 3K96A 4WCDA 4Z3KA 1Y8QA 3S2EA 2VT3A 2SCUA 1HYHA 4J1SA 1GR0A 4QXMA 3UAGA 3GZNB 1E1KA 3TZQA 4DBVO 4Y6RA 4OSOA 1LDMA 1Q2XA 3FR8A 2C54A 4K9DA 1Y8RB 3IP3A 1PZEA 1PL7A 4XYMA 1HSZA 3SXPA 3V2HA 1EEHA 4WCFC 4DWVA 3O8QA 4J2OA 4FGWA 4ZQEA 2CVQA 1X0XA 6ADHA 1N9GA 3R6DA 3IIEA 1EDZA 5L4SA 3DZGA 4NBTA 1YKFA 1IHYA 5K0ZA 3ULKA 3HDYA 5B37A 4KDEA 3INTA 3JD1A 1KBZA 4UVEA 1Y5RA 2VYND 2X23A 3MJ4A 3EUWA 4JP3A 1ISMA 1V3UA 2G82A 4E5YA 1ZK3A 3I6IA 4YJHA 3FWZA 2OORA 4E32A 1I3LA 1NFRA 2X0RA 1PSDA 2IXBA 4IDGA 1B16A 3UUWA 5BQFA 2HDHA 1ZZEA 3K5PA 1TLTA 2OZPA 4MDHA 1V3TA 1BDMA 2JJYA 5HS6A 4B7XA 2BGKA 1UUFA 1QYVA 2V6MA 1FJHA 4MVJG 3U4DA 3BMCB 2R00C 1LDGA 1E5QA 3JQFA 1BWSA 3NJ8A 3PWSA 3V2UA 3ZNPA 5CFZA 2DBRA 1YH3A 4OYRA 2YYYA 3TFOA 1QLHA 3DZFA 4CM6A 3JQGA 3RJ5A 4D0RA 1YB5A 1AGNA 5CAEA 1P1RA 3JQDA 4AJKA 4AJ2A 4M54A 3JD2A 1ZVMA 3UCEA 3ABIA 1AHIA 2BKAA 1QLJA 2RHRA 4GL4A 4OQYA 4QX6A 4DYVA 5HBRA 4RLHA 3JQCA 3UKOA 2VNAA 3UOGA 4BO6A 1PZGA 1M6HA 3IJRA 3FNEA 3MCVA 4BGUA 1EQ2A 1FMCA 4JX8A 2BLLA 4R54A 1LLDA 5DCWA 3H2SA 3GF4A 2GF2A 3LT0A 2E48A 4J1NA 1NQAO 1T25A 3PGJA 3QJ5A 3PRJA 4Z9XA 3D1LA 1ADCA 3ZWAA 1ADFA 3UF0A 2O2SA 4JBIA 4FFPA 4MP3A 1ZUD1 2VOJA 1LC0A 4J1QA 5H82A 2ZB7A 3LK7A 4CM1A 3CSDA 3TL3A 2BGLA 3VZPA 4ZQGA 1DFGA 4LSMA 4CMAA 1Y6JA 1VC2A 2VOEA 1O0SA 3WSWA 3FWNA 1H94A 5COQA 1GY8A 4IINA 5H83A 4GKBA 2C5AA 3WTBA 5IXSA 2ZTVA 4IY1A 4YT8A 2OBYA 2QQ5A 3K9QO 4OM8A 5H81A 3GG2A 1HZJA 1PGNA 1NR7A 4CJXA 3R3SA 1NFFA 4HXYA 4PVCA 5IN5A 3EAGA 4YAJA 5AXBA 4RLSA 3NJ4A 3V5NA 2YUTA 1MLDA 4GX1A 1ULUA 2AXQA 2BGMA 1Q0LA 2R6JA 3L6DA 4CM5A 1R16A 1PJ3A 2QRKA 1NTOA 3UCFA 3B1JA 3DTTA 1EFLA 4CM9D 3OJEA 1NYTA 4NBWA 4ZRNA 5I7SA 4JROA 1W6UA 3JQAD 4FS3A 2PNFA 4YB8A 3S2FA 2NVBA 5DBGA 3CH6A 1FK8A 3DOCA 4G81A 4M55A 2WE8A 5IAAA 3B1KA 1X7HA 1ISJA 3PHHA 5ILGA 3HSKA 5KVQA 1T24A 1GV1A 2VZ8A 4QUKA 3GGGA 1HL3A 3STHA 4Z0TA 3AFNA 2PD6A 3JYQA 3JQBA 4WNIA 2P5YA 5GMOA 4ZGWA 4NJMA 5FI5A 3AOGA 4NFSA 4GMGA 3ENNA 1R15A 2POQX 1UXKA 1ZK4A 4IQGA 3RIHA 1UZLA 2Y1OA 3DFZA 3FNGA 3NKLA 5L45A 1YWGO 3LU1A 2RBEA 3NTOA 4BMSA 3MEQA 1GZ3A 3HDJA 3QP9A 3GAFA 3IDSA 1W4ZA 2VUTA 1GZ4A 2YQ4A 4XCVA 1VE9A 3C1AA 5EERA 5C5IA 3ASUA 5JC1A 2ET6A 3KRTA 4PLWA 4BNIA 3AJRA 2J8ZA 4CPDA 1WNTA 3T7EA 2DUWA 1VJ1A 2GNAA 2E82A 3N74A 4O6VA 4BNLA 1BG6A 2YQ5A 1I30A 2IODA 4CLRB 1D3AA 2Y1EA 4XGNA 2AEJA 2CD9A 4JP2A 1ONNA 5JDIA 1BHSA 2WM3A 3IUSA 3B20A 3QWAA 3VHRA 1CYDA 1PGQA 2PKQP 1D1SA 1A71A 2B69A 5T67A 4E30A 1I3NA 2QZZA 1D7OA 1Z7EA 2Q46A 4D46A 2CY0A 4EUHA 5B12A 1QXSA 1EUZA 4D44A 1YBMA 3GT0A 4MVJD 3QVOA 2NQTA 1DC5A 3BTOA 3NTRA 4LW8A 4FIZA 3FNHA 2EKPA 3WS7A 3RUIA 2CDBA 4YJGA 5U4QA 4GX2A 5L7TA 5TS3A 1EVIA 3M1LA 1T4DA 1UP6A 2C2YA 4EI2A 1LU9A 5JDCC 1HF3A 4TKLA 3OBBA 3RBZA 2O3TA 2YHIB 3TRIA 2Q2QA 1ARZA 3C7CB 1WW8A 3RAJA 3HHPA 4FD3A 3TQHA 4BUCA 3KOUA 1XQ6A 2QRLA 4KQWA 1W8DA 1T1RA 1UP4A 5A3JA 2YDYA 2IXAA 2P2SA 4URFA 3ZU2A 2GASA 2V65A 4FW8A 4J91A 1YL6A 1YBVA 3DHNA 2YFHA 4KUEA 1ULSA 4LVUA 1LSSA 1PGPA 5JAZA 3BMNA 4R41A 3DO5A 4XRRA 3U4HA 3EGOA 1NFQA 1IUKA 5TLSA 4YAGA 2EW8A 1P1FA 4DTIA 1LRJA 3I6QA 1PS0A 2GZ3A 4MKRA 4OQZA 2X5KO 3VPXA 1IE3A 3PEFA 5GZ6A 4J0EA 2Z95A 4Q3NA 1JWAB 3E5MA 2PKQO 3OA0A 1DXYA 2DBZA 2GUGA 3ITDA 4FSHA 1GYQA 5B1YA 1P1HA 5C37A 4D3DA 3NAQA 1EUDA 5JW6A 4NFYA 4IXWA 5A5EA 4DGSA 5A9RA 3I9JA 3WGGA 3GVCA 1CDOA 3JCZA 3WSVA 4Q39A 3I3OA 5JSFA 4RPLA 5HWSA 1ISFA 3TN7A 2DAPA 3RVDA 4E2WA 1Q7CA 4ZD6A 5C3MA 5CPFA 3U5TA 4EJMA 1AUPA 2Q4BA 4FFLA 3OECA 1YL5A 4I8XA 2UAGA 1JQBA 1YB4A 3CXRA 4JIGA 5L4NA 1FDVA 1PS8A 4IDAA 1TT7A 3WTCA 5TC4A 4F45A 3LF1A 1JN0A 1VKNA 1IL0A 2BI7A 3GG9A 3A1NA 1GV0A 2RH4A 4GGOA 1P44A 3G49A 5ICMA 3ASVA 3GUYA 4XX0A 1HDRA 2EG9A 3ZWCA 4CMIB 2X9NA 3L6OO 1ZEMA 3ANLA 5I9MA 4MINA 4IDDA 4YQZA 1HKUA 2GGSA 1NHWA 2FPPA 2WMDA 4MO2A 2NU8A 2DBVO 3U62A 2BMAA 5DDIP 1GUZA 1R4NB 3G3EA 2G17A 4OKNA 3RKRA 1XWFA 3GHHA 2YHUA 1E3WA 5L3ZA 2IZ0A 1DIBA 1R12A 1Q0QA 4E6PA 2FP4A 1Z45A 4GX0A 1E3LA 1PZHA 5CP8A 4ND1A 2AQIA 1TB4A 1L7DA 4R1SA 4YACA 4NPCA 2P68A 3INRA 2EXXA 2O7SA 2FR0A 4JJIA 1T2CA 4YYZA 5IZ4A 3WGQA 1K6JA 4JK3A 4J4HA 4FB5A 3W4KA 4CQMA 4YT2A 4BNNA 3PIDA 4E0BA 1B3BA 1LLUA 3BHIA 3JQFC 4C7KA 4EUFA 3KHUA 4CMEA 3K2EA 1XHLA 5FYDA 4CLOB 4RDIA 5TJHA 1NM5A 3RCBA 1JDJA 1EE9A 5EJ2A 3I4CA 4UREA 1LDNA 4MPDA 2DTXA 1YJQA 4HX5A 1HSOA 1XU7A 3QWBA 1IYZA 4U0JA 5TRTA 2PFGA 2B4TO 4RDHA 5A05A 4MVJE 1HDXA 