1YS2X

Burkholderia cepacia lipase complexed with hexylphosphonic acid (s) 2-methyl-3-phenylpropyl ester
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVGGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lipase
publication title Mirror-Image Packing in Enantiomer Discrimination Molecular Basis for the Enantioselectivity of B.cepacia Lipase toward 2-Methyl-3-Phenyl-1-Propanol.
pubmed doi rcsb
total genus 131
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2005-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ys2X00
1EH5A 4GWLA 2BCEA 2OG1A 4QA9A 5K3BA 4C4YA 2XMZA 3I1YA 2VJAA 1XRLA 4MQMA 1KU6A 4KACA 4LXGA 3LCRA 4OYYA 3O9VA 4UHCA 4AMYA 4KE8A 3FVTA 4BB0A 3RARA 1VKHA 5AKJA 1S8OA 2WG0A 5IKXA 1YA8A 3SK0A 3EBLA 1IZ7A 5C81A 1U8EA 1Q83A 1AURA 1W1IA 3OOSA 2C7BA 5AKIA 1JMKC 4HZGA 3HJUA 3QMVA 4A5SA 1R3DA 4KE7A 3I28A 2VAVA 1YS2X 3F9CA 2VAXA 5CT5A 2PSEA 2H7CA 1P0PA 1CFJA 3AINA 1R4ZA 4OB7A 2CJPA 4G1FA 3ED1A 4EY8A 5AHXA 1TK3A 4FKBA 2ZYIA 3PUHA 1QTRA 5DTJA 4DNFA 1JU4A 3R3YA 1AGYA 3WL6A 5AH0A 3AIMA 1JFRA 2C58A 1QIMA 3IUQA 2ZJ6A 4GBGA 4UBIA 2RHWA 1E89A 5AKHA 1Y7HA 3GFFA 4MWSA 1XZCA 4GDMA 4RE5A 2PSHA 1THTA 4BE4A 1ZI8A 3ZI7A 3V1MA 3SC2A 1O6FA 3GBSA 3LIPA 5JANA 3PDCA 4KE9A 5D7BA 1NU6A 4O08A 3WWOA 2VJCA 4C88A 4Z49A 4BC1A 2XUOA 5BV7A 3WA7A 1XQWA 2JGKA 2PL5A 5E4TA 1MX9A 1EXWA 3RLIA 1LPOA 2CB9A 4FLFA 4KJXA 4Y2TA 4X85A 3D2BA 3O9MA 4FFWA 5J3JA 3PICA 3H19A 4DTCA 4H7JA 5DWDA 3OTQA 4J3JA 3O0DA 5AK5A 3LP5A 1QOZA 5T4HA 4WY5A 3VJMA 4HAIA 4L0CA 3D7RA 4CI9A 3A2NA 4GHWA 3C6YA 3JW8A 3HXKA 4M0FA 3O95A 4DNOA 5T4FA 5DLPA 5C8ZA 5I8PA 1ORVA 2XLCA 4BVJA 3G9UA 4PF1A 4CCYA 5EHXA 3VJKA 2K2QB 5JD6A 1J2EA 1UK8A 4KYVA 4AO7A 3KWFA 4RGYA 2HA2A 3W9UA 1SOMA 5ALYA 1PFQA 2ZSIA 1ACLA 1MPXA 4IQ4A 5AICA 5CBKA 4Q05A 4DIUA 1QZ3A 3WKCA 3BIWA 1GQSA 1JI3A 1USWA 3SWWA 4LKOA 4ZV9A 4LHEA 2IX9A 5ESRA 2QUAA 3HEAA 1MO2A 5ALKA 4N5IX 3W06A 1I6WA 4C4ZA 5AOCA 2QXUA 5FXMA 3DYIA 1N5MA 2C5GA 1UOQA 4U2DA 3L1HA 3R3VA 4WCVA 5YASA 5A7FA 2Z3ZA 2V97A 3DYVA 3W2TA 5F4ZA 1D07A 1O6GA 2JGFA 5K3FB 1CUAA 1CUJA 3G0GA 3F67A 4J0CA 4JH0A 5LZ4A 2PBLA 2CEKA 1UWCA 1TQHA 1BROA 5ALZA 1QE3A 3YASA 4BCCA 3OPMA 3FNBA 3G0CA 1XKLA 3G0DA 4J0HA 4MQLA 3VVLA 4H7IA 4UFNA 3R0VA 1A7UA 4JUIA 3WQHA 4DNPA 5AM2A 3E3AA 3W05A 2I78A 1XRQA 2QS9A 5D3ZA 1DX4A 1GPLA 1Q0RA 1ZI9A 2WHQA 3HSSA 2J3DA 5A6VA 3B12A 5FLKA 5CMLA 4U2FA 4FWBA 3FSGA 3DKRA 3BF7A 4Y2QA 5DNVA 2RGUA 4FLEA 2OPHA 1ZD2P 3QPCA 1BEEA 4MJ3A 1DQYA 2GBCA 2Y2VA 4OU5A 3FAKA 5AI4A 1SCIA 2ZSHA 1BEZA 2WIGA 5ALXA 3C45A 5ALEA 3O4HA 5ALGA 1VE6A 4WDQA 3GROA 3RKSA 4Q3OA 1WHSA 1YB6A 3QBJA 5JZBA 3A2MA 1E66A 2R8BA 5JAHA 2I3DA 2ECFA 1CEXA 5AKGA 1ZJ5A 5HF5A 4BCDA 1IZ8A 5I9IA 1ETHA 2DHCA 1NU8A 3I6YA 4FNGA 5AK4A 3CN7A 4BAGA 2D5LA 4B83A 3I2IA 3HLKA 4KAAA 1IMJA 1HKHA 3LIIA 5LZ2A 1CUCA 1QTIA 5EIAA 1H23A 1YS1X 3QM1A 4B81A 2AJLI 3DCNA 4YX9A 5AI5A 4PSUA 1WM1A 2QOEA 3IA2A 4BAZA 5EIEA 5A7HA 3L1IA 4ARBA 1W76A 2XQKA 3LS2A 3V9AA 3B3QA 5JZ9A 1ORWA 3E1GA 3DNMA 4QDUA 1SCQA 4G8CA 5IH7A 4JNCA 1WB5A 1CUEA 5ALWA 2HL6A 1EDEA 4D9JA 5CH8A 5ALDA 3STWA 5JD5A 3MUOA 2HDWA 5CW2A 4GECA 4HS9A 4NZZA 5EHZA 3HYSA 3C6BA 3HI4A 1G5FA 4X92A 2XUPA 2Z5GA 4GI1A 4MYSA 4X95A 1VZ3A 5JALA 4ROTA 1TKRA 3WYNA 3WZLA 2HA4A 4K2AA 5EIHA 4KAJA 1EVQA 5A2GA 4GXNA 2OCIA 1HL7A 4QZVA 4BTVA 2Y2UA 1DQZA 4W63A 4HRYA 2DFPA 2CBGA 2HHAA 2XUDA 2RHTA 1CPYA 5FPQA 4QDOA 4QEKA 2QXTA 4BZWA 1EX9A 2OCGA 2VT6A 4WFJA 2CKMA 1QIKA 3IULA 5ALUA 3FVRA 2OGTA 3K2IA 3QH4A 2JGIA 4UPDA 5HKAA 4C4XA 3M3DA 4G9EA 2QJRA 1OCEA 1MU0A 4Q3LA 1SCKA 5CT4A 4WDRA 5HQ3B 4PV7A 1HPLA 4KE6A 1EINA 4J0KA 1ZICA 1AQLA 1C7JA 3WIOA 4ZWNA 4AXBA 2HFJA 1VA4A 2BAGA 2OGSA 3RM3A 4ZRDA 4FLMA 3F97A 2H9YA 5DNUA 4IH1A 3FOBA 1CUXA 1W6RA 3I2KA 2CZQA 1BE0A 4UBJA 4WJLA 4EY7A 5JADA 3EQ7A 4FHZA 3CXUA 1X2BA 1EA5A 5AM1A 3BE8A 1QIEA 5AM3A 2VJBA 3G9ZA 3I2FA 3FCYA 2OAEA 3FLBA 2VEOA 1PJAA 3F96A 5JZSA 5AOBA 2EEPA 4B6GA 4K6HA 1K8QA 4RE6A 1JJFA 1EB9A 2WUFA 2XUAA 3OC0A 3WWEA 4M0EA 2PKYX 1XZHA 2PM8A 2QVBA 3V1NA 1QFSA 1XLUA 4DM7A 3S2ZA 2WIFA 1BN7A 3E0XA 3G8YA 1UOOA 4PSDA 2WHPB 3C5VA 4HXEB 1GPNA 3I2GA 3V1KA 4UHFA 4QWWA 3R3ZA 2ZYSA 4Q1VA 5IVHA 5JD4A 2JBWA 1MN6A 1JT2A 4UHHA 1LGYA 3AZQA 4AMZA 4OPMA 5E4YA 3ANTA 3DL7A 2ES4A 3IUNA 5ALOA 1EK1A 2OQVA 1ZD3A 2GBGA 5CURA 1ZJ4A 5CTAA 2GYVA 2HA0A 3R3XA 1LLFA 3WL8A 4L9AA 4I3FA 3WL5A 1EI9A 4LXHA 3S8YA 1W4LA 3C87A 4I4CA 4B9AA 3GZJA 3AUKA 2GYUA 4GLBA 4ZI5A 4EY4A 5K3DA 4X6UA 2AJDA 4GW3A 3DQZA 3H18A 2WFLA 1VXRA 4F0JA 3PF9A 1RP1A 3WK9A 4W9RA 2XMQA 3OG9A 4BDSA 1DX6A 2ACKA 3D3NA 3L1JA 3WKBA 2WUDA 5AKZA 2QJWA 4NMWA 5AI6A 4N8EA 3DOHA 1FSSA 5BOVA 5JASA 1AKNA 2XB6A 1ODTC 1XRNA 1EDDA 1XRRA 4Y2VA 4M0MA 1ODSA 4H7HA 3CCCA 3H04A 1QIIA 1CQZA 1TCAA 2XMBA 1BCSA 2BGRA 1T4MA 1TRHA 4J0IA 3G9TA 5EHNA 5ALVA 1UZAA 1DU4A 2XMRA 2XDWA 2ZVDA 3U0VA 1E3QA 3I2HA 3FYUB 1GQRA 3DJYA 2WKWA 5K5EA 1LPNA 1KEZA 3H2IA 1ZOIA 4U2EA 4DSAA 1BS9A 2AXEA 2G5PA 3ZWQA 2IITA 4E14A 4H7DA 2AJBA 2BKLA 4Y2XA 2B61A 2WIDA 4C6HA 5KWJA 5DYYA 3EQ9A 4EHBA 3I1IA 3PUIA 3H1AA 5DYTA 5SYMA 3WJ1A 2VJDA 4QDTA 4U2GA 1XRPA 5HK8A 1CUUA 2OQIA 1X2EA 5LIPA 