1YS2X

Burkholderia cepacia lipase complexed with hexylphosphonic acid (s) 2-methyl-3-phenylpropyl ester
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
320
structure length
320
Chain Sequence
b'ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVGGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Mirror-Image Packing in Enantiomer Discrimination Molecular Basis for the Enantioselectivity of B.cepacia Lipase toward 2-Methyl-3-Phenyl-1-Propanol.
pubmed doi rcsb
molecule tags Hydrolase
total genus 131
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2005-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ys2X00
3VDXA 1PJAA 3DCNA 4HZGA 4WDRA 1XZHA 3WYNA 4UBJA 5BWBA 1ISPA 1L7RA 1MPXA 2WG1A 4C4YA 4E46A 3HI4A 3A2NA 4EHBA 1OCEA 1ZD5A 4DM7A 3HSSA 1ODCA 4GWLA 1VXOA 5EIAA 3ZWQA 1ZGCA 4W1PA 2I78A 4AMYA 3KXPA 3PDCA 4WJLA 1A8SA 5HFNA 4OPMA 2WFZA 4FOLA 4KE9A 4ZREA 4OYYA 4C01A 3SC2A 1M33A 3BIXA 1F6WA 2CUTA 4ARBA 4UFNA 2OCLA 4MJ3A 4X90A 3GUUA 4X95A 4I19A 1YSCA 3Q0TA 1WOMA 4RNCA 4K5QA 3QMVA 3D7RA 3D2BA 4UHBA 1XQVA 2GBFA 3OC0A 1LLFA 2HADA 1U4NA 5HQ3A 2FX5A 1YASA 4B6GA 1QIJA 1RWQA 3A2MA 1JU3A 4F60A 4KRXA 2ES4A 2AXEA 2HU8A 5SYMA 1K8QA 1WB6A 1CQWA 3CN7A 1SCQA 3I2JA 4X71A 3X3HA 1MTZA 1CEXA 4HXGA 2RONA 4QDXA 2WFMA 3F67A 1XZBA 3DOHA 1K5PA 5ALQA 3C6YA 5CXXA 2D5LA 4AZ0A 1P0IA 4HTAA 3L1IA 2WM2A 2PSHA 5DNVA 4AMZA 3ZLTA 4BRZA 1QIEA 1H2WA 4DTCA 1LPPA 3EBLA 4B81A 3U1TA 4KYVA 1XRQA 3RM3A 1AMNA 3FSGD 4PQEA 1LPAB 5ALXA 1DQYA 5FV4A 5E4TA 2XUIA 4OSEA 5BOVA 5FLKA 3BDIA 2G5TA 2YYSA 2XUKA 4B9EA 1DX6A 2W6CX 2X8BA 1HDEA 3DQZA 3QPAA 2WUDA 3A2LA 1CUEA 3FYTA 2PUHA 4JYMA 4H7HA 5JZ9A 4U2BA 4N8EA 1GPLA 3EIOA 4GXNA 5AI6A 4Q05A 3UMJA 1SCIA 1P0QA 4KAFA 3WWPA 3VJLA 5KWJA 3R3WA 1UXOA 4DGQA 5FPQA 1U65A 1Q83A 3HRHA 4ZGBA 1WM1A 4JUIA 3M82A 4QNNA 4AO7A 4GECA 1CUCA 2HRQA 2C7BA 3QZUA 5T4FA 5J3JA 3GZJA 1CUBA 4E11A 1YAHA 4KEAA 1QFSA 4UPDA 5CW2A 2WIGA 1UFOA 3FVRA 1XQWA 5JYCA 2XUHA 2XQKA 5IVIA 5A71A 5C81A 3WMRA 1P0PA 4XJVA 5BWCA 4YPVA 1KU6A 3WIOA 2VATA 4BCBA 5EGNA 2O2GA 3ILSA 1XZEA 4PO3X 5ALYA 5F4ZA 3W2TA 1T2NA 4ZV9A 2DSNA 1BRTA 1MNQA 1QTRA 2WJ4A 3CN9A 5AI0A 4Q3OA 1IMJA 4UHFA 1L7AA 3LP5A 2EDAA 3AFIA 4G9GA 5D6OA 1GXSA 3ZLUA 1YR2A 4H7FA 4DNOA 1PFQA 3WJ1A 1JJIA 3W9UA 4W63A 3DS8A 1EVEA 2WHPA 3I1IA 5YASA 5HZGA 1ETHA 2C5FA 1BU8A 5ALKA 5HK9A 2VA9A 4X92A 2AJBA 2RIPA 5CT4A 2YASA 3O9VA 2RHTA 4E14A 4BCDA 2QXUA 5ALVA 1BCSA 4KE7A 1TK3A 3HJUA 3WK6A 1TIBA 5ALLA 3ESDA 1CIJA 4FNMA 3WL5A 2HU5A 4Q82A 3R3ZA 3E3AA 3CCCA 4J0CA 2LIPA 5ALFA 5AM3A 1CUAA 4LXHA 3AILA 5CTAA 2VJCA 1N1MA 3D2AA 2QOEA 1L7QA 5FRDA 2WU3A 1O6FA 2BAGA 1CUIA 4F21A 4DNFA 1C4XA 4FBMA 2B61A 2WUGA 1CUDA 1X2BA 5ALNA 4P9NA 4UHCA 2O2HA 3HXKA 4INZA 2ZSIA 4BDTA 3NWOA 2G5PA 3D2CA 1XZKA 4TVKA 3STVA 2WG0A 1VZ3A 4P92A 3UUFA 4C89A 2I03A 2VQ6A 3WWDA 2ZJ6A 2QVBA 4AO6A 5LZ8A 4BBZA 4P93A 5LLSA 1CRLA 1HPLA 1AUOA 2GYWA 2VF2A 3D4LA 2BUBA 4X6UA 2JGLA 2PUJA 4X00A 3WA7A 1XZAA 4DMHA 5D7BA 2VEOA 1H2YA 4UBNA 4M0FA 5AH0A 3F9CA 1JJBA 2BFNA 3STUA 5DTJA 1UKBA 1CUGA 1XRPA 4QWWA 4OU5A 4KAAA 3GFFA 1EH5A 2QM0A 2HM7A 3PI6A 5AM4A 4XIIA 4QDZA 1WPRA 1GPKA 2VAVA 4K6GA 1G42A 3JYHA 5EHQA 4K2AA 5T4BA 1QIDA 3QMMA 4DIUA 4RPCA 4EUSA 4OUKX 4FTWA 5ALTA 3JWEA 2JGEA 3IUJA 4PF1A 2W22A 3D0KA 1WCYA 1ZIXA 4ITVA 1T4MA 3PFBA 5CT9A 2V9ZA 4M0MA 4N8DA 1ZD3A 2BGRA 3L1JA 4IH1A 3TEJA 3C87A 4U2EA 2GZSA 4UHDA 1YS2X 3K2IA 3P2MA 3R41A 5AKJA 2RGUA 3HC7A 4HXEB 4DSAA 3BJMA 1XROA 3C8HA 1U2EA 2Y2VA 5A62A 3O95A 2ZYIA 3G0GA 4UFOA 3H2IA 4MEBA 5ALIA 5FP0A 4OB8A 3FLEA 5D3ZA 2XMCA 3FSGA 1EB9A 3IUQA 3OTQA 2XUAA 4Y2QA 1RP1A 2QR5A 1UOQA 4AO8A 4J0JA 5LIPA 3ANSA 4J0DA 2ZJ7A 5ALEA 5DYWA 2FUKA 2JEYA 5AICA 3W9BA 4Y9SA 5JANA 1TAHA 1NX9A 2XLBA 4QDTA 2CKMA 1QONA 4Y2PA 3WK9A 2JGMA 4BP8A 1JMKC 1QTIA 3STWA 5AKYA 5AKIA 4CI9A 5IVKA 2G63A 2H7YA 5HF9A 1XZGA 1QIIA 5AHXA 4AN0A 4EY7A 3DOIA 3DKKA 5LZ7A 2JGIA 1VA5A 5JAPA 1B41A 4TGLA 3ED1A 5JAOA 2WILA 4EY6A 1CUZA 3C6BA 1FJ2A 1VKHA 3LIPA 1QIKA 4G4IA 3IUMA 2FJ0A 1W52X 1JU4A 2Z3WA 3FYUB 1LPNA 4E15A 3FCYA 1CUUA 3IB3A 1UK7A 3AJAA 1ZD2P 4X7BA 5EIEA 4CIBA 4BVKA 2BUAA 4FHZA 3STXA 3BJRA 1BN6A 4UHHA 5EHXA 2Z8ZA 3TRDA 4DMFA 1NU6A 5KREA 5HF5A 1EVQA 1F0NA 3FLBA 2V98A 1ZJ5A 4N5IX 4MWSA 3KDAA 4RE5A 2C0QA 4X97A 3WK7A 2HA3A 2XMRA 5K3FA 5AOCA 1XZDA 3WKAA 4CG2A 1EDDA 1YAJA 5AKZA 3T52A 1BS9A 1QGED 1FFCA 3VXKA 4OB6A 2XI4A 4OCZA 4MYSA 5EHZA 3AZPA 1NU8A 3H2GA 5AOAA 4PNZA 5AKLA 4CCWA 3CXUA 2GBCA 5HKBA 1EHYA 4GHWA 2J3DA 3AIMA 1R9MA 3WKEA 2B20A 4C4XA 2X76A 1AX9A 4MQMA 4NS4A 5LZ9A 3WJ2A 2WIDA 1GQSA 4QLAA 1BEZA 1MX5A 2BJHA 4EBBA 5LP1A 2CZQA 2ZSHA 2E3JA 2ONCA 5ALJA 3BDVA 4X6YA 2JIDA 3GA7A 4WFKA 5AI8A 3O4HA 1LGYA 5LZ4A 5IKXA 1BCRA 2CEKA 1MO2A 1W75A 3WZLA 2RAUA 4FMPA 3WK4A 2PKYX 3H2JA 1YA4A 1QIGA 2Y6UA 4RE6A 3FNBA 1B6GA 3WK5A 4LHEA 2HFKA 1XLVA 2QZPA 4CCYA 2XUFA 3WL8A 4RGYA 3S2ZA 4EB0A 2XQIA 2HA7A 1ZI9A 4DNQA 1UK9A 4GBGA 3NUZA 4WDQA 2XE4A 3H17A 2I3DA 4NVRA 3E0XA 5K3CA 3WWEA 1DU4A 4X3CA 4KAJA 5ALDA 3T4UA 2PX6A 4FLFA 5BV7A 2XUDA 4L0CA 4Y2TA 2WLSA 1IUOA 2WTMA 3RARA 3FAKA 4FFWA 3I2IA 1YCDA 1UK6A 1K6EA 2OGSA 2PL5A 3A70A 