4PLZA

Crystal structure of plasmodium falciparum lactate dehydrogenase mutant w107fa.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
314
structure length
302
Chain Sequence
KAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title An atomic-resolution view of neofunctionalization in the evolution of apicomplexan lactate dehydrogenases.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 118
structure length 302
sequence length 314
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4plzA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4plzA02
2P68A 1HWYA 1TI7A 3F47A 3ZHXA 3AOGA 2BELA 4JBHA 1KY4A 3ASVA 1LEHA 2WTBA 4EGFA 4BHTA 2C7VA 1DIAA 1H6AA 3C8MA 3CSDA 3SC4A 5AVOA 4YAKA 4NFYA 1G0OA 2EKPA 4FFRA 3DBRA 3MTJA 3OP4A 2C59A 1DEHA 2UVDA 3ITDA 1QRRA 4B7CA 3PFFA 4W82A 4AJKA 3FBTA 2GCGA 2Q4EA 4IGFA 3NT2A 4R5MA 3UW3A 3ZN2A 5IXYA 4CM7A 5I7VA 1EBFA 3KO8A 2PD6A 4M89A 4OMUA 5BT9A 4HNHA 4GSLA 1QYDA 1CETA 1ZEJA 3JD3A 4L0QA 2Z5LA 2Y67A 3PGXA 3KYCB 2VZ0A 3TOZA 4BNVA 2PH3A 4URFA 3VOSA 2OGUA 5ILOA 1I10A 5EIOA 1ISFA 4II3A 4W6ZA 4CLRB 4N5NA 4YXFA 1BHSA 2ZB3A 2ZB8A 2X5KO 1EVZA 1SBYA 3AW9A 2PKRA 1UP4A 4PLWA 2HJRA 3G1TA 4GLOA 4XYGA 3U4HA 3S1LA 3G17A 1IHYA 1TVEA 3OSUA 4PZEA 2UAGA 1VKNA 4ND1A 5JS6A 2DT5A 2RAFA 3I9LA 4AFNA 3DBLA 3FR8A 1I3KA 4FC6A 5IDQA 3ST7A 4BNXA 1S6YA 1B26A 3OA0A 2WWRA 1NFFA 2VNAA 2VYND 4O0LA 4E5KA 4N18A 4ND2A 5TS3A 5HTOA 3JTMA 4TVBA 4DTIA 3LC2O 2E48A 5COAA 4CQMB 3U0BA 2PV7A 1IB6A 1QMGA 4LCJA 2Y1FA 3PZRA 1UZLA 1E1KA 4A0SA 1DAOA 1D4FA 2YDYA 5A9SB 3PYLA 4CV1A 2AG5A 4JGBA 1Z45A 2OHXA 3ETDA 1ZMTA 4IDFA 1P44A 4UVEA 3WNVA 1K6IA 2EEZA 3NTRA 4CLXA 4HWKA 3GEDA 1Y1PA 4BKPA 1PEDA 3LSYA 1PWXA 4TWRA 4J7CA 5KKCA 2DKNA 1WZIA 3MWEB 4P22A 3T4XA 4YYZA 3COSA 5KJFA 3GVIA 1VRWA 5L53A 4OKIA 1GQYA 3MJTA 3D3WA 5IDYA 4DPMA 1GYPA 2B4TO 3KB6A 3SC6A 4A10A 3OECA 1E3JA 1DJQA 3OF2A 2G1UA 3H8VA 4JJIA 1DIBA 4IINA 4FOOA 3NJ8A 3WBFA 2P4HX 2D59A 1T25A 2AG8A 1PZEA 1DJNA 1UXHA 3U62A 1U5AA 1DSSG 5DULA 3VDRA 4ND3A 1ZSVA 2IRWA 4WNCA 3S2EA 4GBJA 2O3SA 1YBVA 4RVHA 2Y68A 2RIRA 2AQ8A 4GX1A 5TLSA 1JLLA 3H6KA 4MIYA 1F12A 3CXRA 1H6DA 1E6EA 2BFOA 3B1FA 3JQ6A 4AJJA 5BSHA 3GPIA 3AY3A 4DBVO 4QFDA 4L75A 4IDAA 1GV0A 4ALKA 1RM0A 3VZPA 1KEUA 2ZYAA 3TZQA 3JQAD 4YCAA 1PQPA 4BNIA 3I1JA 4PLFA 2W2KA 2G5CA 2IE0A 2NUAA 3NT4A 2EP5A 3EZLA 4F6CA 1E6UA 1AHHA 3TZHA 5L7YA 2YFHA 1OC4A 2JCVA 3PYXA 4LSWA 3V8BA 5KTKA 4I9HA 5CG2A 2VYNA 1N9GB 2VZ8A 1JAXA 1HZZA 2AXQA 2CSUA 3RD5A 2UUPA 2G0TA 1RKXA 5A5EA 4XWYA 1C1DB 1NQAO 1IUKA 4KQWA 2OORA 2C82A 2V6FA 3OQ6A 1PU2A 4WCFA 3WYEA 3FTPA 1WZEA 1UUFA 1IOLA 1G6KA 4TZKA 3K96A 4GVXA 3HG7A 2PD4A 3UN1A 3ZWOA 5JCJD 3JQ8B 5HWSA 5IF3A 4IDCA 1HTBA 2CY0A 1AE1A 3WMWA 2J3JA 1O8CA 4DC1A 1EQ2A 1Y9AA 1P45A 1LRLA 1TA4A 2GZ2A 3R3SA 3EGOA 4BGEA 3JQ7B 4J16A 4CV2A 4BMSA 3QY9A 3GZNB 2D4AA 3FPLA 1E3WA 1JKFA 1ONOA 3MJSA 5JW6A 3AM3A 1PGOA 1WDMA 4R1TA 3KRTA 1ORRA 4CMIA 4DMMA 5IFLA 1LLCA 1Y8RA 3T7CA 4B4UA 4JN6B 1UZMA 3C24A 1ULUA 2DTXA 3GNTA 2CMDA 4CMAA 1PJSA 5BSFA 3KVOA 2DBRA 2R6JA 4H3VA 4Y67A 4B79A 3NGLA 5ICMA 4BKQA 5CAEA 3ZNPA 1PL8A 4R9SA 3WSVA 3Q6IA 1HE3A 2GZ1A 4PVCA 1SO8A 1QLJA 2V65A 4BNMA 4J1TA 4QUKA 5IDXA 1MG0A 4EUHA 2GN6A 3PYMA 3QP9A 2X1HA 2YV3A 4GPD1 4PIVA 1FDVA 4OSPA 3DBHB 4X54A 3GK3A 3HFSA 3ZV6A 1UXKA 2V7PA 5BNIA 3PQFA 3M2PA 1ZUD1 5DN9A 1X1TA 2HK9A 1HLPA 4AJ2A 1DRUA 1MC5A 1OOEA 4KMSA 3PEFA 3T4EA 4CQLA 3L6DA 4I5DA 1Y7TA 3L6OO 5IZCC 3HSKA 1BSVA 1FXSA 4IDBA 3W8EA 2PGLA 4AJEA 4PCVA 3L77A 4CMEA 3KETA 4ZU3A 4BNHA 5JDCC 1NAIA 3SX2A 2D8AA 4ZQFA 2PKQP 2VOJA 2CD9A 3ANNA 1OBFO 3WFIA 1LSSA 4CMBA 4FFOA 3JQAA 4NQZA 2D5CA 4JROA 3RU7A 3VKVA 3E03A 2OP0A 3H3JA 1FDWA 1NYTA 1YKFA 5BQFA 4RV9A 5CDTA 4P4GA 4LVUA 2GZ3A 2X5JO 1XU9A 1H9BA 4LK3A 4WPGA 4GVLA 4XD2A 2F1KA 2Y1CA 3KZVA 3ZWWA 3S2GA 5EQFA 2EERA 3MEQA 3AWDA 4YAJA 1YRLA 3WICA 2GUGA 4J1NA 1P31A 1LNQA 1BMDA 1AXEA 2NSDA 5DNAA 3VDQA 4DPKA 1BGVA 4CM4B 1P74A 1C0LA 2DTDA 1NX6A 4ZRNA 1HT0A 4R5HA 1B8PA 3TZ6A 1YDEA 1Z74A 4B7XA 4ZJUA 3JQDA 1PGNA 5JE8A 2WD7B 3H3FA 3BMOA 3GAZA 3TL2A 1K0UA 2QYTA 1JAYA 2BHLA 2GLXA 2HCTA 1ONNA 1A72A 2P9EA 2RHCA 2Y0EA 3C7AA 3H7AA 4EEZA 4PN3A 2FWMX 3FNGA 4GI2A 3IP3A 1KEVA 3WJ7A 4XIYA 2X22A 3SJ7A 2HDHA 1RYDA 3QWBA 1M76A 5L9AA 1ZSYA 5FF9A 3Q2KA 5CPBA 2HKIA 4GGOA 1MFPA 1XDWA 3DOOA 3QWHA 2HMVA 2H9IA 2Y1OA 3ENKA 3EHEA 2FY8A 1E0DA 1EBUA 1TLTA 4JNKA 4BO6A 3NX4A 1LLUA 4UUNA 3IUPA 5A4DA 4KUGA 4UVGA 3TFOA 2HRZA 1KC1A 5DBGA 3WQQA 3R1IA 4XDYA 5B1YA 3GF4A 2FMUA 4FB5A 2FPPA 3NDIA 3SJUA 8ADHA 3HE3A 1K5HA 5KJ6A 5DCWA 2Q1SA 2Y0DA 4CPDA 4GH5A 3K5PA 1R4NA 1RM5A 4XGIA 3U4DA 1OMOA 4XRRA 3PHLA 4Y6PA 5A9SA 4P4LA 2POQX 4YAIA 1YVEI 2Q99A 4FOSA 2PWZA 3R3JA 3P5SA 4XCVA 1EUCA 1GFSA 1J49A 4L9RA 4ZICA 2C2XA 1LX6A 2NVBA 3M6IA 4GX0A 1ZXLA 3A9WA 5GMOA 1QXSA 1XA0A 2AHRA 3DBLB 1I3NA 2A4KA 2YW9A 1U4OA 3U4IA 1GAEO 3DEYX 4BO7A 2D1YA 3F6YA 4PG8A 4WLUA 1MXHA 1ID1A 4RDHA 1YJ8A 4ZQHA 5DP1A 3QV1A 1WW8A 4MVJE 1O6ZA 2W8ZA 4R9RA 3SLGA 5C7LO 5F21A 1E7MA 1ZMOA 4J43A 1V8BA 2O3UA 3KHUA 3L9XA 3KSZO 2QQ5A 1YGYA 3VPXA 1PX0A 4BGVA 3CKYA 3H65A 1ZW1A 4BKUA 4EEXA 4MOWA 4I8XA 