1UK9A 4N8SA 2WM2A 3ANSA 3FLAA 1Q84A 2X76A 2JGJA 3D2AA 1CUZA 1F6WA 3AZPA 3NGMA 4OYLA 3JWEA 4BCBA 4UFPA 1LZLA 3F98A 2XUQA 3G0IA 1QIHA 4KR0A 3WWDA 3QITA 1BCRA 3FYTA 3AIOA 5AKLA 3NUZA 2AJ8A 1QFMA 4Y2SA 2PUJA 2BUBA 5SYNA 3EF3A 5JATA 3AJAA 1M33A 3AZOA 4PSCA 1WHTA 4Y2JA 1KU0A 5FRDA 4G8DA 4X6XA 2XUKA 5EI5A 4MWTA 2FUKA 4Q34A 1XZMA 7YASA 3H0CA 4OB8A 2OCKA 1EB8A 4A23A 2BFNA 5IVDA 3STVA 4X97A 4UBMA 3IB3A 3K6KA 1DINA 1QIJA 1ODCA 5DNWA 4UBOA 5CRIA 1CR6A 3G7NA 3M82A 1OXMA 1WPRA 2V98A 4AZ3A 1E8MA 3D5EA 1YSCA 2BUCA 2W22A 4OU4A 1CVLA 4DNQA 4P9NA 2HFKA 3H1BA 5ALRA 3WI7A 1W52X 1OILA 3DDUA 3EIOA 4B0OA 1F0PA 1VXOA 1MX1A 1VE7A 1G42A 3GELA 1JMYA 2DHDA 5DTIA 4E11A 3BDIA 5AI9A 1CLEA 1MTZA 4CG2A 5BWCA 4F21A 2RONA 2WG2A 2QTBA 1K6EA 5FP0A 1A8UA 4I19A 3I6ZA 4C01A 1H2YA 4EY5A 5CH3A 5ISMA 3BXPA 4CIAA 3VJLA 2FX5A 2Y6UA 1TIBA 2XI4A 4F5ZA 3GA7A 5D6OA 5CXXA 2RAUA 4J7AA 4FFVA 4X7BA 1QO9A 1QGED 1JJIA 5LKRA 5A71A 5AKEA 3G9XA 2XUHA 4QLAA 4NVRA 4CG1A 3DOIA 1J06A 3IDAA 4G5XA 4BATA 4E46A 5ALPA 1MX5A 3ESDA 4W1RA 4OD0A 4CCYB 5LKAA 3PFBA 4X91A 3M81A 4QDXA 1MAHA 3BJRA 4N8DA 1LPAB 5ALQA 2DSNA 1BRTA 4B80A 2JGLA 1R50A 4DMFA 4INZA 1VA5A 3BWXA 2HRRA 1Y37A 3FBWA 5I7UA 3W9BA 5AO9A 1GKKA 4L72A 5C8VA 2W6CX 4WFIA 1Q0ZA 4AZ0A 4FTWA 2OCLA 3KD2A 2WFMA 3OURA 4S0XA 2BUAA 2HU5A 2FJ0A 4AO6A 3D2CA 5AK6A 4K6GA 4FBLA 1J1IA 3O4GA 1L7RA 1LZKA 4AQDA 3ESCA 1UKAA 2YXPX 4B9EA 4EY6A 5LZ8A 3V48A 3T52A 2YASA 4EBBA 2FJPA 2YH2A 1FFEA 1IVYA 3KSRA 1HDEA 3WIBA 1FFDA 4XIIA 2WTMA 4XJVA 3KWJA 2IIVA 5JAOA 3H2JA 1LPSA 2X8BA 2QZPA 1XZIA 3WJ2A 3FCXA 4OSEA 2CMFA 1WB6A 4BVKA 4PO3X 1XKTA 4BYMA 2C0PA 4Y7DA 3ESBA 3TEJA 3IIIA 3ZLTA 4AN1A 3MVEA 1CUDA 5JYCA 2GBIA 3C70A 4N5HX 2WUEA 3D0KA 5HF9A 4X93A 2P8SA 1R9NA 2QT9A 2GYWA 4LIPD 1P0QA 2PU5A 5AI8A 2VQ6A 1W75A 2WUGA 4BC0A 4DYHA 1UOPA 5KWIA 3A2LA 4ZREA 1IUPA 5HFAA 1P0MA 4OUKX 2BGNA 3UMJA 1E8DA 3QVMA 1XZGA 3UUEA 4AX4A 2RIPA 3ZV7A 4PW0A 1AX9A 3ZLVA 1EK2A 4ZXFA 4EB0A 2QMQA 5LZ9A 4Q3KA 3O4JA 4G4IA 1T2NA 1XFDA 3VISA 4RNCA 4QDZA 5LP1A 1CUWA 2XQFA 5K3AA 5A7GA 3VDXA 3WK4A 5KBYA 3CCBA 1A88A 4IH4A 5HKBA 3Q8WA 4X00A 3A70A 1GT6A 1TCBA 3H2KA 2JF0A 4BZZA 1J07A 1CUIA 1CUGA 2EDCA 4TPKA 2JIDA 2HM7A 3W04A 1GPKA 4MYDA 4H35A 5ALJA 1DWQA 3B5EA 1AMNA 6YASA 1CUYA 3ESAA 2VT7A 4E15A 1XZJA 2ORYA 4G9GA 4RPCA 5HZGA 4B85A 4Y2UA 4BTLA 5LZ5A 2JGEA 5FKJA 2G5TA 1H2WA 3QPDA 5EGNA 3WWPA 2XMCA 2DQZA 3HC7A 1X70A 5HFNA 4OB6A 3STTA 1H2ZA 3OM8A 2WU4A 4LYEA 2O7VA 3GUUA 2HU8A 1WPXA 1JJBA 5E4JA 5T4BA 2I03A 2HIHA 4BP9A 3V1LA 3LLCA 5AIAA 5CT9A 1XQYA 3BF8A 2H1IA 3IVMA 3WKAA 1LPMA 4JYPA 1AZWA 1F0NA 3QMWA 4PQEA 2YYSA 3PI6A 2V96A 4P93A 4LYDA 2O2HA 2WJ6A 1ZI6A 3X3HA 3STUA 2DCMA 3R3WA 1XLVA 3UUFA 1B41A 1CQWA 3DKKA 4FDMA 1IUOA 5A62A 1JU3A 1QIFA 3FWHA 3IUMA 5IVIA 2ACEA 2XQGA 4EA6A 3IUJA 1QJ4A 3ILSA 4CG3A 4Q82A 1ZIYA 5CH5A 2JGMA 2XE4A 4DLNA 4V2IA 2XMSA 4NS4A 4JYMA 1WCYA 4PNZA 2VSQA 2WJ4A 2C5FA 3H2HA 3E4DA 2UZ0A 4EZIA 1YB7A 1XZKA 1HBJA 1THGA 2WHRA 2QRUA 2QM0A 4B84A 3IURA 1EDBA 1XZBA 1XZEA 4J0JA 3TRDA 3M83A 5HF6A 1R88A 4XWGA 3QYJA 3AFIA 2WFZA 3N2ZB 2WSLA 1WB4A 1R1DA 2HA5A 3WL7A 4MEAA 1K4YA 1Y7IA 2C0QA 4KEAA 2OLEA 2O7RA 4IH9A 4WFKA 1AUOA 3A6ZA 2PVSA 1UFOA 1UK6A 2DQYA 3H17A 1VLQA 2G63A 3ICWA 3ZLUA 3JYHA 4OCZA 4HVTA 5ALMA 2OXEA 4TGLA 2B4KA 5K3CA 3WWCA 1TAHA 4AB1A 3PF8A 5AIBA 1EVEA 5FUMA 5K3FA 1MAAA 1MNAA 3AILA 5JIBA 4FOLA 1F8UA 3K9BA 4QNNA 3DL4A 5EHQA 2H7YA 4U2BA 3T4UA 1HQDA 2AJCA 2JEYA 1YAJA 1L7QA 5AI0A 3VXKA 3WLAA 1XROA 5CT6A 3MGAA 2WJ3A 1GXSA 3VVMA 2NW6A 3AIKA 3PFCA 1SC9A 4XX1A 4GEGA 1XQVA 1DTEA 4ETWA 3C8DA 3WZMA 5LYYA 1H2XA 4J0DA 2Z8ZA 2QKYA 3BL8A 5JAUA 4H0CA 1VOTA 4UHBA 1UXOA 4DSZA 4ZGBA 4H77A 1ZGBA 4FBMA 2ONCA 1PV1A 1ZD5A 1QIGA 1U4NA 4HXFB 1UT6A 5CT8A 2PU7A 1C7IA 3WMRA 5ALSA 2OAGA 1BU8A 3QZUA 5AP9A 4QLOA 5H3HA 3QPAA 5AKYA 2HADA 3FSGD 3BDVA 4X6YA 2GZRA 3KDAA 2WFLB 4C89A 2HA3A 2JEZA 5ALTA 4DMHA 2ZYHA 5DYWA 5ALLA 1GKLA 1HLGA 4Y9SA 3WYDA 2PPLA 4HRXA 1FFAA 5FOQA 1WOMA 3C6ZA 2X5XA 3F8SA 4BRZA 3EQ8A 4X71A 2H7XA 4J0GA 1L7AA 1NX9A 1LPBB 1YR2A 3D4LA 3HRHA 2R11A 4H7FA 5EFZA 3STXA 4BVLA 1MNQA 4G4GA 4Y2PA 1QIDA 4B82A 4H7KA 1EHYA 5LZ7A 3MUNA 5BWBA 4WY8A 2PSFA 3ZPXA 1UKCA 3C5WP 3DD5A 1CUHA 4KRYA 4UBLA 1YA4A 5T4EA 2EDAA 1QLWA 4UHDA 5FV4A 2HRQA 4CIBA 4BAUA 4B0PA 3WKDA 2DR0A 4W1SA 3SX4A 4P08A 3HABA 4P92A 4FMPA 4AO8A 4MEBA 5C7YA 2HU7A 4X94A 3PE6A 4CCWA 1Z68A 3DLTA 4UBNA 1QONA 1C4XA 5DJ5A 5AM0A 1E5TA 4CFSA 2XUGA 1G66A 3NOXA 3WK6A 4MXDA 2B9VA 5AM5A 2Z8XA 4IO0A 4HXGA 1CUFA 4IHAA 2WILA 2O2IA 2ZYRA 4G8BA 1IUNA 1GZ7A 5ALNA 4X3CA 2WQZA 2V9ZA 1VZ2A 1H22A 1GGVA 2XMGA 1ACJA 1FFBA 4UBKA 3G0BA 5HCUA 4JEIA 1P0IA 1SFRA 2HA6A 3NWOA 2VTVA 5HQ3A 3C8HA 2VA9A 1LPPA 3VKFA 4W1QA 2PX6A 2GBFA 2VATA 3DS8A 2WIKA 4U2CA 4X90A 1CUBA 1AC5A 1DT3A 3I2JA 2J4CA 3WA6A 2QR5A 1VJ5A 4F60A 3WK5A 3R40A 5K3EA 2E3JA 5AOAA 4UUQA 1ZIXA 3WKEA 3I6MA 5ALFA 4DGQA 4YASA 2LIPA 2PSJA 2D0DA 2XUFA 4H7EA 2ROQA 4KRXA 3QMMA 5HF8A 4ZV7A 2J3QA 2WU3A 5JARA 5HK9A 1DWPA 4K5QA 3ICVA 3O4IA 1UK7A 2ZJ7A 5FDFA 3RK4A 1U2EA 5AKXA 3TJMA 1BN6A 5ALHA 4B7ZA 3C43A 5AKKA 4UFOA 4KAFA 1YAHA 4BP8A 4DMKA 4EUSA 3R3UA 2O2GA 