3KSRA 3LLCA 1XQYA 5AKGA 4C4ZA 4CG3A 1PV1A 5SYNA 2WJ6A 3V1NA 5C8VA 4L9AA 1SCKA 5KWIA 1R4ZA 3AUKA 3F96A 4I4CA 2CJPA 4BDSA 1QIMA 2D0DA 5KBYA 4KJXA 1OILA 4CIAA 1R1DA 1CUXA 3IUNA 2QMQA 2XUOA 2XUPA 2H9YA 3G0DA 1LNSA 2OG1A 3WA6A 1DQZA 5IH7A 2XQJA 4G8BA 1DT3A 2FJPA 3VVLA 2ZYHA 1YB6A 1ZI6A 4FBLA 3MUNA 2VTVA 5HFAA 3QBJA 1DWPA 3AZQA 3DYVA 2OPHA 5AM1A 2OAGA 4DYHA 4B80A 4N5HX 5JZSA 1YS1X 1FFAA 4DNPA 1CQZA 1W1IA 5CMLA 5AKEA 3WL6A 4U2GA 4B85A 3V1KA 4OYLA 3O4JA 4BZZA 3PE6A 2VSQA 3C70A 2WFLA 1FFBA 1UT6A 4H7JA 4J03A 5AK3A 2EDCA 3QPDA 4PV7A 3IURA 2HA4A 4BRSA 1I6WA 5HF6A 1GPNA 4G5XA 2QT9A 1CVLA 1O6GA 5LKAA 2NW6A 1KU0A 4F5ZA 2R8BA 4DMCA 1AURA 1DWQA 1WHTA 3I2HA 4A5SA 5DTIA 5E2IA 4B0PA 1XZJA 4W1QA 1Q0RA 3G9UA 1DINA 1CUWA 2OXEA 1HQDA 3QM1A 4BC0A 3FBWA 5D3KA 1BE0A 1Y37A 3PUIA 4ETWA 3A6ZA 4BAGA 4B0OA 3IBTA 1QO9A 2OLEA 4QA9A 4BC1A 3R40A 3AZOA 2QJRA 2PU5A 2V97A 5HF8A 3B3QA 1A8UA 2HU7A 5A7GA 2IX9A 5A2GA 2C5GA 5EFZA 3I28A 2WHQA 1C7IA 5CH3A 3STTA 5ALOA 2R11A 3M3DA 3FWHA 4XX1A 3WLAA 1J2EA 2DHCA 3ICWA 3YASA 2WKWA 1GQRA 4Q1VA 1U8EA 2PPLA 2VT7A 5AM5A 1UOPA 2G4LA 4H18A 3WKBA 2H7CA 2JF0A 3C8DA 4NMWA 5I7UA 4BVJA 5A7FA 3G0IA 2WUEA 2BGNA 3CCBA 3H19A 5T4EA 4BCCA 2QJWA 2OAEA 2HHAA 1LZKA 1TRHA 2XMBA 5AKKA 3OM8A 2OCGA 1ZIYA 5ISMA 4Q3LA 1VE6A 3ZI7A 1FFEA 3C5WP 1G4HA 2WJ3A 2OQVA 5JALA 3W04A 1VE7A 2GZRA 4Q34A 1X2EA 1AGYA 2XUQA 1P0MA 3I2KA 4PSUA 3H2KA 4YK7A 5JATA 4ROTA 1HKHA 3K6KA 4Y2XA 5AJHA 1A7UA 4O08A 2WHRA 5AP9A 1TCAA 1EX9A 2B9VA 4A16A 3DYIA 3NOXA 1N5RA 4BTVA 2YH2A 5DNWA 5JZBA 1ZI8A 4Y2UA 2JBWA 4LIPD 4GLBA 3WI7A 4S0XA 3WKDA 1ZOIA 5JADA 4BE9A 3VKFA 3WWCA 5CH8A 1AKNA 3O4GA 4G4JA 4QEKA 3IVMA 5C7YA 3V1MA 4I3FA 3V1LA 3WZMA 3WQHA 4B83A 5AK5A 4IQ4A 2ROQA 4X85A 4IH9A 3ESCA 4BATA 1CPYA 1USWA 3EQ9A 4YASA 3EF3A 3B5EA 5AO9A 1CR6A 4JNCA 4FFVA 2ORYA 5JARA 3G9XA 4B9AA 1MU0A 3FYUC 3G8YA 2HA6A 1H2XA 5ESRA 1XZIA 4EA6A 3F98A 4DSZA 3W05A 2VJAA 2JEZA 2HL6A 4L72A 4X91A 5K3BA 3SWWA 3LIIA 1MN6A 2H1IA 3WK8A 3ZV7A 3O4IA 1QZ3A 2QTBA 4G1FA 1CUJA 2ECFA 5JD4A 2JGJA 1TQHA 3PUHA 3DJYA 5EI5A 2XLCA 5ALWA 1CUSA 1J06A 2J4CA 4OD0A 3VJMA 2O2IA 4N8SA 5FKJA 4QZVA 2WG2A 3VVMA 1E8NA 3C5VA 1MX9A 4FWBA 3L1HA 2EEPA 3U0VA 1JI3A 1EA5A 2QRUA 4KE8A 2WQZA 3F8SA 5ALHA 3WWOA 1K63A 1DX4A 2XMZA 2Y1KA 1S8OA 2XQFA 4UBLA 5LKRA 4PW0A 4FNGA 1EB8A 1IVYA 1GGVA 3S8YA 6YASA 1F0PA 5FUMA 1EK2A 3O9MA 3PICA 5ALSA 3TJMA 1TKRA 4Y2RA 7YASA 3SK0A 2JGKA 4U2FA 4F0JA 1ZD4A 3HLKA 4Y2VA 5C8XA 3GBSA 3HYSA 1QJ4A 1OXMA 3HEAA 4HXFB 4OB7A 2XUJA 1K4YA 2O7VA 1Z68A 4GW3A 3HABA 2DHDA 5HQ3B 5T4HA 3K9BA 3WYDA 1VJ5A 4BAUA 3C6ZA 5AM2A 4NZZA 2PSDA 4HRYA 2OQIA 2HA0A 5CT5A 5DYYA 4H0CA 1CUFA 3QITA 2GBIA 5JIBA 2IITA 1QLWA 3FYUA 1XRLA 2CBGA 2ZYSA 5EIHA 3G02A 5H3HA 3QMWA 1MNAA 4Y2SA 5AI9A 1QE3A 5HCUA 3DEAA 3MGAA 2XQGA 4QE3A 4P08A 3Q8WA 2GYUA 4B7ZA 1Y7HA 1J1IA 1MAHA 1ZJ4A 1WHSA 5CT8A 1LBTA 1UK8A 5AIAA 2B4KA 5HK8A 3LCRA 4PSDA 4KE6A 3BF8A 3N0TA 1LZLA 5ALGA 4H7IA 1JFRA 5K3AA 4EY4A 5ALMA 2AJDA 1EI9A 1E8DA 4WFIA 1DT5A 3W06A 2HFJA 2OGTA 1QIFA 4CCYB 4Y2JA 1IZ7A 3I6YA 5AM0A 1EDBA 1XFDA 1ODTC 3D59A 2JGFA 1N8SA 2WIKA 3QVMA 5AI5A 2PM8A 2AJ8A 5AIBA 2XMSA 5EHNA 2GYVA 1XRNA 5FPPA 1QOZA 3DL7A 1RYYA 1VOTA 3D5EA 4XWGA 2XDWA 2HRRA 4ARAA 5LZ5A 2J4FA 3I6ZA 4HRXA 4GDMA 3RK4A 2H7XA 4EY5A 4BZWA 2Y2UA 1ACJA 4BTLA 2OCIA 1GKKA 3AIKA 4J7AA 3FLAA 1VZ2A 1SOMA 2WIJA 4UBMA 2VJBA 3IA2A 3WIBA 3C6XA 2GBGA 1W76A 4G8CA 1A88A 1SFRA 4MEAA 3JW8A 3H2HA 4UHEA 1AC5A 1WB5A 2AJLI 3HZOA 1VXRA 4CFSA 4ZRDA 4QDOA 3GROA 1JKMA 5ALRA 2WIFA 1LBSA 2DFPA 4BP9A 2PBLA 3FCXA 5C8ZA 5JD6A 2PSEA 3QYJA 4LXGA 1F8UA 3STYA 5JASA 1CV2A 1MAAA 4LYEA 2WSLA 1CFJA 3BL8A 3PFCA 2AJCA 5ALPA 4K6KA 3R3XA 2CB9A 3G9TA 4X6XA 2Z5GA 2VT6A 3MUOA 3ZPXA 4X94A 4BAZA 1DWOA 4IHAA 4GEGA 5DYTA 3DKRA 1EINA 1R88A 2WTNA 1LPMA 3I1YA 2WFLB 3ICVA 3E4DA 2WHPB 3G0CA 3H0CA 1CUVA 1E5TA 3H18A 1ZICA 1XRRA 1FFDA 2HIHA 1HL7A 2P8SA 3BXPA 2CMFA 1AQLA 4MQLA 4H7EA 4Y2YA 4D9JA 1Q0ZA 3DDUA 4A23A 5FXMA 1A8QA 3IDAA 3NGMA 2QUAA 1LPSA 3V48A 5JAHA 1AZWA 1SC9A 3FVTA 4W9RA 1ODSA 5JD5A 2ZVDA 5DNUA 1WB4A 2HDWA 5IVDA 3V9AA 4AX4A 5LZ2A 1EDEA 4W1RA 4G4GA 4H35A 3WKCA 3SX4A 1IZ8A 2VAXA 3VJKA 1XLWA 2ACKA 5LYYA 1GT6A 2QXTA 5HKAA 5ALUA 3R0VA 3HACA 1THTA 3OPMA 3AIOA 3R3YA 1QIHA 3PF9A 5CBKA 3C43A 3EQ8A 1VA4A 3VISA 1H22A 5E4JA 2HA2A 5AKHA 3BWXA 4BYMA 1G66A 4PSCA 2Q0XA 3RLIA 2UZ0A 2YXPX 4HAIA 4G8DA 1R50A 4ZWNA 3OURA 2Z8XA 1THGA 4W1SA 1BEEA 3H04A 1BROA 4QDUA 3DLTA 4DMKA 2C4HA 1R9NA 1X70A 1XRMA 1EXWA 1E8MA 3M81A 4EZIA 4QLOA 4XVCA 5FDFA 1C7JA 1W4LA 3R3UA 1TCCA 3LS2A 5JAUA 4LXIA 4AQDA 1MX1A 1XZFA 4CG1A 2PVSA 2QS9A 4MYDA 1JT2A 4M0EA 2OCKA 2DR0A 4H7DA 4WCVA 4AN1A 4KACA 1H2ZA 3DNMA 2DHEA 4JEIA 4TPKA 4U2DA 2C58A 1QO7A 3ESAA 3DL4A 3BIWA 1N5MA 5I8PA 1J07A 4MXDA 2XMDA 1XQXA 2I3ZA 4ZI5A 4UBIA 5CH5A 5AK4A 5A7HA 4LKOA 1DTEA 3KWJA 1JMYA 4HS9A 3OOSA 5CURA 2IIVA 2DQZA 1G5FA 1UKAA 4AXBA 4QWMA 3QH4A 4J0IA 2HA5A 4GI1A 2WUFA 4FLMA 4WY8A 1IUNA 5I9IA 3F97A 1ORWA 2QKYA 1VLQA 5AOBA 2O7RA 4Z49A 4ZXFA 1YA8A 5A6VA 2XUGA 2QUBA 1UKCA 1ACLA 1MJ5A 2BCEA 3BF7A 3H1BA 4UBOA 3EQ7A 2PSFA 4LYDA 3G9ZA 1H23A 1HBJA 2ACEA 3IIIA 1Q84A 5CRIA 1MT3A 4Q3KA 