1Y9EA 5HS4A 3GMSA 4YDRA 2QX7A 5KJEA 4Z9YA 1ZK3A 1OAAA 3PGJA 2FPGA 1IE3A 1I01A 2CFCA 3F9IA 4H16A 3WLFA 4NBVA 4FR5A 3IKTA 5TC4A 4AJ4A 1NP3A 1SOVA 3FI9A 2BGLA 3IQDB 5KJCA 2EIHA 1ZK1A 2X9VA 1HETA 4YQZA 4CUJA 1B14A 4UUPA 3GHYA 1ZNQO 2E37A 3C1AA 1EUZA 4WUVA 1IY8A 1JA9A 3WIDA 4ZN6A 5AXDA 2JFFA 5TJ9A 3IL2A 1M6HA 2Q2VA 3JCZA 4YB8A 3MCVA 1FDUA 5DF1A 1XR3A 4R01A 5T67A 4NPCA 5I7SA 1K3TA 2EF1A 1M75A 4NI5A 4BNGA 3RFXA 2ZTVA 3EMKA 3PHIA 3ITKA 4BMVA 5JBIA 1ENYA 4I9UA 1YJQA 1OZAA 3O8QB 3ZW8A 1WXDA 4JP3A 3K2BA 2B4RO 4BUCA 4B3IA 4RF4A 2EKQA 5HM8A 4BGUA 1N5DA 4YJDA 2OO5A 1ML3A 3OIGA 3PDUA 1EE9A 5TX7A 4IMRA 1C1DA 3CEAA 3C85A 1PL6A 5ER6A 1T1RA 2NQTA 3KSUA 2ZCUA 4IY1A 3SLKA 4BS9A 2J3KA 2EJWA 2G17A 4JCOA 3P7MA 1GYRA 3D4NA 1DIGA 1FJHA 1XIVA 1U8XX 1LDBA 1WPQA 4ND5A 2VTDA 3TFQA 4PLHA 1ZK0A 5G0WA 5L51A 4JIGA 3JQ7A 1HXHA 2JD0A 4YAGA 5ENVA 3Q0EA 2W2KB 5FI3A 1SB9A 2NLOA 2Y1DA 2ZKLA 3WTCA 2JAHA 1JWBB 4UULA 3VPSA 2AMFA 4XRGA 4QTZA 4J9VA 2YHUA 2WE8A 4MKRA 1X7HA 2P5UA 4W4TA 1E7QA 2DC1A 1ENOA 1U2DA 1XELA 2GDZA 3HN2A 4HXYA 4B8ZA 1PZFA 3DMYA 3H4VA 1GUZA 3JQ9C 4MVJA 3UF0A 3GG2A 1X1EA 3FN4A 5A9TA 4Y8VA 2ZQYA 3GVCA 1P77A 2FHSA 6LDHA 4J0EA 2PKQO 2AW5A 2D5AA 4BO3A 3R6DA 1NFRA 4YR9A 3JD4A 4WCFB 3RROA 1C3VA 1FDSA 1QYVA 3OQ1A 4NJOA 3UCXA 2Q49A 4RQUA 4E13A 1E3EA 1DHTA 3AM5A 2FZWA 6ADHA 3QA9A 3DBHA 3JQBC 3OHSX 4MP8A 1KYQA 3HN7A 1V6AA 1DAPA 3RI3A 1XG5A 3DO5A 4P8RA 3ICPA 4XX0A 4J4TA 4E2YA 1E3WB 3W1VA 1WMBA 1VL6A 4GLLA 2R00A 2YZ7A 4CMIB 5AQ1A 4QX6A 3IKVA 4ALNA 1Y8RB 4D43A 1WP4A 4NFSA 3LQFA 1EQUA 1C1XA 1V0JA 4L76A 4DC0A 1QSGA 2HK8A 4DA9A 1U7HA 5A5FA 4AL4A 5L4SA 2CZCA 4FPXA 1WAMA 2VT2A 4IM7A 1SOWA 1K89A 3HDYA 4M1QA 4AJIA 1HLDA 3I52A 2YV1A 5TGDA 1T24A 4OGWA 4RVGA 4XGKA 5I7EA 4DYDA 3RCBA 5B4UA 3UCEA 5AXAA 3WGYA 3ZZNA 4J1QA 1MG5A 5L3ZA 1TEHA 4UUOA 4E3ZA 3ZNQA 5F5NA 1WMAA 1HDGO 3GFGA 3HJAA 3I9NA 3QLJA 5K9ZA 3JQFA 3BMCA 4BMNA 2HSDA 2OL4A 2VQ3A 4YACA 3K9QO 1O95A 4HNGA 4M55A 1T2AA 3HDJA 3W6ZA 3CH6A 2CF6A 2B5VA 5CDSA 4I5FA 5EESA 3OMLA 3F4BA 4NMHA 4CQLB 4KUHA 3LT0A 3PP8A 1DFGA 1Y8QA 2E82A 1NVTA 3PJEA 3ZU2A 4D46A 2VRBA 1MX3A 4QO7A 2EWMA 1A4IA 5COBA 2B4QA 2EG9A 4XB1A 1QYXA 3H9EO 2WYUA 2F00A 1E3LA 1VL0A 3HQ4O 4NZ9A 2EHDA 1NHWA 1QV7A 3OEYA 5B12A 1ADBA 2WD7A 3F3SA 2CVQA 2BGMA 1ZJYA 2EW8A 3GUYA 2C7GA 2PTGA 3JQAB 4ZD6A 3E9MA 1SC6A 4QO8A 4QSMA 1EUDA 1U28A 2C20A 4FFMA 4K6CA 4TROA 1KETA 1GQQA 4PG4A 4PFJA 4J2HA 5EMHA 2D3TA 4U0JA 3FNHA 5U9CA 4FD3A 5JYEA 2X5OA 2IXBA 1UP6A 2XXBA 1Q7CA 3UFXA 1H0KA 2C07A 3NV9A 5GZ3A 4BIIA 2VHVA 1I0ZA 1P1HA 3DAPA 1GUFA 4S3MA 4BB5A 5DOVA 1DLIA 3H5NA 4YQYA 4B8WA 1DB3A 3INRA 3A4VA 3D4OA 4R16A 4TZTA 2HLPA 4BKRA 5F1KA 4JJGA 1HDCA 3GRKA 4CR7A 3DQPA 4E32A 3BMOB 2AQKA 1I33A 3ANLA 3PHHA 1PQUA 1UDBA 5G0TA 1YS4A 4C7JA 5I9NA 4R3NA 3S55A 1ZFNA 3VPHA 2H1SA 1LSOA 2FP4A 3GAFA 4N5LA 4XIJA 3UOGA 4MVJF 1VC2A 5G0SA 3B1JA 3I6QA 4LVCA 2VN8A 2JKVA 4CM8B 3RC1A 5C7OO 1HL3A 2PZJA 3EY4A 3RUIA 1MXFA 3F1LA 1Q7GA 4Q3CA 2J6IA 4RQTA 5CP8A 5LC1A 2FRDA 1R0LA 2ZYDA 2YY7A 4U7WA 2J8ZA 1TXGA 5BR7A 1J0XO 4A27A 3GGGA 1YB5A 4WGGA 2GO1A 4AJLA 3RSHA 3MTGA 5TT0A 3G1UA 1YO6A 5MDHA 1DLJA 3L6EA 3EW7A 1MLDA 1PGJA 2UUOA 2AEJA 2O23A 4JBIA 4CM5A 2W2LD 3UVEA 2GD1O 2FN7A 4YPOA 2X23A 4C7KA 5T8KA 4CM9D 2I9PA 4B4WA 1Z7BA 3DZBA 4UUMA 5EINA 1HDYA 1R4NB 3G49A 1LDGA 1PJ4A 3VVCA 3ZWPA 3KV3O 3DTTA 4J49A 4EYEA 4WEOA 3WGZA 2VYVA 5ES3A 2WM3A 4IDEA 1GPDG 2JFGA 1K2WA 3LT4A 4Q3NA 1FK8A 4NDNE 4L4RA 1DXYA 3RFVA 3ZWBA 3NDJA 4ID9A 3K73O 5K6AA 2BLLA 3GMDA 4ZA2A 4OQZA 4RF3A 1LDYA 1GZ3A 5KKAA 1T26A 4MVJH 1NVGA 3DZHA 4O59O 2P4QA 4YBZA 5C37A 1UJMA 3WYBA 1NAHA 3DAGA 4KQXA 3FR7A 4E0BA 4HFRA 2DU8A 1LRKA 1TB4A 3BAZA 3V2HA 3GDGA 5KVVA 3AI1A 2GASA 1Q7BA 5CEEA 1B8UA 1P33A 2YFQA 2AQIA 4H15A 3HUDA 3C7CB 3LF2A 3DOCA 3ZV5A 1YQGA 1E1LA 2I76A 5KCZA 3O8QA 2ZTUA 4FJ0A 2D0IA 3TZKA 1SCUA 4XYMA 1B15A 1PL7A 1SAYA 5EN4A 2BI8A 3NRCA 3ZV4A 4ZQEA 4R3WA 2PZMA 4NHEA 3EZYA 1GDHA 3D1LA 4OXNA 4EJMA 4MIOA 1AN9A 3GVPA 4RVSA 3E9QA 4D45A 3AK4A 1XU7A 3I9MA 1HKUA 1DFIA 1R37A 2HRBA 3NYWA 5A3VA 1ZEMA 1YQDA 1EK5A 3PDJA 4BO1A 1O89A 1OI7A 1R0SA 3INGA 2WSBA 1HYHA 1PGPA 3GVHA 4DQUA 1V35A 4MP6A 1NBOA 4P38A 1YWGO 3RFTA 3ULKA 1NASA 5TF4A 1EEHA 2YV2A 4RVUA 4J0FA 4Y9DA 3BHMA 5L45A 1E3SA 3B1KA 3EK2A 3WGHA 1VLLA 1DC3A 1H9AA 3DAFA 3DTYA 3I5MA 3JYNA 4BNNA 1B16A 3QVXA 2VT3A 3UUWA 1HE5A 3MOIA 4DPLA 3QRWA 1LDEA 4G81A 4CM9A 5JO9A 1WDKA 4OQYA 3PFWO 1E5QA 1JTVA 4FIZA 1ADCA 1EFKA 1BTOA 3ETGA 1X7DA 4GX5A 2FOIA 4Z0HO 4EITA 4F6LA 3QHAA 2I3GA 2QRJA 4QEDA 4KTTE 1ARZA 1DC5A 1DIHA 3R0IA 3O38A 4FFLA 2XF8A 3S8MA 1VPDA 4XA8A 4ND4A 3ROPA 4O63O 3TQHA 2VRCD 2WJPA 5G0UA 1DRWA 1I24A 1MA0A 4IDDA 1DHRA 1I2CA 3G0OA 3ZWXA 3AUUA 4HBGA 3ROMA 1I5RA 2ZK7A 3MOGA 2OP1A 4WKGA 1BXGA 4MP3A 4WLOA 5JDIA 3LT1A 4PVDA 2O50A 4ALIA 3RASA 4NBWA 5EERA 4PLYA 3GLQA 2VWPA 4B3HA 4XYBA 5T57A 3H5AA 4PLTA 4IS2A 1ZSNA 1GCUA 4NK4A 1C0IA 3K6JA 1VJ0A 3KYBA 3LYLA 2BF7A 2UV8A 2DVMA 3ZWMA 1B3BA 3IOYA 3PLNA 4B3JA 1HDXA 3PJFA 1QP8A 4NR0A 1P1IA 1CRWG 1OC2A 4U0KA 4PG7A 3KTDA 4RZHA 5I8WA 4ALMA 4BO8A 1W6UA 1E6WA 2PA3A 3ZWYA 4LMRA 3U09A 3LU1A 2O4CA 4RPLA 5G2OA 