4CMIB

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 96
structure length 251
sequence length 267
chains with identical sequence C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmiB00
2PH3A 3EY4A 4GX1A 2G5CA 1I0ZA 1RYDA 2VYND 2V6GA 3T4EA 3OIFA 1T25A 1CYDA 4CM4B 5BSHA 1UDBA 5C7IO 4YR9A 2UVDA 3KVOA 3GZ4A 5H81A 1HXHA 4QO7A 3EUWA 1IPEA 4QUKA 3GVHA 1I01A 3JQGB 4HP8A 3LF2A 4EJ0A 1QLJA 4E5YA 1ARZA 3VAZA 1JW9B 3WB9A 1GUYA 1HTBA 5DCYA 1GTMA 2GGSA 3K6JA 3RFVA 2VWQA 3S2GA 3TZCA 3B70A 3RBZA 3VPSA 5FI5A 3WYCA 5JY1A 1EUDA 4TVOA 3LC7O 1WMAA 3RUIA 4DLLA 1PGJA 5JAIA 2VHXA 3ZWXA 4ND2A 2HUNA 1OBFO 3JQGA 3ENKA 1ZK0A 5DP1A 2ZYAA 5T67A 1M76A 1EVJA 1JDJA 5CDYA 1V9LA 5ENVA 3DXFA 3H8VA 2X9GA 3WR5A 3W6UA 3IUPA 1U3TA 3WS7A 3FNFA 4M54A 1YS4A 4RV9A 3E5MA 1J5PA 4M55A 3S1LA 4DPLA 4PZCA 3U3XA 1I5RA 1XG5A 1BGVA 3GK3A 3ST7A 1LDBA 1MB4A 3F3SA 4FFOA 4DUPA 4IZHA 1JLLA 2R00C 1DOHA 3PFWO 4ALIA 5L45A 4ZN6A 4WCFB 3LF1A 4UEOA 5FI3A 4DLAA 4MVJE 4Z3KA 5I9MA 1U8FO 1KY4A 3H9JA 5A5FA 4F45A 1UXIA 4PLFA 4OXKA 1IOLA 4JN6B 1HYGA 1YKFA 1K89A 5JYEA 4OMUA 4QX6A 3U09A 3ONFA 4YRDA 4TWRA 1LLDA 4PLWA 2PD6A 3VPXA 3H4VA 3JD3A 4ND1A 4LN1A 4FGSA 3CUKA 1U1IA 5J23A 5IDQA 3GN1A 2VOEA 4CUZA 1F0YA 3LT0A 3CIFA 3OEWA 3LC1O 1FDSA 2NVUB 4WLEA 1WVGA 1LSJA 3GLQA 2Q45A 3JD0A 3DFZA 1E3JA 1BXKA 1DIHA 1ADFA 5AXCA 4E13A 3LK7A 5G0TA 4ZA2A 3IQDB 3OMLA 3K5PA 2GASA 1ENYA 3GMSA 3QIVA 5TT1A 4TRNA 3FHLA 3R3SA 1HDCA 2VZ9A 3S2EA 2R6JA 5C37A 1T24A 3R1IA 1E6EA 1U28A 3GHYA 4MP3A 3ZWPA 4D0SA 3I9MA 4XGIA 2ZTUA 5C5IA 2DVMA 3PI7A 1K6XA 4ZQFA 1XCBA 1X7GA 3BTOA 1IY8A 1W73A 2NUAA 1P1FA 2W90A 3PLRA 1X13A 2O23A 2Q46A 2YV1A 5A1TA 4JNKA 2E49A 4IBOA 4P4GA 5TSDA 2HLPA 3RJ9A 4E2YA 3Q3CA 3VC7A 1KS9A 2O4CA 2QYSA 1W4ZA 3H5NA 4GGPA 2W2KB 4EUHA 2DPHA 3DZGA 3NT2A 4YWJA 5F21A 5JPIA 1NQOA 3VDQA 1YXMA 2Y66A 3PGJA 3LLVA 4J7UA 3VH2A 1Q2XA 1VL8A 2ZCVA 4Y6PA 4Z3DA 4RPHA 4WJZA 2PZMA 3F1KA 3QWBA 4LRTB 5T6BA 5JNLA 5L4LA 1U7TA 1PWZA 2NU9A 2D2IA 1PS8A 3W4JA 4CMKA 2HJSA 4JBIA 5G0VA 3IP3A 2HK8A 3Q9UA 4PG7A 3L4BA 3UFXA 1GUFA 1PSDA 3S8MA 5CEJA 2X7HA 2C82A 4CLHA 2AMFA 5G4LA 3TSCA 4O1MA 4EDFA 5JCJA 3O03A 3KUXA 4YB8A 4INAA 4GAEA 2GN9A 3SC6A 4BNIA 1Y8QA 3OM9A 5A9SB 3AUAA 1HZJA 4UUOA 2POQX 1R6DA 4EEXA 2DBQA 3ZHZA 4I5FA 4PLHA 1GV0A 2DTEA 5JAMA 1DDOA 1NHWA 3PEFA 4MKRA 3RUDA 3H5RA 4CMBA 4RVSA 4DGSA 3WNQA 4N7RA 1SEPA 4WASA 4CLXA 3LZ6A 4IUYA 5MGBA 3NGXA 3ZHBA 1D8AA 2LDXA 2YJZA 4EYEA 4CMEC 5KOIA 3KEQA 2BF7A 3GC6A 3PXXA 1TT5A 1XLTA 2VRCA 2FSVA 3JSAA 2AA3A 1BWSA 4I08A 3WGOA 1WZIA 1YQDA 1OC4A 2VUUA 3CEAA 4Z9YA 2NU6A 4JBHA 1SOWA 2RIRA 2VRBA 2ZTVA 3D0OA 4FB5A 5I7EA 5TJHA 1UJMA 4Z9FA 2I67A 3DOJA 1I2CA 2HMWA 3MWEB 4WECA 5T8KC 5IG2A 4CPDA 5HM8A 4EBFA 1PGPA 1LA2A 4KP7A 4PLPA 