4J7UA 5F3RA 5ICSA 4XYGA 3ADOA 4NK4A 4IXTA 4QFDA 4B4UA 4DIOA 1QP8A 3O9ZA 3FPCA 4AICA 2PZLA 1NWHA 1NNUA 3LT2A 3NX4A 5TQVA 3UN1A 1YS4A 2CZCA 1F8GA 2D5AA 1DC4A 5JAQA 3CUKA 1VSUA 4BB6A 3H2ZA 4E5KA 5L4LA 1WDLA 5EIOA 2Y93A 3GY0A 1MC5A 1IY8A 3GPIA 4KTTE 4YAIA 3U0BA 1X0VA 1UP7A 5GY7A 3L77A 4CM8A 2GZ2A 4P22A 4W99A 1P0FA 2OGUA 4JCOA 1VM6A 5JCJA 1NPTO 3WMWA 4J9VA 3ZHYA 4YR9A 3ZH2A 1QYWA 2AG5A 4IJWA 3P2YA 5ADHA 2VCYA 3L4BA 3UGKA 2QIOA 4XB1A 2D5CA 3GDGA 4BGVA 3PHIA 1MX3A 4BKUA 3AUTA 1U8FO 2X86A 4II2A 1MA0A 5IDQA 4NFHA 3PXXA 3JQ7A 3TZ6A 5K6AC 3K8ZA 1NPDA 1U4OA 2FOIA 2HK8A 4JN6B 2PTGA 5JS6A 1UDCA 1X1EA 2PLAA 4ZA2A 4UUMA 2CDAA 3GC6A 4S3MA 1C1DB 1UXGA 3RC2A 3KYDA 2PGLA 3VPGA 4NU5A 4Q3EA 3TL2A 2QYSA 3TWOA 3MOIA 3TZHA 5G0WA 4DUPA 3QRWA 4B4OA 4Q3AA 3QWHA 2UV8A 2V7PA 5TF4A 3W1VA 1YE3A 1EVYA 3EZYA 4R68A 1DAOA 5JLAA 4HFRA 3SVTA 5KJ6A 2WD7A 1PJLA 1B2LA 5L7WA 2I3AA 2B4QA 1KEVA 5J23A 1WDKA 2UUPA 3QQPA 2C29D 4YBZA 3OEWA 2J3JA 5A9SB 2A94A 2HLPA 4KZPA 3CEAA 5I7EA 2Y1CA 4RGBA 4W4TA 1E7SA 1JTVA 1R0SA 4IS2A 2AHRA 2DT5A 1E6UA 1P1KA 3PJEA 2DKNA 4E2XA 3JQBC 3O38A 4CUZA 1SC6A 1T2AA 4ZU3A 4WE3A 3RC7A 3VTZA 1I3KA 2YV3A 3LT1A 1H6DA 3BAZA 2EF1A 2AMFA 3GZNA 5DF1A 1I5RA 2ZCVA 4DQUA 4HFMA 1Y8RA 1RPNA 2EJWA 5A9TA 2VWGA 3ZV5A 1KERA 1UDBA 3CPSA 1EZ4A 3NT2A 1QV6A 5L7YA 3GNTA 5BNIA 4FJ2A 4N54A 3QWFA 5JAMA 3L4SO 5HRUA 3DBVO 2Y1FA 3ZHBA 1GFSA 2QX7A 3ORFA 3VZQA 2QG4A 4N5MA 4F6CA 1RM5A 1TEHA 1T26A 1PX0A 3WYBA 1RM4A 2D4AA 2I67A 3GA0A 5JDIC 3D4PA 3PI7A 4YEDA 2ZYGA 3HWRA 2IEDA 3OIDA 4KQXA 3UVEA 1N1GA 2VWHA 3BMCA 4ROSA 4Q3BA 1MB4A 4CODB 1T2DA 2J3IA 3H9QA 2FSSA 2O3JA 1DB3A 4RVSA 5JCJD 3NDJA 2F1KA 2GRAA 3E6AA 4EYEA 3H9EO 2Y66A 3PHGA 5ITWA 4CMGA 2OHXA 4JXKA 2OP1A 4RVGA 3GK3A 1FDUA 4CV2A 3AY6A 4J7CA 3F3SA 1HDGO 1DAPA 3BHJA 1PIWA 1I36A 1V8BA 4ZQBA 2JCVA 4A2CA 4OGWA 4GSKA 3QA9A 4IJKA 2DBQA 3U09A 4EITA 4EEXA 5F21A 2VYVA 3FI9A 3W4IA 3GMSA 1GQYA 1R0KA 2NNLD 1N5DA 3FD8A 1P0CA 3HN2A 1CJCA 4IM7A 1EBUA 5G4KB 3JD4A 5COAA 4F46A 3WG9A 2F00A 3KLPX 4CMHA 3P19A 3TOZA 1K5HA 4ZJUA 3GDFA 1I0ZA 4MKZA 2NM0A 3E9QA 4GI2A 3X2FA 4DLLA 2BD0A 1DBVO 1M75A 5A4DA 3TNLA 5JMPA 3EVNA 3FTPA 3E8XA 2BELA 4KWIA 5L9AA 4GH5A 3S2GA 4XYLA 2C07A 2YJZA 4D45A 4I5DA 5I7FA 2FZEA 1E1LA 3PVZA 4OSPA 3IKTA 3WGYA 4J6FA 4LN1A 3M6IA 4L0QA 1GQQA 5HTOA 1LDEA 3KTDA 1F0YA 1IPEA 1MG0A 2I76A 4DQXA 3FTNA 3NT5A 4HKTA 3CIFA 4BVAA 3OIFA 2RCYA 3VH4A 3Q6IA 2X1HA 3PWKA 4Z0PA 5B4VA 1D4FA 1U9JA 1DJQA 4ESOA 1U4SA 4J16A 8LDHA 1O95A 1U2DA 2WYWA 1ZXLA 3ANMA 4BQPA 2PY6A 3R0IA 4W9NC 4D3FA 1B26A 3WIEA 1NWCA 1P3DA 1HRDA 4DVJA 4HY3A 5TT1A 3ON5A 1JWBB 2X4GA 4O63O 3AUUA 4FCCA 4PZDA 4W6ZA 5AXAA 1KEPA 3RKUA 5T64A 1Z73A 4BKQA 4ALKA 2OO5A 4PG4A 1HXHA 2X0IA 4BNMA 4J4TA 2AA3A 4A03A 5DP1A 5JFOA 3DOJA 3G1UA 1PS9A 4R1NA 4I9NA 5JXWA 1GUFA 5KCZA 3IQDB 4M8SA 1Z6ZA 1H0KA 1WDMA 4RV9A 3LYLA 1OFGA 4H3VA 5U1PA 2NV6A 2HUNA 3EMKA 4PRKA 1U3WA 2DVMA 4CV1A 4IIVA 1YOVB 1LQTA 2RH8A 4HNGA 3ZV4A 2IDZA 1IPFA 3EY4A 3NDRA 3Q0EA 4JBHA 3ZN2A 1JLLA 2EKLA 2PZJA 1O5IA 2DLDA 3SEFA 1V3VA 3DZIA 3GGOA 2EP7A 3JQ8B 3LC2O 2NQ8A 4I5FA 1A9ZA 4CM4B 1RKXA 3D3WB 4CLRA 3RFXA 1QYDA 4NU6A 3OJFA 4OXYA 1BW9B 3LVFO 1H2BA 4CMEC 1VKOA 4OOEA 2CSUA 4YJDA 4HP8A 1R4MB 3MTJA 4RORA 2OFPA 2PZMA 5AQ1A 3ZWMA 2VN8A 4PG8A 3Q1LA 3ZNQA 4WLNA 5AXDA 5EINA 2VT2A 3A14A 1E1NA 3MJEA 4NH4A 1ADGA 4AJJA 4Z6KA 3C85A 2FSVA 5I9LA 4PZCA 2YHIA 1GZ6A 3F4LA 4DXHA 3HFGA 1E5LA 5ER6A 5HM8A 1NQTA 3DAPA 4ND5A 3KEQA 3U49A 4B4VA 4WEQA 2FN7A 4GLLA 1F12A 1EE2A 4R1UA 2I9PA 4IJUA 2JAHA 5AXCA 4HWKA 1GCOA 1XU9A 2HQ1A 2J3KA 4LSWA 4BO2A 4DC0A 1HDOA 4ILKA 3PLRA 5K6AA 2YY7A 3L4BC 1BVRA 4A7PA 3KYCB 4R69A 3MJVA 4RVFA 1PEDA 3R3JA 4TSKA 3PQEA 3OMLA 1V9LA 4EZBA 4WEOA 4AG3A 4UULA 1ID1A 3HB4X 1SCUA 3CZRA 3GR6A 1ISHA 2X58A 3ICCA 1GYRA 2Z1MA 3I4FA 1IHXA 4BHTA 3BMOB 1XSEA 3GPDG 3DMTA 4LGVA 1RYEA 2ZTLA 4BO1A 4WLUA 5TIIA 4ND3A 1DIHA 3I23A 3KBOA 4HFJA 2Q1SA 4TRRA 3OFSA 5DNAA 4BO8A 1ISGA 1X7DA 1KETA 2AQHA 4AJPA 1G0NA 2P9GA 2X9VA 4MVJH 4PZEA 1E7YA 3Q9NA 4JBGA 5EL0A 2A4KA 2VNSA 2PZKA 1LJ8A 2B5WA 4QFCA 5KJEA 5BSHA 3VVCA 4J0FA 4U7WA 4B8WA 1YVEI 1HE5A 2D59A 5TSDA 2HK7A 2I5PO 5BSEA 3WWYA 1VL0A 4A10A 2DC1A 3L0DA 3TZCA 4BMNA 3PTZA 3RUCA 5LC1A 3LT4A 3ZI0A 2IE0A 2HMVA 4R5MA 2Z1NA 1UR5A 3D0OA 3P5SA 2R2GA 3D3EA 1LDBA 3JQAB 4K1LA 4P4NA 4E12A 3OJOA 1YXMA 3ZDFA 4KUHA 1B8UA 3H8VA 4MVJP 4CMIA 1Y1PA 