4AN0A 1CUSA 1XRMA 1E8NA 1CIJA 2WHPA 3STYA 3R41A 5AJHA 4L3WA 4A16A 2XQJA 1LBSA 2OGZA 4XVCA 2J4FA 4Y2YA 1LNSA 2Q0XA 2XQIA 3WK8A 3CN9A 3DEAA 3HZOA 1JKMA 2I3ZA 1XZDA 5KREA 1R9MA 4Y2RA 1RWQA 4BE9A 1XLWA 1FFCA 5D3KA 2CUTA 2XLBA 3H2GA 2BJHA 3C6XA 1N1MA 4UHEA 3D59A 3KOOA 1A8QA 4QWMA 3BIXA 2G4LA 2WG1A 4BDTA 1RYYA 5LLSA 2WTNA 3N0TA 1TCCA 1UKBA 1U65A 1XZFA 1G4HA 3U1TA 4YPVA 1MJ5A 4HTAA 1QO7A 5CXUA 4TVKA 1XZAA 1XZLA 2QUBA 3FLEA 1ISPA 3P2MA 1CUVA 4BBZA 4QE3A 3WK7A 1K63A 1MT3A 1N5RA 1N8SA 2C4HA 5JAPA 5ALIA 1ZD4A 1K5PA 3TGLA 5IVKA 2WLSA 2VF2A 1LBTA 1CV2A 2HA7A 4G4JA 3IBTA 3HACA 1A8SA 1XQXA 2WIJA 2PSDA 2XT0A 2Y1KA 5AK3A 2XMDA 2ZJFA 4YK7A 2XUIA 4ITVA 2PUHA 4K6KA 3FYUA 3G02A 1DT5A 4BRSA 1FJ2A 3FYUC 4LXIA 2Y6VA 3KXPA 1YCDA 3BJMA 2Z3WA 1CRLA 2RI6A 4J03A 1YASA 3Q0TA 2XUJA 4DMCA 2DHEA 4W1PA 4ARAA 2GZSA 1B6GA 5AM4A 1DWOA 4H18A 1ZGCA 5E2IA 4FNMA 4C87A 2B20A 5C8XA 5FPPA
chains in the Genus database with same CATH superfamily
1UBFA 3T1NA 4U5QA 1EH5A 3UGKA 4GWLA 1E9AA 1P1KA 2BCEA 3CVOA 1VDMA 1GZUA 3NWBA 3IQZA 5K3BA 3I34X 4ZFNA 1QU3A 4KIFA 1RQGA 5A5DA 4LJ5A 2FOLA 4C4YA 4EI2A 3GJ8A 2JW5A 4OV6B 4ALKA 1JVBA 5FNVF 1JTFA 3T9DA 3GAZA 3H5AA 4TTRA 1RLUA 3BXHA 4BO3A 4CT5A 2RGNC 1UDAA 2HW8A 4IKEA 2Y71A 3MK31 4L07A 3SMQA 2RGXA 1OV6A 3QUTA 3TYXA 3ZHQA 2WV7A 3CZMA 3ZY4A 4F5YA 3AVYA 3PNBA 4LXGA 2RH9B 4PR3A 2O5EA 3LCRA 4URZR 3DEKA 4BNXA 3VPDA 4JXKA 3A7DA 1T9AA 5EZ6B 4QYIA 2PRSA 3A4TA 3V5NA 4BB0A 4Q6WA 4ENUA 3OF2A 3ZXSA 2P6OA 2D2IA 3CCFA 3RARA 3TNFA 5CA1B 4MVJD 1GCUA 2AOUB 3SK0A 3OTGA 3BVPA 3Q5EA 2A3RA 4A2WA 2CFCA 3L07A 3LRTA 4KNWA 1IZ7A 1ZM7A 1RMTA 1A5AB 1T4GA 1A9XB 2RK6A 3PNSA 3TTWA 3JWIA 1ODLA 1AV7A 1T0JB 1XP8A 2QLTA 3GRUA 3OOSA 4O4IB 4OH1A 4ETIA 1T9BA 4TWIA 5TQ2B 2IPLA 3D3WB 5AKIA 5IANA 3FPKA 4NE7A 1EBUA 1SBQA 1X9GA 2JHFA 1JMKC 2WQ6A 4BO2A 4A5SA 4NH0A 1DQRA 3E61A 3H8JA 1G2PA 2R8XA 3ZIUA 1ZXXA 4QECA 5HHTA 2F1IA 3GLQA 3SYLA 3DEFA 1VBKA 2O06A 1O8CA 4WNIA 1YS2X 3F9CA 3BMOB 2XDYA 1N7IA 4IGIA 5AJUA 1DBIA 3DLCA 2Z6UA 3IDQA 2PSEA 1I32A 3U9LA 2H7CA 2OE2A 2YHUA 1R4ZA 3AINA 4AU1A 3TKAA 4BP3A 3GBVA 3N2NA 1P4GA 4FJ0A 4OB7A 5LNK6 2XXJA 3D0QA 1U8CB 2YBDA 4CM6A 5I51A 4G1FA 4W5NA 4EY8A 3KETA 4M7PA 3KSAC 3CSDA 1ZO8A 2PQMA 4FWIB 1TK3A 4FKBA 2ZYIA 3OOHA 1AN0A 1DBPA 1SC4A 1P1IA 2IOHA 3COWA 4R2KA 1DC7A 3B1JA 5C0OE 1E59A 2HPVA 4Q3EA 4Q19A 1XF1A 1CQXA 2COUA 2FPKA 5M34A 1MLDA 3J7AC 3LKBA 3O8OB 4DWVA 5M2QA 2QUJA 1T3ZA 2X41A 3LY7A 2CYCA 4BASA 1KK0A 1BS1A 1LU9A 1TYEB 2TECE 3QE0A 4UHKA 5CXSA 1ETUA 1ZESA 2JFWA 5JLJA 3K72B 2ZJ6A 4MR8A 5JXIA 5TC4A 3IRUA 1AUQA 2W71A 2AG0A 2Q1YA 2RHWA 1E89A 1R6DA 1C7ZA 3GA5A 3L8ZA 1T4CA 2ASEA 2HQ1A 3LXRA 4PYMA 1BOOA 2VDRB 4NBVA 4NPAA 4TXJA 1OC4A 2G1JA 2VP4A 2W2LA 1ZZEA 3F9RA 5ENDA 4BE4A 2YXEA 4YMUA 3HB7A 1BVRA 2D7CA 3GFBA 3LL7A 4QEZA 4KXQA 5GZ6A 1SCDA 3PQCA 3RT9A 2PNJA 4ZVMA 3GBSA 1SIBE 1C5KA 2QYTA 2W5UA 3WS7A 1CJUC 4QEDA 5D7BA 5C3UA 2JBAA 2JEOA 4WKNA 2X1LA 5JSUA 2FWIA 1DSSG 1NV8A 1OI4A 2MOKA 3QTLA 2DWOA 4JUDX 3WWOA 1P75A 5CNMA 4RSGA 5KX5A 1JNYA 2PKCA 4AP5A 3AWIA 3GD5A 3EDMA 4BC1A 2BHNA 4FYPA 5BV7A 1T3GA 2JGKA 4YAFA 1CZHA 2O23A 4PXSA 4X66B 5K0SA 1W88A 1D03A 2PL5A 3MT0A 3ODPA 5L4LA 3CUTA 3ZK8A 1EXWA 4DLWA 1TZBA 5EE0A 2M98A 1MIOA 2W98A 3TTYA 3C85A 1C3OB 1PS8A 2OCXA 4FLFA 4G6ZA 5BSHA 5HUJA 1HX7A 4IIBA 4MUKA 3R3HA 3DW3X 4I9FA 3C6KA 4A0GA 2JLXA 4RKRA 3F5MA 4KXVA 4JFRA 4PFKA 2QE7A 2PZEA 2WNSA 1GG5A 5FT9A 4RPKA 5LVAA 5LQUA 4B3FX 3GP8A 1BW9B 1E1LA 1KBZA 3OPVA 5SY6A 3F3SA 3AQ4A 3U4DA 2W6NA 2C1EA 3GU3A 3O0DA 2G8NA 2WLTA 3BWCA 2Q49A 4MJ7A 1NOIA 5EJ9A 2AOTB 5E6SA 5FORA 3G2PA 4OHKA 5CNIA 4RGVA 1FRFS 2RBGA 3EIXA 4HQNA 4PS1A 4WY5A 2CFTA 4HAIA 4KPFC 2TSYB 3RJ5A 5JQGA 1KERA 1UPXA 1CJSA 2V7UA 3OESA 4L8FA 2ZRKA 3H8SA 3ITDA 4PWZA 3SC4A 1EFPB 1VCMA 2KBEA 3JW8A 4PPNA 5CLHA 1PSZA 1T4BA 1MG5A 3Q8MA 1NMZA 4M0FA 4I4LA 5CJ2A 3O95A 1NVXQ 1PV2A 2VYQA 5T4FA 3GV0A 2PA0A 4LRXA 4OP2A 4TQGA 4PZUA 7MHTA 3TLCA 3P2EA 2L69A 3SLKA 5C8ZA 1DKMA 4UDYX 4YUZA 4JMLA 4RTPA 4YRQA 1UMDB 1KEKA 4G56A 4FC6A 3G9UA 4PF1A 3TIFA 4CCYA 3GWGA 3EXIB 1K4MA 1GYRA 1Z7GA 1H94A 1KOJA 3TSOA 1DKPA 1H6AA 4BLTA 2UUCB 2PCJA 3GRAA 2ZCJA 3PVZA 4BVBA 2GCGA 2FN4A 3TPZA 3WMGA 3TCXB 4YXWD 3JZAA 1J2EA 2B5WA 1C9JA 1MB2A 1ZMXA 1W0JD 1WUIS 3KWFA 3VPHA 2AMFA 5JDIA 4Z3OA 1PFQA 2PKRA 1W5SA 1XA3A 4F7WA 1I2DA 1E2UA 1MUUA 5CB0A 4YV7A 1ACLA 5IF3A 1UC5B 4WXEA 1O6ZA 1PQ4A 1ISJA 4Q05A 1ND5A 1USWA 3E82A 2FW6A 4US0R 3DOUA 1E1KA 1Q6ZA 3KX2A 4MPPA 4PCVA 4B6QA 5TX7A 5ESRA 4G67A 4XD7A 4ZCTA 3NUGA 4POOA 1VLMA 4LJ4A 5EJAA 3GGPA 4YY3B 1ZDMA 1JE1A 4LY3A 4PVCA 4UTNA 3B82A 3PNYA 7ABPA 1I6WA 1XX6A 4I4NA 2J9XB 3ZE8A 2XECA 1K4KA 1E9RA 2RSLA 2Y1LA 4Q1DA 3GPBA 1PJ3A 1C3LA 2FLKA 2DC1A 5U1PA 5L3QA 1NQAO 1PG0A 2KJQA 16PKA 3HXTA 4S35A 4BBZA 1QYDA 4YV0A 1NQOA 2IUTA 2NO1A 1PHPA 1OXKB 3FDIA 4KFRA 1P5FA 5CB8A 4XLZA 1U3UA 5LUBA 2XJ4A 3LOQA 2FEXA 4YFVA 2PXHA 1Z4IA 2C5GA 1UOQA 1FUYB 3F1KA 4M49A 4U2DA 4FWTA 2BI7A 5BMVA 1UAYA 4PONA 3DZFA 4KQXA 1CLUA 3DG9A 2ZBGA 3DYVA 2VDJA 4HXYA 3W2TA 2NSLA 5F4ZA 1H65A 1TZCA 1XTKA 1O6GA 2UXBB 2I8AA 1LS6A 4DC1A 2XWJI 1E3MA 1M8JA 2XVYA 3DVRX 3QUSA 3SOZA 