1YS2X

Burkholderia cepacia lipase complexed with hexylphosphonic acid (s) 2-methyl-3-phenylpropyl ester
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
320
structure length
320
Chain Sequence
b'ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVGGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Mirror-Image Packing in Enantiomer Discrimination Molecular Basis for the Enantioselectivity of B.cepacia Lipase toward 2-Methyl-3-Phenyl-1-Propanol.
pubmed doi rcsb
molecule tags Hydrolase
total genus 131
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2005-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ys2X00
4W1PA 2FUKA 3PFBA 3DYIA 4MEAA 4Y7DA 2OGZA 5K3DA 5F4ZA 1TRHA 4BATA 4UHDA 1AMNA 4B6GA 1ZICA 1UK9A 4J03A 3WJ1A 1CUEA 2X76A 1BRTA 4B0OA 1JU4A 1XRQA 3ESBA 3K2IA 1R9MA 1CEXA 2HRRA 1PV1A 1S8OA 1EB9A 4WDQA 3W04A 4KR0A 4ZGBA 4AXBA 3M3DA 3G0CA 3WL6A 5DYYA 3FBWA 4KACA 3RK4A 4H18A 4C6HA 3A70A 5AOBA 2DFPA 3HSSA 1EDEA 2HIHA 3QMMA 5JZBA 2OAEA 2G4LA 3A2LA 5J3JA 4V2IA 2O7VA 2O7RA 1LPBB 5JZSA 2O2HA 2HA5A 4FBLA 4G8BA 5LZ8A 5IVIA 5C81A 4TVKA 5HKAA 5JATA 1EH5A 5HK9A 1GPNA 4W1QA 4MYDA 4ITVA 2PUHA 4P92A 5ALIA 3G9ZA 2C0PA 1W52X 5CT6A 4DTCA 4FLMA 1QIIA 2I3DA 4Q3LA 2XMZA 2QTBA 4B0PA 5KREA 1DQYA 3BDIA 2WIDA 1U2EA 2G5PA 3OTQA 5AKZA 5ALDA 5EHNA 2BUCA 5ALSA 3TJMA 4AQDA 4A5SA 4KE7A 4W9RA 2WJ3A 5AK6A 1VA5A 2C5GA 3H18A 1ZGCA 1YB6A 4X71A 1XZIA 2XUAA 1EDDA 1M33A 4PSCA 1CUSA 4J0KA 1EXWA 3WZLA 2O2GA 5AKYA 1C4XA 4G4GA 3I28A 3O4JA 2PSDA 1THTA 1BS9A 4Q34A 4FFVA 2C0QA 4FLFA 4GLBA 3ZI7A 1MAHA 4HS9A 2W6CX 4AMYA 4QEKA 5FPPA 4QWWA 5JD5A 4IH9A 4C89A 1MT3A 4EZIA 4EUSA 3WKDA 4GI1A 5AKKA 2FJ0A 2WUEA 1YS2X 4H7HA 1IUNA 5A2GA 4UHCA 4EY5A 1CVLA 5JARA 4UBMA 2HHAA 3IUQA 3O4IA 3WQHA 1AQLA 2JGMA 2C7BA 4WFIA 4LXHA 2DSNA 3CXUA 4UHBA 4Y2PA 4H7KA 4H7DA 2B4KA 4CIBA 1VE6A 5AM1A 3E1GA 4BVLA 1XROA 4UHHA 4Y2RA 5JASA 3LIIA 1LNSA 3F9CA 3R3WA 4Y2TA 5SYMA 2DQYA 4BYMA 4LXIA 2V9ZA 3LIPA 3UUFA 5CXUA 1XRRA 3O95A 3QBJA 5AI4A 5AKHA 3D4LA 4JH0A 1CUZA 1MO2A 2Y6UA 5EHQA 1QOZA 1LGYA 2AJBA 3HYSA 1ZOIA 3W9UA 3D59A 1UWCA 3BIWA 3IA2A 3IB3A 4Z49A 1IUOA 2XMQA 4UBLA 3WWPA 2QJWA 1R3DA 5C8XA 2XLCA 3GBSA 4K6GA 2WILA 4PO3X 3BDVA 1LZLA 4B9EA 1FFEA 1TKRA 3HI4A 4GDMA 2OLEA 4QE3A 3VJKA 4LXGA 1CPYA 1N5MA 2ROQA 1WHSA 2XQKA 2ZJ7A 2XB6A 1NU6A 1ZI6A 2PU7A 3U0VA 1H22A 1U65A 5EHXA 2PVSA 1HBJA 5HZGA 3ZPXA 4FTWA 1VE7A 2HL6A 5K5EA 2GBGA 5ESRA 2QT9A 5DYTA 3STTA 4KRYA 2XUKA 1XRPA 2C5FA 3BXPA 1DINA 4GW3A 3QM1A 2ACEA 1GXSA 4B83A 2HM7A 1KEZA 1CUXA 1CR6A 2Z8ZA 2OGTA 5BOVA 2DHCA 2UZ0A 1E8DA 3TRDA 3STXA 3VJMA 1JJIA 2XT0A 3WWDA 2J4FA 1CV2A 4MXDA 4TGLA 3RM3A 4CCWA 3AZPA 1IZ8A 5KBYA 1MNAA 2DQZA 3ICWA 1DQZA 2PU5A 2AXEA 5I7UA 4RE5A 1GKKA 5AM3A 1EA5A 2LIPA 1XKLA 2OCGA 2HU7A 1FFCA 2WFLB 5IH7A 2ZSHA 2VT7A 1QIGA 1QE3A 5H3HA 2C4HA 2OQIA 5JAPA 1EX9A 4JEIA 4KAFA 5ALMA 2QUAA 4IHAA 1TIBA 2WUFA 4C88A 3WKAA 3A2NA 2WQZA 3FWHA 3T4UA 3DD5A 1ODTC 5HF6A 2H7YA 4DMFA 2CJPA 5ALTA 1E8MA 2BKLA 2QZPA 4BAZA 3O9MA 2VJBA 4JUIA 2H1IA 3WL7A 1EVQA 2Z8XA 3N2ZB 1OXMA 1SCQA 3IULA 1ZJ5A 4E15A 2H7XA 2VAVA 2JGKA 1G4HA 4E14A 5E4JA 4QNNA 4QLOA 2XE4A 2WFMA 1JJBA 3WYNA 3WLAA 5FDFA 1OILA 3WA6A 1Y37A 2ZSIA 4QZVA 1YA4A 3WMRA 4MQMA 4OPMA 2Z3WA 4WY5A 3D0KA 4HZGA 1JKMA 5K3AA 1P0MA 3DLTA 3C5WP 2XUFA 4B85A 4DMKA 2OCKA 3VJLA 5AKLA 2DCMA 1USWA 1SCKA 3BIXA 5AIBA 3B3QA 3GFFA 2VJDA 3FOBA 3G02A 5C7YA 4ZI5A 5FKJA 4MWTA 3BF7A 5CXXA 5AI5A 1XZHA 2XI4A 2YASA 3FLBA 3RKSA 2WTMA 5CTAA 4N8DA 1UOQA 1GQRA 4CG3A 2ACKA 1JJFA 4Q3OA 4D9JA 3PF9A 5HFAA 2HA6A 4QLAA 4ROTA 3V9AA 2NW6A 2QUBA 3O9VA 3LP5A 3AIMA 1ORWA 3G0BA 3QMVA 2GBIA 3YASA 2B9VA 4J0GA 4IQ4A 1MPXA 2WKWA 5IVKA 2VATA 4BTLA 1CUJA 2HA7A 3KSRA 3E4DA 3O4HA 3FYUB 5FUMA 1EVEA 4DIUA 5E4TA 5AM0A 2XMSA 4WCVA 4DMCA 1YB7A 5HF9A 3WK6A 1ZD4A 5CT4A 2J4CA 4X00A 3V1MA 2XMBA 4DMHA 1EI9A 5ISMA 2X8BA 1GPKA 2XUGA 3PICA 4ZREA 3L1JA 4NS4A 1DWOA 5T4FA 4FNMA 2P8SA 1XZMA 5JADA 4OB6A 4CG1A 4DNQA 1QIFA 1YAHA 3K9BA 1XZEA 4DLNA 3AILA 5JAUA 1B41A 2J3DA 5CMLA 2HFJA 3I1YA 4X93A 3R3YA 4B81A 1GPLA 4OD0A 4M0FA 5ALQA 1J06A 5D7BA 4PNZA 7YASA 4Y2QA 3JYHA 1WPXA 3WZMA 1VLQA 1XLVA 2ZJ6A 2CMFA 1Y7IA 4K2AA 2JGFA 3OURA 5AHXA 1QO9A 2WUGA 2WFZA 2HFKA 3HRHA 1I6WA 5A71A 1K63A 1XKTA 4X6UA 5IVDA 4XWGA 1XZGA 2EDCA 1F8UA 3SC2A 1MTZA 5AI6A 4Y9SA 5AK4A 1JT2A 4N8EA 2Y2VA 1YSCA 2G63A 1A88A 1TCCA 3WIOA 2EEPA 1DWPA 2WTNA 3F98A 3FYUC 2OCLA 1LPAB 3H2HA 1Q84A 5DYWA 1J07A 4BC0A 4M0EA 4BP9A 1QFSA 4MJ3A 3I6YA 4K6KA 1TQHA 4DYHA 4XJVA 1N1MA 5I8PA 2ZVDA 2G5TA 2JEZA 1GQSA 5AI9A 2ZJFA 4Q3KA 1ODSA 1J1IA 2H7CA 4U2GA 1ZD5A 5EHZA 2QR5A 1A7UA 4PF1A 4BE9A 3M83A 3WJ2A 3F97A 2WHQA 5CH5A 3L1HA 1CUBA 3H19A 4MEBA 1N5RA 1ZD3A 5K3CA 3STVA 1QONA 4C4XA 1XLUA 3C6BA 2GBCA 4IH4A 1XZDA 3WL8A 2XMDA 1VOTA 4EB0A 2JGJA 4UUQA 2HDWA 2GZSA 1VXOA 3EQ7A 4YK7A 1QIDA 4OB8A 4WY8A 5JZ9A 1UFOA 4O08A 1GGVA 3GZJA 4OUKX 4H7EA 4OB7A 3AINA 1ZI8A 4Y2UA 4FWBA 1XZLA 1HKHA 1BCSA 2C58A 1YCDA 2ZYRA 3QMWA 2ES4A 5LZ7A 3B5EA 5LLSA 4KAAA 4CCYB 4J0CA 3BWXA 2B20A 3KDAA 2PPLA 1P0IA 4GWLA 1CQZA 1H2XA 3UUEA 4DGQA 1XZKA 4CFSA 3HXKA 1EDBA 2V96A 2BGRA 3F8SA 2JBWA 