5A04A 1X15A 4DIFA 3UHAA 1CWUA 2Q2VA 4CM7A 2VT2A 3FRJA 1H5QA 2EKQA 4J9VA 4RPGA 1EMDA 2BKAA 3L9XA 1ISJA 4BIIA 1P1IA 3FPLA 4URFA 4J0EA 3DAPA 2B4TO 3NJ8A 1YBMA 2X0JA 3BHMA 3EZLA 3MJSA 4GH5A 4R41A 4XR9A 2EF1A 3IJPA 2HDHA 4XYBA 3V1TC 3QA9A 4AJOA 3OECA 3ETGA 2Y99A 1H2HA 1KVSA 4P4NA 1E3LA 5JCXA 4QFDA 3NX4A 2OBYA 4DPKA 3T7EA 2O3UA 2NACA 3HZZA 4BNTA 4ZD6A 1U3VA 2C54A 5EN4A 4U7WA 3ZH2A 3W6ZA 3JTMA 1XYGA 2Q1SA 3I4FA 1KIFA 2Z95A 4XYEA 3WQQA 4BO6A 3MJ4A 2CF5A 2RBEA 4EJ6A 3DOCA 4W7HA 3RVDA 4CLDA 2A9FA 5TS3A 2VNSA 3D4PA 3GUYA 3NGLA 4FD3A 2R00A 3QW2A 4L4SA 2VYVA 1DC5A 3DZJA 3HQ4O 3PJGA 2UAGA 1K0UA 3GNSA 1YVEI 2EP7A 5TF4A 5KKCA 4RF4A 1H94A 3PLNA 3EAGA 3OQBA 1LQUA 3JV7A 4ND5A 1QLHA 5TT0A 2HK7A 2JCXA 1UZNA 1LI4A 2OL4A 4E2XA 3K92A 2PKRA 3BIOA 3C85A 4IGFA 1AXEA 3NAQA 2JAHA 1YL6A 5EMHA 5DNAA 2EJVA 1GPJA 3AOGA 6ADHA 4XRRA 4H16A 1OZAA 1P1HA 1T4BA 2WYUA 4L76A 4GKBA 5A3JA 3F5QA 4FJ1A 4CQMA 1GL3A 5I8ZA 2CFCA 3HDYA 2WWRA 1MX3A 2CY0A 1ZMOA 4XB1A 3SC4A 3WJ7A 3U9LA 1UXJA 3IC5A 1EDZA 1XEAA 1UP4A 3OBBA 4B4OA 2C0CA 4BNFA 4ZJUA 3LQFA 1E1KA 1DO8A 3F1LA 4NQZA 4MIEA 4PVCA 3X2FA 4AJIA 5U9CA 3AFMA 1ZUD1 3TF5A 1EVYA 1PGNA 1NQTA 4K1LA 4TSKA 5EJ2A 4E21A 1BG6A 4NK5A 1ISHA 2YDYA 2O7QA 4HADA 2GZ3A 5T57A 1PL7A 4G81A 3PDUA 4LVCA 4FFPA 4U8GA 2D5AA 5KJCA 3OEYA 1ISMA 4UVEA 4Q3DA 3PK0A 2VRCD 3MCVA 1BSVA 1HT0A 5TC4A 1HDGO 3WICA 4YQZA 4WLVA 1KY5A 1ZJZA 4IS3A 1LLUA 4M8SA 2ZJ1A 3HHPA 3U5TA 4CR8A 4Y9DA 5TQVA 1I30A 4Z9XA 1JN0A 4JLWA 5F1KA 3BA1A 1NAHA 3WGIA 1R4MB 1B8PA 4I9HA 2AXQA 3GG2A 4AICA 3ZU2A 4AJ1A 2BFAA 4F3YA 4CJXA 1I3NA 4EJMA 4IJKA 4HV4A 4IDAA 3U62A 1A9ZA 3VKVA 1LLCA 4C7KA 3I52A 1HE3A 3GDFA 2CUKA 1ZO8A 3QP9A 1DPGA 2W98A 2GR9A 2B4QA 1KYQA 1PTJA 4MINA 4PLTA 3VHRA 3NYWA 4NFYA 4P8RA 2EHDA 4LSMA 5G4KB 3L6OO 2GZ2A 3TDKA 4LCEA 3VH4A 3VZRA 4IGEA 1I33A 2V7PA 2P2SA 1HLPA 3WG9A 4DA9A 4OJNA 3W4KA 3MTJA 3ZWYA 2P68A 3PYLA 2J6IA 4LW8A 4KQXA 4RGBA 2RHCA 1Q7CA 3ZU4A 1QSGA 2EKLA 3TL3A 3NJ4A 4CR6A 2BFOA 4N5MA 1PIWA 5U1PA 4PLZA 1DJNA 3JQ6A 2AG8A 1PX0A 4BNWA 1T2FA 3QWIA 5DOZA 3RU7A 1DFHA 1JAXA 5AYVA 2FOIA 3KXDA 5JY6A 4YT8A 4PN3A 3N74A 4W99A 3PDJA 3SJ7A 2VHYA 1NPDA 3COSA 3QE3A 2FPPA 3RIHA 3WQRA 1O94A 4JBGA 3QY9A 3ANMA 1XKQA 3DC2A 2X23A 4NK4A 2ZATA 2R2GA 1U2GA 3I23A 4CMIA 2CVQA 3BMNB 4YAEA 3NT4A 1JAYA 1HL3A 3GZNB 5G0WA 1O89A 3QWFA 4E2WA 3SX2A 4CM8A 1NWCA 3H7AA 2OP0A 1EBFA 1M67A 4FS3A 1TLTA 2FWMX 4BGIA 1Q0HA 1E7SA 2JJYA 3DO5A 3OJ0A 4XIYA 4CMHA 5IDYA 2C7VA 3GGPA 3RKRA 1F06A 3JQBC 3GMDA 4DVJA 1ADBA 2CVZA 3FNEA 2EEZA 4WLUA 4BKRA 1U9JA 3STHA 1H9AA 4KDEA 3M1AA 3ZI0A 1RM5A 3JQ8B 1DLIA 2EERA 1PJCA 1CETA 3CZRA 3MTGA 5IN5A 5T8KA 5A5EA 3PHIA 3GA0A 4DMMA 3WFJA 2I3GA 4O6VA 5BNIA 2B5WA 4J2HA 3QJ5A 3JQAA 3ETEA 1PZGA 3KOUA 1NX6A 