4GR5A 3NRCA 4J0CA 5JC1A 2PBLA 2CEKA 1ACMA 1JZTA 2P0AA 1TQHA 3C6MA 4W8HA 4YCLA 2DULA 4RY2A 3FXAA 3PE3A 5AVUA 3DF9A 3PJDA 4JBNA 5AJXA 4BCCA 5CVCA 1XFAA 3FNBA 3G0CA 3JQAA 4P5EA 1Q5PA 3VHLB 1IRIA 3OKPA 2H06A 5H5JA 4AD8A 2C7RA 1XQ9A 2I6TA 3FDZB 5DGIA 3EXFA 5EE9A 2OWEA 1SHTX 2UZ4A 4LV5B 1RCUA 3Q12A 3SYNA 2CEAA 3HP1A 4CMCA 3JYPA 5BVGA 2YS6A 3QUCA 4K9MA 3KUXA 4MUFA 1K27A 4A92A 1TGVA 1GXSB 1NRWA 2ZBQA 4LOJA 1N5DA 3W05A 4ZICA 1E1RA 4MDFA 1II0A 3LI2A 4MP3A 5IYZA 1EX1A 2I29A 2WAAA 5A4KA 4MVJF 5DXJA 1I7SB 3LHSA 4IUCS 2QWXA 1FLDA 2C2MA 5D3ZA 4V1CA 3GMDA 3VYSB 2OFOA 4ZMBA 4H1HA 3GXBA 1ZUHA 2FFBA 4U5XA 3ZWVA 3B3FA 3NTUA 4GWGA 1X86B 2PXXA 1RI4A 1QYIA 3CRZA 3D3QA 3PSHA 4RK1A 3L4BC 4YCAA 4QODA 3KB2A 4CR8A 4YAOA 5A6VA 3B12A 5DSXA 2A0KA 1ZGHA 4ZK6A 5LP6A 4LHSA 2SICE 4YDRA 3B48A 3WX0A 3TE7A 4EHJA 3FYCA 1DKLA 1IBCA 4Y0VA 3GLRA 3RAJA 3O8BA 3B5JA 5BN5A 4FDVA 3CWQA 3FTFA 3BREA 4M8LA 1L4KA 4HHEA 4MQ5A 2ZWVA 2W0MA 5KDLA 3VUFA 3QPCA 3R8FA 5COQA 4QPCA 1NR7A 2QRZA 1DQYA 1U1DA 2IGBA 2VBIA 3NW9A 4L9SA 4QULA 4DB4A 2OORA 1V25A 4TMFA 4XDZA 3W5CA 5KOJA 2O14A 3VOAA 3FAKA 1C1DB 4PM4A 5AI4A 1U28A 4WNAB 5HQJA 2XW6A 4J0FA 2V7QD 1JDUA 4JBIA 1DDOA 1IH8A 3AHHA 4PAMA 4OI1A 4EFKA 1MO6A 1ZOOA 3URKA 1LDGA 1VL2A 1ZD1A 3JRXA 3QNMA 4B4VA 1F7VA 1OH7A 2PKWA 4JBHA 5ALGA 2ZI9A 1BEUB 1TQ2A 1VE6A 5FD8A 5JXJA 5CLIA 1IN8A 1J1UA 1FOEB 1KC1A 1SHJA 2D74A 3R5JA 3ADPA 4IR7A 3A4VA 3OO1A 1V9CA 4TVBA 1NVGA 4UEWA 4MGEA 4GGMX 4YALA 3EF1A 1THZA 2MYNA 1GL9B 2V74B 3T12A 4TSKA 4F91B 5BQ5A 3SG0A 2YZ2A 4V3CA 4OSPA 4E5UA 1Q14A 3F5SA 4RCYA 5AKGA 4OLAA 1SQSA 4R8MA 4D3SA 2YWXA 3DFMA 4IZOA 4CFYA 3V1YA 1F6DA 2HN9A 2NM0A 1JR4A 1ZNXA 2J6IA 2DHCA 3CG4A 3EUEA 1D2MA 1SKYB 2P77A 3FHLA 4IOLA 2R1VB 4O2LA 5AK4A 2PS3A 2QG6A 2EFJA 3IIEA 3SBDA 1VPEA 2VK1A 3OO0A 2D5LA 2ZUUA 3IE0A 3PGJA 4HI0E 3I2IA 1JSZA 4PZCA 3NDRA 3E9EA 4WJZA 4WXHA 3UWPA 5BNIA 5JJ5A 3CLUD 5L53A 1E5DA 1L9KA 3LIIA 2Y8EA 2EWWA 3IOBA 4PAGA 4X1YA 3Q9UA 1QS0A 1KHTA 4QQRA 4YJ2B 3ZE7A 1PX2A 1UBMS 4DHEA 3KZNA 1E6MA 1PWEA 4KXXA 4C3ZA 1K9VF 1E9FA 1L5MA 1WWKA 4FW9A 4XFJA 3IT1A 3PUYA 3SZ3A 1XZQA 2A67A 2I2FA 1IHDA 3FFXA 3ERCA 4B81A 1F2TA 2AJLI 1Y6QA 3B6KA 3H9QA 3KE8A 5G0TA 4Y0NA 3BERA 3NC1C 4PSUA 3EASA 3A1EA 3CZPA 3IA2A 2GWRA 1G20E 2D1SA 2ZR7A 3C5CA 2M6LA 3HWX1 1V8BA 3AP1A 1E0SA 2PMKA 4K8OA 5DGXA 1PEDA 1YULA 4N5LA 5A3VA 4CDGA 5JZ9A 1OWLA 1TECE 1T15A 2H51A 3ROEA 1ORWA 2AL7A 4HOYA 5CLLA 4URFA 2HTEA 4RY9A 2TRSB 3S55A 3ZDCA 5KYXA 3HXLA 5DX8A 3MD0A 5HZKA 5IH7A 2Z95A 1YNOA 1EZ4A 5TPWB 3WYFA 2OSBA 1V4BA 4JB3A 4QYTA 3CONA 3K0KA 4X7MA 1Y5LA 1Y1TA 4OHBA 5DM1A 3IOEA 3P2KA 1OXXK 3ILYA 1A96A 3O26A 4Z9YA 3RUIA 1EDEA 4C6TB 3U5ZB 1DEOA 2CCKA 1R0CA 5ALDA 1PEAA 3STWA 5JD5A 3MUOA 3NEAA 1E9CA 2ZUBA 1UJCA 3PWKA 5DM2A 3UOAB 5EHZA 5TMDA 3GVXA 3HYSA 4XXHA 2IYSA 4TL9A 3C6BA 2E49A 2R00A 2GAFA 4X92A 3NGXA 4W99A 3BN3A 5ER9A 5HFJA 3QU5A 4LY6A 3T7TA 1BH2A 2IYAA 2V8OA 3WRXC 4JI2B 5EZSA 1ZLYA 2HY7A 2WZQA 3EPJA 1CNEA 4HDRA 1YIDA 3T3GA 4Z86A 1U7TA 1NW5A 4LJRA 1CQPA 1HE3A 4U00A 221PA 3ASUA 1K7SN 2Y0DA 1FDIA 4QREA 2B1GA 2HA4A 1IXSB 4HWGA 5J4KA 1B00A 1HE4A 1HMPA 4KGDA 1QOQB 4KAJA 3I1JA 1MOSA 4C3VA 4D9GA 3QVWA 1JB9A 3SE7A 4RSRA 3JZMA 2SCUA 4F7DA 1R5JA 2AA3A 4BTVA 3NOVA 3NWJA 4B7AA 4ES6A 1GU0A 2K5UA 3RC9A 2I34A 1VJTA 4W63A 4HRYA 5DXAA 1VJ1A 4K6CA 2I4NA 3A9CA 1CTQA 3U7IA 2P9TA 4QEKA 5TPZD 2QXTA 3EFOA 1P33A 2IHZA 1N0IA 1P74A 3R23A 4IIGA 4OHCA 4Q7JB 3V4RA 3JAWB 4CQMD 4FFLA 4IDDA 1EX9A 4GZLA 2VF8A 1L5LA 2DQSA 1II9A 2NTNA 3H5WA 4X5OA 4QJBA 4WFJA 1IK6A 2AKYA 3PDHA 1RAGA 2L82A 3MCAA 4IOKA 2Q1TA 3OEHD 4B3JA 1W4CA 1Z5UA 2EJUA 3OIUA 1JX6A 4N3GA 4HQRA 3DL0A 5KOHA 4Z2AA 1P4HA 1TM7E 4JY7A 4FHGA 3UH1A 3V8QA 1MD9A 4U39A 4HLQB 4CKWB 1H2AS 3O38A 5JSZB 1ISFA 3K2IA 4Y1RA 3RHFA 1B74A 3L7NA 3LE8A 4CLOB 4HGNA 5HKAA 4GLFA 1GGMA 1YJBA 2BFWA 3WXBA 1N5JA 1HT0A 2JI9A 1DUVG 2VNJA 1QP7A 4G86A 2CFRA 2Q99A 4IEIA 3ZK9A 3GVHA 4DBVO 3RS5A 1EMDA 5P8WA 3GQBA 1OCEA 3CLUC 2R2AA 4Q3LA 1SCKA 2DBZA 3FZGA 3V42A 4O63O 1R9GA 1RM0A 2F3UA 4F9TA 1F20A 1Q92A 4PV7A 1SCAA 1LSUA 4TMKA 4E5YA 1F14A 4FS8A 4IV5A 1DO0A 2VK8A 4EM6A 3L7IA 4LS3A 1V1JA 4PBTA 4YIHA 1RI1A 1QMPA 3ID6C 3RVQA 1B4DA 4OK6A 1SB8A 1FFGA 2UUAB 4ZYUA 2EP7A 3OT1A 1C7JA 3CMMA 5LMZA 2H4JA 3KNZA 4RD2A 4D41A 4UNIA 4TRRA 2P4UA 1WEKA 3DR3A 4ZWNA 3AEQB 1JHUA 4MKZA 5EXXA 3UK2A 1XEFA 1NZJA 2OYRA 3PHLA 1DAFA 5JTUA 2BAGA 1CZRA 3ZH2A 4OSOA 3ZVKA 2OGSA 3RM3A 1GPMA 2PO7A 4ALNA 2FK7A 3FY4A 2R6DA 4LISA 4ZRDA 3WGKA 3PEYA 1CEEA 3O3CA 3OLYA 4CUZA 2FWBA 2FSHA 3F97A 1D2GA 1Q0SA 1V6AA 5DNUA 4IH1A 3DR5A 3PJRA 2KBFA 2Q4EA 1FX0B 3FOBA 3HN2A 1KH2A 3CZQA 3I2KA 4NG5A 1ZH6A 3RSZA 2ECOA 3ZW7A 4EYKA 3SR3A 3TIXB 1RBQA 1ZMTA 2GEUA 2YCBA 4LSGA 2HJHA 2XGMA 1SUAA 2IXGA 2QTMA 1V41E 4HNAA 1NIJA 4DY6A 2I33A 1O7JA 3ABZA 4R1QA 2CNBA 2PO5A 3EQ7A 1LTQA 3HG7A 3PLAE 3OMWA 3I4CA 4C0HA 2JGDA 2AEFA 4EFLA 5JAHA 4H6PA 5AM1A 3BE8A 1JKXA 1QIEA 4V0ME 5DI9A 5C8YA 4D8VA 1IAQA 4G4SP 4RV9A 1KZ4A 1FX1A 1KSHA 3N5CA 4MQ6A 4ZC1A 3UV6A 1FRNA 2HMAA 2QMUA 2Q9AA 2OAEA 1A98A 1C9MA 4EZBA 5CGZA 2IW1A 3C3PA 4QXOA 1WV0A 3SIRA 3H11B 3Q7IA 2BHTA 1KIAA 5DTMA 4RTRA 