4DL9A 1GU7A 1C1XB 4NK5A 4JX8A 1EZ4A 1O5IA 3OA2A 4NU6A 3V1UA 4WK6A 2EV9A 5T8KC 4CMGA 3CE6A 4XR9A 3RKRA 1I36A 2WD8A 4QFCA 5L4LA 1ISJA 4GL4A 1PIWA 1R4MA 2NACA 2HMWA 4OOEA 4D0RA 1I2ZA 2ZATA 5ER9A 2P2SA 3OIFA 3EVTA 2BRUA 7MDHA 3VTZA 1WWKA 3GZ4A 2VNSA 3K30A 4GKVA 3O26A 5FI5A 3N58A 4JXKA 3AUAA 3BMCB 3ONFA 4GMGA 5LCXA 3CMCO 1N92A 2ET6A 5KVQA 5K6AC 2XAAA 1I3MA 3RUDA 3VVBA 1GR0A 3FTNA 1FF9A 3Q9NA 3N74A 4CM6A 1E3IA 4TRJA 3O4RA 2IYPA 2HAEA 1Y8QB 3KBOA 3QWIA 2CF5A 3PQEA 4YT5A 4BKOA 2NVWA 5K0ZA 1UH5A 3DMTA 3EAGA 3WBBA 4OKNA 4UEJA 1QORA 2Q46A 1JW9B 1PJ3A 3GNSA 4PLZA 5JCJA 4Z3KA 3PK0A 3KYDA 1A7AA 2JHGA 4LW8A 3JV7A 4R54A 3SBOA 4E2WA 1DBVO 4GQAA 4IBOA 1F8FA 3RBZA 4L4SA 4N5MA 1KBZA 2VWHA 3W8DA 3LLSA 2JFHA 4E31A 3PIDA 1VJTA 1I32A 2VRCA 4OXYA 4NFHA 5TQVA 2Y1EA 4JJFA 4R1NA 2B36A 4IQGA 1PQWA 4INAA 4QT0A 3JQEA 1HF3A 4OSOA 3TJRA 4WEQA 4DXHA 4CM8A 4LCEA 2QRLA 4YWJA 1KEPA 5JPIA 4BO0A 4C4OA 2WMDA 5L4NA 3GVXA 3PTZA 2J5KA 4RLSA 4DIFA 2IEBA 3GHHA 4E6PA 1BG6A 3W4IA 1GQ2A 4M54A 4NJMA 3AOEA 1CDOA 1W0CA 2IDZA 2X0NA 3FHLA 3GR6A 4RGBA 1LLDA 4I5EA 1CERA 2CVZA 2AA3A 5F3RA 1E7WA 1K6JA 2JD1A 2JJYA 3NT5A 3MZ0A 4GWKA 4WASA 4YVFA 5IG2A 4XDZA 3RC9A 2GF2A 1GL3A 3ONDA 1F8GA 3DZIA 1WDLA 1CIVA 3G3EA 5AXBA 1KVRA 3UXYA 4BNKA 1IPFA 4LSMA 3RVDA 4DYVA 1YE3A 1PR3A 1YOVB 4RF2A 3A28A 3BTSA 1AXGA 5THQA 1A9YA 2H5LA 4BNUA 1GADO 1RPNA 5DT9A 4D79A 4RL6A 1FDTA 2C5AA 2HU2A 4NBTA 4IZIA 4J4HA 4WCFC 4K26A 4RPKA 4LGVA 3VH4A 2X0RA 3KLPX 4KP7A 2FR1A 5FWNA 1PS0A 1J6UA 1LC3A 2NU7A 1ISGA 1LXCA 4XJTA 3V1TC 3DFZA 1GYQA 2YQ4A 1LBEA 4IS3A 4BB6A 4Q3AA 3STHA 4BNJA 1YDWA 3E82A 4J7UA 4WNIA 3DONA 3O03A 1N2SA 2C0CA 2PY6A 5G4KA 5KJ1A 2VOEA 1IZ9A 1SNYA 3LF1A 2I65A 3QE3A 4B4OA 2WYVA 3L07A 3NGXA 5L7WA 3HDQA 4XQEA 3ANMA 4FQ8A 4CV3A 4EJ6A 4H7PA 2FZEA 5L7TA 1U4SA 5I9LA 2P5YA 2VCYA 1J5PA 3RBVA 3L4BA 4U8GA 4IGEA 5JDIC 4NBUA 4R68A 1XEAA 2QYSA 3UH1A 4DWVA 4IDGA 1PZHA 3K8ZA 2NV6A 3GA0A 3TPCA 4BNWA 4GSKA 2ILTA 1CJCA 4CR6A 1M67A 3QVTA 1AHIA 4M49A 4E5NA 3F46A 4D41A 3JYOA 4PZCA 3Q3CA 3PHGA 2DLDA 1B3RA 2D2IA 3PWSA 1P1JA 4J7XA 2ZTMA 4AJPA 1CYDA 4G5HA 5I8ZA 3WYCA 4G2NA 4D3FA 4RO0A 2X9GA 4DIBA 2C5EA 4J9UE 3IDSA 1P1KA 1ZK2A 3E6AA 1NWHA 4KDFA 2A9FA 1I30A 1BXKA 2GERA 1HDZA 1V3UA 8LDHA 4M8SA 4PLPA 4EJ0A 5LDHA 4CMEC 5JC1A 3KSDO 4EUEA 3VHRA 2QG4A 3HB4X 4I9NA 2X6TA 3DB2A 3DFUA 3I6IA 2OUIA 4TQGA 4TKLA 1HSOA 2FSVA 4K6FA 4XQCA 4U5QA 3E5RA 3B20A 2NU6A 4ZGWA 2E6UX 4CMHA 3QWAA 1BWSA 1QKIA 1EVIA 1GD1O 1I3LA 2BFPA 4DLLA 3F5QA 1HDRA 4OXKA 3RQSA 4TRRA 5BNFA 4D42A 3RU9A 2A92A 3U9LA 5JAMA 3E1KA 4YAEA 4WLFA 2ZJ1A 4B7UA 2CUKA 1XGKA 1X0XA 1U2GA 4R51A 2A35A 3I4CA 1Q0QA 1N7GA 3AU8A 3AFNA 4OL9A 1SEVA 4KOAA 1QLHA 3TNLA 4OM8A 4DMLA 2IZ1A 3JQCA 3NDRA 1NR7A 1KVUA 1Z73A 4F3YA 4K9DA 3GY0A 4YEDA 3PWZA 4M86A 5TSDA 3L4SO 2ZIZA 4YT8A 4AJ1A 3OJFA 3FNFA 1RWBA 4J1SA 3GN1A 1HE2A 2JCYA 2RHRA 5BSEA 2DUUA 4TSKA 4CUKA 2BFMA 3GDOA 2I67A 1EFLA 4MO2A 3IAHA 1A9ZA 5DBFA 2IEDA 1IULA 1G0NA 4G65A 4MPDA 3HADA 4M87A 3WWZA 4ALJA 4EZBA 1PJTA 2I6TA 4A2CA 1SMKA 1ZBQA 2BGKA 4CMCA 2QZZA 4IJWA 3NAQA 1BXZA 2I66A 3B6ZA 4KUEA 2Q45A 1NPTO 1K6XA 1EDZA 5KNLA 1MGOA 2VTEA 2G82A 3BTOA 3RWBA 4AJHA 3W4JA 3AOEC 5HRUA 3UKOA 1T2DA 4PGFA 3ZU4A 3JQGB 3INTA 4FFPA 3DZGA 3ONEA 1YONA 1E1NA 4PRKA 4WCDA 5CDGA 4IPTA 3WOHA 5AYVA 2PR2A 4OH1A 5L95A 3A14A 1XKQA 2GSDA 1BXGB 2QHXA 3TDKA 1JKIA 2VUSA 1H6BA 1JKJA 3UCFA 3ABIA 4W7IA 3FRJA 3TF5A 1H5QA 1HYEA 4PG6A 1MUUA 3WIEA 2YDXA 1SPXA 4JK3A 4YRBA 5JO0A 5JSFA 3V2UA 4CLOA 3RBXA 1KERA 1XCBA 2BH9A 5U1PA 4YT4A 2DPGA 3GDFA 3CMMA 5JY1A 1LSJA 2J3HA 4XZ3A 4A73A 2WYWA 4Q39A 3WMXA 2W4QA 3GGPA 3JYLA 4MVJM 4DIOA 3ADOA 4RF5A 3OJ0A 1MB4A 1LI4A 2W90A 3ZHZA 5I7FA 3PHJA 1T2EA 3EVNA 4TVOA 5AOVA 3TOXA 3WSWA 4AJNA 1EE2A 4ESOA 5KOIA 1UXJA 1JVSA 1XQ6A 3LC1O 3WGQA 4YJHB 2NWQA 3PQDA 1Q1NA 1GZ6A 4CJXA 1E92A 5B4TA 1E1MA 1ZKMA 4Z6KA 4A03A 3ZDFA 2AEFA 3A06A 5IJZA 2GN8A 3FBGA 5JY6A 2VZ9A 4XKJA 4ZHSA 4ILKA 5EJ2A 1F14A 3WGIA 1C0PA 1V3TA 3CZRA 1SZJG 3EDMA 1PJQA 3I23A 1D3AA 5JYDA 1LSUA 1R4MB 2IXAA 1D8AA 1EMDA 2PGJA 4AICA 3KLMX 3L4BC 3FWZA 1YB4A 1ONPA 1X14A 2NVUA 3LZ6A 2JL1A 5H82A 2DUWA 2ZQZA 1ZXBA 3FPCA 5LDGA 1GEEA 4BQRA 4FDAA 1QYCA 2PD3A 1DFHA 1D1SA 1GEGA 4MKXA 3X2FA 4E4YA 2HK7A 2Q2QA 4L74A 1ZJZA 3RUCA 2ZYGA 1XSEA 4IIVA 1MFZA 1M2WA 4WLEA 3GNQA 5KVSA 1DDOA 4KDEA 4I5GA 3VZSA 1N7HA 3WLEA 3RIHA 3KYDB 4MJLA 3NUGA 2NM0A 5JC8A 4CUZA 1LLQA 3H9GA 2Q4BA 3PXXA 4W99A 4E5MA 4FW8A 3GN2A 4RLHA 2DTEA 3OICA 1KY5A 3DOJA 1M6WA 4XQ9A 3B70A 1CF2O 3UGKA 1YB1A 3D4PA 3D7LA 1YOVA 3ZU3A 3ZW9A 3DL2A 1I2BA 4Z0PA 3U4CA 3WQRA 3GRPA 1NQTA 4CLHA 4DGSA 5ADHA 1B0AA 3I9OA 1QR6A 2JHFA 3BHJA 4EDFA 1N1EA 2GNAA 5IAAA 4IQ8A 4FGSA 1MV8A 5H81A 2P9GA 3ENNA 3H9JA 2VHZA 5F1PA 5CHEA 4XEHA 1F06A 1XHLA 2AQHA 4FCCA 2H63A 2QIOA 3IIEA 3AUSA 3GQVA 2DFVA 2VUUA 2NU8A 4NJMB 1XYGA 3OFSA 3W4KA 2Y93A 5HS6A 1BRMA 2IODA 2EJVA 1LQUA 2P91A 4DLAA 1W73A 1QYWA 1Z82A 1BVUA 4IUYA 1PTJA 2DM6A 2OBNA 2HMSA 3RC2A 2AEMA 3QVSA 1U3TA 3RJ9A 1JVBA 1B8VA 1R0KA 3S2IA 3OH8A 1KVQA 4DBZA 1IZ0A 4LRTB 4BO9A 3ZWCA 1ENZA 3C1OA 5C5IA 1A5ZA 1JQBA 4NNJA 2RBEA 5CDUA 3RAJA 2HMUA 1HYGA 3ZGYA 