4KUGA 4J49A 4ZQHA 2J5KA 4BNVA 2A92A 4KUEA 1GQ2A 3UUWA 3KYDB 1PGOA 2AQIA 3NT5A 1YO6A 1Q0QA 1QKIA 3DBRA 1C0LA 1EBUA 2FPIA 4JCOA 3VZQA 4ZQBA 1D3AA 4Q3BA 5ICMA 3GRKA 3ULKA 1R12A 3ZNPA 2AHRA 1DAOA 1FDWA 1I3MA 1ZK1A 4GSLA 1I2ZA 2H1SA 2IYPA 3DAFA 4O59O 4IQGA 3VOSA 1NFFA 3BMCB 3RC2A 1MP0A 4MP6A 3E6AA 4JQCA 4CQLA 1NQAO 1UXHA 5JDCC 4A7PA 4ZICA 2B69A 3K2EA 2QW8A 3E9MA 3DBVO 2GYYA 5ADHA 4J4TA 4TROA 2J5QA 3EZYA 1C0KA 1XIVA 1N8KA 4J6FA 4BO4A 3KSZO 3BMCA 3RUHA 3RUCA 3M1LA 2NQ8A 1V8BA 3Q0EA 1SOVA 4B3HA 3KSUA 2NTVA 4WOKA 4XYLA 2Y68A 4U6SA 1GV1A 5IXYA 1B15A 3BTSA 4GL4A 2UUOA 1A5ZA 1SMKA 3I9NA 2X5JO 4J1SA 2PFGA 3V8BA 3WQSB 5JO0A 4DIBA 5JSFA 1N2SA 3BXXA 4JJFA 3GN2A 1XGKA 4RLHA 3ZNNA 1ZKMA 2VWPA 1RM3A 2OO5A 3TN7A 3H65A 4HFNA 1Q7BA 2B36A 5EQFA 4I5DA 4LRSB 3JQCA 2X4GA 5DCUA 2Y1CA 3RC7A 5U4QA 2X9VA 3KLPX 4I8XA 3PWZA 3U4IA 4IINA 3DQPA 4DXHA 1P45A 2I6TA 4GVXA 4R3NA 4YAIA 3W8DA 3ROPA 4N18A 4W82A 4WGGA 4D7AA 1NASA 2DFDA 5JW6A 4N5LA 4GX5A 2ZCUA 1E3EA 3CMCO 4YXFA 4MVJM 3UH1A 5B12A 4RF3A 3ZNOA 2B4RO 1KC3A 3O8QA 2BMAA 4J1NA 1G6KA 4JGBA 4AJ4A 4ITUA 4WNIA 2EXXA 4FIZA 3OP4A 4PRLA 4WE3A 3ANLA 5EIOA 3LT1A 4DBVO 1YBAA 4J43A 5FWNA 5JDIC 4IMRA 1FDUA 4AJ2A 3I6QA 1E3IA 3FNHA 4KTTE 2D0IA 4GI2A 5COQA 1O0SA 4A27A 5CAEA 2J3HA 2VHZA 4H3VA 3EC7A 4ALKA 3RC1A 1WAMA 4WK6A 4DMLA 4Z0TA 4LCJA 1P0FA 3I6IA 1V3UA 3CINA 1Y8RA 4LSWA 1MC5A 4BO1A 1C0PA 2Q3EA 3ZWCA 5JLAA 3G79A 1P74A 2I3AA 2RH8A 1R15A 1HE4A 3WNVA 4YAGA 3E8XA 3A28A 1HE2A 3JQ9C 1DC4A 3JYNA 5KWEA 1BXZA 2EWMA 2XF8A 4RPKA 5KKAA 2DM6A 4PLCA 3TZKA 3VPFA 5CFZA 4NJOA 2F00A 2AQ8A 1ONNA 1F14A 2Q1UA 4WOJA 1JWBB 3ITKA 2H63A 3B20A 1V35A 3QQPA 5B4TA 1E7RA 3JQAD 4CLOA 5BNTA 3ZHYA 1GU7A 2RCYA 3RBXA 4E5PA 1Z73A 4ZGWA 1N5DA 1Q0LA 3I1JA 4BNZA 2Y1FA 3E1KA 1YDEA 3GAZA 4IIVA 3TZ6A 4RF5A 3I9OA 4XGKA 4OL9A 3SXPA 3WGZA 2D8AA 1C1XA 3HADA 4JROA 4R3WA 4TRMA 1Y7TA 5BQFA 3KETA 5JS6A 1I3LA 1R0SA 2X0RA 2WE8A 4BV9A 4GLLA 1FDTA 3NTQA 2ZQYA 2PZKA 4WCDA 1EVIA 2VHWA 3FSRA 2A4KA 3RUAA 2HK9A 4KUHA 4CM9A 2PGLA 1FMCA 1GAEO 1BMDA 3OQ6A 3IKVA 2VTDA 1F17A 3AM3A 3EK2A 4OSOA 1A4IA 4R5MA 4XA8A 6LDHA 2B0JA 5ILGA 5HS6A 1UZLA 3O26A 2QIOA 5G2OA 4BMSA 3QVSA 1ZCJA 3GUCA 3V1YA 1RKXA 3PGXA 4ALMA 2RH4A 3LVFO 4R01A 3AY3A 4ZVVA 2AEMA 1VL0A 1NYTA 2OXIA 4IDGA 3WSVA 4IXWA 2X86A 3GPDG 4WNCA 2JHGA 3HNPA 3GFBA 2O4UX 3DBHA 1O8CA 3K9QO 1ZEJA 3GRPA 1DEHA 2HMUA 4YRBA 3OQ1A 3JQBA 3PHHA 4PFJA 3K96A 1PL6A 3WDSA 4TRJA 3KO8A 1MXFA 3U0BA 4XX0A 3VKUA 1C3VA 3C7CB 1XSEA 4NJMA 4D43A 3LC2O 2O3SA 3ZWNA 3PVZA 1A71A 1CF2O 3TZQA 1KVRA 2NLOA 3R0IA 3VPHA 2DQ4A 2O3QA 4WUVA 3W8EA 3TOXA 2X9NA 3V1UA 3HE3A 5B4UA 1QP8A 3AI2A 1R66A 4TKMA 2PD4A 4FFMA 4HBGA 4FQ8A 4WEQA 3Q2IA 1LDYA 3EDMA 5DF1A 4BB6A 2ZB8A 4HKTA 5K9ZA 1GYPA 1ZMTA 3PPIA 