2VJDA 4DLNA 1XLUA 4AB1A 4BVLA 4AZ3A 4UFPA 4UUQA 1D07A 2BUCA 3AINA 2J3QA 2X5XA 4KR0A 4H77A 3ZLVA 3G7NA 2PU7A 2Y6VA 1Y7IA 3KOOA 5ALZA 4K6HA 5FOQA 1TCBA 3KD2A 1XKTA 2V96A 5AK6A 3I6MA 1ORVA 4IH4A 3O0DA 1JJFA 4WY5A 3RKSA 1CUHA 1E89A 4EY8A 1W6RA 4HVTA 1GZ7A 4UBKA 1UZAA 5K5EA 5DLPA 4C88A 5K3EA 5IVHA 3FOBA 5CXUA 3D3NA 4L3WA 4J0HA 3IULA 4FKBA 1IUPA 1KEZA 2WU4A 1R3DA 3TGLA 1E66A 4YX9A 4Y7DA 2DQYA 2RHWA 1ZGBA 3B12A 4KRYA 3ANTA 3I2FA 3ESBA 4H7KA 5DWDA 4C87A 4J0KA 3G0BA 5K3DA 3KWFA 3E1GA 1CUYA 1HLGA 1UWCA 5E4YA 2ZYRA 2XMQA 1CLEA 4B82A 1E3QA 4U2CA 5AI4A 3DD5A 1XKLA 4J3JA 3H1AA 2C0PA 1LPBB 2K2QB 3MVEA 4FDMA 1WPXA 2OGZA 1LPOA 4IO0A 1EK1A 4JH0A 2XB6A 3I2GA 3OG9A 4JYPA 4MWTA 2ZJFA 4X93A 5CT6A 4BB0A 3R3VA 4FLEA 2XT0A 1XZLA 4G9EA 1QFMA 1UOOA 4J0GA 3WL7A 1BN7A 3GELA 2BKLA 2XMGA 3C45A 2Z3ZA 2DCMA 4WFJA 2PSJA 3UUEA 4BE4A 5DJ5A 3BE8A 5K3FB 1FSSA 3N2ZB 1XZCA 1XZMA 4ZV7A 3QPCA 4C6HA 3PF8A 5AKXA 4B84A 2RI6A 1GKLA 4V2IA 4OU4A 1YB7A 3M83A
chains in the Genus database with same CATH superfamily
3IQEA 2F9FA 2Z09A 1COWA 1PJAA 3DCNA 3HZZA 4M98A 1DAPA 5D85A 5JS1A 3T7SA 3ISJA 4B47A 2DUJA 5LOVB 1ODKA 3Q15C 5CYFA 4BJ1A 2IHKA 2KQUA 3DZ8A 3JQ8B 4YA6A 1ISPA 2FMKA 2JFXA 1M10A 1XZPA 2WG1A 1WHSB 3MD0A 4MV0A 2XZOA 3USES 3I32A 1GRNA 4JXZA 1NJFA 1EWKA 4AJNA 2R44A 4X3OA 1Z8DA 3A2NA 3HDYA 2B7LA 5DN9A 1SN7A 2JKZA 3COSA 3H5LA 2M1XA 3LPDA 1OCEA 3OU6A 2XDAA 3W6OA 3NVMB 4TSFA 4OJQA 1ODCA 5F1PA 2O6LA 1Z82A 2QX8A 1Z3CA 3K8ZA 1TQ2A 4R0VA 4XVRA 1FYVA 2D0OB 3VU9B 5JHHB 5EIAA 2OVFA 5SZHB 4B4KA 3ZWQA 1SB8A 1I1OA 1ZGCA 4MWCA 4REQB 4W1PA 2I78A 3VR1A 5K8CA 1DC7A 1O94D 2FG7C 2IVZA 2FW0A 1G8AA 2B9EA 2H4ZA 3K05A 3U4GA 1A8SA 4D43A 1X7WA 4CU5A 4QT4A 3LC2O 3S2UA 1W4ZA 2HRCA 1DAFA 2C3UA 4U3JA 1Z25A 2KLBA 4ZQGA 2Z56A 2NTYC 4GX1A 4Z4GA 1G5PA 3VMMA 1GO2A 1UWKA 3LX4A 4OYYA 3ZD9A 3FHOA 3GLIE 4AQ7A 1M33A 2FP3A 2BZ0A 5IDWA 4LF8B 4GMKA 3BIXA 3ROGA 2C2OA 1ZSYA 2VL7A 3QQ5A 1KYZA 3A06A 3ZQ4A 5G02A 1AQYA 3OE7D 1U9YA 2HK8A 5TDHA 1J25A 1E7RA 1W0KA 2XVZA 3SVZA 5FO1A 4LTNA 4DCSA 3ID6C 3N8DA 4ZRMA 3VPAA 4XYMA 1F1JA 3NBAA 2NUTA 3QA9A 4N5NA 4K40A 1WOMA 1DJPA 2JAHA 4N76A 5ED4A 1L5NA 4K5QA 4UCFA 5ELLA 3FNIA 4Q9DA 4M1TA 3CXRA 3D7RA 3PC2A 1KP2A 4KV7A 4U5XA 4IPTA 2QWXA 3CRRA 4YI3A 1Z0UA 3PXGA 1P7WA 1BW9A 3L41A 2HMVA 4P33A 1BE8A 3I8SA 3TLGB 2JLUA 1PFUA 5BSFA 1YASA 4IHJA 5T64A 4B6GA 2R1TB 4Y6GB 4L16A 3U62A 2AFRA 1RWQA 2Q7OE 3U39A 2WJJA 4GP7A 2B35A 4X8OA 3RFUA 621PA 2EIXA 4KRXA 1ISGA 2ES4A 4KWTA 2AXEA 2FPGA 2FLVA 4UQPA 3IPAA 1XYYA 1GZUA 4GI5A 4WN3A 4ER3A 1R6XA 1NBMD 1JDPA 1K8QA 1P17A 1UAGA 5LD2B 3PQ2A 4J1TC 1CQWA 1LDNA 4JOQA 4KQGA 4D45A 4X71A 4NDAA 3UWSA 3X3HA 2P9BA 1SIBE 2XDYA 1PNVA 1R0SA 5JNTA 2ZTSA 4RH0A 3FKSD 2YDYA 4BWVA 4GAEA 5ILGA 2JHGA 3Q5DA 4W5RA 2HMYB 2P41A 2W6OA 4OH7A 5BVGB 2GWHA 2WFMA 2X0EA 3TRFA 1G41A 1J5PA 1NQAO 1XZBA 3QI2A 2WSSA 4X3PA 4YWJA 5K9ZA 5KU1A 2IS1A 4PO8A 2D06A 1XA4A 4P38A 5CXXA 2PMEA 1DUSA 4M6WB 5FBHA 4MS3A 1R7RA 2D5LA 4WOPA 5DSTA 3CH4B 4AZ0A 2IYWA 2PA0A 4LVUA 1L8AA 1UFKA 1C29B 2R2GA 2PSHA 4XQCA 4J75A 4DMMA 1OXVA 2AC7A 4DTCA 1QIEA 3H4IA 2VDJA 3PV0A 1N6LA 4IMPA 5DBFA 3A6JA 5BNFA 4B3BA 2CFSA 3FN4A 1VYUA 3S44A 1I6KA 2P69A 3U1TA 3ER9A 3ZHYA 3D54D 1ZUIA 4UUMA 1VLHA 1XDWA 4X20B 1UAYA 3A8TA 3D6FA 2JAPA 3PEUA 3MC1A 3D1LA 3DVAB 4P5DA 2VK4A 4RULA 3K15A 3M6FA 2BE9A 3MPOA 4RDCA 2RDMA 2XUIA 2AMLA 2HAEA 2HQOA 4MCJA 4O4IB 5H02A 2HTEA 3UOWA 5BOSA 3KQUA 4EZBA 4M7PA 5CB4F 1FTQA 3PKZA 4M54A 3QVGB 5BR1A 3QF4B 2DBYA 3D9QX 5CFQA 3DMTC 2G6BA 3CW2A 2II6A 5L3QB 3FPKA 4EKNB 1T3ZA 5FA6A 4CF7A 1MRNA 1G0NA 2OGUA 2W6CX 2X8BA 5BXQC 2B0JA 1PDVA 4C5CA 3HUTA 1RXIA 2QBYA 2INGX 2B8NA 1VG8A 4HXYA 4TS3A 4CIXA 2CFTA 1L5OA 1VJCA 4O2BB 3P45A 4MVCA 3B48A 2ARKA 1OLUA 3V6MA 1YC5A 3FPSA 4AXXA 3IE1A 2R3SA 2FK8A 5ECWA 3VR6H 4MB6A 2C5BA 4WPGA 2FNAA 3NXKA 4RQBA 2EBHX 3EIOA 4I81A 3J7TA 4TZKA 5AI6A 3HKCB 3FDFA 5EOVA 2PG3A 3E7XA 2CLMB 4NMHA 1P0QA 4JCOA 4I36A 3VR5D 3WWPA 2ENWA 3KYCA 1AH2A 1XDSA 5U4XA 2V6JA 1PBNA 3GA0A 3WV4A 2NAFA 2C4TA 4ND6A 3VJLA 3ACDA 2F8LA 4GI3A 4RKEA 4ABYA 3KT0A 5FI5A 5ERGB 4PRZA 4YP1A 4YMGA 1ZCJA 3A27A 1LB1B 1RS0A 1T5HX 3BFVA 1OT5A 3BH7A 3OZUA 3HRHA 3L8YA 3S7ZA 3TYXA 1GG9A 2REBA 3BPSA 4R69A 5G0WA 2REQB 3M6XA 4G09A 4KAXA 5E9QA 3W7VA 4OX9B 2OQRA 3M82A 2X9GA 3PR1A 3VSAA 1F60A 4PHHA 2H51A 4EM6A 3DTTA 3UMFA 4F5YA 5KVVA 5DLYA 4D0LB 2GX6A 1G1AA 3SSMA 1E0JA 1NMQA 1Z29A 3KOWA 2C7BA 1B8UA 1GUFA 4QXMA 3B53X 4RLHA 4OUDB 4QOFA 5T4FA 4F72A 5J3JA 4OQZA 4E11A 4EG5A 5DBGA 2EIHA 1PZNA 3K1AB 4GXTA 4KEAA 4Z0PA 4JJAA 4BKPA 1YCHA 4UPDA 5CW2A 3N75A 2WIGA 1EXNA 3K1YA 4FD3A 3FVRA 4G63A 4V0MA 1ABBA 1XDBA 4M4SA 2X0RA 3NVAA 3RU9A 5CLLA 3VSCA 1W1WA 2J9ZB 4FILA 1MRZA 1DDIA 1NPYA 3HCNA 4I2NA 4MVJM 3L0CA 1GL6A 1RBZA 1P1KA 1WB9A 3V46A 1FP6A 3TVDA 2EKZA 1E2HA 4OBWA 5IEBA 1FCJA 1TK9A 1X1AA 1NOKA 2I6XA 5BT9A 1SKYB 1XCBA 3TZ6A 2QGFA 4IDFA 2VQDA 1RBQA 2W6QA 3GVHA 1QCCA 5EQFA 1PUIA 5BSMA 1EVZA 1TT7A 3DLBA 2NO4A 4J1TA 2NUBA 3RC2A 1D6SA 1N3IA 1SQSA 3EWNA 3NVKI 1KR2A 2V7VA 1FDVA 1QCZA 4DJAA 5JVDA 1DIOB 1H65A 2YINC 5G0UA 2PV0A 3C3BA 5AVWA 3VH1A 4I1IA 1SIUA 4ZCLA 4JSYA 2XGGA 1JFVA 