4PLZA

Crystal structure of plasmodium falciparum lactate dehydrogenase mutant w107fa.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
302
Chain Sequence
KAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title An atomic-resolution view of neofunctionalization in the evolution of apicomplexan lactate dehydrogenases.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 118
structure length 302
sequence length 314
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4plzA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4plzA02
1HF3A 2AG8A 3CKYA 4WE3A 1AE1A 1O8CA 3RBVA 5AXBA 4A5OA 4KUGA 1E6WA 3ZHBA 4CMEC 4XQEA 1PS8A 4BNKA 3Q3CA 2HSDA 3D3WA 1YQXA 2AMFA 1KVUA 4DLLA 5A3VA 1R16A 4A27A 2CD9A 2OGUA 4ZRMA 4F6LA 5U9CA 2P2SA 4IJUA 3B6ZA 3INGA 1E6EA 4CMEA 1GUZA 1XA0A 3B70A 5FI5A 4S1VA 4D79A 1PR9A 3VKVA 2X9GA 1C0KA 1E7SA 4TRJA 4XCVA 3H7AA 3DBHA 5JLAA 2IDZA 4KWHA 3H9QA 2QZ9A 3PYXA 4E5NA 3NDIA 3AUSA 5IDQA 3GC6A 3LC1O 1E92A 1VL6A 1ENYA 1SZJG 3DZGA 4CM1A 2J5KA 4U0JA 3LVFO 3MJTA 1HDOA 3AWDA 3B1JA 3PIIA 2EW2A 4ZU3A 3L6DA 3PZBA 4XDYA 3AI3A 1GD1O 2GRAA 3BMCA 4YXFA 1DHTA 5IXSA 3IKTA 2O48X 4MIOA 2WD7A 4ZQGA 4BKUA 3VPFA 1ULUA 1PJ2A 3T4EA 4BV8A 1WDKA 3IP3A 1DB3A 4CLOA 1Y9EA 3JYQA 1HRDA 3GUYA 1EVYA 3ASUA 1RPNA 5TT0A 3GHHA 4RORA 5EMHA 1ZEJA 1VJ1A 3TFOA 2GZ2A 3GZNA 5CPFA 3BTVA 3EK2A 1P44A 3AOEC 3DWFA 4PLTA 4ZGWA 3IQDB 5JC1A 5DZSA 9LDBA 4FJ1A 4YJFB 3DBRA 1UAGA 3NTRA 1ZZEA 4G2NA 3KYCA 4L73A 3O38A 3CXRA 4HFRA 1ISMA 4ND1A 1X7GA 1ZK2A 1CDOA 2O50A 1ZSVA 3GVXA 1W6UA 4O1MA 1AHIA 1IPFA 1HDYA 2G0TA 4W7HA 1V3VA 1SBYA 4L4XA 3UAGA 3PHJA 1B8PA 4E5PA 4CMIA 1H6BA 3DBRB 3NUGA 2UAGA 2EF1A 3ZWNA 5G0SA 4DLAA 3H3JA 3K30A 3DFUA 3M2TA 1T25A 4NR0A 3B1FA 3WGTA 3KSUA 1YL6A 4C4OA 3U4IA 3OECA 4PLHA 3SC4A 3KM0A 3Q1LA 2NVBA 1FDUA 5C7LO 3OBBA 1A7KA 3WNVA 1DIAA 2BGKA 4R51A 4J7CA 1ZMTA 2OP1A 4CUZA 3AY3A 5A05A 1NR7A 1BRMA 1GYQA 2Q99A 1EZ4A 3C1AA 5G4KA 5LCXA 3GDFA 5CEFA 2Y05A 1KYQA 1H9AA 2GDZA 4F3YA 1YWGO 1GUYA 4BNXA 5IN5A 1XWFA 3D4OA 2TMGA 3E5MA 2VRCA 3QE3A 3MOGA 6ADHA 1U2GA 2EKPA 3TJRA 5JXWA 3V2HA 2X0JA 2G1UA 1HE3A 5G4KB 5DP1A 3DOJA 5JS6A 4BB5A 1P1JA 4ZD6A 4DBVO 1EUDA 1YO6A 3UN1A 3KYDA 2ET6A 3MTGA 2VN8A 4KDFA 2C07A 4JN6B 3KHUA 4NFSA 3BTSA 1QXSA 2D4AA 4OQYA 1ZCJA 2HMTA 1RM4A 4ZICA 2I3GA 3LDHA 4QO7A 2W98A 4P4NA 1PQUA 2JCVA 2WD8A 1V35A 3OH8A 2PFGA 4UEJA 3OICA 5JDIC 4P38A 4R3NA 3DONA 3R0IA 1KVTA 3KYDB 2DUUA 2B4QA 3AI1A 2IE0A 3WTCA 2WTBA 4I9UA 3TZCA 2B5VA 3GLQA 3OEWA 3PYLA 5B37A 2X0NA 3HDYA 5JO9A 4OM8A 2CMDA 3L4SO 1NBOA 5ES3A 4BV9A 1ZW1A 4WCDA 1VJTA 4GGOA 5JDIA 1Y9AA 1T2CA 1PEDA 2JHFA 2FHSA 5LC1A 1I3MA 4GX5A 1SOVA 4UVDA 3SJUA 4ALKA 2C5EA 1ENOA 1Y8QB 5AXCA 4JBHA 4B8WA 2C29D 2Q3EA 1KEPA 1M2WA 3QLJA 4QQRA 4ZVVA 2NTVA 4A10A 2RAFA 4CMGA 1B0AA 4J90A 3WSWA 1BVUA 4Y6SA 3GAZA 3C7AA 4J7XA 1YQDA 3HQ4O 4MVJM 3DMYA 4HNGA 4J0EA 4RQTA 1GPDG 5BR7A 3STHA 3ZHYA 1V9LA 3C8MA 1TT5B 2ZQZA 3E5RA 1DFGA 3QVXA 1IB6A 5JDCC 5IN4A 3UXYA 1I2BA 3Q2IA 1A27A 4GVLA 1E1LA 3G1UA 4E4YA 1UAYA 3C24A 5JMPA 2H63A 2HRBA 2Q2VA 3KTDA 3A28A 4MVJF 3W6ZA 4NU6A 3RFXA 2VWQA 2SCUA 3T4XA 4PG8A 2ZYAA 1PJ4A 5B1YA 4FGSA 3K96A 2VQ3A 4A2CA 5B4VA 2D8AA 8LDHA 5JDCA 3KB6A 1M76A 2CDCA 1MXHA 4E13A 5G2OA 4BGIA 4IINA 3MJCA 1E3EA 4BIIA 1EBUA 1Y8RA 1C0PA 4OSOA 4RL6A 4Q3EA 5FI3A 1ZKMA 2GZ1A 2IODA 1Z7EA 2X58A 2NQTA 5A1TA 1LQUA 4I5GA 4CODB 4PFJA 1XHLA 4TRRA 1VI2A 4XD2A 1NPTO 3WGZA 1E3WB 2BFAA 2RIRA 4IIUA 1UXGA 4MO2A 2DPGA 1RM5A 1LDNA 1GQ2A 4BNWA 1PQWA 1RM3A 1JAXA 4FFNA 1Z73A 3RC7A 2B36A 1T1RA 3GN2A 4JGBA 3PWZA 4LRSB 2WYUA 1NASA 2XXBA 3H2ZA 3RUDA 2EW8A 1NFQA 3IOYA 1RJWA 1SNYA 4TMFA 2X86A 5DT9A 2PKQO 4JK3A 5G0TA 4CM6A 5KIAA 2D59A 2VNSA 3PLNA 1IL0A 1KERA 1U28A 1QYVA 4CUKA 1H94A 3O9ZA 2O23A 4BGUA 1LUAA 3PHIA 4MIEA 4AJOA 3ZCXA 3I23A 3COSA 4JX8A 1J5PA 3JQCA 4PLVA 3VZQA 1LSJA 2QYTA 2CUKA 5JW6A 4WLOA 3H8VA 1N2SA 3JQ7A 3DBVO 3WYBA 4GWGA 5JY1A 4R54A 5T57A 2D5AA 2AQHA 2A4KA 1HYHA 2Y1EA 1NWCA 3ETGA 1UUFA 3TDKA 3DO5A 5TSDA 3ADOA 2IYPA 4KP7A 3DXFA 4QT0A 5DCWA 3RKUA 5AOVA 2UVDA 1BMDA 3FHLA 1O94A 4Z0HO 1YDWA 4KTVE 3ZI0A 4RQUA 1WW8A 1DHRA 4NNJA 4ND3A 3ICCA 4A03A 3GF4A 3UFXA 3U3XA 3ZW9A 4YAEA 1F12A 4DBZA 4PLPA 3RFTA 2YV2A 1DSSG 1BG6A 4B3IA 5A03A 4MVJA 1JDJA 1YBMA 1JVSA 3EAGA 3HB4X 4J9UE 3LT2A 3FSRA 4XGKA 4B4VA 3GNTA 2E82A 2PNFA 1DRVA 1YB4A 1W4ZA 1ADBA 2W2KA 3LLSA 3V1UA 3LC2O 2RH8A 4JXKA 2EG9A 4PVDA 3F6YA 3GVIA 1GR0A 2NQ8A 4GI2A 4QECA 2Y1OA 3W4KA 3WWZA 2FPPA 3EW7A 3E9NA 3UUWA 1PL6A 5ICSA 2OHXA 5DF1A 3F5QA 3KOUA 3WJ7A 1H6CA 4NJMB 4WNIA 1YL7A 3H9EO 3KV3O 1ISIA 1CERA 1ZXLA 4CM8B 3KSDO 4JJFA 1P1HA 3EHEA 4J1TA 1YS4A 4B7XA 5H81A 4YT4A 1SB8A 2ZB3A 3G3EA 4Q3AA 4C7JA 1XR3A 2VUTA 3P19A 4PLZA 4M86A 4YAKA 1E6UA 1AGNA 4Q3NA 3S2GA 4XYGA 3DTTA 3FRJA 3CMMA 2VRCD 3PGJA 1E1NA 1Q0HA 4FFRA 3I6IA 3K2EA 3WSVA 3ZH2A 1PJCA 4EUHA 2LDBA 4Y67A 3D64A 1O0SA 5ER9A 3GVHA 3SXPA 2OP0A 1B3BA 3C1TA 1LLUA 4F46A 1UR5A 2JD2A 2VWGA 3OM9A 1J4AA 2VCYA 3RSHA 2CY0A 1VRWA 4L75A 2P5YA 4CM3A 1WAMA 3FF4A 3GK3A 1HSZA 1ONPA 4E6PA 3IKVA 4YQZA 4YR9A 2AW5A 1U3VA 5JCJA 3CZMA 5LDHA 5B4TA 3IUSA 1P1RA 1PL7A 2Q1WA 1R4MB 