1ONPA 3DZBA 4B7XA 3L07A 3D3WA 1NWHA 5KJ6A 2I76A 4PZDA 5THKA 1G0NA 2P4QA 2HMVA 3SLKA 4D3SA 1DJQA 2CNBA 4OYRA 4YJDA 2X58A 5LDHA 3D3EA 4E31A 3UXYA 5TX7A 4YPOA 2H6EA 4E30A 1X1TA 4RF2A 1Z82A 1YQXA 3RFXA 5MDHA 1PQUA 1YH3A 4H7PA 3PP8A 4W9NC 4BUCA 3D4NA 2JFFA 3P7MA 3PIIA 1JVSA 5DN9A 5CHEA 2JL1A 3GHHA 4H15A 2Y0DA 3GF4A 5TNXA 1B7GO 3DHNA 3ROQA 1MC4A 4XGNA 2Z1MA 4J91A 4OKNA 2D59A 4QSMA 2WMDA 3MZ0A 1UZMA 2I65A 3GNQA 3JQ7B 3WLEA 4E33A 3H6KA 5IDWA 3PJEA 1TB4A 2O3JA 4YT4A 5IZCC 3FF4A 3DMTA 1BW9A 5DZSA 1ENPA 1PJTA 3PRJA 5HTOA 2DBVO 1QORA 4PVDA 3EVNA 4L74A 4YVFA 2O48X 4J0FA 1ZJYA 2Q4BA 2V6MA 4XJTA 1QR6A 5EERA 4BKPA 1GZ4A 4R4JA 3JQ7A 4CV1A 2QZ9A 1SB8A 3AM5A 2ZJ0A 4XZ3A 1PJ3A 3WFIA 4ZHSA 3P5SA 3PTZA 5A9RA 4G2NA 1YOVA 3KYCA 5JAZA 3CE6A 4MVJI 3JYLA 2WTBA 1RJWA 1U3WA 1WP4A 3DOOA 4RDHA 1A7KA 5L3ZA 3RASA 1E7YA 4CM9D 2Q1WA 4YJFA 1N9GA 1ISFA 1YL5A 5COBA 1ID1A 4EUFA 1T4DA 1PR3A 2DUUA 2AQKA 3NKLA 4FN4A 2JD0A 4GKVA 4I5EA 4K6FA 3RFTA 1F8FA 1VL6A 1E3SA 2VCYA 1A72A 4FCCA 4BOYA 3ZWMA 5I8WA 1Y8QB 3S2IA 4W4TA 4K9DA 4BNKA 1J6UA 2DTXA 2DUWA 4GQAA 1B14A 3TPCA 5JDIA 2YFHA 4CMCA 3O9ZA 4WPGA 3ONEA 5HA5A 3UOGA 4XQCA 2C5EA 3PQEA 3RWBA 1ZSVA 5BT9A 2PA3A 1NR1A 3PWKA 4D0RA 3F46A 2DPGA 4CLRA 1UAYA 4ESOA 5ITVA 1UAGA 4BL5A 1TT5B 3I5MA 1YBVA 1M75A 4IPTA 3RI3A 4Z0HO 5AXDA 5H82A 1P31A 4E5KA 4RZHA 3AU8A 2FZWA 3BTVA 4TMFA 1KERA 4CM3A 3JQ9A 3M2PA 4R9SA 3ZV3A 1GD1O 4OM8A 1LTHR 2GD1O 1EE2A 2VN8A 3G0OA 5A06A 2E37A 4RQUA 4W7IA 5I7SA 3MJCA 1GCOA 1TT7A 1KVUA 2BHLA 2I9PA 3GVXA 2ZTMA 4J2OA 3ZHXA 5A02A 4NHEA 3HN7A 4II3A 4DREA 3INGA 1ZH8A 2CZCA 2HQ1A 4Q9NA 1WDKA 4WEOA 2V6FA 3D64A 3SVTA 4QT0A 5I9NA 1FK8A 1JKIA 3RC9A 1BHSA 1AHHA 1IULA 1YL7A 1HYEA 4R1TA 8LDHA 1QYDA 4DL9A 3QVXA 3B1KA 3GDOA 4LVUA 4PGFA 4AJLA 4YYZA 1ZSYA 2Q99A 2EW8A 4YTEA 1T2AA 3HJAA 2ZK7A 2CDCA 4I5GA 4L0QA 4NH4A 3U4HA 4CM6A 3WIEA 4E4YA 3SBOA 4CLEA 1I8TA 2NVBA 3QVTA 2EKPA 4D79A 2DU8A 4J7XA 2PWZA 4YACA 1GQQA 4I9UA 3VH3A 2TMGA 1DAPA 3CMMA 4K6CA 4NG5A 4YT5A 3I9JA 3DDNA 4CUKA 1I24A 4JP3A 4BNXA 1ZXBA 3BMQA 2IXAA 1DB3A 3DAGA 4FW8A 3FTNA 4K28A 2RHRA 3ZW9A 4FSHA 2WJPA 2NNLD 2WYWA 2JD2A 2OFPA 3P2YA 1HDXA 1HDZA 1V3VA 1N7HA 1X14A 2D5CA 3H9QA 1O5IA 4QECA 4MDHA 1XA0A 2B37A 3GPIA 1D1SA 3FTPA 1EEHA 2VTEA 3JQEA 4TVBA 3KHUA 3RSHA 1TVEA 4AJNA 4CODB 2VZ8A 2UUPA 3BTUA 5IFLA 1MG5A 1K5HA 1IPFA 3FR8A 4DTIA 4BV8A 4JX8A 1PJ4A 1CERA 4CV2A 1XELA 4PLGA 4R5HA 2V6BA 3BMOA 3IKTA 1N92A 1YB1A 2A94A 5BR7A 3KM0A 2IZ1A 4KTVE 3VPGA 4RLSA 3E5RA 4CQMB 1GCUA 3AY7A 1GPDG 1LNQA 2SCUA 3AJRA 4IQ0A 1RPNA 1ZW1A 4MVJF 4A26A 3WGGA 4XKJA 2OZPA 3H2ZA 3ZWAA 4MIOA 1EUCA 3NV9A 1ZNQO 5FYDA 5TIIA 4YJHA 1EFKA 1L7DA 4HNHA 1SO8A 4NBWA 3C24A 1GUZA 3I3OA 4Q39A 4OHUA 2PH5A 4HFMA 4YT2A 1KC1A 5G0UA 2PD3A 