2WK1A 1BRTA 2H16A 3U1BA 3B3FA 3HCDA 2I4NA 4JXJA 4KMSA 2MSEB 2IEYA 3CN9A 5BR4A 3DDZX 4Q3OA 4MTCA 4L28A 2Q3BA 3E9EA 4B2IA 2RHDA 4HDSB 1KEKA 2DQ4A 1T0HB 2FPKA 3GFPA 4C0BA 4UHFA 1GZ3A 2YFKA 4IIYA 1OB2A 4RIGA 1Z2CA 2PANA 3URKA 2ZIWB 5F77A 3ZGNA 4G9GA 2CL7X 3MWEB 2YRFA 1MEEA 1KVTA 3E8XA 3GX1A 5DNAA 4TUYF 5D1NA 5C3UA 3R9KA 1PEYA 2QI9F 3ROTA 5FUVA 2ZXEA 5EE1A 3ZLUA 4RJIA 1RMTA 4X1IA 3W9YA 5BNZA 5KAMA 1L4YA 2FZKA 3K8OE 2XYVA 2A30A 2C57A 1LLUA 4G1VA 2C04A 4RFLA 3NCHA 1M2WA 2JJ2A 3AEUB 4BV9A 1KJWA 2K87A 4HRAA 4CPDA 3VAYA 1NUSA 5T3UA 5HUHA 1VHQA 2I4MA 5EIFA 3A6PC 2DFKB 2JLQA 4AY2A 2VRWA 4RF3A 2QL6A 2J3JA 2P78A 1TPYA 1TYZA 3D81A 4I66A 4TYPA 3OX4A 4RJKA 4W63A 1EVEA 5GJCA 4UTVA 1ZXLA 1IPFA 8MHTA 1L4NA 3CE9A 1W0CA 4UVGA 2YUIA 3TLXA 2A67A 2IXBA 1CZOA 2FRXA 2H52A 4NBKA 1VRVA 3BORA 3GFGA 3DMTA 3EXHB 1BU5A 3QNUA 1WMAA 2M98A 2EZ8A 4M3NA 3INGA 2XT6A 2H1WA 3AX6A 2ZW9A 2FEWB 3IDZA 4QYIB 1RADA 3X2FA 4M38A 1P60A 4YFVA 4D9GA 1HH4A 2XQVA 2ZRGA 4LC1A 1CJCA 1I0LA 3EEQA 3GYBA 4XZ3A 5CM8B 4AIRA 1H5NA 1D09A 1BE6A 3HUUA 2YWDA 3WK6A 5FPKA 2ZU0C 1KSJA 2P1RA 3IRVA 2NT3A 2Q1UA 2AZMA 1FTWA 3ESDA 3MQ4A 4XUCA 1BMTA 5ALLA 5FR1A 4ASUA 6LDHA 4IXWA 3DTVA 4OQNA 1SUCA 1NT2A 1WP9A 1H94A 3QBTA 1KJYA 1GVNB 1JEDA 1QDLB 3R3ZA 2ZRBA 3CCCA 1Q12A 1NBME 5TPWA 3Q7QA 4IFEA 4AKEA 1XAHA 2P9CA 4DMUB 4Q93A 3IIJA 1AZTA 3SLGA 3DL2A 1CUAA 1FP2A 2VH1A 3O7MA 1B2RA 1G20E 2VJCA 4N0DA 1N1MA 3D2AA 4OXXA 4CYMA 5BVHB 1K89A 2VRCD 4TTAA 1KAHA 4LI0A 2QOEA 4L51A 3T1HB 1E1CB 4QBGB 4MARA 2BPOA 1AQ6A 4IVPA 3SIWA 2V5VA 3ASYA 3GC6A 1TFRA 3A3OA 2F1KA 4MRRA 4HWPA 1RI3A 3N7AA 4LXXA 4TVSA 4FBMA 4QBKA 4TV9A 4Z99A 1W5BA 2EFEB 1PZMA 2YJ4A 3ZVMA 3SLKA 5IAKA 4B73A 1D2EA 2IELA 4P9NA 5DI3B 3RYIA 3G5LA 2VJMB 3HXKA 3QE0A 1R4NB 1SXIA 2FU5C 3QPUA 4INZA 2V3WA 3QG1A 4JJ8A 4BDTA 1Y6ZA 1KDTA 1NDUA 4A82A 4W6ZA 4E5MA 4EI9A 5KNBH 3AYXB 3LPAA 4KL8S 5JJIA 3OQ1A 2R1UA 5F2EA 2GXSA 5E9WA 3WMFA 4BVEA 4TVKA 4CLXA 2A0FA 2ZANA 1EAYA 3LLUA 2VVTA 4NBNA 3UUFA 1PWXA 1HNNA 3BEDA 7ABPA 3KVYA 2M6KA 1RMYA 4D92A 1XX6A 3TW0A 3DXFA 4ID9A 1YBFA 2WU8A 3MMZA 4HEA6 4I50B 4MUBA 1UOEA 2D5BA 5LLSA 1IXZA 2YS7A 1UPUA 4B3DA 1DAIA 4HATA 1VFNA 1N3YA 1EM8A 1R6VA 4HH0A 4R0MA 2C88A 2ZDQA 5C53B 2WE8A 1E3WA 3PQ3A 4D3XA 3U48A 3FHTA 1IPHA 3O1LA 2V4MA 4RSGA 5DYIA 1QDEA 1Q6ZA 1R9JA 1V26A 3PRYA 2C96A 4NMXB 5TQ0B 1GEGA 1ECCA 4ZEOA 4EARA 3HY4A 4AZ3B 3OFND 5D51S 1WUJS 1DDOA 2GR9A 2VEOA 1MV5A 3A1SA 3NETA 5ARDA 2YV3A 4DA0A 1V11B 4YMSA 1XXHA 3KIPA 1J24A 4Q3DA 4CM9A 4L0DA 5AH0A 3LC7O 5HOEA 1OJLA 3DP7A 2C1ZA 5HBGA 1JJBA 1F51E 2BFNA 1AB5A 1IWOA 2H65A 3E7DA 3KLMX 5DTJA 4HWKA 4RZSA 3RQSA 5TC4A 4OU5A 5JSZA 3PGVA 4IO1A 3O38A 4HTFB 3R7NA 3N28A 5B4UA 1N33B 4OQQA 4EJFA 5AM4A 5C1DA 4QDZA 1GHTA 4C3UA 3LTNC 1JEYA 1C4OA 3CNOA 4JLVA 3A9WA 1OH7A 4BYGA 2QN8A 1TF7A 4ZJYA 1RKXA 5LMUB 1V8OA 2EYUA 1GUDA 1PFKA 2M32A 4NLLA 5EHQA 2GCOA 3LG2A 3HJNA 9MHTA 1IHYA 3ABIA 2VN8A 4AFNA 4PHGA 1HFJA 3FWPA 1Y3HA 3HP7A 1XHLA 2ZP1A 2A2ZA 3WO0A 2YOGA 4CKYA 4DT1B 3RNLA 1PCXA 3QMMA 4H6XA 4DIUA 4M9QA 4EUSA 3GLVA 3U09A 2V7UA 3UCFA 1JP7A 4GEKA 4JXKA 3NXSA 4TXMA 1U7TA 2XADA 5ALTA 2HHJA 3JWEA 3T1YB 2VRBA 3I3OA 4FN5A 1I33A 2JGEA 2ORWA 4JGIA 4PLHA 4QODA 5DASA 4ZOQI 4OX9Y 3L9XA 5E6RA 4XYBA 1V7PC 2W22A 3A25A 1BAPA 3D0KA 5CNJA 5EJ4A 1MC8A 2OK8A 4DQDA 3RSQA 1CB0A 4H6WA 2XD9A 3I5AA 4IUBS 4BRZA 5K4GA 4F97A 3LBFA 2CMKA 4FSXA 1XTSA 3CLUC 2QTWB 2JARA 2J48A 1R18A 1CJKC 2GPAA 1XQ6A 4BFZA 4XWOA 4WA7A 4RCZA 5KNCA 5GQSA 1ZD3A 2A7QA 1R0XA 3A6KA 3BMOA 5ESWA 4BMZA 5BSGA 3PX2A 3TEJA 2ASVA 1A5TA 3QOFA 2NSLA 2Q2OA 2R84A 3D0OA 4OO3A 1TUIA 1QDUA 4O2AF 5DO9A 1FFXA 1PGNA 1JHMA 2AFHE 2VBCA 3L6DA 3D3EA 2Z95A 4UHDA 5TXGA 4BFUA 3EPPA 5D3MA 2P35A 2QVZX 1XN1A 1N9ZA 1WMFA 4H27A 1TTHA 3D4BA 3DZGA 3P2MA 3WXBA 4D4MA 4AG5A 4C04A 5EKSA 2C5LA 5AXBA 1N6KA 4BIIA 2GEDA 1ORDA 2NNWB 1JG4A 1BOFA 1PVDA 2WJPA 2YVQA 1A2BA 3CJQA 4FK8A 5HRCA 2PUDA 5A62A 3M5WA 1XELA 2HGZA 1ZLYA 3SGLA 2ATCA 1P45A 5HG0A 2FN4A 5HEKA 5DHSA 5B58C 4AP6A 1O1YA 3PIDA 2WT8A 1N5KA 4LSWA 4FNOA 1E9FA 3U0BA 3RV4A 4AJ2A 3DB1A 1PNQA 3OJFA 3R0IA 5HQJA 1YUNA 3F7NA 5FP0A 4BZPA 1ZCBA 2WD8A 4Y7CA 1E32A 1OBHA 2W8BA 3DFMA 3JQAA 4GXQA 5D3ZA 5D84A 2DB3A 3IUQA 1EB9A 1NA5A 4DG5A 4Y2QA 1RP1A 3LHSA 4FHFA 1LQUA 3DR5A 5GJVC 1A4IA 1QGDA 1W96A 4J0JA 3RGGA 2QE6A 1XTZA 3ANSA 4Z3OA 1X7XA 1P1FA 4KGDA 3J7AC 4A92A 1Q7RA 4G41A 1II8B 1WXXA 2JHCA 3BXHA 3W4KA 2NZ2A 5F21A 1W85A 3OPNA 5CAEB 5DNDA 1AO0A 4GYYA 4ZAVA 1HK7A 1NC3A 2JEYA 3Q9NA 4S1WA 2ANCA 5AICA 2UZIR 2COKA 1BYIA 2PLFA 3MGKA 3R5HA 4XDYA 3R76A 4DLKA 3SX0A 5JANA 2FRVA 3GEDA 3IOMA 5M29A 2XLBA 4QDTA 1V1RA 2W37A 4S35A 4WOBA 4Y6RA 1CHDA 1R66A 4Y2PA 4FGZA 1WO8A 2JH9A 5F51A 3OJXA 4OI0A 2JLSA 1C3VA 2FH5B 1ZK2A 1ZN9A 3I6BA 1XYVA 2PSSA 3LXMA 4BP8A 3LUBA 1VPLA 1DELA 4R1OA 5AKYA 4ZQHA 3UXEA 4JX9A 3E9NA 2YIJA 4C4RA 4BE7B 1SQGA 3LYUA 4L4YA 1BWRA 3HNPA 3MIZA 2OSBA 5DK6A 4EHNA 4WBNF 2MMCA 3OZRA 2R6JA 1USUA 1H0HA 1QIIA 1XZGA 4YN3A 3ZR4B 1KY2A 1QHNA 1WXEA 2GPBA 3DOIA 2P6NA 3MJFA 2NYVA 4JVMA 4OM8A 4RPIA 5DOVA 1QH9A 5LZ7A 1Z17A 2X2EA 2NU7A 4KQ1A 1IBCA 5AW1A 3I9V6 4BPBA 5JAPA 1YS7A 1B41A 4Y6QA 3PD7A 2YNMC 3K5HA 