1QIHA 4RE6A 4Q1VA 5DLPA 1QFMA 4DSAA 2OGSA 4M0MA 5A7GA 3G0IA 1CRLA 5FPQA 2GYVA 1F0NA 3H04A 2OPHA 1EB8A 2HU5A 1E8NA 1VXRA 3VXKA 3G9XA 2WIKA 3DOHA 5ALFA 1OCEA 2ZYSA 1FSSA 4U2BA 4DM7A 1QZ3A 3C5VA 5ALOA 2QKYA 2WHPA 2AJ8A 5T4HA 5KWJA 3FSGD 4RNCA 1TCAA 5JAOA 4X94A 4A16A 3ESDA 3ZV7A 3PUIA 3NUZA 5ALXA 1IZ7A 2GZRA 4INZA 4MWSA 4NZZA 4UBJA 3CCCA 4JNCA 3OM8A 3R3ZA 1QTRA 1THGA 2XUQA 2DHEA 4X7BA 2WJ6A 3X3HA 3V1KA 3FVRA 5ALLA 3I6ZA 3HZOA 4BE4A 1ORVA 1NU8A 4C4YA 1UXOA 4GHWA 2PSEA 5DNUA 3WA7A 2I78A 5AOAA 4EBBA 4UBOA 4JYMA 3C6YA 3H0CA 1GKLA 4L9AA 3H1BA 4H35A 3L1IA 5AK5A 1DX6A 4Q82A 2Y6VA 4BCCA 2FX5A 3IUJA 3VVLA 3W06A 2PSJA 2XQJA 5AJHA 2XMGA 1DTEA 2VAXA 4BZZA 4FDMA 2DHDA 3T52A 3I2IA 5CH8A 1G42A 2CEKA 3R40A 1XQVA 5IKXA 1LLFA 2RHTA 4LYDA 3SX4A 4BRSA 5K3EA 3I2FA 3CN9A 1AGYA 2PX6A 4P93A 4B82A 2Z5GA 3EBLA 3HJUA 4FBMA 4J0DA 1HQDA 5FLKA 1W75A 5HQ3A 3HC7A 3TGLA 3D7RA 3QH4A 5ALUA 5E2IA 4BDSA 4OU4A 3WK5A 3ICVA 5CT8A 3MUOA 1R9NA 2RGUA 4AO6A 5A7FA 4I3FA 1G66A 2ZYHA 4YASA 3WKCA 1TAHA 5FOQA 4U2CA 4LYEA 5ALZA 5AM2A 1CUFA 1K6EA 1FFBA 2FJPA 3F67A 5FRDA 2WUDA 3R3XA 2VSQA 3BF8A 4PSUA 5EIAA 1AX9A 4U2DA 1JFRA 1HLGA 3QZUA 1WM1A 3I2HA 3WIBA 2IITA 5ALRA 1QIKA 3D2AA 3WI7A 5CURA 3C43A 4PW0A 4PV7A 1LPSA 3W9BA 1WB4A 2XUIA 4G8DA 2XUHA 2VEOA 3LLCA 1P0PA 3SK0A 1AZWA 2WJ4A 5JANA 1E89A 1SOMA 1A8SA 4G9EA 2XMRA 3WK4A 1IVYA 3O0DA 4X95A 5FV4A 1YASA 3KD2A 1PFQA 1WB6A 4UPDA 4BZWA 5ALGA 2WSLA 4RGYA 1L7QA 3HABA 3U1TA 3RARA 1KU0A 1XRMA 5AOCA 1W76A 2Y1KA 3H2JA 1CUVA 3WWCA 3FNBA 3K6KA 2XDWA 5EFZA 3S8YA 5SYNA 3V48A 5AI0A 5AKGA 2VJCA 3PFCA 1ZIYA 1CQWA 1DT3A 4F21A 5DTIA 3I2JA 1QIJA 4Y2SA 2XQIA 3ED1A 1ACLA 4FKBA 2WIGA 1ZI9A 1XZCA 1UKBA 2R11A 4N5IX 1MAAA 1DWQA 3C6ZA 2BUAA 4KYVA 1BCRA 1K4YA 2JGLA 4QWMA 3QITA 3I2GA 3MVEA 4BVJA 3ZLUA 4L3WA 1ZGBA 3ANSA 1NX9A 5LZ2A 5HCUA 1YR2A 2BAGA 3H17A 5A7HA 1QTIA 4Q05A 4UBIA 5ALKA 3ZLTA 3IVMA 4GBGA 1BU8A 5I9IA 3G9TA 4HXFB 2HRQA 5DNWA 2V98A 2WLSA 4OU5A 5AI8A 2YYSA 3DS8A 4OCZA 3C45A 4ARAA 4ETWA 3ZWQA 3BJMA 5ALYA 5JYCA 4J0IA 1QO7A 5HKBA 1BN7A 2PUJA 3DJYA 1AKNA 4K6HA 1DT5A 3LS2A 2OG1A 2WHRA 2GBFA 1Q0ZA 5ALHA 3C8HA 1DU4A 5ALNA 1X2EA 1E66A 2I3ZA 2BCEA 1JMKC 3P2MA 3Q8WA 4CG2A 2IIVA 4Y2YA 5DJ5A 2H9YA 4GEGA 3GELA 3WKBA 4G4IA 1UKCA 2Y2UA 4LKOA 2PSHA 3C6XA 1LPPA 3G8YA 3D3NA 5D6OA 4UBNA 2AJLI 2JIDA 1EK1A 1T2NA 2VF2A 1MJ5A 3OG9A 4FOLA 4BDTA 2HA4A 2D0DA 2I03A 1FJ2A 5ALWA 1N8SA 3E0XA 4F5ZA 1SFRA 1K8QA 4N8SA 3PE6A 2CUTA 1CUCA 4BC1A 3ZLVA 5JIBA 3AZOA 1H23A 4B84A 4PQEA 3G0GA 1F0PA 5T4EA 4AN0A 2WU3A 1XZAA 3D5EA 3AUKA 2AJCA 3C70A 3OC0A 1G5FA 3EQ8A 1W4LA 3GUUA 4C01A 5ALVA 5ALPA 4J0HA 3MUNA 4AO8A 4X3CA 4KE6A 3VVMA 4DNFA 5JAHA 2CB9A 1UOPA 1MN6A 2JF0A 3BJRA 5LP1A 1UK6A 3PUHA 2O2IA 1RP1A 4UFPA 5IVHA 4KJXA 1QGED 2PM8A 1O6GA 2QVBA 4X97A 3STWA 4EHBA 3W05A 4EY7A 5DTJA 5C8VA 2WIFA 1WHTA 1XFDA 2HU8A 3FLEA 1BROA 4JYPA 5LYYA 1PJAA 4F60A 4W1SA 4OYYA 4E46A 4G1FA 5K3FA 5KWIA 1CUIA 3C87A 5YASA 4BRZA 3STYA 1R4ZA 3WL5A 1LBTA 3FSGA 3R3VA 3FYUA 3PDCA 4AZ0A 3M81A 2QM0A 5AKEA 3E3AA 1XRLA 2BJHA 4QDTA 4YPVA 4HRYA 1CUYA 1YAJA 2OCIA 2QS9A 2E3JA 5A6VA 3F96A 4G8CA 5LKRA 1XRNA 5EI5A 2AJDA 5CT5A 4BP8A 2B61A 1D07A 3A6ZA 4U2FA 2ONCA 1U4NA 3FCXA 2QJRA 5CW2A 5LZ9A 1ZD2P 1FFAA 4I4CA 4WJLA 4GXNA 3A2MA 5BV7A 3CCBA 1R88A 3FVTA 2BUBA 3VISA 1VZ3A 2WHPB 2XQGA 3G7NA 1BEZA 2VT6A 4I19A 3WWEA 5BWBA 3H2IA 5AP9A 3H2GA 3N0TA 4BAUA 2ZYIA 5HF5A 3DYVA 2WG0A 3M82A 2V97A 4AO7A 1QIMA 1E3QA 1H2YA 1WCYA 4WFJA 3ANTA 4MYSA 1TCBA 3O4GA 3NWOA 3ESAA 1O6FA 4H0CA 3JW8A 1L7RA 4UFNA 4CI9A 2JGIA 5EIHA 2HADA 3I6MA 4B7ZA 3G0DA 3IIIA 3WK7A 5LIPA 3JWEA 4Y2XA 2OQVA 3V1NA 2XUJA 5FXMA 1QLWA 2J3QA 4FMPA 4PSDA 5ALJA 1ISPA 4G5XA 3B12A 4HXEB 4C87A 3KOOA 4A23A 5JD6A 1XZJA 2PL5A 2PKYX 4AN1A 4BAGA 4EY4A 2Z3ZA 5AH0A 4B9AA 4CIAA 4J7AA 4ARBA 1JU3A 1YS1X 4IH1A 3DQZA 1UZAA 2WG1A 4ZXFA 4XVCA 3DCNA 4L0CA 3IURA 1P0QA 5EGNA 4BBZA 3QPCA 1MX1A 1QIEA 5T4BA 2YH2A 3I2KA 1VJ5A 1TK3A 1W6RA 4J3JA 3NOXA 4KAJA 4IO0A 3EQ9A 3SWWA 2QOEA 4BVKA 5EIEA 5LZ4A 5JALA 5HQ3B 1CUAA 1IMJA 4TPKA 2Q0XA 3QPAA 4ZRDA 4UHEA 2D5LA 2OXEA 2HA3A 3DNMA 1MX9A 2EDAA 1CUUA 4AB1A 1CUGA 4QDXA 3TEJA 2HA0A 1AURA 1CLEA 3ILSA 3MGAA 1ETHA 1EK2A 1A8QA 1YA8A 5K3BA 4G4JA 4YX9A 2YXPX 1MNQA 2IX9A 3DL7A 1ZJ4A 1T4MA 5AKIA 2CZQA 2R8BA 3R41A 1LBSA 3DKKA 1L7AA 5AK3A 1A8UA 2XUDA 4K5QA 4G9GA 1R1DA 4UHFA 3CN7A 2PBLA 5CT9A 4W1RA 4UFOA 5AIAA 5CH3A 4Y2VA 2GYUA 1ACJA 1XQXA 1ZIXA 2QMQA 4XX1A 4CCYA 1IUPA 3I1IA 1C7JA 3WWOA 4EY6A 1ODCA 3S2ZA 3G9UA 4HVTA 5AM5A 1JI3A 3R0VA 3FCYA 3FYTA 2VQ6A 4QA9A 1HPLA 4QDZA 3HEAA 3R3UA 5CBKA 4EY8A 3VKFA 4QDUA 3IBTA 5HF8A 2BGNA 3FLAA 4FNGA 1MU0A 1R50A 1RYYA 4X91A 1Y7HA 1E5TA 4BCBA 3QYJA 2PSFA 4U2EA 1AC5A 2VA9A 1BN6A 2XUPA 3Q0TA 4OSEA 4KRXA 4P9NA 3GA7A 4ZV7A 2CBGA 2RIPA 3V1LA 4BCDA 3DEAA 3OPMA 3AFIA 1RWQA 1VKHA 1EHYA 5D3KA 4LHEA 4X6XA 4GECA 3UMJA 1XZBA 2HA2A 4X90A 3QVMA 4X6YA 1UK7A 2GYWA 1XQYA 3D2BA 3DDUA 3FAKA 4HAIA 4KEAA 3VDXA 3WK8A 3PF8A 4E11A 4B80A 3H1AA 4FHZA 2X5XA 4X92A 1UK8A 2BFNA 4P08A 4N5HX 1UOOA 2XMCA 3AJAA 2JEYA 1LPOA 1CFJA 1VA4A 5JD4A 1SC9A 3EIOA 2RI6A 2RAUA 4QDOA 2CKMA 1LPNA 5BWCA 3C8DA 3WK9A 1BEEA 1WOMA 4HTAA 