3JD2A 3OEWA 4WLVA 1P0FA 2X0IA 3F4LA 3I3OA 3WDSA 2X86A 4I08A 4YTEA 2BI7A 3DHNA 3PRJA 4NG5A 3D64A 5IZCA 4A7PA 3ZHYA 3H2SA 4W9NA 4XR4A 2EGHA 1EVYA 4ZRMA 1NFQA 2Y1GA 5JDCA 2YYYA 2DBZA 5DCYA 2YJZA 1R12A 3PI7A 4NH4A 3VKUA 4U6SA 1DO8A 5JFOA 3ZWVA 3O9ZA 4IJKA 2CDCA 5G4LA 4YJFA 5B37A 1VSUA 3EUWA 4HADA 4XJSA 4PZDA 1YH3A 4KTVE 1NXQA 4N54A 3DXFA 2CDAA 5G4KB 5J23A 4FC7A 4D44A 2RH8A 2R00C 1H6CA 3IJPA 3AI2A 1TT5A 1LU9A 2EKLA 2XPCA 3BXXA 3CZMA 1SEPA 3BZUA 3QVWA 1ENPA 1HEUA 1O0SA 5DP2A 3DDNA 4NIMA 2BFAA 4IJUA 1NPDA 1IYZA 4LN1A 3GG9A 1LRJA 1ISIA 3MJEA 2BD0A 4BNLA 3OETA 3BMQA 5H83A 3X2EA 4O5OA 1R15A 5BSGA 1PJCA 4Z0TA 5CPFA 4Z9XA 4MVJG 3TZCA 3WS7A 4UVDA 3HB5X 1LUAA 1LJ8A 2YQ5A 3A1NA 3ICCA 3JQFC 2NQ8A 1UAGA 4HX5A 4MDHA 1V3VA 4L8VA 2Z1MA 4AVYA 3NJ4A 4HP8A 3BTUA 2ZB4A 3QSGA 3AUTA 3DZKA 3AY6A 5TT1A 4N7RA 3W6UA 4PLCA 4RCVA 1SB8A 4D0SA 4YA6A 1CEQA 2B83A 2OXIA 2PNFA 3E48A 2O3JA 1H94A 4D3DA 4HFJA 1O9BA 1T4DA 1F0YA 3ZWAA 1UXGA 3HFGA 1E7RA 3DHYA 2Q50A 3H9UA 1IL0A 2E49A 2O3TA 2W2LA 3LLVA 2VHWA 2ZCVA 4E2ZA 4CMJA 4CM3A 2IZ0A 4UAGA 2DQ4A 1I8TA 3ADPA 3SVTA 3GPDG 5ITVA 3PWKA 4Q9NA 1DC6A 2AE1A 2O3QA 3E5MA 4IXWA 4MVJI 4MINA 5C7IO 5FYDA 3L0DA 1BDBA 3FNEA 5A04A 3LDHA 2IYOA 2Q2WA 1ULSA 2Y0CA 5JNLA 3AJRA 4FFNA 1XLTA 4WECA 3ASUA 1DRVA 3MJCA 3VZQA 4BO5A 3GEGA 3D0OA 4FBGA 3VPFA 4II2A 1EK6A 1F17A 5COQA 1CWUA 3VAZA 4CODB 4DRYA 3JQGA 2NTJA 5DZSA 1L1FA 3RC7A 5A9RA 2EP7A 2O2YA 3P19A 2Q1WA 1BVRA 5F5LA 3MJ4A 3EYWA 1TT7A 3T7EA 2IZZA 2OZPA 1NQ5A 5IN5A 5THKA 1NQOA 2PZKA 5IZ4A 4YT2A 4JQCA 4KWIA 4XGNA 4BL5A 4U6QA 2GN9A 1UZNA 4EUFA 3LC7O 4BNZA 2EW2A 1NTOA 5EQDA 4D3SA 1N8KA 4J4BA 4UEKA 3U49A 4E5PA 1YQXA 3ZH2A 5CFZA 3H5RA 4TRMA 9LDBA 3LT2A 1GPJA 1NHGA 4A26A 5JCXA 4L73A 5DDIP 2YHIA 4BO2A 4RORA 3BMNB 3FWNA 3QIVA 5MGBA 4KZPA 1C0KA 1PJ2A 4BVAA 4YJHA 4DREA 1BDMA 3K92A 3GOHA 4YJGA 4Z3DA 2GGSA 1NR1A 2WDZA 1U9JA 2UDPA 2ZJ0A 3WNQA 3BTVA 4FSHA 1GZ4A 4Y6RA 5DCUA 1P1RA 9LDTA 4BNFA 3FF4A 2Y99A 4CQMD 1OFGA 1A7KA 3PJGA 1BW9A 4J3FA 5T6BA 2QZ9A 3G79A 3C3XA 4R69A 3PLRA 3TWOA 5IDWA 4OJNA 4CLOB 3SEFA 1Q2XA 3RUAA 1CQIA 5ITWA 4O6VA 4EI2A 4GMFA 3TSCA 2LDBA 2C29D 4HFNA 4WJZA 4W9NC 1U3UA 3Q11A 5G0VA 3VTFA 3WWYA 2FR0A 4GKBA 4IXTA 1NM5A 1VL8A 4CL3A 1GY8A 1PSDA 2AE2A 5FEUA 4OIMA 1DIRA 2O3RA 5A03A 4E21A 1RM3A 3P2OA 1Z75A 2FSSA 2RCYA 3DZFA 3OBBA 4JP2A 2B0JA 2PGDA 1HDOA 1WNTA 1JWAB 2C54A 1KC3A 2SCUA 3CIFA 4CV0A 2GYYA 1QG6A 3WGOA 3IJRA 2VUTA 5DBIA 3AM4A 1GUYA 2VWQA 2PH5A 3KM0A 3BIOA 3PVZA 2B37A 2GR9A 3KUXA 2C2YA 1LQTA 1X7GA 5IXSA 1DPGA 1D1TA 3IC5A 4W7HA 3ZHBA 3KEQA 3ZNNA 2NVUB 5F1OA 3MWDB 4FJ1A 4R1UA 3WG9A 3GUCA 4RZIA 3ZU5A 3CTMA 4J90A 3S2FA 2V6MA 1A71A 1GTMA 1RJWA 3K2EA 4BO4A 3VZRA 3KOUA 3OQBA 2J3IA 3ZI0A 4OOFA 1U5CA 4Q3EA 2X58A 1YL7A 1UP7A 3Q2IA 4PLGA 4ZVVA 4RPGA 1M66A 3OJOA 3JQ9A 1E7SA 2NADA 4R4JA 1T1SA 3H9QA 3KYCA 3PZBA 4BOYA 5CEFA 4S1VA 4OHUA 4MKZA 1GCOA 1Z7EA 4HFMA 4J91A 2OMEA 1LC0A 1YL5A 2QW8A 4CL8A 4CLRA 1HZJA 2DBVO 4E12A 2TMDA 1W8DA 2JCXA 3NTQA 1QV6A 3CUKA 1YBMA 4IIUA 2PFGA 1UDAA 2I3AA 2NTVA 4F46A 1PJLA 3JQBA 2V6BA 2O7SA 4XYEA 3DBRB 3EC7A 4RVFA 5CDYA 1T2CA 4QECA 3FCOA 3RUHA 4CR8A 1DOHA 4L4XA 2Z95A 4J2OA 1Y6JA 1LDMA 2CNBA 2ZB7A 2NNLD 4JBGA 2FPIA 3GGOA 1KEWA 3CPSA 3WGTA 5TRTA 5JMWA 2DPHA 3QQPA 1PGQA 4Y98A 4BQPA 1MP0A 3WR5A 4BNTA 4QQRA 4CQMA 3TL3A 3WTBA 3AFMA 4IQ0A 4YRDA 3KEOA 4PRLA 2B5WA 4HY3A 1VM6A 1ADGA 3ZWNA 4UEOA 1U7TA 3JD0A 1CQJA 1G1AA 1D7OA 2DAPA 1E5LA 2FR8A 3V5NA 1ZO8A 3Q9UA 3LVFO 4R1SA 2PZLA 1UDCA 4A5OA 4CM1A 2O7QA 3RUEA 5GZ1A 2PK3A 3DHEA 3WFJA 1S7CA 4HV4A 2X9NA 1E77A 1YXMA 1IPEA 1JDJA 4WOKA 3E8XA 4UVIA 4ZQBA 3U5TA 1P0CA 3OJLA 4GWGA 3M2TA 4E2XA 1A27A 5A05A 1ZZEA 1H93A 2UYYA 3P2YA 5JMPA 4MVJD 2P9CA 3HDHA 1PS9A 4J6FA 3GEMA 3JYQA 3C7DB 2B69A 4HKTA 4OAQA 2WEKA 3OJEA 4XQGA 1Z6ZA 5TJHA 4AG3A 4EW6A 4FS3A 1C14A 5DOZA 2OFPA 5EL0A 3GH3A 4YJFB 5AXCA 2EXXA 3HZZA 7ADHA 3JD1A 4PLVA 3WXBA 5KWEA 4E30A 3TRIA 2Q1TA 2WE7A 3D5QA 3WB9A 4FN4A 1V9LA 3E18A 1ADFA 1P9LA 3DWFA 3RJ5A 1TT5B 2NU9A 5A02A 2O4UX 5KVCA 4Y6SA 5A1TA 1KVSA 2JAPA 3NKLA 4LISA 5B4VA 3GC6A 3ZV3A 1WLYA 2CVOA 3AI3A 5JAZA 3WJAA 2VHXA 1HE4A 4D7AA 5TIIA 5HBRA 2VWGA 2B35A 1KIFA 5JAIA 3D3WB 4RDIA 1T2FA 2PLAA 3UAGA 3BMQB 2GN4A 4XB2A 2HQ1A 4FJ2A 4R41A 4Z9FA 4JLWA 2XOXA 3VH3A 1ZIDA 1O94A 2A94A 3F1KA 4NU5A 3ROQA 4BNYA 1XWFA 4BGIA 1LA2A 4RVDA 1DC4A 2CDBA 3IP1A 4O1MA 1J4AA 2R2GA 1YL6A 4GX2A 4CLDA 1ISMA 2QRKA 3OM9A 1R66A 3BA1A 4TRNA 5JAQA 2V6GA 2Q3EA 1ZCJA 5C3MA 1X0VA 2DFDA 1YBAA 1N9GA 1UAYA 3VPGA 1W4ZA 4UREA 3ON5A 5L40A 3ZNOA 2X8LA 4FGWA 5CEJA 2OOSA 1KVTA 2W98A 3VH2A 1B7GO 4CLEA 5HA5A 4LRSB 3DMTC 2HO5A 3IUSA 5EPOA 1U3WA 3AY7A 4ONEA 3FD8A 2BMAA 4P4NA 5BNTA 2J5RA 4PG5A 2TMGA 3OIDA 2XXJA 4IMPA 1HRDA 3JQ8A 3I9KA 3I9JA 3PIIA 4NBRA 2HJSA 4WE3A 1RYEA 2O48X 5A06A 3QJ5A 2Z1NA 1EDOA 2G76A 1FMCA 1ZK4A 3BHIA 3GZNA 4LMPA 2GRAA 2OBYA 3QW2A 4ITUA 3GT0A 2Y66A 3DC2A 3UICA 3KXDA 2LDXA 5CG1A 3FSRA 3WX0A 4BV9A 2DBQA 3N7UA 4RJTA 1L7EA 1ISHA 2ZTLA 4CMKA 3W8FA 4OO3A 3D5TA 3NTOA 2J5QA 3QVOA 1NVMB 1ZVMA 2HUNA 3M1AA 4AJOA 3BMNA 5I9MA 2VHYA 3VC7A 4Q3DA 3I83A 2I99A 5JLAA 4DLBA 4WOJA 3IS3A 1EVJA 