4A27A 4CUJA 1Q7BA 3PYMA 3ROPA 2Z5LA 5A04A 4GMFA 5DT9A 2AW5A 3S8MA 2JD2A 4FC6A 1R4NA 4QT0A 2XF8A 4RCVA 1UXJA 5LDHA 3E5RA 1H9AA 1VSVA 4PG7A 5DP2A 1LLQA 3F1KA 2P9EA 4OMUA 1Y5MA 4A26A 2W2LA 3AY7A 3BTUA 1ZMOA 5BNTA 1KEUA 3CINA 4P4LA 1HLPA 4RVUA 3HUDA 4NZ9A 3E48A 2C59A 1TXGA 2DFVA 2I99A 1F14A 2VRCA 1YQGA 4PLVA 3GGPA 1A5ZA 3EZLA 3KSUA 5ITVA 4XA8A 3ZWVA 1H93A 3D7LA 2YV1A 3FPLA 4WLVA 4IDFA 3UW3A 1WVGA 4BNXA 4ZVVA 4TRJA 1SMKA 3QE3A 5DBIA 3FF4A 4M49A 3VAZA 2RHCA 1VPDA 1KEWA 3KLMX 3ZHZA 3VDQA 2UVDA 3DZHA 3ICPA 4CLOA 4OIMA 4ND2A 4LMPA 4DMLA 4BNVA 2W98A 1E6WA 4PGFA 4UVGA 3WNVA 3OJLA 1YB1A 1DJNA 1YONA 4KP7A 4X54A 1PQPA 3QVSA 4XWYA 3D64A 5GZ3A 1GPJA 2WTBA 2E49A 4FPXA 3UCXA 2EGHA 3GEMA 1ZSNA 2NTJA 3PDJA 4R01A 4U6SA 5JO0A 4R16A 3W8DA 1PJBA 5TX7A 4AVYA 3PYLA 3JD3A 5F1PA 2PR2A 1LRKA 5IDWA 2VHYA 1QSGA 3EHEA 1OC4A 2HJRA 1XYGA 4MJLA 3GVXA 5ENDA 4J4BA 1UDAA 1F8FA 2EWMA 4AFNA 4PFJA 3WLEA 1LEHA 3JYNA 1B8PA 2EHDA 5DCUA 3TFQA 4BNHA 1GDHA 3KYBA 3WWZA 1MFZA 4PLCA 5ILOA 5COBA 1CRWG 4O59O 3PP8A 1TT5B 4XIYA 1J4AA 1XG5A 2ZTMA 5LCXA 2B37A 2HMWA 1Q0HA 3DQPA 4I1IA 1DDOA 1QG6A 3WBBA 4AJIA 5JPIA 1MXHA 1W73A 3ROMA 3I9LA 4IMPA 3FR7A 1NVMB 5DULA 4BKRA 3ZW8A 1HYGA 2GSDA 3ZWBA 4DBZA 3T7CA 3ONEA 2JKVA 4FFRA 4GWKA 3ETDA 1E3SA 1E3IA 4E5NA 5GZ1A 2QW8A 3E1KA 4HUJA 4EUEA 4BO0A 3WNQA 1T1SA 1X13A 2IZ1A 3ETGA 1C1DA 3PWZA 5LDGA 3UICA 4A5OA 1RM0A 2A35A 2AE2A 3WJAA 3TF5A 5CEFA 3OQ1A 4W9NA 3H6KA 1LA2A 1PL6A 4LISA 2NVUB 4WUVA 3BMQB 1CERA 1XKQA 1ENPA 2ZQZA 2P4QA 1P31A 5JC8A 3DBHB 4ALMA 1H6BA 1DIAA 2BFOA 5JYEA 3MWEB 4GX5A 1LLCA 4L76A 3WB9A 1ZFNA 3P2OA 5A3VA 3LC1O 1KC1A 4NDNE 2GN4A 4CR6A 1ONOA 1UZMA 3CTMA 1LBEA 3DBLB 4BNFA 4MOWA 5A9SA 4MIYA 3ONDA 1P9LA 4XR9A 3WQSB 2ZIZA 2W2LD 3E82A 1X1TA 4MVJI 4WOJA 1BXGB 2B35A 1P74A 1C1XB 1ZK2A 4YDRA 5JBIA 1GQ2A 3ZU3A 3DHEA 4GVLA 3RROA 1GTMA 2G5CA 4ZHSA 1SB9A 3B70A 4TROA 3ZWOA 1K6XA 2V6BA 3KVOA 4PLGA 1E7QA 3Q11A 3WGOA 3AU8A 2NU6A 3WDSA 3V8BA 4IS3A 2NVWA 3KV3O 4XRGA 2EGGA 4EBFA 2ZK7A 2JD1A 3M2PA 3DAGA 3OJ0A 1F17A 2JCXA 4PVDA 4YWJA 4E13A 1GUYA 1LXCA 1VJTA 3H65A 3KXDA 4S1VA 4CMCA 2JFGA 1H5QA 4BV9A 1I33A 4R3NA 4J43A 1SZJG 4M87A 1JKJA 3ZV6A 4JJGA 1BGVA 1DO8A 1N7HA 1UAYA 3H5AA 1QMGA 2YZ7A 4PIVA 3RSHA 4ZN6A 2HJSA 1JKFA 4Q3DA 3IJPA 1E92A 5MGBA 1U5CA 3KO8A 3WX0A 3IOYA 2Y0DA 2DFDA 3A28A 1TVEA 2ZYDA 3F4BA 5JE8A 1ZH8A 3F5SA 2Y1DA 4YAEA 3MJSA 2J5RA 1U1IA 1I2ZA 4CR8A 4DPLA 4WNCA 4YPOA 4ID9A 3EVTA 4PRLA 4I5EA 1XIVA 4UUOA 3JQ9A 4QO8A 1PGJA 1MV8A 1SOVA 3C1OA 3KETA 2C2XA 4I08A 4RL6A 1B7GO 4QEDA 4FFNA 5JY1A 3RFTA 1WP4A 3ZU4A 2P9CA 4QTZA 2X5OA 2YV2A 3RU7A 4BO4A 1E3EA 1PGOA 1PU2A 3ADPA 3N58A 1DLIA 2Q1TA 4YA6A 1W0CA 4CMKA 4WGGA 3B6ZA 2DM6A 3GEDA 3ZGYA 4CQLB 3K73O 2ZKLA 2CF6A 3NUGA 2X7HA 5F1OA 3NGXA 3GRPA 3ZWWA 3KSDO 1DFIA 1X14A 1E0DA 3ZV3A 5G4KA 1RJWA 1Q7GA 2J3HA 4WKGA 2GD1O 4NIMA 4KWHA 1Z7BA 2AEFA 2VUSA 1C14A 4TVOA 3HN7A 4B4WA 4CMJA 1D8AA 1NXQA 4BB5A 2A9FA 1DFHA 3HDHA 4PLFA 4XGKA 1DPGA 1ZKMA 1EBFA 1S7CA 1J6UA 9LDTA 2OOSA 2CVOA 3L9XA 4RVDA 3LLVA 3ROKA 2NTVA 1BXKA 4W7HA 4Y9DA 4FJ1A 4IQ0A 1PR3A 5JCXA 4L75A 1HZZA 1M2WA 5G0UA 1YO6A 1XQ1A 4EEZA 3SJUA 4YXFA 1QYCA 3DMTC 5DCYA 1NPYA 2XXBA 3GVHA 1A9YA 1QYXA 2FRDA 4E4YA 2FHSA 3OICA 4QO7A 5U9CA 3JD0A 4C7JA 1KIFA 4TMFA 5I9NA 5FEUA 1EVJA 1R0LA 4RO0A 5KJFA 5THKA 1MUUA 5JYDA 2BHLA 4CLDA 2J6IA 3IS3A 3FHLA 4B8ZA 1YBAA 1E1MA 4WLOA 3RJ9A 2PD3A 3AY3A 3HB5X 2OUIA 1D1TA 1MP0A 4WCFB 5I7VA 1MG5A 2B4RO 3C3XA 5I8ZA 1HT0A 3EW7A 4CQMD 4B7UA 4BGEA 4NG5A 2Q4EA 3BHMA 4BGIA 3QLJA 4GKVA 1B15A 4PLHA 1PL8A 3MOGA 4OKIA 3PZRA 1UH5A 2WDZA 4B3HA 4P8RA 2IZZA 4XDZA 2EKQA 3WYCA 4TZTA 1DIGA 4DREA 3C24A 4AJHA 2RAFA 4E2ZA 1FXSA 5DBFA 3F46A 4XB2A 3WGIA 2X6TA 1O9BA 1XR3A 3PHLA 1E7RA 1U3VA 3IAHA 4D79A 4XYBA 3ZWXA 1HDCA 3CKYA 2GO1A 4ITUA 1XDWA 1DRUA 4YTEA 5KKCA 1K0UA 3HE3A 1NBOA 1OZAA 4DYDA 3AOEA 3PZBA 2VHZA 4FN4A 5AVOA 1LUAA 4PLPA 2TMGA 4G5HA 5I8WA 1GADO 3KEOA 2HRBA 2GPTA 5C7OO 5IJZA 1PJ2A 2W2KB 1ZK1A 4E2YA 2CF5A 5A1TA 4Z0HO 4BS9A 2HSDA 3NTQA 4JNKA 4L4RA 3GFBA 3JQ8A 4WECA 4BNGA 5IZCA 4DL9A 3A06A 3WMXA 1HWYA 3EDMA 1YDEA 3F1LA 4CM4A 4JGBA 2XXJA 4FJ0A 3D3WA 4NBUA 3IUPA 4YRAA 4DPKA 2HK9A 3GAZA 2Q3EA 4IBOA 5A03A 3BZUA 1BW9A 4U8GA 2J5QA 1NR1A 4YAKA 4HBGA 4K6CA 3RUAA 4NK5A 3L9WA 1I01A 4J1TA 1R4MA 3L6EA 1NVGA 5C7LO 3ZZNA 3WOHA 3ZWNA 4IIUA 3VOSA 1CQIA 1N8KA 3RU9A 2Q1UA 3DAFA 4I5GA 5ENVA 3KUXA 