1GT6A 2OAGA 4H77A 2QRUA 4MQLA 6YASA 4S0XA 3AIOA 5CRIA 4KE9A 1W1IA 1FFDA 5HFNA 1Z68A 1DX4A 5D3ZA 2VTVA 3QPDA 3AZQA 1F6WA 4FFWA 4C4ZA 3BE8A 3IUMA 4ZWNA 4HXGA 3KXPA 5AICA 1LZKA 4H7JA 1U8EA 3RLIA 1X70A 1XQWA 4AX4A 1QJ4A 4DNPA 2WM2A 3OOSA 3AIKA 1HDEA 1X2BA 3KWJA 1XLWA 5DNVA 5E4YA 1CUDA 3KWFA 1CUHA 1Q0RA 5DWDA 4H7FA 2K2QB 1H2WA 2XQFA 3EF3A 5ALEA 2XLBA 2DR0A 3HACA 3H2KA 4XIIA 1WB5A 1Q83A 1C7IA 4L72A 5A62A 4HRXA 1KU6A 4WFKA 1MX5A 4BTVA 3GROA 2RHWA 3LCRA 3DKRA 1LPMA 2WFLA 1K5PA 3STUA 1XZFA 1CIJA 4DSZA 4J0JA 2QXTA 4X85A 3IDAA 5FP0A 2WIJA 5AKJA 1EINA 3NGMA 1BE0A 4EA6A 4ZV9A 5AO9A 2VJAA 5HK8A 2W22A 4FLEA 3IUNA 3WKEA 3D2CA 4NVRA 1JMYA 1SCIA 1VZ2A 4W63A 1GZ7A 3W2TA 5C8ZA 4KE8A 4RPCA 1HL7A 5AKXA 3DL4A 5LKAA 4UBKA 3HLKA 5K3FB 2QXUA 4F0JA 3BL8A 5AM4A 1AUOA 5LZ5A 1WPRA 3ESCA 3DOIA 4OYLA 2WU4A 2WG2A 4NMWA 4BB0A 1CUWA 1J2EA 1UT6A 4DNOA 1B6GA 4H7IA 2XUOA 3WYDA 4Y2JA 2JGEA 1H2ZA 4AZ3A 4LIPD 3PI6A 2ECFA 2RONA 1UKAA 2ORYA 4AMZA 4WDRA
chains in the Genus database with same CATH superfamily
4L4RA 4U1RA 1E2PA 2A4KA 2N47A 3N58A 2FUKA 3ZHQA 3F7MA 1UKVY 4PZYA 4Q4LA 4PGFA 1OLXB 3V42A 1B0UA 2EOAA 4LISA 1H4QA 2FUCA 4NIMA 5JAIA 4MEAA 4Y7DA 3OIGA 3A58B 4IMJB 1XI2A 3CGGA 1BJRE 3E58A 4MUKA 1DFIA 1UKZA 4PC1A 3HKEA 5F4ZA 5FL7D 5ILOA 4YHHB 1K06A 3DMDA 4RJJA 5AVOA 1OFGA 1PG0A 2E49A 4UHDA 2BZ1A 5CLFA 3M6UA 1PJZA 1HTWA 2QT0A 1JJVA 3OZ7A 4OKNA 3WJ1A 3IKVA 2IEGA 3ECAA 3U40A 4M9CA 2IYEA 2C5EA 3H5WA 1OFHA 2A4MA 3MYRA 3KL2A 1UPTA 2RAFA 3LCVB 1LX6A 4QOFA 4LVNA 2MSKA 3K2IA 2LVBA 3OIYA 1K3TA 2JFYA 2JIBA 1WUJS 2QLTA 3C7KA 3HDYA 2X0FA 5KNCA 3C5HA 1DEXA 4EBFA 2V0GA 3H7IA 3U80A 2V8OA 2YWEA 3O31A 2HZ7A 4KR0A 1MIHA 3OEED 2R0QC 1JKXA 4M1MA 3WJAA 1EEHA 1XWWA 2X19A 3H42B 4JLWA 3S7TA 3D4OA 5DN6A 5FI1B 1FTSA 2V8BA 4J91A 4M36A 5T64A 1T3HA 1YL6A 1T2CA 3OFVA 1N5OX 2DG2A 5B64A 2I4LA 2NU7B 2P69A 4Y1GA 1XB2A 3KSUA 4GRDA 1GTL1 2G1KA 1MO4A 3EYWA 2FF7A 2XQVA 3FBWA 1BD4A 1CRQA 2VWPA 3FRHA 4P7FA 4RIEA 4TV8A 3RK4A 2AF4C 2RHOA 1TEVA 4O59O 5G3YA 5AOBA 1CJTC 1Y7TA 4RY0A 2P9TA 4C6HA 4G1BA 4BLUA 5IXYA 5DNDA 1DJMA 1L4MA 2CVFA 2OFOA 4ZHQB 3NHBA 4ZKEA 3ILYA 2BMJA 3N8NA 4JA0A 1SKBA 3QMMA 3DAPA 3CUYA 3GLGA 1CE8B 3A2LA 3SXJA 2Q9BA 2OO5C 3BEDA 1D7AA 2A1UA 1X3SA 3CEPB 1BCSB 1QS0B 3EZNA 1SG9A 4UVIA 3BCUA 4F9EA 3G17A 2NVWA 2DWPA 3WLSA 4EI2A 2BGUA 2YIMA 4U9UA 1LPBB 4TM7A 5TMEA 3NBFA 2IUEA 1MXHA 3DEYX 3VSDA 5ITZA 2PT7A 2OV2A 4RK6A 5JVDA 2M2IA 4FBLA 2FMFA 2JASA 4TVKA 4G0NA 1KJYA 2CLCX 1RKVA 3R5KA 1PR5A 5FTNA 3ZDZB 2IF0A 3QU7A 1G5TA 4PC7A 1LS1A 1QCYA 5CCDA 1JA1A 1DIAA 2G71A 2WUWE 3DFFA 1SQGA 2XHZA 4RKRA 4W1QA 4QSHA 1BO6A 2XCOA 3DMTC 4YA6A 1H4VB 5CLIA 1DP4A 4COOA 4L6AA 4MYDA 4NCJA 2VDUE 4ITVA 8ABPA 1QGUB 1KEEB 1Z83A 5H80A 2ZWAA 5BQ3A 4LUCA 5L6MB 1YBHA 5H0IA 1DE0A 4NCNA 2CNDA 3EEYA 4Q19A 4FLMA 2E89A 1QF7A 3I92A 3T9CA 5IASA 1VP9A 3OQOA 5JPDA 3ETGA 1V1MB 2QTBA 3PGVA 2ALJA 4LQ4A 1EFRD 4OH1A 3T9BA 3KUXA 4Q3AA 2WIDA 4E5VA 1E0KA 1WEKA 4ISBA 1XUOA 3WIDA 3LOPA 4QGHA 4W5QA 5HDBB 5I3ZA 1XNQB 1XHEA 4CMIA 3U0BA 2CLKB 4RVSA 3I1FA 5C8DA 3HZZA 1BXGB 1MOZA 4ZOEA 2HXYA 2L0XA 4UTZA 2DZDA 3TJMA 1L5SA 3EVDA 1XCMA 3T8YA 3HDTA 2QP9X 4AQDA 4EI7A 1PR1A 4Q7EA 4RHYA 4E2FA 2TMDA 5CYOA 4E1AA 3KCQA 4ENPA 1VCMA 1JHMA 1YDGA 2JIMA 2LP4Y 4JLUA 3C48A 4P4UA 1GV0A 1A7JA 2ATVA 2VUUA 6LDHA 2FEMA 3DB2A 3TEFA 1JKJB 4DFDA 4HX9A 2AEJA 2WOOA 2XUAA 3O7MA 5CX1A 1NXOA 1DKMA 4RACA 4G6ZA 4PYMA 3HWWA 4DQDA 1Y3FE 3IP3A 5HOQA 1V3UA 4AD8A 2DTDA 3H5TA 3WGVA 5J23A 1M2JA 2H85A 4PVDA 5CXQA 2EJCA 1N3LA 1U8CB 1ADBA 1DXYA 3C15C 4RVGA 3I28A 2VFAA 2PSDA 4XEHA 4AUKA 1VP3A 1Q3KA 1BS9A 1U3UA 3HR8A 4CKCA 4XZ3A 1G9TA 1LSOA 1VB3A 3KJEA 1JIVA 1XKXA 4US1R 3O2NA 1V41E 4ZCLA 3U39A 4ZZ1A 2GPWA 2V7TA 1J0EA 1Z73A 3VYWA 1ILEA 4BQSA 4GAEA 4LGYA 1X86B 4BFXA 3MBIA 1J9ZA 4GLBA 1LWNA 5G53C 2F62A 3AVOA 2X6TA 1QE0A 4TXNA 1KK2A 3O4RA 3ODPA 3OJEA 4AMYA 3BDAA 1Q21A 4JXKA 4Z2YA 4D74A 5KQGA 3X1JA 1HE2A 1RQ2A 4LTDA 5FHRA 2ZDGA 4B4VA 3K32A 4RKFA 1SQ6A 1MT3A 3S2EA 4EUSA 2AYXA 3Q7IA 2MR6A 4US0R 2A0FA 5BWLA 4PZLA 2ZT5A 4KYIB 2YC4C 3FWYA 4H7HA 3H9CA 5D1HA 3WBKA 4RF2A 3TBFA 4G0UA 1L7BA 5A2GA 1AO3A 3I0MA 3KLMX 3M1AA 4RKQA 1W4BA 1JG2A 5JARA 2IEDA 3I4LA 1B7GO 2FZ5A 3ICCA 2JATA 1L5MA 2O5VA 1KMQA 3IUQA 2AFHA 4JROA 2OSVA 4ZOAA 3O4IA 5TR9A 3A05A 5J4KA 2KPOA 2VDPB 1QUEA 1RHQA 3TQFA 1B2RA 1QAOA 1ULTA 2C7BA 2JGMA 3T1OA 3HM9A 3V4PB 2W4MA 3M1LA 2BDTA 2E4XA 2DSNA 1K88A 4TTSA 3M0EA 4XVHA 4PICA 1XN1A 2R48A 3ONVA 4V0QA 1DKLA 4H7DA 5DLYA 3KHSA 1IHDA 3REFA 2BBWA 2YMMA 2P7IA 4K6FA 1VE6A 5E1MA 5BQPA 3P97A 4YWHA 1K2WA 4ECEA 1DJPA 2XA9A 3E1GA 2VP0A 3CLSD 3QVUA 4IXDA 1N57A 1CP3A 1S3GA 3GK3A 3RYFA 1CQIB 4R1PA 4MUYA 1ZP6A 1CFZA 5FTWA 4YQEA 3M6LA 1S2IA 3P9PA 4QUJA 2GPNA 4Y2RA 4AY4A 4LXQA 4RTQA 2HK8A 2WYHA 4OL0A 3EEFA 1DHTA 1XQ1A 5ECGC 2VYND 1I3CA 3LIIA 4U7GA 1LNSA 3F9CA 5SYMA 2HLPA 2DQYA 3AJ9A 2NU9B 1JU9A 1X38A 4LV6A 3ZCRA 4ALMA 2V9ZA 3DPSA 5JHHB 5L4SA 4HV4A 1GG2A 5AVKA 3PQCA 4MKRA 3GLUA 4M9QA 2QX6A 3GG9A 2OWEA 3L8EA 1M2KA 3LFUA 1P7CA 2UVPB 1ANKA 1MCZA 2P3LA 1W4CA 4HDOB 3T61A 3UOWA 1Z22A 3A6LA 4OK3A 3A1TA 1S6YA 4CF5A 2DFKB 1PN3A 3KQNA 4GZMA 4DR7B 