2JHGA 1MA0A 4KQXA 4CQLA 2HQ1A 2J8ZA 1NNUA 2A9FA 2FSVA 1PGOA 2YJZA 2VHXA 3M1AA 3VH1A 5IZ4A 2GN6A 4BO3A 4R5MA 1AHHA 5EQDA 4WCFB 4ZQFA 3LLVA 1MUUA 3K31A 3BHIA 1NWHA 2HMSA 4TVOA 5ER6A 2NV6A 2IEBA 2EGHA 4RZHA 4N5NA 4J1QA 5DNAA 2PZMA 4E2ZA 1WXDA 4QUKA 4E0BA 1R6DA 3HDQA 4MOWA 5A9SA 3RUIA 1GY8A 3V2GA 5FWNA 1YE3A 4XX0A 1R4NB 1NHGA 1PJTA 1GU7A 1ISGA 5HWSA 3DB2A 3K9QO 2WM3A 2HAEA 5JC8A 5AXDA 3L6OO 5A9SB 5IZCC 2Q2WA 4LRTB 1BXKA 2YQ4A 3PYMA 3JQFA 1NAHA 4IJVA 1ZSYA 3NGLA 1ZJYA 3SJ7A 5KVSA 3BMOA 3FWZA 4J4HA 3MZ0A 4BO4A 5TQVA 3PDJA 5C5IA 4OXYA 3W8EA 3CE6A 3TN7A 1ZMOA 4YACA 3HHPA 5KJCA 1IULA 2FR0A 1U4OA 5HS6A 3HNPA 3PTZA 1HKUA 3R6DA 1Z75A 4NBWA 3BMOB 5MDHA 4AJKA 4CLEA 3CPSA 2NTNA 2GN4A 4ZJUA 4JP3A 4JROA 1Q7CA 4TVBA 2ZB7A 3ZV3A 4EJMA 1R0LA 1YBAA 1IHYA 3AOGA 3FPLA 3I9OA 4UVIA 1LI4A 4WASA 5A3JA 4CLHA 2JL1A 4ALIA 2XF8A 3NJ8A 3P5SA 1LLQA 3AUUA 3FNGA 2DBZA 3RI3A 1EVZA 2E48A 3GEDA 4DRYA 4ZQBA 2WWRA 4A7PA 3PEFA 1SPXA 3WIEA 1ML3A 1XDWA 3IS3A 4XJTA 2FZWA 3QVSA 2X7HA 4FIZA 1A4UA 2R00A 2O3UA 4RVSA 2CF6A 3WOHA 3F1KA 1JLLA 3MWEB 4I9HA 4MP3A 2AEJA 4RPKA 5THKA 4KUHA 4W6ZA 2Y0DA 4K1LA 4BMVA 5L95A 1R0SA 2GR9A 4M49A 4WECA 1KC1A 3RBXA 4YT2A 1DXYA 3PXXA 3WLFA 5CDUA 4I08A 1DIRA 4NFHA 3RAJA 3WQQA 3DFZA 4N18A 4XB2A 4M1QA 3GGGA 4U8GA 1BHSA 4BO6A 2HMVA 3FNHA 1E3SA 4CUJA 4PN3A 3ONFA 3S2EA 4J7UA 2C7GA 5J23A 2I99A 3DZIA 5G0WA 7MDHA 1P33A 2OFPA 5I7VA 2ZTUA 1X0VA 1E77A 2D0IA 3M1LA 3OIDA 4RPLA 1DC5A 2BLLA 1A5ZA 3EYWA 4MVJD 4B3JA 3I9KA 1BXGA 4O5OA 5CP8A 3WGYA 3ZWBA 4BO1A 4BO9A 3L9XA 3QJ5A 1LXCA 1R15A 3F1LA 1TI7A 2J3HA 4PLGA 5I7FA 3DDNA 1XEAA 3VAZA 2P9CA 1DFIA 3H2SA 6LDHA 5HRUA 2YFHA 4QEDA 2X9NA 2GN8A 1PJBA 1EE2A 1QMGA 5DCYA 3CSDA 4WLVA 3ZGYA 4YPOA 5EL0A 3AFNA 2EKQA 4TQGA 3QIVA 1HZJA 3VVBA 5FEUA 3HG7A 4LISA 4CJXA 2Y1DA 3WGHA 3GGOA 1I8TA 3M6IA 2GZ3A 3TOZA 2F1KA 3JSAA 4BNFA 1I3KA 3ETEA 2HRZA 4GAEA 3BYZA 3NX4A 2I3AA 4ZHSA 2AEMA 4EJ6A 2C0CA 4N7RA 5U4QA 4EITA 1V6AA 1N8KA 2O2YA 3GOHA 4LSWA 1F14A 2J5QA 3MJVA 1ARZA 1N7HA 4MVJP 4CQMA 5TJ9A 1BDBA 3OIGA 3QP9A 1YBVA 1WPQA 1V3UA 3H4VA 3JV7A 3QWFA 3Q2KA 4RF5A 3QVOA 2ZIZA 1NPYA 3WDSA 4MKZA 5BNFA 4NHEA 3U4DA 3N74A 2G76A 5G0VA 2DU8A 2Y68A 3ANLA 1ONOA 2BMAA 4BL5A 3VZRA 1UP4A 5JAMA 4BNTA 2FPIA 4GKVA 2C59A 2DQ4A 3RC2A 2QIOA 4LMRA 2FOIA 2YQ5A 5CDTA 4FGWA 4R5HA 2AE2A 1QRRA 1V0JA 4IDEA 1QLHA 4RPJA 4DPLA 1ZH8A 5KVQA 4HP8A 2VZ9A 1XG5A 2BELA 1D8AA 2D1YA 1T4BA 5KNLA 1TLTA 4QTZA 3ZWMA 5JAQA 3K2BA 4IJKA 3G17A 1JW9B 1J0XO 1VPDA 3JQ9C 2F00A 5JCJD 3HJAA 4QSMA 3ZW8A 3I83A 2CNBA 2V6FA 3UCFA 3WXBA 1DRUA 5CFZA 3ORFA 3A1NA 2VRBA 3D3WB 3KRTA 1JWAB 3INTA 3GGPA 1VE9A 1UXHA 3H9GA 4D7AA 4I8XA 4JQCA 3JQ9A 4XQCA 3OP4A 2QRJA 4CM5A 2NLOA 2X23A 4HY3A 1EMDA 4YRDA 1GAEO 4Z3KA 3VTZA 2P4QA 5AVOA 4U6QA 2GGSA 1T2AA 3DBHB 3E9MA 4IDFA 1H5QA 1PZFA 2X9VA 1LU9A 4XR9A 4BVAA 4BNUA 4BNJA 1H93A 2AG5A 3CIFA 1GDHA 5T6BA 1UP7A 2YDYA 4FFLA 1Y5RA 4DMMA 2D5CA 2QYSA 2EERA 2G82A 3GUCA 3KVOA 1DPGA 4L74A 5THQA 2PGLA 3BMCB 2HJRA 1HZZA 2V7PA 4XIYA 3W4IA 1QR6A 3I6QA 2WD7B 3WMXA 1UDBA 3FPCA 2JD0A 4H16A 5KVVA 5HTOA 4JLWA 3O26A 3U4HA 4CLOB 1SEPA 5T67A 1B26A 4JBGA 1BGVA 1B7GO 3CTMA 3VVCA 4DWVA 3LSYA 2YHUA 2Y1FA 3TQHA 3PJDA 1IZ9A 3GZNB 1H9BA 3WGGA 4TZTA 3AOEA 4XGIA 2E37A 3PJEA 4QX6A 1CYDA 1F8FA 1FDTA 2BGMA 3IJRA 2HO5A 1Q7BA 3TZQA 4AJ4A 3IUPA 3S8MA 4R69A 1VJ0A 4IDCA 2JAHA 3EVNA 3AY7A 5L7TA 4LW8A 2PY6A 2V6BA 2NUAA 4DXHA 3KYCB 3OJ0A 4DC0A 5FF9A 1B15A 1TA4A 2E49A 4DIOA 4IZHA 1X0XA 4NU5A 4OOEA 5CDYA 4XYEA 4BKQA 4J6FA 2NNLD 4LGVA 4IQ8A 1T2FA 1KOLA 1DLIA 3UCXA 5I9LA 4CMIB 1NVMB 3KEQA 1KBZA 3P7MA 2O2SA 3GMSA 2H6EA 1CETA 1ZK1A 2CFCA 3H5NA 3QA9A 3VH2A 1NXQA 1PJSA 3F4BA 4LSMA 4YAIA 3IJPA 4CV2A 1PIWA 3I4FA 1PGJA 4WLEA 3BA1A 1LLCA 3ONEA 3NJ4A 4ZQHA 1DC3A 1ZK4A 5TJHA 4Z9FA 4XKJA 3K92A 1DFHA 4W99A 2JFFA 3EZLA 3DC2A 3GRKA 3UHAA 2E6UX 4ALLA 1E3IA 4R1TA 4AJNA 4KMSA 5BT9A 5GZ6A 4E5YA 3GNSA 2PLAA 3U0BA 1ORRA 3H9JA 3EY4A 3GN1A 4YWJA 3BTUA 4IM7A 2VHZA 3AU8A 4MP6A 3W8FA 2Q4BA 1GPJA 1Z45A 1NPDA 2D3TA 3D7LA 2QZZA 3HFGA 3JQAA 3GA0A 3VDRA 5ADHA 1EFLA 5DN9A 1I30A 1GADO 1PQPA 3OJOA 3V8BA 3ZNNA 4OSPA 1MV8A 5I8ZA 4NBVA 3HDHA 3LF1A 4YVFA 4DREA 3QHAA 3UKOA 2X0IA 3Q9UA 3MTJA 3WMWA 4AJPA 1K6XA 1B2LA 1VKOA 3KLPX 2EXXA 4D42A 2Y1CA 3PPIA 4I5FA 4MVJG 4A0SA 1N5DA 2VZ8A 3D4NA 2BFPA 1GV0A 4WLUA 1K5HA 4YJDA 2J3JA 4EW6A 4R68A 4MP8A 1MLDA 5DCUA 1R0KA 2PWZA 2UYYA 1U8FO 1DAOA 4DUPA 4IS2A 5DULA 2DBQA 1HDGO 5F3RA 5JCXA 3IMFA 1X7HA 3LT4A 1I2ZA 2YDXA 1XLTA 2GASA 1JKIA 2H1SA 4EYEA 2OZPA 4EEXA 3MCVA 4Q3CA 5IDYA 3GFGA 4HWKA 4FCCA 4J49A 2B83A 2NVWA 1HT0A 5I9MA 3VDQA 4WPGA 3GVPA 4AJJA 1HYGA 2JJYA 3OJEA 1NVGA 3LZ6A 1C14A 3RUEA 4E2XA 2P68A 1A9YA 1PZEA 5L7YA 4CQMD 3JD4A 1ZBQA 3PDUA 1EBFA 3C1OA 3BHJA 4J4TA 1E7MA 2CF5A 3FI9A 1CQJA 3NT5A 4GMGA 4Z9XA 3L77A 2HU2A 2NU9A 5JE8A 2PGDA 3I9JA 1MC5A 4J0FA 3B20A 3ROPA 3WBFA 1P9LA 3TFQA 1HLPA 1D1TA 1X14A 1F8GA 3NKLA 2BH9A 3I5MA 4FFOA 4K28A 4DIBA 5BSFA 3V5NA 5ITVA 3JQBC 4GGPA 1VC2A 3RVDA 1BDMA 1XELA 4JJGA 2YW9A 1OOEA 3GY0A 1Y8RB 5A5FA 5IDXA 4OL9A 3TZHA 4NPCA 1KC3A 4BO5A 1IE3A 4L0QA 1LBEA 2YHIA 1A7AA 2DT5A 3RUHA 1DO8A 4MINA 