3DZBA 3GHYA 2HU2A 2HO5A 2EV9A 3D5QA 5G2OA 3BXXA 1PJTA 3C1TA 5BSFA 2VTEA 5BT9A 3AFMA 1IZ9A 2OBNA 3GFGA 5DOVA 3WLFA 3QIVA 4CL3A 2BF7A 2YW9A 4UEJA 1H9BA 2Q50A 3IC5A 2ZCUA 1P33A 4N18A 2HRZA 1SOWA 4CV0A 1AXEA 4RPHA 3OIGA 3DZJA 3FBTA 2WJPA 2JFFA 3ENKA 1C3VA 3KYCA 1I10A 4WK6A 1QORA 3JQ6A 1WAMA 5THQA 1UZNA 1DC6A 3DC2A 4KOAA 5G0SA 3CMCO 1P1IA 5JY6A 1PWZA 4LCEA 2H9IA 3NDIA 2JHGA 4YQYA 3HQ4O 4BNWA 2PV7A 2C7GA 2O4CA 3RBVA 5IF3A 1GYPA 3A9WA 2Y99A 1EFKA 3BMOA 4II3A 4RPGA 4B7CA 4OAQA 4D7AA 3K2BA 3JTMA 1L1FA 3D4NA 5EMHA 1ISIA 4AL4A 3C8MA 1E77A 1U3UA 3JYPA 1Y81A 3U9LA 4FR5A 1LSJA 1ZJZA 3PK0A 3ZWYA 2AQ8A 4GPD1 3O03A 4TRNA 3UH1A 2O3QA 3GVPA 4KUGA 3ONFA 4CL8A 7MDHA 1BXZA 2DTDA 4FFMA 4NR0A 5EESA 2XOXA 4XEHA 1HDYA 2ILTA 2PWZA 4D43A 1KS9A 1PJSA 1U7TA 3X2EA 3HNPA 1EDOA 3RBXA 4CLEA 5TJ9A 5F1KA 3QVWA 3G0OA 3GOHA 2WWRA 4PLYA 4NHEA 5AOVA 4LRTB 4BNUA 5CG1A 4ZQFA 1LSOA 3I1JA 4J90A 4F3YA 2VWPA 4YJFB 1NAHA 5EQFA 4BO7A 4UVHA 1PWXA 2HKIA 3S2IA 4CM9A 4B79A 3EC7A 2IYPA 4MP6A 3PYXA 3JQAA 9LDBA 5KVSA 4BNYA 3S1LA 2BRUA 5AYVA 3CE6A 5A02A 3F6YA 1C0KA 4LVCA 2P91A 2GLXA 4C4OA 2Q2VA 3LC7O 2PD4A 3L07A 3DOOA 5G0TA 5FI3A 1ZBQA 2EERA 2VYVD 3D4OA 1Q1NA 3FN4A 1XGKA 5BR7A 3QHAA 1HE2A 4XZ3A 4KMSA 2LDBA 1LI4A 4J9UE 3VC7A 1EUCA 1Z75A 1VI2A 4BNZA 4ND4A 1U2GA 1PQUA 2FZWA 3BYZA 1TI7A 3M2TA 1OMOA 4R9SA 4U0KA 4YRDA 4MIOA 4B3IA 4GSLA 4L9RA 2V6GA 1A4IA 1ORRA 4I9UA 5TGDA 5CG2A 1G0OA 1C0IA 1C0PA 3AW9A 3G79A 3MJTA 5T6BA 1V35A 3AWDA 1YRLA 5CEJA 4RZIA 3WR5A 4UVIA 2JL1A 2JAPA 2ZJ0A 3JQ9C 1HE4A 2A92A 1A27A 3HZZA 2CDCA 3V2GA 4ALNA 2GYYA 4NJOA 5JMWA 4D0SA 3H3JA 1IZ0A 4RF2A 4QECA 4U5QA 4P38A 3DBRB 4LRSB 4B3JA 4GWGA 3TZKA 5IG2A 1NQ5A 4K6FA 1TA4A 3QVXA 1A4UA 1WZEA 3I5MA 5CDTA 2X0JA 4EJ6A 4D41A 4E33A 4ZQHA 4MVJF 4BQRA 1BDBA 1P77A 4AJOA 3GLQA 1ONPA 1Y7TA 3NRCA 4G2NA 4QQRA 5F5NA 4MVJA 3WXBA 4LK3A 1V0JA 4RPKA 2O50A 1GU7A 2B36A 4IQ8A 1SPXA 1YL7A 3BA1A 2BH9A 5B4TA 4FOOA 5CDGA 2P5UA 2I66A 4Y8VA 4CMBA 3AUAA 4FBGA 2D1YA 1JVBA 3OQ6A 3OA2A 1TT5A 1JW9B 1WXDA 2PKRA 4NNJA 1UAGA 4UAGA 4R9RA 4MIEA 4Y98A 2C0CA 1K89A 2C82A 1AE1A 4XQEA 3WYEA 2C5EA 3ANNA 4DQVA 1HETA 2UDPA 5JO9A 1YJ8A 4OL9A 2HMUA 4ZRMA 1XEAA 3IKVA 3MWDB 2AG8A 2D0IA 4FOSA 1U28A 2GCGA 3RQSA 4BKOA 3CZMA 4GBJA 3BTSA 3TOXA 2H6EA 3GUCA 3JYLA 2NSDA 4DLAA 5TT0A 3Q9UA 1Y8QB 1E7MA 1I2BA 4O5OA 3TPCA 4D42A 1SAYA 5T57A 2NVUA 3BMQA 4UVDA 4GQAA 4JLWA 1SEPA 2FPIA 4G65A 2XAAA 1PJ4A 2G76A 4W7IA 4PG6A
chains in the Genus database with same CATH superfamily
4OH7A 1X2BA 4JSTA 5CHEA 3O8QB 3Q2OA 3RC1A 4BNTA 4PFSA 2CLMB 4MARA 2YXPX 1G3IA 1N9GB 3OM8A 4LSGA 4BV2A 1XVUA 3FI0A 3BDAA 1TF2A 2Q99A 2AZXA 1PVDA 3EXHA 3G0DA 4R8RA 4TKUA 3EVAA 1N6OA 4DRZA 2OZKA 5EE3A 5JROA 1LCIA 1NQUA 1RHMA 1T4MA 2JFXA 2RGNA 3KZNA 5CFLA 5IT0A 1WUHS 1YGYA 1V5WA 3RANA 4JJKA 2XXAA 1GG5A 1J0EA 4Q9HA 2GRJA 2HR1A 1NP3A 1BXGA 2OZLB 1PR2A 4A36A 3N7UA 3LUFA 1CUHA 3P45A 1VE7A 2P5SA 3Q15C 4IVQA 3KOOA 3EXIA 3M1AA 2EEZA 2GZDA 4FZRA 1ODIA 1QAMA 3H9GA 4LNHA 1F2VA 3H4MA 3SX2A 2ENWA 3UUFA 4EI7A 3NAGA 5L53A 3JQPA 2VXCA 4E09A 2RGGA 1PR9A 1EQUA 1EM8B 3WGNA 3U3XA 4ASUA 1XRMA 5C5CA 1VJ0A 2ZXFA 3MMZA 4Q6BA 1J8YF 2LV8A 3N70A 4LC1A 1WPQA 3FNFA 2WD9A 3QFSA 2ETXA 2ZE8A 2HBYA 3LPAA 1UINA 3IVCA 3MPUA 2HPZA 4MV0A 4PX3A 4KQJA 2I7DA 4FC7A 2HA0A 3VU8A 3A70A 4PHCA 5FPQA 1L4MA 1TFRA 2ZVQX 3DXFA 5HA5A 3RT7A 1E99A 1KP2A 1GTL1 1H6AA 3VBCA 4KIUA 2GTPA 4XJSA 1O8CA 4E1BA 1GGHA 3FJ1A 1OZFA 3LZ6A 4KO4S 5CXUA 3A4VA 3KB1A 1XZFA 2UZ3A 2IEBA 3H13A 3SHOA 1EFPB 1T8TA 2ZR8A 5HRCA 4LMRA 1XJQA 1YJXA 2AFRA 2B83A 3I39X 5KIAA 4IMRA 4EB6A 1G9TA 1N6KA 4L08A 2QX4A 3PIIA 3QE4A 2VDRB 1GEGA 1G42A 2IX9A 1U8XX 1VG1A 2ZYUX 3AGQA 1FY2A 4JWTA 5DZSA 5BO5A 4CMGA 4DC9A 2CXXA 2P8SA 2JCBA 4J1TC 3I9OA 3UJCA 4J6EA 4M7PA 4OOFA 4R81A 4YP1A 4DRYA 1COZA 4C2BA 1NL3A 2CXUA 1T2NA 3RIEA 2FPXA 3INGA 1Y6QA 4AYTA 4OI0A 3K70C 1SKYE 2YV5A 4FDVA 1FP2A 1QHHB 4KWCA 4RVHA 4UM7A 2PX3A 5D84A 3SFVA 4X6XA 4XGIA 5CR9A 4R71A 1U3GA 2BZSA 1XZ8A 5IVPA 5BYKA 1JAIA 1BJKA 4BJ1A 3DR3A 5DTMA 2ANCA 1SB8A 2IL1A 1UANA 1WUJS 2AT1A 2B1RA 1NW5A 1Y9AA 2RAUA 2V58A 2YWGA 1CNMA 1O94A 1D1PA 3I3SR 4PZ9A 2CNBA 2QYTA 1AU9A 3IBFA 1YB6A 1T9ZA 3UW1A 2WQ7A 1I3MA 2OMKA 3WLAA 3FOZA 2W6JD 4ND6A 1OUMA 1Z4OA 2D5BA 5BNFA 1GZUA 1YHYA 3QKRA 3RTBA 2FFJA 3BH7A 3GEEA 3PFNA 2QM7A 3C5CA 4JLSA 3SLKA 1JR6A 1WQ4A 4LE2A 4RF5A 2DPXA 4TMYA 2DSTA 3D6VA 