1T4BA 3ZCXA 1Y5MA 1H2HA 2BKAA 1AUPA 2X0JA 1P3DA 2I5PO 3I4FA 1E7YA 5GY7A 1N1GA 4ROSA 4GAEA 4HUJA 1U1IA 3SXPA 4UVHA 3JYPA 4ALLA 1RM4A 4K28A 3Q1LA 1KOLA 1GV1A 4TKMA 3AU9A 4RPJA 4WLNA 5FFFA 2RH4A 3LK7A 3K31A 5A3JA 1Y81A 3WQSB 3H2ZA 3MJVA 3TN7A 1HSZA 1VE9A 4Q3BA 2GPTA 1X15A 1KS9A 4F45A 3DZJA 3L9WA 3DBVO 3JSAA 4TMFA 3F5SA 3RUFA 3ETEA 4DVJA 1IHXA 4DQXA 2YHIB 3WGGA 2YUTA 5TNXA 1ZH8A 1NWCA 3E9NA 1VSVA 1PS8A 1JU9A 4DQVA 1JN0A 3PPIA 5T5QA 1P1FA 5GZ6A 1WVGA 4IZHA 4YJGB 5T64A 1MC4A 5U4QA 3U3XA 1VJ1A 3DR3A 1NPYA 3PJDA 1U3VA 1VI2A 1LDNA 1Q0LA 3HHPA 3V1YA 2X4GA 4E33A 3CINA 5ENDA 1PR9A 1PJBA 3BYZA 5KIAA 1H2BA 3GFBA 3C1TA 4KWHA 4XYLA 5IN4A 2E4AA 4BV8A 2JD2A 1BW9B 2O2SA 2Q1UA 3UHAA 4E5YA 4B4VA 1NNUA 1Y5RA 4MIEA 4QXMA 2H6EA 5ILGA 3V2GA 2X7HA 2HMTA 3IMFA 4MVJP 4DUPA 1PZGA 1UXIA 5ICSA 1AGNA 2NTNA 4I1IA 1A4UA 3RKUA 1R16A 1X13A 4CM4A 1VKOA 2VYVD 4ZQGA 3HNPA 3VH1A 3D3EA 4GGPA 4EBFA 4OYRA 1XQ1A 1PWZA 4RPHA 3ROKA 2EGGA 1Q0HA 2Y05A 3ORFA 5JXWA 4YRAA 4K1LA 1B2LA 1R6DA 3NEPX 4IJVA 1L7DA 3QWFA 3HWRA 3M1LA 1LTHR 1UR5A 1U8FO
chains in the Genus database with same CATH superfamily
1T5BA 1FYEA 4FZJA 2VBFA 3CUYA 3AI7A 3B7GA 2P9BA 3QUCA 4N0PA 3VR2A 4JBHA 4PYQA 4OIFA 4UTVA 2C2MA 3EGDB 4FR2A 3ASVA 3PRKE 4EGFA 3P45A 4BHTA 1IZ7A 3CSDA 3LHFA 2ATVA 4JITA 5AVOA 4CKEB 2G9RA 2VSOA 1I2DA 3QVVA 4G07A 1JWLA 1ID8A 3U7GA 2F1JA 3DBRA 1EFHA 3ITDA 1X19A 4IQFA 3KOYA 4KGXA 2ZR0A 2R5FA 1NONA 3B6JA 3DMFA 3FBTA 5AKLA 2GCGA 3ZE0B 4AJKA 4B6GA 2QTZA 3CEJA 1EINA 3GA5A 2B25A 2N1BA 3ECAA 3DEIA 3NT2A 4M9CA 4NICA 3UW3A 1T3HA 1YTLA 4JI6B 4CN8A 5A2GA 5ES4B 3ZEAA 3W5BA 2BH2A 1M6EX 4HOYA 3NRBA 2PD6A 4LUCA 2Y6VA 3VKFA 1PDWA 3VDQA 2A1TS 2OSVA 2RHBA 4JEIA 3U3ZA 2NOAA 1CETA 1C5KA 3QMPA 4URXR 2ISQA 1OZGA 4EA9A 3C3KA 2VEDA 3PKJA 2RKOA 4LX8A 3BEDA 3T9FA 1PR2A 2DUJA 4OU4A 1OYVA 1SHJA 1KK2A 2PYIA 4KNWA 2WWTA 4OQ4A 1ISFA 1ZMXA 4GYYA 4II3A 4CLRB 4B8YA 4P5PA 4ME6A 4MVWA 3SN6A 1BCSB 4UJ5A 4XYGA 4RNCA 3E3OA 1PR6A 3KJGA 3WVNA 3U4HA 5KMGB 2YKGA 4LBVA 1G8JA 2XSZA 3OPXA 3PE4A 1UPAA 4KNVA 1OLXA 3LHSA 2EFDB 1OIXA 2ZBQA 4X7BA 4BU1A 2GZHA 5JV5A 3HCAA 5JCOC 1NRWA 4FLFA 1YI0A 4AY4A 5IWAB 5EG5A 4D82A 2XWJI 4QPDA 1VJGA 1YZGA 3S5JA 3G7SA 2RG1A 3ST7A 3H84A 5E2IA 2R47A 3WMGA 3OA0A 2CXUA 5CLHA 2OXRA 2CXSA 4Q16A 2PRKA 4ZOBA 2ZUVA 3T0GA 5LUAA 3PC6A 4M0FA 5E7JA 1TYAE 4P0QB 4NYJR 3KJEA 4UAVA 5AVVA 3MAGA 4ND2A 5JSKA 6GPBA 1ABBA 1XLUA 3B2NA 1Z37A 3JTMA 2XI4A 3LI2A 4R2LA 3SHTA 1P81A 3MCZA 2W6CX 2E48A 2C2WA 4LJAA 5COAA 1E61A 1XTRA 3EODA 3BWDD 3BREA 5DYYA 3VV2A 3Q12A 4CIBA 1L8AA 1EVQA 4PPNA 4TKVA 1D4FA 1JXMA 3QI7A 1MQSA 3E7FA 4GT1A 4KBFA 4DSOA 4RVOA 3USZA 2YDYA 5A4IS 5CYGA 1BH6A 1JR3E 3PYLA 3TD2A 3NWJA 4JGBA 3TQTA 2OENG 4V1CA 5BVGA 3AVXA 1AQIA 2NUTB 3ETDA 1RFLA 2D5LA 2VRNA 4IDFA 3T95A 1NUAA 3F4KA 1Y82A 2EZUA 2QPOA 4CIVA 2CK3A 3JWPA 3M6VA 5D3ZA 4AXXA 4B5KA 1LBSA 4CHGA 2P3SA 3LSYA 1PWXA 1KFCB 2C5FA 2WDPA 4P32A 4TWRA 3SOZA 3WK4A 1FXWA 4YCJA 1CS0B 3Q7QA 4Y30A 3NKFA 4YFVA 5TXGA 5KQPA 1XQVA 2ZJ8A 4MR7B 1IMOA 4LIPD 4PHFA 5BYKA 4LXHA 1CJSA 4WZAA 1OLSB 1EFRD 3NV7A 2I7XA 3ND5A 3COSA 2CCGA 3T5TA 1WRBA 3GVIA 5B30A 2D5BA 1RRFA 3WZ2A 2EFYA 3D3WA 4YRTA 4DPMA 1N5MA 3FPEA 4QUJA 3SC6A 4A10A 2YHAA 1E3JA 5HF8A 2AKAB 2G1UA 2YTZA 4R9NA 3A7EA 5EJ7A 5LMCA 1X7XB 4KO8A 3T1QA 4HGNA 3NJ8A 5TPZD 2HEGA 4I1PA 4FUQA 2P4HX 4RTOA 4R0VA 2D59A 1X1BA 1MRZA 3BXPA 2OR3A 5FR2A 3R9IA 1LTQA 4RESA 1KHHA 4UTNA 1YR6A 5J4HA 5J59A 1FFSA 2QD2A 2W42A 1U5AA 1DSSG 2OV6A 4GD3Q 3UKDA 3TLGA 4KB5A 2DWOA 3LY5A 1BS2A 4ND3A 1ZU4A 1KH2A 1L5FA 1TIBA 2J0UA 1Y8AA 2WUWE 3BWCA 4GBJA 5H8WA 1YBVA 4C0QC 2XWPA 2Y68A 3CRQA 5ER9A 1MHTA 1ODFA 3UB4A 1BHJA 3AJEA 3DE4X 3IB3A 1DELA 3MXTA 2D2FA 1R27A 2H48A 4A2PA 2B7LA 3U7RA 3FPAA 5ULLA 1O0CA 1XV5A 1H6DA 4O2AB 4YAWA 3ZK7A 3OO0A 4H0CA 4UEQA 5FL7D 1YQTA 2BFOA 3B1FA 4H4CA 1VZ3A 1QIKA 3X1ZA 3CJTA 5BSHA 5FPYA 2O0HA 4A23A 1QQBA 2WSMA 4EHIA 1I9CA 4EMSA 1QO7A 2MTBA 4QHSA 3MF4A 3IE2A 4IDAA 4AULA 4PQYA 4L8YA 4LPKA 4FXOA 1K9SA 2ZYAA 3JQAD 2FMTA 5A0FA 4TL7A 1UBNA 2CE7A 4DBLC 1WOMA 2HQOA 4TL6A 2W2KA 1WY7A 2IE0A 4K0RA 2EP5A 5EJAA 1E6UA 5I5GA 4KWTA 1G38A 3CLUD 4JJ4A 1W49A 1XVUA 1JAZA 1FJ2A 1OC4A 2YFHA 3PYXA 1JSCA 1L4MA 5CG2A 1CJTC 2VYNA 2GA9A 2VZ8A 4KAFA 4PYLA 5I48A 3CNNA 1Q77A 2ZJBA 2LIVA 5CHYA 3RD5A 5AVTA 2CE2X 5D51S 3P9NA 3G0GA 5HIJA 4Z4IA 1X80A 3V1MA 1C1DB 4ZV9A 1E9FA 2P2DA 1IUKA 3G0CA 2MU1A 2OORA 2EBFX 2JAOA 3WYEA 3OQ6A 1PU2A 4ERXA 1Z4QA 1FSSA 3WQHA 3UC9A 4L9AA 5AW6A 3VKWA 1J8VA 1G6KA 3ZJ4A 3OG9A 4M8IA 1M2HA 1TQ8A 2Z0MA 4FFWA 4FSXA 3UN1A 5K0LA 2CKMA 3N2GB 4BAZA 1H8ED 1U6JA 4L08A 2CY0A 1MTOA 5EHNA 3KKMA 1Q57A 2PGAA 3ENVA 4JB3A 1DQZA 1RT9A 3DPUA 3WMWA 4NBLA 1P45A 2ZRBA 4MLCA 4CV2A 3HP7A 2J30A 3F73A 3CN9A 1D2AA 2OKGA 5AOCA 5JW6A 3ZYZA 2J59A 2WUVA 3EE6A 1CB0A 1EGHA 4EMUA 3HJCA 2QM7A 3R9WA 4IIDA 4BWYA 4K9NA 1XJQA 4PTZA 4PZPA 2A1TR 1TZ2A 1XDZA 2W6JA 2ID9A 4R2KA 5ICFA 4DMFA 3MA0A 4CMAA 4Q1EA 4RHEA 3JW8A 1WZCA 2PN1A 2RHHA 2DBRA 2XQJA 3KR9A 4WL0A 5JIBA 1RHKA 5IH7A 2VJPA 3D3NA 1YR9A 3JATA 4H3VA 3E9RA 5G3ZA 4Y67A 5EP1A 4BEJA 5ICMA 5CAEA 3ZNPA 3B5EA 5A62A 4PVCA 3HGMA 5IDXA 2V65A 3TEJA 