4Q3BA 1XSEA 1PS0A 2OUIA 3I9NA 4Q9NA 4FJ2A 3W4JA 3RBZA 2GD1O 3JQBA 1LSUA 3A14A 3KO8A 4NI5A 5F5LA 4OYRA 3E18A 1LDYA 1YDEA 2CVQA 2FWMX 3ENKA 4XEHA 3BHMA 4BNYA 1QYCA 1ADGA 3QSGA 4XYLA 2AQ8A 4RDHA 3WG9A 1Y81A 2DFVA 4KOAA 1TB4A 1LC3A 4ZN6A 2ILTA 4FJ0A 5IDWA 1P1FA 5KKAA 1L1FA 2WE8A 4RPGA 3I52A 1I0ZA 4FPXA 3FWNA 4BO0A 4KTTE 4GWKA 2A94A 2QQ5A 3AM4A 2BFMA 4B4UA 1VLLA 2HJSA 4JCOA 2PGJA 4Z9YA 1KVQA 2P91A 1I3LA 2PK3A 2O3TA 1YOVA 2W2LA 4XB1A 1OFGA 3HWRA 1VKNA 3JQ7B 4HV4A 4RF2A 5ILOA 3VH3A 2YV1A 1EQUA 1YVEI 3PFWO 5BSEA 4OKNA 1K2WA 3T7EA 3DAGA 4YBZA 3WLEA 4FFMA 2E4AA 2Y66A 3AM3A 4K9DA 4QXMA 3VKUA 2JKVA 2I9PA 4HKTA 4D0SA 2Q1UA 3ZV6A 2X6TA 4IUYA 5LDGA 2B0JA 2W8ZA 4BUCA 5KVCA 4E12A 1H6AA 1Q1NA 1FXSA 1K0UA 1HWYA 4YT8A 1P1IA 1WLYA 1XIVA 5I9NA 3ZNPA 5EERA 3OMLA 4RVGA 1YL5A 3QWBA 1LRLA 3GDGA 3L4BC 1X15A 2ZJ0A 5COBA 1IZ0A 4BO2A 4BNGA 3F47A 1RKXA 1V3TA 2ZQYA 4GLOA 1LDEA 2AA3A 4RVUA 1NQAO 1KY5A 1SMKA 3GHYA 1GV1A 1YONA 3GG9A 1NFFA 2Q1SA 3L4BA 4O6VA 2W2KB 1UP6A 4N5MA 1CQIA 1LQTA 2DUWA 4ZRNA 5H83A 3F3SA 1NTOA 3G49A 1TXGA 5TRTA 2DFDA 4Z0TA 4IDBA 1U3WA 1HDRA 3QY9A 3N7UA 4GX0A 3RD5A 1W0CA 1BW9A 1FK8A 1PTJA 3E9QA 4Q39A 1OC4A 4BQRA 1G6KA 3WGOA 4BNIA 4EEZA 4WNCA 5CDGA 5JO0A 1EUCA 4P8RA 4NMHA 4Y98A 1FF9A 4FN4A 3SC6A 2I76A 3Q11A 5CPBA 5GZ3A 1WVGA 4CMBA 5KWEA 3GEMA 3KLMX 1BW9B 1BSVA 3K5PA 1Y6JA 2B4RO 4UVHA 3E6AA 2AQIA 5T64A 4LMPA 4M54A 3JQAD 4WLNA 4BNVA 1VM6A 3PK0A 2UDPA 2WMDA 4MIYA 2Q50A 3ZZNA 2B4TO 1AUPA 2RCYA 1ZK3A 5TC4A 1P1KA 1HE4A 1GQQA 3ABIA 4IPTA 2PD3A 2Q46A 3LT0A 3PQFA 2NVUA 3WNQA 2C5AA 4HFJA 3DAPA 4D3SA 1M75A 3NYWA 3P2OA 1T2DA 2GPTA 5I8WA 4EBFA 1DBVO 3EGOA 2O3RA 2HK8A 2X5OA 3B1KA 1E1MA 4B4WA 1EEHA 4J2OA 4XR4A 4M8SA 1X13A 4OOFA 3O8QA 1MFPA 2I5PO 2NWQA 2V6GA 1NP3A 3PIDA 3KBOA 4GKBA 2O4UX 4DVJA 1WDLA 4WEOA 4XQ9A 4AJIA 4EGFA 5DOVA 4I5EA 1K89A 4DTIA 3I1JA 1WMBA 1EK6A 4LVCA 4CQLB 2IXBA 2CDAA 3BMNA 7ADHA 4JIGA 3EMKA 2I6TA 3L0DA 1BTOA 2PZJA 2PKQP 4PZDA 3IC5A 5T5QA 2B69A 3JYPA 4AJHA 5EN4A 1I5RA 4ROSA 3FBGA 4D45A 4TKLA 1GYRA 1Q7GA 1C1XA 4KZPA 1GL3A 3GDOA 3OJFA 4FQ8A 3W8DA 1SOWA 5JFOA 3MJSA 2DBVO 1J49A 2Y67A 3JQ6A 4GSKA 1C0IA 1SO8A 4JNKA 5TS3A 1N9GA 3WFJA 4D44A 3QWIA 3ICPA 1RM0A 2EJVA 3V1YA 2NU6A 3MJEA 4QO8A 1HSOA 4BNLA 1O95A 2X22A 3OQ1A 2FZEA 2QX7A 4DYDA 1Y1PA 3HB5X 4GX1A 1MP0A 5MGBA 2VTEA 4ALJA 5COQA 4D3FA 5IZCA 1X1TA 5TGDA 2VUUA 4HBGA 3WYEA 2PZLA 1C1DA 4D0RA 1MG0A 1EE9A 1YGYA 3Q6IA 5F21A 3LF2A 3TZ6A 2IZ0A 5GY7A 4UAGA 3WX0A 4IDDA 3S2FA 2CDBA 3PHGA 3GG2A 4II2A 2FR1A 3ZWYA 4J3FA 4UVGA 4IMRA 1YJ8A 3OA0A 4PLCA 2YUTA 2VWPA 3U09A 1C1DB 5CHEA 3RJ9A 2FPGA 1GZ6A 1PR3A 2AHRA 3WQRA 1QORA 4D41A 1E7WA 3NDJA 4NJOA 4BO8A 3K6JA 4UREA 5DOZA 4L76A 5L40A 1EFKA 5H82A 4INAA 3DHNA 2PH5A 4PLYA 2NSDA 1SAYA 1OI7A 1SC6A 2FRDA 3CEAA 1H6DA 1F0YA 4UUMA 4W9NC 3TRIA 3ITDA 2RBEA 3HUDA 4H3VA 3ROKA 1NFRA 4J91A 4GPD1 5A5EA 1KEWA 3U5TA 2VNAA 4E21A 1X7DA 3DZBA 3ZV5A 4OJNA 1BXZA 5A06A 2V65A 4FOOA 4W4TA 4BGEA 1U7TA 4CMJA 4R1NA 4DA9A 2BHLA 5L51A 1IYZA 3W6UA 2W2LD 4FFPA 4J4BA 1ZEMA 1HETA 4IS3A 2AQKA 4PGFA 4HNHA 1ZSNA 5KCZA 2ZCUA 1Z82A 3ZU5A 5KOIA 3ZWVA 4AJ2A 1S6YA 3NEPX 1E3JA 2XXJA 5ENDA 4PZCA 3F9IA 2ZJ1A 2EGGA 2VTDA 2OMEA 3RUFA 1LNQA 2JFGA 2DC1A 3PHLA 3CUKA 4ILKA 5L4SA 3QV1A 3A06A 1IOLA 3IL2A 2EP7A 4X54A 3SVTA 4YRAA 3N58A 4FC7A 3NDRA 2ZATA 2XAAA 1CIVA 2NM0A 3BAZA 5TNXA 2DBRA 1ENPA 3AI2A 4TROA 5TX7A 2CVOA 2OBYA 1M6HA 3Q0EA 1UDAA 3JQ8A 4IXWA 1B8VA 1BXGB 5ILGA 1PJ3A 3AJRA 4CMAA 3RU7A 2R6JA 4L4RA 4LN1A 3WR5A 2A92A 3NT4A 1QYWA 1UJMA 1XCBA 4XZ3A 5L9AA 4M89A 2Q2QA 3QWAA 4YTEA 2X4GA 3X2FA 4N54A 1R12A 1N92A 1XU7A 2PV7A 4JJIA 1QYXA 2ZYDA 1DLJA 4OH1A 1NQTA 5K9ZA 3ASVA 1EDOA 2IZ1A 3U49A 1XYGA 4IXTA 1EDZA 3DZKA 2TMDA 1P74A 4NK5A 4F45A 1E7QA 4OHUA 3RJ5A 3HN2A 4PIVA 2DPHA 3D3EA 4U0KA 4CR6A 2ZB4A 3X2EA 4IZIA 4G81A 3JYLA 1A72A 2HMUA 1HL3A 4NDNE 2ZCVA 5EESA 5F1PA 4IDAA 3S55A 1DC4A 3GFBA 4HFNA 5BSGA 1P31A 4CQMB 2A35A 4E2WA 3LYLA 3WTBA 4PRLA 1HLDA 1PGNA 1MX3A 4NFYA 1I24A 1FDVA 4GLLA 4PG4A 1CJCA 4NIMA 3FCOA 3JYOA 3RC9A 3VPXA 4B79A 2YV3A 3RWBA 3UOGA 1U9JA 2D2IA 2GF2A 4CLDA 2EKLA 3QW2A 4B4OA 3ON5A 4DPMA 5KJFA 4XWYA 2JCYA 5C7IO 3H5RA 1Z74A 3I3OA 4ID9A 2X5KO 3AUAA 4TZKA 2C2XA 1BVRA 1DAPA 1C0LA 2ZTMA 4DL9A 2UUOA 4FR5A 1JAYA 3PJFA 3C7CB 5K0ZA 3DOOA 3F46A 2ZTVA 4CMCA 3RROA 1MB4A 1OC2A 1H2HA 4BNHA 4JBIA 1CWUA 3VTFA 2XPCA 3OSUA 3G0OA 3ZWAA 3AU9A 1FJHA 1LRJA 1Q0QA 2VOJA 5FFFA 4DQXA 2C7VA 1NQOA 3I9MA 3LU1A 4RPHA 4UUNA 1I2CA 4E2YA 1I32A 4AFNA 1DC6A 5EQFA 1LLDA 1KY4A 2GYYA 3OA2A 5A04A 4K6CA 1GZ3A 1VSUA 4GMFA 4CL3A 3D4PA 4EDFA 9LDTA 3HN7A 4BB6A 3NGXA 4R9SA 3E82A 1D7OA 2OBNA 1GYPA 4AL4A 1PJLA 3FTNA 2J5RA 3GEGA 2Y99A 2DTXA 2QRKA 4E5KA 8ADHA 3ROMA 1A9ZA 4DPKA 3ULKA 1MC4A 4GX2A 3HDJA 1L7EA 4ESOA 2AXQA 2LDXA 3QVTA 4OO3A 3M2PA 3VHRA 1E0DA 3OQBA 4PZEA 3VPHA 3GMDA 4UEKA 4G5HA 4E31A 1PU2A 3HSKA 4ND5A 1QYDA 4JP2A 4O0LA 1I3NA 5C7OO 4BKPA 1T4DA 4XRRA 1E3LA 1U1IA 1I10A 3OFSA 2FSSA 4OIMA 3JD2A 3GR6A 4PG6A 4YJFA 3PWKA 1WDMA 3HZZA 3ZDFA 4D46A 4BNZA 2AE1A 1YB5A 1ENZA 1G1AA 1L7DA 4MJLA 1UZMA 1DOHA 1JQBA 1U2DA 1JN0A 3A9WA 2Z1NA 3K73O 1FDSA 4IQ0A 1BWSA 