1WDTA 2H8KA 3NTLA 4G6ZA 4A8JB 5HUHA 1X7YA 3UFXA 4R2HA 4L73A 4GP6A 5CMLA 2BBWA 2G63A 1YAJA 3RYIA 4EYOA 3ZX4A 4NBRA 1IJKA 2NO6A 1RWBA 3GEPA 1C2TA 1S9DA 4B2LA 2R86A 1SCUB 2V4UA 3KT0A 3LOPA 4LSZA 1RM3A 1TLLA 4Y2RA 5DOZA 3O26A 4C05A 6ABPA 1MIHA 1FDSA 1T3ZA 3KZ1E 3TQSA 4DJEC 3QX7A 1J39A 1QPBA 1HEUA 1ZK0A 1NBAA 5MGNA 2I1QA 3AEQA 4IHQA 3I32A 1NUPA 2ZIWB 2WFAA 3UJNA 1WXIA 2DB3A 3MCTA 4WK0B 3TGPA 5F33A 1W7AA 4TM7A 3PPVA 3CH7A 2REOA 2EWWA 5AHRA 4TKVB 4XJTA 3K0CC 3OE4A 1MDBA 2FZLA 4FD2A 3DFIA 4FYWA 2R3SA 2VTDA 3PJDA 3AF3A 4I50F 3AYXB 3K2IA 2NADA 5C1BA 2QBYB 1TRKA 2ZBVA 4YRLA 4E4YA 1Y3HA 5D1HA 4KACA 3HBAA 4QYSA 3SJ7A 4RZHA 4RK5A 4O4HB 1QFYA 5EZYF 1WMAA 1WXFA 5KVAA 3ELDA 5F52A 1U0JA 3N9IA 3P7MA 2VJBA 1PJQA 3MRSA 2DPHA 3T0GA 2MHCA 4C0BA 4QPNA 2WVJA 4N3BA 4PLZA 2PDAA 4KK3A 2XLCA 3LTEA 4KVZA 5DIZA 4JUCA 4KGVA 5C0OE 3GYBA 4UM9B 1IZYA 3U7IA 4Y6SA 3UJBA 4MI9A 5T5QA 1LPBB 2HJ9A 5HS4A 4IGFA 1P1JA 2AC2A 2PT5A 3NH6A 4QFMA 4HD8A 4J2HA 4LZLA 4CTJA 4WCFA 2OV3A 2I33A 3H9UA 4WN3A 1T2EA 5CDFA 1NUTA 4ZZIA 4MULA 1ZIDA 1N7GA 3OJXA 2PRJA 1E79A 1SFRA 2QLTA 5KZMB 2A1IA 4OBBA 2OHHA 4OHPA 5KNCD 4TMZA 2BN4A 1UFOA 3SFTA 5D01A 2YDXA 3ITKA 1IH8A 2GN8A 4KR9A 4HUQB 2PMDA 5ER9A 3RPEA 1OBFO 3IE1A 5B30A 1KC3A 1VKHA 3DB2A 2VSOA 4HK4A 3H1EA 1KFJB 3RUHA 4E5MA 1LC3A 1AZLA 1VE6A 1WCYA 1TEZA 1E64A 2EATA 1DRWA 4FM9A 1NASA 5A6SA 3GCWA 4ENPA 2CYCA 3V8PA 3A1DA 5IX8A 4NC9A 1TCVA 1U9YA 3O4RA 3IMFA 2H5LA 2X9QA 3CRQA 4AMBA 3K1AB 2CFCA 4S04A 2R00A 1NI4A 4TVBA 4C89A 3GA7A 4EQ6A 4RF4A 3OTOB 5C7IO 1GD1O 2ZTSA 4LPSA 3ASZA 4RA9A 3ZNNA 1GL3A 2B8WA 4ADSG 2E55A 4AG5A 5CVDA 3SDSA 1B1CA 3K30A 4NMHA 4ZTBA 4B3FX 1YVRA 5F78A 4B40A 4ER7A 2RGDA 3G68A 2QRJA 4XAQA 3VH3A 3DMRA 5DT2A 4EGJA 1U2GC 1N2CE 1XC7A 1ZMTA 2GKSA 1JJVA 2V74B 2AGVA 3BE6A 1Z5WA 3L43A 2FPGA 2YHAA 1FE8A 1OSNA 1J5XA 2CN1A 3EMBA 3JWEA 1CZOA 2I0FA 3H5RA 1MGOA 2VRBA 1DKNA 3DDWA 3N2LA 4HWGA 1GTZA 2FW8A 2YWBA 3Q7TA 4FINA 3OG9A 2XDQA 1UZAA 2QZPA 3PWTA 1JLHA 3R5FA 4BLQA 1NBHA 2EKBA 3VR4H 4YRBA 5CDUA 2LZ0A 1NY5A 4E2FA 4RQTA 2ECKA 2DHDA 3ASYA 3CUUA 3HVRA 2GEKA 2CLOB 1GPH1 4PWZA 2OC9A 1BVUA 1CZRA 1N4AA 1N1DA 3UGJA 2HCBA 2PJUA 5G1NA 2HDWA 3AVOA 3VMMA 4I9FA 2GYWA 4MW7A 5JWHA 4AIIA 2Y1GA 4WKPA 1KMQA 2WTXA 1QJ4A 1K7SN 1P75A 3A4NA 1Z39A 2VJQA 3JATA 2B34A 2HF7A 1OI4A 3ELWA 3HCNA 2Y68A 3NHZA 3RO7A 2C5SA 4JXJA 3ZNOA 3N2NA 4D99A 3Q2KA 1OWLA 2NQ2C 3EUAA 4IPTA 1NI3A 4LYGA 3UJ6A 4B82A 3O90A 1GZ7A 4EKEA 4XQGA 4FI3F 4QSMA 4PONA 1T35A 1QIJA 3OLVA 4NX2A 5LZ4A 3H11B 3DCJA 1FDWA 3PBKA 4PAQA 4KN8A 3PQDA 3S55A 1FW8A 1DQZA 1W88A 3E70C 4KXUA 4Q02A 4HV4A 4MUBA 1BTOA 4O8CA 1AKUA 3VPFA 2QTFA 1BOOA 3P32A 2YL2A 4MQFB 4RFVA 2OMEA 2YN0A 4N5NA 4IAOA 1F20A 4R0VA 2IXEA 3DEHA 3DNMA 3CR7A 3MJCA 1L7OA 4A0HA 2VHJA 4M60A 2OXTA 5H3LA 3ZK7A 1GSOA 3NEJA 2GEFA 5FHQA 1DUVG 3EPLA 3FOFC 1I94B 1CR1A 1UMDB 1GA6A 2A30A 3GVIA 2O07A 3I01M 1GJRA 1D2MA 1S3SA 1U3TA 3OH8A 4L5YA 3TTTA 1E7WA 4CF7A 5FFFA 3UUGA 4DS3A 1YRHA 2GX6A 3TXYA 3KCNA 4KFRA 5KMGB 4YT5A 1C50A 2Z58A 3GUHA 3NXSA 4MKFA 2XPCA 2WWIA 4TS4A 1IY0A 3LDUA 3SAJA 1W0KD 3IT0A 5LB4A 4DLUA 3SMVA 1GR1A 3HV0A 5LYYA 4ND8B 1IOZA 3VZSA 2PR7A 4MDYA 1U2TA 2VAWA 3RF7A 1JTEA 3WGHA 1Z68A 5TXGA 4DSTA 2ZZNA 1M5RA 2G1AA 3WFJA 2DF8A 3AF2A 3TI9A 2AOUB 2COEA 1I7NA 4A6DA 2NXNA 5EG5A 1OAOA 5EI5A 3TKYA 5IJ0B 4BN5A 2B2NA 4HAYA 3NHLA 3PJGA 4MW1A 4HDNB 1S9HA 2XD9A 4EO9A 1SHLA 3ZEAA 1NVTA 1M8KA 2L17A 1R37A 5DEOA 5K1ZA 4I36A 1YS9A 1WX1A 4EMBA 2DUMA 1KJYA 3GRZA 3CFYA 5LMUB 1FP1D 1XWWA 3ACBA 6LDHA 3DO6A 4REQA 2A58A 1G63A 3LWBA 3BGWA 1CQJA 2FPPB 2G9QA 1N7JA 2FY8A 2WHRA 3A2NA 4PN3A 3HFSA 2EZTA 5H68A 1LDYA 1JAYA 2P78A 4N12A 1JMKC 4UNSA 1Z62A 3EZ6A 4KMRA 1ODJA 1KNXA 3WQQA 4KAFA 4O4IB 4Q3CA 4MUKA 5IK2D 2NU7A 4EAAA 2L42A 1P6QA 2C5BA 4DV1B 3R5SA 1D0SA 3TDNA 5A5FA 5C8ZA 3G13A 1EMDA 3AI2A 4R2LA 5FYQA 2O8BB 1B1AA 4QG7A 3VO2A 2WJAA 4YJFA 4DIMA 3LRXA 5TEWA 4XQ9A 2K87A 3HJCA 5KAPA 2WMYA 1C9NA 2WYVA 2AQKA 1A88A 3TVYA 4R8SA 2NSHA 2OQVA 3H3FA 2Y6VA 3KOWA 4BB0A 5KYKA 1JSLA 1ZD4A 2A1UA 3AILA 4IIJA 3CMMA 2HQBA 5CDYA 4C4RA 1DS6A 2ZITA 5D7NA 1L5HA 1JEAA 1KA9H 1R3UA 1U4NA 1YNOA 4CG1A 3N8GA 4JEUA 3IBTA 4ZK2A 1JG3A 1IBRA 2H63A 2VHCA 4EL0A 1JDBC 2C9BA 1WF3A 2WR8A 2B1GA 3LE8A 5EJAA 2AFHE 2UXCB 1Z0UA 2X41A 3E03A 5CDHA 4ZV7A 1NP7A 2EP5A 3I83A 3NM5A 4HQFA 4B8YA 2MMGA 2AKYA 3LBAA 4PIPA 4WK4B 4W82A 1Y1SA 3TRHA 