1IUKA 4B43A 3ED1A 4ZT5A 3S4YA 1K7YA 2KBEA 2DQSA 5GY7A 5I7VA 3CBGA 1VSVA 1NVDA 2AOWA 3FNGA 2DHQA 1G8KA 4DL9A 1K6XA 3I76A 3U81A 5AW7A 1X7ZA 4IDHA 3MTBA 2VSYA 1FJ2A 3LIPA 2E4WA 3N2YA 5DHAA 5IYZF 2A58A 1Z0AA 1DBWA 4MW9A 3ZNQA 1T3TA 3I0NA 4CM8B 3ABOB 1XVVA 2FJ0A 4ZANA 4F45A 1HT3A 2PUAA 1DRJA 1JFFA 2Z3WA 1UZNA 4MAMA 2VTDA 3QTTA 1LPNA 4N0QA 1QWOA 3RVPA 3ND8A 1Z4KA 4PN7A 5A4JA 5DMXA 1QHFA 1CUUA 4RESA 3L49A 3LBIA 3EIQA 3FDIA 2ZJZA 4LUCA 1QS0A 4BUCA 4U3JB 1UK7A 1T2AA 1KFJB 1ZD2P 2IHTA 3MGBA 3GG9A 3N53A 4X7BA 4X7PA 2BBWA 4RD3A 3K6RA 3RUIA 5EIEA 4FM9A 2IW3A 4P86A 3D5QA 2IOQA 3IL2A 1RE0A 1WNTA 1KI4A 3W34A 4I46A 1B8NA 2EP8A 4RLSA 2GJSA 2V58A 2Q9AA 4J9UE 4TYQA 4MRNA 1K8ZB 4AZVA 4WLUA 3RTDA 2R47A 3V34A 2TSYB 3F74A 4YQZA 1WTCA 4R1LA 4D6YA 1APBA 1N1GA 4XRRA 4ZAXA 4OHZA 2AQIA 1ZJ6A 1T0BA 1YFLA 4NCAA 2FW1A 4L4XA 1PWHA 1EVQA 2FZLA 1FTSA 3I0MA 1F0NA 1ODIA 2P9QA 3PUZA 1GQOA 1DAGA 1GSIA 1PRYA 2V98A 3A4YA 4TXNA 5UKDA 3RT7A 2AKEA 2ZR0A 1BEUB 5BSKA 4IHJB 1B3RA 1W5FA 2HMAA 4MWSA 3TINA 2XW6A 5EIOA 2EFHB 2JD1A 2GM3A 3GDGA 1JS1X 4YONB 1V8PA 5AVJA 1Z12A 3VR6D 2HA3A 3BB3A 4NBUA 1W4BA 2JFZA 2FPGB 3A0RB 4YQFA 4HGYA 1RDFA 3LDGA 5K0CA 5AOCA 2IZ7A 4JLDA 4KOAA 3K0AB 3UK0A 2FSHA 5CYGA 2ZWVA 3KZCA 2VG8A 4L3OA 1QBKC 2JIZD 1PD0A 2N1MA 1EDDA 2YC4C 1J33A 4L0MA 5AKZA 3DA8A 1ZG3A 4WZZA 5B4TA 1U0OC 5LQRA 1VPWA 3K70B 1G21A 2QQFA 4QIHA 3DAHA 5FAXA 4BEWA 2J0QA 4GKBA 3JZDA 2PKCA 4MGEA 4EMBA 3F4BA 6ADHA 3AY3A 4GF5A 3GCWA 3KS9A 3VXKA 2C9YA 1P4SA 1SCAA 5E0OA 4INJA 2DTXA 4OF4A 1HEUA 3KK0A 1GUYA 1R6BX 2GVNA 4MP6A 4HKTA 3H9BA 3G6KA 3TBHA 4F9GA 1VIDA 2GB4A 3ZHRA 1NU8A 5THQA 1Y1QA 3CVWA 3HGTA 4GFDA 4MS3B 3T7RA 4AZ0B 1QTQA 4YRKA 1W36C 1EHYA 3R8FA 1Z74A 3OTGA 2QTMA 1GKIA 1X1DA 1NW3A 3QEMB 4C03A 1UBSB 1EJBA 3LVBA 1TCUA 4HQKA 2X1HA 5JCJD 2B20A 4GIBA 2D5CA 3C3AA 4ZI7A 1X15A 2J9FA 1AX9A 3I12A 3VO2A 4DB4A 3S68A 1U7UA 3UG6A 1TZCA 4IX9A 5CG2A 4NS4A 4R7ZA 1SY7A 1TK2A 4K9OA 3IP1A 2BH9A 4GRDA 2HT6A 2ONYA 2GUWA 4GPEA 4UKDA 3RS2A 2WIDA 1GQSA 1WTAA 4Q4JB 2VH5R 3WJ2A 3DBLA 2Y93A 2DWQA 1AKQA 2V74B 2F8SA 2A14A 2ZOSA 1C9KA 1MEOA 4JUAA 2L18A 1OBOA 4DS3A 4X1KA 1DQRA 3VV2A 2C3OA 5BOSB 1IJFA 2IOHA 3H11A 2JBAA 4ALLA 1TJPB 3R5XA 1F38A 3O1JC 3ADOA 3TNLA 1LEHA 2CZQA 2GMWA 3B7GA 5AHKA 1ZRMA 3KV3O 1YQDA 2YNMA 4BLRA 1D6JA 1RLOA 2HSDA 1IM8A 4R68A 3DNFA 1SXJD 2X86A 4F4DA 2IKQA 4AN4A 3MT9A 3ONEA 3PP8A 3I23A 4HAYA 4YROA 3TR5A 1G7RA 2JIDA 4WQMA 4B4DA 1EWRA 2ZVPX 5TIIA 2QBYB 4OXKA 2I6TA 3IEUA 3ORHA 3KZKA 3O4HA 3ZWOA 4H4EA 3WMGA 3AVWA 1FXUA 1OLUB 2AR7A 3B2EA 1NJ6A 3C2QA 3QIAA 521PA 2H92A 1UKEA 3TTWA 4KWIA 1DRKA 1G5QA 3DBOB 4F6RA 4BNYA 2ZR7A 2YIDA 3TIIA 1AF7A 1W75A 1U02A 721PA 3CWCA 2HF2A 3RPEA 4ZTUB 1Q19A 2PKYX 4NZOA 3RHZA 3KYCB 3OZAA 2RGCA 3CNNA 3Q1LA 4LPKA 1EFTA 1TQ6A 1OWOA 1U1CA 2YQZA 3DBIA 3GFRA 1BGWA 5K4AA 3TH5A 1OZHA 2BMJA 4ZVQA 1GQ2A 4RJ2A 4DWOA 1XNHA 4E03A 4ZCMA 5T7BA 1NJ1A 1AB6A 3MLEA 1NF9A 1ONSA 2NMVA 4WERA 5FULA 4OH1A 3CLTD 4DCNA 3WV5A 4DLWA 4MDFA 2QZPA 1Q91A 3B6ZA 1KXZA 1B16A 1WD5A 1Z15A 4BMSA 2XUFA 5F7ZA 1FYEA 3A3PA 4KLRA 1QJCA 4L76A 4U63A 5C1IA 2O7SA 5IDQA 1UP4A 2QROA 2XQIA 1CJVC 4A8JC 1STOA 4ZZ0A 1ZH8A 1UK9A 1SKYE 1T9CA 3Q7SA 2YMPA 3AB7A 4DDKA 2N9UA 5CDSA 4L5BA 2GA8A 1WOYA 3OP1A 1EXMA 5SY4A 4PGGA 4C30A 2R6CA 1M6YA 3A7EA 4WZAA 2YQ5A 3TQRA 1KI9A 2BE7A 2FX2A 2JIMA 1M2VA 2MIIA 1SD2A 3OT1A 4JI3B 4BO4A 3I5XA 3V8EA 3VJRA 2QD1A 3ABQB 4HDAA 3SAJA 3THWA 3I05A 3OCWA 3OO1A 4I3GA 4PLCA 3DVLA 5HRUA 2HX1A 1S9DA 2XNCA 3DOCA 1QBGA 4RZ3A 5AXAA 4E08A 3IQGX 1I4EB 1Z6QA 2P9TA 2WUWE 2ZSKA 1NZDA 5LR6A 2BDTA 4L0CA 4Y2TA 2V8BA 4PYKA 3BKXA 1J0XO 3AVVA 1E79D 3KR2A 5IP5A 1U3CA 4LNAA 1PNOA 1TJ3A 5JSYA 3H16A 3IP5A 1UAAA 5KTTA 2EF1A 3D8RA 2BM8A 4FFWA 3SC4A 2IZOA 1KIFA 1UK6A 1YQUA 2Q2WA 3AHIA 3E0QA 4GP6A 3LO8A 3LHKA 3PZBA 3M4JA 3A70A 1XTPA 1KDOA 1H2HA 2MR5A 1NN1A 1K06A 5ELXA 2VAPA 3EAGA 3KKQA 2P2CA 3H8JA 2Q4OA 3ABRB 3LLCA 1PDOA 4GR5A 4MYHA 4R5MA 4W99A 2C2KA 3FFBA 4I5GA 3MSCA 3T35A 4DCJA 5AKGA 2GRJA 5I9SA 4DZZA 2GXUA 2QL7A 1EBBA 5H4GA 3L4JA 1YDWA 1RRVA 2A9JA 2WJ6A 3F9RA 1MB0A 4L9AA 5T57A 1SCKA 2VK1A 4Y0VA 4A2CA 3DE2X 5DSZA 2DZDA 4PLZA 3QV1A 5HPYB 4OYRA 1H42A 1UBFA 3B1ZA 2IIBA 3KLBA 3KZVA 3L8ZA 3NBMA 3A1UA 3OZWA 1QG0A 1U8ZA 1OILA 1ZA1A 4MLDA 4X1IB 4CIAA 3F5QA 4RV5A 2K5UA 2WSBA 3OI7A 4UXIA 1G4UR 3SF0A 3IUNA 1ZM2A 1AS3A 5J2TB 1SXQA 1L3BA 1NJGA 2H9YA 3FUTA 4C6SA 3G0DA 1N7HA 3X1DA 1QV7A 3WA6A 2C78A 2WOJA 4GX2A 5KNBD 2B1IA 2XQJA 3HWX1 1IN4A 1U31A 2CLSA 4H1TA 3DT9A 4KC0A 4YECA 5K01A 4RZQA 2B4AA 1UBUS 1KC3A 1B15A 3A6DA 1PR0A 3BH6A 2BF4A 4P82A 2QYTA 3PGLA 3R3SA 2Q9UA 1VLVA 4A10A 4PY2A 1ZJJA 3DYVA 1K6JA 4TLMB 4J3FA 1JFTA 1GTVA 2OPHA 1G5RA 5GM1A 4OI1A 1H0RA 1Y9DA 3UJ7A 4AT1A 4FYPA 1QGUA 3DZHA 4J7CA 2CZGA 3EPJA 1V2HE 2CW5A 2PUBA 1V3TA 1VHTA 3GFSA 4Q15A 3D02A 1U0TA 2PFSA 4DNPA 1CTQA 3VNVA 2NU9A 3GMTA 3MHPA 2C7QA 3GAZA 1QCYA 3RODA 4MW2A 1MOSA 4WLNA 2CF5A 2IEAA 1JHOA 5AKEA 5ER6A 2EFJA 4U2GA 1P7YA 4B85A 3FDJA 1TO2E 4F8EA 2Z9DA 3V1KA 2C8LA 3GJRA 3O4JA 1A96A 4BZZA 5C8YF 2CE2X 3DTVB 5L40A 1TKAA 2DFVA 1JWLA 1FFBA 4H7JA 3EOBI 2EDCA 5TPWB 4QKQA 5DTMA 4NWIA 1FMTA 2VKQA 4PV7A 