1IONA 4JLAA 5JZVA 1YS6A 5AI4A 2C1EA 1AS3A 2IOHA 2QMUA 4FHFA 3INRA 3URMA 1EVYA 2O3QA 1QX3A 1EKXA 2R60A 3AXTA 3DDOA 3QVGB 4E4RA 2HO5A 3TRJA 3ZE9A 2CNLA 2KX7A 3PTZA 3RC9A 3CF6R 2XMPA 1HDYA 4L7VA 2HIAA 4MZDA 1FDIA 1P45A 4FC6A 1UAYA 2C7PA 3RT7A 1W36C 1T2FA 1KP2A 2HMAA 3V00A 2ODPA 1QLJA 2OXCA 4LF6B 1YVPA 4LZZA 3EA0A 2XRZA 3VO2A 1NL3A 3VI4B 1J5XA 3QF4B 2F3PA 1PFUA 3WWPA 1XVUA 4L95C 2QJWA 3BWVA 1P7WA 3GBSA 1FL9A 5D5QA 1I0LA 1QH1A 4BX2A 4K6GA 1NPDA 4BP9A 3UPUA 1WBJB 3GRAA 4I50B 4MA5A 2A88A 2C2HA 1PJRA 3M4XA 3ZC3A 2YMLA 5KTKA 3HCBA 2A9RA 1E1YA 1EESA 1LZLA 3DWGA 4R2WA 4E70A 1LC3A 3QVLA 2UV8A 1R0BA 4FYKA 4HDKA 4U7FA 1IRIA 5K8IA 5JUWA 4C7XA 3L5KA 2Y1WA 3MTAA 4UC0A 4QO7A 2OLEA 3SNKA 4QE3A 3VH3A 5JV5A 2CXOA 3KETA 3VJRA 4BNZA 2H29A 1BYIA 1Z08A 3PHBE 1EP2B 3GGOA 1M2VB 4JLVA 3IJPA 3U7FB 1ZINA 2V03A 4I9GA 4BUJA 3K1AB 2XQKA 4OATA 1PIWA 4XA8A 3PX3A 4I3GA 1NXSA 3MS2A 2ZJ7A 4DCNA 2WAAA 4H15A 1G1MA 1YS4A 2WA1A 4TTIA 5BP7A 3UAWA 6REQA 5JJCA 2XBLA 1XYYA 4P82A 4G67A 4D3XA 3ZUGA 3R09A 4K26A 2B8NA 1II9A 4NCBA 3PZBA 1U65A 3UK6A 4HLNA 1RTKA 2CFCA 1CHDA 1QQAA 1NQUA 2PVSA 3RQSA 4YP9A 1DDGA 5HZGA 4HJXA 3HXOA 1IPHA 2VHJA 1EX6A 2Q2WA 4QXOA 3ZPXA 4LGMA 3J81k 2Q3MA 4D82A 1E6WA 3F1KA 3DG9A 4O0LA 1WDKA 3HWX1 4KBGA 3E05A 3AM4A 4EVQA 1VLJA 2WP8J 3UCXA 5TC4A 1M2WA 2ZR7A 5CA1F 5ADVA 4ILEA 2H7VA 3V8VA 3UWKA 3HTXA 4IKOA 4YRGA 1UL1X 2ZUFA 1X77A 4XDYA 4L8LA 3STTA 3HFRA 3LVQE 4YYZA 1FNSA 2VJKA 1Y4ZA 3CTPA 1SMKA 3I62A 2ZSKA 4U2KA 4KRYA 2XF2A 2Z09A 5IDXA 5TJ9A 4E08A 3VPAA 1EM8A 3E0QA 5G1OA 2P9JA 1GZVA 4JASB 2PV7A 5AW7A 4N12A 2ACEA 2HHHB 4OBEA 1MC1A 4B83A 2I1LA 4NBWA 4TT3D 1L9KA 1C14A 1CUXA 2BHTA 2XTAA 2ZR9A 2EV9A 3L6OO 2VYQA 3AWIA 2NMVA 3AUFA 4TXLA 1ZJ6A 5BMVB 3AUSA 1X7ZA 3AG5A 3ZY3A 3IEPA 1JJIA 2XHEA 4B6QA 4BFYA 4DDKA 2ILVA 2ZRPA 5I9LA 3OQ6A 1PVDA 5JQWA 5JSQA 2XT0A 3A4YA 5LQCA 2J4FA 3O93A 3PC3A 1GSOA 1K9SA 5CLHA 1U3CA 1CU1A 3FWZA 2DFVA 2V6FA 3GDHA 3RM3A 2WKSA 2JBAA 3A11A 2HBRA 1IZ8A 1TPYA 3G68A 4GPBA 4KN6A 4XVQA 5JCPA 3PHIA 3FDZB 1R18A 2QD4A 3QLJA 4DUPA 4Z4HA 1SXPA 3NYIA 1U1CA 3EWNA 3BB4A 1SOAA 1YZGA 1PK8A 4FB5A 1QDEA 1VE1A 5EA2A 1HG1A 1HSZA 2Y1CA 2PU5A 4KXXA 3H99A 4YJGB 1CY8A 3QBVA 4ZEMA 2P35A 1FC0A 3GPDG 1O3YA 2HSDA 1N2GA 4RE5A 1Z5UA 2PG3A 3BTOA 5E9QA 1L3CA 2QSJA 3IP6A 2P1DA 4OAPA 4G84A 2QTMA 2LIPA 4N47A 3VO9A 3ADBA 4CDRA 4BMSA 1UMCB 3SZOA 2PKQP 3QX7A 4GZ5A 1LEHA 2O0LA 1QQBA 1U7HA 3GLVA 3EEOA 3IR7A 1F1BA 2DE0X 5EWJB 4FGZA 2VT7A 3C24A 1Q6ZA 3O73A 5BW5A 1MJNA 1QE3A 2P6UA 2OQIA 1EX9A 3GQBA 4JSYA 3FN4A 1DWUA 3B7PA 3LC2O 4KAFA 1I2ZA 4LDQA 3DEKA 5JVDF 3AB7A 3RADC 2QUAA 5EUCA 1C4OA 5BN5A 1YGYA 2YDYA 3D43A 1TIBA 4GQBA 3AVUA 3D54D 3IAHA 3VDQA 3KNZA 4DTIA 3FWHA 4X20B 1Q92A 3OM1A 1PFYA 4JA2A 3ZIAD 3EN0A 5HF6A 5I9TA 4QXQA 1H6BA 5ALTA 5HEKA 2ZZKA 1E8MA 5KYUA 2BTOA 4ZIRB 3FMGA 1OLOA 4HB2A 1LLDA 3DHVA 2VP2A 3UKDA 1OKKD 1JSLA 2DU8A 3NXSA 5AW0A 3OMLA 3UW1A 2AXPA 3A3KA 3WL7A 1B74A 1H85A 2Z8XA 4C7OB 2YZKA 4LRXA 4NBKA 2QROA 4CUKA 1H1DA 2EYUA 3CPEA 1EFPA 5CXSA 1OXMA 1YS9A 3IULA 2CJFA 4RH3A 3L93A 1P2DA 5ESXA 1JDTA 1ZJ5A 2XVMA 1L1EA 4DLKA 4YMUA 1YDWA 1T26A 3LY5A 1EXMA 4E15A 3DBRA 3LQKA 4NTZA 4OMDA 3ZHYA 2N9UA 3TQCA 1BQEA 5F1YA 5JHGB 1PTJA 3RE1A 1CHNA 3TGPA 2BTEA 1GNRA 3BA1A 4EF5A 1S0UA 2UVDA 1G4HA 3JQ7B 2GKGA 4E14A 2NZJA 3GJ3A 4FE7A 1L5KA 4J43A 4QLOA 3HO6A 3L04A 4KXMA 3RHFA 3WLAA 3WYNA 3ONDA 2JFXA 4CIVA 5FDFA 5ICGA 5BR8B 1Z82A 3QE9Y 4D9IA 2AC7A 4IIUA 1OILA 1J20A 4CM3A 4QG3A 1N2ZA 1EPUA 3TOCA 1F48A 3KBOA 2XE8A 3PFWO 1YA4A 4ZVLA 3WLIA 5KYYB 3U09A 4PX3A 1WW8A 2J0EA 3OP1A 2ZIAA 4OPMA 1G0OA 2BFEA 2GETA 3REGA 4DCSA 3OPYA 4E07A 1QPGA 5KNBA 1OT5A 2GFQA 1ZMRA 1EE1A 3VKUA 4CF4A 3V2UA 3D0KA 2V3CC 3B70A 1D0IA 1GTVA 2BEUA 2GF0A 3CT6A 1JKMA 3O5AA 4Q9DA 1P0MA 3DLTA 2B36A 2W8ZA 2SHKA 4L50A 3KCNA 4TM8A 5J5CA 3PI7A 4WBSA 4B85A 4HUTA 1XGKA 3ECSA 1FTNA 2JCBA 4ACAA 5AKLA 4OGGA 4UEQA 4R2XA 3NHUA 4QPNA 3TKYA 1CZNA 1NBWB 4EGQA 3TTWA 2VUHB 2AN9A 4J16A 4EKEA 3T1TA 4RVOA 3N2NA 3BIXA 5EL0A 2PJUA 3EASA 4G0MA 3ZHRA 4N0DA 4N5DA 1OREA 4JHXA 2XNDA 3C4QA 5IT0A 1YUBA 1U6IA 1WDTA 1EK5A 2ZIVB 5ITZB 4PLYA 3NJRA 1WR8A 3NYQA 2B3DA 5FIUA 1JEDA 4U7WA 3TNYA 2PLAA 4EKNB 3I83A 2J6BA 3G02A 3RVMA 4LEIA 5C7YA 5HQTA 3I5UA 2AK2A 1NYTA 2FPKA 3A36A 4FZ3A 1D6MA 4MO2A 4NJEB 5LQDA 2XI4A 3MGBA 4FYWA 5BWNA 4PNEA 4CQMB 2GXSA 3RKSA 2JI6A 3WYGA 4MI6A 1FBTA 3DP7A 2MTBA 2YZGA 1KBZA 2I6XA 1JG4A 4OHCA 1VJ1A 3NMUF 2N3ZA 5CTAA 3MT8A 1H94A 2JIPA 2R8RA 4RHXA 3PQ2A 3VPXA 1UOQA 2CLHB 1GQRA 2BE9A 3CBGA 3PYMA 2ZG6A 4Q3OA 3ZIUA 4GPD1 1NASA 3D2LA 4GYJA 4BGVA 3B9PA 3CZRA 3E5NA 3I6IA 2ZOSA 3SM3A 2PGNA 3ENNA 4UCXA 5LDHA 4HB0A 1BZYA 1MRSA 3SHQA 4JBIA 4D9JA 5ED0A 3QXXA 3DBLB 4M7WA 4W6QA 4HQFA 3CW9A 2IEBA 4H1HA 2O7SA 1NA5A 2XB8A 3K94A 2FZWA 1NYLA 4ZHSA 1NMXA 3A31A 2X5KO 4R9SA 3AIMA 4ZOCA 2J5XA 3SLGA 5HIIA 1KZGB 3DVSX 2IXDA 3ISVA 1YJCA 3BT7A 2O59A 2C2OA 3CO0S 4Q7LA 3WKCA 2WVAA 2F59A 1KEPA 4JX9A 4J0GA 1T5LA 3PLAE 1SCUB 3ABRB 1TTPB 2WD9A 4HSEA 1ZA1A 4P80A 5JXHA 1GTRA 2VATA 4MQEB 1JI0A 2WPNA 3TOXA 1A9XB 3JQGA 4RK5A 1NVGA 2CSXA 3KSRA 2H18A 3P2JA 4MVJI 4TXHA 4UM8B 5JC8A 1ZHFA 3A6KA 4C06A 3FYUB 3HXTA 