4BNMA 2OO5A 1B16A 3H5AA 4GH5A 4ALMA 5AQ1A 1JWBB 4RCVA 3WIDA 3IAHA 2WDZA 3FBTA 3MWDB 4GVXA 1RYDA 4NG5A 1O89A 3RUAA 3IIEA 4O63O 1YH3A 2VZ0A 4CLRA 1M6WA 1ZFNA 2J3KA 2WJPA 2ZKLA 3PHHA 3Q9NA 5DDIP 1WNTA 4FSHA 5B12A 4NBRA 4P4GA 4YAGA 3O4RA 1EK5A 1PS9A 4WGGA 3HFSA 4RLSA 1U4SA 3WYCA 5I7SA 2HDHA 5A4DA 4CLRB 4FDAA 1IHXA 1U3UA 1IUKA 3PWSA 1ZUD1 4W7IA 3GNQA 2O7QA 1T24A 5EINA 4CMHA 4Y9DA 4CMKA 1J6UA 1YB1A 4MVJE 5L3ZA 1M66A 1OMOA 4WKGA 1EVIA 3PRJA 3EUWA 1GFSA 5EPOA 2NU7A 5JAZA 3DR3A 2VWHA 1SCUA 3NRCA 5JY6A 1TT7A 2O7SA 4AJ1A 1ZIDA 4BKOA 2Z95A 3ADPA 4KDEA 4RO0A 5KJEA 3JCZA 1WZIA 3VH4A 1YKFA 5C3MA 3TNLA 2C20A 1OZAA 4Z6KA 2WYWA 3WJAA 1K3TA 3VZPA 2QG4A 1E1KA 4IGFA 1HE5A 3JD1A 2GUGA 4EUFA 5TIIA 1EVJA 3K8ZA 1Q2XA 3UCEA 2DAPA 4U5QA 5JSFA 2YY7A 3ZWWA 2WYVA 1ZJZA 1ZXBA 1JU9A 3JQAB 4WEQA 3JTMA 3ZHXA 1CF2O 1WZEA 3WWYA 5F1KA 3D5QA 3G79A 3GPIA 4XQGA 2IXAA 2JAPA 2OOSA 1PZGA 4OGWA 3T7CA 5A9TA 3TWOA 5IAAA 3KUXA 2JD1A 2EIHA 2X5JO 4AG3A 1VL0A 4U7WA 1MFZA 4MKRA 1UDCA 3H3FA 1AN9A 1VSVA 3UICA 1DJQA 1P3DA 5FYDA 1Y8QA 1KEUA 2PH3A 2FP4A 3G1TA 3PFFA 2EV9A 4CM9A 3F5SA 5AXAA 3C85A 1U8XX 4OXNA 2C82A 4AJLA 3IP1A 4R1UA 2DM6A 5JPIA 2W90A 3OETA 1O9BA 2BGLA 1YJQA 4CL8A 2DTEA 4CM7A 1TT5A 4IIVA 3R3JA 4ND4A 3ZU2A 4II3A 2FN7A 3GRPA 2X8LA 4HADA 1LDMA 2NACA 4F6CA 4OXKA 4DYVA 4WK6A 4GQAA 4XGNA 2HUNA 3DZFA 4DIFA 4YRBA 1QSGA 4RVDA 4QFCA 3MJ4A 4Q3DA 1E7YA 2HKIA 5GMOA 4CV3A 4L9RA 4RF4A 1QV7A 4OQZA 1OAAA 5CG1A 1DEHA 4R9RA 2GLXA 3SBOA 3GAFA 5JAIA 3FNFA 3RU9A 2BI8A 4XDZA 3VOSA 4OMUA 3L6EA 3WBBA 1N7GA 4M87A 5L4LA 2Y1GA 4YJGA 1N1GA 4N5LA 2WE7A 1NAIA 3DTYA 3OIFA 4NZ9A 5HM8A 4ALNA 4CV0A 4DQVA 1JTVA 3WFIA 4FW8A 3VZSA 2CVZA 4K6FA 4YCAA 1E3WA 1LC0A 5BNIA 3AY6A 1LX6A 3H9UA 1NVTA 4UULA 1HTBA 3QQPA 3PI7A 2Y0CA 1V8BA 3BMQA 1KETA 2HK9A 2C2YA 1K6JA 2Q4EA 4YJGB 1NR1A 2XOXA 3DZHA 2IYOA 3FD8A 5DP2A 3V1TC 1GEGA 4H15A 1D4FA 1ONNA 3ST7A 5BQFA 1LEHA 2B37A 2BRUA 1UH5A 2DLDA 2P4HX 1O6ZA 1MXFA 3H65A 2YHIB 1R37A 1YQGA 5L45A 3BMQB 3GVCA 2Y93A 3TPCA 3ZWPA 4C7KA 3ROQA 4RDIA 2RHRA 5U1PA 4B8ZA 5KJ1A 3DL2A 2FMUA 4CPDA 3ZNQA 4K26A 3RIHA 4AICA 1DIBA 3RC1A 5I7EA 5COAA 1LSSA 5TF4A 2W4QA 4RLHA 2BI7A 4PLFA 1JKFA 3LK7A 1IY8A 2IRWA 4B7UA 4J2HA 4TRMA 4ONEA 3ZN2A 1Z6ZA 4E33A 4ZQEA 4R16A 1O5IA 5JYEA 1U5AA 3DEYX 3WGQA 4BO7A 2RHCA 3NAQA 1KS9A 3CINA 1WMAA 4WLFA 4PRKA 3I9LA 3PZRA 3LT1A 4R41A 5TT1A 1N1EA 3DZJA 4W82A 1C3VA 2PD6A 4A73A 2AEFA 1YOVB 2GERA 1LJ8A 1SEVA 2VUSA 2VYNA 2EHDA 4H7PA 3ZWCA 2ZTLA 3C3XA 4HX5A 4L4SA 3RASA 4AVYA 1U5CA 3IDSA 4E32A 1T2EA 2IZZA 3L9WA 3SLKA 5DBIA 1QLJA 1B14A 1ISJA 2QRLA 3LC7O 1TEHA 3PGXA 4TWRA 1Q0LA 3KXDA 4YEDA 4WOKA 3RQSA 1YRLA 4YT5A 5KJ6A 3BTOA 2P5UA 4PG5A 4WOJA 4NBUA 1CEQA 3FN4A 4I9NA 2BFOA 3AK4A 4RZIA 1F06A 2EEZA 4YQYA 3TOXA 2VT3A 3TL3A 4URFA 1DIHA 4DQUA 2O3JA 4HFMA 3V2UA 1XKQA 3A4VA 1GZ4A 4IQGA 5HBRA 2UUPA 2VYVA 2PKRA 3ONDA 1NQ5A 4UUPA 1SB9A 4NJMA 3UW3A 4CM8A 4BNNA 1LDGA 3FR7A 1UZNA 2ZB8A 4NBTA 1B3RA 2BF7A 4RVFA 2Q45A 1PZHA 1KIFA 2B35A 2I65A 3EDMA 4YA6A 4UUOA 4RF3A 3E03A 1NYTA 2X0RA 4YYZA 1ISFA 4PVCA 1GTMA 4YB8A 1I36A 1P45A 4D43A 2YFQA 4CV1A 2P9GA 1GUFA 4FC6A 4OKIA 3UGKA 4S3MA 2Z5LA 4GSLA 4R4JA 3GZ4A 1JVBA 1TVEA 3TSCA 1P77A 1LDBA 4RVHA 3WICA 5IJZA 1T26A 4FBGA 4WJZA 3CMCO 3LQFA 1ADFA 4BQPA 1HXHA 1U3TA 2VOEA 4J1NA 3R1IA 4HUJA 3VPSA 4BS9A 5HS4A 1U7HA 2X1HA 4RV9A 2VHYA 3PVZA 4WUVA 5JNLA 5K6AC 3EZYA 2FR8A 3FTPA 3DHEA 2VT2A 4P4LA 3ANNA 2HK7A 2O3QA 3QWHA 3EC7A 3UH1A 2EWMA 4CR8A 1PL8A 1A4IA 5F5NA 1KEVA 5CEJA 3E8XA 4FB5A 1XU9A 5K6AA 3PQDA 3GT0A 2NADA 4WCFC 4A26A 4E30A 3UVEA 3DMTC 2NU8A 1Y5MA 4L8VA 4GBJA 4KUEA 1R4MA 1HE2A 3NV9A 4MPDA 2BKAA 3NTOA 4XA8A 2NVUB 1M67A 1WP4A 5AYVA 4EJ0A 3CH6A 2R2GA 3OHSX 2G17A 3MOIA 3JD3A 1S7CA 3GQVA 1A71A 2HMWA 4DLBA 1OBFO 4WCFA 1JKJA 1W8DA 3DMTA 1FMCA 4OAQA 4CM9D 1DJNA 1I33A 1WWKA 5B4UA 4QFDA 2Z1MA 3O8QB 4PLWA 2GO1A 3ZWOA 3DAFA 4IDGA 3UF0A 3AM5A 1W73A 3BZUA 1R4NA 3KSZO 3SX2A 1EQ2A 3SEFA 3TZKA 5CEEA 5TLSA 4DMLA 3NT2A 2YZ7A 1LA2A 1KVSA 3BMNB 4MVJH 4CR7A 1LRKA 2HCTA 4BGVA 3ENNA 4B7CA 4MDHA 4LCJA 3JQDA 4EUEA 4MVJI 1P0CA 1ZK0A 3KETA 2I67A 1HDCA 3BXXA 1C1XB 3OQ6A 3ZV4A 5ENVA 4Y6PA 3S1LA 4AJEA 4J9VA 5ITWA 3JQFC 2UV8A 1ULSA 4BOYA 4BKRA 4FS3A 1N9GB 3JQEA 2POQX 1GEEA 3KEOA 5CAEA 5G4LA 2QW8A 1PWXA 2O4CA 3PQEA 3ZHZA 2GCGA 2NTJA 4IY1A 2WSBA 2EP5A 1H2BA 3DBLA 3WS7A 1ISHA 3OEYA 1PJQA 2IEDA 3QVWA 2VHVA 1D1SA 1D3AA 3RCBA 3AUTA 2QHXA 2J6IA 3FNEA 5DBFA 4XJSA 5L4NA 3D5TA 3HE3A 4Y6RA 4TKMA 1FDWA 3R3SA 2GSDA 4G65A 1HEUA 3DBLB 1NM5A 4BMSA 2CZCA 4J16A 2DVMA 1MG5A 3U4CA 1RYEA 1UZLA 3KZVA 1NHWA 3EVTA 3E48A 3JYNA 1AXGA 2P9EA 3O03A 3CZRA 4YDRA 1RWBA 5IG2A 1EUZA 3I4CA 3DOCA 5GZ1A 4I1IA 1PX0A 1IPEA 3WQSB 5F1OA 5A02A 1PSDA 1GCOA 3WGIA 5CG2A 4Z0PA 1NX6A 4TSKA 4EZBA 4J43A 4KQWA 1QV6A 2R00C 3HADA 2Q49A 3W1VA 5BSHA 1Y7TA 5EJ2A 1G0NA 4IBOA 1PGQA 3D1LA 2CSUA 4W9NA 3ETDA 5IXYA 4XIJA 4IMPA 2Q1TA 4D3DA 5ICMA 1HDXA 5KTKA 3GH3A 1E5LA 4M55A 3DQPA 4BHTA 5IFLA 1DIGA 1E5QA 4PCVA 1LTHR 2JFHA 4R01A 5EIOA 2I66A 1HYEA 4EI2A 3OF2A 1XGKA 3WB9A 4LVUA 2PA3A 2ZYGA 2GNAA 5CDSA 2FY8A 4Z3DA 4KWIA 5HA5A 3BIOA 1VL8A 1X1EA 5BNTA 5KKCA 