5F5LA 2ZB3A 2QRJA 3H9EO 4UVIA 2NM0A 3I4CA 1LDEA 2Z1NA 5L95A 4W9NA 3IL2A 1Z74A 3AU9A 1I2BA 3GT0A 3NUGA 4CM5A 1GYQA 3DBLB 2OGUA 3DTYA 1CRWG 1ZVMA 2G1UA 4XCVA 4BO7A 5LC1A 1LC0A 3H5AA 4KWIA 1PL8A 1IHYA 2HCTA 2OMEA 4R54A 2BFPA 2BLLA 3PHJA 2WDZA 2CDBA 1RWBA 1H6BA 1HYHA 2G0TA 1LQTA 2AQHA 3G17A 1I32A 3CZMA 1QV6A 4FOSA 1LX6A 2ZYDA 1SNYA 1P0CA 3DBLA 3EW7A 3PQFA 3VZPA 1UUFA 1E1NA 3ZZNA 4IY1A 4FC6A 1EFLA 4XIJA 5IZCA 2YY7A 1Y5RA 5F1OA 1VE9A 3VTZA 1VJTA 4XDZA 4HFJA 1QRRA 3UN1A 4W6ZA 5B1YA 5DT9A 4Q3CA 1RM4A 5H83A 1T2CA 3DWFA 4IDFA 3FBGA 5CG1A 2E82A 3OJLA 4KDFA 3CKYA 2QYTA 3KZVA 3I83A 3H2SA 4UREA 5ICSA 4NPCA 2VUTA 1Y9AA 3INRA 4BO0A 1LC3A 1YWGO 4AJHA 5L7TA 3AI3A 2HRZA 3EMKA 1C1DA 1QYVA 2QQ5A 4BNHA 4F6CA 3DZFA 2OORA 2XAAA 4OKIA 5L7YA 2CD9A 5TJ9A 1EK6A 4OQYA 2FR8A 5L9AA 4RVFA 4DQUA 5IZ4A 1CIVA 3PYXA 1CQJA 1PEDA 4QTZA 1IYZA 5DBFA 2WM3A 1ADCA 3K8ZA 3IAHA 3DR3A 3HN2A 3GVIA 1B8VA 1P33A 2HKIA 1ISGA 1LDGA 1JKFA 2DTDA 2I5PO 3INTA 5CDUA 4BGEA 2WD8A 1D1TA 2DFVA 4ROSA 4N5NA 1W6UA 3ABIA 5F5NA 3UF0A 1NFRA 3AW9A 1WMBA 3UCFA 2ZB7A 2BI7A 3E9NA 3G1TA 4CMIB 4FFLA 4PCVA 4CV3A 4CM8B 1GR0A 1U7HA 4BQRA 4UVGA 1BDMA 4M89A 1E7QA 4M1QA 4UUMA 4XD2A 2GUGA 4GWKA 1ZK3A 5FFFA 2NSDA 5A05A 3U4DA 3C7AA 1NQ5A 4RORA 3WYEA 2AEJA 3JD2A 4CMEA 2P9CA 4IJVA 3PZBA 4B4UA 4YJGA 5L4SA 4C4OA 2J8ZA 4RZIA 3DZKA 2ZIZA 1JKJA 1DC6A 2NV6A 4BKOA 1HRDA 2BD0A 1O95A 3JQAB 3NDRA 4U0KA 2DC1A 1IE3A 1GFSA 3L9WA 3M6IA 1IZ9A 1Y6JA 2YHIA 4NNJA 1OI7A 1VKNA 1VM6A 3ONDA 1Z75A 3PWSA 4OSPA 4XQ9A 1E7MA 2Y1DA 3DBRB 4E5MA 3TWOA 2PLAA 4FC7A 3JQFC 1PJ2A 5CPFA 1HKUA 1S6YA 7ADHA 3PIDA 2XOXA 5A03A 4BO9A 1E6UA 4A0SA 4D46A 4BO5A 1BVUA 5C3MA 1YONA 1AHIA 2HMSA 3I9KA 2ILTA 1MGOA 4B8ZA 1KVTA 2PV7A 4IS2A 4J90A 4KWHA 1B26A 3AUTA 5GZ6A 3AOEC 4CQLB 5L40A 2IZ0A 1N7GA 8ADHA 4IDBA 4DBZA 1DHTA 4ID9A 1XR3A 1ZIDA 5F3RA 4BNJA 4PIVA 3IJRA 1WLYA 4MP8A 5KJEA 1PS0A 3O38A 4WCFC 4R51A 2NU7A 2X5OA 3OJOA 4B79A 1J0XO 2DKNA 4ZRMA 2NU8A 1A27A 3Q9NA 3W8FA 4NU6A 3WTCA 3RCBA 4HNGA 1NAIA 5KJ1A 3ICCA 9LDTA 2TMDA 3L6DA 2P5YA 4ZQGA 4B7CA 4Q3EA 5AOVA 5LDGA 4NI5A 2GPTA 2P4HX 3G49A 1K3TA 4QEDA 1N1GA 2H9IA 4ZRNA 3I9LA 2J3KA 3GNTA 2YHUA 4D3DA 3PJFA 5JYDA 4BB5A 1J4AA 1EQ2A 4XB2A 3UW3A 1LRJA 1NNUA 1WDMA 4ONEA 4DLBA 3C8MA 3P19A 2C5AA 4CMGA 1E0DA 3O8QB 1KBZA 5KVSA 3ICPA 3AWDA 2PZLA 3FI9A 3AI1A 1YB4A 4AL4A 3PQDA 3QHAA 4A03A 1R4NA 5HRUA 1X1EA 4I9NA 2NTNA 1NBOA 2ZB4A 1C14A 3ZWWA 1U3UA 2PGDA 4NDNE 1ISIA 2BI8A 3PFFA 1RM0A 4TZTA 1AUPA 1Y8RB 1Z6ZA 3TOZA 4ILKA 2GO1A 4DRYA 1IB6A 5IJZA 1FXSA 4GMGA 4E5NA 2JHFA 4OIMA 5LCXA 4O5OA 4GVLA 2Q4EA 2YUTA 2AE2A 3FBTA 3K73O 1JQBA 4NBRA 1E3WA 4L9RA 4BGUA 3ADOA 2O3TA 3WGYA 4PG6A 2W4QA 3UICA 3HFSA 4PRKA 3ZWVA 1Y5MA 5JAQA 1BDBA 5GZ1A 1R16A 2VZ0A 4HWKA 1GEEA 