3GLGA 1MGPA 2GN6A 3PYMA 3QP9A 2YC2C 2X1HA 3MGBA 1SKYE 5ALWA 4JS0A 1FDVA 3ABQB 1OYOA 2XMZA 2OAGA 3PG5A 4OHBA 3H2GA 3SYLA 5IK2A 4FGUA 1TPZA 1UXKA 3LY7A 3OY2A 5LLTA 1WP9A 1YR7A 2K87A 3M6XA 1YS2X 1M7BA 4RZUA 4QNRA 3ZZ0A 4AJ2A 4LY0A 1MD9A 3JRWA 2XBUA 3OZFA 3CEHA 3I2HA 2ANBA 3L6DA 3DFFA 1LVUA 1YQ9A 3OVMA 4Y2UA 2QTFA 5IZCC 1NMEA 3HSKA 4YIKA 1IK6A 2HOQA 2YY5A 3URMA 3L1UA 2DXIA 1P0IA 3L77A 5AKYA 4CMEA 3KETA 2IH2A 2ZUWA 2NXNA 4H1VA 4ND8B 4BNHA 5B2FA 3SX2A 2C83A 2EL7A 4DSZA 1Q19A 1MRSA 4ZQFA 2VRWA 1S4QA 3ELBA 2H54A 2XADA 3CE9A 3N75A 3PDCA 4JT9A 1DQRA 1R6AA 1XL0A 2QTCA 4L8WB 3Q7EA 5BXYA 1PQ4A 1W581 4NQZA 1ETUA 5AO9A 3H3JA 2LKDA 1NYTA 3R09A 4RVCA 2VQSA 4IWXA 4UHJA 1DWOA 3HXKA 4G3XA 4UJ3A 2W70A 5CDTA 4GLBA 3LKZA 3SYNA 5C52B 2X5JO 4IEEA 1XU9A 3EXFB 4RTPA 3LXMA 2O8CA 4PYOA 4GVLA 2F1KA 4L0MA 4ILEA 2BISA 3BL8A 1JHOA 4ZCLA 2XT0A 2GCPA 3N8IA 2QAGC 3FCEA 1Q0PA 2ZR9A 2ZUSA 4M99A 1M2KA 2FMXA 3KS9A 4KW7A 5AIAA 3N7AA 1Y1SA 2CJYA 1MIOB 2I7VA 2OE2A 4OMFG 3REQA 3UAVA 5BSTA 3WICA 1XTBA 3KAKA 1WEKA 4HX2A 2X1VA 2IY9A 1AXEA 2J3LA 3QY0A 2VYQA 1UWCA 2PCJA 2IIPA 1P74A 1H1TA 2VP0A 2RJ3A 3TGWA 1QRTA 1NX6A 5F7JA 2R7NA 4UQOA 4UC0A 1B8PA 5AOAA 3GXBA 1PUJA 1Z74A 3AF3A 4B7XA 3PDIB 4I1VA 1R9NA 3A2MA 3BGSA 1YUMA 3BMOA 3GAZA 1K0UA 2PS0A 2VJNA 2IYWA 2GLXA 3VBCA 1CRQA 1CY8A 4BQEA 1DAEA 2P9EA 3EWIA 2VA8A 4H6XA 4LOHA 4OMCA 1E1YA 4Q19A 4YN3A 4Z5XA 4AO7A 5K0FA 1Z26A 1ZCZA 1ZIXA 3WKBA 1KEVA 4EG3A 5HIKA 1OFIA 1HE8B 4UAUA 4XIYA 4GPIB 4DMRA 2H2HA 2X22A 4YUXA 3G0DA 5DYGA 1SBQA 2A5YB 4GBMA 3RLFA 3CCCA 2XWQA 3S4YA 4XVUA 2X3FA 1RYDA 2EJTA 2GBLC 4ZVPA 3CNBA 3OZVA 2C9DA 5BV1A 4HN4B 2WJVA 1P9NA 4GGOA 1F8UA 4RY2A 4H1TA 4EMTA 1MFPA 3O3MB 2HMVA 1G291 3PUJA 4EY3A 1VMKA 1EDBA 4EPXA 4JNKA 3COJA 3KB8A 3H17A 4FYWA 2FPRA 1LLUA 2UYGA 4Q66C 1CJUC 3W3AD 3TDMA 1T6BY 3PD0A 4KUGA 3GBVA 1AGXA 4EFDA 3TFOA 1KC1A 3DWEX 3IEMA 3GJTA 5DBGA 3IPRA 5CFPA 3T1YB 4Z2YA 1AU9A 1KAOA 2PMEA 1UEXC 5EMKA 1QC5A 2EFGA 2FUG6 2OYSA 3K9FC 3ZBTA 1ZNYA 1P19A 4W9RA 5DCWA 4NYJQ 4IZ6A 3PT5A 4D8TA 3CRZA 2V7QA 2Y0DA 4CPDA 2HDOA 2J6HA 1M83A 5D5HA 2ID7A 3TLKA 3C4VA 4M3NA 1R4NA 4OQXA 1OMOA 3MQ4A 3PHLA 3NP9A 5JTUA 1E2KA 2P1RA 1EA7A 2Q99A 1O03A 1E2IA 2EDAA 4KQEA 1NBMD 2BTQA 1J49A 4DCNA 3VBEA 1DTEA 3P52A 1DKQA 1NI5A 4NYMR 4X44A 3KQOA 1LX6A 3QLUA 3WLOA 2NVBA 1EX1A 1S2DA 3RANA 3WQBA 4G97A 5AI5A 1JIJA 2HFKA 1ZOSA 5JWHA 2AHRA 2HNKA 2H07A 2ACWA 5KWIA 3HTXA 1GAEO 1DKNA 3CF4G 4FEGA 2IYAA 1OLSA 1G8PA 1KXJA 3NAMA 2BGUA 4JLBA 1RLJA 1IXKA 2VR1A 3MINA 2F67A 5EUMA 1G2IA 4WLUA 1MXHA 3F74A 5EIEA 5JMOA 2Q0SA 1SULA 5LIRA 4J16C 2HRQA 1QTNA 3QV1A 3WJ2A 1M8FA 1PV1A 2F8LA 1ZJJA 1V8BA 1JE1A 1X7XA 4L16A 2IQ5A 1BKSB 5ALKA 3KHUA 3L9XA 4AZ3B 3VPXA 3C4JA 2XECA 1ST3A 2H18A 3FFTA 3JY6A 1TKRA 3IUQA 1UMCA 3QE9Y 1LX7A 3K9NA 4EEXA 2ZXEA 2EWWA 2I2FA 1B00A 1ZH0A 3OKFA 4BTVA 4LS3A 4OXXA 2WMNB 3PFHA 3HO1A 2YWGA 1EP1B 1MH9A 3HKBA 2NP6A 1DAFA 3ISVA 1OAAA 4QU5A 2OG2A 4KIJA 3DE0X 3R5FA 4RFSB 4XLTA 3WLFA 3ABOB 2JKZA 3IKTA 2WAAA 1XEWX 2BGLA 2WJAA 2PUGA 3NBAA 4HLNA 3WKDA 5KDOA 4B75A 4TM7A 1HETA 1EK0A 1KWKA 4O2AA 2XMRA 3TZEA 3KTOA 2AJLI 3CJQA 3GHYA 3RC3A 1OJLA 3C1AA 3F2VA 4LJLA 3X2SA 3AHCA 1Y6QA 3M4YA 1IY8A 1I80A 3L6CA 2EJUA 2Q8QA 3L41A 2OGTA 1E94E 3G89A 1PP4A 4P92A 1RQGA 4UBLA 2YWCA 1A8PA 1PW5A 1SC9A 2ZRNA 2MSKA 1HLGA 3JCZA 4I36A 4MWDA 4WRRA 5CR9A 2A8YA 3IPYA 3V8PA 3F3KA 5FQOA 3O91A 2XMGA 3QF4A 4KYVA 4NPCA 3D6AA 4DS3A 5DN6D 1DQYA 3O1IC 1E60A 3ND9A 4Z4CA 1O54A 1UPXA 2ZTVA 3K9BA 1U2TA 4B6EA 4AY2A 3EMKA 4QHTA 2D06A 4X62B 1V41E 4GXNA 3C5VA 3CUWA 1ENYA 1KSJA 3GFRA 1C4XA 3CVWA 3R6LA 1NRIA 2GZSA 2O1XA 5LP6A 5M34A 4ZVQA 3LUCA 3ZC3A 1DQPA 4C4YA 5H59A 3DXYA 4BUCA 2IDJA 2QV7A 2WINI 4BGUA 4YV7A 1NW4A 2AUTA 1ML3A 1EE9A 1YUBA 2IOHA 2R44A 4KQ6A 4PHGA 3UWOA 4IMRA 1C1DA 2CBZA 3LOQA 2ID8A 3EIFA 4KNYA 2JBHA 1U0GA 2OVBA 2VLIA 1T1RA 1J1IA 2FN4A 3K2IA 3KSUA 1Q5PA 2BM1A 3QE4A 3IE1A 3I5AA 2X1MA 1FNNA 4JCOA 3D4NA 1KZYC 3N2GA 5AKJA 3QKUA 2P5TB 2PXCA 3U0VA 2GPJA 1WPQA 1A5AB 1P7CA 3PNLA 2PBFA 4ND5A 4PLHA 3ZUGA 1ZK0A 2ZJ5A 1QONA 3LMKA 4WFQA 2FPWA 5L51A 2DH5A 4KE8A 4YAGA 3UXMA 4LKRA 2E4UA 5FI3A 2NUAB 1M33A 2Y1DA 3WTCA 5B58T 3T34A 4BN5A 1NIPA 3ZV7A 3VPSA 1Y9DA 4PYIA 2GNPA 1NP7A 2VEOA 1ZITA 4J9VA 4PS0A 4CCYB 3IERA 3DL4A 2DC1A 1ENOA 2GDZA 2XOEA 2YXDA 4ZARA 4HXYA 1T8UA 5HUHA 3U5ZB 4XM2A 1QNLA 3DMYA 5LR6A 4MVJA 4BBZA 3MTIA 1A8UA 1RIFA 1R0BA 1ND6A 2A7XA 1ZJ5A 3FN4A 3U61B 4X5OA 4Y8VA 3GVCA 5IHXA 4MPJA 1P77A 4KREA 3PXEA 6LDHA 2X4DA 3RS3A 4J0EA 4KFUA 3COZA 5C3UA 4YMLA 4LFAB 2Q9CA 5JXHA 4HQ0A 5ALSA 5LLDA 4P3OA 1XMOB 4FT4A 4LYGA 3BE4A 3OQ1A 1D1PA 2P9JA 1VJ5A 2ZETA 3QYFA 4RQUA 3F67A 1PWEA 1E3EA 4E13A 4G26A 2FZWA 2BGRA 4F91B 5B3JC 2GAFA 3C6YA 1KJYA 1P7ZA 1KYQA 4EWLA 1IQRA 1V6AA 3ELDA 3RI3A 1W4RA 2QD3A 4H7IA 1AOXA 1MQ8B 4NHOA 4J4TA 3L1JA 1JFFB 4RH1A 2G9VA 1XKTA 1WMBA 1QTIA 3LCJA 1AS2A 5DV9A 2QY6A 5J5VA 1A8SA 1TU4A 2G9UA 4CMIB 5AQ1A 2FSHA 2UYQA 2ORIA 1TKCA 3DAHA 2ZRKA 4BU0A 4CFZA 3E3MA 1DXOA 1C1XA 1EQUA 4LBZA 3DDOA 3G9XA 4DC0A 4XWOA 2HK8A 4RWEA 1U7HA 3NHBA 4B3RB 3AJDA 1PKXA 4QJIA 4RHFA 5BQOA 2IP1A 4DZZA 3ZY2A 2HBZA 2I6FA 