4PTYA 2PY6A 1U9IC 2VJMB 3A3OA 3COSA 3IAFA 2B83A 5FUMA 4JUBA 1MJFA 1EVEA 1NVDA 2A35A 3COZA 3LC0A 4G09A 4ZVKA 5IM4F 3KV3O 2JH8A 4BVBA 4ZT4A 4R84A 3EGCA 3TIXB 3CF2A 1ST2A 4NZ9A 1I0IA 1IIBA 2MR5A 4LWQA 4WCVA 1YB7A 2I65A 3H13A 1NXTA 4TLEA 3CLUD 1JTFA 3LT2A 4TL6A 3JAMA 4ALJA 1H2EA 4AJ9A 4M8NE 2F1HA 2FSFA 2WICA 3DZIA 4H6PA 4RWZA 4BKPA 5BNWA 5CFQA 3CJRA 2VXCA 3E5RA 1O08A 3LUPA 3LXXA 1SVWA 5ISMA 2FN8A 5DLQC 1GAWA 3QUAA 4B47A 3ESXA 5KSOA 1X7HA 3WB9A 1JE0A 3MHPA 1VMAA 4HB3A 3VR3D 3D6NB 4GRIA 4WLNA 4HYTA 4XD7A 2QQEA 3D3EA 3OJXA 1CERA 2Y0BA 3KHKA 3U3RA 1DWOA 2IW3A 3AM3A 3E35A 1UDBA 2CMDA 1YKGA 3L5OA 3VBCA 4EFKA 1JPVA 1XZMA 2I1QA 5CAEB 3IQIX 2GCNA 2R1UA 3RYTC 4L27A 1QIFA 1Z06A 3GT3A 4JODA 3R7AA 5GOTA 5JLJA 5JAUA 2NNWB 1B41A 2JGNA 2Q8PA 3GRCA 3HGTA 4YT8A 1KSHA 9ABPA 1OX6A 2ZJOA 2FR8C 5DTEA 1W96A 2B3TA 4NBTA 1VKNA 1SUIA 2YQ4A 4J76A 1M2NA 1GPLA 1MQAA 2O14A 2Q1YA 3Q7SA 3Q87B 5DX8A 1ECJA 4OD0A 1AKWA 1J06A 2UKDA 4YUAA 5BYKA 5D7BA 2BT4A 2VDVE 2FLKA 4HYYA 4KK3A 4MQBA 3TJZA 3ZDFA 1WW3A 4TMWA 1FTQA 1F9AA 1YQQA 1YR6A 2GBLC 3C6KA 3JYHA 3KTFA 1WPXA 4D43A 4URXR 3WZMA 1W94A 1HOTA 5LQMA 1QFJA 2ZI3A 2ZJ6A 5L6LB 1E99A 5ITSA 1NBAA 4RFVA 1Y7IA 2JJ1D 3P2IA 2IEIA 4GI2A 1I7DA 2FRDC 4OHMA 2FPUA 3CS3A 4ND2A 1C1YA 1LI7A 4D3ZA 5J63A 5KWVA 5FX2A 4K9MA 5JWHA 3RJTA 3OURA 1XT6A 1DAIA 3LZ6A 1IJEA 3ES9A 4L4YA 2C4WA 4JQSA 1C7RA 2H0QA 1VSUA 2VHVA 2HFKA 3HRHA 1AQ6A 3SX2A 4GLFA 1FP6A 2BGLA 1KQPA 3H9EO 1XEWY 3G13A 2PFGA 4JZYA 4X84A 1WIWA 3X43A 2NAPA 4RPLA 5BNIA 5JZ9A 1N75A 2GJ4A 1F8UA 1W85A 5H59A 1PZNA 4QGSA 1W87A 2P9FA 1UDXA 2WHYA 4LQLA 2OYCA 2COEA 1U0LA 1UPCA 2EFHB 3A9TA 1HORA 2OBBA 1JT2A 2FUG1 1R0XA 3JPWA 2I33A 1LKZA 3P9QA 2ZRMA 1YSCA 3O4FA 1LK7A 1J2JA 1TCCA 3KEGA 3RTAA 4BNDA 5BVGA 2I2WA 4KG7A 1Q1AA 3I23A 4EATA 4LXUA 4YJ3B 2AMJA 1V39A 4F4HA 3IXLA 5IFLA 3L4JA 1W4ZA 1YJQA 4AG3A 2PUGA 3UAYA 5C34B 3NVMB 1PFGA 1GR1A 5ELMA 4LJRA 4BNHA 5AW5A 1Q84A 3OFKA 4EYSA 4M4SA 4M7PA 3F5QA 1M7BA 1VHTA 1JR4A 2P2LA 1YE3A 1SCDA 1WW2A 1G6HA 1L6RA 2D54A 2AUNA 2IDMA 2I7XA 1JLRA 2OG2A 3BS4A 3KTAB 3MWLA 3O0TA 4MS3A 4ZK6A 2WYWA 4O29A 3I6YA 4P22A 4JXJA 1U9CA 3BXHA 1FLDA 1WF6A 2W6ZA 2YJ3A 1JIKA 5AW2A 2JIOA 5FQNA 1VPTA 3OUZA 2A5FA 3ME5A 3L46A 4JMPA 3OJOA 4X1IB 4A0FA 3ZTWA 4ZYTA 1N1MA 2C3PA 2IYNA 2ZVDA 5F3DA 4RLQA 1N92A 3ROTA 4KDFA 4MLDA 1JB1A 1UEXC 3IP1A 1C1HA 1DKOA 2WNIA 1FLNA 1FPQA 1P6UA 4AL4A 1ZBQA 1OASA 2PZMA 1CJSA 4PLZA 5C1IA 2JGRA 4DABA 3K8OE 3RSQA 2QQ0A 1YGPA 1ODSA 4QJBA 3SX0A 1J1IA 3UFBA 5FLYA 3IDSA 4EGSA 4U2GA 2CUKA 1TA4A 1ZD5A 4RJLA 5CDFA 3ZZTA 2ZBFA 1RPZA 4BE9A 4QBHA 3OKFA 3ST7A 5E2BA 3M83A 1O95D 3WJ2A 1GYQA 2PNJA 2A0WA 1J09A 3NHRA 1SKUA 4XIYA 2BTQA 2FMTA 1UBHS 2OUKA 3PRYA 4WXMA 4UBNA 3PKIA 5IKMA 4IDNA 3D3QA 3A28A 4CMAA 2VRCD 3IJEB 4MEBA 1IQRA 1W4RA 2ZPUA 1ZD3A 4BGDA 4BMCA 4AZSA 3M6VA 2FZCA 2C04A 1PVOA 1M1YB 4LHXA 3NCHA 2EKBA 4WZBE 4DDVA 1U0SY 1X1EA 5DP1A 3Q40A 3J7TA 2XIJA 1V8PA 1LI4A 1XZDA 5CLLA 2CNBA 1JFFB 1O5OA 3AT1A 3COWA 3DZKA 4WW0A 4YMSA 2VPXA 5B7QA 1ELOA 1VOTA 4WOPA 2AE1A 1N4AA 3CFYA 5AW9A 1E5VA 2IUUA 3HO8A 1DDIA 2G7ZA 2X6RA 1Z8HA 1N1EA 3EHDA 2HDWA 3D8RA 3QELA 4UUQA 2FMHA 2ZZMA 4M46A 2B1QA 5FBHA 4MUBA 1F5SA 3W8RA 1XN4A 2XXBA 2Y9PB 2NZ8A 1J5EB 4GKAA 2ZIXB 3H4MA 3PP8A 1AY0A 1GGVA 4O08A 3QQPA 5EAIA 1PT8A 3ZD8A 4JOQA 4Q4JB 4RD2A 4F6RB 5JR3A 5KZMB 2O8EB 4PONA 5JFGA 4H4EA 4OUKX 3I4FA 4WXRA 3NHZA 3W4IA 1NN5A 3HB5X 3LECA 4QOGA 3AETA 3UB3A 2GNAA 2H07A 2PFKA 3GAAA 4EDHA 2EP5A 4FWBA 3HDHA 2PRYA 2PVPA 3VNVA 3X1XA 1ZISA 2ZYRA 3TLGB 2H1CA 4NDNE 2LRHA 2H2IA 4RDIA 5JSZB 3SD7A 2VDWA 5A3SA 4J0CA 1WXDA 1ZMBA 2PGXA 2WW8A 3HUFA 4B3HA 1YMVA 2W6ID 4FINA 3PEUA 2IYTA 3TDNA 3IVCA 3TX2A 1PR3A 3B1ZA 3NWJA 2WHXA 1Z4IA 4ZJPA 1PNTA 2Q3FA 3TW8B 5HRCA 1S01A 1Z74A 3BXGA 2OHJA 2QRZA 3O84A 1WPGA 1KIMA 3UUEA 2XZLA 4CFSA 1ZM2A 2LR0A 4H3KB 4NU5A 4WZZA 5DEIA 3TSYA 1OBVA 2ZXUA 3TAXA 1PX2A 1WKBA 5IK2D 4CQMD 4KIFA 3UQYS 4V0LA 2ZRNA 4DJDC 1R6UA 2PD6A 3N8GA 4ML3A 2F6RA 2BGRA 4DIEA 1RXWA 3N0XA 3F8SA 5EPEA 5EJAA 3V1UA 1YB2A 5AXDA 1C30A 2D0PB 4A26A 4TYMA 4F56A 4HZIA 4Q1VA 4F2GA 1Q0SA 3ZHBA 3TVTA 1K66A 4BO0A 5C5CA 3ODGA 5A7GA 4PO8A 2QPOA 4E5SA 3EODA 3AONB 3CX4A 3G0IA 2SBTA 5B1IA 3ORFA 1JR3E 3IBSA 4H1WA 2H00A 4QPZA 2PA0A 4RH1A 4YJHA 1F0NA 4YBZA 1AK2A 3OQ1A 4LFCB 4UM9B 4PYRA 5B5SA 2VSXA 3H04A 1JUDA 4E4TA 1EB8A 4JLBA 1L8LA 3GPLA 2EKLA 3AHJA 4O2AF 3UYLA 1PKEA 4BWGA 5JC1A 3ORYA 2X0EA 3U7EB 4YIHA 4HG2A 1VXRA 1NVWQ 1T3SA 1WG8A 3G9XA 4IJWA 4XYMA 1TU0A 2W58A 2SCUA 5L53A 1OCEA 3SKYA 1A9RA 2E5WA 1V1JA 1T1JA 5KWEA 3P96A 2V4ZA 2Q6TA 5F52A 1QZ3A 1UR5A 2GR9A 2W83A 3C5VA 5F5NA 2JFPA 4LMPA 3WLHA 2QKYA 2WHPA 2AJ8A 4XGRA 2IDJA 1PJ8A 1M2EA 2FWPA 2GEUA 4X94A 3GZTB 3CLHA 1PQUA 2KSQA 4X65B 1Z5PA 1V3QE 3LWZA 5FCDA 3ITDA 1QP0A 3ESDA 5BV8A 1Z2EA 5D3MB 2O0MA 5CITA 1ZUNA 4UD2A 4O8ZA 1IHPA 1P61B 4Y2GA 2F1OA 2DM6A 3NUZA 1QGOA 3ZWCA 1JNXX 4LF9B 5KJ6A 1F2DA 3RYCA 3GUCA 3HKCB 1G2QA 1XTRA 1KPHA 1A5ZA 4H3HB 1P39A 5B55A 5IJ0A 3VAYA 2C2MA 3TLMA 3MTEA 2WZDA 2E4UA 4LV8B 1H66A 2CMGA 3B9RA 1C3LA 2XUQA 1EE2A 1YBFA 3L05A 3OLQA 2AQIA 2OGWA 4X7BA 2WJ6A 5DLEA 2C98A 4MV4A 1NP3A 1Z0UA 3UENA 3PD0A 