1PO7A 1PT7A 2C4TA 2HJVA 4Z4QA 2H9YA 1FYVA 2A67A 5HKOA 5A06A 3OM1A 3OTQA 2JCYA 2WWGA 3GJZA 4LOKA 1FTQA 3KZMA 4POAA 3WQRA 2GFHA 2FG5A 3OSUA 4FYPA 4Y67A 5C18A 3W3AA 4J49A 3VR2A 1DRKA 5KQRA 1S2MA 1T29A 2XB9A 1T4BA 3OC0A 4PSVA 4AUMA 4CV3A 5G0VA 4MYTA 5CCDA 3W0LB 4MR8B 4IHJA 2YFQA 3O3MB 1Y33E 2Q1XA 3K92A 3IUMA 2HXYA 3PGXA 2UVQA 4B6RA 1QJCA 2ECQA 2Y9MB 1VJDA 4NMXB 3DQZA 3GLIE 4DLKA 5IJWA 2ZYAA 1I80A 1D9XA 3KB6A 1H2HA 2IPXA 2YWFA 2HDNB 4PGMA 2EBHX 2NTNA 5EHZA 4I3FA 1CUXA 3UIEA 1IOLA 1HK7A 1PNQA 5BV0A 5F7XA 4MP8A 3C14C 4RK4A 4WOKA 4RHUA 3MGGA 5A5GA 3SQXA 2VTVA 2R8RA 3B1FA 3GH3A 3I9KA 1U8YA 3ROXA 4KW7A 4QDTA 4Z5XA 3U3JA 3SZMA 3G2JA 4QPDA 1L3BA 3ML1A 2O59A 3O75A 2J9FA 5KYGA 3O8OB 3VFDA 1D2GA 2VUUA 4NCXA 1M67A 2P9ZA 2ON6A 4KX3A 4MVYA 4PNPA 3GQVA 4L74A 1XELA 4P2BA 1U0EA 2I6TA 3NEPX 2G7ZA 3QPCA 4YRMA 4OJNA 2FR1A 4PGAA 3JVEA 1HL7A 1L5RA 4BXOB 2WZQA 1K6MA 1ZSVA 1DEOA 1EWYA 1QIKA 3H9JA 3RS9A 4TMWA 1H2XA 3CNQS 3BTVA 4KR2A 2K7FA 2EW2A 2JFHA 1QP0A 5FF9A 5GAJA 1Z3CA 3GZTB 4J0HA 4EW2A 2YYZA 3Q7SA 1SHKA 4MR9B 4YMVA 2Q45A 4R05A 3T1NA 1G8JA 3UV6A 3E5NA 4M1TA 3TUZC 1OYOA 3OP1A 4GOKA 3VR6D 1XDZA 2VA9A 4IIGA 3GGDA 4BFCA 4BNJA 4BCDA 3TTSA 5CDSA 2B21A 3QK7A 2GILA 2QTNA 1FDOA 3KJFA 4J0QA 4F3RA 3VGJA 4KGDA 1JT9A 2D00A 4H3HB 5AT1A 3ZHSA 3DP7A 3PVSA 2JRLA 2JRCA 2BM0A 1OI3A 1O96B 3QLVA 1JU9A 5I3ZA 4BP3A 5K6RA 1D6JA 3QFHA 2JG3A 3IVAA 1A9XA 1PJRA 3R4CA 5B3AA 3S2EA 2VT3A 5AM2A 4E46A 2H9AA 3MJFA 4DMCA 1HYHA 3K6KA 2O0MA 1QM5A 3GZNB 3KJEA 3FDFA 4NHOA 3TZQA 1YR1A 2FRVA 1ABBA 1LDMA 2GJAA 1ESEA 3NBQA 1WHSA 4GRAA 3KYIB 4MVWA 4ZT3A 1DKUA 2DLNA 2X7XA 4DWVA 1JRLA 5JLJA 2DE0X 1DTWB 2P65A 3UHPA 1DKQA 2J41A 4FGWA 2VPQA 4YCMA 6ADHA 2XKJE 3C3EA 4N0PA 3VO9A 4U7FA 3ABOB 2F9MA 3ESRA 3WSTA 1T5IA 1R9MA 2H06A 4PIMA 3DZGA 1E6MA 1RP1A 1YKFA 1WUYA 4F5ZA 3GFQA 4B7ZA 4DY4A 1C3OB 4D3XA 3U7JA 3HUUA 3DT6A 3INTA 3JD1A 5K8IA 5DM0A 3RYFB 2GAOA 1T8PA 1Y5RA 4TTAA 4UVEA 4QU5A 1X1AA 1V3UA 3G2HA 3HEMA 1A04A 4E5YA 2AJCA 3HJRA 1XTKA 3I6IA 3BB1A 2ZT8A 1AO3A 3FWZA 5ED0A 5LZ5A 1GKUB 4BZXA 4E32A 3W6NA 2QROA 1QUFA 1B16A 3UUWA 4D9GA 5BQFA 1V16B 3K5PA 2J59A 2RHLA 1YRYE 1V3TA 2NSYA 4G5OA 1XPJA 3HM2A 4MDHA 1D07A 5HS6A 3H04A 2XT0A 3NP9A 2TMYA 3AONB 3BMCB 5FCDA 3D31A 4C14A 2AW3A 4PX5A 2OHOA 2HV9A 4JEHA 3VR1A 1Q50A 1BROA 2QAGA 4GMHA 4PO9A 4RZUA 3BFVA 4MCIA 1YACA 1U1FA 3KFVA 2UZIR 4OYRA 1EE1A 5DBOA 3WL3A 1GNPA 1M2OA 3DZFA 4CIXA 4PQEA 3RJ5A 1R3DA 3TTVA 3EEOA 4Y2TA 1A9QA 5G3ZA 3QUQA 1EWKA 3EGWA 4RD6A 1P1RA 5ECWA 5CAEA 1J5EB 3A9TA 4M54A 1T6YA 5ICFA 5GM2A 1T0JB 3QFRA 2XCRB 1GN8A 4QQFA 5KTOA 4JLUA 3UCEA 1YB2A 2CLCX 1ZPDA 1EG2A 4HTFA 4ZI5A 3LOUA 1PFVA 3CWZA 4RK7A 3TZEA 3WDKA 2P2GA 5K0JA 4UJ5A 4AXXA 4QOEA 3LUJA 3NHPA 3BF7A 1T5SA 1XZPA 2COKA 3UKOA 3THYB 1QAQA 2VNJA 1K86A 2ZRPA 4A8HA 1QDEA 4XLZA 4JX8A 3FNQA 1A2KC 1IVNA 1R10A 5DX8A 4WBNF 2FSIA 3ZCSA 2B7LA 4OHYA 4ENWA 5BN4A 4IWNA 4GNRA 4K87A 2I4RA 3ZWAA 3OCXA 3M7IA 3W5AA 4B7AA 4S1NA 2O2SA 4MB2A 1U8UA 4C2TA 4FGLA 3M6AA 4YO8A 2VOJA 2H2DA 1U0LA 1T9DA 3OKAA 1GL9B 2RGWA 3P0IA 4RA6A 1ACMA 1QQ5A 1GGNA 3ZBQA 4Q4AB 3Q8WA 3DZDA 4GPIB 4LSMA 3QI2A 4IEFB 3ODPA 4Q4JB 1Y6JA 4V0OA 2FLVA 5AHOA 1F3OA 1O0SA 1E5DA 3VU9A 2BMEA 1KMMA 4QTUB 1GY8A 2C5AA 4HEA1 4DA6A 5IXSA 2ZTVA 3GPBA 4IY1A 5KYUB 1RIFA 1F6WA 2NT4A 3MSXA 4MPJA 2QQ5A 3EZNA 4G67A 1BFUA 2J9XB 3GG2A 1HZJA 4FKMA 4G26A 1TUIA 3FDJA 5IAJA 1NR7A 2GTHA 4ER0A 4CJXA 1WBBA 2VSXA 4PVCA 3REOA 2GTIA 5IN5A 3EAGA 3ILHA 2ZT7A 2C0QA 4LEIA 4RLSA 3VKWA 5FL3A 3VPCA 1USKA 4C0JA 3GP8A 1G98A 4WFIA 3S44A 5HOEA 3ESZA 4HWTA 1P0PA 5BN1A 5EXSA 3R9IA 2R6JA 3RGGA 1XFAA 2GBLA 4CM5A 4MO9A 1TMYA 1VRVA 5DGHA 2EX4A 2QUHA 1II0A 4Q00A 2CK3D 2JAUA 5KYYA 4Q7JB 1KDPA 1MVLA 1PJ3A 4RD1A 5TR9A 3UCFA 5CB0A 3C3AA 5AJWA 3TE7A 1B74A 5I7SA 2A6PA 2BMVA 2GBFA 3Q7IA 4PYNA 3RABA 1JDVA 3W2HA 3DTNA 2C97A 3KKNA 2PIDA 4BATA 3LM8A 2JIMA 2V54A 2WE8A 3IPYA 1HFJA 3HA7A 3B1KA 2V8BA 3ZZ0A 2IU6A 2E21A 2NO7A 2VHTA 2QA5A 4Z4HA 2F62A 2AF4C 5JD3A 3DDHA 3UWSA 1G55A 3STHA 4Z0TA 1NN5A 1WUKS 3JQBA 1SUWA 5FNVA 1XRQA 5HCIA 3ZZUA 4K2HA 1SA0A 2B9VA 4JEMA 4NJMA 1QGOA 2XKBA 2M6SA 4B3MB 3ENNA 2G1PA 2DWUA 4CETA 3R09A 1UXKA 1YDMA 1ZK4A 2H0QA 3CQ9A 3CURA 3HCCA 3LA8A 4FUQA 1C3JA 4KO2S 4MPPA 1RW4A 2WHPB 3ZD6A 1S4MA 4EJSC 5L45A 3LKVA 2WAXA 4X44A 2QRGA 5BMOA 2CL5A 1GGJA 3D6NB 2ZXUA 1C30B 3ILXA 4W5RA 3MS2A 1YZQA 4FIDA 1R8YA 2NV0A 