1A71A 1PJAA 3AL2A 5GM2A 3F96A 4QTTB 4A8PA 2ZM6B 3PNMA 2EEPA 1IB0A 1ZW6A 4X41A 1A9PA 2JFGA 2R44A 1FE8A 3KFXA 3V1UA 1P4AA 3WWEA 2BFDA 1QG6A 4OAQA 1I3NA 1OA1A 2D62A 2YXNA 4PGMA 3O2NA 3NDPA 1GM5A 2AQ8A 2D0PB 1Z8NA 1YRLA 1Q1AA 3LA6A 1V1MA 1WAMA 1NVVR 4RIFA 3PR3A 5FUVA 2ZJBA 4CKEB 1AIPA 1Z0SA 1LQTA 1ZH0A 1CEQA 3GPDG 3TZ6A 3ABQB 5KHOC 2O54A 5HGXA 1S2DA 5CDFE 1Y8QB 3WO1A 1P61B 2IKSA 3UK7A 4DSUA 3L4SO 4K28A 3ZNQA 1W4ZA 5FUQA 1ADJA 5E7JA 1UBGA 2EZ4A 1T2UA 2FFJA 2NXEA 2X8AA 2WIFA 4IDGA 2A1TS 3S8MA 3VNRA 4DM7A 3GEMA 1UOOA 1M5RA 1VIVA 4IIYA 4UM8B 3ZG6A 1KIMA 2QROA 1VMEA 2GRAA 5IJ0B 1RPJA 4M8IA 1RJFA 5L3RA 1BHQ1 4WQMA 4YRLA 4F2WA 3HXMA 5LSAA 4J75A 3R3ZA 3BM5A 3GLHB 1PQUA 3F6EX 1V1RA 6AT1A 3EEIA 1XPUA 2Y4NA 3V8PA 4N7JA 5H16A 3S7TA 5A0VA 5AUQA 1Y3DE 1XELA 1DFGA 3JZFA 1ONOA 4LC1A 5ECYA 4OGLA 3UT5B 3AZQA 1NG1A 1RQXA 3FSJX 2X1HA 3ANTA 5JMWA 4PX2A 4OH7A 1KJYA 2DBVO 2YHIA 4Q03A 2MSKA 3DL7A 4OJKA 4TSFD 5LU9A 4FFBB 5TF0A 2IEIA 5CVUA 1CS0B 1YOVB 4NZPA 4KI7A 4A3SA 4EUEA 1AGNA 4JB8A 3NASA 3A3OA 3AK4A 3OFVA 4MLZA 5F9MA 2OQVA 1ZD3A 4P22A 1R8XA 3EAQA 3LPLA 1W29A 4BKOA 4E33A 1PTJA 2F43B 1DCTA 5CTAA 3AV0B 3WHIA 4M76B 1SY7A 1QFXA 2YJ4A 2YIVX 1ADCA 4BRUA 5E38A 3QWBA 1GCAA 1PL6A 4YRDA 3JD3A 2FWJA 2G8LA 3RUEA 5KYGA 3EPLA 1EHIA 1PTJC 1SCBA 2RGEA 3F6CA 3RAGA 4AJHA 1YL5A 1Z4OA 2I80A 1I80A 2QTVB 1W4LA 2PAAA 4IJMA 1ZNZA 1HORA 4DMLA 4D9CA 3PKZA 3DJFA 1NULA 3THWA 3GT3A 3LW7A 3WJ7A 1SXJB 1BX1A 3U1BA 3BA6A 1KZ1A 4NE2A 2WWIA 1DJPA 1V96A 3RRZA 3AUKA 3BAFA 4P3NA 2VJLA 1LVGA 4OBXA 3IPLA 5GP1A 3U81A 3ZDZB 1ZKDA 3BA1A 4RA6B 5K3DA 3O3MB 3PPXA 1IXYA 1ZRSA 2BE7A 1HLFA 1SK9A 4EAQA 3ZV5A 5ADWA 1T3TA 3V2UA 1E3TA 5EVCA 4XWTA 4RY0A 2V4UA 2P1DA 5J2TF 2FUCA 5GGYA 1O6CA 2D2VA 2O8DB 2GM5A 2H1LA 3A27A 4KO4S 4Q3NA 3HV2A 4O4LF 2D4HA 4I46A 1G60A 3EEQA 4KP7A 5J4LA 1JYFA 3K8OE 4W9RA 2SHKA 3ZD9A 3MFYA 1QFZA 3OG9A 4WA8A 4HY3A 2V5UA 1HMYA 4PFQA 3ZDEA 2ACKA 2MSNA 1IDN1 3T0FA 4LMAA 2V0NA 3WKBA 1Y4UA 3OETA 3MW8A 4ZMSA 2B8NA 4G1CA 2WUDA 1AUPA 4TS1A 5U9CA 2RFLA 1NVDA 2OV1A 1L5NA 1TC2A 4GOJA 1P4RA 4IWNA 1NQXA 2ZIZA 3CZ4A 3QHPA 4NMWA 1O96A 4WOPA 1C80A 2BP7A 4QU9A 2CHEA 1P62B 1UDRA 4G1EB 3ZU6A 4DQVA 1FSSA 1L3BA 2FZ4A 2PX0A 3BUSA 4WLFA 4FT4A 3M9LA 1M2GA 3WGOA 4YQZA 2BSXA 1MAVA 9LDBA 3G5MA 2IXTA 4W9NC 4XGKA 1L8QA 2WAXA 3ISTA 4L85A 4MA0A 4CLRB 4P84A 3UMFA 1EDDA 4RD1A 2LVBA 3D5TA 4A0SA 1ODSA 1I4EB 3PQ3A 4E6EA 2GCEA 3CCCA 3H04A 1QIIA 3I05A 4ABYA 3U40A 1TCAA 1TQDA 2PGAA 3UJ7A 4IJVA 3SXUA 3VDRA 4EVRA 2PL3A 3QLTA 1HFWA 4TS3A 5HS4A 1Z3CA 1I1NA 1UZAA 1L7PA 4HSEA 1DU4A 3C48A 1WU8A 2G4CA 2ZR8A 3QKSA 2HHLA 1IONA 1GQRA 1DCKA 3LHKA 4DMCA 4LEIA 2IS4A 5K5EA 2C9ZA 3LWZA 2O3JA 2V54A 2IODA 2HBQA 4IBOA 5LA6A 3DO6A 1FLNA 1LPNA 3IKLA 4G63A 4K6MA 4R3WA 1EWYA 2JKYA 3RSSA 3T5GA 3VSBA 4ASUA 5KVSA 1BGVA 3AERA 2E1RA 5GADl 4C1NA 1J2YA 1QO0A 4GGOA 3TL3A 1RZRA 3P0RA 3L8DA 3ZWQA 1GTZA 4BTEA 2QX8A 1M34B 3P2OA 2H59A 4JL8A 1ZCBA 1NMYA 3PZRA 3OIYA 4JHXA 5EWLB 3D6UA 1LK7A 3L46A 2BKLA 3H1EA 3DYBA 4Y2XA 1Z33A 2W6QA 3LUKA 3P9CA 1DZIA 5F78A 2B61A 4CM8A 3PXDA 4P6VF 3AJ9A 4K3VA 1TM3E 1YR8A 2ECKA 2I8CA 2V55B 4V0MA 3OQBA 1MOPA 3OOJA 2JHCA 4ZGGA 3HXOA 2RIRA 4PC3A 1EVJA 1NP6A 3HCWA 1F4LA 3IHLA 4ZCSA 4DUZB 2NMVA 1XWIA 4E3ZA 1U2GA 3UAXA 4BPRA 1G5RA 3TGWA 2BMDA 3LWBA 1E9VA 1NX6A 2O1XA 3DZGA 3H1AA 2O48X 1I5EA 1DRJA 2HCFA 6Q21A 5A4IS 1NPTO 2IV2X 1R10A 2WV9A 4R7TA 2HLNA 5AUNB 3ZJYA 2QY9A 1U2GC 2GPBA 1XTTA 1OLUA 4LXTA 2ZS8A 4V0LA 3WGJA 4G0UA 4U2GA 5HK8A 5KNBA 2H6EA 4FCVA 1RHMA 3U1VA 4GYYA 5GONA 3L7JA 3PFFA 1V3QE 4DKXA 3COYA 5LB4A 3WIVA 2WM2A 4A2CA 3FLAA 1Q84A 1LBQA 2G82A 5JSYA 3BE5A 3GCXA 4OQQA 5COAA 3KYBA 4R6WA 1FTQA 1SMKA 1NM5A 3KHTA 5DM60 2YS7A 1XCJA 1CUZA 1CZNA 4BNWA 4Z3KA 2BMEA 1L7BA 1A9SA 1YMVA 2WIAA 1OXUA 3A1TA 1TDJA 2AIRA 3AZPA 3BD6A 3KUUA 3P94A 4OYLA 1B2RA 1Y42X 2MR5A 3S2GA 2FCAA 1GUZA 3A9WA 2QRGA 3F98A 1C7QA 3TLGA 1AQUA 1HQCA 2XUQA 4D9IA 2O59A 3UJPA 5CTJA 1Y98A 4D44A 3JVUA 4QYIB 4Z51A 3I5YA 4KR0A 1N2GA 4CF4A 4AQ7A 3EG9A 1BFKA 3SEQA 3KQWA 3UOWA 3QITA 3UUWA 1E9DA 1WXXA 2A0UA 4OHXA 2J30A 3WFZA 4F6RA 5GTDA 4GG1A 4M98A 2I6UA 2YFKA 4LRWA 1EWKA 2O2DA 2C20A 2RC5A 4HQFA 1J24A 1F9AA 2WKPA 3GAFA 3FVVA 4Y2SA 1P7VA 2J08A 4ZT5A 1HK7A 3GGCA 3K5HA 1Z4QA 2HK9A 3FCSB 1NL3A 3CINA 3EF3A 4OGWA 1NXXA 1WDTA 2WIBA 2G0NA 1P18A 2DQ4A 3AJAA 2JA2A 4P7FA 1M33A 3NPMA 3VZBA 3ZW9A 1UZNA 2A1TR 4XCXA 1I6LA 3U16A 3NU1A 3QNUA 1WHTA 1ZQ1A 3LZDA 4OHFA 3RHSA 5J23A 3BT7A 5B3JC 1AQYA 4G8DA 3IMEA 4DRYA 2EARA 2XUKA 1DADA 3KZCA 1O95A 3EIUA 2VS1A 4Q34A 3OOYA 3QMPA 5FUWA 5FBKA 4NATA 1KFBB 4UE2A 1MXHA 2OCBA 1TKAA 4S3MA 1P72A 4MTLA 1AH2A 1EZZA 2FN9A 1HDZA 3TNJA 5TSDA 3GCDA 2HSJA 1O95C 2BFNA 3KKMA 4BO8A 1XLTA 3H9CA 3IB3A 3Q3CA 3SQLA 2IYUA 4TQ9A 4EG5A 4HF7A 3UJBA 1P19A 2C84A 1R4NA 2VCHA 4L4YA 2WY2D 3AP2A 1K3TA 1OFVA 1UBSB 3LKZA 1QIJA 2OYSA 3QJGA 4D1YA 3HDTA 1JPNA 2CHGA 2RHLA 4AWBA 5FUXA 5CD1A 2PUVA 4R8SA 1N78A 5LU8A 2AFRA 1UJMA 4L57A 2Q3EA 4KWIA 2GF2A 1R8JA 2PR2A 1J5PA 4AZ3A 2FETA 4L3VA 3QPVA 1Y8CA 4MQ4A 1X8LA 4E2WA 5CLFA 3WLOA 1QH1A 2P3OA 4KR2A 1P1HA 3NHBA 3NBAA 4LQ4A 3NORA 1D2HA 2ZRGA 3EA5A 4R8VA 