3SKVA 4DCJA 1S1MA 1U2DA 4WLFA 4BE4A 4BRUA 2O8DA 1ORVA 1C8LA 1KYTA 2A3NA 3LXMA 4PRZA 5GJWC 3HO1A 1YDFA 1UXOA 4RU1A 1Z2DA 1HYEA 2AEMA 3ML1A 1NBIA 5ER6A 4MWEA 4GHWA 1T1RA 3EEBA 3S5JA 2OGUA 1WY5A 2C9CA 4KXFB 4DSTA 2I78A 3DE0X 2VKQA 4OI4A 1WBDA 1ZGJA 1Q1QA 3NFRA 1XEXB 2DMRA 3B6EA 2D5CA 3SF8A 4EBBA 4QREA 4JYMA 2H2WA 4HK4A 4NZOA 1P2SA 3CNLA 3DLIA 4FP9A 1ISJA 2UZ1B 5CPFA 4CR8A 3TB6A 3PLRA 1B43A 1JEOA 1UAGA 3OFNA 4HRVA 3THWB 2PXXA 2HWXA 2X2EA 1I3MA 4G24A 5B7GA 3H1BA 2PUTA 3KSZO 2GXAA 3WNQA 2CEAA 2QG4A 4KU4A 4NENB 2XEXA 3LYLA 4TS1A 3Q88A 4S1WA 3UHAA 5I6DA 4B32A 1DB3A 2HF2A 4RYLA 4TN1A 1RMTA 4XR9A 2Y6VA 4BCCA 2FX5A 2I3AA 3GFOA 4OLJA 3N7AA 4FE4A 2PWYA 1U7WA 4HX5A 3DKPA 3BJIC 3BMQA 2EFJA 3ZNPA 4Z9YA 5JWRA 3KVNA 3TMAA 1K7CA 2DHDA 4FDMA 4NWIA 4S2UA 3TE6A 2ZJ2A 1XVAA 1PSZA 2TMGA 3GJ7A 4MVWA 3N2GA 4HADA 4F84A 3ON5A 5CH8A 3VR2D 4F2PA 4QUBA 4HVCA 5L3SA 2JBHA 5M04A 121PA 2RHTA 5D84A 3I6QA 2C82A 7ABPA 1II0A 3DEZA 4BRSA 4EX6A 4PZ0A 1SBIA 1ZLYA 4HNSA 1A9QA 4WV3A 1OMOA 1YIAA 2QYTA 2VH5R 4F1JA 3CN9A 1F38A 2HQRA 5AVWA 3A9SA 4GX2A 3BWBA 5FUQA 4BFSA 1GTG1 4WI1A 3BBPA 4WADA 1RP7A 2BFFB 1IL0A 4RVCA 3W1VA 3HJUA 2O5EA 4LGVA 1HQDA 1C3JA 2HKIA 2C4KA 5B53A 2XGMA 1N32B 1VHQA 3HC7A 1VJGA 2RHLA 2YXBA 3NBKA 5ALUA 4FFPA 1H0RA 4G0XA 5E2IA 1B73A 3TUJC 2ZRAA 1TUIA 3WK5A 5K3SA 4CV2A 4OG2A 1I2AA 4QPDA 5KYKA 3DDZX 3ICVA 4MIOA 4RSGA 4QUAA 5CT8A 1F14A 3A4NA 2YXLA 2I87A 5KOHA 3O8CA 2C61A 2V3VA 1R9NA 2RGUA 4H4DA 4UZFA 4AO6A 3Q8KA 1EVLA 2IJGX 4ZCQA 3DBHB 4N0PA 1TYZA 1U7UA 3K09C 5E7QA 4GMGA 3HCRA 5C7LO 1APBA 1WQ4A 2IPMA 5HA5A 1Z88A 3BYZA 3O1IC 4AS1A 1DAFA 3I09A 4UAJA 5A5DA 5JJBA 3BKXA 3U3XA 3CZ9A 2VP5A 4U2CA 4EF4A 3COPA 1AO0A 3DDSA 4MP8A 1V4VA 1JQLB 2GQ0A 2AG1A 3CSDA 4L0QA 4WN9A 4EHDA 3AR2A 2BHRA 3N1UA 1XD8A 1ZNQO 4IKPA 1K6EA 5C7OO 1KOLA 2XYPA 4OHKA 4JUDX 2RGCA 2CJWA 5HNKA 1C4KA 1OF1A 1EP1B 4IJ5A 3KS9A 1E59A 3DOEA 5AXBA 2ISSD 4LRWA 3K20A 1HLDA 4OJTA 2O3SA 4QGGA 5EIAA 2Q7DA 4ESHA 1Q1EA 1TKCA 4HWTA 2W8BB 4IIJF 3QZUA 2ZXEA 3UMCA 4Z4FA 4YP7A 1XC7A 1I6KA 3C6MA 3NLLA 4NP6A 3I2HA 4KXNA 3WIBA 3G3EA 5JDIA 5THXA 1E3TA 3LD9A 5C8YB 1O54A 5ALRA 1QIKA 2EEZA 2GM4A 2PJRA 1EG2A 2IS6A 3ICPA 2PSSA 1E1RD 1SKQA 1SUEA 3FUCA 4PV7A 5KI6A 5JW6A 2W93A 1GGMA 3PNLA 3GDOA 3FBTA 4MV5A 5FAXA 3QTTA 1V1RB 3CKYA 1XAHA 1TZMA 3COYA 1XDGA 4NBSA 1SC3A 4G8DA 4TOIA 1J23A 1CJMA 2ERYA 2OHFA 2HXSA 2VEOA 1O0SA 1B93A 1P0PA 1YH3A 2XR1A 3EAFA 4LECA 3VX4A 3IEVA 1KRWA 2XE7A 4C22A 2NGRA 3OLYA 1SOMA 1A8SA 2JD1A 4G9EA 1YZYA 2XMRA 3I9FA 4MEJA 1IVYA 1RT9A 1I13A 1MXFA 1KO5A 4YS6A 4X95A 4BHTA 3QG1A 1JHYA 2O2ZA 2X8AA 4B71A 4S35A 2CFSA 4XRGA 1QP7A 4CKEA 4M1SA 5B4TA 2B7CA 2PQ0A 3BH6A 3TINA 3IE1A 3CHYA 3GD7A 4EG8A 1T2DA 3LHSA 1ZVJA 5ER9A 4UPDA 5KVAA 2CLDX 5EWMB 1TGVA 2JLWA 2A84A 3CVOA 4AKIA 4BZWA 3BGWA 2DULA 1QP8A 2WSLA 4MICA 3JWPA 3ROXA 2FFQA 2FPMA 1L7QA 4HH0A 2XXJA 1Z4KA 2W7TA 5CDTA 3D3WB 3AKZA 4HOYA 3RARA 4EABA 1PL0A 1HMPA 1Z12A 2CHGA 1KJJA 2GHRA 3IOBA 5AOCA 3SEFA 2A3RA 2WMYA 2L19A 3SHVA 3R6WA 3UGJA 3OTIA 3ROEA 4U6SA 5CA1B 3EXEB 4M21A 1CUVA 5DBIA 5IABA 1QU2A 3FNBA 1GAQA 3FVWA 1OI2A 2OCBA 2XDWA 3TSAA 1IWOA 5B4UA 2PS0A 4HI0E 3S8YA 3HA3A 1TJNA 2QSZA 1L9XA 3ZCPA 4AZ3B 4TUYB 3V48A 3ZR4B 4A03A 5GONA 4XVRA 2BJWA 2WJYA 3VMMA 2UXCB 2ZYVX 1EIWA 4F21A 1Q1BA 1PWYE 4IUBS 4F2HA 4FCCA 3I2JA 5LN1A 1J6UA 3ORSA 2VF7A 3UK2A 2GJSA 4ZOQI 1UBLS 1E9SA 1Q6YA 1LX7A 1E0DA 3KU4A 4LE0A 5BXYA 3P71T 5DFAA 1XTJA 4RQUA 1KYYA 4YRLA 3EE6A 4M0LA 4JYCA 3HKEB 4BS9A 2JAHA 1TT5A 4FKBA 3QIVA 4MAMA 3WSTA 3A2KA 3T7JA 2ZE6A 3O2QB 5DBGA 4YAGA 3DE2X 1PNQA 3GWZA 4DJFC 2IPLA 2ZSJA 4OL9A 1Z5NA 2ZS8A 3PC8C 4LHWA 1L1RA 1IEWA 2F64A 4R16A 3TR6A 1VKZA 2ICAA 2JGLA 5EEHA 1RRPA 3QITA 2KQUA 3I2GA 3L3BA 4U4AA 1M5RA 3V2HA 2HEGA 2IS4A 2Q5IA 3TSOA 2OD2A 2AT1A 1Q0UA 4OO3A 3IHLA 2PZFA 1Z07A 2WABA 3DXZA 3I42A 4FN5A 5HCUA 4D2IA 5DW3A 2DY1A 5A7HA 4AS3A 1E18A 1RVV1 1Y9JA 3FCEA 4LFAB 1G7CA 3GVXA 5CCXA 4D3DA 4YACA 5E9WA 4AMGA 1BGXT 1NDUA 1BU8A 2ZYTX 4FSXA 4GOMD 3LDAA 3P27A 3QFSA 3BQ9A 4J4HA 4WLUA 4DA6A 3SDZA 2WNSA 1QHYA 2V98A 5A5EA 1ZVQA 4C4PA 1CDOA 1A72A 5AI8A 2PUEA 1P91A 2IYSA 4BGEA 3EGXA 2YYSA 4UM9D 2IXAA 1FVHA 1ZDMA 3IE2A 4TV8B 2WKQA 4C0JA 1O97D 5HQJA 1HY3A 1K1EA 1P7PA 2Z8YA 2VHCA 5AJWA 1Y6GA 3BJMA 5ALYA 1KS2A 1XMQB 3MZ0A 1F4VA 4NBVA 2IUTA 3T9EA 4KNWA 3TW4A 2PN1A 5CFLA 1B8OA 2QRPA 4FSHA 3GLGB 3QEKA 1M74A 1I2DA 1DT5A 4P1ZA 3VO8A 4GC5A 3SYNA 2X41A 3L4BC 3W8DA 2AOVA 5FWYB 2A1UB 4H1VA 1DKQA 3NKFA 5GWXA 2A0KA 2UUBB 1Q0ZA 3RH0A 4B3TB 1F12A 3QSYA 4KR6A 5HUQA 4MWCA 4OK5A 5NULA 3NWBA 2YWXA 5DASA 3RO7A 5CFMA 3BIJA 4Y1EA 4Q9NA 5J40A 3D1VA 1RHJA 3WSWA 5DBFA 2O2YA 5JVDB 4JT8A 1KKUA 3P2MA 3CWZA 4GPTA 2OR3A 4Y2YA 3GO4A 5DJ5A 3WMWA 2VL7A 2GD6A 4H59A 4GEGA 3K9FC 2IP4A 5KTYA 2YIVX 2JA1A 3WLFA 3WKBA 1DUSA 4WOBA 2CXNA 2WWGA 1B15A 4ND7A 4O4IA 2Y2UA 3BWEA 3K1TA 3IBYA 3O8BA 3PHLA 4L5CA 2C2YA 1MEEA 1O03A 1UFKA 1JALA 3IQXA 4QOJA 5FBLB 4CU2A 3CVWA 1TL7C 2FPXA 2Z2XA 4LN1A 4YMVA 3SU8A 1YONA 3K6JA 4FQ7A 4JEHA 4B4KA 2X86A 1U7TA 1TM3E 1ZEJA 1USGA 3MEQA 2O3RA 2EKDA 1T15A 3Q3IA 4IF4A 2AJLI 1FSPA 2X8WA 1OZAA 1GGHA 2DAPA 4Q4DA 4C3UA 1ZAKA 2JB9A 