2J5BA 2CFSA 2VF2A 3BCHA 1WAMA 2VT2A 3S29A 4XD7A 4D4KA 4M1QA 1LPAB 3GDWA 1DBWA 1HLDA 3IXMA 3I52A 4INOA 2GJKA 2NXJA 3M4ZA 4RK7A 3ZS8A 4RCZA 2DP4E 3CSUA 5DBOA 3RCBA 3X1KA 4A4DA 4DYDA 5AXAA 3CCBA 5J1TB 1E32A 3DT9A 3ET5A 4J1QA 2ROQA 1SCDA 4LHVA 1A88A 4UUOA 3LG2A 1D8TA 1WMAA 3G2OA 1HDGO 1X1CA 2V5VA 3IRUA 3JQFA 3QOFA 4P34A 5CNKA 4BMNA 2FCAA 5AW1A 4YRIA 2HSDA 2OL4A 3K9QO 3W6ZA 1BOOA 2VDRB 1DG1G 1ZN7A 4QNNA 1EFUA 4I5FA 4F9TA 4C07A 1FZQA 5JH7B 1MIOA 4CQLB 1ZKDA 5F3WB 4G9BA 2WT9A 5GVRA 4AMYA 2FMFA 1DFGA 1QAQA 4P5EA 1Y8QA 2A1UB 5DW0A 3EZ6A 1NVTA 3ZU2A 1XWWA 2I34A 3BB1A 1G59A 2RKWA 5H02A 4KE6A 3VR3D 2YZGA 4XARA 1NBIA 2RGRA 1U8AA 3RDPA 1RQ7A 1S3FA 3PGLA 4R31A 1VL0A 1DEAA 2IK8A 3HQ4O 1ORDA 2EHDA 1QV7A 2ZRIA 3B1VA 1WMDA 5JD6A 3N2NA 2R6AA 4WY2A 3D4LA 2BGMA 3JQAB 2PTGA 3R7DA 1RRPA 2HF7A 1T15A 1N0VC 1U28A 2C20A 2HPHA 2WIDA 3IR7A 2VZEA 4PSDA 1F4PA 2O19A 3EASA 5IT9A 2P79A 3P9KA 4PG4A 2ZZNA 2DHQA 1NXVA 4PFJA 2ETXA 3AZQA 3IAEA 3STUA 4U0JA 4P54A 3UJ9A 2X5OA 2IYUA 1UP6A 2IXBA 3K8QA 4KKVA 3C8UA 2B99A 2SNIE 2ZSJA 4MHSA 1H0KA 3WZMA 2C07A 4NJEA 4XI9A 2ZPTX 4UE6A 2VHVA 4Q4LA 3OU2A 3VC2A 1QRAA 1FFXA 1FYFA 4PC2A 4BB5A 3VDXA 3TECE 3DAYA 5DOVA 3R4VA 4PC6A 3H5NA 4GDFA 1R8XA 1Z4LA 1Z6QA 3GAMA 4QD3A 2EBHX 2WHEA 4EG6A 4R16A 4UPVA 1E2EA 4UZFA 4BKRA 3MT9A 3GRKA 2W6QA 1UT8A 4CR7A 5CXQA 1OR8A 3DQPA 1BX3A 3FOBA 3GGDA 4ESHA 3KFLA 2AQKA 3DNPA 1VJCA 1PQUA 3HUFA 5DX0A 2AJTA 2H3EA 4G09A 4W5HA 4OGGA 1N5JA 1ZFNA 4NWIA 2AZXA 2H1SA 4BLSA 2DERA 1YRHA 4JODA 5KSWB 1GKYA 1LBHA 2J9FA 1J39A 4QGGA 4TTQA 3B1JA 1F60A 2HWXA 3RC1A 3SAJA 2Y76A 1HL3A 4D57A 3EGIA 3RUIA 1MXFA 2QRZA 1E3QA 3F1LA 5FTKA 1TRHA 1DGQA 1AD2A 4MJ7A 3Q9LA 3PUWA 1JQ3A 4NARA 5LC1A 4FWBA 2FRDA 4HVAA 3WNBA 2ZYDA 3FB1A 4U7WA 2J8ZA 2O2ZA 1RWOA 5BR7A 3F90A 3GGGA 1YB5A 4EB8A 4WGGA 3O4HA 4ENTA 1KQNA 2GO1A 2IDKA 4NYMQ 4UD2A 4UM9D 3W1EA 1BO6A 1O97D 3CR8A 3F8SA 3I01M 3G1UA 1YO6A 3UMRA 1TEZA 2GFIA 2IP4A 4WY5A 3VSAA 3K1TA 3EW7A 1CY4A 1MLDA 5TS2A 4TV8F 3LBNA 2HK6A 5ALGA 1UBFA 1LKZA 3ETHA 1U5BA 4RA6A 5F7ZA 1V2HE 1XVVA 3B8EA 1NYRA 3S99A 3MPUA 1N3LA 4ZC1A 1N2CA 5JQWA 4UUBA 4UARA 1EJ2A 4WDQA 2Y2UA 4YCMA 1N2HA 2LV8A 4D8WA 4HNSA 2GD1O 3C5HA 3F7OA 3CNOA 5E3IA 1Z5NA 2HLNA 2XTAA 4P31A 4C7KA 5T8KA 2DT8A 4QPNA 4TT3A 2GKGA 4B4WA 1Z7BA 4HXEB 1CU1A 1URPA 2IOFK 3LLMA 4MQFB 1LDGA 4ZKEA 1TM1E 1BYUA 4E08A 1TAQA 3FNQA 3PKIA 4P81A 5AHOA 2G36A 1JBEA 3DTTA 5AD1A 4WXEA 1FYWA 5K0TA 1M2OB 2RAVA 3R20A 4WEOA 1EUCB 2JZOA 1UKVY 2P3QA 1T3GA 3FPKA 1GPDG 4F06A 4HNUA 4TMTA 1FK8A 4TL9A 1F2UB 4DKXA 2J0QA 4RFSA 4YRSA 5JROA 1Q22A 4LDZA 5J4YA 3TPFA 1Q0SA 3DNMA 1SU7A 2XTJA 1N5RA 1XROA 1Q3KA 1JSZA 2C4HA 3FDIA 3JQRA 1T0UA 3P9ZA 4AY5A 3HKDB 5JLJA 3GMDA 5K6AA 5CW2A 2HU5A 4RF3A 1GZ3A 3V6MA 3DTVD 1U0EA 4U7PB 4MVJH 3GEHA 2LW7A 3TNFA 4IF4A 4UXHA 4AURA 4LCBA 3OFNA 1RXVA 1TGVA 3JR3A 1CFJA 5KQGA 1E0KA 1RCFA 3WP1B 4NF2A 4HRXA 1G7SA 3M7IA 4U7TB 3DAGA 5HKAA 3LPDA 3FR7A 3OZBA 5K99A 5IUKC 1T6XA 1WOYA 5F12A 4OJTA 3AEQA 2OCGA 4XUDA 2PZ8A 3BAZA 3V2HA 3BQ9A 2Z3ZA 3AI1A 3DH0A 1B8UA 2YFQA 5GOTA 2AQIA 3HUDA 3C7CB 3ML1A 4BN0A 2ZBUA 2YIMA 1A50B 4RSRA 5K8CA 4IRXA 3N6XA 1E1LA 4QGHA 4RTRA 2JIBA 4GZ3A 3RSFA 1AA9A 2FPGB 3I0NA 5FB3A 5J4VA 3LX6A 1GGEA 3WC4A 3KWMA 3NI2A 4B2PA 1ZIPA 5JALA 1IN6A 1W5BA 4JKOA 3IBFA 2VDJA 3KOMA 3TZKA 1VE1A 3WNZA 3W8RA 1E1CA 2R87A 1PL7A 2P1DA 3FSGD 3K94A 5EN4A 3RARA 3W2EA 1BIFA 3M6LA 3P94A 4JQZA 4QXPA 1CPYA 3AXTA 3FMFA 1XZ8A 2A5DA 4H7JA 2FX3A 4MIOA 2H1IA 1HMPA 3I6BA 3TJZA 3I2FA 4BP8A 4ZZ1A 4KV9A 4IIJA 1A77A 2QQGA 3I9MA 4FZ5A 4UPEA 3OEEA 2HRBA 2P9QA 4L07A 1ZEMA 5G1OA 1R0SA 1NI3A 4OKSA 3HVJA 2CJFA 5BN5B 2BZSA 3SXUA 4DQUA 1V35A 4ETNA 4BJ6A 2RC5A 2COKA 4AK9A 1J22A 2HRRA 3QH4A 4GZMA 4I55F 1S3IA 2BR3A 1NBOA 3U4AA 1QGDA 3E23A 4P38A 1YWGO 2O8DB 1JDNA 1U81A 1NASA 4UM7A 3EQ2A 4MICA 4UHKA 3PXUA 3FHJA 2ZUEA 3OZCA 2DHRA 2HD4A 1MAWA 2YV2A 4ISCA 1AN0A 4CCYA 4Z99A 4MI3A 5CITA 4EUSA 4UUAA 4Z3OA 1E3SA 1RAEA 3EK2A 3WGHA 1Q12A 2HA2A 1DC3A 2V1UA 1DG9A 1H9AA 3WL3A 4HQLA 2I9KA 2ZYHA 3PVCA 5EKTA 3MUEA 1Q1QA 4K9KA 4B0PA 4G81A 3HUUA 4CM9A 4PFQA 1JJVA 1WDKA 3RS7A 5IT4A 3P2IA 4FIZA 3A6PC 1U11A 3H4IA 4UOZA 2W4IA 3NHYA 1EFKA 1L9XA 3ETGA 1ZAKA 2WM8A 3H83A 2Z6UA 4DMUB 2X5XA 4RWZA 4EITA 3RODA 2I3GA 5J3JA 1LNZA 2QRJA 4QEDA 4AX4A 2O7NA 3MTBA 3OFKA 2YBDA 2IDMA 5TARA 3MFQA 4FFLA 4C2AA 2GLUA 3PICA 3EIOA 2C0QA 3ZVRA 1OH8A 3S8MA 1VPDA 1V37A 1Z07A 4AO6A 1ZQ9A 4XA8A 5BW5A 1R9GA 1NBEA 2I6UA 5E9QA 3S2ZA 5MFPA 2WSSA 5C2JB 2D0DA 1ZQ1A 3AO0B 2W6MA 5JPCA 4ZOCA 2A58A 5CK4A 3A37A 3O4FA 1DHRA 4B7ZA 1EFRA 1I2CA 3O7WA 3AUUA 3U44B 3LCUA 2OP1A 1IEVA 4WLOA 4OHFA 4AKGA 3SP1A 3ZIUA 1G19A 5HJ2A 4P3YA 3EUFA 1TC1A 2QLLA 3DOEA 5TPZA 4TUYF 3RNOA 3G02A 3NHSA 5EERA 4XCXA 5DSZA 1O8BA 5BR8B 3VU1A 4OB7A 2BAGA 2G7MC 4B3HA 5ESXA 5M7EA 1BWPA 3K1AB 3FZNA 3VGPA 3CF6R 4P0PB 3AL3A 1Z6XA 2UV8A 2EKZA 1TF5A 4EJSA 3TNJA 1QTQA 2IEAA 4AZ0B 2NVOA 2WKPA 1QP8A 3B3JA 3HCPA 3PJFA 4KN5A 4MQ6A 1CRWG 1OC2A 1UPCA 1R0RE 5FYQA 1T6YA 2ZRJA 3RW9A 4AJ4A 2JLUA 1FJXA 3SPXA 1Y3CE 3BKWA 3IMGA 4RZHA 4UZEA 5I8WA 2PXXA 4KFRA 5CYFA 3PNQA 1WULS 3KZOA 2SKCA 3RRBA 2PA3A 4BO8A 2A1UA 