4XYBA 2VYND 4R1SA 1UXJA 1H0KA 1B8UA 4FD3A 2H9IA 4I5DA 1ZNQO 3ANMA 2YYYA 3VPGA 5IF3A 4UVEA 4E3ZA 3PP8A 1QG6A 2DKNA 2O3SA 2OL4A 4GL4A 1XQ1A 2H5LA 4PG7A 2C54A 4NK4A 2JCXA 3QRWA 1ID1A 1DDOA 1AXEA 1UXIA 4CM4A 2PZKA 2OORA 1QP8A 4ZA2A 1YXMA 1G0OA 2VHWA 4YJHA 3GPDG 1F17A 2Y0EA 1HDZA 3AFMA 2RH4A 4MKXA 4IJWA 4U6SA 4O59O 2GN9A 3TL2A 3ITKA 2ZK7A 1QKIA 4Y8VA 2V6MA 5JMWA 2VYVD 1ADCA 3RUCA 5L7WA 3U62A 4CM4B 4P22A 1GQYA 3NTQA 3ZU3A 3DHYA 3JQ8B 4XYMA 5DBGA 3TF5A 3F4LA 2PR2A 4YJHB 4XRGA 4DC1A 1CRWG 4HXYA 4NQZA 1I01A 4TRNA 2WEKA 1GCUA 5C37A 2G5CA 4NH4A 4B3HA 5L53A 3INRA 4UEOA 2B5WA 4LCEA 1XQ6A 2DTDA 3ZNOA 3S2IA 3JQGA 1PWZA 3KYBA 1JA9A 1R66A 3D0OA 4IGEA 4BMNA 3E1KA 3C7DB 2BD0A 3P2YA 3MEQA 3PLRA 3PJGA 1MGOA 3H6KA 3OJLA 5JYDA 1Z7BA 1DRWA 1LSOA 5T8KC 2HLPA 4CLXA 1ZVMA 1P0FA 2EJWA 4R3WA 4RGBA 2OXIA 3ZU4A 3JD0A 3VC7A 4ND2A 4FOSA 3RKRA 3RFVA 5G0UA 3SLGA 1PGPA 3ZWXA 3JQGB 4RJTA 4E5MA 4YAJA 3AW9A 2PD4A 4ITUA 4DGSA 5T8KA 5JBIA 4LK3A 2J3IA 1K6IA 3U9LA 1E7RA 3FR8A 1KVRA 1ZO8A 1UXKA 3L07A 4J1SA 2PTGA 5A9RA 1T1SA
chains in the Genus database with same CATH superfamily
1BQEA 2C1XA 2IHVA 1HF3A 2AG8A 2EZ8A 2LKCA 1I2MA 4FE4A 1JJVA 3LBIA 1DX9A 4FSDA 4UE6A 2M1ZA 5MFPA 1VCMA 2C94A 1L4YA 3KFLA 4NP6A 4ZZ2A 4A5OA 1G8GA 1QIIA 3ORRA 1SXHA 2BBSA 3T7SA 4NZYA 3ZHBA 4HQ0A 4BPBA 1NE7A 5FPKA 1YZKA 2HA3A 3P9YA 3U6KA 3UPTA 3ANYB 4CF6A 4DEXA 3Q3CA 1G21A 3VU9B 1J2RA 1Z34A 2HSDA 5TMEA 1N75A 2R1TA 2O14A 2H48A 3OFJA 4F6LA 4A27A 3L49A 5AVVA 5U9CA 3HXTA 4UDOA 5E2AA 2J3MA 3KOYA 4Y9RA 3U31A 2HQSA 3WL6A 4XWWA 1BFKA 2D1RA 4K9SA 1QOPB 4DT1B 1E9FA 2MYNA 1XA0A 5CH3A 1DZIA 4RMJA 3ZDDA 2XT6A 2WSSA 2X9GA 3VKVA 5AJHA 1Y9ZA 1HORA 3CNHA 1G21B 1L9XA 4E1VA 4J75A 3QTBA 4E5NA 1CY4A 4YALA 4QUIA 2YUIA 3AUSA 2YMLA 3NWBA 3GC6A 3EZ7A 3WLPA 4D9MA 5ALVA 1PT7A 5IDQA 1SZJG 4CM1A 2FH5B 5KTYA 1VYTA 1OXUA 1SCIA 3H5WA 3HCDA 1EHYA 2HLDD 3M9XA 1ZRMA 3ASYA 2H9AA 2BVNA 2QB5A 1HDOA 3AWDA 4EIWA 1L7VC 3L6DA 4ZU3A 1Y82A 2R25B 5EZ5A 3D3KA 3DVQX 1TFUA 2AUNA 2DPXA 3BMCA 3U39A 1DHTA 4EA8A 3B48A 2O48X 4MIOA 2WD7A 4ZQGA 3ORSA 1A88A 1C7EA 1ND5A 3EVBA 4DLWA 2VTVA 4BV8A 4JLBA 1YKGA 3LKZA 4G23A 3GUYA 2FSIA 1A95A 5JVDA 1RPNA 1A9RA 2FUKA 4KGDA 3TSWA 5EMHA 1U8TA 3H18A 4H7FA 2C5FA 3OAAA 3I4LA 3UOWA 4LPKA 1UT8A 1E60A 1QV9A 1P44A 3AOEC 4EW2A 5IKPA 3ICQB 2JK0A 5DZSA 1N7JA 3FDZA 3UXHA 1NUUA 2OGSA 4C2AA 4XWGA 1DIOB 1MNAA 2ZAYA 4Z7QB 5JVDB 3K2IA 1OW3B 2P9TA 3HVRA 3AWIA 1QPBA 3K8YA 3FHCB 2X9QA 3ABQB 3WK5A 3IERA 3LPNA 3NUQA 3O38A 4MV4A 3TQIA 1LPOA 4HFRA 5F23A 2YIJA 3I2IA 1ISMA 3O93A 4H60A 3Q88A 2V3CC 4F6RB 3BN3A 3WB0A 1JDPA 1RJEA 3CKLA 3HYSA 1IPFA 4IVRA 4J29A 1P3Y1 1YS1X 4O1MA 5DLYA 5IAGA 3FDZB 4F11A 5A5VA 3CGWA 1LJLA 3GROA 1DO0A 3PHJA 2NXJA 3AZQA 2ATXA 4KXXA 5I4KA 2WIDA 3HDVA 2BC9A 2I1LA 5EIWA 1SXJA 5BSTA 2I7XA 3IAS6 1IZZA 3H3JA 4AKGA 3DFUA 4QTTB 4JZKA 5DU2A 1IBLB 3HR7A 1YJXA 5FWXA 1GGNA 4U7PB 3TIFA 1T4MA 2BEWB 5DNVA 1VL1A 1Q3TA 2E21A 3KM0A 3UG7A 4DG8A 3FTCA 2VLIA 5IPFA 2V59A 3OBBA 4L5BA 4Z4EA 1A7KA 4KMMA 1KFCB 3FVWA 5UKDA 1JB1A 4A16A 2ZSFA 2GKSA 1UKAA 3O75A 4R51A 1SXJB 3AY3A 4LGCA 5HXAA 1GZUA 1M2EA 3AESB 3FPHA 5G4KA 1ATIA 2QUAA 1PO7A 1KAEA 5IANA 1IVNA 1X1BA 2HWKA 3A27A 3DL4A 4BRUA 3U3JA 3O2SB 4UNRA 5KOJB 5AD1A 4I46A 1YWGO 4OXRA 1X1SA 4OQNA 2JIDA 4B81A 5AW9A 4LQCA 3SQWA 4J7AA 4L0DA 4R0VA 1XWFA 1AGRA 3C7KA 5BQ5A 3D4OA 3AH8A 5IN5A 3RFCA 1Y7IA 4AZ0A 3QE3A 1KIAA 5F12A 1P6QA 3NEYA 3JX9A 1Y3CE 4CFSA 3TJRA 2NU7B 5KAPA 4IYJA 4YROA 2K7FA 3QX9A 4FDUA 2WJ4A 1HE3A 2XUGA 4EY8A 5G4KB 6PFKA 3UMJA 5BUSA 4DBVO 5AW2A 2MT9A 1EUDA 4I3FA 2ZJ5A 3LIIA 3Q12A 4JJEA 2VJDA 1PG5A 3KYDA 1EFRA 1SVSA 1NBMD 4FEYA 3AEUB 3FH0A 3M3PA 2J33A 1KTVA 3KHUA 1QXSA 2D4AA 3N6XA 4V0OA 3VR6D 3FDIA 1RM4A 1S0UA 1WNFA 3IALA 3KEGA 4RQAA 5IJ9B 4BFSA 4P98A 1TTHA 2JCVA 1PJ8A 1EUDB 2BY4A 2PFGA 2VSNA 2H18A 4GM4A 3U80A 1YIAA 4DJAA 2P3LA 3PRKE 3IAAA 3KYDB 4GI7A 4IWNA 4CNQA 5DE3A 4ZCMA 2QN7A 4M9XA 4B3RB 2WTBA 1GNTA 2UYGA 4DA0A 3ZWQA 3R5TA 2HA2A 3DV2A 2F64A 2FX5A 3KQWA 4AN4A 3Q41A 1UF9A 5FPSA 2Y6UA 2J7PD 1SHKA 2CMDA 1X42A 4WY2A 2XAUA 1QDEA 1Z62A 4GGOA 3M5PA 1XNRB 1Y9AA 4F56A 1PEDA 2F55A 4MGZR 5ALIA 2FHSA 2XF2A 1I3MA 1W88A 3LC0A 2IA5A 4GX5A 5FPPA 3AG6A 4X64B 2DXIA 3EXFB 3SJUA 4I1RA 3Q3JB 3A3PA 3EB9A 5ITSA 1IDOA 1QBKC 1Y8QB 1TTTA 1FZTA 1C2TA 1RC0A 1THTA 1CUGA 3QLJA 4AIIA 2QJWA 4MGEA 2PX8A 5LD2B 3I04M 4NABA 4A10A 2RAFA 3MGAA 1ULBA 1B0AA 1FTNA 1OLXA 1BVUA 1RWWA 1SUIA 3GAZA 4HQNA 3MIZA 3R09A 4I2VA 4FDLA 4EZEA 3KZMA 4P3PA 3STHA 3ZHYA 1V9LA 1VG1A 1Z6GA 4OX9B 1TT5B 1G16A 3E5RA 2JFVA 2IZ7A 2PQMA 3LYUA 4UHEA 4WOPA 4FHGA 1A27A 4KLAA 1LZLA 3K0FA 1QVWA 3I2HA 5IBQA 2RC6A 3TCXB 2H63A 3LS2A 2QM7A 3W6ZA 4NS1A 3RFXA 2VWQA 4NCBA 3KLBA 2Z0MA 4K6HA 4UNQA 1WVIA 3OEHA 2ZYAA 5CLGA 5B1YA 5I7WA 1P5ZB 4WBNB 2AZTA 5JDCA 1G4HA 4OHBA 3KB6A 1QIDA 4IRXA 1MXHA 4X1OA 4PW0A 5AK3A 4D4IA 5ALTA 4KHPB 3K0FB 3NBMA 1SU8A 1ZGHA 4BIIA 3S7ZA 1E9BA 1UBUS 2PAAA 4PFKA 3DLBA 1C0PA 2C83A 4RL6A 2X58A 2NQTA 1RE0A 3EUAA 3R7SA 5HOQA 2FKAA 3R7WB 1NGSA 1VI2A 2V7GA 2QPOA 1RYFA 1E3WB 2OLEA 2ZXFA 4EUNA 4ZFNA 4IIUA 3PNQA 2EGUA 1GAXA 2E89A 1UXGA 4MO2A 5J47A 