3VC3A 3O92A 1LEHA 4NBRA 4NBUA 4PRZA 1PR5A 1GAQA 3Q41A 2VSXA 4LGVA 1TNDA 2CWDA 4GLOA 4PLHA 4UMFA 4CMKA 3ELBA 3PQ6A 1AS3A 1OILA 3EIOA 4GUAA 1RXYA 3P2IA 2JK0A 4KX5A 4CLXA 1XQ6A 1D4FA 3SEAA 3MCVA 1T0BA 3CEHA 1T4CB 1E2FA 1FFWA 1U7PA 3IAS6 4YXFA 1IN1A 2H2HA 4EQ6A 4Q9NA 3PCTA 1NF3A 1PFGA 1M75A 2DHDA 1NONA 2EJVA 2VOEA 3CYFA 3PT5A 1NQUA 2QG4A 2P1ZA 3HPRA 1CLEA 3QA3E 4PZ9A 1A69A 1WXGA 4CG2A 3AR3A 2FWNA 2G5GX 3R5KA 4QPNA 4RHEA 5GGXA 1Y5IA 3IB6A 1R0RE 4ZZIA 4RTJA 3GDGA 4F21A 2WG2A 3JQPA 4WINA 2QT1A 3EWNA 1QC5B 2ATCA 2ZZNA 2JBAB 3ELYA 3HRKA 1HO3A 4IGAA 4YTEA 3ZWYA 5B36A 5KX5B 1Y80A 1FU7A 1M1YA 1NUHA 2VPTA 1EUDA 4RORA 5G2OA 5IU6A 4E22A 5JPCA 4QOIA 2GAOA 2PX4A 1V43A 4QPJC 1G17A 2QM3A 3GCGA 2Z2JA 3I6ZA 3WLKX 1W88B 3J81k 2OAP1 3AEKA 3JZIA 3QFRA 1H2YA 5LJLA 1MIOB 3HY6A 2R87A 1M6WA 1LLUA 4IQFA 5ISMA 2F3QA 2OSVA 1CEYA 3AR8A 3JY6A 3X2EA 5BV2P 1Q0LA 2FX5A 2J3HA 1T0PA 2YXBA 4IM7A 4R54A 3K7EA 1RZ3A 4YHBA 1REQB 4PGAA 3BL5A 2J1LA 4MPTA 4Y18A 1GTG1 2GZ2A 3UWDA 3GA7A 5CFZA 4PTLA 5K8TA 2R4TA 3H87A 4BY9E 1A2OA 3DNPA 1NE7A 3T3IA 4PN3A 2F67A 2RAUA 3ZTYA 3T38A 5C53B 2NSJA 1IJKA 1QGED 3PPYA 5TXGA 2OCYC 1WKBA 3Q10A 4WRRA 5AKEA 4CHTA 3FHTA 5E2BA 4GKJB 3B70A 5BR7A 5C1BA 2R6GA 5JQGB 2DPGA 1HZJA 2O3TA 2EU8A 3D0OA 3HGTA 3QVVA 1TCVA 2C3MA 1GHTA 4XSVA 1CQIA 2QNIA 2RHRA 1BQEA 4MVJG 3OZFA 4NVRA 4TV8F 4GRDA 4IFIA 3AG6A 4RYDA 5SYAA 1J06A 4D2IA 2OBXA 3AKEA 4I36A 1UDBA 1ATZA 2WA1A 3ESDA 3OE1A 2VP0A 3VAYA 3LP6A 4OD0A 3HKCA 1ZG3A 4XYEA 3TCKA 4CCYB 1K86A 3VPGA 4D96A 1HH4A 2PRIA 1U2ZA 2XDAA 2GAIA 5IMBA 1AXRA 3OLXA 4EJSA 5AFSA 1TD1A 3AOEA 2AB0A 3BJRA 3ED5A 4CMBA 2TS1A 4XUCA 5ALQA 4UOQA 1QE0A 1XRJA 3HCCA 3GEGA 3N8HA 1XMQB 4DRXA 1R50A 4I4TA 5HUQA 4UU0A 3LQYA 2O0JA 3TZLA 3VNBA 1AUVA 4GDFA 4REQA 4B71A 2WWRA 1JDJA 2GKGA 3E7FA 3MWGA 3TAHA 3VZQA 1QUEA 1FP2A 3WP0A 5KQSA 1UFVA 2HRRA 1LJLA 3A1WA 2JJ1D 2DBRA 2X0EA 3FBWA 1LW7A 4UCFA 4UE3S 1MV8A 2NU9B 3OZWA 3DEIA 3RVKA 3SF8A 1PNTA 1PQPA 4JVMA 4RPJA 3C3DA 2FSVC 3BD7A 2PRYA 3PDIA 3QQPA 4MIYA 4ZALA 3BMCA 4XYGA 3I30X 3SKVA 4BLOA 4OK5A 2NG1A 2CJFA 3OU7A 2W6CX 4WFIA 5I4KA 1Q0ZA 4DCJA 3COZA 4AZ0A 5CG2A 5L3QB 1V9SA 2IBTA 3P9NA 2LIVA 3PQEA 1NRXA 1P4SA 1Z15A 4S0XA 3UJ6A 2ZYUX 4HDCA 3MGCA 4OL0A 4REOA 3REGA 2FJ0A 4TQUS 3ZI4A 4AO6A 5I48A 4MVJM 4ZO9A 1UWLA 1BO6A 2BR3A 2VHZA 4K6GA 1FPQA 3EJ6A 4FBLA 4P4GA 4DZRA 3UV7A 5JJCA 3O4GA 2K2WA 3FCEA 3ELWA 2RGRA 2C3PA 3W90A 3EDRA 5BMVB 1RKUA 3GMIA 1N2XA 3SZRA 2GJAA 4E88A 1IN5A 1ENOA 3HM9A 2HBZA 1AKTA 3F6RA 2Q5FA 4H1TA 5GIOE 3RVSA 2X19A 3CUYA 3CISA 2IZ0A 3O47A 4QQFA 3T52A 4HH0A 2FMKA 3OQJA 1T5OA 3PGVA 4XTRA 2FJPA 3TXAA 1KS9A 4LQDA 5C51B 1DFHA 1R74A 3MCWA 3R0XA 1I4TD 3DULA 3K5WA 5BW5A 2BELA 5D87A 3OX4A 3O93A 3RIGA 4KNVA 2AZMA 3MQ2A 2FEKA 4DWOA 4FZ3A 2ZB3A 5HRAA 3N6VA 4LZWA 4RJJA 1MV5A 1EIZA 3N7UA 4N7RA 4C4OA 5B6JA 4MTCA 1V0JA 2OECA 2WTMA 1EVKA 1TU0A 4XJVA 3WSTA 4KJZA 3ADOA 1UZUA 3RHTA 5JAOA 3EXFB 2P1RA 4XSGA 3W77A 1LBIA 2X8BA 2NU6A 4KB5A 5BVGB 4YMVA 3QE4A 2BEUB 2E5FA 2QZPA 5F2EA 3NKLA 3WJ2A 5JWRA 3EAFA 4LFAB 1NJ8A 1XDDA 2ON6A 2QHXA 2XEXA 1CVRA 3FCOA 2VDUE 3JR3A 3MCTA 4GMXA 5IYZB 2B92A 3RDPA 3N5KA 5KVVA 3E53A 1ST3A 4WBXC 1Z3IX 4YRZA 4ZZ1A 5ERGB 4V1CB 1ZSYA 1H1LA 1SH7A 2YQZA 5E1MA 4ZV4A 1OMOA 4N76A 2ZJYA 4PO3X 1EGAA 4KUHA 4DIBA 4ZI7F 4CMHA 2PT9A 2HCRA 1ZU4A 1XTRA 2QMZA 3F4BA 4Y7DA 3RR2A 3OCVA 5K4HA 4WACA 3C8ZA 2X2OA 1QJCA 3QW2A 3LW8A 3QVTA 1UKVY 3CUSA 3ESBA 1RVV1 3GW8A 2D5BA 4EKGA 2WSBA 5BN5B 5LOVA 4NCNA 4KWHA 3EXEA 2XNCA 3PR2B 2EOAA 2KW5A 5DKFA 4OREX 1GPBA 4XOIA 3TWOA 1DAPA 3FB1A 4IQGA 4D43A 2YMQA 1IFXA 4N5HX 3OQOA 4X93A 5CVEA 1RXVA 1R9NA 1PNQA 3K16A 3ZWBA 5JC8A 3NX4A 4LIPD 3J7TA 2FRXA 3IAXA 2PRKA 3DZDA 2BTQA 5KOJB 2VQ6A 4LDRA 3LK7A 1ODJA 2Q1SA 3PTAA 1J8QA 3O1JC 3UK6A 5KWIA 4ER0A 2A78A 3QENA 3WWZA 4R7ZA 1L5SA 2AYXA 2ERYA 3KEMA 4PBRA 1P0MA 1JQAA 2SKEA 3FYDA 3KJQA 1E6LA 4OUKX 3MMXA 5AVYA 5A4FS 1ZVJA 2OA0A 3EVBA 5JYBA 5FX2A 2CXXA 3UUEA 2DYKA 2HGZA 1WIWA 1IXKA 1LDBA 2AUMA 1LLDA 2EP8A 3O4VA 4HQOA 1O77A 4KOAA 3NM6B 4MR8B 3AU8A 5AW5A 1CF4A 4JEHA 2D1TA 3ZYCA 5AJYA 4NECA 1VBNA 1XMXA 3H2SA 5EHGA 1KQ3A 1XCMA 3NZEA 1IEWA 2H31A 4RVFA 4Q3KA 1JZQA 4OIMA 3N6RA 3HVUA 4G4IA 2A1IA 5GOZA 2YY6A 2KI5A 4WEQA 4EW6A 2FPRA 4OFWA 1A88A 4KVAA 1R0LA 3Q8WA 3GGOA 3K8ZA 4MW5A 3ZGZA 1EA7A 3DP9A 4US1R 2P6PA 1DKUA 1RABA 1D7AA 4D8WA 1HUQA 1B0AA 1CUIA 3HBNA 1UBKS 4GPZA 4N03A 1WVIA 4RZIA 1U3FA 1OT3A 1EWRA 1GPKA 1NSTA 3B1VA 3BQMB 4DWWA 4TS4A 1MB9A 2CL6X 4BRWA 4X1YB 2PUBA 5ALJA 4IOJA 3HY3A 4I1UA 3KLOA 1F60A 5DM4A 1F51E 1T0UA 2Z08A 5FO1A 1WDWB 3AUYA 1CUYA 4Y67A 1JIUA 4O8CA 1C9EA 4FNOA 3ESAA 3P0EA 5KVCA 1F2TB 3QX9A 2ANBA 5D86A 2PWYA 3DDWA 4QOEA 3U80A 1EXMA 1L5ZA 2Z1MA 4O2AF 4WN3A 5MGNA 1ZVKA 6ADHA 3OY7A 4TSRA 1OI7A 2C31A 3O1IC 4FDUA 1FP6A 4KSBA 5HZGA 2C7OA 1HDYA 1OBFO 2DKNA 3Q7PA 3RH0A 1MORA 4MRNA 4HLUC 4BTLA 2YY7A 1U5CA 2QX9A 5LZ5A 3B7GA 3ESQA 5KKCA 2D3TA 4LVUA 4OI0A 2G5TA 1H2WA 4LI3X 4RMGA 2V7GA 2ZAYA 1UH5A 4NMMA 4EG1A 2WSMA 1OFUA 1UAGA 1HZZC 1T1RA 2QNBA 4YDHB 3V4ZA 1ZVQA 4POAA 3WRYA 4HB3A 2LKCA 3FZNA 5EXSA 2H3EA 2E4YA 3TZBA 4XIYA 3C14C 2OV4A 3KKQA 3GJYA 3T7RA 3OM8A 