3DO8A 3BREA 4IWNA 1T9GR 1U9IA 1JW9B 3PKJA 4BDTA 3E53A 3A8TA 2HA4A 3SNHA 3NVKI 1NG1A 2RC6A 3L0ZA 4OA5A 4JLOA 5D5PA 1ZAYA 1A97A 1AGNA 1JDVA 2QM3A 1FJ2A 3KKMA 1N8SA 1R15A 1X8XA 2O2SA 1P3DA 1VKOA 1CSEE 4F5ZA 3P9SA 1F4PA 1SFRA 5KKNB 2CL5A 3PGJA 1Q11A 1TFRA 2CFOA 4TMKA 1UKEA 1UKYA 5EZQA 4N8SA 1JLHA 4Z4QA 1XKQA 1CULC 2FQXA 3PE6A 3SBDA 4AIIA 4N6OA 5B58C 5U4XA 4LXYA 4GGOA 5CX1B 2XCSB 2ZTSA 1L7XA 5FJIA 4IOLA 3IQWA 4DEXA 1EEXB 2J4DA 4JT4A 1F0PA 1P8AA 1ZM3A 2BHNA 4PQEA 3EXAA 4V0SA 5AHRA 3NTLA 3BTVA 3UJDA 4AN0A 1MKYA 2ZRDA 4XFDA 3H8SA 4L5YA 4RSRA 3NJ4A 5IBQA 5FO1A 3TQSA 3WJ7A 1YU6A 3K73O 2VAPA 5KTRA 2WZBA 4CKCB 1H9BA 3DV2A 3JY6A 3C70A 3T9FA 2ZCUA 3DMNA 5AW4A 5ICMA 4RZXA 1NTOA 4RADA 1DQPA 3VKGA 4PGHA 4HDQB 5ALVA 3EF1A 2FR8A 1R10A 3JQFC 4C7JA 3LBNA 2NIPA 2QLFA 4Y6LA 5KTNA 2QZ9A 1W8IA 2B21A 3AHEA 4RJTA 4EG3A 1NUTA 1RWOA 2XTNA 4IHQA 5FR1A 2RHMA 4LHSA 5DBEX 3KELA 3SS9X 1O94C 2OFPA 1GP2A 3RAEC 4XH9B 1XL1A 2QMOA 4CYMA 4Q9AA 2INGX 1C29B 2EWMA 2XA2A 4BMXA 2FGKA 2EGUA 5H1YA 1V5GA 5ILGA 3BH7A 4JLPA 4LJ8A 3LRPA 2H08A 3L7CA 1JVSA 1JEQA 3IERA 3JQCA 2FMXA 2GKOA 5IVHA 2FRDA 4KJXA 2DJ5A 2QRNA 1YQ9A 1O6GA 4X97A 4URVR 3CPHA 3STWA 4YRTA 4K6MA 3T5MA 4C7MA 1MJHA 1RE0A 2HRCA 2D1SA 1YUMA 2YZMA 2OKGA 3SEZA 3EZ9A 3UWOA 1Z0SA 4EKYA 4KXUA 1FDOA 2AFHB 2EP7A 2ZWIA 1ZZEA 4YTEA 2JLZA 1DJOA 3ZWDA 5KMGA 5LNK6 1VQ1A 1TYBE 4KV9A 2ZSEA 3FLEA 3JAWB 2OK8A 1BROA 3LW7A 4LRSB 4PLTA 3ZX4A 4DYDA 5AVJA 1IZ0A 2Y4OA 3GGCA 1Z17A 1YK1A 1V6AA 1TM1E 3CO5A 3N2KA 1A95A 1VE5A 2GO7A 4N3GA 2P8JA 2QSYA 3IPYA 2RD2A 4W1SA 4OYYA 1NXQA 1DV1A 3MQFA 2ISQA 4G1FA 1XXLA 4MI9A 2Q29A 4M9ZA 4NDAA 1CUIA 1L5WA 3VTKA 4IIXA 4BRZA 1FVFA 4Y67A 4FC7A 3WDLA 2II6A 1SBCA 3RYFB 3G8AA 2OOKA 3C3AA 3ZVRA 3WY9A 3ND5A 4KUEA 4BO6A 5C18A 1GNPA 1VMDA 1ZZGA 4AY5A 3R3VA 2B0CA 4E5MA 2ZT6A 3EH2A 3Q6MA 3RUIA 5K05A 1J0BA 1QV6A 1U8XX 2ZAGA 2BI8A 2H4WA 3M81A 2HK6A 2N0SA 3OF3A 3RJZA 2GZ1A 4A92A 3DZFA 3G1WA 1XRLA 2CLEB 1MORA 1CEEA 3R4CA 5MGNA 2DPYA 1G41A 2Y1LA 5DZSA 6AT1A 2IS1A 2CXSA 3Q8LA 1BG6A 3L7BA 4JJIA 2VSYA 2YRFA 3QLUC 4TMXA 5INTA 2J08A 2C07A 5ICSA 1FJHA 3IUBA 2QUIA 1IM8A 3A3YA 3I9NA 3VZCA 4EKIA 3A6EA 3I04A 1CB0A 1XRNA 3GNQA 4R8RA 4OQQA 1MH1A 5CT5A 1XYVA 2OQ2A 1TD9A 1PFKA 2ZB3A 3IT0A 3JVUA 5E7MA 3TNDA 2YOFA 4DR3B 2CVPA 3UMRA 2Q0SA 3A6ZA 4U2FA 1SG6A 2I3BA 3GJZA 2Y8EA 2ONCA 2G70A 3DONA 2D8AA 4O5OA 4PNPA 1C50A 3N0VA 3V55A 3V7FA 1FA9A 1FBNA 1U4NA 2VDQB 3FRJA 2IBTA 4BO7A 1GPWB 2R6ZA 2A1TR 2Q41A 2QJRA 3HYRA 4JJ8A 3WHIA 4KAXA 4PS1A 3IL2A 3ESZA 4KTTE 3AX6A 2F55A 3A4IA 3Q1KA 5BV7A 1C2YA 1NC3A 1B16A 4KIGA 4MRNA 2W70A 4F04A 2XKAA 2YN2A 4P7KA 4PYIA 3VISA 1P80A 3VR4H 5EERA 1VCIA 3D6VA 5LL6P 3RLFA 4N7RA 3AR4A 3BMXA 4I8IA 4IQFA 1R0YA 4S1OA 1QE5A 4I19A 3P4YA 4FGUA 4QUKA 1IEVA 3R1IA 5IXSA 4IOMA 3AYXB 3URKA 2I2BA 4TKZA 3S2IA 1QH1B 1U4OA 3T7TA 5LMZA 3ZDAA 3N0TA 1Z7YA 3IALA 3HZHA 5FPYA 4P5EA 5J5VA 3IYLW 1H5QA 2ZWPA 3FDXA 3HGMA 3NJ8A 2BIFA 5IWCA 2Y92A 1N0VC 2OC4A 4FD2A 1SOVA 1YACA 2VBFA 3GFTA 4HDKB 3M82A 4D26A 4J6FA 1ZGHA 2VDLB 3K9HA 2GYYA 4XUDA 5DIZA 4NECA 4O4HF 3EVGA 4FD3A 4KN5A 4G41A 4D4KA 4OJMX 5JNTA 4R40A 3HSKA 4IMRA 1QDLB 1TMOA 3O4GA 3EFOA 4EHJA 5LFAA 3C5CA 4KO1S 1SXJE 5FFNA 1P2BA 2ZBQA 2P75A 4DIBA 2FFBA 2O1XA 3JWJA 2P9CA 3KD3A 4I9FA 3GXOA 4AF7A 1J24A 1K9VF 1YQXA 4AJOA 2XNSA 4B7ZA 6REQB 1FSFA 3IIIA 5G0UA 4A15A 1ZH4A 1L3IA 4BNKA 5K8LA 3KL4A 4Y2XA 2ZS9A 3UVEA 2XUJA 4KQIA 3QNMA 4MUGA 1RXSA 4WLEA 4FMPA 4XSGA 5KNCD 1FZTA 1QB7A 5D51S 3KVOA 4NF2A 4TKVA 2GILA 1JDBB 3WISA 3NIGB 1KO4A 4G5XA 4CIYA 4KQJA 1SC6A 1Y33E 1OTYA 4V3CA 5AUOB 1KEKA 4D0SA 2ZI4A 5DN6D 4F92B 1L4KA 1E2HA 4O6VA 4HXEB 5KYVA 4YMHA 5JZMA 3KOOA 3A7EA 3HS3A 3JQDA 2Y1GA 4PINA 3UXEA 1XZJA 2ERXA 4RPIA 1D8AA 4AN1A 1FRFS 1XWFA 2R25B 2QVCA 4XOUA 3UUGA 4ZTUB 1XTQA 5GONF 4EY4A 4XE5A 3HVJA 1M73E 1HETA 1JU3A 2AR7A 4OGLA 2ATEA 3IQHX 1JSCA 4XVCA 1VLHA 1SKYE 3CWQA 2FLWA 1EM8B 3FHCB 5GVRA 3WMEA 5C2JB 1PUJA 1FNNA 1XJ0A 2V59A 1KSFX 2NTYC 4G97A 5F7ZA 3ZOKA 1I3KA 4CM4A 2F1KA 3WIEA 5HOEA 2ASEA 2W0SA 1PEKE 3E81A 3C5EA 2IYXA 1II8A 4L8WB 1N7JA 3ER6A 2Y1OA 3BL5A 3ITEA 4MV7A 5T4BA 3WQQA 4YB8A 3UWMA 3RHZA 3OICA 3NATA 3HFJA 4L5BA 4A10A 1DJQA 2G9QA 2JD0A 3BXXA 5IUKC 1TTTA 3W6UA 3S2GA 3UTCA 4LBZA 1TK3A 1W6RA 2DHRA 1AOXA 4KAJA 2A7XA 1X7ZB 1AHIA 1A2KC 1MB2A 1UQTA 3KQQA 4Q48A 3S99A 5AT1A 3B3GA 3O8OA 1HRDA 1TB4A 2QOEA 3TF5A 5KOJB 3DB1A 4FR5A 4M9UA 3DVAA 1M8JA 4YROA 2IH2A 1IK4A 1JXQA 3LP8A 3EIEA 3TJRA 5HQ3B 1K92A 4YMGA 3LA8A 4UHEA 2D5LA 4DC9A 4NU6A 3AFHA 2IUYA 2HA3A 3LXRA 3AF6A 1ZHHA 2DKFA 2C42A 4DIFA 3CMMA 4Y1RB 3EFHA 4YRIA 2ECOA 3QWBA 1CUUA 1WSWA 2HQ1A 3NONA 4KO4S 5L7YA 3ZYCA 4IIEA 3ZDRA 3MIZA 1E9RA 4KWHA 4ZZIA 1RZUA 4FK8A 4MW5A 4ARCA 1XG5A 1DC4A 1UAAA 2W48A 1B6TA 1GLNA 2G8LA 3PDUA 1XVTA 1L8OA 1P5RA 1DXHA 1RYZA 3G5MA 4QJ4A 2QENA 2XTJA 4QDXA 2HJHA 4Q3DA 1G6KA 1W1WA 2QYSA 4BTEA 2A78A 2R1ZA 2ZLBA 3GFRA 1RYBA 4F96A 1AURA 3R0JA 3DMPA 3ILSA 5CYPA 2CXRA 4ZOLA 5DRTA 1EK2A 2O4UX 1IZZA 3VU3A 4BJHB 3PEEA 3GVIA 3K1JA 1YA8A 4GC9A 4N3BA 5K3BA 4LKRA 5A0TA 2RC5A 1QTNA 3LOUA 3KM0A 4G4JA 3R5FA 1JS1X 1JHZA 3BA6A 1NW5A 2WINI 1ZJ4A 1T4MA 1YB4A 1FQOA 3IVRA 