4CMIB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 96
structure length 251
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmiB00
3F1KA 2E6UX 4Z3KA 2Y1DA 4ZHSA 1T1RA 5JBIA 4YR9A 4D79A 4DQXA 4OJNA 1O95A 2PKQO 1R4NA 1E3JA 2AE1A 3GFBA 1A9ZA 2W90A 1OI7A 2ZTVA 3PIDA 4RL6A 3RUDA 3OJEA 4CL8A 2GN9A 2G76A 2Q4BA 3KHUA 1EK5A 3NYWA 3VVBA 4U0KA 2SCUA 4BQPA 1ZFNA 2GZ1A 1K89A 1YS4A 3HDQA 1Y9EA 4WCDA 3Q6IA 4INAA 3JQGB 3H5RA 4URFA 5C37A 2BHLA 4DPMA 4D0RA 1H6AA 2EG9A 4BV9A 3WMWA 3JQBC 1TXGA 1B7GO 1SOVA 1I0ZA 1XWFA 3AUUA 4XDZA 1DFIA 4BO4A 4XR9A 1HF3A 4ALJA 1Z74A 4ND4A 3SVTA 3ONFA 5U1PA 3DONA 4EBFA 4HFRA 3RJ5A 1YVEI 1ZZEA 3UCFA 3GRPA 3TSCA 3PIIA 3W8DA 1PZHA 2P68A 3AY6A 2B4RO 4D45A 4I9HA 3V1YA 1BSVA 2DM6A 1DJQA 1BXGB 3ZW8A 4JGBA 2PV7A 1ZK4A 1PJTA 2PWZA 4MP3A 1Y7TA 4C4OA 2C20A 1BG6A 3ANMA 3MOGA 4KQXA 5ICSA 3EGOA 4J7XA 4BV8A 4F6CA 3U3XA 2X9NA 4IM7A 2WJPA 4BNFA 2VWHA 4NK5A 2AA3A 4XYEA 2Y0DA 4DQVA 1YB1A 2NVBA 1U5CA 1DC6A 3JQ7A 3H4VA 1BW9A 1ONPA 4HBGA 4OHUA 3WG9A 3FBTA 1PGQA 1UXHA 3L4SO 4IXWA 1N92A 2E48A 2NU9A 3C24A 2J3HA 4UULA 4N18A 1NX6A 1AHHA 3JQAA 3OP4A 1ZVMA 4FB5A 5EL0A 4QFDA 3DZBA 1NTOA 1PGNA 2VT3A 2JHFA 1Q1NA 4K1LA 2R00C 4LGVA 4WGGA 5C3MA 4XIYA 3UFXA 1UDBA 1HKUA 1WDKA 5B4VA 3R6DA 4A27A 2UAGA 2NTNA 2YDYA 3SEFA 3IS3A 4ZJUA 1YWGO 1ZSVA 5HA5A 4AJ2A 2HRBA 4YT8A 3JQCA 3G1TA 4BOYA 3RUIA 2I67A 3G17A 3ZV3A 3UN1A 3VKVA 5JDCC 3E6AA 1T2DA 2UYYA 4J1TA 1KEWA 5ITVA 3PYMA 4NJMB 4ZQEA 4GBJA 1OBFO 5T57A 1B3BA 3HHPA 4L73A 3TZHA 4BNUA 1Y5RA 5CDYA 3WS7A 5JCXA 1EUZA 1D4FA 1ONOA 1UXKA 2YFHA 3MJSA 2R2GA 1KVRA 3DZJA 1K6JA 2UVDA 4RQUA 5AYVA 5EINA 3ZWPA 3CPSA 1PWXA 1I3KA 5TJ9A 4CODB 2P5YA 2ZQYA 4GSLA 1PTJA 1P1RA 1D1TA 4Y9DA 5BNFA 1HDRA 1LJ8A 4OIMA 4J7UA 1SBYA 1WPQA 2JCVA 1PS0A 4OGWA 4PLPA 1Q0LA 3HFGA 3WFIA 1ZXLA 4Q9NA 2OBYA 1LUAA 1RYDA 3IL2A 5T64A 4H15A 2GCGA 4B7UA 3Q3CA 4CR6A 4B7CA 3TZKA 4KUHA 2Q1UA 3W8FA 4CLHA 3TDKA 5F21A 1Y8RB 2JFHA 3P2YA 2UUOA 4BUCA 5TIIA 5TLSA 4CMEC 3RC2A 3WR5A 1WAMA 3UW3A 3ZI0A 1HL3A 4PLCA 4YT4A 2NACA 4YRDA 5T8KC 3KXDA 3RFXA 4O63O 4Q3NA 1DC4A 1C0KA 1MXHA 2BFAA 3GN1A 4RGBA 3VZQA 3ZWOA 5DOZA 3GFGA 3KYCA 2AXQA 3NDIA 3FNFA 1DHTA 4Z0TA 3WQSB 3Q11A 3OECA 4JCOA 5CP8A 3GAFA 1ULUA 3JQDA 3V1UA 5KVVA 2HKIA 3GVHA 4JJGA 2NVUA 4PG7A 1XKQA 3U4HA 3G0OA 1Z45A 3VC7A 3ZGYA 2GRAA 2OBNA 4ZRMA 4O1MA 3W4IA 3V5NA 3AJRA 1JVSA 2VCYA 1U5AA 2Y1CA 2JAPA 3LDHA 4TMFA 4CV2A 1VPDA 2G0TA 5F1OA 4W7IA 2VUUA 2X5JO 1PL8A 2O3UA 1JDJA 1ZW1A 1ZIDA 4A0SA 4CMHA 4OKIA 1Q2XA 2A35A 4BNWA 1O6ZA 4AJEA 1X13A 4HWKA 3INRA 1PJBA 4Z9XA 2C5EA 3JQ9C 2QW8A 5KIAA 5L95A 5TSDA 4YJFA 4CLDA 1JTVA 1ID1A 2HMTA 3K2BA 4IQ0A 1I3MA 1ARZA 4PG4A 1OC2A 2JKVA 4XWYA 4NFSA 1N9GA 3ONDA 4M89A 1ISGA 1C0IA 2EKPA 2D1YA 5CPFA 4PG5A 1DRVA 4D41A 1M67A 4WUVA 5AXDA 1C1DB 4XYMA 5IAAA 3WYBA 5F3RA 5EPOA 3WSVA 3NKLA 1ZUD1 2VRCA 2YV1A 3HN2A 3KV3O 4MKZA 5A06A 4XB1A 1ZK1A 4J2HA 3GH3A 2D5AA 3C3XA 3TFOA 1CETA 1GAEO 1KY4A 2JAHA 1LEHA 2FR1A 2VYVD 3H9QA 9LDBA 1AHIA 3KLPX 3WICA 5JNLA 2QZ9A 4LVUA 1LA2A 5ENVA 4QO7A 3DO5A 4BNYA 4CV1A 1DFGA 1HYHA 1G0OA 3FTPA 4ZN6A 4AL4A 3OEYA 1IYZA 3BMCB 4BNNA 4N5MA 1XEAA 3LK7A 1LLCA 3K9QO 2VOEA 1P0CA 4J6FA 4YEDA 1B8UA 5L4LA 3WIEA 3JQFC 1L7EA 4BB5A 3JV7A 3EAGA 3I4FA 2X1HA 1C0PA 4RQTA 3ZHYA 3GT0A 5AVOA 3ADPA 4UEKA 3V2UA 5A9TA 3KRTA 1RKXA 3U4CA 1E1MA 1WP4A 4GMGA 4MVJM 3N74A 4YT5A 2H9IA 4R5HA 2AQKA 1PJLA 1P44A 1R37A 4Z6KA 3PTZA 1NHWA 1CJCA 4CQLB 3A14A 4CM1A 3QW2A 2WD7B 4PLGA 3QVTA 3E9MA 4W7HA 3P5SA 2IEBA 4ZRNA 3JQGA 5BSFA 3W1VA 1BDBA 1N1EA 3DOJA 4MVJF 4OO3A 3LT1A 3PYXA 5CDSA 1GUFA 3WNQA 1E3WA 3H7AA 5LC1A 5TRTA 1TT5B 2D3TA 2HSDA 1R15A 4QFCA 3PDUA 3ZWAA 2P9CA 1PJCA 2DPGA 3M6IA 2C7GA 1DLIA 3PZRA 1PJ4A 1UZLA 2OGUA 4YA6A 4TKMA 4R1NA 3FWZA 5HM8A 5BNIA 2PGLA 1N2SA 3Q1LA 1TLTA 2CSUA 3H9EO 3Q9NA 3C7CB 3FR7A 1G6KA 1HRDA 3UOGA 4J90A 1BXGA 1ISFA 3HDJA 5JDIC 1HZZA 3I4CA 4ALKA 1A7AA 4DMMA 2VNSA 4P38A 1K0UA 2NTJA 1QORA 2PD4A 2VQ3A 4IDEA 4BO6A 3TN7A 1K3TA 2W2LD 1DB3A 1NWCA 2IXBA 4KUGA 3OICA 3GOHA 3NDJA 2C29D 1U7TA 1E3SA 1OC4A 3PPIA 1XYGA 4BNLA 3E5RA 4FFLA 2B83A 1E0DA 3VPSA 2GN6A 3S2IA 1JQBA 4OXYA 1B16A 3LF2A 3K96A 4F45A 1LSSA 5JW6A 1ZXBA 2V6FA 4CUZA 4J4BA 3PDJA 4N5LA 1GY8A 1PQUA 4DQUA 4EUFA 1PJQA 4WJZA 1CERA 1KY5A 1EFLA 1ZNQO 1B14A 1LRKA 1VJ1A 2ZK7A 3PQEA 4GGOA 1ZJYA 4DLLA 3CZRA 2Q46A 2YQ4A 4W82A 1H9BA 4ND3A 2AG5A 4U8GA 1NVMB 2IDZA 4I5GA 3GGGA 3CXRA 3S8MA 3PFWO 3L6OO 3PEFA 5BSEA 2D2IA 4IDGA 4R3NA 5AXBA 3GMSA 1DO8A 4QX6A 4TKLA 3OBBA 1RM0A 1W4ZA 2RIRA 1NM5A 2PZKA 4NJMA 4BMSA 1W8DA 5GY7A 4BNZA 4P4LA 1GQQA 1P45A 3JD4A 2B0JA 4ID9A 3K30A 3CEAA 4D46A 2YY7A 2NSDA 4L75A 4MVJG 1N7GA 4HUJA 4E12A 1RM5A 3SBOA 3WGHA 2HK8A 4RLHA 4PVCA 2OUIA 4DXHA 1YBVA 4CQMB 1HYEA 4TRMA 4W9NC 2VHZA 3ENKA 1PZEA 3BIOA 4K26A 2Q1SA 4XYGA 5COBA 2HK9A 5TT0A 2Q99A 2QRKA 4MVJH 5CDGA 3DAGA 2EEZA 2ZTUA 1I01A 2HMUA 2EJWA 3HE3A 4XQEA 1E7QA 5CEEA 5IDQA 4DC1A 1M76A 3A9WA 5I9LA 1Y8RA 2FSVA 2C59A 3FNEA 4YBZA 4RO0A 5TGDA 5L45A 4I8XA 2LDXA 1IHYA 1ZJZA 4GKBA 3G79A 4II2A 4QECA 2YHIB 4CM6A 4M54A 4OAQA 2I76A 4DUPA 2G1UA 3KB6A 