1LBEA 1N1EA 2X5KO 3GEDA 4PZEA 4B8WA 2FP4A 3C1OA 4CLOB 2WD7A 1P44A 4OQZA 3QVWA 3V2UA 3L4BC 2C29D 3D7LA 2Q2WA 1DLJA 3TQHA 4B4VA 5ILOA 1Z7BA 1IZ0A 1HETA 3A9WA 4U0JA 2B83A 2W2LD 3CXRA 1JWAB 5DULA 2IXBA 1C1XB 5CPBA 2C7GA 4GX2A 2PY6A 2OHXA 1ZFNA 3LLSA 4F6LA 2BELA 1DC3A 5DCWA 2QHXA 1U2DA 1R0LA 2RAFA 2X8LA 3C1TA 1ML3A 2AEFA 4BNUA 4RPJA 1BXGB 2EP5A 1QYXA 4BNGA 4II2A 1VRWA 4HXYA 5EINA 2GLXA 1X7HA 2JCVA 1PZEA 3RKUA 4XQGA 4NU5A 2VOJA 1UXGA 1O9BA 5KCZA 4RVDA 3UCEA 1ZZEA 4XYMA 4GX0A 2AW5A 1LRLA 1CQIA 1BXGA 1J49A 3HG7A 3Q11A 4TRRA 5JMPA 1X0VA 1OOEA 4Y98A 3UGKA 2Y1GA 1SEVA 3A14A 3GGOA 3DBHB 1WNTA 2YDXA 3D1LA 1VJ1A 1AE1A 5IN4A 3V5NA 3G1UA 3Q1LA 3GGGA 1HDRA 1NM5A 1PU2A 4A73A 4R1UA 2ZKLA 4GMFA 3TFQA 1LJ8A 1EK5A 2G17A 2YZ7A 4BS9A 4AG3A 1LSSA 4IIUA 4NJMB 3QV1A 1SZJG 4OH1A 1Q1NA 3BYZA 2JCYA 1I3KA 1SCUA 2DLDA 3PZRA 1NR7A 3WTBA 1ZXLA 2Y67A 1O6ZA 4J1QA 4CM4A 3L4SO 4XJSA 1V0JA 2YQ4A 1NHGA 1W0CA 3E82A 3OIDA 3FWNA 3ENNA 4AJKA 2IDZA 3JD1A 3ZV4A 3VVCA 4ALJA 1XQ6A 1PJLA 1MFZA 4ALNA 4FJ2A 4B7UA 1H93A 1XQ1A 1A9YA 1LU9A 4KMSA 3GAFA 1LDNA 3H3JA 2Y0CA 3DTTA 1B2LA 5B4VA 4PG8A 3D3WB 4K26A 4OXYA 1QYWA 3KBOA 3WBFA 1KETA 1HDOA 3JQFA 4Q3NA 1Y81A 2FMUA 4O63O 4G5HA 1JA9A 3IP1A 4L75A 2B35A 2X0IA 4WLOA 3VTFA 1BTOA 4FBGA 2WE7A 5KTKA 1C0IA 4YCAA 4P22A 3ITDA 3R3JA 3AOEA 3NDJA 3S55A 3W4IA 1U5CA 3WMWA 1MXHA 3CPSA 4D41A 3WYBA 2BGKA 3K30A 3QSGA 2Q2QA 2EGGA 3L6EA 4XWYA 1FF9A 4S1VA 2GSDA 3ANNA 3SJUA 4BNMA 2NTJA 4WCFA 1EUZA 3AY6A 1SB9A 1I36A 5BNFA 5JDCA 4GBJA 4IMPA 1BW9B 1DHRA 3TRIA 1PQWA 3JYQA 2FPGA 5THQA 1K6IA 1NP3A 3BHIA 3LSYA 1E1LA 2FSSA 3RD5A 4F46A 1GY8A 3C3XA 1VSVA 1QG6A 5K0ZA 4FPXA 1E5QA 1XU9A 4DPMA 2BRUA 1LLQA 1YOVB 3KYCB 1Y9EA 4MVJA 1WPQA 4J7CA 1EQUA 1PR9A 3WGHA 4DIOA 1YJ8A 2CVOA 3ADPA 1ZK4A 2NVUA 4UUPA 3WX0A 5HS4A 1NPTO 4YJFB 1F8GA 1N9GB 1PJQA 1YE3A 4UULA 4JXKA 3CSDA 1E77A 4Y6RA 3OIGA 4YBZA 4NBVA 2Y1EA 2V65A 3DFUA 1GADO 3ZGYA 4FGWA 1T2DA 4LGVA 2O50A 1AXGA 5DDIP 1ORRA 3TZHA 4J16A 3Q2KA 4UUNA 3JYPA 5IDXA 4MVJH 4M49A 3TL2A 1JVBA 3F4BA 4P38A 1NXQA 3WLFA 1V6AA 4D42A 4CLRB 3ZNQA 5COAA 1OC2A 3TNLA 4WLNA 2G76A 4MOWA 4D44A 2AE1A 1A4UA 2DT5A 3KRTA 3E48A 4X54A 3AFNA 2QZZA 4G65A 5FF9A 4CM1A 1BRMA 4MVJG 3WOHA 3DZHA 4BQPA 4BO8A 5AVOA 3CTMA 1KEWA 2CF6A 1GZ3A 4YRAA 5JFOA 3HSKA 2EJWA 1B8UA 3RQSA 4D45A 1M2WA 4ALLA 3MJEA 1QYCA 5EQDA 4RVUA 2C07A 4OOFA 4YEDA 4LMPA 3R6DA 2UV8A 1MFPA 2CSUA 2HJRA 4J3FA 4JJIA 1DIGA 1OAAA 1XU7A 1WXDA 2W2KA 3KYBA 4IM7A 4MO2A 4NBUA 3LT4A 5A3VA 4BMNA 4RO0A 3T7CA 4U5QA 2UDPA 3MEQA 3W1VA 3Q6IA 3SLGA 2HO5A 4RPLA 2EGHA 2YFQA 4DC0A 3VVBA 1DXYA 2VUSA 2WEKA 4AJJA 1UDAA 1P3DA 2NVWA 1JU9A 4HY3A 4CV0A 3L77A 1EDOA 1JTVA 5HBRA 4OO3A 1OMOA 1SPXA 3MOIA 4MKZA 4U6QA 1LSOA 2C20A 2GZ1A 1RYEA 1H6CA 