1XDBA 3EEYA 4AS2A 1KI6A 1PSWA 2EHJA 1LDNA 1VI5A 3KJNA 3LXXA 4I8DA 1CYEA 4HMQA 1B23P 1M83A 4KWEA 2PA0A 1Z73A 2IYLD 1FW6A 2X40A 5AHKA 1KEZA 2B2XA 4YNBA 5SYAA 3A7DA 3MGGA 2XXBA 3H2ZA 3PLAE 2FWBA 2WHRA 2WSSD 1BGXT 4G1UC 1L5HA 2EW8A 3KPUA 4TTJA 2XNJA 3URMA 4HX9A 3HK2A 1Q1GA 5G0TA 2PPVA 3IQEA 2GFQA 4M46A 1IL0A 1KERA 3DNFA 2EQAA 1ISPA 3WKEA 2PX2A 2VDUE 4BLTA 1RQXA 2L0XA 4LBWA 2Q9UA 4RPCA 4MIEA 5BMVA 4EKYA 2B6HA 4NC9A 3KYJB 1L5HB 3COSA 1IBKB 1UMDA 4PONA 3VR3A 1ESZA 4EKNB 3H1PA 3NM6B 3QBJA 5JW6A 5MN6A 2LCIA 3CLUC 3WYBA 2AX4A 2R7KA 2V96A 2Y2VA 4LA4A 4YMIA 3TL6A 3VMMA 5JY1A 4R54A 3VJKA 4QVGA 1RQLA 1GNSA 1OASA 3SIWA 3EXG2 1AU9A 2AQHA 3V80A 4LHWA 4EA7A 3ETGA 3NC1C 2XLCA 3DFFA 1U2QA 3G9UA 3CN9A 3I1IA 1JR6A 3CRNA 1UMKA 4P33A 1Z0DA 1X1CA 4YH1A 3RKUA 2EFYA 3A7EA 3OAAD 4JT2A 1WXFA 2UVDA 1BMDA 1Z5VA 3FHLA 3PXEA 4QREA 4MYTA 1M74A 1HNXB 3TE6A 4Z0HO 2XR1A 3G0BA 3ZI0A 2G63A 3MJDA 1WW8A 4HGQA 2JRLA 4FYHA 5LA6F 4EO9A 5ADVA 3T34A 1KAGA 3OTGA 3CCCA 4N49A 4ND3A 4NNJA 2BI4A 5K3AA 1A4XA 3UGTA 3QELB 4YP1A 4HDSB 3VSEA 1LS6A 1W25A 4JVMA 2H0QA 3QF7A 3ZW9A 3JZMA 1FX0A 1FQKA 1YZGA 3W2EA 4ZO7A 2ISCA 2XYQA 2M6LA 5A03A 4KR6A 1ZG3A 2V8OA 4EO4A 4TV8B 4LJ8A 2PNJA 1L7RA 2NX2A 2YRWA 1JVSA 4LZZA 4MWBA 5PGMA 2H7CA 2RGWA 4MYSA 3DHVA 3HB4X 2OV3A 1PW7A 2MYUA 1RXSA 4B4VA 5BPFA 1NNSA 3U60B 1VI6A 4Y0VA 4Z7NB 4B6RA 3U1VA 2ONYA 4EY7A 5DRYA 1SXJD 1ADBA 2FPRA 4HNAB 4MB0A 2HC9A 1X92A 4C04A 1E5VA 4CVNA 1YNSA 2BSQA 2EG9A 2QU7A 1DEXA 1J09A 3T3NA 1L5QA 2IYYA 2NQ8A 4GI2A 2Y1OA 1JT2A 4QOEA 5EVJA 3Q8MA 4P9NA 1Z6QA 2OHXA 5DF1A 1YZTA 3AEKB 3KOUA 4ZIRB 3HBAA 1N2CB 5DH9A 3GWGA 4WNIA 3TSOA 3Q0IA 5M7EA 1Z8FA 2LNDA 4CM8B 4YY3B 1CERA 1KDOA 3AR2A 3IE2A 2LD4A 3H9BA 4X66B 4J1TA 1YS4A 4B7XA 4F4UA 4NL4H 2ZB3A 1C3OA 2VQDA 3G3EA 1IXZA 4LHXA 5IYZF 4BFZA 1HQKA 1XR3A 4CIDA 3S8YA 3DMFA 4PZPA 4FCWA 1XVAA 1MN6A 2XBUA 1Q92A 3P19A 4X7MA 5BRJA 4M86A 5KTTA 4P7GA 4LSGA 4Q1BA 1WW2A 4HUQA 3A9UA 4XYGA 3O1HB 4L28A 1OGJA 2G83A 2LW7A 2I3DA 3EIWA 3PGJA 5GJVC 1Q0HA 2FPXA 2XCIA 3GCXA 3K2EA 4D81A 3ZH2A 1C3OB 4Y67A 2C8KA 4LRQA 3ZG6A 1O0SA 4K9PA 3ZZUA 4BV3A 3TGLA 4XFJA 2N46A 5CB6A 2QU8A 1IEXA 3OM9A 4HAVA 1EFRD 5E7MA 4EVQA 3EA0A 1ZN9A 2VCYA 1XNHA 2GARA 3RSHA 3RAGA 1VRWA 4MR8A 1LFAA 3IMEA 4NECA 4O2BB 3WWCA 4DMKA 5IC4A 2J59A 3E84A 1QRUA 2D13A 3SM3A 2W2NA 2H51A 3FCYA 3T94A 3TEJA 1NN5A 3QKRA 1HNWB 1WV0A 3AUYA 2P2ZA 4N8EA 2VIIA 3LA6A 3NTVA 3WADA 5IKEA 1DXHA 2GWHA 2BMFA 2HLNA 1EDBA 1SUBA 4JC5A 3TLMA 3WWEA 1C5KA 5I45A 3T99A 1N32B 2FSVC 3I64A 1R3DA 3PEEA 2WNHA 4NZPA 1Y3IA 4MR8B 3L7JA 1K92A 4X20B 5JCJA 4B09A 1S8AA 1Y1LA 3R77A 2XQKA 4WINA 3SS8A 3C3YA 4FNOA 4GEGA 2JHGA 4JP1A 3RRZA 1MA0A 2QTFA 3ZEIA 2R8EA 3O4GA 5JAPA 5E4FA 2XYGA 3CVOA 3R6GA 4N3GA 1MOZA 1GTVA 2VDLB 2X2PA 1TZKA 4QELA 1L4UA 4U3JA 4XTRA 5AI9A 2YJZA 3VH1A 3B51X 4LKRA 2GN6A 3W3AA 5K3DA 4ECEA 1TCVA 5FL7A 4WCFB 4N3CA 3T41A 5J3JA 1H3NA 3W0LB 3WRYA 5FYQA 2CT8A 1NNI1 4EMSA 4YJ3F 4IIHA 5HR5A 4TVOA 3FLMA 3FWHA 3DH0A 1ZJ4A 2WHYA 2YMMA 4O4LF 5HVNA 4MO9A 1L8OA 4X8LA 2QPAA 5DNAA 1WXDA 5C3UA 4EW3A 4GMKA 1OX5A 4R8MA 1R6DA 4XVQA 4MOWA 4JGGA 2CLEB 3RUIA 1GY8A 5EKXA 4NFLA 4LY6A 3TIGA 1R4NB 1I94B 1UPXA 2WSYB 1VSTA 2WM3A 5FJIA 1Z5WA 3CLRD 2W2TA 3HLYA 4D3XA 1E5DA 4YP5A 1FFGA 1KYZA 4OU4A 4TS1A 4HI0E 2EP8A 3LNTA 2UXBB 2I6UA 2XUFA 4ZMRA 1OLOA 2FYTA 2XX3A 3OEHD 3DF7A 3IBCA 5CLFA 4D8XA 4HVTA 1F2VA 3DQQA 1HR0B 1IUPA 1QH1B 3IO3A 3SHTA 4E14A 2H11A 4IOLA 5KVSA 5GIOE 1HKHA 4LJ7A 4QARA 4PZLA 4EATA 1WS6A 2Q4OA 4GOND 1N2GA 5FBRB 2V1UA 4UXJA 1ZYUA 3BIWA 3RC3A 4WBXC 3ZYCA 3K0SA 1SPBS 1YVDA 3HCWA 3CWCA 5AK5A 5C8DA 1TCUA 5D87A 4QM6A 4PIPA 5C5IA 2XNHA 1YB7A 3LFUA 1ZMOA 2MSLA 2B4AA 4HPJB 1NQUA 5K8IA 1HKUA 2PU7A 2ZAMA 2A5FA 3H6GA 3NV7A 4NBWA 2QTHA 1BVYF 2C2BA 4CLEA 2I4RA 1PT9A 1PX2A 1RYNA 2GYVA 3CPSA 3SS9X 4ZJUA 3DM9B 4JROA 5CTAA 2J87A 4HF7A 3AT1A 4HLCA 4LNUA 2ZRIA 3CEJA 4TVBA 3H4TA 3AKCA 3LP5A 4FLFA 3VAAA 4EJMA 2QVCA 3GW8A 1SUEA 3I9OA 3LUKA 4MVXA 4JI1B 4E94A 4WASA 5AVRA 1S2OA 3PG5A 4S1NA 1R1DA 4CLHA 2JL1A 2YR0A 3DEIA 3K94A 4ALIA 2YYAA 4F2PA 2UYCA 1D0SA 3FNGA 2DBZA 4ML3A 1LBSA 3V4LA 4G0WA 1A2KC 3I8XA 1Y6FA 1MIOA 5FNVA 4PPYA 1ML3A 3NFRA 1XDWA 1W581 1NF8A 3RSCA 4LNUB 4EHKA 4C7OA 5T3YA 1P72A 2G0NA 4JAVC 1MOQA 4ZYWA 1YTUA 3VR3D 1MQAA 4LRUA 4LJAA 3ZY5A 5CXQA 3P71T 4WXHA 3WI7A 2O07A 1AZLA 1SBIA 1YZ3A 2FK7A 2P8SA 3M70A 4F1WA 2DKFA 2G9VA 4UMVA 3KHKA 2GKOA 5THKA 5JCZA 2DULA 4AG5A 2GR9A 1PQYA 5BYJA 1JSCA 2JK1A 1VGVA 2IT1A 5MF6A 3VHXA 3X1DA 1IJFA 3SMQA 3WZMA 4C7OB 2AX3A 1PL0A 3BUSA 3A1VA 4HQ6A 1XXHB 4JI2B 4CEIB 1ODKA 1DIRA 2QN6A 2QPTA 3RDPA 4I99A 3RYIA 1A50B 4G1VA 4FMDB 1XC7A 4LKOA 4U8GA 1XMXA 3RK1A 4BO6A 1CR4A 3FNHA 1NRXA 1GL7A 2W83A 1Y34E 3HVIA 3GA7A 2QYHA 1S3GA 3OY2A 4LTDA 4TVKA 4UU8A 4WTOA 3ONFA 4BMXA 4PN3A 1SY7A 4J7UA 3TQFA 3C5HA 1E4OA 3MS7A 1DTSA 2QI9F 3QK7A 1MABB 3SQLA 1NJFA 1P33A 4JI7B 2OFPA 2WLTA 2ZTUA 3HYCA 3RSLA 3M1LA 3OIDA 5CLJA 1G18A 2QRUA 2PRSA 3LQ4A 1KZ7B 2NZ8A 3R3UA 2HCBA 5LQDA 2TECE 4FD2A 2BLLA 4KNYA 2GEFA 4RSRA 4ZOLF 1SBHA 1MKYA 1JGTA 4TM8A 1Y48E 5FI0B 2QLBA 1U90A 1XRRA 2VHUA 5ENZA 2RGNA 2Q29A 4BO9A 4HB2A 