2NTVA 4Z3DA 3TOZA 2RCYA 3EYWA 3F46A 3CKYA 3GR6A 1VSUA 4JP3A 3ZU3A 4M1QA 4OOEA 4IMPA 3KVOA 5TNXA 3CIFA 3I3OA 5IFLA 4FFOA 3ICPA 1O89A 3JYLA 3WIDA 2X23A 1NPDA 1EE2A 2QZZA 3JCZA 2X9VA 4CR8A 4E4YA 3OMLA 1YDEA 3H2ZA 3ZZNA 1K2WA 2NM0A 1C1XA 5A04A 3INTA 2HAEA 2GLXA 4UEJA 3AI1A 1QYXA 3ZW9A 4R5MA 1A71A 3FNHA 3P2OA 3PJGA 1LDGA 1ADCA 3AM3A 4FS3A 4Y6SA 5CPBA 5L7TA 3R3JA 5KVCA 1AXEA 3AY7A 4A03A 3IIEA 4WASA 3C1AA 4MVJI 2ZJ0A 4EW6A 4E5KA 3PWZA 1DFHA 2BLLA 1PR9A 4CMJA 4DGSA 4J1QA 4D3FA 1SNYA 4ZQFA 4WCFC 2EP5A 3OQ1A 3HADA 2FOIA 4NZ9A 1H5QA 4HFMA 3VPGA 3D1LA 1R0SA 4WOJA 1PQPA 4II3A 1MP0A 2UDPA 3JQBA 6ADHA 2VHXA 4BGVA 2P4QA 3OIGA 3LVFO 3UVEA 4EUEA 2GO1A 2X0IA 2F00A 3I1JA 2NQTA 2VYVA 4FQ8A 4UUNA 4IDDA 5EQDA 5C7OO 1YL5A 4K6FA 5LDGA 2VUSA 3DZHA 4E21A 4HXYA 5A05A 1C1DA 1ZCJA 4U5QA 1V3UA 2YQ5A 3GZNA 3PZBA 2C5AA 2FP4A 1VJTA 2DKNA 5ES3A 4A2CA 3AFMA 1LSUA 1B8PA 3RVDA 4HADA 1LC3A 4YJGB 4LMRA 4NBVA 4Q3EA 4E5MA 5A5EA 3QVOA 3TFQA 1QV7A 5ICMA 5IJZA 2RBEA 3CMCO 5HWSA 2P4HX 4AJLA 5GZ6A 3RUEA 2NLOA 3I9OA 1LC0A 2QYSA 4XRRA 4L8VA 1EK6A 3H6KA 1I30A 3TF5A 3UH1A 1F17A 5JYEA 1KBZA 2CF5A 3RROA 1R0LA 4JIGA 1EDOA 3BXXA 1CF2O 3CZMA 3BMCA 2Z5LA 4FBGA 4NBUA 1AE1A 3E8XA 3RD5A 3O8QB 4IJWA 2FRDA 3V2GA 2Z1MA 5FFFA 3F6YA 2ZYAA 2Q2VA 3QJ5A 4M86A 1H6CA 2Q2QA 4L4SA 3UCXA 4UUPA 4DPKA 2O3SA 3KO8A 5GMOA 2ZIZA 2Q3EA 5JLAA 1DJNA 3TNLA 1JN0A 3UGKA 5TF4A 3ZWBA 5I9NA 2F1KA 1DXYA 3QWFA 5DN9A 5DDIP 1A27A 3A4VA 1KVSA 1XSEA 4J0EA 1QLHA 3OJLA 2GYYA 3H5AA 4CM5A 1K5HA 1O5IA 4FC6A 4XD2A 3VTZA 3WGOA 4CQLA 4DIFA 1UAYA 3MTGA 1EVYA 3ZHXA 5DOVA 3W4KA 2JD0A 3EZYA 2WSBA 1V0JA 1LDNA 4YAEA 1E7WA 5THKA 3HB5X 3WTBA 1MV8A 3C7DB 2AEJA 1LTHR 3GVPA 2PFGA 3N58A 2ZB7A 3GNQA 1U8XX 2W8ZA 3LLVA 2FPIA 2IYPA 5JDCA 1SB9A 4KUEA 2WYWA 1GYPA 1D3AA 4BO1A 4CJXA 3BTVA 3CMMA 2Y93A 4DVJA 2FSSA 2VYNA 1TVEA 5CHEA 3D4NA 3FRJA 1VL6A 3GGPA 2W2LA 1O0SA 4EI2A 4RVHA 1EFKA 4JJFA 1SOWA 1ZK3A 3H2SA 4GAEA 1O9BA 2IZ1A 2DPHA 1NVGA 3AW9A 4YQZA 1XLTA 3ZCXA 5T67A 2VTEA 3E9NA 3L6DA 2IZZA 1DRWA 1GV0A 4BNKA 5CG2A 3VZSA 4H7PA 5I9MA 1NFQA 1B3RA 2GDZA 2QRJA 3JD3A 2EF1A 5TJHA 3KBOA 3GEDA 4QUKA 4W4TA 4ESOA 5EIOA 5ILGA 3DAFA 2EJVA 1E7YA 4OYRA 2JJYA 5JY1A 3CTMA 3CSDA 2E4AA 1SAYA 4J4TA 1NYTA 2DC1A 4PVDA 4CMEA 1I2BA 4MIOA 3NAQA 1T26A 2ZTLA 2EIHA 3DL2A 4ITUA 1NR1A 1NXQA 3AU8A 3GNSA 4GWKA 3ZWVA 2HRZA 5T8KA 1RYEA 4WNCA 5CG1A 2NQ8A 3CH6A 4MIYA 4NI5A 2IRWA 1LBEA 3QY9A 1HWYA 3L9WA 5FI5A 3U4IA 3ANNA 4B4WA 1JLLA 4I5DA 1Y5MA 4RVDA 3WB9A 3NEPX 1H6BA 3GF4A 3RQSA 4LVCA 2YFQA 3FWNA 2J5KA 1XQ1A 1NFRA 4UUOA 4MPDA 3JYPA 3AOGA 1NPTO 3Q2KA 1LSJA 3EVNA 1DC3A 3FTNA 2HUNA 2BFOA 4NJOA 1H93A 5K0ZA 4DC0A 1Y9AA 3K73O 4XB2A 1P0FA 4E5PA 3D5TA 1ENYA 3ST7A 4Q3DA 2UV8A 4UVGA 2Y68A 3TZ6A 4UVHA 5ADHA 4HFNA 1E3WB 2J8ZA 4WCFB 4ND5A 3JQ9A 3WLFA 1U9JA 2IE0A 3OJ0A 4O6VA 3B1KA 4Z0HO 4PLYA 3FI9A 5EN4A 3NV9A 4DIBA 4CQMA 2IEDA 4FFNA 4ZA2A 5G0WA 2ZB3A 5TC4A 1ADBA 2FMUA 2X0JA 3T7EA 4IPTA 3IKTA 4L9RA 1E92A 2ZB4A 1B2LA 3VAZA 3WWYA 1KIFA 2ZB8A 4I5EA 5DCYA 4JBIA 2Y1OA 4I9NA 4YPOA 2A94A 4E2YA 4W6ZA 4CMCA 2YW9A 2YHIA 3I23A 3OQ6A 1YRLA 2HLPA 1IZ0A 1LLUA 2V6BA 3MZ0A 4KTVE 5G0TA 5A03A 3PVZA 5B4UA 1QYVA 2DAPA 2I6TA 3E1KA 2G17A 5IDXA 3RASA 5AXAA 2JD2A 5KWEA 2AW5A 4LW8A 3UKOA 4A5OA 1A72A 5JSFA 1BDMA 1N1GA 4GX0A 1UP6A 3FR8A 1GL3A 1D8AA 1QRRA 4R4JA 1X7DA 3S2GA 3QWIA 3RU9A 3TZCA 3WSWA 3KUXA 1Z7BA 2WM3A 3NGXA 3JQFA 3NX4A 5KVQA 2BGMA 4LCJA 1QYCA 3LF1A 4PG8A 2O3TA 1MX3A 2JCXA 4EEZA 1VI2A 1W6UA 4B4OA 2PH3A 4UAGA 4A10A 2EGHA 2HDHA 3HFSA 1GR0A 1ISMA 2Y05A 1NR7A 4NBWA 3FBGA 1NFFA 2DBQA 1NASA 1DRUA 3RC7A 4RDHA 1L7DA 3RAJA 5A02A 2J3KA 4EITA 1R66A 4BO7A 3ZWWA 1KS9A 2HK7A 1I8TA 3PHGA 4XZ3A 4DYVA 4JK3A 3HSKA 4G2NA 1R16A 1IPFA 3BZUA 4RPJA 4LRSB 4B79A 4BL5A 1Q7BA 5F5LA 3PGXA 4JBGA 3R3SA 2NU7A 1YXMA 5L4SA 1G0NA 1HE3A 5FWNA 3E03A 4WOKA 2B35A 4GPD1 4YJHB 2Y1GA 1LRJA 1EVIA 2J5QA 1JAYA 2P9GA 2D4AA 1H94A 4I1IA 4PCVA 4TQGA 4QSMA 4YJGA 5JCJD 3GZ4A 4U0JA 1OFGA 4FJ1A 1FK8A 1GU7A 3N7UA 5JDIA 2WYUA 3SLKA 1LQUA 5KJ1A 2JFFA 3WTCA 3ZV5A 5TT1A 1J4AA 3DBHA 1GYRA 2O7QA 3I52A 2DLDA 3FSRA 1OAAA 4IS3A 1MB4A 3MTJA 3O8QA 3NTRA 1A9YA 1P3DA 1ADFA 1W73A 3WFJA 2PZMA 3KOUA 4P22A 1S7CA 4M55A 5K6AA 1LSOA 2XPCA 2I65A 3V2HA 3VHRA 3ETDA 3QHAA 1BTOA 5CEFA 2AEMA 5HTOA 4CUKA 4FCCA 1PU2A 4NU5A 4UVEA 2X5KO 3ZNNA 3T4XA 3FCOA 5KJCA 1IOLA 1C1XB 4IGEA 4XR4A 2DQ4A 2WDZA 1ZMTA 3WX0A 2Y66A 5FI3A 5I7VA 1YQDA 3B6ZA 3TZQA 4S3MA 2J3JA 5DP1A 1DSSG 2H6EA 1ISHA 4HNGA 4BNHA 1RPNA 4YJDA 3ZH2A 3D3WB 1WDMA 1XA0A 3T7CA 2O3JA 2WD8A 3TL2A 3MOIA 1DBVO 4RORA 5CDTA 3F5SA 3WQRA 4B7XA 3OF2A 1J6UA 1PGPA 2CUKA 4L4XA 4CPDA 4GL4A 3C85A 2ZYDA 3ZV4A 2TMGA 3O26A 4PIVA 3WJ7A 4KQWA 1HEUA 3TL3A 2X86A 4XGNA 5JC8A 1HDYA 2QQ5A 4IDBA 3QVSA 4Y6RA 2WEKA 1OOEA 4I5FA 5COQA 3NDRA 4GX2A 2H1SA 4IJUA 3QWHA 3E9QA 1NQAO 1PJ3A 3T4EA 1J49A 3RUCA 2P5UA 4BGUA 4W9NA 2DBZA 3W4JA 3OFSA 4IJVA 1R0KA 2CVZA 2RAFA 4Q39A 3GZNB 2V6GA 5DNAA 3AWDA 4CL3A 2EHDA 3KM0A 1UP4A 4PLTA 2ZCUA 2AE2A 3A1NA 4WLEA 3TOXA 4ZQHA 5ER9A 4AFNA 1GV1A 4PRLA 3GRKA 9LDTA 4OH1A 3OJOA 4LN1A 1H2HA 4BNJA 