2Q1TA 3FNGA 3OHSX 1XDWA 1NVGA 4FFNA 5A4DA 1CJCA 1EZ4A 4M86A 3RJ5A 3GQVA 4L8VA 2GERA 1HF3A 4HX5A 1FDVA 2OBNA 1GDHA 5A9SA 4DQXA 4DYVA 1SAYA 1XHLA 2FY8A 2XXBA 3ORFA 4XDYA 4P4LA 5IAAA 3LU1A 2BH9A 3ZV5A 3OFSA 2O7SA 4YAKA 4NR0A 2VQ3A 3ETDA 4JIGA 2YV3A 4MJLA 3V2HA 1YJQA 4ZQEA 4DQVA 4AFNA 3IOYA 1VLLA 4EEZA 4TZKA 3A06A 3BMQB 5F1PA 2I66A 1BVRA 5DOVA 4CUJA 2GN6A 1KEVA 1T2EA 3DB2A 3IUSA 4EI2A 3U49A 2HU2A 1EVZA 3ASUA 2BGLA 1VC2A 3WWYA 1DBVO 2JD1A 3IS3A 4RDIA 3B1JA 5BSEA 1M66A 4PLYA 4RCVA 3C1AA 1I10A 2LDBA 4XQEA 4Y67A 4WLFA 4MVJD 3ZWBA 3PJDA 2YYYA 3PYMA 3GG9A 4LK3A 5TGDA 3UKOA 4J9UE 2PNFA 4C7JA 3BMOB 1UH5A 1NVMB 1V3TA 5ENDA 3JCZA 4BVAA 1NFQA 2IZZA 1VSUA 1DRWA 4I1IA 3H3FA 1Q7GA 1YRLA 1CEQA 3SEFA 2NADA 1UR5A 1UP6A 3P2OA 1K6JA 1G0OA 1ZBQA 4ND3A 4TQGA 4YJHB 4HUJA 5EESA 2YV2A 3FWZA 1DRUA 4Q3AA 4BKUA 3MOGA 1LUAA 2BGMA 3TFOA 4UAGA 2P9EA 4MIYA 5KVQA 5KJFA 2HMTA 4EGFA 2VNAA 2IYOA 2FZEA 1M6HA 3E03A 4BO2A 3HWRA 3QLJA 3O4RA 3K2BA 3NEPX 3NDIA 3GOHA 2OOSA 2DBRA 4BMVA 2ZYGA 4PLVA 5JO9A 4BNLA 4PG5A 1Y1PA 3JD4A 2H5LA 3BAZA 3RROA 3B1FA 3DONA 3U4CA 1IUKA 4TKLA 3D4OA 1PZHA 1GEGA 2C59A 2QG4A 3E9QA 3ON5A 5EL0A 4LMRA 4IXTA 3HFGA 4CL3A 1TA4A 5AXBA 3H9UA 1Z45A 1U8XX 2ZTLA 3EVTA 3OICA 4IDDA 2BFMA 2IODA 3ZU3A 3ZU5A 5I9LA 2E48A 1R0KA 3OH8A 3OSUA 4ND4A 5CDTA 3NTOA 2UYYA 4YAJA 1UP7A 2AG5A 2OP1A 2JFGA 5ER6A 2O2YA 3EYWA 2JFHA 1MV8A 2Y0EA 4S3MA 3PHGA 3KEOA 2EG9A 2FR0A 4XYGA 3HB4X 1PS9A 4EITA 2Q49A 3F6YA 2CMDA 2GN8A 2P91A 5CEEA 5I7VA 5JCJD 1TI7A 4Y6SA 5L53A 3D5TA 3WWZA 1UXKA 1L1FA 4R68A 1WW8A 1ENOA 3DHEA 4UEKA 2J3IA 3VZSA 5GMOA 2IRWA 2W8ZA 2Y05A 4DWVA 3AM4A 2D4AA 3MJTA 3JQDA 4RQTA 3RUFA 4KQWA 3B6ZA 4OXNA 4XEHA 1TEHA 1PQPA 2YQ5A 3LYLA 3F5SA 5TLSA 1C1DB 3QWAA 1AGNA 1ADGA 1M6WA 5KNLA 1F12A 5HWSA 5K6AC 3F4LA 3QWHA 4CMAA 4YA6A 3BZUA 1H6AA 3TJRA 4R1SA 1DIAA 3VDRA 3LT2A 4GGOA 2O3RA 5CDSA 4L4XA 2GN4A 1LSUA 1MLDA 1YB5A 3DZIA 3NRCA 4B3IA 3UVEA 2PKQP 3WSWA 3L0DA 3ZWOA 4FDAA 1L7EA 2GNAA 2J3JA 4NFHA 1S7CA 1R37A 4J4BA 1VKOA 3D5QA 4A5OA 2YW9A 5JE8A 4OAQA 5L7WA 2F1KA 2FN7A 4ZU3A 4QFCA 2QRKA 2OUIA 5KVCA 1NPYA 2B5VA 3AUUA 3GVCA 1FJHA 1YQGA 4R9RA 4JJGA 4KOAA 1NVTA 1X0XA 5GY7A 4OGWA 1P1JA 5CDGA 3FN4A 3HDQA 3LDHA 1R4MA 3DL2A 5T64A 4A10A 1GQYA 4IQ8A 2QX7A 1T1SA 4A2CA 3UCXA 2NWQA 1U4SA 2IEDA 1IHXA 2VWGA 4FJ0A 3F9IA 1HLDA 4YJGB 3QVOA 1U5AA 5CP8A 3KV3O 5IXSA 2VT3A 3N58A 4BO3A 1X7DA 2EW2A 1W8DA 2HRBA 1P1KA 1ZSNA 2EIHA 4BHTA 2IEBA 4NIMA 2YHIB 1MG0A 2P5UA 5G4KA 4CMJA 3BHJA 2E6UX 2XPCA 5JC8A 1KEUA 4IJUA 5FEUA 4GSKA 2GDZA 3FPCA 4FFRA 1DFIA 3C7DB 4E3ZA 1H0KA 5JXWA 3GY0A 3GR6A 2WSBA 2VYVD 4IJWA 5JC1A 3ROMA 2I99A 3KTDA 2NQTA 4NZ9A 5CEFA 4J1TA 1K2WA 3V2GA 3S2FA 3DMYA 4AJEA 2W2LA 3ZCXA 1QXSA 4O0LA 4JK3A 3WBBA 2X22A 3A4VA 3OA0A 