4TYMA 3L7DA 4CEJB 3AM1A 4RPLA 1YD7A 4OGLA 1GGHA 4RV4A 2PM8A 1JBQA 1W5TA 1CY1A 2YYSA 4WOCA 5LKRA 1K7EB 4M8KA 1NV8A 1TYZA 1RI2A 4NU6A 3KZNA 2YJ4A 2AI2A 1WJGA 2E4XA 4QJ5A 1DG3A 4IVNA 3RKRA 3RV4A 3B82A 1ISJA 2R1VB 3VJMA 4BECA 5L4LA 3CVYA 1UPBA 3VYRB 4PHHA 1U0NA 1MH1A 5AHKA 4MYUA 1XMSA 2ZATA 1DNPA 5J43A 3HVRA 3Q7RA 4M1EA 4B71A 3VTZA 1SXPA 1ORVA 4G0QA 2JVIA 2REXB 2FQXA 1PJZA 3O26A 3Q8WA 4KE9A 3H8JA 3BMCB 3CMCO 5D1HA 2RAUA 1W94A 4X6UA 4JJ6A 3A1FA 5GJCA 2I4RA 1DOAA 1NW9B 2YV4A 4PSCA 3CUSA 3QVLA 2WTUA 2HB6A 3IXLA 2HAEA 4I8IA 3QWIA 4YT5A 1R3UA 1JEOA 1EX7A 1HT1E 3SXJA 4F4HA 4JJ7A 1Q1AA 1SA0B 2HIGA 4HEHA 4LJ9A 3VHLB 4YNBA 1A2KC 4OKNA 3GNSA 4PLZA 4AD8A 4ZVRA 1ZJ4A 1SVKA 1H8EA 4X8HA 3NM5A 5NLLA 1JMKC 4ZYUA 1HTTA 1DBVO 1K75A 3GUUA 4IBOA 2ZUUA 3DCIA 4D96A 3LLSA 4B6JA 4EJFA 1J8YF 3RRXA 2W93A 4F04A 2VRCA 1QHGA 2QL5A 3LAWA 1L5KA 1Y7LA 3ZWDA 4JLDA 2P2CA 4IQGA 4MW2A 5JOQA 3C6KA 2QI9C 3NVAA 4P9NA 4F4UA 2OY0A 2BF4A 4S0ZA 5AQEA 4DXHA 2IZOA 4LCEA 4TTTS 3ZY4A 3BJMA 1AG9A 1FNMA 1MO4A 3WKCA 4OI1A 2YXEA 4IXMA 1V26A 2GWHA 3GVXA 3PTZA 2NTEA 3NTXA 4L5CA 4DCTA 3KT0A 4EI7A 1QF6A 5CVEA 4S12A 1BG6A 2VPQA 1W36B 1XKLA 2J0EA 4FHCA 4QUGA 5FI0B 2B8NA 2QTTA 3N05A 1NW7A 1V6SA 3CPEA 1QQ6A 2A78A 3L05A 5TEWA 2O8FB 4RGBA 1LLDA 4D9NA 1CP2A 4I55B 4XUGB 4HVLA 4LBWA 5I4IA 3O8RA 4XJVA 3GRCA 5F3RA 2XD4A 3L7MA 3VKHA 1CJVC 1Z4KA 2JJYA 3MZ0A 3NIBA 1CT9A 2IHZA 1GPAA 3BDAA 3NC4A 3K1ZA 2GF2A 3N0RA 1GL3A 3K1YA 3TLEA 4B40A 2C98A 1SBIA 3DZIA 2PSHA 5EYPA 5AXBA 1UKCA 2P6UA 4LSMA 3RRMA 1OCEA 4XWAA 5JNRA 2PBZA 4BZWA 4HO1X 2IE8A 1YOVB 4MAAA 4ZKDA 5A3QA 3A28A 4DEXA 1TM2A 1AXGA 3BTSA 3DBIA 3GCDA 4NENB 3UJNA 1J8MF 4BMCA 4TGLA 1GADO 5DT9A 4D79A 3RTGA 2XLCA 2FN3A 3RRYA 3UJHA 3VSCA 2R0QC 1GGKA 1AUVA 4NBTA 3MN1A 1PUIA 5KNCD 1F2UA 4M0EA 4IZIA 4J4HA 4O4LA 1SVIA 3DCNA 1C7ZA 3N2KB 2O8BA 2AR0A 4WCFC 3TEFA 4QPPA 4YIHA 3HLTA 4DNQA 2FR1A 2XOKD 3C6MA 4CHTA 3D4IA 1LC3A 4Q02A 5TPWB 2R86A 2NPFA 2FVYA 3OQOA 4AIRA 1Z2CA 1UPFA 3LJKA 1QFYA 1ZGAA 2G72A 5HFAA 2WIGA 5A5DA 2QSJA 2GB4A 3MT8A 4IS3A 1U9IC 1GP2A 4Q3AA 2F43B 3BGOS 1QO0D 1YDWA 2Q3FA 3CZAA 4J7UA 4JYPA 3N2IA 5THXA 2PY6A 1ZIYA 3VNUA 5KJ1A 1IZ9A 3LF1A 1F8YA 1E9EA 2MIIA 2KBEA 3NGXA 5F78A 2FPLA 3HDQA 5LDGA 4LRQA 2OFFA 3C48A 4FQ8A 1A9OA 4KG7A 4EJ6A 2GDJA 1TA9A 3U56A 2D74A 2DULA 4EHFA 4BCDA 1U4SA 1A3CA 1SU8A 2UZ0A 4DLXA 2F90A 3ZGLA 3C39A 2VCYA 1J5PA 3T5AA 3STYA 3LO8A 4N7JA 4IGEA 4TUYB 4EVSA 1UJNA 3KOOA 4R68A 3UH1A 4ZYWA 2GEBA 3X1XA 3WGUA 1FNDA 4US1R 1SK9A 1PZHA 4BNWA 3KKEA 4ARAA 3SBEA 1CJCA 4RQAA 4RD0A 3TTSA 1G21A 2QRUA 4E5NA 4HX9A 3LC0A 3Q3CA 3FCSB 3PHGA 2DLDA 5H1YA 4AO8A 1FJGB 4HUTA 1FNBA 4FYHA 3ZTYA 2B9VA 5AKKA 2XJ9A 5JEDA 2ZTMA 3FYHA 2FWAA 4BTEA 4CG2A 2PUEA 3HR7A 1AB6A 2XE7A 4MS4A 3RRJA 2X9GA 3KVVA 5AK5A 3F96A 1MR3F 4J9UE 3IDSA 4NS4A 4QC2A 5CURA 5FULA 4N48A 1R5BA 3IIIA 4IYRA 3CHYA 4ZYZA 3GOQA 2FWBA 1RP7A 2A9FA 5BN5A 1SXQA 1I30A 3WGLA 1Y6ZA 1ZH6A 4FYXA 2Q7OE 4CIXA 4MZDA 3RAGA 2WFZA 1EG2A 3A1WA 1ZGGA 4EUEA 1RVDA 1U8YA 1YZNA 2IV7A 1CUSA 5BWLA 4EHLA 3MYYA 2QG4A 4QAJA 1AC5A 2X6TA 1VMDA 3DB2A 3W3AA 3ZHQA 2G1PA 3T3HA 3V4ZA 4DR7B 1NI4B 3PR1A 3PQ4A 4V0LA 4F21A 2WHXA 3MUOA 4NONA 4TMWA 2K2WA 4RS4A 3E5RA 4JLUA 5TMDA 1BWQA 2FZLA 3QEOA 4Y2YA 3NH6A 4LY3A 4ZGWA 3HJGA 2E6UX 3O21A 4CMHA 4RPCA 4UHFA 3GJXC 4IH9A 3N39C 5EP3A 4IEFB 3LWZA 3V4RA 1T8PA 2BFPA 1GG8A 2ZIUB 4DLLA 2IEGA 3O93A 4DR3B 4D42A 3AVOA 3RU9A 3LZCA 1E9SA 1VFPA 2CNNA 2XVYA 3MG9A 2JBWA 3U9LA 5JAHA 4G0UA 2E4WA 5LYYA 2HW8A 3K4PA 2CUKA 3THYB 3EN0A 1KP9A 4AMUA 2A35A 1V11A 1NBMA 1DKMA 4WACA 2GHTA 4PYKA 2NZXA 5BPHA 3R5JA 2PL1A 1UQTA 1Z39A 4KOAA 3TNLA 4OCZA 1ZRSA 3IKLA 4OM8A 5AW9A 3FW1A 4DMLA 1NR7A 3EULA 1KVUA 1PDVA 1Z73A 2H2DA 4TXMA 4UBKA 5K20A 3EDOA 1RE1A 3CISA 4BFWA 2FV8A 1QWOA 2X19A 3PWZA 4A3SA 5FBVB 4OQFA 4Z8YA 4XFDA 2I3DA 4MJ3A 3L4SO 1P7PA 4L22A 2YV5A 4RHXA 4YT8A 3DV0B 3ETLA 5TMEA 2C0PA 2CB9A 4UDXX 4AJ1A 2GKOA 3R9XB 2XLBA 2JCYA 1BU5A 3CFYA 3TYXA 1G60A 1J42A 3W3ZB 4E5YA 2YVLA 3R76A 4LJSA 4ZI3A 2ZXUA 4NCBA 4JLAA 1QS0B 3X3HA 2IEDA 3BJRA 1G0NA 1WXHA 2TMYA 1EP3B 1MNAA 2XA1A 2IV2X 3S44A 1L7VC 4CYMA 3WRXC 4D6YA 3G23A 5AH0A 1K8XB 3SCZA 5L3SB 1PJTA 4O4JF 1ZBQA 2QZZA 3T94A 3QKIA 3K1AA 1CHNA 2UZ1A 3SZOA 3ZY3A 2R4TA 4D5GA 4A36A 3IIJA 4M9XA 4JV5B 1Z4OA 1YIAA 2FU5C 4I4LA 5GJWC 1OX4A 1ZJWA 3G8DA 2QRVB 4R8KA 5KNLA 2BV3A 3DE1X 2XUPA 3C8DA 1THTA 2FUKA 2WKRA 4TV8A 5KWVA 1VE5A 4BVEA 4LF6B 2H4ZA 2JH9A 4HXFB 4NX2A 3ZU4A 2XDYA 5SICE 2IUSA 4KI0A 1PR0A 3ONEA 3DTVB 1HPLA 3G0IA 4WCDA 1N77A 3T06B 2PL3A 3C4QA 1VXRA 5FO1A 2PR2A 5AYVA 3UJ7A 3OPMA 2C4VA 2OXTA 1XKQA 5L95A 1BXGB 2QHXA 3TDKA 1JB9A 2PKYX 1D5CA 3TSYA 1JH9A 1IN8A 2PT6A 3FRJA 3D6MA 1A69A 2EARA 2QJRA 2RGCA 1H0HA 2R1VA 2Q3JA 3A04A 4XOIA 4JK3A 4YRBA 2OILA 2ZJFA 5LJIA 3V2UA 1QDUA 1R4ZA 4CTJA 3HO8A 5DN6A 2EX4A 1PLKA 3L4EA 1EWRA 4MRAA 1W2HA 1L4KA 2DPGA 3QXGA 2NZWA 4Q01A 2JKYA 2VA9A 3H0KA 1E3MA 1GFIA 1LSJA 4UBMA 4MR9B 1BDIA 2J9XB 3W04A 3ZQ6A 3DEZA 1QH9A 3OIUA 5J58A 3RK1A 3IOMA 3TXXA 3WMXA 3I58A 5EXXA 3JVVA 4KPFC 4D0LB 4C7XA 2VT6A 4KXWA 1Y5LA 3ADOA 1U0LA 1UWKA 3OJ0A 5D3KA 2A0FA 5HF9A 1NLUA 3KJHA 1OZFA