3Q9UA 5A1TA 4FR5A 4HX5A 2DBRA 2W2KB 3ANLA 3F4BA 3WNVA 4BMNA 1Y8QB 5HRUA 1LLDA 1UXJA 4YXFA 4RF4A 3H5NA 1YQXA 4ZICA 3O03A 3GQVA 1T4BA 1N7HA 2DUWA 1U2DA 4KDFA 3QVWA 1JU9A 1EZ4A 1IL0A 2TMDA 1MC5A 3GN2A 3FD8A 1U2GA 4RF2A 5DBFA 4CLXA 4D0SA 4DLBA 3H9UA 3KSDO 3X2FA 2J5RA 3AM5A 2EP7A 2FY8A 3IDSA 1VSVA 4RZHA 4EJ0A 1RM3A 4RVFA 2OXIA 1EBUA 5JC1A 2Y99A 1LLQA 4UEOA 4IUYA 1N8KA 4LK3A 4TVOA 4BNIA 1T2CA 1KERA 3ZWCA 4L4RA 3UHAA 2X4GA 4BO5A 4CLOB 5B4TA 4YWJA 3D64A 1P1IA 4R69A 5L4NA 4C7KA 4NH4A 3OM9A 4TWRA 4XRGA 1KEUA 2OORA 1FDUA 1I33A 1Z73A 3QIVA 5JMPA 3O38A 3PGJA 4WCFA 4CMBA 2O4UX 4EJ6A 3GHHA 3BTSA 3GDGA 1WVGA 3VOSA 1IY8A 3GPDG 1AXGA 3H3JA 2Q2WA 4B3HA 1AN9A 3D7LA 1E5QA 1IE3A 1UUFA 5GZ3A 4E33A 4ROSA 3WMXA 1M66A 4BNMA 1NP3A 3DDNA 1F8GA 4MO2A 4U6SA 2GERA 3LQFA 4GI2A 4B4UA 3HZZA 1HXHA 4KDEA 2Q1TA 3HUDA 3I6IA 3DHNA 3GMDA 5ER6A 4I9UA 2H63A 3K5PA 1SPXA 1DEHA 3KYBA 3EK2A 1V8BA 6LDHA 3VZPA 1PX0A 2WE7A 1WDLA 3GDFA 3MWEB 3L4BA 4MKRA 2FPPA 2HMSA 4R41A 5DF1A 2DVMA 1PJ2A 4CLRB 4RPKA 4E3ZA 2PTGA 2NWQA 2VHYA 4TZKA 3M2PA 4IQ8A 4JNKA 1EQUA 4YTEA 1LDEA 1KEVA 1DIBA 3VZRA 4C7JA 3D3EA 3DXFA 4R9SA 4EYEA 4BO2A 5K6AC 2Y1EA 3DOOA 4IZIA 1Z75A 3U5TA 3QQPA 2VRBA 1B0AA 3HDYA 5G0VA 1UJMA 4R1UA 4MP6A 1VLLA 2OMEA 4TRRA 3AOEC 1M6HA 2OOSA 1WLYA 1KVTA 1LRLA 3U09A 4CM7A 3LYLA 1PQWA 2D5CA 5DBGA 4IINA 4J1NA 3NT4A 2X0NA 4YQYA 5BR7A 2PKRA 3BTOA 2CNBA 4NIMA 1LXCA 1C14A 1ML3A 1X15A 1U7HA 2CDBA 3BHIA 2GN4A 5C7IO 4OM8A 3MCVA 4BKPA 1XGKA 5CFZA 4AJNA 2CVQA 3PHLA 3SJUA 4JX8A 4CM9D 1Q7CA 3W6ZA 2QYTA 3DZIA 5JCJA 1PS8A 1U3VA 1I5RA 2YDXA 5KOIA 1ISIA 3GVIA 4NMHA 1XCBA 4B3JA 2G82A 2OHXA 1MFPA 4DRYA 1I24A 4BVAA 4YJHA 3I9NA 1RWBA 1HLPA 3I9JA 5DCUA 4BNVA 1CDOA 5KNLA 4E5YA 1TB4A 1HSOA 1BVRA 3SC6A 3IC5A 1JVBA 3HQ4O 3HWRA 5TS3A 4DLAA 3OEWA 3JTMA 1CYDA 4EDFA 5A9RA 4NNJA 3PYLA 4IGFA 1XELA 3JQ6A 3FNGA 5T6BA 4BQRA 1X7HA 4KOAA 3WGIA 1ZEJA 2IODA 1KVQA 4A26A 1UZNA 3PWKA 4BKRA 2ZYGA 2CDAA 2J6IA 1DLJA 1YJ8A 3ULKA 4F6LA 3BA1A 3IQDB 4PLWA 3P19A 1GZ4A 2C07A 3JD2A 4FW8A 1S6YA 2EXXA 3H65A 2NUAA 4OSPA 3C8MA 3DTTA 1J0XO 1IZ9A 1ISJA 5IF3A 1EMDA 1E7SA 2FZWA 1FDTA 2CDCA 4GX5A 2DU8A 5DCWA 2BFMA 4E5NA 3KEQA 1ZK2A 3BMQB 4PRKA 4JQCA 2HCTA 1N5DA 2DBVO 1H6DA 3WXBA 3WQQA 2A92A 3JYQA 1E6UA 2QHXA 2E82A 5BT9A 2C2YA 3GK3A 2R6JA 3IJRA 1E1LA 1MG0A 4FFRA 2EKQA 3A28A 1P77A 1NNUA 3D3WA 1E7RA 4XA8A 2I5PO 3VH3A 5L7YA 3ZHBA 1QR6A 2RH8A 3ROKA 1T24A 1A4UA 2NNLD 4E0BA 4O5OA 4IIUA 3BMNB 3EDMA 2YYYA 3SC4A 3WWZA 2JCYA 1YBMA 2VWPA 3L77A 3PQDA 4O59O 7ADHA 1U8FO 3IUPA 1KETA 3VPFA 4YACA 1ONNA 1X1EA 4MVJP 3TQHA 3DR3A 1PL7A 3F1LA 3DZKA 4KMSA 2GZ2A 4IDAA 4OXNA 3WGYA 1PWZA 3NGLA 1V6AA 2EGGA 4KWIA 3RKRA 1UAGA 3DB2A 4JP2A 1YOVA 2O2SA 5C5IA 3MJ4A 2AQHA 4RF5A 5JPIA 3JYNA 3HG7A 4R01A 5H83A 3VTFA 2HU2A 3L4BC 3LZ6A 2OL4A 3ETEA 3DMTA 5TQVA 3JD0A 2X58A 4QQRA 4E2WA 1X0XA 3DBHB 2BGKA 2W2KA 3BMOB 1FMCA 4Z0PA 1EUCA 4J1SA 1Y8QA 2QRLA 1EQ2A 5L51A 1GEGA 4N54A 5L3ZA 1YONA 2X8LA 4CM8B 5IXSA 2X7HA 4A7PA 2HJSA 4RVSA 4GH5A 1X0VA 4XDYA 4AICA 4J16A 4NG5A 1ZKMA 2GD1O 2GSDA 1Z82A 5L53A 4BGIA 1F12A 4B8ZA 4GQAA 2B37A 1JWBB 2C2XA 5IG2A 3FF4A 1H2BA 3ASVA 2I99A 4BMVA 2EV9A 2P9EA 2DT5A 2PGDA 2V7PA 3VPHA 2EW8A 4J2OA 3BYZA 4AJKA 1UXGA 2X5OA 4ZGWA 3GHYA 5DT9A 4EEXA 3NTOA 1MG5A 1EEHA 3LC2O 1U3TA 4CMIB 4CLOA 3C1OA 4E2ZA 1GCUA 1HYGA 4MIEA 1PGJA 1R12A 4FC7A 4QEDA 4BGEA 2ZCVA 4PZDA 4FIZA 5LDHA 4YVFA 1YL7A 2B69A 3HDHA 3OSUA 1D7OA 4HV4A 3Q0EA 1WXDA 4U7WA 4EGFA 4RCVA 1M75A 3MJVA 3OIDA 2D59A 4MKXA 4D43A 3QSGA 3RBXA 4XKJA 1GADO 1EVJA 3B70A 3H3FA 3ITKA 4DTIA 4KWHA 4M49A 5IN4A 1XR3A 2DFDA 1F8FA 3PHHA 4BS9A 3IKVA 1WMBA 1SZJG 4GWGA 7MDHA 1NWHA 1T1SA 3ZNPA 3V1TC 4AJ1A 1V35A 3CE6A 1OMOA 3ZU4A 5L40A 2D0IA 4IDCA 3GY0A 1GPJA 3O9ZA 5JFOA 1Y1PA 1NBOA 1KYQA 1CEQA 3QP9A 5DBIA 4DREA 2FWMX 1O94A 4DMLA 1TA4A 3OA0A 4CLRA 8ADHA 5AOVA 4A73A 4HKTA 3SXPA 4YRBA 1RM4A 5DULA 3HJAA 4RF3A 4J0FA 4CR7A 3RI3A 3NRCA 3NUGA 1VL0A 3RFVA 4B3IA 3H9JA 4JLWA 2GUGA 1WWKA 2PNFA 1LDYA 1DOHA 1MFZA 1T4DA 3GNTA 3VH2A 1VM6A 4ONEA 5JMWA 5L7WA 1B8VA 1E6WA 3KSZO 1HLDA 4E30A 5K9ZA 1XG5A 4Q3AA 4R3WA 1YBAA 3RJ9A 4CM9A 4J9UE 4BIIA 1JKIA 1ZEMA 4FD3A 1LQTA 3OA2A 1LU9A 5FYDA 3ICCA 4BKQA 2DTDA 2ZQZA 4LMPA 1SEVA 3UAGA 4WPGA 4HY3A 1K6XA 1PZFA 3AK4A 4H3VA 4NPCA 1I3LA 1JA9A 4GKVA 2X6TA 2PKQP 3D5QA 3IUSA 2WWRA 1VKNA 3INGA 3CUKA 1QYDA 1MA0A 3DMYA 5KVSA 2POQX 2VN8A 5ENDA 4XYLA 2O3QA 1GPDG 1MC4A 2NADA 1CWUA 5U4QA 4BNGA 5CDUA 2AG8A 1NAIA 2XF8A 3VKUA 1IHXA 4L74A 3UXYA 4BO3A 3COSA 3CINA 4JJIA 1YL6A 5I7SA 2ZKLA 1MXFA 3EC7A 1FF9A 1HE4A 1QKIA 3OIFA 4KP7A 4AJOA 2O2YA 3ZN2A 4AG3A 3LLSA 4GLOA 1QXSA 1E6EA 1C0LA 1X7GA 4HP8A 1KC1A 4TSKA 3MJEA 3ONEA 3QRWA 1HSZA 3DMTC 3JQ8B 3NT2A 3NJ8A 2YV2A 1U3WA 1P1KA 3B1FA 5EJ2A 4R16A 1YE3A 4GVLA 4PN3A 1HDGO 3U49A 5A3JA 3L6EA 4XGIA 1HTBA 4JXKA 4B8WA 4YT2A 4K9DA 1F14A 2PH5A 1A7KA 4ALIA 4WEOA 4Z9YA 4FN4A 2XXBA 3GUYA 4FFMA 2PZLA 3I5MA 2IXAA 3PHIA 4X54A 4FOOA 3TWOA 1HETA 4OQYA 3BMQA 4WEQA 3GPIA 4J43A 4WNIA 5H81A 3GAZA 3RBVA 3W8EA 1EDZA 2AQ8A 2JHGA 3BHMA 3K6JA 3JQEA 5CEJA 1SB8A 4FSHA 4JN6B 