1WS6A 5NLLA 1FXWF 5L45A 1AKWA 2EG5A 4QJ5A 2O7VA 5D8DA 3E1SA 4DR3B 2FWRA 5DN9A 2AN1A 5T41A 1UJ4A 2O2CA 4ESEA 4V1CI 1NXOA 1TTHA 3CO0S 2Z5LA 5JRJA 3CNLA 3DM5A 3NIFB 5F35A 5JRZA 2VHXA 5TS3A 4RK5A 3USZA 4ENTA 1OZ0A 4KK4A 4NJEA 2M6RA 3FBGA 3V1LA 3H0KA 3MNFA 2MCFA 1WKVA 3EZ9A 4BNHA 5LR6A 2D2EA 3FWKA 4BQNA 3Q7SA 2QPTA 1HV8A 1GGKA 3HLTA 1NIPA 4FS3A 5JAZA 2HDNB 1IM8A 4HDRB 4JVNA 4U9UA 3NHSA 5EAIA 1DB3A 5JSFA 2H1IA 4NP6A 2WDZA 4YCMA 1N2CE 2B0JA 3EHEA 4PG4A 1E0AA 4EEZA 3RPEA 5J63A 3SN6A 5JW6A 3T1TA 4PQEA 1QF7A 2JGRA 2WK1A 4U7HA 1B93A 3SYMA 4ZYXA 4DNXA 4LYDA 5KTKA 2WJ6A 1XDGA 4GH5A 1JG6A 1SKQA 3I5XA 5ELLA 5IKMA 1RTKA 1E5QA 3NIGB 2SCUB 4B73A 2KLHA 1MTOA 4LPKA 2IS2A 5IFLA 1JQLB 4J29A 3OICA 4LZNA 1PBNA 2W6OA 3AVTA 3DQQA 3EIEA 1NJ2A 1MXFA 4NTZA 3Q8KA 4ZN6A 3R7WA 5L3VA 3UUFA 1BMQA 1CQWA 1SBYA 5K6AA 5I7OA 2GA8A 2ACVA 4H6XA 3EFOB 3ND7A 4GMGA 2BMJA 3B6JA 3HU1A 4TKMA 2QUKA 2IUUA 1N4DA 2F3SA 1EGVB 1XHLA 1UQTA 3W7BA 1HNNA 1J90A 3C74A 3FWHA 5DOZA 3EGWA 2I1LA 5I45A 1DC4A 1LY1A 4IJUA 1INLA 1U63A 1Z12A 3N2GB 2WAYA 3VO8A 1UBJS 3ETGA 1TJ5A 2XQGA 5AW9A 4F2HA 3IUJA 4DJDC 2BMWA 2YWEA 2OFFA 5KOHB 3OJXA 4WV3A 4HX5A 3UW1A 2NZYA 2HMUA 4KDCA 5IAEA 3WLHA 3R8CA 4V2IA 1QQ6A 3GEDA 5JEEA 1CJTC 2XMSA 4Y1RB 5HCIA 3K8QA 5EKDA 3KOZA 3D6MA 2J45A 4DJAA 3AWDA 3LDHA 3HVIA 3VHXA 3EX7C 4O3MA 2Q5OA 4IMRA 4QLBA 1F4PA 4CKBA 3HBFA 4NH4A 3U9TA 1Z9BA 3LYHA 2FSPA 2HSZA 2Y4OA 3OZAA 4IXNA 5I7AA 1XZKA 4RFSA 2WHRA 4R16A 3QEJA 4J76A 3GQBB 1UWKA 3WL3A 1EFRA 5I01A 3IURA 4X1KA 1KOFA 2LE0A 1JV2B 4UZSA 2QDXA 4AKSA 4KQ2A 3LVBA 4KMOA 1N0VC 2PZAA 2OO5C 4L2IA 3IQWA 2OTCA 1QK4A 1W48A 3DEZA 4NS1A 2YDXA 5FA8A 1TL7C 2PUGA 1DJNA 2HWYA 1SEVA 1ZN2A 2ZI6A 4UTPA 1JHMA 2ID4A 1TGYA 1AG9A 2RB4A 3OT1B 4J0JA 2CZCA 4YMIA 1JXQA 1KYXA 3AX6A 2I62A 3EXAA 4QJIA 3FTCA 1G8MA 4K7JA 2MT9A 4RPHA 3IILA 2FUNB 3O4FA 3KJXA 4BMCA 2EATA 4ME6A 3AFIA 3LXXA 4RL4A 4F92B 4RS3A 4FE3A 2CL5A 1JZSA 2BZ0A 3A3KA 4R51A 5JI2E 3WL7A 2H5IA 4BQFA 7ADHA 1JJAA 1N1DA 2ZREA 5LMCA 4KVGA 1G2IA 3ROKA 3GHYA 3UAZA 2Q4RA 2BD0A 2PQ0A 3I53A 3JVDA 2OLEA 4KEAA 5CDSA 2XNDA 2RK3A 3K0AA 2JNWA 1XMPA 3FUVA 4MGIR 4EGFA 1YKGA 3K9CA 4M53A 1E7QA 2YOFA 3G2KA 1LJUA 3L5KA 2HPZA 3FNHA 5JAMA 3M1IA 3KTAA 1N8NA 1OBVA 1U6IA 1JFFA 3H17A 1HL3A 1N4AA 1LC3A 1VLQA 2G63A 3H4VA 1JS1X 2GCOA 5KYYA 2IYFA 4OBWA 2Y1WA 4CBVA 4I14A 2P90A 2JGDB 3MAGA 3NDJA 2O2ZA 4OCZA 4HVTA 2JLZA 2WMYA 3D6NB 3MWLA 5C8YB 5D7NA 1KSFX 5A9TA 1KDRA 3WB0A 1QF6A 3NJ4A 4I2VA 4AKEA 3JQFC 5K3CA 2UYYA 3HCOA 1W4AA 3SSMA 4Q1CA 2A84A 1J33A 5EHIA 4M1YA 5AIBA 4WLUA 5K3FA 1SUFA 3LK6A 1GRNA 5F52A 3AL3A 2ZPUA 2P9CA 3U6KA 3R7LA 1BWPA 4PX3A 2DP4E 1TRKA 1PFKA 4FOLA 3G89A 2Z3VA 5IMSA 2NPOA 2YJ3A 2BFDB 3DE6X 3G1WA 5DX1A 2BJWA 4QNNA 2VAMA 3DL4A 3IS3A 4C0XA 4DEXA 3MBKA 3VC2A 4BO6A 1V1MB 4GP7A 3T4UA 3FMPB 2O19A 1CB0A 3ZWWA 5KPDA 3VHQA 1OYOA 1VPLA 1E79A 2XYHA 1U1IA 4HUTA 3KSMA 3LGXA 5BVHA 4FIZA 1TYZA 4EG8A 2CNDA 5AI0A 1KY5A 1ZUIA 2Z9BA 3LA8A 3VXKA 1LBEA 4C5BA 2E4VA 1T1GA 2PGNA 4WI1A 1Y8ZA 1JFSA 3R8XA 3IA7A 1GCIA 3M70A 4FYIA 4B2IA 5JOQA 4WLOA 1Q7CA 2P9GA 4KNYA 3FHJA 3B36A 2JIZA 2EX0A 3NHPA 5D85A 3ZV4A 5A5VA 4KQKA 2CDRA 5I6DA 1JNXX 3A4LA 3FX2A 1Z13A 4LJYA 4OBEA 1EDOA 1HA3A 1UBEA 4R0VA 5DPMA 1E2IA 5H9WA 3K20A 2DERA 1SVOA 4Y3UA 2FAXA 3A6LA 3QP9A 1ORTA 2TMGA 1KVSA 2WJZB 3EBPA 3PVSA 1XQVA 2DUWA 1DTEA 3UWMA 4BX2A 1T5BA 3R7AA 4DL9A 1Y9JA 3TUZC 4TOIA 2GZAA 1VMDA 1Z6YA 1ZMOA 3NRBA 3TCNA 3ASZA 4M88A 2JCYA 2B36A 4ABTA 5TDHA 4PYRA 5BWNA 5KJ1A 4NZOA 5ED4A 1DBSA 1JDPA 1YB4A 5KCZA 2UYCA 4BP8A 3AEUA 1GO2A 2QKYA 1RQPA 2V7PA 4J4BA 2JLBA 1TLFA 3IHTA 1OFTA 2Q29A 3KUCA 3MG9A 4H3KB 3P9KA 2O8EB 2YHIB 2YTZA 1G64A 2C4MA 3R0JA 2PRJA 3JAKA 3MJTA 1VCIA 4YRMA 1KNXA 4QUJA 2I7XA 3DD1A 1ZGBA 3ZVLA 3KUDA 4GC5A 4E5NA 2FNAA 4MV6A 4PXAA 2X3FA 3PTLA 4UUAA 4YMWA 1PV1A 3PKIA 3NQ41 1ZD5A 4UVHA 5JNLA 4ND8B 4QU5A 4W5WA 1CF9A 2R86A 5MN5A 2CLSA 3UKJA 3GFGA 4IHQA 4Q4JB 3TKYA 3OEWA 4WKGA 1S5PA 4FC7A 4NWIA 3F78A 2HQOA 2PU7A 1C7IA 4MHSA 3NP7A 2V4MA 1DBVO 1OYYA 1WPGA 4PIMA 4Y1EA 4DV2B 3THWB 1C8BA 3DO8A 3LYUA 4KQGA 5AP9A 1JI0A 2VYNA 3Q85A 4QLOA 5H3HA 5HILA 3R5XA 4LRUA 1RYZA 3OH8A 3ZEAA 3G85A 4B45A 2QDKA 5B7GA 5C8DA 5JRDS 5FTMA 4W5OA 1JEOA 4JOQA 2LBPA 5EMKA 3HWWA 1FC0A 4A10A 4C6RA 4CQNA 3RJ9A 2WT8A 3GCZA 4JT2A 1NXVA 2BFMA 4I1IA 2DPXA 4GPAA 3OZSA 5THQA 4KLZA 4L75A 1U1FA 2UVDA 4AIIA 1ZPDA 3QVJA 1U94A 3ZHXA 2H54A 3DZKA 2Q6VA 4QXMA 3ZWAA 1G8HA 2XNHA 2LR0A 5CD9A 1Z6AA 3SQDA 1Y9EA 2A9FA 3VPXA 3ZNOA 4MVCA 1W93A 5G0VA 4E5VA 1YUBA 3RS0A 1A5TA 1T1JA 5D1HA 5HBGA 4U9IS 5ARDA 1GKLA 3F6BX 3LGAA 1HLGA 3B52X 3M4YA 5A3SA 4G0QA 4N47A 2VJPA 2OCAA 2B0CA 2GJSA 2P2ZA 4L5CA 1NW7A 2YJ6A 3P5BA 4R9RA 5FYDA 2REBA 3T3DA 4F93B 2SNIE 1TAQA 2G3YA 3IKMB 2W2KA 3DZBA 3WFIA 3KV1A 3PFHA 5ES4B 2OXTA 1CT9A 4Y6GB 1E1QD 3OJEA 1O96B 5KTPA 5E3JA 4BRZA 1TW3A 2BP7B 5IC6A 1WXQA 3D4PA 4EQZA 1DVRA 1W85A 4TRJA 5KYUA 1V11A 2PCLA 3OBIA 4TL8A 1MCZA 3AKCA 3V34A 3ZY2A 1ISSA 4I8DA 2A5YB 1W25A 2GNAA 3RYIB 4L95C 1C30A 3UMBA 2ODAA 4NONA 1Q20A 3TD9A 5P21A 2H11A 4ND5A 1SU7A 1AGXA 4Y8VA 5BORA 4DV1B 1JDTA 2RAFA 4JN6B 1VHQA 3STXA 1LI5A 2J6BA 2QRNA 