1QZ3A 2PZAA 3B51X 3SC3A 1SD1A 5EERA 3RNOA 3FTEA 1O6BA 2ET6A 1ZBDA 2H4ZA 3NB0A 3ZQUA 4BNIA 4DDTA 1ZI9A 1DUIA 1CP2A 2J8ZA 1JLLB 2HIMA 2JAWA 4BVHA 4C7XA 4BGDA 3CZAA 2FJUA 3OQIA 3RHSA 5DM1A 1QFJA 2A1TS 3SKVA 4C4AA 3N5CA 3NORA 4ZCTA 3ZX5A 2BHTA 2FR8C 4RBNA 1YMUA 3SHQA 3R4VA 1I30A 2OEPA 4JJ8A 1VKRA 1M8JA 2LE0A 4KK4A 2QMEA 1LWNA 2AEJA 2H4WA 4B47A 5JDIA 1BHSA 2W6NA 3B20A 4ZFNA 4DBLC 1Z6PA 1JFFB 2QP4A 3I28A 1EA7A 5HQJA 1PGQA 2D7JA 3KB8A 3VUFA 1D1SA 2ZE6A 5A7FA 2HMYB 1T1JA 1LVGA 2ERCA 3HZHA 4FFVA 5B12A 4GUDA 2RGUA 2QTVA 1VFPA 3BE5A 4MV6A 3QVOA 1ELOA 2VXOA 1PK9A 4RK0A 5F2OA 1SKQA 5D87A 1P18A 4LW8A 2CNNA 3ZZMA 2XZPA 1QHYA 4QUIA 4C6HA 5ALGA 3WS7A 2CDBA 4YJGA 3NNSA 2HBZA 3V7YA 4Y1GA 1UK6A 4LS3A 4L3OA 3E2PA 1G66A 4TKLA 2CWWA 2H7VA 2I6SA 2CUNA 3RBZA 2YHIB 4LRUA 1XDSA 3QOYA 1X77A 3NKVA 3SSAA 4YUAA 1JFRA 1TDJA 3AFGA 1CRQA 3HHPA 4BUCA 5EEGA 3KOUA 4BP9A 1XQ6A 1XZNA 2IUEA 2IUYA 2IVZA 3WP0A 4GKJB 1COWA 1TZ2A 2QRLA 2MINB 1W8DA 1QVWA 2BOVA 4KXLA 5EXEA 3WISA 4CWAA 1X1DA 1KEKA 5EIXA 3N3AC 3D2AA 5B53A 2OA0A 1G20E 1E9SA 2JIPA 3AFOA 1SG6A 2YFHA 3DHNA 3IBYA 1D2HA 4M9XA 5FUBA 3TBFA 4ZOAA 1PWEA 1IM5A 4DLWA 1WETA 3BT7A 1LV8A 2J9YB 1YBFA 4M88A 5EHXA 4AY4A 5IUNC 5E6UA 3AR3A 1NFQA 4KE6A 2RCNA 4Q9JA 4W9RA 3PC8C 4DNPA 5DTJA 1P6XA 3WIVA 1N5JA 3I6QA 1MCZA 2XZOA 4LJSA 1GXSB 5KNCH 4LDZA 1PZNA 1C7ZA 3D7MA 2X5KO 1XZQA 2IDKA 2XKAA 3K8YA 3P2MA 4OLAA 1IE3A 2C4NA 1JEQA 3KZCA 1E9CA 3AQIA 4I7EA 4RSRA 5IM4F 4N9WA 2Z95A 4Q3NA 2ZXEA 1D2AA 1CJVC 4A8PA 3LUDA 2WILA 5CXQA 2GUGA 1X80B 2L69A 3ITDA 3KK0A 3PCXA 2YCLA 2WBLC 1GYQA 4ETIA 4MLPA 4Z9AA 4YIHA 2UU9B 3GOQA 2WLSA 3NAQA 3TAHA 4NFYA 3DLBA 3ZCTA 4LTNA 2B7BA 4IXWA 5A5EA 3BRWD 4DGSA 2FB9A 1DXHA 1VLJA 2WSMA 1MB9A 4UDNA 1EM6A 5D6OA 2WWVD 5JWRA 3SM9A 2PUBA 1RZVA 3MQ4A 1C1YA 3HDVA 1QK5A 5HWSA 4D92A 1ZS9A 1WO8A 3RVDA 2W2NA 3LGAA 2EL7A 4FCTA 4TWZA 5DW3A 4LZAA 4YDHB 4KQHA 3TG8A 5LKRA 3BCHA 4KXFB 3S1AA 2K4MA 4BEWA 4I8XA 1FBNA 4N49A 2JVIA 4P58A 4DQ0A 3P71T 1GPBA 2XE7A 3FPFA 2CNDA 2ID7A 2ZAGA 3H16A 1TZJA 3KOXA 3WGUA 4JR0A 1FDVA 2OYSA 2WJHA 4JI1B 1E94E 1QH1B 3GP3A 3WTCA 3LQ1A 4LJLA 4LMAA 4EI9A 4PM4A 5HUJA 4OG2A 1Z6XA 1NKVA 1BGXT 1XDBA 4XD7A 5TEVA 3ZKWA 1CDEA 2XGOA 3QF4A 5KYNA 1I1HA 3S68A 1IMOA 5DNDA 3Q3EA 4Z54A 1N78A 4L7QA 3G49A 3OZGA 4QHTA 2ODTX 1UIMA 4YMWA 2EDCA 5BV8A 1NJ8A 4XX0A 3C45A 2EG9A 3L6OO 1RRVA 1ZEMA 1FP4B 1UJNA 3EC1A 1MTOA 2QOEA 4MINA 5EQTA 2YX1A 4ZVNA 2Y1XA 2VHQA 2PS1A 2YFYA 4H1WA 2OE2A 2DBVO 1NN3A 1QO7A 2CHUA 3AZPA 6Q21A 1GUZA 3CTPA 1F8YA 2OO5C 5LFAA 4QUAA 1XD8A 4UTPA 3C6KA 2YHUA 4DQLA 5L3ZA 4PZZA 4LWZA 1DIBA 3I34X 3UXMA 2NZJA 1X8JA 3NCTA 4V02A 2XMSA 1T6NA 5DBEX 5KB3A 4LBZA 4AZ3A 1O97C 1L7DA 5AJZA 2M1XA 2P68A 1Q57A 4NE2A 1I51A 4G0UA 4UAJA 3PGMA 4FLFA 2DCMA 4OU5A 5K3SA 1K6JA 2FCAA 3NATA 4JK3A 2GAFA 4AMGA 2J31A 3AEUB 4KFTA 1SVOA 2ZJ4A 3RH0A 3U48A 4BNNA 1K8ZB 3BN3A 3LJKA 1H9CA 2I4TA 3W5HA 3K2EA 1O77A 5FYDA 4KREA 1K92A 1SUIA 4FEAA 5TJHA 2G1JA 4EPYA 5CFRA 1JDJA 5I51A 3DV2A 1FYDA 4MPDA 3ZXUB 2OHIA 3GQBB 3K6RA 2WMNB 1QQ6A 4O2BA 3GRAA 1HSOA 3INYA 2OD7A 1WHTB 3NBMA 5MN6A 5TRTA 4A91A 1GPNA 4S12A 3WHKA 2JHCA 2XTAA 4RTPA 5FAKA 5IVKA 5ICSA 1H2ZA 1ORTA 2ZI6A 3QX9A 4UHJA 5DASA 3B9BA 4NK4A 5DYNA 1DJPA 3N6RA 4IXTA 5EP3A 1YI0A 3I64A 3VC1A 4MHTA 4HX9A 2C7BA 4UHFA 4KXMA 3K9GA 1U7PA 4D6PA 1QX4A 2H4YA 2CZCA 1O0BA 5LD2B 5JAQA 3CUKA 4QUBA 4BB6A 1JJAA 3PQ6A 1U1EA 1WDLA 3PQ4A 5LQMA 4CKCA 2H7XA 1GITA 1XKTA 2JIBA 4AKTA 3GPIA 5BUQA 3HU5A 3NLLA 4NDZA 1UP7A 1IXKA 4BZWA 1VHDA 4P22A 4XX1A 1T3GA 2QN7A 2OGUA 3IAEA 4JCOA 3WMWA 2QJRA 4BLUA 4N6OA 4YR9A 1USIA 3N5KA 4HMQA 3T5BA 5C4MA 1T43A 5K51A 3ZH2A 1QYWA 3SS8A 5L3SB 1HH4A 1G8PA 3DMGA 4TZ6A 2WIBA 4KPUA 4RHYA 4EPRA 4DARA 5SZHB 4BKUA 1S3IA 4S0ZA 2R751 2Z43A 4X24A 5KTNA 4N7JA 1FMFA 2G6TA 5IDQA 4S1OA 3U3MA 4WZBE 2WJZB 1L5KA 2XVMA 1NPDA 1IQUA 2ZJOA 2ZVPX 1L7QA 3DE4X 3O0TA 2XW6A 4RZ2A 2AG6A 3TRJA 5JS6A 2JGAA 2QRMA 1NLUA 5KTRA 2V4MA 2O2GA 2NX2A 2PS3A 4Q03A 1Z88A 1EJ2A 1RP7A 1WUTA 2C2WA 1JZSA 1Y34E 2RGXA 2XGSA 3GC6A 3IQFA 3LVRE 3N2KB 2PGLA 3OOJA 4K6OA 1PBTA 3SICE 3WYGA 1CEXA 3MTEA 4BJ3A 4Q3EA 1GM5A 2RK4A 1B93A 3MOIA 3LAWA 3TZHA 3IHTA 2AN4A 4MUGA 1WTCA 1G2IA 2V7PA 3PVCA 3TJMA 2XOEA 1HV8A 4GEKA 5C52B 1X86B 4R68A 2VK2A 1ONSA 3T99A 6YASA 5IDVA 5IU6A 1DBWA 1BU5A 2AD5A 3LWDA 5KJ6A 1II8A 3SVTA 1PJLA 1B2LA 3FNRA 3MMXA 2D2FA 3RJZA 2WK1A 5HZMA 3U31A 