4YAGA 4FGWA 5H82A 3GGOA 3ETGA 2BH9A 5IZ4A 2PK3A 4E32A 1E77A 1L1FA 4ZQBA 3PK0A 2PY6A 2WE8A 4DYDA 1FJHA 1I36A 4YAJA 3SX2A 3BMNA 3ITDA 1DIRA 5A9SB 3UUWA 1DPGA 1DIGA 3RU7A 2CD9A 1YJQA 1CIVA 3DWFA 4WLNA 2BRUA 5HBRA 1H0KA 3OJFA 1GD1O 3S1LA 3LT2A 4ZU3A 4QT0A 4K28A 3S2FA 3O4RA 4OSOA 5EERA 2CMDA 2HMWA 1GDHA 3E18A 4EJMA 2GF2A 3IAHA 1QG6A 1GUZA 1XIVA 4ZD6A 5HS6A 4MOWA 4P4GA 4G5HA 4CMGA 4M8SA 4WE3A 4YDRA 3EVTA 1SC6A 1FDSA 3NT5A 3KTDA 5G2OA 4XIJA 3ZV6A 4MDHA 4PLZA 3WGQA 3ROPA 4CMKA 1UH5A 1XQ6A 3K92A 3DFZA 2BF7A 4R54A 4XQ9A 2O50A 2V65A 1BVUA 1VKOA 4WKGA 2HQ1A 3BMOA 1Z7EA 3FN4A 3PJEA 2Q50A 4D42A 3P7MA 2D8AA 4CM8A 2DFVA 2YJZA 3EUWA 4WLVA 2I3GA 4ILKA 3H8VA 4O0LA 5G0SA 3STHA 5FF9A 3ZWMA 3GEMA 3MEQA 1UP7A 1R6DA 1HDXA 3QLJA 5F1PA 3FPLA 1Q0QA 2C82A 3OQBA 1FDVA 4BO8A 3VH4A 1QV6A 2PD3A 2BI7A 1MUUA 3WDSA 4GMFA 1P1JA 1F0YA 4OOFA 4OMUA 4ND1A 4UREA 1ZBQA 3AOEA 1NAHA 4QTZA 1BHSA 2FR8A 2JL1A 5I8ZA 2ZJ1A 4WECA 1ORRA 1U28A 3I9LA 4NFHA 3ZNQA 4NU6A 4CMIA 4YAKA 4YYZA 1YDWA 4AJJA 5JY6A 2PD6A 2VWQA 2IYOA 5EESA 2PZJA 4UUMA 4FFPA 3R1IA 4WLFA 1LI4A 2Y0EA 1NHGA 5JAQA 1GYQA 2Q49A 3G49A 2CFCA 3QV1A 4E13A 5JO9A 2WMDA 1UXIA 1PL6A 1IUKA 1H9AA 3I6QA 1R4MB 2YZ7A 5C7LO 1SEPA 1LX6A 4BO9A 3RC9A 2ET6A 1TT7A 2G5CA 5G4KB 1V3TA 4XJSA 5DZSA 3B1JA 4IS2A 3PJDA 1PR3A 3RKUA 1GEEA 5KKAA 2Z1NA 3VH1A 3E48A 3PLNA 4ZQGA 2QG4A 3DBRB 3MJTA 1PEDA 3RFTA 3ASUA 4CV3A 3UF0A 1T2EA 1KC3A 3V8BA 2DTXA 1A5ZA 5EQFA 3ROMA 2O3RA 4MJLA 1P1FA 5KTKA 1YB5A 3KEOA 2OZPA 5JXWA 5IZCA 1NQTA 3KYDB 1ENPA 1T25A 1YOVB 3DBLA 3B20A 3BAZA 3EY4A 1YKFA 3FHLA 5F1KA 4CMAA 3AUTA 3ZU5A 2NVWA 1E1NA 2GASA 1A4IA 4XX0A 1EBFA 4MVJD 1B15A 1X1TA 4NQZA 5MGBA 2B5WA 3WBBA 3AI2A 5FEUA 3RSHA 4DBVO 4G65A 5G0UA 1XU9A 4W99A 1E5LA 1HDCA 1LDBA 5AQ1A 3KZVA 3C1TA 1ZH8A 3DEYX 3E5MA 1ENZA 3MWDB 4FOSA 4I08A 3C7AA 4L76A 3DHYA 3W6UA 1E3IA 1TEHA 3AUAA 2FR0A 2BI8A 1VRWA 3ENNA 3GC6A 4TVBA 2AEFA 2BGLA 1O8CA 1GFSA 4E6PA 4HFJA 3QE3A 3M1LA 3ZHZA 5BNTA 3DTYA 1QSGA 5IDYA 1BWSA 4XYBA 4IDFA 4Q3BA 1AGNA 4DBZA 1JWAB 4GGPA 5JE8A 2FHSA 2VZ0A 2EW2A 3RWBA 1JAXA 1YH3A 1PSDA 3AM4A 4NFYA 4EZBA 4CM3A 1UZMA 2XXJA 4MINA 1VL8A 3L07A 4WLOA 2BELA 2GN8A 4RPLA 5HS4A 1HDOA 4RVGA 4P8RA 3WOHA 1YO6A 3DFUA 1U4SA 1HZJA 4IJKA 4PFJA 4RLSA 3ZNOA 4Y67A 3EHEA 4Q3CA 4CM4B 3IJPA 5IDWA 1NQOA 1W0CA 3PFFA 1P31A 2YUTA 3ABIA 3GDOA 3WGZA 2FPGA 3OHSX 4XQGA 3ADOA 3JQ8A 1Q0HA 2VTDA 3F4LA 3PQFA 1KEPA 1SO8A 4Y6PA 4Y98A 4DA9A 3SLGA 1BXZA 4FJ2A 3LU1A 1WW8A 1KOLA 4U6QA 1PS9A 5U9CA 2RHCA 3R0IA 4OKNA 2C54A 3GG2A 1B26A 4LRTB 3RUAA 3RC1A 4D3SA 1ZMOA 1D1SA 5DP2A 3S2EA 1K6IA 1SCUA 2OP0A 3PP8A 1V3VA 2VYND 1YB4A 4E2XA 3OH8A 3RBZA 4XGKA 4NK4A 3RIHA 2PGJA 2Y0CA 1CRWG 3PXXA 3OETA 4PZCA 4NDNE 1EE9A 1E7MA 3PJFA 3DHEA 5L9AA 4PZEA 4R9RA 4AJ4A 4LSWA 1QLJA 3GLQA 3U62A 4CUJA 1DC5A 2E37A 2I9PA 2LDBA 5A9SA 2I3AA 3WBFA 4R1TA 4B4VA 4J9VA 2NU8A 2A9FA 1P1HA 4RDIA 2B36A 4PLFA 5ILOA 3TJRA 4DL9A 1WZIA 3BTUA 2HMVA 4RJTA 4OXKA 1BMDA 1GCOA 1GQ2A 4TZTA 3GA0A 1DDOA 5IXYA 4ALMA 4R51A 1RJWA 1FXSA 2A4KA 4FPXA 3DAPA 1ZK0A 4MP8A 1U1IA 2V6MA 1R4NB 4ALNA 3F5QA 2H5LA 5JO0A 4YAIA 5I8WA 4TROA 3G3EA 2ZTMA 4J4HA 2YHUA 3GVXA 2FN7A 1UDAA 3QWBA 2AQIA 3D0OA 2Y1FA 3DQPA 2VOJA 4F3YA 3QVXA 3EW7A 1V9LA 4J7CA 4K6CA 4DPLA 5IZCC 4GLLA 2C7VA 4GVXA 2VT2A 2WYVA 4PGFA 3L0DA 4KTTE 2PR2A 1NQ5A 1HE2A 2YV3A 4DIOA 2X9GA 4FJ0A 2JFGA 2ILTA 3F3SA 5AXCA 1VE9A 2X22A 2DUUA 2VUTA 1ZO8A 1E1KA 2GZ3A 4IQGA 1YGYA 4LISA 3X2EA 4IY1A 1VC2A 3WGTA 1MGOA 2P2SA 3DOCA 2Q4EA 3GEGA 3RUFA 4BHTA 4NHEA 1JW9B 2VZ8A 3HNPA 1U3UA 2VNAA 4UVIA 5GZ1A 3ZWNA 3PRJA 1CQIA 4XEHA 8LDHA 2VZ9A 4D3DA 4FDAA 4HNHA 1BRMA 1NPYA 2UUPA 4GX1A 4BNTA 3IOYA 4JROA 4CQMD 2B5VA 3DBVO 4JBHA 2C0CA 2RHRA 3M1AA 4PLVA 2XAAA 3UCEA 2NU6A 2EERA 3RUHA 3UICA 3I9KA 5G4LA 1PJSA 1T2AA 1SMKA 2PA3A 2OFPA 5KJFA 4GSKA 1NVTA 3JQ7B 3ZU2A 1BW9B 2WTBA 3RCBA 3EMKA 4NBRA 2O48X 4YRAA 3AUSA 4P4NA 2E49A 2QX7A 1I2ZA 1R4MA 2VHWA 3IMFA 4J91A 1U4OA 3JQAB 2JD1A 4RVUA 3M2TA 3PI7A 1BXKA 1J5PA 2RH4A 3EZLA 5G4KA 1X14A 3ON5A 3GUCA 1WMAA 2Y67A 5A4DA 5JS6A 5JAIA 5B12A 3IP3A 3F9IA 3DBRA 2VHVA 3K8ZA 1CQJA 4AJPA 1PGOA 3JQAD 3JD1A 1XU7A 1GUYA 4MVJA 4RPHA 2AHRA 1M2WA 3KYDA 3PLRA 4FGSA 2VWGA 3LC7O 1ENOA 3U9LA 3AU9A 3D4PA 2B4QA 3SJ7A 3ZWYA 4D7AA 2CY0A 1I32A 5J23A 1DHRA 1F06A 2I66A 3TPCA 1Y6JA 3WYEA 4ZVVA 5A5FA 1ULSA 4IZHA 3DZFA 4TRNA 5THQA 5JYDA 3ZWXA 4J49A 1ZSNA 3H9GA 4IXTA 1UR5A 1GTMA 1DAPA 4LSMA 2O7SA 5I7FA 2O4CA 5IN5A 2GNAA 2P91A 3BHJA 1EUDA 5JAZA 1YQGA 3ZDFA 5KCZA 3U0BA 2BFPA 2PLAA 4AJIA 2W4QA 4G81A 5A3VA 5B1YA 2OP1A 3GG9A 1ADGA 2BD0A 4N5NA 4BKOA 1P74A 2CZCA 4E31A 5COAA 3HB4X 4RPGA 4S1VA 4BB6A 4M87A 4PG6A 1Y81A 1KVUA 1EVZA 3AY3A 3TRIA 1AUPA 3VVCA 1XDWA 4IBOA 3S55A 1M6WA 4F46A 1G1AA 1T2FA 3K31A 2EWMA 4L0QA 4OL9A 1I2CA 1GZ6A 3U4DA 5T5QA 4NR0A 4YB8A 4YCAA 3D4OA 3PWSA 3AI3A 1QP8A 3KYCB 4OQZA 4BO0A 4IMRA 1IB6A 3L9XA 4XJTA 1DIAA 2R00A 3GVCA 3KSUA 5KJEA 5ITWA 5BSHA 4QXMA 1DIHA 1LNQA 3AFNA 4R1SA 4R68A 4RZIA 4H16A 2NV6A 1LDMA 3KLMX 2WD7A 3E82A 1I3NA 1IULA 1DAOA 2NVUB 4CM4A 2HO5A 5LCXA 2QIOA 3LT4A 4IIVA 4BNXA 1Z6ZA 