5FBRB 3W6UA 2P3QA 1I5RA 1WBDA 2WAMA 1QQ5A 1TNDA 3CLKA 1GPNA 1L9KA 4IHQA 4MW6A 3RSLA 1GSAA 4UXJA 3NATA 3ADCA 1NR7A 2MWMA 1NW4A 1RXEA 4G5XA 1ADGA 3RQIA 4V1CI 3II6X 5JAMA 1H1DA 1RLTA 2NZVG 3TQSA 1LK5A 5ABPA 1WKCA 2PT7A 4JWTA 3GB9A 4I4TF 4FXOA 4MWGA 3CBQA 5LKAA 5FA8A 3ROZA 2GSWA 4A8JA 3CMCO 1R6DA 3BGWA 4I55A 3LYAA 2XKBA 1YVPA 1YQQA 1OXKB 4G0XA 1KAGA 3RS4A 2G1JA 4N0PA 3GGSA 3E35A 1DO0A 2HN9A 3A1FA 3CM0A 2AUNA 3RYIB 4BGVA 1OI4A 5WRFA 4NOJA 2Y05A 3X43A 2ZWPA 3EVBA 4QGGA 4RLFA 5EESA 3ZQJA 2PIAA 2VO1A 3ANMA 4L9RA 4Q3NA 3G9UA 1FK8A 1GKYA 1QLHA 2KI5A 3IIKA 4GPAA 4P7JA 2D3WA 4YAEA 2O3QA 1E2JA 2HPVA 4D8WA 3VTAA 1HE3A 5HJ5A 1D2CA 1LWOA 1OLOA 3EDYA 3QM1A 4FD2A 1RRFA 4LTMA 4XKJA 2BHNA 5JPCA 2ZWMA 3NT5A 4G1UC 4CL3A 1ZVMA 2YZ7A 1Y37A 3PUIA 1Z6PA 3U2QA 5E9JA 1A2QA 3MRSA 1KZ1A 1OZFA 5AXCA 1RJGA 1JQLB 3N7TA 5K03A 2Q4EA 3PENA 3L0ZA 5F7OA 4BAGA 4B0OA 3C5CA 3BYZA 2BJVA 5I4BA 1IWBB 1QO9A 3IJ5A 3UAOA 2B5WA 3BQMB 3ND7A 3L4KA 5EE3A 1EM8B 1BVUA 4G5RA 3HI6A 5HF8A 3TXAA 1DWUA 2OAQ1 2F7SA 4WECA 3TLKA 1E3WB 5A7GA 3LCMA 3MB5A 2DLCX 3N6RA 4OK6A 2C5GA 4D1YA 5IBPA 2HJ9A 4B32A 1Q77A 1LSSA 4HGRA 3GN1A 2ZJ5A 3ZWMA 2VXOA 4RMIA 2LCFA 1WSBA 1OA0A 2BMDA 3STTA 1R4MA 4LXUA 1FU4A 1R0KA 1XXHB 1LC0A 2FMTA 4XX1A 3ICWA 2QX6A 1I80A 5CJJA 1EHIA 1Z4MA 3S2EA 4TL8A 4K6OA 3KP1A 1BA3A 1GQRA 3IKLA 3IIMA 821PA 1R0RE 3KKEA 3OEWA 2H0AA 4FGUA 3VH2A 5JSZB 1ONOA 5EJ7A 4D8YA 3EWAA 1UOPA 2G4LA 1QHXA 2QTLA 4H18A 3PNSA 1K68A 3IQZA 1AN9A 5F12A 3KZXA 4C7KA 2IX3A 2CT8A 3C8DA 1J6UA 4YJ3B 5A5VA 1PT7A 2RC6A 2Y4OA 4NBSA 1D4OA 1WD7A 4ITUA 4NEGA 2GCOB 1EWVA 3G59A 2ICAA 1DKUA 2Q3LA 3EG9A 4HMQA 2ZGVA 4MCHA 4WXRA 4Z8XA 3U3ZA 4EO4A 3MGCA 2R4UA 1EQ2A 1RRMA 2BGNA 2PX0A 2YJ3A 3B20A 3M5DA 4FI3C 4W7HA 5KDDA 1T26A 2O3JA 4RHUA 4FGSA 3C3EA 4RZIA 1N34B 2XSZD 5H80A 1JR3D 1IN6A 2WEKA 3P4UA 2JI6A 4HQLA 2VNHA 5EL0A 3V8RA 2XVYA 5DNYB 5BN4B 2ZAIA 2HHAA 2R25B 2XMBA 3EGIA 4Z54A 3OM8A 2JJYA 4NARA 3TQTA 2Q4TA 5J5CA 2RSLA 2IEZA 3AR6A 5ISMA 5EWLA 4DCUA 5E6RB 3P1JA 3UTCA 5KTYA 3KKMA 3NC4A 4LOKA 2D1YA 2WM3A 3QE2A 1OXBB 4IDBA 1A9TA 3GNLA 1V7QA 4EUKA 3FSRA 1G4HA 1HZJA 1UDXA 4M9ZA 1PNRA 3D3JA 1RC0A 1X2EA 4CEIA 1F0YA 4Q4LA 4GOXA 4XGNA 5H68A 5K8JB 3BMOB 4Y8VA 1AXGA 1Y3FE 5HKLA 5B55A 5HA5A 1NXQA 5MGBA 5BSWA 5K6RA 4U02A 1ZN2A 3PC4A 2FPWA 4ZVUA 4NENB 5FUWA 5IC5A 4YK7A 1OWLA 3RBZA 1FFXB 1ORHA 1W6UA 2O23A 3A31A 3CH7A 4NYMR 1EP2B 1WEKA 2G40A 4ZHQA 5B5SA 2YFQA 5G2OA 1NBAA 1ZHFA 2GZHA 4LDQA 5D3MB 4MKXA 4B3IA 3DMPA 1JBQA 2KE5A 1A7UA 2KMLA 2H2HA 1JLRA 3BHMA 3G89A 2IBTA 4I3HA 2IBMA 3PNBA 1H9BA 3PHBE 4CWAA 2B9VA 3I52A 4DGSA 4JP2A 4CLRA 1V5IA 1MUUA 1Q7BA 3OQJA 1Z7EA 4LQ4A 4Z7QB 3KQYA 3HMQA 2QMYA 4BVBA 1BMFD 4OHOA 4YAIA 2O59A 4LDRA 1E60A 5F7XA 1DC5A 1DS6A 4FZ3A 4YRLA 1L7DA 4FGKA 3IAM1 4IEFB 5SZIA 2GOYA 3FWYA 4BE9A 3QI7A 2WSIA 1IHXA 3ZLJA 3DO6A 2A3NA 1RVV1 5KWEA 1SU4A 3BIOA 2W8BB 3JQAB 4JGBA 2AKAB 1KO8A 1OQAA 1GARA 5CEFA 2VYFA 1EIWA 2CSUA 3CSDA 3HCAA 3P5SA 5G4LA 3IVMA 2AQ8A 3SQNA 1HI9A 1F8YA 3WIDA 1DBPA 4ZEMA 5C18A 4KPEC 2NZJA 2ZIGA 2W0MA 1GDTA 4IX1A 4R8MA 1KAEA 1U3GA 3U4IA 1FNSA 1FS5A 2Q62A 3W7AA 1NNSA 1X7XB 4O4JF 3C0KA 4I3FA 4HBZA 4YIHA 5F1OA 3M9XA 3HNOA 2N75A 2VYNA 2H5JA 3GW8A 4YYZA 4ND4A 1PJZA 2REXB 3LHIA 2BMAA 2Z5LA 4MYUA 4HGZA 5AHRA 3VDQA 4AMGA 4BU1A 3EEYA 5HZHA 5JZMA 1ORTA 2R8XA 4YJGB 1QG6A 2NXJA 5KCMA 3RVJA 2JHPA 1HRDA 2G82A 5FNZA 4Q9HA 2WYWA 3E7WA 1UT5A 4ES6A 3VPSA 4UREA 5KSWB 2VC2B 3AM5A 3TDKA 2K2WA 1V1RB 4FCCA 4TWJA 4P53A 4HYEA 1PR4A 1VJDA 3LWZA 1U80A 3HWRA 3RS3A 2SKDA 4MVJF 3WBBA 1T25A 1CVRA 3ZDQA 1K9VF 2RGDA 1JAIA 2VNKA 4IIEA 1OFUX 4OA8A 3UHJA 1PT5A 1RYZA 4IF4A 4K6CA 3VI3B 3P9QA 1RAGA 2GQ0A 3B5EA 5AO9A 2CBZA 4JNCA 1JLKA 3QU9A 4P2BA 5L3VA 4YCCA 3GQVA 2BM0A 2GASA 1QFJA 2QRZA 3UHAA 5CA1F 2DT8A 4MGZR 1T9AA 1QF6A 1W2WB 3G8YA 4J9VA 3R7DA 3JYOA 2P2GA 3V8PA 1KO1A 1T5DX 3HFSA 3LQRA 5HIKA 2NU7B 5IFKA 3EX7C 5ESRA 3KJNA 5IJ0A 3GUHA 1F4PA 1PVVA 4IP0A 1MMFB 1CEYA 4N7MA 2DFLA 2V7BA 3QVKA 4LY0A 3IT3A 5B36A 1KDRA 2JVKA 5L45A 3W05A 4CCSA 3O3MB 1MV8A 1GRQA 1ZAKA 4DLRA 2ZS7A 4L15A 2ZRIA 4L72A 1T9HA 1U4SA 3AT1A 3G2MA 3W6ZA 3L7YA 1X7ZB 4X91A 1I6MA 1UR5A 2JCVA 1CJBA 1VBMA 2OT3B 3NC1C 2V7QA 5FV7A 4C4TA 4K9SA 3S55A 2V7WA 5REQA 3UPTA 3IEXA 3SWWA 1M8KA 3JWIA 5EUQB 2OESA 2WV9A 4EAQA 1QZ3A 4YDHB 1G9TA 4NBWA 3QG5A 1JFFB 1RKUA 2ECFA 4WWHA 1TQHA 4GO1A 3L8HA 1GRRA 1L5YA 3OZSA 3K5WA 2VPTA 3KYBA 3TUJC 4IV8A 3TNFA 1DXYA 5JNUA 1DLIA 3NANA 4GGPA 4TKLA 3MBKA 1EXVA 5KKNB 1ZSVA 4FMBB 3ZIDA 3ENWA 2V6IA 1LI7A 4PONA 2BZSA 4MW7A 1RKVA 1T9ZA 2GEJA 3FR8A 4HUJA 4QZVA 3SQWA 2A35A 1E8NA 1KPGA 5D00A 1R2QA 3VVMA 4H16A 4M9SA 3U26A 4JYZA 2GO1A 5TPZD 3K9GA 2CJWA 2YRXA 1BOOA 4MS4A 3IRUA 1YJBA 3N7UA 3G1WA 2BTQA 2EEPA 1X7DA 2QRMA 2W2XA 2VP3A 4OQXA 2W4IA 2CXXA 4UU7A 3U0VA 1MOZA 3R09A 1EA5A 3E1SA 1WUYA 2QRUA 4QEZA 4KE8A 5E6UB 3T5GA 3ZV5A 1ZDMA 5KTOA 4KNWA 3WSVA 4O4LF 5ALHA 1BG6A 2JJ1A 1ESNA 1I32A 1WDMA 4FDLA 2C95A 1JLMA 1V7ZA 2BR4A 5DCWA 1G2PA 3KC2A 4JDPA 2Q41A 4YALA 1P1HA 4URYR 2XD4A 2ZJBA 2P77A 3M4NA 4C22A 4V1CB 3BWVA 1YACA 4HO1X 4CEJA 3ZDXB 1N5LA 1XTBA 1ZYUA 5BR8B 3EGEA 3C3DA 3S8YA 1LSUA 1QH0A 2QAGC 2FF5A 