3OC6A 3NWOA 4KMOA 3VSCA 1TI7A 1U65A 2FOXA 4TVSA 1QK3A 3WDMA 2TS1A 4UBOA 3LM8A 1XEAA 4LPSA 1YA4A 2OLKA 1H5UA 3F6SA 5KSPA 2P9CA 3IBFA 1DFIA 2FDXA 3PNOA 4YRNA 5KC8A 1ORIA 5JYCA 1Z08A 2X9NA 5CVEA 1GCIA 2J09A 2G70A 1FFSA 1QMGA 4UBIA 5DCYA 3BOSA 5EAIA 3FCEA 2QQEA 3K0CC 2PIAA 3ZGYA 1JHQA 1V8PA 1U6IA 1Z06A 2VHEA 3W5AA 2V9ZA 3W8NA 4B9EA 3M81A 3T3GA 3HG7A 4BWVA 4LISA 1TEZA 3OHMA 4JOSA 3SJBA 3S1AA 2Y1DA 2V6IA 3M6IA 4PN7A 3HYTA 2PJRA 2FGKA 2F1KA 1V5EA 2Z2IA 3K9BA 4A4DA 1T8PA 5K0SA 1MRZA 1G8MA 3NHRA 1I3KA 2CLLB 3ETEA 5EKSA 1N33B 3NX4A 4ZHSA 3AHEA 2ZRKA 4FFVA 2C0CA 4EITA 2QTWB 4XUEA 4J3NA 5HOEA 1KYVA 3T3EA 1OT3A 3I09A 1ARZA 4CQMA 4BV2A 1JEOA 1TQ6A 5EE5B 3FYDA 5TJ9A 2B2NA 3OD5A 1V5IA 1PD1A 4RLFA 1YBVA 1L5NA 5F35A 1NLMA 1ODLA 3H4VA 2FUCA 2P2LA 3JV7A 3Q2KA 4U7FA 3CUYA 5D8DA 2YRFA 2ZIZA 4CT4B 4MKZA 2PUVA 2B6NA 5CGQB 3S8EA 4KQMA 2ANBA 2A57A 2BM0A 2HK6A 3U4DA 3SZRA 4TSRA 5AW0A 1K8YB 2DU8A 4KIFA 4QTUB 1BCSA 3VX4A 2H7XA 2BMAA 4BL5A 4MUMA 3ETNA 3B3AA 5CDTA 2DQ4A 3RC2A 2IEAA 2FOIA 2J9RA 2YQ5A 4K3UA 3HABA 4HGRA 1V95A 1FP4A 1V1MB 4IDEA 2VFAA 4DPLA 1BS9A 1TU0A 2NZJA 4GVPA 1FP2A 4F86A 2VZLA 3IBTA 4N9QA 2IVZA 4UU0A 3ZZTA 3BILA 2C96A 3FSEA 3W78A 1ZM9A 1BCSB 2IF2A 2CXUA 4W1RA 3ZWMA 3THXA 3HJGA 4OH7A 2AK2A 4IJKA 4X93A 4DV7B 2D0OB 1FX1A 2F00A 4UTOA 5JCJD 4PCAA 3RABA 1N5KA 3QMMA 5AHRA 5FKJA 4QSMA 3ZWDA 5TS2A 2CNBA 3LY5A 4LXXA 2V6FA 3KTOA 4JKYA 2BJHA 4MRSA 2X0DA 2ZIFA 3UCFA 5CFZA 3A1NA 2A86A 4H35A 3C4VA 2YWDA 1Z07A 3INTA 4KQ1A 4O0MA 4D7AA 3BL6A 5IFKA 1JIXA 1RJDA 3A9RA 4FGUA 4R9VA 5FL7D 2QRJA 3NH6A 4CM5A 2NLOA 1U0BB 1Q3HA 4Z3KA 3O8BA 3RIYA 3VTZA 2P78A 1N0IA 2H8GA 3LGXA 5AVOA 3REQA 3WGJA 3X44A 3EIXA 3DBHB 2C8LA 2YOFA 2F1OA 2OMKA 3EVCA 2PMEA 2X9VA 1LU9A 4JI3B 2HV8A 1UPFA 4XR9A 3DLAA 4GOMD 4YRTA 4IFEA 4ETIA 2R8OA 3WWOA 2CFTA 1W1IA 2Y6VA 3F98A 4QPDA 7REQA 1GDHA 5T6BA 2YDYA 3BXZA 4FFLA 1Y5RA 3DAYA 1DELA 1FC0A 1Q0SA 2QYSA 3LWZA 3OTHA 4LBYA 5HSGA 3RTCA 4QPJC 3LUJA 2BFNA 4L07A 3HEAA 1M34A 1FSSA 4CW7A 1P29A 5LP6F 5THQA 1WZUA 2A2ZA 3ZK9A 2M9MA 4HEJA 1QIKA 1ZNWA 4FI3C 4PSUA 3W4IA 2QRQA 3VR5H 2XKAA 3PR1A 4MV8A 1OAOC 2JD0A 1WTAA 4H16A 1GRRA 4I5IA 4ZYUA 1MJGM 1LPBB 2XQGA 4WKOA 3OLXA 3U4HA 1X6VA 1L5YA 3IKJA 5D7BA 3T5PA 2GPWA 3UMCA 1U3DA 1JDUA 2OV8A 4ARZB 1WRBA 3A6ZA 3H1BA 1V37A 3TQHA 1IZ9A 3FWYA 2Y1XA 3AOEA 3ZE7A 2E37A 3L0PA 5EA2A 5F7ZA 2WNSA 1CYDA 2BGMA 2WINI 4JMPA 4R1OA 1G1MA 3OJXA 2QX9A 5E2BA 4AJ4A 5JXJA 1LS1A 2FSHA 3MT7A 4N40A 2CXOA 1H4TA 1VJ0A 5BUCA 2RGCA 3MPUA 4IDCA 5EXXA 4G37A 3B3QA 3CNLA 3O1IC 5A0VA 3BK7A 4DXHA 2V6BA 2NUAA 1QAOA 4D8VA 1L4BA 3KYCB 3FYHA 3L7BA 3WYFA 5FF9A 1OV4A 4D8YA 4TYMA 3EPKA 4G01B 2Z2JA 3H13A 3DPSA 4DIOA 4IZHA 3IB6A 3ZKAA 4NU5A 1H4VB 4MW4A 4XYEA 1M8KA 3RG2A 3TTTA 1EKXA 5DYIA 1T2FA 3UCXA 4MS1A 3QMVA 4C30A 4JVSB 2ZJFA 4BLUA 1DAEA 5I9LA 1D0IA 3KEQA 1KBZA 1BRTA 1JHAA 3P7MA 4EFLA 3JRXA 3OPQA 4WN9B 1RBMA 1XVIA 4WGFA 2QAGC 3GMSA 2ZAIA 2PSFA 4P4UA 4N41A 3DVAB 2H6EA 7ABPA 5JXGA 1Q3KA 1OYVA 3CURA 4MVWA 3BGOS 4BQSA 3VKGA 1F6BA 1PJSA 5K4AA 1W8IA 4C6SA 3SN6A 1T0UA 4CV2A 5ICEA 1OQAA 3LLMA 1G9XA 1M1XB 2L2QA 4WLEA 1P5HA 1RYZA 2DUMA 1UMCB 3ONEA 4HDRA 4KIJA 3OJWA 5D5PA 1IY9A 4BZWA 1ZK4A 5EWMB 4IJQA 4LYHA 2R87A 3ECAA 5TJHA 3CZAA 2W42A 4PNPA 1DFHA 4KX5A 3GRKA 2JGKA 3EFBA 4ALLA 4TYWA 1JLSA 2DHQA 4AJNA 1E2KA 1NUHA 2XMRA 4KMSA 2VDWB 3EY4A 4F1KA 3BTUA 3O2JA 1ZOIA 2DQKA 1U3GA 2VHZA 2E3JA 1P8AA 4IM7A 4MP6A 1XVUA 4HDRB 3W8FA 4P7KA 3DKPA 4Z99A 2H31A 5LP6C 3HFGA 1XJWA 1NW9B 2PUGA 5FUBA 2VJMB 2YZGA 4G36A 4LX0A 2IC5A 3ND7A 3GJTA 5ETJA 5F51A 5K0CA 1EFLA 2D1QA 5DN9A 4OCZA 4NU0A 3WO0A 4HEHA 3OJOA 1HMPA 3V8BA 1BC5A 5ARDA 4OSPA 5I8ZA 3RHZA 4TXMA 5AVYA 3LUAA 2VP2A 3HDHA 1ZCBA 4X5OA 4AO7A 3GZJA 4AUNA 1S2LA 2W2OA 3MTJA 1QTNA 4FYKA 3M3DA 3SQMA 2F2TA 2P62A 4PFSA 1VKOA 4NBNA 3ZDQA 5IX8A 1EXDA 4I4CA 4NF2A 1BX3A 2Y1CA 3PPIA 3D2AA 3GYBA 3NDPA 1Z5UA 4MVJG 3U81A 1T0IA 2C42A 4A0SA 4D98A 1XLTC 2VZ8A 4ZVTA 1W52X 3SFVA 2X8AA 3T3DA 4M76B 3AGQA 4YJDA 3PPXA 1UWKA 4FYPA 4NMWA 1QZUA 3CF6R 4IDPA 2ZBGA 4PBTA 1MLDA 3WSTA 1CQPA 3KVYA 5DCUA 3HL0A 2Y92A 3PC8A 3V9AA 2X19A 4IS2A 1SC1A 5DULA 2ZETA 3UYLA 3I6BA 2JI9A 4BWGA 4CDGA 2IH2A 3G2PA 4IX1A 1WUJS 3F7TA 4V0RA 4BX3A 1T3TA 1GKUB 1XAJA 2GASA 1KMIY 2AYYA 3G9QA 3LXUX 4EYEA 4ZI7A 2OZPA 3QEAZ 3MCVA 3PQCA 2G40A 4HWKA 1T8YA 2WTEA 4G8BA 4J49A 4UPDA 1H2ZA 4RWEA 3HKBB 1RCUA 2E4ZA 1GPUA 4EECA 1T9GS 3RJTA 1O97D 3E23A 3EIQA 4KQ6A 4KQCA 1T9KA 2O1EA 2DSTA 1XWIA 1C14A 2HSEA 3LZ6A 4RTKA 3UPUA 3ZVKA 4Y2PA 2H1LA 1PZEA 2IY8A 2NAFA 4CQMD 2QLMA 4JP5A 1ZBQA 3PDUA 3AUKA 4P82A 5BUQA 3C1OA 3D6HA 3BHJA 1ZJJA 4CI9A 1TAGA 3KOOA 1KQPA 1MF7A 3JAKA 3O8LA 2WU1A 2XI4A 1KDPA 4LDAA 2UUAB 2YINC 1FLAA 4Y1RA 1RLUA 4RSMA 1R7RA 3B2QA 4CIYA 1KEEA 1SFRA 1F1JA 5D84A 2CMKA 1YUMA 3OX4A 2SCUB 4KK3A 3D8BA 3IE1A 3LDUA 5BXQC 3DDZX 3LYAA 3TEFA 3HA2A 1KI3A 3QF4B 1VDZA 3JAKB 1F8GA 4KXMA 4QYMA 2BH9A 3I5MA 2BDEA 1H65A 2HIMA 3KKKA 3V5NA 5BSFA 3JQBC 4ZT3A 1VC2A 1XCGB 2RGYA 2ZBUA 2B8NA 3E3LA 4G4GA 4Y1RB 5H70A 3QBEA 1QE0A 2Y1LA 2DH5A 1Y8RB 2W22A 5IDXA 4CETA 1UJCA 1ZCZA 4QUJA 1CTQA 3L79A 1KC3A 1BFUA 4NPCA 3TZHA 3LPLA 4L0QA 