4QRHA 4CLHA 1CY4A 5F7XA 1QOPB 3SXUB 3RS3A 4PSVA 4Z7JA 3AVOA 1LDNA 5G1OA 1L1EA 4H7KA 3B13B 1EHYA 1CR0A 3G49A 3W2GA 4HVCA 4YV1A 4UU7A 3QKSB 4XUDA 2ZR0A 3LDGA 1P1CA 3IR5A 3WR5A 4NPHA 3A37A 4GYJA 1EE1A 1WUTA 2IIBA 4WY8A 2PSFA 4G81A 1S2LA 1DHRA 3ZPXA 3R9WA 4BX9A 2WDPA 4NBWA 2PGDA 5LA6B 3CU5A 4QAJA 1M2HA 1CUHA 1MPTA 3E18A 3KQLA 1XAJA 4D5GA 4QVIA 3AERB 1HG1A 3U37A 2ZLBA 1HDGO 4JR1A 1RPNA 5T4EA 2YRFA 2EDAA 4JT8A 3ZOKA 2ZK7A 1YRYE 1SUEA 2V7XA 3TFOA 1W5AA 2FPMA 1KMCA 3AR5A 4CIBA 2R6JA 4BAUA 4CM8B 1NJ1A 3JYNA 3WAKA 1IY8A 3WKDA 4QARA 2AYYA 3TRKA 3K70B 2DR0A 3U4HA 5DVZA 5K0CA 2XYGA 1ZIPA 1X9HA 3E58A 1YBFA 5EKUA 2V1XA 4UM9D 3R7DA 4AO8A 4MEBA 4TKUA 1QAOA 1GZVA 3D1JA 1M8FA 2HU7A 1JIJA 4CIXA 1TLTA 2FR8C 2C9OA 4S0ZA 3CBGA 3PFWO 3T9EA 1AZTA 2GPAA 3PC7A 4O5OA 4F1JA 4G41A 2JS7A 4HFJA 1OLUB 5E1BA 1C4XA 5LC1A 2X0RA 3FUXA 5DJ5A 3ADCA 3FTPA 5GONB 1P77A 1VB3A 3E5RA 4QTUB 4EG7A 2PUFA 1T6NA 2IX3A 2FQYA 1AKQA 4Q4LA 3G5AA 3L02A 3AKDA 5KPJA 4O4HF 3NTXA 2QN8A 2CDAA 2EBFX 1XRSB 4B46A 1CETA 1W7AA 5DIZA 2AZ4A 2O2IA 1UC8A 4K9DA 4G8BA 4QUHA 5IXYA 1HTBA 2BMVA 5IH3A 5KTMA 1SXHA 3TQQA 4L8LA 4XIJA 1CDOA 1IUNA 1GZ7A 4DDTA 4ZAFA 1GCOA 1N6OA 2WQZA 4HEA6 1VZ2A 2YJNA 4BFUA 1W8IA 5J9FA 3NJ8A 4DT1B 5D6NA 1GGVA 4F3TA 2Z0MA 4FCCA 4US2R 4DLTA 3VX3A 3EG9B 2P6UA 5EIOA 3C3CA 2QN2A 2DFLA 2FZVA 4F6RB 1RJWA 4FYYA 2BLLA 3LKDA 2X1MA 2IZ7A 3ENNA 2EWMA 4UBKA 3G0BA 5IN5A 4L0QA 3RLFA 3VH3A 4YP0A 1IATA 1KDOA 2Z6QA 4R1TA 4NJMA 1YBAA 5ELXA 3AMVA 2WE8A 2VTVA 4JA0A 4GM4A 2DY1A 4RVCA 1PJ2A 3VKFA 3EXG1 4W1QA 1WHTB 1C29B 1ZIDA 3LBNA 3OE7A 2PX6A 3OEEA 3W5BA 4LHZA 1OXBB 4C0LA 2GBFA 3QVXA 2W6JD 2VATA 4C76A 4AWAA 2H9AA 3NFRA 3DS8A 4W8OA 3G9QA 2FPPA 2XPCA 4U2CA 1DJLA 3RV3A 5F2OA 4F3NA 2GCIA 1M9NA 3I2JA 3BZBA 3RRJA 2ZKIA 1T91A 3LFTA 5BY2A 1SCJA 1UBUS 2J6HA 3HCPA 3KVYA 4LK2A 2NO9A 3ANXA 3H13A 1ZC4A 4ZQEA 4ZQFA 4U0KA 2CUZA 4D9MA 1JDVA 3GJXC 5KJ6A 1YFLA 2PGOA 4IV0A 4QO7A 1R4NB 1CZKA 3R40A 5DX0A 1WF6A 4LX0A 2E3JA 5AOAA 1T6BY 4JUAA 3SSOA 1VPVA 3CRQA 3FAZA 3BZWA 3WKEA 3WDMA 3HA2A 3R5HA 2G25A 2Z09A 2AEJA 1TUBA 1QGDA 1EG2A 4OLFA 1MC8A 2PKEA 1V8PA 5CJPA 1KSGA 3X1KA 1JXAA 4DGQA 5JFTA 1ZWLA 5K01A 4C29A 1M0EA 2Q45A 4NHEA 2LP4Y 4RQAA 3IL2A 3HFSA 4H7EA 2ODBA 4IRMA 1QH1B 1JJ7A 1TYDE 2ROQA 2XTJA 1MHTA 2P6RA 2Z30A 3QMMA 5E7MA 1MP0A 1Q0PA 3DHWC 1MO4A 1RYHA 2B4TO 3QPBA 4FXPA 4MUEA 5HF8A 4QXRA 4ZV7A 1IULA 2P9JA 3ECAA 3PDUA 3R0QA 3HBMA 1MFZA 3N0XA 3MT7A 1GARA 2W8ZA 4R4JA 3C7KA 1QKIA 2A88A 1MVOA 3WLJA 4YA6A 2L18A 4OLJA 1IJBA 2R8PA 1J56A 3L7DA 2XIQA 3EEFA 5DN6D 4ZHQF 1TF7A 4G89A 1I6MA 4K0RA 5THXA 4EQ6B 1Q2UA 1A1VA 4LBZA 4C2AA 4R2MA 5ESXA 4TWJA 4WNCA 4KFUA 3RK4A 3ANMA 3WBFA 1SWWA 3SSAA 2P2NA 4LCEA 4YJHA 1SU4A 1ZBQA 1BN6A 2DJ5A 4DCPA 5B1YA 4BV3A 5HJ7A 1ESZA 1RR6A 3U49A 5CYPA 3TECE 5IULC 3JQBC 1NKTA 5AKKA 1NE2A 4I9UA 4DE5A 2MWMA 2ZYGA 2J5XA 3AY6A 1WZEA 3L79A 4KAFA 4ZO8A 4CL2A 1M7HA 2QLMA 4WZZA 4CKZA 3D8TA 1U3TA 3EZYA 1NNSA 1M1YB 1EUDB 2BCGY 4LMPA 4EUSA 4YRPA 5KYWA 4HMQA 3SHWA 1H3NA 1MBZA 5A3RA 2IXDA 4M9QA 2ZROA 2VP5A 3NC0C 4AN0A 3DUFA 1YRWA 3JQEA 4DA8A 1Y4DE 2Z1DA 4IDPA 5JS2A 1M1XB 3U61B 3QEMA 5IJAA 1QSGA 2P78A 5IRCD 1E8NA 3GIWA 3BFXA 3P27A 5L51A 1MB3A 2XB4A 2XQJA 4BX3A 4RD4A 3VU8A 1KVQA 1Z6TA 2OGZA 4DLSA 4EGSA 3CVXA 1N33B 4OHZA 4Z54A 1WDKA 3CF4G 2GZMA 4RJIA 3FMVA 4LF5B 3ICQB 3DOOA 3MAJA 3P8ZA 1ICIA 1KPIA 3B9PA 2JDIA 3GVIA 3VM6A 1AOXA 1DGQA 5CCEA 2RJ3A 2NXNA 3H16A 2YIJA 1N6LA 5FWNA 4Q18A 4TKVB 3IXQA 3GN2A 3IESA 3HZOA 2HCBA 1WBJB 2O4CA 3HV0A 4EHDA 5BPHA 3G2IA 4MMYB 4Q0MA 1CDZA 2ZGVA 3AQIA 1KFCB 3V2HA 3EMBA 2OLKA 4KLAA 5CLJA 5IHXA 1W19A 2BZ1A 3DAHA 1CQIB 2YWBA 3DGEC 5KHAA 2F3TA 3GGJA 3SHOA 3KT0A 5AVVA 1IM5A 2ZSBA 3N0RA 2I3AA 4EHHA 1S6YA 2N1BA 3U3OA 1FU8A 3JWGA 4EMBA 3ER9A 1XLWA 1FFCA 3UATA 4DIKA 4WGGA 1N9ZA 1YZLA 3H2GA 3KAKA 4HX2A 4OQMA 1L2TA 3C6XA 4YJFB 3HKCB 4ENPA 4GGPA 4E2YA 1CDDA 4MUNA 3BBLA 4OQFA 1YR7A 1HYEA 3V7UA 1A8QA 1HYBA 4D8XA 4EJSB 3EZLA 1V3TA 3IEPA 2Y1FA 3PPWA 5BV0A 1V48A 2F4NA 2OV2A 3VH1A 1TPZA 3PNLA 1TKCA 2YMMA 3GFOA 5TQVA 1Q7EA 1LDYA 1L7MA 1U6KA 3RU3A 3MTEA 4WZBA 1HNZB 4I4TB 5CLGA 4C2UA 4HWKA 3U7JA 2JFVA 1XEAA 3WLFA 1Z73A 2XOKD 4LOLA 4B47A 4BNMA 1M1UA 3K9LA 3FGZA 4KG7A 4UVGA 5LQRA 4REQB 1N7GA 3SXPA 5J2TA 1R6BX 2WTNA 3JQQA 1XZFA 4NX2A 5C34B 3G2LA 3U7FB 4FDLA 4XQ0A 3RCBA 2KYRA 3PPVA 5CM2Z 3SF8B 1VI6A 3TL6A 3PTZA 5JYEA 4KFSA 1R27A 2ZJOA 2HLDA 3PDIB 2DECA 3BMCB 2FRVA 3HB0A 4B34A 3ZHUA 3OJ0A 4XB1A 3FSRA 4KIGA 4IG9A 4NCIA 1XZLA 1RU3A 4AZ0B 1LH0A 2V0GA 3UN1A 3B7WA 5CFMA 2A9PA 2PIDA 3AR4A 4U9HS 3H84A 1XMJA 2AI3A 4ZO7A 4FD2A 3UC9A 1NFRA 2XE7A 2WTAA 3AR2A 1VG9B 1Q0TA 2HNKA 4ARIA 2M1XA 3O2SB 1L1RA 3DE3X 1LS1A 1YZ3A 2DX7A 1GPWB 2ONZA 2FKAA 1YZFA 2J4DA 2LUOA 2VJMA 4MHOA 5ALIA 1QTQA 2PKQO 1KP9A 4FHFA 2X5NA 3CFYA 1KZHA 4P58A 3B2QA 3EIWA 3V32A 5C7IO 2WLSA 3TGLA 1CV2A 4F97A 4IX9A 2OBNA 4MH0R 2WW8A 4P7GA 4NR0A 3NANA 2CMDA 3DC2A 3ZKWA 5F7OA 2DETA 4X8LA 1A8SA 1XQXA 2PSDA 3OAAD 4IVRA 1VIAA 4LRTB 4Q3DA 4J4HA 1AHPA 2QQ0A 4RV5A 5LQCA 2ENWA 1ULSA 2OLJA 1WZ2A 1V5WA 1V7PC 2PL9A 4FSDA 4ZT2A 1XEXA 4KQMA 1FUEA 1HYHA 4ITVA 3SC3A 1XN4A 4W9MC 2EYQA