3DZGA 1C3VA 4MVJE 3LSYA 2HJRA 2ZATA 4AJHA 1IPEA 3I83A 3ROQA 1HE5A 1TT5A 2O23A 5MDHA 4ND2A 1OZAA 4UVDA 1Q7GA 3WLEA 4D44A 1I10A 4ALLA 3DC2A 2CF6A 3DBLB 3LT0A 1XHLA 3QA9A 4TRJA 2BMAA 2OO5A 1HDZA 3HN7A 1PZGA 1E3LA 1MLDA 4YJFB 2Q45A 4J3FA 4N7RA 4CLEA 3ORFA 3F47A 3MJCA 4EUHA 1ZSYA 1N9GB 4WLUA 4DWVA 2XOXA 3K2EA 2GGSA 1GQYA 3NJ4A 2GPTA 5EMHA 2FZEA 3VDRA 5TX7A 1WZEA 5BSGA 3KETA 1JKFA 4Z9FA 3I9MA 2Z95A 3WJAA 4XCVA 4RV9A 3WYCA 3FPCA 2DTEA 2EKLA 4LCEA 5CAEA 1TI7A 1UDCA 5I7EA 3Q2IA 4XQCA 5KKCA 1E3EA 1GZ3A 1HT0A 2J3IA 4KZPA 5F5NA 1BGVA 2BKAA 5B37A 1FDWA 1PIWA 1QYWA 3VDQA 3WGGA 2GR9A 3A06A 4BKUA 2W98A 1WNTA 4CV0A 1P9LA 5BQFA 4PLHA 4QO8A 2AMFA 4Y8VA 3VPXA 5KJ6A 3G1UA 3LC1O 2X0RA 2CVOA 2IZ0A 2VRCD 1VJ0A 4NBTA 1JKJA 1QMGA 3NTQA 2Q1WA 3PHJA 4AVYA 5JAMA 3QWAA 4WK6A 3JYOA 3IP1A 1P33A 2B4TO 3JSAA
chains in the Genus database with same CATH superfamily
1GNQA 3F1KA 1R18A 4Z3KA 3HJNA 2TMYA 3W3ZB 5GV8A 4UU7A 1PJ8A 1T1RA 4B74A 1NBME 4DILA 1J2TA 3B6IA 1NC3A 1H2AS 2PKQO 3ZK9A 2OKGA 4RD1A 2HY7A 4JLNA 1RRMA 4OFWA 2P2CA 1ZM3A 2ZULA 3R5TA 2EX4A 1FLDA 4CL8A 2GN9A 1YFKA 2PMKA 2AN5A 4P9NA 5FBRB 2O8BA 1SD2A 1XDBA 1Q16A 2P7HA 4R1QA 3IT1A 1XMIA 2SCUA 1R3UA 1N2CA 4QUEA 721PA 2PT5A 1K89A 4MUKA 1Y9EA 4ZWNA 3PF8A 2H57A 3Q6IA 1WPGA 3U1VA 3EMVA 5A7GA 1U02A 4A36A 3C87A 3DV2A 1VJRA 3BRWA 2QE7D 3H5RA 4URFA 4DCNA 5C37A 2ZI3A 3LVBA 4MUGA 4D0RA 1QFXA 1YQUA 4JMPA 5CXSA 1RP1A 3JQBC 2Q4RA 1UBMS 2VJOA 1NUQA 3AUUA 1I0ZA 4LZLA 1PZNA 1DFIA 1ZC4A 3HJHA 3UJ9A 1HF3A 1WM1A 4QEKA 3GLRA 4R9UC 4A4DA 4LV8B 5JZBA 4ND4A 4HB3A 4PTYA 3SVTA 3ONFA 4HDMB 2C0PA 4D98A 1CP3A 3L01A 1YVEI 5CX1A 3D4LA 5FBVB 4YIKA 2AXEA 3BFJA 3IMEA 2VP6A 5FT9A 1FNNA 2VDKB 5LU9A 1XNJA 2NYVA 5T3YA 2P68A 3QEBZ 2B4RO 4PICA 4D45A 2J0SA 1BSVA 3EVBA 4M0KA 3SS8A 1T91A 3IQIX 4YMIA 4JGBA 4HEA6 4EJSA 1I5OA 3IH5A 1MAHA 1RCFA 4P6VF 4C4OA 4K0KB 3I28A 1BG6A 2OD7A 5EMKA 5F7JA 3ANMA 2HU7A 1DWOA 4D0GA 5ICSA 1Z8FA 3CEHA 4J7XA 2IP2A 2HCFA 4JLAA 2PX6A 5ALUA 2YXEA 1ILEA 2WJPA 4B09A 1U81A 1Y1LA 2W6JD 2B3DA 2IHYA 2GVNA 3D7SA 3E8SA 3FNIA 3QF4B 4G67A 3DKPA 4DQVA 2NVBA 4B34A 1U5CA 1DC6A 2VPIA 5A4MS 2REQB 1BW9A 4OHUA 1YU9A 4R3UC 3PVSA 4L5YA 2VPPA 4V02A 4ER3A 3HP4A 3FBTA 4YDQA 3TVDA 3RHSA 2E48A 4JB0A 4J2TA 4OPMA 2J3HA 4UULA 4QLBA 1JECA 2R7NA 1Z0ZA 4EEKA 1N2IA 4QGSA 2I6XA 4OU5A 4EHFA 3SIRA 4UBOA 4FB5A 2CWDA 1NTOA 2PZBA 4OEHA 3TCKA 1SUSA 4K1LA 2I4RA 2Q7XA 2Z3ZA 4LGVA 4DNOA 4XIYA 1SD1A 4JH0A 4EHNA 4AM8A 1T5IA 5B4VA 3G8AA 3NHYA 5C31A 2E9SA 1YWGO 3KT3A 4WK4B 4YK7A 4MYUA 4AJ2A 5FNVA 4V3BA 4J07A 4URYR 3RUIA 5J5AA 4L8WB 3HXOA 4DNPA 1DAMA 3UN1A 4WZBA 3VKVA 1N2CE 3D54D 3IHTA 5JDCC 2BOVA 3E6AA 1L4GA 3G0IA 1KH2A 1Q0ZA 3GA7A 3GLIE 4BZZA 4NVRA 4ZQEA 1B3BA 1TCVA 4ZTUB 3SF8A 3TGPA 1Y5RA 2VZEA 4P7GA 2LNDA 3WS7A 2IGBA 4BB9A 3OE5A 1D4FA 1ZIPA 4TYPA 3K6KA 1KEEA 3NTXA 3OZFA 3EF3A 1VJDA 4IEFB 4X1YB 4ZAGA 1GKLA 3TLMA 3WJ1A 4H31A 5ALIA 2WTUA 3E9RA 2C9CA 5EINA 3UJ6A 3WMEA 2LBPA 2X1MA 1PWXA 2E87A 1QTIA 4IHJF 1CZOA 1XLTC 2GPAA 2XAUA 2PG3A 4MWOA 4V38A 4NOKA 1YGPA 3N5KA 3DLHA 3LYAA 1L6RA 3H05A 2JCVA 3LX5A 1QKKA 4WERA 2EZ9A 1H4QA 3CN9A 4TLDA 4D74A 3HFGA 4R1LA 1Z6XA 3IL2A 4DNQA 4EA8A 4H15A 2UYCA 2YWEA 3Q3CA 1P2SA 2V3WA 3BWCA 2VJAA 2JLCA 3ES9A 3S1SA 2PWPA 1L5MA 4KUHA 4NICA 2VAVA 4PC1A 4LYJA 4NMWA 4CLHA 1R27A 3AL2A 2K7ZA 5J5VA 4I4TA 3VO9A 2AFRA 4YUAA 2JFHA 3SG0A 1DCMA 3GYBA 1JEOA 3DLIA 4EG5A 1TYBE 2YOFA 1ORWA 2QMZA 5CJ2A 1V8ZA 2QWXA 1I7LA 4PLCA 2OV2A 3IB6A 2GVDC 4OGFA 3QLUC 5T8KC 1JFVA 1ESMA 3DJYA 3B1YA 3E58A 2QSZA 3ADBA 3WGNA 3AETB 1RLMA 4CE6A 4RD6A 1XCLA 2YIJA 5BQ3A 4ZC8A 1XRPA 4I50B 1IXRC 3GFGA 4AF6A 1OTXA 3AEXA 2HCJB 3FNFA 2R1VB 2CUNA 1CUDA 1PYGA 1J24A 3SOPA 2C1EA 2VJKA 1JMYA 1W5SA 3GAFA 3MJFA 4LNUB 1E6LA 4G8JA 4KNWA 4Y9UA 2ECPA 1ULUA 1E9AA 2GPJA 3ME5A 3PVCA 5BOSA 2HKIA 4XM0A 5HNKA 4L57A 3MMNA 5JRDS 1XO1A 4X7MA 5B30A 3CG4A 4DY6A 3G0OA 5E8JA 4LZWA 2QT1A 1Z45A 2CMGA 4MV4A 4MVWA 4DT1B 5BYKA 5CD1A 4C3OB 1ELOA 2A9VA 4ZRMA 5J4VA 3V5NA 1G5IA 1OA0A 1JG6A 1N0HA 1PWEA 4Z9AA 3VPBA 2A59A 2CUZA 2JAPA 1CBUA 2B1RA 2G0TA 4GBED 4W7IA 2AUNA 3G89A 1XA3A 2O3UA 1OXUA 1JDJA 3O0TA 4IF4A 1ZIDA 4LJAA 3WLJA 2HCRA 4OKIA 4TLEA 1TKRA 4C03A 1IQUA 4AJEA 5JIBA 1Z26A 3M4JA 4GBGA 1UPFA 2MHCA 2C3YA 3INRA 3NNNA 3EG9B 1QCCA 2V5UA 1M2VB 1ZINA 3KD3A 5KIAA 3N2IA 4C0BA 4FHGA 3WK7A 1GT91 1B6RA 1O96B 4YJFA 4C4XA 4IQ0A 4ZRDA 3I12A 4QDOA 4LDPA 1BFUA 4NFSA 1R3DA 3ONDA 4FHCA 1RHKA 2JHPA 4M89A 4RK7A 5A4FS 5CIYA 3CH7A 3P4UA 2BIFA 1M67A 2HA6A 3NEYA 1NF9A 4JOSA 4WUVA 1C1DB 1SCBA 4B3DA 4XYMA 1PUXA 4KWTA 3KXLA 2IZOA 1B41A 1DKRA 1T8UA 3BDIA 3I76A 4ND8A 2V0CA 4TOIA 3SMVA 2QU8A 1EHIA 4JYZA 1NGSA 1ZUD1 4I1UA 3KV3O 3M9XA 2O8DA 5FHRA 3I92A 1QE0A 3BXEA 5I01A 1W75A 3KZXA 4GOOD 1CETA 2GTPA 3NWOA 4EY6A 1Y7HA 2W2VA 2BFDB 2JAHA 2VYVD 3C6XA 1R2QA 2P6MA 3E84A 4WOPA 3WKEA 4AP6A 4C87A 3D31A 3H9QA 2QJWA 3KLPX 4IJ6A 4J8PA 2QZ9A 2OAQ1 1LA2A 3HI6A 4K40A 5ENVA 4FFBA 5E4YA 4C43A 4WVLA 3SCZA 4BNYA 1PG5A 4TL8A 1G0OA 2XGOA 1KBQA 2IHJA 2Z5VA 4JJ4A 1RAAA 4XUEA 1EVQA 4AL4A 1FX0A 2GPSA 2IU4A 4BNNA 1J23A 1PT6A 