5FUMA 2BY4A 3U7FB 3TD9A 1EK2A 1KPIA 1D8AA 4U7WA 1N4AA 4DOMA 1VIAA 4EFDA 4Z4QA 4DIKA 1MT0A 3K4QA 2QSJA 2I4IA 5DVZA 1NLMA 3E23A 1SK9A 2QTCA 2GPYA 2C5SA 3DFZA 3HG7A 4IDCA 4DIEA 3AIIA 3VYUB 3TS1A 2FQWA 3AR3A 4PZEA 5ALSA 3SC2B 1XK6A 3Q85A 2PL1A 4YFYA 4B8WA 4HADA 3VYSB 2CV0A 4UTOA 1JI0A 3DGEC 4KN9S 3WGNA 1OLXA 3K9FC 1YZGA 4CUKA 5I4KA 1TAQA 4EEZA 3CB2A 2PRZA 4MV8A 1UP6A 4Y2GA 1A9ZA 3UB2A 4LJSA 5DT2A 5C8XA 1QORA 1DJQA 2FF7A 3P9XA 5DHTA 1OVGA 2VQ3A 2W43A 1P6QA 3HEAA 3WTBA 4LF7B 1P8AA 2R9VA 4NOMA 4D0SA 4OB7A 3TEFA 3QY9A 1NVGA 2O7VA 1E1RA 2RGWA 3BWBA 4WJZA 1X13A 3X1JA 1P19A 4KWEA 5C1OA 4OXQA 5LMNB 4TM8A 4IMJB 2OFOA 2H9AA 4PSVA 2DHDA 2QF7A 3B78A 4C7MA 2GT1A 1M1UA 4DY4A 1TYDE 2ODNA 5T4HA 1Y7TA 3N76A 3RBXA 3H2ZA 5CHYA 3SEZA 4BAUA 4R71A 1J20A 1DIAA 2Y77A 2V4ZA 3CPEA 4D5GA 4ISCA 1GNPA 2HXYA 3LGXA 2JAQA 2J9FB 4L4SA 4NZZA 4ZI7B 1M2GA 2AG5A 2OQIA 4HRYA 3V32A 2HC9A 3ERCA 2HA0A 5CT5A 4UAJA 2C4VA 2YL2A 2WNIA 3R7AA 3G2HA 2F2TA 3VOSA 4DSNA 1L4UA 3FIUA 3V2HA 3DBLB 3FFTA 4GZ5A 5CFPA 2N46A 4YRZA 2AYXA 2IITA 4OQFA 3TSYA 1QLWA 2IH2A 4LWZA 1TVKB 1ZISA 2C2WA 2F90A 1XTKA 4X1KB 3VVCA 4BKOA 4DC0A 5A4MS 2CBGA 2ZYSA 4E07A 5JYDA 4EI8A 3H11B 2JBAB 3GJ4A 2P68A 4RTMA 1P4GA 3L8GA 2BFEA 6Q21A 5I7HA 3UW1A 3ESYA 3IP9A 4LJ4A 4KK3A 1A71A 2ZE5A 3REOA 1MNAA 3QBVA 5AI9A 4ER0A 2BF7A 3RVLA 4IGKA 4MINA 1SCNE 1XV5A 2Q6OA 2W2VA 3IYLW 5HCUA 1DAMA 1JEQA 1KVQA 2LCIA 3FTDA 3T1VA 3V3TA 8ATCA 2WZCA 5KS2A 1XMJA 2TMYA 2XECA 3AUSA 2PT9A 1BD3A 3MRTA 1JSZA 2L82A 3HTXA 3DF7A 1KKMA 3GRYA 1RXCA 3ANNA 2O4UX 4OQYA 1ZJ4A 3F5FA 3JZMA 4J49A 3EVEA 4IS3A 2XWSA 3I92A 3NAZA 1W5TA 2XTJA 4F6RB 5I48A 4UEWA 1K27A 5A06A 2P3OA 3U80A 4JEMA 3JASA 1REQA 2Y0DA 2DMRA 2VDLB 3HKDA 5AJTA 3E03A 2H4XA 3PHCA 2FP4A 1NAIA 3BF8A 3FNFA 2G08A 2GLXA 3C41J 3N0TA 4KE6A 3HWWA 4OHKA 3ZWYA 4DLXA 3QLJA 4LJLA 4GYJA 1NJ2A 1NVUQ 5K3AA 5ALMA 1QK5A 1CRWG 5IW8A 3SG0A 2V0NA 3U4HA 2EZUA 1Y48E 1V5EA 3RVRA 4C0XA 5IF3A 1B4DA 3CHYA 1YZUA 5P8WA 5HCIA 3W06A 4NK5A 4GPIB 2HFJA 2IYUA 3VR4H 2WD9A 2JLYA 3JYPA 5LWQA 1N2SA 3ZD8A 1G8YA 4BLUA 5A4AA 3UGQA 2BFDA 4IJQA 4NV3A 1IZ7A 4RD4A 5AVRA 1KRWA 3UK1A 2PGXA 1P33A 3SBEA 1PNTA 5C35A 4FVTA 3KR1A 4PRYA 2IYXA 4MJ7A 4DR1B 4KMRA 4R3UC 1XFDA 1IJKA 4QSHA 2JIRA 4Y6PA 1IQRA 4CCAA 3F6EX 1SKAA 5KVAA 5EYPA 1VPVA 1FZQA 1ADFA 2IE8A 2JB9A 4WZAB 1J22A 4N3NA 1D2RA 3QVMA 1M2VB 4EGFA 1U6JA 3FZNA 3OT1B 1A9XA 4OQDA 1J7KA 5AI5A 4LRXA 3THWB 2OYSA 3FUUA 2QAGA 5ECDA 5EHNA 3LUHA 2UYCA 5GOTA 1LK7A 1PG2A 5IKMA 2QYOA 1NVWQ 2QTAA 4XDZA 4OFWA 3EYWA 4RORA 5IJXA 4CRWB 3SHFA 1VCMA 4LECA 3L0IB 1QOZA 3IKTA 2BKXA 1RWPA 4QRIA 1RYYA 2IOFA 2I4OA 2P2YA 4XWGA 5FBLB 1WMEA 3KSBC 2PDAA 1VMDA 1SHZA 1X8JA 1SWWA 2EU8A 2X0DA 3L5OA 4QXOA 3LT2A 1E5QA 4H31A 4GZ6A 4TKMA 1T9DA 3E9DA 3O82A 4PWYA 3GDFA 4MRAA 1RABA 2C9DA 2HQRA 2ZAGA 3BMXA 5DP1A 4X24A 1TFUA 3TIGA 3F4KA 3RK4A 3U3RA 3P0EA 1DJMA 4XW2A 2VHEA 5J2TA 1KXJA 3CRQA 2VPYA 2C4UA 3LZ6A 4ZI3A 5C52B 4BV3A 4N18A 5LYJB 4IWXA 1UMKA 1BRMA 1P2GA 1Z4IA 2PMDA 2VBGA 3AGPA 1SKQA 1OUMA 4H9GA 5B1HA 3E2PA 1MR3F 1GPDG 2GARA 2PRJA 2OCIA 5DIZA 2Q5JA 5LA6A 2GAIA 3HVKA 3ORRA 3EEIA 4HFMA 3JCZA 1T2VA 4C3VA 3UHFA 3MCTA 2GPWA 4LZJA 4A26A 3AL2A 2J3LA 1M76A 3LQFA 5I3ZA 2D0IA 2W98A 1AE1A 3WMXA 5AVZA 1X92A 2OBYA 4E1AA 1E0DA 2EFGA 3CG4A 1X7YA 1W0JD 5E6SA 3B9PA 4C78A 4ER6A 2CLEB 3AUYA 3C7KA 1P72A 4Q47A 2FMHA 4URVR 3KEOA 4Z0HO 3KD3A 2GK7A 4G8CA 5CG1A 1TE2A 2B34A 2XZTA 1Z4NA 3QKUA 3EGOA 4ID3A 2RHLA 3CRNA 4N82A 5G0VA 2ONJA 2AJLI 4GRIA 1Y0BA 4UD6A 1VXRA 1DJOA 1PK9A 2VHVA 4LRTB 5H7XA 5DLEA 2CFIA 4CFSA 4M76B 3Q3JB 2YY5A 1U8AA 5BWNA 3CZRA 1BTOA 3GROA 2H85A 2TS1A 4JT8A 2I7VA 2CVZA 3T3MB 3CR8A 4GR4A 2E55A 1LBSA 4NPAA 2DFPA 3FWKA 4C4SA 2PBLA 2CNWA 4U5QA 4OGLA 5JD6A 1JUDA 3PEYA 3T8YA 2OHFA 3BQ9A 2RGEA 1OFIA 1CV2A 2AN3A 1CLUA 1QGUB 2V9CA 3OLZA 1CFJA 4OXIA 3B6IA 1B7GO 3T34A 4ZVPA 2AJCA 5ALPA 4UNRA 2GD6A 4X6XA 2R751 2GFQA 2Z5GA 3HYNA 2KHZA 3JV7A 1KI3A 2YZNA 1R0ZA 3E18A 1WV1A 2IT1A 3KJZA 1L4EA 3VOAA 1HETA 5IKXA 5KMGA 1I01A 4IAOA 1WUKS 1EINA 2A1TS 2ANBA 1UM9A 2E37A 3Q7IA 5DEOA 4H2DA 3UV6A 3NUGA 4DF3A 2GK3A 1EX6A 1DZ3A 3SX2A 3I1YA 3NTVA 2OHVA 4KMMA 4FU0A 1KIMA 2VNJA 5D5PA 3ICVA 2UV8A 5EJ2A 5JRJA 3BDAA 3FYSA 3I04M 2AS0A 3QUBA 3IILA 1O87A 4C2AA 4DILA 3KKPA 5ITSA 3QXCA 4G67A 5ER9A 3WLEA 2WHPB 4JCCA 5JTUA 3FLMA 3KSAC 1E5TA 2A5JA 2OZKA 3NM6B 4NOKA 5FOVA 4CJXA 1XZQA 3WGMA 3UXYA 1ML4A 3BXPA 1YDEA 3SJZA 3OLCX 4EGAA 1MO4A 1N7IA 4HRVA 4NE7A 1O5TA 2ERXA 1SIWA 3HN7A 2ZVJA 2F3SA 4A15A 1P0FA 2ZPAA 4WGFA 3T41A 1FJHA 1R6AA 2EHJA 4D9JA 1W581 1Y8QA 2WZDA 3UY4A 4I55B 2PZFA 4A8JB 5TMPA 5FXMA 1GFZA 1FRZA 1RHMA 3ETGA 1SCBA 3CW9A 3Q87B 4A8HA 1LI4A 3WDLA 2P65A 2VKTA 4NZNA 4JC4A 1C1XA 1FVOA 4V3CA 1U0EA 4W9RA 4YIKA 5MN4A 5J1SB 3W2EA 5DNUA 1WB4A 1VJ1A 1MLDA 4MQEA 4PTLA 5IVDA 4ALKA 2J6IA 2WQ7A 1JHDA 2OFPA 3GOHA 2ZRNA 4UUPA 4W1RA 3LZCA 4H35A 2O06A 5CK4A 3SX4A 2HW8A 1IZ8A 2VAXA 3Q3HA 3PWZA 3VJKA 1EXDA 1UL1X 2ZPUA 3RVDA 5CFRA 4GOKA 5IMSA 2PXCA 1T5TA 3IESA 4S24A 5LYYA 3C74A 4D4KA 5GZ3A 1N6OA 5HR5A 5J23A 1JPUA 4H4DA 4NDNE 4RFSA 2RHRA 2QXTA 4GLLA 5KHOC 2BM1A 1XXHE 2XVMA 1N36B 3FYHA 3IJPA 3HACA 2K7ZA 