4GKJB 2Z08A 1XSEA 1XTJA 3MGBA 4Q9NA 1ZI6A 4EDHA 5EJ7A 3W4JA 2OAEA 2P0YA 1JG3A 4TQUS 2H4XA 1T1IA 1W44A 1ECBA 3G0HA 3A14A 4PC1A 5IF9A 3GJQA 1RSZA 1N6OA 4OYRA 4NBKA 4EGSA 1YDEA 1BA3A 4DB2A 3BHMA 3AF5A 1OIVA 2ZPAA 2AUMA 1C30A 3PVSA 1O77A 1X7ZA 1U0OC 3QKUA 4LYFA 4RDHA 3WG9A 4KOAA 5C4IA 4A6PA 2IUTA 1P1FA 3H11B 2XE6A 3KFVA 1L1FA 2WE8A 3O47A 5C4GB 2UU9B 1DAMA 4FPXA 1E0KA 3H3XA 1KO8A 3UANA 1IM8A 4KTTE 4BO0A 3M0EA 4YP7A 1J22A 1RHQA 4GWKA 1UK6A 2VAXA 3HZRA 3U16A 5C8YF 4M1KA 5EXSA 2BFMA 2RH5A 1N4DA 3DEKA 2ZR7A 3INYA 1I13A 2IP1A 1E2BA 3O4JA 3RO7A 3S2YA 1BS1A 2O3TA 1GPMA 3FYUA 1ZH0A 2PLNA 4XB1A 3WNCA 3WLOA 3HWRA 2FG6C 3VR1A 1GTRA 3KJQA 2FRXA 3C6BA 3JQ7B 1D04A 2B7BA 3FTDA 3X1YA 2NT3A 4BX0A 1Y1KE 1SUDA 1ANKA 1V16B 1K8QA 3PFWO 1YRQA 3T7EA 2D1TA 3IQXA 3KZCA 4YBZA 1KTIA 4FFMA 5EWLB 2Y66A 4BX2A 4F3CA 2YIVX 3H8WA 2I9PA 1K75A 1NXPA 4YRPA 4ETMA 4D5GA 2CL7X 3ZV6A 4IUYA 5BR8B 2CXPA 1TZ2A 3PNYA 1VCIA 3TMAA 4E12A 1RQRA 1Z33A 1KRWA 1H6AA 1M54A 2GAJA 2XE8A 1USKA 3OTWA 5A5GA 4PHGA 3QNWA 1M0TA 5LYJA 1DWPA 5I9NA 3ZNPA 1WTCA 1KFBB 5CR9A 3BB4A 3UFXB 4AY3A 2FMHA 3H2KA 3NVMB 3Q5EA 2IELA 4L95C 1X15A 2J46A 3K8OE 4I4TF 2PT5A 2FVYA 5IKMA 1JG6A 4C87A 3EMDA 4Q9AA 4I81A 1RKXA 1G8FA 3AL0C 3MUNA 1NQAO 2BM1A 1O1YA 3I53A 1GV1A 3COYA 4BU1A 2ZUUA 5DB4A 1GQOA 1L5SA 2QSUA 4X00A 4FGJA 5H1YA 3ZHOA 3Q87B 1MRNA 1NBME 2W2KB 4ETNA 2ZJ2A 1UP6A 1LQTA 2ZTSA 1A2QA 2R4UA 4KI0A 2DUWA 4QUAA 1FMTA 1WD5A 4HNTA 2QG9A 3MMXA 3VOBA 5AKLA 1EJ2A 3WLQA 1N6PA 3PEYA 2DFDA 1G4AE 4IDBA 4JS0A 1DMSA 1HDRA 2Q07A 5CW1A 3RD5A 1D4AA 1GA4A 2W70A 3AR6A 5EIXA 1O0CA 4YHBA 3N2EA 1OC4A 4BQRA 3KB8A 2G77B 5H3CA 2ETVA 1X94A 2JFZA 2C7BA 3QVJA 4EEZA 1Z4LA 1P2FA 2ODEA 5DASA 2O9JA 3CF4A 3FKQA 1EUCA 4BWFB 2C7OA 1DJLA 1XZIA 4LYGA 1FF9A 4FN4A 5EEHA 1JR4A 1FW8A 2PDAA 4I50B 1FNSA 1KPIA 4UM7A 3NW9A 2FV8A 3JZAA 1K1EA 3FB4A 3F4KA 3R41A 4ASUA 3RTDA 4ZQCB 4UU7A 1KA9H 3G8DA 4CMBA 3KLMX 4YV1A 3ABOB 3K5PA 4L57A 4UVHA 1JFLA 1BVHA 2VLBA 3E6AA 4FEAA 4NBLA 3MCAA 5ALYA 3LUBA 4RJJA 1WXEA 4L3VA 1QONA 1UBEA 1KBOA 5ICGA 2XUZA 1R88A 3JYHA 3Q2OA 2ZGVA 3EPLA 1ESCA 2QTGA 2RCYA 2XVAA 2A9PA 3PIRA 1GVNB 5TC4A 1P1KA 1GQQA 4A2WA 3FNRA 4FGLA 4IPTA 4O25A 4ZALA 1G66A 2F9LA 4GI3A 4NOMA 3R8XA 5U4XA 3DDCA 8AT1A 1KMMA 4HH3C 1L5RA 2W0SA 3AGPA 3IUJA 3PA6A 3NYWA 3I0NA 4QE3A 3UMBA 1T2DA 3WLLA 4DUGD 4CIVA 1E2LA 3ILVA 5BQOA 1X70A 3EWAA 2FEPA 1DBVO 3Q72A 3A2LA 2QXYA 2X5OA 4BZXA 4DILA 2M1XA 2WU3A 5HJ2A 3OPYB 4H7HA 5LA6A 3TINA 4EY5A 5CIYA 1LZKA 4M8SA 1J7KA 1HFEL 2QDKA 1WD7A 1MFPA 1RVV1 2NWQA 3BXPA 2HADA 4LYAA 2QUKA 3E9CA 1U7XA 4KOEC 1GUDA 3PQ3A 4WEOA 2B34A 4AX4A 2VDKB 5DOVA 3THOA 1C2YA 4H1HA 1R27A 4I5EA 4RXTA 1YB2A 3IURA 1K89A 5I01A 2JASA 2WR8A 1WMBA 3OZWA 2GSWA 3NGMA 3PSAA 4LJKA 4CQLB 3BMNA 5C8XA 4NXMB 4JI5B 3KQYA 7ADHA 3C87A 3EMKA 5LA6B 2PKQP 3KU4A 3TPZA 3UFBA 1IY2A 3JYPA 1ZGAA 5EN4A 1BE0A 2EZ4A 1QDUA 3FBGA 2PHZA 3TW0A 2BISA 1G7CA 1ILWA 1VECA 1O95C 1RYBA 2E4UA 5JFOA 1SOWA 4C4TA 2DBVO 1SBZA 3MUEA 1VBMA 4HPWA 4AP9A 2WJGA 2NXCA 1C0IA 2XZOA 2XT9A 2WIJA 4OUDA 3DZ8A 1N9GA 3LD9A 3Q7EA 1V47A 3ICPA 1KO5A 2QL9A 4JOCA 2KWIA 5EGSA 5DTIA 2Z6AA 4XX0B 1HSOA 2FA9A 4RY9A 1ABEA 4WXMA 5D5QA 1Z4MA 4PEVA 5KYUB 1QQ7A 1GG8A 2QX7A 4MV7A 1VCNA 3U4GA 1L7BA 5IYZA 2DR2A 5CTJA 5I6DA 3TI9A 4FE3A 5HIKA 1K98A 1OXVA 4X6XA 2AXNA 2VTEA 4EA9A 1KPHA 3GJZA 3BD9A 4D3FA 1AQJA 2PGOA 1PBNA 3IEMA 1CPYA 1OWPA 1XK7A 2PZLA 5CW2A 2PRZA 4N0PA 3WYEA 3VUFA 2NZYA 1C1DA 1EE9A 1JLMA 1YGYA 5F21A 1BOOA 1S8OA 3UOAB 3QMWA 5K2OA 4FQ5A 3V55A 2DFKB 5IYZB 3AVVA 4EH1A 3JR7A 4ERNA 3LP8A 4UAGA 3V3TA 5DYYA 3F0TA 3S2FA 3S28A 1JMVA 2NG1A 1M33A 2FR1A 3ZWYA 4J3FA 4UVGA 2IFTA 1T8TA 4IMRA 2AR0A 2PE5A 3OCVA 2PVCA 5CLLA 2VWPA 4BFLA 5BWCA 1C1DB 2O2HA 4QIHA 3RJ9A 2V5UA 1L3BA 3ZHVA 3BH0A 3FMGA 2YZKA 4D41A 1K8ZB 3VU8A 3N6VA 1LTKA 4LQDA 3H5LA 2I6FA 1ZJWA 3U19A 1WXXA 2J3EA 1MO6A 3MWJA 5L40A 3GRFA 1IOWA 4OLAA 1CZOA 1RQPA 1KJJA 2NSDA 3W2TA 1OXKB 4K8OA 1R6TA 5IVDA 3CEAA 1JL3A 4QDZA 2Y3IA 4ER6A 3ITDA 3P52A 3F97A 1CUSA 1MAHA 3TS1A 1NFRA 4GPD1 4S05A 1L1RA 2VNAA 2ECQA 2GCEA 2NT4A 3DZBA 5AM2A 2ECOA 1PUIA 1N6KA 2RHOA 4UE3S 1EA7A 3GU3A 1S9DA 1U7TA 1NOIA 4P2GA 2OESA 3JPWA 1B1CA 1Z2NX 3AF0A 4R1NA 4R8VA 5IP5A 1XL1A 1UBRS 2BHLA 2C84A 3L1IA 1AF7A 3W1WA 1IYZA 2Q27A 5L51A 5JSUA 3N86A 4FFPA 2AD5A 1CY2A 1ZEMA 2WQZA 4J4BA 2AQKA 3BRSA 2M6KA 3ZS9A 4O4LA 4LVOA 3PCXA 2OT3B 3C4JA 3SC2A 3UGQA 2ZCUA 1Z82A 3ZU5A 5M29A 2V3WA 3DS8A 2X2EA 2C4NA 3K8QA 3T5CA 1E2NA 1K97A 1F1BA 2GXSA 1TU4A 3HCCA 3WYNA 4AJ2A 2XGMA 4WVLA 1XZMA 2VF8A 3FZQA 2WUDA 3MTQA 4L8FA 4CBVA 2EGGA 3L1HA 4JX9A 3H0CA 4A15A 1GHTA 2OMEA 3RUFA 1ATZA 1ESMA 4EFNA 1XTPA 2QXTA 2DC1A 4OA5A 4YJ3B 1B93A 3CUKA 3PHLA 4ILKA 2PS3A 1YULA 5EYPA 4V03A 2O59A 4R9UC 1NXOA 3ZCTA 2R5WA 1N78A 1L4FA 1PJRA 1D6NA 2PS9A 3ND6A 1EWKA 5C46F 4FC7A 2ZATA 4A8TA 4DHEA 1SHLA 1T9BA 1ULZA 1TLFA 2ECKA 2CBXA 3PFHA 2OCDA 4OHWA 3K9WA 5AVJA 3WP1B 1A8QA 4HC4A 4EPVA 2ODBA 2OBYA 1T3LA 3CYFA 2GBFA 2GYUA 5LKRA 4F4HA 5J4LA 3FWPA 1AMNA 4HVLA 1AKQA 2JLBA 3BZBA 3WXMA 3QOFA 4IXWA 2RHJA 5ILGA 2Q6VA 4A8JA 1DUIA 1WQ4A 2JPDA 1C1YA 1Z4QA 2WFZA 4AI6A 4WFJA 3WNBA