5FBZA 1FYWA 1BHO1 2YMLA 1RZRD 1IRXA 1LLCA 3JALB 3K9QO 3L8EA 1IBKB 4RM3A 1RJ9A 4J6FA 3LBIA 3FOAA 5L4LA 5CB4A 5GONB 1L7EA 4BB5A 4RQTA 3EAGA 4P92A 2X1HA 1UMDA 2FFAA 4UNPA 3ID6C 4UEKA 3W9UA 2VDMB 4P36A 4CETA 3UFBA 5KYYA 5FTMA 1M8GA 3V2UA 1K66A 2C8JA 1YE8A 4MWTA 1U2PA 5CR9A 1E1MA 4MVJM 1A8QA 3EIXA 2X6RA 4ENQA 2NV0A 3ABSB 1R37A 1ZN7A 5H59A 3UNXA 1J2EA 4ARSA 1CJCA 4CQLB 5HW0A 4TYNA 2CNWD 2H2FA 4H3SA 3E9MA 3ZX4A 1XVIA 1UL1X 2P9JA 2D5LA 1JA0A 1Y4DE 3PE6A 2G08A 4W9MC 1VZ2A 2R8BA 5BSFA 1BDBA 2CJPA 3DOJA 4ZVKA 3PYXA 3WNQA 1F60A 1QH8A 1E2IA 4FMBB 4HZGA 3UAOA 4EWLA 3S1AA 4L6IA 3SGLA 4AIIA 3D8SA 4B6OA 3TPFA 4F56A 1R15A 1TYDE 4QFCA 4MS3B 3LTEA 2JASA 5IVIA 2E1PA 1MH1A 3NAGA 4N82A 3M6IA 4QGGA 1SRQA 3RVKA 3VNUA 2BJHA 1LPAB 4ANFA 1E2BA 1U5BA 3UJDA 1U0FA 3BGWA 2OXFA 2ZEJA 3LX6A 5LB2A 1C7ZA 1L1EA 3PFCA 5E8RA 4PSUA 2DFTA 3EUFA 5DGHA 1M7BA 1RRGA 3TAUA 5BNIA 3L0YA 1ORIA 1S8OA 2CSUA 2YVLA 2YX1A 3HL0A 3C7CB 3ASZA 2QL6A 3PUKA 4EPTA 5C18A 3FR7A 3GT4A 3HTXA 2I4IA 3SD7A 1V8OA 2P7IA 3IOCA 3QSYA 1S2NA 1BXGA 2P9TA 1Z4PX 1EGQA 3PDWA 1RPTA 2W43A 1ADJA 1A7AA 1P0PA 1ZG3A 3P9ZA 3HDGA 4UCFA 3ZPXA 1HNXB 2Q7OE 3P0JA 3LGSA 4R8RA 4BO6A 1T0PA 1K3TA 2WABA 1CUIA 1DB3A 2VUIB 3E3LA 3NDJA 3OTIA 2C29D 5T3UA 1U7TA 1E3SA 1RIFA 1TZCA 3PPIA 1H8HA 3HEBA 3AB8A 5G1PA 4F2GA 4G97A 4NESA 1EXNA 3ONVA 2CVHA 2YQZA 2B83A 3VPSA 2W6MA 3QPCA 2CV1A 1V5GA 1U6IA 1WXGA 1B16A 3ILSA 3OBIA 1WEHA 3K96A 1UKYA 4L5CA 4TQAA 5FPSA 5HFJA 2QD3A 4C3VA 1L2TA 4DV6B 1ZD2P 1AS3A 2QXYA 2QGNA 3CIOA 1L5WA 3ZH9B 4FMCB 1GY8A 2GILA 3GJ8A 3PRHA 3Q7PA 3TINA 4D8UA 3FOZA 5LD2C 1KRWA 3DXYA 3VSAA 4YJ3B 1KY5A 4YO7A 2IOHA 4GGOA 5FFMA 3M5PA 3PQEA 5CBPA 2ZAMA 4D92A 1MB3A 3S2YA 2YRWA 4WESB 1XYVA 1FRFS 3D8HA 4BIMA 2EGUA 4DLLA 4GZ3A 1XB2A 3COZA 3QX9A 1H9BA 2BMVA 2C3UA 3GP3A 4MVYA 4ND3A 1UADA 4W82A 1NVMB 4F7WA 3O8NA 1PDOA 4LXXA 2V9CA 4JLBA 4S1PA 4ZQCB 1J1IA 1RHUA 2P41A 4IDGA 5AXBA 1SBIA 1EX7A 3NHFA 1DO8A 4ZMRA 2H4ZA 3OBBA 1LW6E 1W4ZA 3N7AA 2H4HA 2BPOA 4YC7A 1RXSA 1CVLA 5HBGA 4BMSA 2C8KA 2WDPA 2IYRA 2QRPA 4P4LA 3OT5A 2IUSA 1GQQA 3UT6A 4M1SA 3E23A 1P45A 2B0JA 2ORYA 4DWJA 3GLIB 5FA6A 3HU2A 1QOZA 4UM9D 4MVJG 6YASA 1Y6RA 3R3WA 4M46A 1QRSA 1EUYA 1OLXA 4BFWA 3SBOA 3SYRA 3QKRA 2J67A 4CEHA 1ZJWA 1DI0A 1MIOA 5E6RA 4CQMB 1UOQA 1FSPA 4JDPA 5BUZA 2IYEA 2VHZA 2AOVA 4TLMB 4W5OA 1C3XA 2DETA 3CRZA 1L8LA 5LA6A 2Q1SA 1GLVA 3E22B 2DR0A 2ATEA 1ZS9A 5TT0A 4QFMA 5GVSA 5LZ4A 4MVJH 4W6QA 2QYOA 3LP8A 4EFNA 2ZYSA 2QXUA 2VJDA 2ZTUA 1I01A 1NUPA 3OOSA 4KE7A 3HRHA 3QLEA 2HMUA 1AKWA 2LXNA 4PFKA 4XQEA 4DC1A 1M76A 5I9LA 1S8AA 2JC3A 1ESNA 2C59A 4YBZA 2UYHA 4YP9A 2LDXA 1TMKA 1YA4A 3C7TA 3GAAA 4B87A 2QAIA 2WNSA 2YHIB 1E6CA 4OAQA 2I76A 1H0SA 4U39A 5ILQA 3QKWA 1KHHA 4Z3DA 2NO5A 3UW1A 2GBPA 4D4GA 2RCYA 3EFOA 3EYWA 4J0IA 5HIIA 3RSGA 3SPXA 4DMFA 3ABZA 3H4TA 1GSAA 4W9RA 1U2DC 4IMPA 4MYRA 2UZ0A 2GVZC 2XWBF 5LQNA 1QQTA 5TNXA 2GAOA 1Y8ZA 5IFLA 1WSBA 3GFOA 3ICPA 1UC8A 3IO3A 3ZKWA 4BC0A 1EE2A 1FP2A 2X9VA 1VCHA 4ZO9A 5IS2A 1ODLA 3H2ZA 1Q15A 1LBSA 4INPA 4RZXA 1K2WA 1G291 4JLMA 5EXPA 2NM0A 1C1XA 3C3JA 4WFIA 4PPYA 2JLVA 4GPAA 1ECLA 3AI1A 2EOAA 1QYXA 2PLRA 2QAJA 3LCCA 1A71A 1IEQA 2RCNA 3PJGA 4M53A 4Y6SA 4DLYA 3P97A 4WBSA 4RANA 4DVGA 3E7PA 2ZRNA 5BV0A 3CYFA 1AXEA 1IBSA 3CG0A 5FKJA 3EGDB 5JUWA 5KOHB 1J21A 2BBSA 2QTVA 2XOKD 4RNCA 4ZU6X 3SX4A 3IEIA 3MBIA 3FTFA 2ZJ0A 2ZAGA 1PJZA 3I6YA 2FKAA 1MGPA 1PR9A 5BORA 5DNUA 4AB1A 3K0FA 4IIJB 3KZNA 4ARIA 1AMNA 4Z3OA 3VR1A 4DRXA 1QQ6A 2P65A 3AI7A 4NCBA 4IIYA 2IEZA 2ZR9A 1A9TA 3AUFA 2VRNA 3KSRA 4NZ9A 3WA7A 3VPGA 1XZMA 3D1LA 3O3MB 1XZHA 1CUXA 4WOJA 1PQPA 1YD7A 3OESA 2ETVA 2ZIUB 4II3A 4OLJA 5CVDA 3LWDA 4YP6A 4AO8A 2XE6A 2VHXA 1O58A 3IXLA 1C41A 3LVFO 3U4QA 4JWKA 4LI0A 4URUR 4LF8B 1XEXB 2NQTA 1TADA 4FQ8A 2PRZA 1PZXA 3X1ZA 2IU0A 1ACLA 1UEXC 3FUCA 4U5QA 1EWYA 2YQ5A 4ID3A 3EIWA 3QLVA 2DKNA 4HEJA 3TTXA 2RBGA 3UG6A 2C2HA 2A1UB 1LSUA 4UM7A 3RVDA 4HADA 3L0IB 4RFSB 3G2OA 4LMRA 4NBVA 3VC1A 4GI5A 3QVOA 5ICMA 4J0GA 1KYIA 4ZYZA 2F6RA 3RVMA 1UMBA 3CMCO 3EDRA 3DDSA 2QTCA 5FL7D 3W06A 3VU3A 1FSGA 5AT1A 3MQ2A 1CUGA 3HPQA 3RSQA 4HPWA 2NLOA 4XRRA 1LC0A 2QYSA 3RUEA 3TSYA 4L8VA 4N49A 3TF5A 5DJ5A 5KMGB 1SD5A 4O2AF 2CF5A 2FLVA 3A27A 4J29A 1R0LA 3MILA 4BRWA 1N5RA 5AVUA 4RHYA 2QN9A 3Q8WA 4GPTA 4CN9A 2VH1A 3G85A 4INJA 3H9CA 3A4IA 3E8XA 1VGRA 1N3BA 3AJAA 3KPUA 4QYIB 2N46A 2FMKA 3CR8A 4IJWA 1E2MA 3WRVA 2E3JA 2H48A 4A0FA 2Z1MA 4ENWA 3U7RA 5FFFA 2XBUA 3F6YA 1N32B 4NY1A 4DMUB 2Q2VA 5CJJA 1M72A 1H6CA 4MUXA 2BSAA 3JPWA 3KR1A 4JDUA 1NIJA 2Q3EA 2WFAA 2F1KA 5D1HA 5AWFC 1Z7GA 5LD2B 5BV2P 2OV1A 1NOIA 1U7DA 2WUFA 1A04A 3C7KA 4X60A 1Z29A 4XPIA 4DLRA 1IDN1 1TD1A 2IP4A 4KIWA 4HWTA 1FXUA 2ZI4A 2OV4A 1O5IA 4L22A 4XD2A 4CM5A 1AO0A 2FOLA 2XSZA 3G2QA 1UAYA 1SUDA 4WXEA 2ZRDA 2VK8A 3CT4A 5AW3A 3ETJA 2F59A 3ESZA 2BMFA 2VDWB 2J9RA 1H23A 3NWJA 3P52A 4I6GA 4REMA 3W4KA 1V6SA 3AC0A 5FYQA 5THKA 5K8CA 1UC4B 3SQNA 3IE0A 2PO5A 3HP7A 1J7KA 3C7DB 2AEJA 3PNOA 4LZNA 4UEWA 3SOZA 1LTHR 4ETNA 4ZZIA 1NDHA 1DUSA 2WYOA 3FYCA 3N58A 4N0QA 4O4JB 2W8ZA 4ZAWA 3LLVA 2YCLA 2FPIA 