2IIBA 3QU4A 4B6RA 1INLA 1BX1A 2CZQA 2R8BA 3WLNA 3ZHSA 4CGZA 3K15A 2J3MA 3KOUA 3P94A 5K09A 3JQEA 1K5HA 3JQ8A 4NV0A 2PX0A 1JWBB 2OSBA 1MEOA 2W6PA 2JW5A 2W2KA 1ZC3A 4WASA 5BN5B 2XUDA 2WWRA 3HUEA 1QVRA 3FYCA 2QN9A 5HZKA 2ZSUA 3D7MA 3O1LA 4R7ZA 4EHFA 2X4DA 5HM6A 5IG2A 2PIDA 1H0SA 1R1DA 2NUPA 3EC1A 4UHFA 2IV7A 3CN7A 2PBLA 4MQ4A 5GMOA 3E03A 4W1RA 4S05A 3BK2A 6NULA 5KYUB 1Y3HA 4HBZA 4O4IF 5ICCA 1UPFA 3LV8A 1NVEA 5CH3A 1SU4A 1TEHA 2PFSA 2GYUA 2GTHA 2C8JA 2NVOA 2PGIA 2Q5FA 1FSGA 1G21E 1C41A 2QMQA 2YWJA 1ZS9A 4AJIA 3TTUA 1KMHA 1MD9A 2QF7A 4ZV4A 3TQOA 1I4TD 1IUPA 4FONA 3BCRA 3C8ZA 3JQ9A 2IELA 3L84A 3NH6A 1C7JA 2AI3A 1Z4JA 1HEIA 2I67A 1EFPB 2GLXA 2V3WA 4WZBA 1I4OA 1C80A 1GPH1 2XPCA 1CIPA 1NDQA 3EZLA 2YYZA 1FYFA 3OOYA 3RSLA 3WDSA 3WV4A 4A6DA 1BX0A 1JI3A 2AZTA 2PGJA 2RGNA 3R0VA 3DBRB 4FDLA 3UJHA 3FCYA 1WWKA 3KTOA 1OHHA 2VQ6A 2ADMA 4QA9A 4JQYA 3O82A 5ENZA 2VHTA 2BPOA 4E32A 3BRSA 1SXJC 1UM9B 2JFQA 1TQDA 3R3UA 1JAHA 3CKLA 4ZEVA 4UNNA 1IBRA 1KA9H 1XA4A 5C52B 4YYEA 4UATA 1CF9A 1WXQA 4MWOA 4P4GA 5TF4A 4RZ2A 1SEPA 1RWNA 4XWWA 4YXWA 4KXYA 2FXIA 1KDYA 3QFHA 3E7DA 1WMSA 2GF2A 3SZLA 1Z38A 4ABYA 1J8FA 5HF8A 5MF6A 1ULAA 4FNGA 1X1TA 3OPYB 1RYYA 4Q3CA 2FWRA 1DO0A 2AMFA 2PRKA 4QDJA 4AURA 1C7ZA 4UQLA 2X7JA 2P79A 2BEUB 2V6BA 1Q2UA 3CX3A 5K8TA 4C20A 4A5OA 4U2EA 1SBZA 1YE8A 3KZVA 3H6GA 2W2LA 2PANA 1ZJZA 3JTEA 3WLRA 4FJ2A 3SJAA 1IULA 2V1UA 4RGBA 3QKWA 3EBPA 2J0VA 3BTSA 3RSSA 2B5WA 5REQA 2EL9A 1Q77A 3GA7A 3OO0A 3C7CB 2CBGA 3G2HA 3LBAA 1XP8A 3NH9A 3VC7A 1U8YA 2MJLA 1GRVA 5CIWA 1A76A 3V1LA 3G1UA 3TM5A 3OPMA 4F97A 1KSJA 4GM0A 4PG5A 4DLRA 5D3KA 2JL1A 1QHFA 4X6XA 2OA0A 5KTSA 4MI3A 3UMJA 1K5GA 4II3A 2IZ7A 1HE5A 4QXMA 4V38A 1EZ4A 2G80A 3WX0A 2BFCB 2HUNA 4HAIA 4WKNA 1EFCA 3RFCA 1EUCA 1JWLA 1CIVA 4KEAA 3VDXA 3PF8A 1UC5B 2IS2A 2G36A 4H31A 1JR3A 3FYHA 4FHZA 2X5XA 2YWCA 1UK8A 2QIOA 4EB6A 1N9GA 1PT6A 1UOOA 1M2GA 1U0GA 1N2JA 3AJAA 3D8SA 3ICOA 4G65A 3VZDA 1C0LA 2NYUA 4ZZ2A 1NVAA 2IYYA 2R2GA 1ZNZA 3VPFA 2O07A 3TXYA 3ZWMA 2XCIA 1PE0A 1ZO8A 1CFJA 1VA4A 2B8JA 2Q3BA 2Z43A 3HYLA 2WR8A 4TL8A 4RWEA 1HT0A 3F6PA 4O25A 3UICA 1EGAA 4OMCA 1WDWB 2ZYDA 3N5CA 1VTKA 2GCOB 4RJIA 3ZDBA 1IHUA 5MFZA 5H4GA 2R9VA 3C8DA 3NT2A 3ZWXA 1N7HA 4PEVA 1HFWA 3AUJB 1RHRA 1S9HA 2O2DA 1FVXA 1RZRA 4H77A 4MQLA 2ZBDA 1GN9A 1GPMA 4NPHA 3TXAA 3ZK8A 1GGFA 1WRBA 1ZIOA 2A86A 5CRIA 2Q9UA 2XTMA 3EGWA 4KE9A 1R5JA 2VK2A 5HMLA 3UMFA 2X6QA 1Q57A 2HSJA 3LF1A 1E9FA 1U2TA 3OX4A 1XTPA 3SC6A 1FX1A 1LRLA 1WO8A 5CHYA 3W5DA 4BMDA 2CWDA 3JQGB 5HFNA 4EUNA 4BMVA 2CDBA 3IIMA 3V97A 4UEJA 4RS4A 1LSJA 3ZN2A 1ZKDA 1SBQA 4RZQA 3TCKA 1F60A 2F48A 3AZQA 3AW9A 5JBIA 1SXGA 4B79A 3IKTA 3Q9LA 5BORA 1WV0A 4OOEA 1RRCA 2JI9A 1M1XB 4UZEA 5TEWA 1OWNA 4JVMA 3C3YA 3CPJB 3HDGA 4ESEA 4BIIA 5IBRA 4JX8A 3F78A 4C4TA 5TDHA 4HQOA 4ASUA 1QLHA 4QT4A 3HH8A 4RV4A 1U8EA 4FMCF 3RLIA 2XYQA 1X70A 2AB0A 4MDHA 4QOIA 3LQ2A 4D9MA 2NYAA 3R76A 1WZEA 3W6NA 2IH4A 5JH7A 4ZI7A 5HR5A 3UH0A 4JLJA 1TUGA 1K4KA 1CQXA 1PCXA 5EN4A 3W5VA 4DNPA 3E48A 5EJFA 4I5IA 5T6MA 3W1WA 2VQEB 4HR7A 1X2BA 3HCNA 4MB2A 3LPAA 1BMDA 4RLSA 3LH5A 4L6IA 3RRMA 4XB6B 1SD1A 1YTUA 2ZFUA 3T0IA 3NGXA 1KZYC 1R6XA 4L9RA 1Z6GA 4H7FA 4M0KA 4M9SA 1OA1A 2JPDA 4MPTA 4PN3A 4HGZA 3RS4A 3TECE 4UOZA 4IXMA 2CFRA 3SMQA 3PE4A 4AM8A 3DOFA 1SR8A 4KQEA 5KX5F 3D6HA 2C97A 3EF3A 3IPCA 2VDRB 3CLVA 2YY7A 4LXXA 1Z3CA 3C6QA 4C14A 3ZD7A 3BB3A 4K2HA 4YXFA 1PBNA 2AW5A 4MK4A 4CLDA 1KP3A 1GDTA 4DDUA 4DLUA 3V7WA 1C7IA 1RJFA 4L72A 1FFYA 3F8WA 1SXHA 5EJ6A 4Q39A 1CR0A 2PH1A 4XQ9A 3SZRA 1MX5A 3B1KA 5GJCA 1R4MA 3OD5A 4NR0A 2RE8A 3GT0A 3L8CA 3MIIA 5JY6A 2YCLA 2XNCA 1MB9A 1TD1A 5EKSA 3RKUA 2XCRB 5BSHA 5AYVA 4R0VA 4TTPA 1X1QA 2IUSA 3WQRA 4H6WA 1IN4A 2WFLA 1K5PA 2P0YA 2UYHA 5ITVA 4B7UA 1WZ2A 1A9PA 1GFZA 2W2MA 3UA3A 5ARDA 3U17A 3R3HA 5FP0A 5J47A 5AKJA 3K72B 3DP9A 1H4SA 2Q4TA 5G41A 1DCMA 1Z29A 1YJ5A 2PUWA 1LW6E 3AGQA 3FUUA 3I39X 1SURA 4TLCA 3AERA 4EA6A 2A2ZA 3LBIA 1LB1B 4ZK2A 1VMIA 3CU5A 3DLCA 4BRWA 3DAGA 2FPGB 3AR9A 3IP7A 2K7FA 3DEFA 4NS1A 1KC3A 1EK6A 3M3HA 3IUNA 4WPGA 2I6TA 2DWUA 1L8AA 4JHLA 1UT5A 1NW9B 1VYUA 1GDDA 4NVRA 2FW8A 3PK0A 1KMIY 1PR6A 3PWSA 1VZ2A 1FQKA 1NHWA 1WSAA 2XZPA 1W85B 1YVEI 1T6BY 5LVAA 2BGTA 3OH8A 3AF2A 4HJRA 4FUTA 3RG2A 4O1IA 5IJ9A 3PUZA 2JLUA 3W2TA 4PO9A 2HLDD 3GMSA 4JKIA 4NHOA 4U5QA 1JBKA 1UJNA 3CBQA 4LJKA 4BN0A 1BXRA 4BNDB 1GPBA 2QRJA 2MYPA 2OVBA 3UCEA 3GRZA 2VP3A 4RPCA 2PRZA 2PUCA 2A33A 4JQZA 1K6MA 1E20A 1YKFA 1DIBA 4E7PA 4IRXA 1OFIA 4UBKA 4YPFA 4CZ2A 2O8FA 1YQTA 3HLKA 3BHNA 1WP9A 2PO5A 2QXUA 3NHLA 4J7UA 3WQBA 5FTMA 2A7QA 2G9UA 4BEVA 2BMDA 1AUOA 3H5VA 1NUQA 4HQ6A 4DB4A 1T24A 1G1AA 5HILA 4JWTA 1GG9A 2WD7B 4MS3B 5CK5A 4QJ3A 3ZNOA 4D0RA 1A50B 4BB0A 4ZGGA 2PWAA 1JLKA 1YZTA 1IM2A 2YY6A 1TYDE 1G5PA 2J9RA 1GL6A 4EITA 3O7WA 1LLQA 4P86A 3LC1O 1L7NA 3AF3A 4XCQA 3FOFC 4PYJA 3WZ2A 2Q21A 1K6JA 3HP1A 5EVJA 1H2ZA 3R0QA 5EVCA 4IWXA 4LMBA 2HV8A 2W4QA 4HYEA 1IHYA 4WLVA 13PKA 3KT3A 1UC8A 3KE9A 3QI2A 3G7UA 4B8YA 1XZQA 4AMZA 4WDRA 1JG6A 3FLMA 3QVJA 5KNLA 3V8PA 2RKOA 1NNUA 2J7PA 2YV5A 1G6OA 4KPUA 3LY7A 4RKYA 4CQNA 1OI7A 4XARA 4UJ5A 5J58A 1RC8A 3PFBA 2G9NA 3IBFA 3GGGA <