3QOWA 4OMFG 2PKEA 1KJQA 1DRUA 1QOQB 3IAFA 1PWYE 3IO3A 1U0HC 2AYYA 3FCEA 3MW8A 3PBKA 4G5YA 4ERNA 3AIOA 1JFSA 2NVUA 3E84A 1QIHA 2XE7A 2W6JA 5CBKA 4NATA 3EQ8A 1VA4A 3UHOA 2D00A 4B6OA 5IJWA 2Z2JA 1JLLA 3I9KA 1GAXA 1GV0A 5E4JA 4I1RA 4HB4A 3PKIA 4KQ2A 6PFKA 3L0YA 7MDHA 4B3JA 1J8MF 2DU8A 3A1VA 2Z4RA 3VZBA 1NJ5A 4QFCA 1I5OA 3TD2A 5AVOA 5DM70 4WD3A 3ZE8A 3CYFA 1OYYA 2P0YA 4L4ZA 4PSCA 1R4MB 2P67A 1O54A 1MG5A 5ARCA 3A26A 2OP0A 1JSXA 3IPXA 2YXPX 5DYNA 2GI4A 1GRVA 3GBVA 2QNBA 4IXTA 2EGUA 1JGTA 3OKCA 3TZBA 4BX8A 4EMSA 4B71A 4CGZA 2Q8QA 1DJNA 4N3CA 4RM3A 1YB2A 1OGYA 3AFOA 2NPOA 4N6GA 5E7JA 4OLAA 1K3UB 1DHRA 1OXXK 1SMKA 1T2CA 5CXSA 2B94A 2ZS9A 4W5WA 4W1SA 3BTVA 1VG9B 3FCSB 3H04A 2AVNA 1ZIOA 1BROA 1KOFA 2V0CA 4QDUA 4TLEA 4WUVA 5BT8A 3DMDA 2NUPA 1NVEA 3EGXB 1B0AA 3DLTA 2IV7A 4DMKA 3UWOA 2C4HA 3RSCA 3NOOA 3DHVA 3MWYW 3S70A 2CXSA 2AG0A 2ATIA 1D1SA 3IP8A 2EOAA 4YAJA 3QTBA 4FJ1A 3DHNA 4EZIA 4ENRA 5BY2A 3LPCA 1U6IA 1GUAA 2PYDA 1EVJA 1C7RA 1QVAA 4PIVA 1C7JA 3PVCA 3RREA 4UC0A 2VWHA 4M21A 4LEIA 2I6QA 1A4RA 2CD7A 5T67A 1E62A 3H7IA 2P9EA 3LS2A 4JI2B 3PITA 3VC2A 1TM1E 1VMAA 3QEJA 4MW4A 3PFWO 4ZMRA 1POXA 2VTKA 3H9GA 2QS9A 3THOA 2CV2A 4PGHA 4I4LA 3TX6A 4BNKA 5LQMA 1JDBC 2YVLA 3SFVA 1ECPA 2DLNA 5EWLB 3FIJA 4F12A 2YTZA 4V2UA 1QMPA 2FJUA 3ZBQA 3DHEA 4RHEA 3RVOA 4HLNA 1Z6XA 3OQIA 4O4HF 2OCKA 4OP1A 2WYIA 1CYDA 5KTKA 4Q4HA 1V48A 1FNNA 2AV6A 1LD3A 2AEMA 2Z4TA 4RXMA 3UB4A 3DBVO 1NN3A 1N2XA 3LFHA 2EP7A 2JAWA 3H8WA 2ZRHA 4JEIA 1VQ1A 4U2DA 3ZWCA 4CEIB 1Z08A 2WF8A 2X4DA 2B1JA 2DAPA 2HRZA 3RRBA 1GL3A 1HNZB 4LF5B 1ZBDA 2VK8A 3GDOA 3O8QA 4US2R 3HKBA 5C51B 1NM5A 3UJBA 4P3OA 2C84A 1LF0A 3JPYA 4ZHQB 5CCDA 4EKIA 4RADA 4F3NA 2B37A 4ZHSA 3NIGB 1PR6A 5AUQA 5KQMA 3AHCA 3LM8A 4N1AA 1WPGA 1HORA 2QLFA 1CY7A 3UUGA 4QRHA 1JXQA 4J76A 1Z0ZA 3S2FA 4YT4A 3RU2A 4DR2B 4UTRA 1N78A 4J90A 3DDHA 1KDYA 3KJHA 5DX1A 4BNUA 4CLRB 3KWJA 3ICOA 2D6FA 1Z5WA 3KG2A 2AG6A 3OCVA 2QN3A 3H86A 3NTLA 3U9SA 3AVPA 3RIMA 1DPFA 1NNI1 1DCFA 1PAUA 2BCGY 2CK3D 3E9RA 2IIVA 1FSFA 3ZK9A 1UZMA 3WR5A 3GGDA 1T1JA 3T4XA 2HSZA 4NRDA 2G8NA 2QA5A 5CVCA 4GPZA 1OC2A 2AI3A 4LX8A 4QWMA 4ZTZB 3V2IA 1NL3A 2F9LA 4J0IA 2J9GA 1FTNA 2V03A 1IY2A 1NF3A 3DEFA 2X0NA 4FW8A 4YV2A 3P9CA 4RX1A 4DV7B 1IUNA 1GPUA 1K0FA 1P91A 3EFOA 2QD2A 3PFGA 4P4TA 4UNSA 1ORWA 4IMRA 4YRDA 5I9IA 5B2ZA 5KC8A 2UUPA 2WNHA 3S40A 1CEEA 3ZH2A 3PDIA 5AOBA 2O7RA 3KAJA 3N6XA 1CRQA 4MQUA 3WRVA 2DETA 3B6JA 4JENA 1SBTA 2IXFA 3DLIA 1YA8A 2QQ0A 5HGJA 5D01A 2XUGA 3A6EA 4MW1A 1DQPA 2JDIA 1MJ5A 2YHIB 1Q0QA 4P7BA 2FN8A 4BO8A 3EPHA 4K6MA 3NLLA 4IGFA 4JL5A 4E1VA 1N9GB 3EQ7A 1SUAA 2QLJA 2PSFA 2EJBA 2H2IA 3QUQA 4IGEA 3IEPA 1H2AS 4LYDA 4XOIA 5CU7A 1G3QA 1H23A 2JATA 1YRWA 4DUYB 2RI0A 3GCDA 2QJTA 1HBJA 3S29A 4UAGA 2YHUA 3MFYA 4EVRA 3I6QA 5BN5A 1Q84A 3D8BA 5CRIA 2Y66A 3DEIA 1OJ7A 5ICCA 3WHIA 1C81A 3AY0A 2CJFA 3AI7A 3LT0A 1GCIA 1Q2XA 3ZDRA 4EB6A 3VO1A 3U19A 4NZ9A 2R6DA 1XVAA 4KTTE 4C6TA 2VQSA 2AVDA 3JZFA 4QJ3A 1J2RA 4H77A 3ZLVA 3A05A 1TIKA 3HCWA 3ILYA 3KTFA 4F56A 3AR9A 4TRMA 2DX7A 4OGGA 1S6YA 2W42A 3NM5A 2PKXA 1HC7A 4W6QA 4BU0A 1XHEA 1SCDA 3IB6A 3LY7A 5D7NA 4K6HA 1DO8A 4LXTA 1HSZA 1EG7A 1UEJA 2FUNB 3GUZA 2OMEA 4XCXA 2JD2A 1S3IA 1XKTA 4KQXA 4ZARA 1U94A 3QVXA 4QTUB 5AJXA 5REQB 4ZDKA 2VHJA 5MDHA 3I6MA 4HFRA 1EGHA 1Z5OA 2EQAA 4IH4A 4M22A 3AUFA 4X54A 2ATVA 1HEIA 3ET5A 4WY5A 3RKSA 1KERA 3HLYA 1A9YA 4QJBA 3W5CA 1XJQA 5EP3A 2WHYA 2EG5A 3ENKA 4YQYA 3SIPA 4AKHA 4UQOA 4XJSA 4EY8A 1M75A 1U4OA 2EEZA 1ZNZA 4HNQA 2BYTA 1IBKB 3KU4A 4CKCB 4J29A 4M49A 1YCGA 4GI2A 1KO5A 2ODBA 5K5EA 2XVAA 5G3ZA 3D6MA 4C88A 1XZ8A 2X6RA 5IVHA 5IUNC 3EPLA 2GAAA 3WRXC 4LHZA 2CJWB 3L93A 4AJLA 4MS4B 1CIPA 1RKBA 3OLXA 3OVMA 1YKFA 2IY8A 2BTQB 1S02A 3G2QA 4TMWA 4QOHA 5IM4A 1IEVA 1O97D 4V02A 1IUPA 4G26A 4JROA 4BKQA 3ZXIA 2X22A 4PNHA 3FHCB 2XGJA 4YAKA 4DJTA 1E66A 4K0RA 4KXWA 5KNDH 2O20A 5DWQA 1EEHA 1YJQA 1ZGBA 3FMVA 1FA9A 3QYPA 4KRYA 3K0HA 1KI8A 1XJ5A 3I2FA 3TSWA 4E2XA 4H7KA 1GITA 5C3MA 3V1TC 2ZS8A 1KOLA 2ECKA 1VSUA 1Q95A 4BQPA 5ITZB 4CEJB 3G0BA 5IT4A 3HB9A 1ZITA 4HQNA 1AQJA 4TT3D 2CXOA 3G2NA 3E1GA 2G28A 2FPUA 2J7PA 1GPMA 1KYQA 2QMUA 2XKAA 2FSIA 2FK7A 4AF8A 1P4RA 2QZJA 1B1AA 5B3KA 3N86A 3B36A 3R9WA 3M5PA 3CKLA 4QVGA 3N2LA 3CLSD 3WIEA 4U2CA 2HK6A 2ASEA 1ZK0A 2B6NA 3DD5A 4LDNA 5JCOC 2C0PA 2C4MA 3CUKA 5I7RA 1JB1A 3TNJA 1YVDA 1ZGGA 2A0UA 2FDRA 1OLXB 2C92A 2OGZA 4RSHA 4RK4A 3JWPA 4ZZ3A 4D99A 2R1VA 1JL3A 3IEKA 4KUGA 3HXMA 2UU9B 4WNCA 2XB6A 3H75A 4ROSA 5COBA 1PD1A 2LP4Y 3QHPA 2LDBA 5TGZA 6GPBA 2D8MA 1RPNA 2GHRA 2YC2C 3T3PB 2CSXA 4MUEA 4BGDA 3LNCA 4P98A 3S8EA 2GHIA 2ZATA 5C37A 1Q1ZA 3KSUA 2FW7A 5AJWA 4ERXA 2PGLA 1A27A 1ETUA 1F14A 2EFCB 1F4LA 2P79A 3FI9A 2QX4A 1QFMA 4H4CA 4J0GA 2XHEA 1BN7A 3ZJUA 5IAAA 1EM6A 1KYTA 2AX3A 1TEHA 2NXEA 4GMFA 1IHDA 3C45A 2FWPA 3EF0A 5CFZA 3N59A 3GLFA 3NP7A 1DG9A 1UKZA 2FTKE 2PSJA 2PS9A 2NVBA 2H2FA 2VXCA 3W78A 1PJRA 3K5PA 1RWBA 1ADBA 2BEJA 1UJ2A 2C3MA 2IC5A 3BE8A 1T2EA 2VR1A 1XZCA 3VTZA 2PD6A 1DHTA 4LWQA 3GPDG 4KN5A 4RVNA 4F11A 2E5LB 1OGJA 4ML3A 1DARA 3T3EA 4C6HA 4AX8A 2V6GA 3TR0A 3WLQA 4L74A 3SS9X 3CF2A 4S12A 2ZK7A 5L7YA 2FYTA 5AVKA <