2IYPA 1V1JA 1SB9A 4HDAA 4PNHA 1I3OA 4KUEA 5F2EA 1CUBA 3OC6A 5FHQA 5BQPA 2Z6UA 4BO1A 3QX3A 2C5FA 3FYUC 4QDTA 1MQAA 5ITZA 1EWQA 3DJFA 1L8OA 3C6ZA 2VF7A 1QQBA 3QFSA 1DNPA 5EFZA 2OCAA 3EA0A 1ZMXA 3D4NA 5JJIA 3JRWA 4XWAA 4B32A 4JP8A 4PZLA 1XPRA 3WLQA 1TF5A 3WAKA 1GG8A 3H2SA 4GAEA 1HMPA 1O9BA 3S7TA 2IZ1A 2GZRA 3GBSA 3SQLA 3KR9A 3W34A 5LP1A 4BXOB 3ZCXA 2WJZB 4ZZ2A 5HPYB 1OFHA 3L6DA 4QGAA 2HF2A 4XSVA 1GZ5A 2IZZA 3A9SA 2F1OA 1MEEA 1T5OA 2XMGA 1DRKA 1RW4A 4QICA 1WUJS 2EF1A 3KB8A 3K70C 4HWSA 3KBOA 4QYSA 5AJYA 2UXCB 1C1YA 1FP4B 2H8GA 4H7KA 5EIOA 2R86A 3IBGA 3DAFA 3DSRA 3UGQA 2K5UA 3GUHA 2JJYA 1YRAA 3AUJB 4YAFA 5JY1A 1GCAA 1TKBA 2LUOA 2V7XA 4DSUA 2BF4A 2E4AA 5B58C 1DBIA 2V7TA 1NYTA 1Y8CA 2DC1A 2WFLA 1KWKA 4A3SA 3CX3A 4MXDA 3BVPA 5BV7A 2CFSA 3WHLA 3V8EA 1G2OA 1ZRSA 2ZTLA 2EIHA 1GPH1 1NR1A 1NXQA 3HCDA 4GWKA 4RTSA 3GJSA 3EIQA 4BLPA 1RYEA 1JUDA 4WNCA 4O8CA 3SK0A 2PS9A 3SIXA 1MO3A 1PT7A 3H5OA 3ZZ1A 2C2ZA 3VZBA 1U31A 3GFPA 5JCOC 3FCCA 3CS3A 3UK2A 1JIQA 4EIWA 4RBNA 5CB4B 5DHPA 3TNJA 3ANNA 4WXPA 4YRSA 2WP0A 4PYRA 1D1PA 1XMOB 2XUZA 3P0IA 4N12A 3EH1A 3NEPX 3RTGA 3GF4A 2Z5GA 1ESDA 3RQSA 2CT8A 2YFQA 4CCSA 4PTZA 2R1UA 2ZSDA 3L7CA 4LSGA 2JAXA 3VHLB 1SBTA 3K1TA 2GI4A 1WXXA 3LW7A 4G4JA 4LC0A 4QOFA 3IUQA 4MPDA 5JAHA 3DE4X 4PC2A 4GECA 3AOGA 1H4TA 1RWNA 2F7SA 4K86A 3Q2KA 3NM5A 2NXJA 1UBTS 1FQWA 1YF3A 1ZOLA 2UVPB 2R8YA 2Y4NA 1DC3A 3LJKA 1RXWA 1GKIA 2X1LA 5A0VA 1NRIA 4XEUA 1NUHA 2LRHA 4PC3A 3W6NA 3WLLA 1FTYA 2BFOA 5EVJA 5KQPA 4UQLA 5K0ZA 2RI1A 3KX2A 3TW4A 4MDFA 5BRAA 2VATA 1G55A 3D5TA 5BN1A 3PFBA 2UV8A 2Y68A 3MAAC 4UVHA 3TZ6A 3NHSA 3OY7A 4NTZA 1AO3A 2XNCA 1N2ZA 4ND5A 5J4LA 2ISCA 3K4HA 5FUYA 1XX6A 4KXFB 3W3AA 4EECA 2R751 2FPKA 3B1KA 4PLYA 1KQ3A 1GILA 3NV9A 1ZUHA 4JHLA 4RH0A 1TYEB 2W6IA 4FFNA 1BYIA 3FE2A 4RQAA 4ZA2A 3VA7A 1ADBA 3GFQA 4ZOCA 3IKTA 3QLVC 5BSRA 1NUAA 2BGIA 2CUTA 4U02A 2IYAA 4Q4AB 5F9MA 4KFCA 2QJTA 1B2LA 1R0RE 3AFHA 1HOXA 1XRNA 1T6NA 3OF5A 5JG7A 1O0BA 2PGXA 4WFKA 1H22A 3CB2A 5FRDA 2O8EB 5DIZA 5EJ5A 1QAOA 4F9EA 3WKBA 1NE2A 2A94A 4DCGA 3JTEA 4TV9A 2F1JA 1LBQA 4BFSA 2P9QA 3V6LA 2R8RA 1ORVA 1AK1A 5E3HA 4BTLA 2GKGA 2I8LA 3GFRA 5DKFA 5JMOA 1BGXT 4LJSA 4ZU1X 4Q19A 1GFZA 1JHVA 4M3NA 5G0TA 1QYVA 2DAPA 4CNQA 2CXQA 4LJRA 4NS1A 4L4UA 4BWYA 1OZ0A 2VNKA 4G5SA 1AOXA 1E99A 2AW5A 3P27A 1DQYA 4LW8A 1GIAA 3UKOA 1N1GA 1JNYA 1UP6A 5TV2A 4DV7B 2AFHE 1GL3A 3LZCA 2H08A 4JJKA 1OFTA 4HGOA 5SZIA 1YDHA 3USCS 3W2FA 1JVNA 2XE8A 3JZAA 3NALA 3ANSA 4QG7A 1GTL1 4AYTA 4DA8A 5A4KA 1AK2A 1FNCA 2Y71A 3UJ8A 2BGMA 3T52A 2XIQA 2ONYA 3II6X 5EMNA 4DUYB 2JJ8A 2GKOA 4B4OA 3RS7A 2QRHA 1Y3HA 1XF1A 5K3EA 4A10A 3KEFA 2EGHA 1JDNA 2FUCA 3T12A 2TECE 3RB8A 3HO8A 3QGMA 4Z4HA 3AFOA 4YRMA 2Y05A 3DMNA 3W5IA 4O2BF 1J1ZA 5EPUA 3OUTA 1CW2B 5IJ9B 5JS7A 1L7DA 3AIIA 4JBYA 4C30A 5FUMA 2YJGA 3UWDA 1VIYA 2B1IA 2HK7A 4Y6LA 1FVOA 4UPVA 2OFFA 2Q6OA 1XMSA 3RFUA 1JHOA 4GOXA 5BW8A 3UK1A 3OM1A 2R48A 3AM1A 1OASA 1AZTA 1P7CA 1ZWKA 3SJCA 4CKWA 1Y8AA 2GBLC 4PO3X 4LRSB 3SSOA 4BL5A 1LY1A 3FYUB 3DE3X 3Q0TA 3CKKA 4ED9A 2JCGA 2YJ5A 1OZFA 3DE2X 5GWXA 3JWIA 1SG6A 1JZTA 3D8BA 1VHDA 1BN6A 2VVTA 3NBAA 4IRXA 4BFXA 2OZLA 4YJHB 2Y1GA 1FS4A 1ZIYA 3PDCA 2VTVA 2ENWA 4TQGA 1JLMA 4PCVA 3G6KA 4YJGA 5E6RB 3GZ4A 1J39A 2XUPA 4U0JA 1OFGA 2ZS7A 1GU0A 4GD3Q 4XOUA 3AVUA 1MT0A 1VRCA 1GQSA 3M4NA 4CL0A 2WI8A 1YC2A 3DT6A 4UBJA 3SDBA 2WSMA 3O0DA 5EP2A 1AKEA 4FGLA 4GYJA 5HE9A 3G5UA 13PKA 4UFPA 5TT1A 3DBHA 3L05A 4Q9IA 2YV5A 3SI7A 4BUJA 2P2DA 4F3CA 3K70B 1GGFA 2VXYA 3T3NA 3GGDA 1E3QA 1WPXA 2EBWA 2YYAA 2HF8A 1G7RA 1T0JB 5DYYA 1O6BA 1EEXB 5CRIA 3O8QA 4N0PA 2ST1A 3RVJA 5FTLA 1HUQA 4EO7A 3MHPA 3R4VA 5I8PA 3VNSA 2MSNA 1P3DA 2H52A 1ADFA 3DNMA 3I72A 3DL7A 3NJRA 3SC2B 3TZBA 3AP1A 1YHZA 3GRZA 4UMVA 4D9CA 2E18A 2RK4A 1TUBB 4FT2A 4ZAXA 3FYTA 1S7CA 3EIEA 4XWTA 4AULA 1LSOA 2C7BA 2I65A 3VHRA 1NU8A 2V7BA 3IKLA 2A9KA 4LMBA 3QEMA 5ARCA 1CKEA 4FCCA 3N75A 3CRQA 3DTVA 3OEED 1PU2A 4Y1GA 3OIWA 4NU5A 4L5BA 3FHCB 4UVEA 3HLKA 2X5KO 3DT8A 1PYOA 2BEUB 4G0VA 1CR0A 1H4VB 2REBA 2V7GA 2CCKA 2XE7A 1K7SN 1C1XB 2QD4A 2DQ4A 3WX0A 1NX9A 2W22A 3LTNC 3ZCSA 1KY2A 1L5HB 1Z22A 2E21A 2QLNA 1ZI9A 4TWIA 3PR3A 1Q1QA 1UK9A 3PG5A 4X7RA 1TMOA 1ID8A 3JX9A 5FTJA 3UB2A 1PFVA 1G4HA 4BNHA 1Q22A 1FU4A 1WDMA 3KPWA 1XA0A 3T7CA 5AI5A 3TL2A 2FE4A 1J2JA 1OVMA 2Q0QA 3QM1A 4QYWA 1DADA 4YRPA 4E08A 2IEYA 1GFWA 2XRFA 3PICA 3M49A 1ZISA 2CUKA 4CPDA 1P7WA 2XDYA 2ZAYA 4GL4A 3WB0A 4DM4A 5H02A 1DAHA 3ZV4A 3PD7A 4EGSA 4QVKA 3UMYA 3DDHA 1NVKA 3O26A 4PIVA 3WJ7A 4LX0A 4HCJA 3RYCB 1VB5A 1A8PA 4XGNA 4TXLA 5GPBA 4LKOA 1YTUA 4IFEA 2FG7C 2PUGA 2WEKA 1OOEA 4I5FA 5COQA 4R7GA 1QVWA 3GOQA 1H5UA 2XR1A 2AFIA 2H1SA 1R10A 4IJUA 3QWHA 3PPYA 4OU4A 4RABA 3E9QA 3UAZA 4CRWB 5IF9A 1PJ3A 3OLYA 2QUHA 4DCPA 1PVOA 3RUCA 3WRXA 2P5UA 4S0XA 3W5BA 4DSNA 4G0NA 4W9NA 2DBZA 4BGUA 3AR9A 3W4JA 3WZMA 1BQ3A 3TM4A 4EA7A 3AWDA 4ZVLA 1GPBA 3WGJA 3KM0A 1UP4A 2I22A 3KVYA 5JTUA 3A1NA 3DLAA 3N0RA 4DR3B 1DEOA 5ER9A 4AFNA 1GV1A 4PRLA 3UB4A 3R75A 5C2JB 2WJIA 3R7SA 1H2ZA 4OH1A 4JL5A 2COUA 1ECGA 3OJOA 3REFA 3TZLA 3WLMA 2I54A 5A1TA 