4EHIA 1WBDA 1KEVA 1YTUA 4DRXA 3DCNA 3VPAA 1MTZA 1VG9B 4ILEA 1AMNA 2UUPA 4YBZA 3OEWA 2YYSA 4LOJA 3BGIA 4K9QA 3K0SA 2CCJA 4N01A 2QLFA 2RKWA 3NO4A 1C4OA 4C43A 4IIHA 4ZYXA 3T6KA 5AOCA 3D3NA 1R0SA 1CK4A 1RYMA 2QTLA 3SXJA 1E2MA 4E2XA 1KYZA 2DG2A 3IP7A 1YIDA 4JB2A 1HNZB 1BH6A 3RU2A 3O38A 5MF6A 2KPOA 1K08A 3HVKA 1F60A 3ORRA 3TQRA 3KFXA 4R2WA 1YC5A 4IH1A 4QRHA 4ZOEA 1NONA 2R6ZA 2F4VB 2NU6B 3E7PA 4DQUA 2ZBEA 4HFMA 1OH5A 1U3DA 3W5SA 5JCPA 1RPNA 4BFUA 5HJEA 2PGIA 1JFLA 4L51A 3ZV5A 1UDBA 2EX0A 1ZHFA 4F97A 1CNEA 1X94A 1G4HA 1KRWA 1DX9A 4ZJPA 2I4OA 5BNIA 1JJIA 1VHTA 4FMBB 4IIJF 4N54A 3ZV7A 1PI3A 2ASEA 3STWA 1E1QA 5ALLA 4WKOA 4BQEA 2QTWB 3ZHBA 1GFSA 4P7FA 4D4IA 5F4BA 1B8OA 1RM5A 5DIFA 4F6CA 2VSQA 4NICA 2NP7A 4XI9A 3JX9A 1XZAA 3KPYA 4KIFA 1PX0A 4MA4A 1NJGA 4PHHA 1CU1A 3WYBA 1RM4A 1OA1A 4JLKA 2IEZA 4Q6WA 4EPXA 3GA0A 1ESZA 4OA8A 4AW9A 3HO6A 3BRQA 4I99A 2C3YA 4TV9A 3HWRA 1SK8A 4P3XA 1PG0A 3OIDA 1C8BA 3URMA 5FA8A 3KVRA 4EGSA 1OVMA 2B4YA 3EVBA 4EHJA 3L05A 4MYUA 3CM0A 4ZZ2A 2BR4A 2FSSA 3BD9A 3FGZA 3NXKA 3BFPA 3A6JA 3I6MA 4RVSA 1FXUA 2O5EA 1PZXA 5C1IA 1TFUA 1X92A 3EJWA 1L7XA 2ARKA 2Y66A 3O0DA 3KKQA 5DWDA 3VR6H 4RVGA 4Y0AA 3AY6A 2W0MA 2QIPA 2WU0A 2ZJZA 3F3SA 1QIHA 1T6XA 1DAPA 1R7RA 1ZMBA 2OGZA 2QPTA 2Q0HA 2H2WA 2WU8A 3GLVA 4G4IA 1V8BA 4P3OA 4OHFA 4QODA 4ZEMA 4WLUA 1OH8A 2DFPA 3H0KA 4A2CA 2YH2A 3O4IA 4GSKA 3DB1A 1QANA 3WIUA 4M8LA 4TTRA 4EEXA 5F21A 1ZL0A 4QTXA 3AXSA 5E8JA 3SSNA 3T06B 4NENA 4Z4EA 3VRHA 2YXLA 3I1FA 3RREA 1EBUA 3SEQA 3CXUA 1RSZA 5G4KB 1GGMA 1TMOA 3RG2A 4ZI7A 4JLDA 4X64B 2FPRA 4JBXA 4M76B 3KLPX 3IAXA 2W37A 1K5HA 2WC1A 3MFYA 5T4FA 3UNXA 3GDFA 2V55B 3VDNB 2NYUA 4YP7A 3SR4A 2IH2A 1FLAA 3ZE7A 1Q83A 1UC5B 4DLLA 1NVVR 3D3JA 2BD0A 4ESEA 3ESBA 1UQRA 1DBVO 5GOZA 5A4DA 4ESVA 4OMCA 4F5YA 3P2EA 4GBGA 2J7PD 4HWOA 2P11A 3WYFA 4KWIA 1L5ZA 1KMHA 4OHBA 3LD9A 2OFOA 4Q47A 1QRDA 3ZZTA 4D45A 4I5DA 3TSYA 4M99A 3NHJA 2FZEA 3PVZA 1H1TA 1SXJA 5I48A 3NUQA 1C29B 2JLZA 5CXSA 1US8B 2R11A 3O4GA 3VYRB 4MQMA 1PKXA 1ZA1A 5HTOA 4N48A 4HDQB 2CMFA 1U5BA 2J0UA 1MG0A 1XF1A 2IYVA 4NNOA 4MCJA 4X41A 2I76A 5FLYA 5TQ2A 4WOBA 4FYKA 8MHTA 1Z6YA 1IXRC 3S99A 3RTCA 2GJ4A 2ICAA 2O8NA 3JRWA 4GQIA 2QRQA 1NW3A 4URUR 5LVAA 1YS1X 4ZI2A 2YVAA 3F5DA 4G1CA 3OFVA 2G06A 3PWKA 3MM4A 1GWNA 4BAGA 5CDFE 3EY9A 3QKSA 4S2EA 1U9JA 2J46A 2A88A 3STYA 4DMKA 2QG9A 4I4IA 2XRYA 1U4SA 3KQHA 2FMHA 4OEHA 2R7MA 3P96A 1Z5NA 1MNQA 1O95A 1U2DA 4C1NA 3ANMA 3N53A 4W9NC 3E35A 3IVMA 4Y2UA 1TX4B 1HRDA 1UBCA 1UOPA 2C4MA 5ARDA 5JI3E 3WZMA 2V6IA 1GPWB 4M38A 2YZGA 2X4GA 5EJIA 1IVSA 4LY6A 3AR9A 4PZDA 4Z3OA 3OCUA 2RH5A 2NO1A 2V7EA 1QK4A 2ST1A 3A4LA 1EXDA 4PG4A 1LBTA 5KDDA 1GOTA 1Q0UA 3EQ2A 3FOCA 2AOTA 2QP9X 3WK6A 1CUSA 4BQOA 4BIMA 1TM7E 2A8YA 3X1JA 2HYIC 2C77A 4GD3Q 1M7HA 3AR2A 3HHEA 4K9KA 2XT9A 3IQDB 3ND7A 1RVV1 2BP7B 4EQZA 1OYYA 2XGMA 4U7TB 4B3XA 2OZLA 1H0KA 1WDMA 2WABA 4RV9A 3VZCA 3KS9A 3FWPA 3LYLA 4CL0A 5I4KA 2XVYA 4H3VA 2G9VA 2W43A 2WF8A 3R6WA 2OECA 2G72A 4PQRA 2ZJYA 2E1RA 3MYYA 4KSCA 3MWJA 4RHXA 1YOVB 3RVNA 3UJ9A 4HNGA 2IDZA 3EY4A 3KSAC 2QN9A 3NDRA 1E6CA 3ETHA 4CE6A 4Y2GA 2P0AA 1O5IA 1YZTA 2WJYA 3QUTA 4L4YA 5ESRA 4S1TA 4F06A 1KIMA 1K8RA 2EP7A 1VG0B 3LC2O 4N3CA 2FEKA 4KIWA 5CGZA 4G1FA 1CY8A 5F76A 1F2UB 3RV4A 4DR6B 4XDHA 3P52A 1T9KA 3JQQA 4WW0A 3AF5A 4Q16A 2QM8A 3K16A 4U9HS 3SYMA 1JIKA 4DWJA 3KEMA 4H2DA 4OXYA 1ZNWA 3IILA 3ZHUA 3CT4A 4C4SA 1H2BA 3VKHA 1VKOA 5CA0A 4OOEA 3WLIA 4UPDA 1F4PA 3AETA 2YY5A 4OI1A 5AVUA 2WU1A 1L8AA 5DYYA 4MRSA 1Q1GA 1SUAA 2PZMA 5KTMA 2P90A 2VN8A 4EELA 2BGTA 4B5LA 1CQIB 4BVJA 3KLBA 4BYMA 4PG8A 2KB0A 1ILEA 5KC8A 2O2DA 5JCOC 2C4KA 2PSJA 3PE6A 2CXNA 1JILA 1JE0A 1U94A 2DUJA 2JFOA 2NXCA 2VT2A 3A14A 1E1NA 5NLLA 3ZXSA 2EFHB 4ZVSA 4Z6KA 1LPNA 2PV0A 5F9MA 5A3RA 3OZ7A 3EPRA 5I9LA 1UZUA 1EWVA 1GZ6A 5AMXA 1NQXA 2X5NA 1QHHA 5EMJA 4URVR 4JLAA 4DMGA 4KU4A 1EFVB 1L5NA 1G2PA 2ZYTX 2ZG6A 3P9RA 3KEQA 3BX1A 4DLSA 4LVNA 4WEQA 2WWTA 2XT6A 5JSZA 2LRHA 1U0BB 4R1UA 3CKKA 5FR2A 1B23P 2Q9UA 4U39A 1HQKA 5FULA 5AKGA 1M74A 3G59A 5BRNA 2HQ1A 2CL6X 3TOCA 2ETVA 4LSWA 4KYTA 2A57A 2OD2A 1B00A 1HDOA 3KT8A 1TCAA 3L4KA 3PLRA 4CU5A 3HA3A 3VYTB 3L4BC 4IHKA 3ZCQA 3EIXA 2IP4A 4A7PA 4WJLA 1S4QA 3SF8B 3HBJA 3CRNA 2NZYA 5TQ0B 4QWWA 4TSKA 1M54A 4RFSB 2O7RA 3G8BA 2AK2A 2BFFA 1W49A 3DO8A 4YRNA 2H1WA 1OLOA 1SIWA 2GF9A 4MGYR 1YFJA 1TZCA 3ZD8A 1SCUA 4A8TA 2AR0A