1L4YA 2C4TA 3OCZA 3G0HA 1EM8A 3TRFA 3T3IA 1ZR2A 2GXUA 2Z8YA 1CNFA 2W2KB 1A95A 1T4GA 5EHGA 3ANLA 3WGMA 4OVKA 4V03A 5BURA 5HRUA 5BWBA 4YXFA 2JLRA 1XD9A 4ZICA 4B7AA 1UIMA 3MOSA 1A1VA 3GQVA 1YOBA 3WMGA 1T13A 1W5BA 2A14A 4S1WA 3VSBA 2ZYTX 3QVWA 4QU8A 4DLPA 1ZN8A 3FPEA 3TQIA 2O2EA 2TMDA 3ROXA 4NHOA 1WDTA 2JVKA 3K2IA 1MC5A 3N5CA 3NEJA 3PFKA 3X1KA 4AZSA 3FD8A 1U2GA 3ESXA 1SCAA 5DBFA 4D0SA 4RDXA 1PD1A 1KK2A 1ZESA 3KSDO 4PIMA 3X2FA 1FUEA 1SOMA 1FVXA 2FY8A 1L4HA 4NBLA 5AK5A 1VI5A 1VSVA 2LTAA 2ZI7A 4RZHA 1EGAA 1EBUA 2FZLA 1CDZA 2VJBA 4KQIA 4H7DA 4TSFD 3KAPA 4LK3A 4MJ3A 3TYXA 1FBTA 2Z83A 4G63A 1OYOA 1NXSA 4QSHA 3H8WA 2J30A 4FU0A 3T5TA 3UHAA 5B4TA 4YWJA 3RRNA 1P1IA 4R69A 1O08A 4RESA 1K6EA 4C7KA 2BUAA 3OM9A 1Q11A 4TWRA 3LECA 4P3KA 2PJZA 5TMDA 4CTOA 3CB4A 1ZUNA 4U2EA 5FPKA 1G2QA 1FDUA 3FAZA 1IWOA 3KK0A 1N6PA 5JMPA 2DGDA 1Z2NX 3O38A 1U7ZA 4EKYA 4CMBA 2VI5A 3GDGA 1TCBA 1GGHA 2RHLA 3JVIA 3NBMA 2ZXFA 3EVEA 3JARA 3O93A 4TTTS 2Q2WA 4B3HA 5LQCA 1AN9A 3U3OA 1ZJ6A 4YIHA 3D3NA 2JLQA 4EMSA 4E33A 1M66A 3SWWA 4BNMA 1NP3A 4AY3A 3NBXX 1UQRA 1ECCA 5D3MA 4LBYA 4MO2A 2ILVA 2R6AA 3D7NA 3IRVA 4JBLA 1NQXA 2AFIE 2Z08A 3O7MA 5ESWA 3SIWA 6REQA 3O7WA 1KMMA 1SKQA 1TM4E 3LRTA 1W1IA 2EKZA 3RYHB 2C4KA 2MSWA 3LL7A 3KYBA 5EVCA 4DDMA 1IPHA 6LDHA 4WN9A 5DX0A 4O4HB 4E46A 3GDFA 4XGRA 4MKRA 5IAOA 2JGRA 1K27A 1Z5WA 2MJLA 4MW7A 4H6WA 5ALMA 1W4LA 1PJ2A 4D9BA 3J80A 2RGUA 5IANA 2PRYA 3UKJA 1VYVA 2FZ4A 2OCPA 1N8NA 1NI3A 4IWXA 4RPKA 4D2IA 1W8IA 1E20A 1E3DA 4LRUA 1WMSA 2FWIA 2NWQA 2NPOA 2O1XA 2QVGA 7REQA 1LX7A 5LQAA 4ZOEA 2WV9A 2I2FA 4FKMA 4YTEA 1YA6A 3FPAA 3L18A 5JR3A 4DJTA 1DIBA 3AB7A 2D5BA 2GYUA 3C3AA 3VZRA 1RWKA 4TYMA 3DXFA 1OREA 4C7JA 3KAQA 4GE0A 3RVRA 1NLUA 4RQBA 4WZ6A 1BQEA 2AFHB 2Z43A 3FHOA 1KXZA 1TKAA 1EU1A 2FEPA 3U5TA 3D81A 3FOFC 1PNOA 1ESCA 1PD0A 2VRBA 2OXCA 3F74A 3PQ7A 2C3OA 4NZOA 2R1TB 1L5OA 4ZT7A 5GIOE 5D2CA 4CQNA 2I2XB 4TRRA 3WSTA 3N28A 1PQ4A 2ENUA 3P9QA 2MTBA 3U09A 1LRLA 2VPYA 4RH3A 4J1NA 3NT4A 4EB3A 2WTMA 3NDBB 1KSFX 2XWJI 3CZ4A 4P31A 5BR7A 3SZGA 2JLBA 5TMPA 2FUG1 3NHRA 1SCDA 1CR6A 2XUDA 2YZ2A 4QQKA 1NRJB 1HQKA 2H5JA 1JG7A 3LZDA 4PYOA 2M6KA 5ETJA 1EXDA 2J07A 2PUEA 1KZHA 4ARZA 1VJCA 2CVQA 3SJUA 5DBOA 1QIKA 2Y77A 1RXYA 4NSNA 4G41A 4TMYA 2F8MA 4CM9D 1Q7CA 4WMLA 2IDMA 4GPIB 4DJFC 2GEUA 1SBQA 4X44A 4X95A 1FFAA 4YR7A 3DZIA 3Q0IA 2GA8A 3WKAA 5I7RA 5LUAA 2ZRGA 4KODA 2HQRA 1G60A 2IVZA 3EE6A 2YDXA 9MHTA 3G9ZA 1U3GA 3I73A 4HAXA 2KW5A 4M0CA 1XCBA 4MPPA 2ZREA 3GA5A 4TM8A 4YONB 1MJFA 1MFPA 1J00A 3ZE7A 1AQUA 1QIEA 2OMKA 3TTVA 4BVAA 4EVRA 3T5DA 2MR5A 1V8DA 3AHJA 1K5DA 1RI4A 1HLPA 3ADKA 4MQ6A 5DCUA 1CDOA 1WBJB 2QY6A 4WD3A 3A0RB 3TTSA 4B5LA 1U7OA 3PQ4A 4B83A 3FNBA 4PNPA 1HSOA 1N2EA 3FROA 3H4MA 1EFVB 1ONSA 5BNZA 3M3HA 4BE4A 2WC1A 3HWRA 4H7IA 2O2CA 4C78A 4LRXA 3F8SA 3ZTYA 5FI0B 1CYDA 5GOZA 5A9RA 3W7AA 1WCIB 5AP9A 4IGFA 1E2GA 2BEKA 3JQ6A 4RIFA 5T6BA 1II8A 1NJ1A 3KU4A 2FZKA 2P79A 1YCFA 3R3VA 4MUNA 3ZU6A 4BCBA 4F7DA 1A9OA 1J8FA 4KOAA 3VKHA 1WBDA 4B3XA 1M9NA 4MLPA 2B4YA 1ODTC 3CW2A 1YZFA 4O08A 3L41A 1CZNA 3KUUA 1IBMB 3FIUA 3UMJA 1NW5A 2QTWB 4A8JC 4JLDA 4BP8A 9ATCA 3ULKA 1GR1A 4LQ4A 4F84A 1N6KA 3GRCA 3PQ5A 3W5DA 3Q12A 2PUTA 3VSEA 3ZEIA 3AF4A 1RMQA 3DTTA 3GRUA 1J0XO 1IZ9A 3IBYA 4HZUB 4QUAA 3DBIA 4FHEA 1EMDA 1OKKA 2CDCA 1FDTA 1WHTB 1U1FA 2VDJA 3GARA 1L5NA 3AR5A 3V1NA 2DU8A 1H0HA 3O5AA 3WQBA 4C22A 3A25A 3KEQA 1GVNB 4KDRA 3M1IA 1C4KA 2J3LA 2P4EA 2HWYA 4JCCA 2E82A 2V7EA 5AD1A 5HIMA 3CTPA 3VR0A 3V2IA 3DS8A 5AVYA 3IAM6 3KT6A 4FFRA 1K9SA 1P77A 3R20A 2RGAA 2QRGA 1DWQA 3SQWA 2WU8A 4V1CA 1OBCA 3LX8A 4KG7A 2I5PO 3VH3A 2FUKA 4Q02A 1QR6A 1JI3A 4M9ZA 3TLXA 4FHZA 3CO0S 4E0BA 3QTBA 1BWPA 1VYHA 2LPMA 2ODNA 4IHKA 2YYYA 3SC4A 3EIHA 4G0WA 4BFVA 2IKSA 4HQ6A 1UQTA 2WQZA 3HR4A 4W8OA 1U8FO 2HPAA 3S40A 1ONNA 4FM9A 1X1EA 3HUUA 3AERB 3GCGA 3P9SA 5EXEA 4MAMA 4EELA 3HYNA 4EY7A 4DR2B 1T8TA 3F5DA 4QLAA 3DZKA 2G80A 2YICA 4F5EA 2DCUA 3GEEA 4WK2B 1P9NA 4K6KA 4MW4A 1NVXQ 1P4JA 3R7NA 2UYOA 1FTGA 2OZLB 4G5GA 1UAGA 1J0DA 2Z2KA 3TE7A 2LKDA 1YOVA 1V7CA 2O2SA 2WBLC 3FUTA 3HYSA 3MJ4A 2VP5A 5DI3B 2MSCB 5K0JA 5E6UB 5FB3A 3PT5A 2RGGA 3VXKA 2AYXA 3HG7A 1YKSA 3T3DA 2XD9A 2AVDA 1SQSA 4TN1A 1IVSA 4MW9A 3HKCB 2ZWIA 3BGDA 4QD3A 1P7PA 1C30B 1XXHB 3BQMB 4U7TB 4IIDA 1AV7A 2ZM6B 1FIUA 4QQRA 2GXQA 1JFSA 1X0XA 2P2YA 3DBHB 5LP6F 1EGMB 3M33A 3OQIB 4Z0PA 2C9MA 1IJKA 1XTTA 1Y8QA 4Z4QA 2IHVA 2QRLA 3IQWA 4WH0A 1Z2CA 3M9WA 4N54A 5L3ZA 4D8WA 5IXSA 1TTQB 4WXMA 4GH5A 4R9NA 3SEQA 2J9ZB 4P54A 3D6NB 2CYAA 1OH7A 2WHQA 4EJFA 4AICA 4J16A 1UC5B 1Y9DA 3Q8KA 1OI3A 4AXXA 4KPUA 2I7TA 3ELWA 5L53A 5BSUA 3KWJA 1UMKA 4L4YA 4GQAA 4XLTA 3RPEA 4C0HA 2ZBQA 4CG1A 1ZWLA 5A5DA 4ENSA 3JASB 4E1VA 1GTSA 4N0DA 3ZHSA 2I99A 2Z4RA 3RIEA 3C16C 3W78A 1YJ5A 5E2BA 4ZPJA 2EV9A 4BMVA 2P9EA 4Z4IA 2C00A 4KE6A 2DT5A 1KWGA 2OV6A 2PGDA 2V7PA 3OX4A 3SDZA 1UT5A 1Y1RA 3BYZA 4AJKA 4EG0A 1UXGA 4FFSA 1OWOA 4HAIA 3F6CA 4EEXA 2C78A 1MG5A 4LJKA 4X20A 3UO8B 4QG3A 2D2FA 2Q8QA 3IVMA 4CMIB 2HBZA 3JZIA 2OILA 3C1OA 5ALLA 1MO5A 1AXRA 2C61A 2QL5A 3H16A 4FOPA 3WJ2A