3FD8A 3ZN2A 3RAJA 1PZFA 1YGYA 4DC1A 4XR4A 5KIAA 2PKQO 3BMNA 4NMHA 3GZNA 5DBIA 3RBVA 2J5RA 5KVVA 1D4FA 2FHSA 4CQMD 5DBGA 1GYRA 1HEUA 1B0AA 1U4OA 3F47A 4R1NA 4PG4A 4YDRA 3KLMX 2GRAA 1A7AA 4M87A 1T1RA 4J4HA 3OJFA 4KZPA 2D1YA 2O2SA 3PHLA 3EHEA 4Z6KA 5BSGA 1VPDA 4HFRA 3T4XA 4AVYA 4BGVA 5TRTA 2ET6A 3OJEA 3A1NA 3HB5X 3E18A 4BNNA 1E92A 4MPDA 1HZZA 2X6TA 3JQ8A 4L4RA 4UVDA 3IDSA 5AQ1A 4RVHA 2JKVA 4MVJP 1MA0A 4YQYA 2Y93A 2VHVA 1DRVA 1GZ6A 5ES3A 1PWXA 4AJPA 5BSFA 4R69A 1ZK2A 4BKQA 2VYNA 1WWKA 2HSDA 5AXAA 1MUUA 4B3JA 3GDGA 4E6PA 5B37A 3GEMA 1ZEMA 3GFGA 3GEGA 4JP2A 3IMFA 3KB6A 3KSDO 1B3BA 1SBYA 4WKGA 3OA2A 2X1HA 3KYDA 3K31A 5G0SA 3ZDFA 3ZV6A 1T26A 5I7FA 1PGQA 1DIRA 1HSZA 1OFGA 3RUEA 2EV9A 4QQRA 3EGOA 3ZW8A 4QXMA 1QMGA 1B16A 1R4NB 2Y1OA 3G3EA 4XRGA 4D3FA 2IE0A 3IIEA 2G82A 5C7OO 4Y8VA 1WZEA 3H9GA 2QRLA 3QRWA 1KEPA 1IL0A 1ENZA 1PJSA 1DSSG 1LEHA 3GH3A 1PJBA 4FOOA 9LDBA 2HAEA 3MWDB 4NFSA 1P9LA 3DMTC 1H6DA 4UVHA 3OETA 1P1RA 4IDEA 4FR5A 4RL6A 1HSOA 5A9TA 3WJAA 1E3WB 1KOLA 3WMXA 2GCGA 3HUDA 1H9BA 5DP2A 2GF2A 2JAPA 4RJTA 5CG2A 2Z5LA 4E12A 1E5LA 1UDCA 2PGJA 3OF2A 3N7UA 4UEJA 2WD7B 1B3RA 1XWFA 3RU9A 1YDWA 2PK3A 2FR1A 3FCOA 5ER9A 5ITWA 3FR7A 5JMWA 2PTGA 1D7OA 4QO8A 2DBZA 1E6WA 1P77A 1WDLA 4LISA 1EE9A 1HDYA 4OOEA 4IDCA 3DEYX 2P9GA 3HDJA 3HDHA 2ZQZA 2PR2A 2DAPA 4CL8A 4MKXA 4Z0PA 2X0NA 5GZ3A 3M2TA 1DIBA 3ROKA 4E2ZA 4E0BA 1VI2A 1ONOA 2E4AA 4E32A 3UAGA 3MJVA 1SC6A 3DHYA 1QV7A 3WIDA 4BNYA 5K6AA 2Q50A 3AUSA 4EW6A 4R16A 1E1MA 1LDMA 1H2BA 2C2XA 1ULUA 2FRDA 4RVGA 2PZJA 3NTRA 3WXBA 1CDOA 1HWYA 1LRKA 3WGTA 1AN9A 4IZIA 4GPD1 4EUEA 2CDAA 2XXJA 4GWGA 4B4WA 1TXGA 4L73A 1G1AA 2VWHA 4DYDA 5T5QA 3CH6A 3JYOA 1DFGA 1ULSA 4EZBA 1NTOA 3AK4A 2A35A 3WGQA 5L4NA 5L51A 5JBIA 1LXCA 2D3TA 1VJ0A 3GVPA 4GLOA 5EPOA 3X2EA 4NBTA 1HE5A 4N54A 5C7LO 3ASVA 2WYVA 1Z7EA 2C2YA 4CR7A 1KVQA 1E7WA 3VH1A 5IF3A 7MDHA
chains in the Genus database with same CATH superfamily
2OM2A 2WTNA 4GX1A 3ZE0B 1FTYA 1SCUB 1NLZA 2ABWA 2Z0MA 1RYDA 1WF6A 2JATA 4OGGA 2V6GA 3OO0A 3TKAA 4CM4B 1UDBA 4EG5A 1YR1A 5C7IO 4LV6A 4HUQA 4CDMA 5A71A 4L5AA 3BL6A 1KSGA 1EGMB 3GZ4A 1PFGA 5H81A 5EJEA 4YMUA 1Q1QA 4DZZA 3EB9A 4OJQA 3WLTA 2HA5A 1YVDA 3I6MA 3VA7A 2Q27A 2BMDA 3MWFA 1YB7A 3H84A 4IG9A 5K0BA 5TR9A 1DEXA 2RGEA 2XWSA 4U39A 3RV4A 3PITA 5ALPA 4E5YA 1K6EA 1ZM2A 3DMFA 2KYRA 1NQVA 3VR4H 3WB9A 3CZ5A 1MHTA 1C81A 3VFDA 3BILA 3IHTA 4BZXA 3UGJA 1GTMA 1SIUA 1K8QA 2A9OA 3JVDA 3L06A 3VPSA 4LWOA 1TCBA 2WAXA 3WYCA 2IWHA 4I3GA 5HFAA 3QVGA 1ESDA 2BR5A 3A4LA 3VR5D 1KYYA 3HZHA 3JYHA 4B6GA 2RH5A 1QH8B 3I58A 3IRVA 3X1JA 4CF5A 4CKCB 3GPLA 5AOBA 1OBFO 3ENKA 2AYZA 1ZK0A 2V7BA 5CYFA 1M76A 3W1WA 1Z0FA 5ENVA 2EZTA 2X9GA 1CT9A 3RRBA 2PVPA 3WR5A 3IUPA 1U3TA 1PFUA 3LHDA 3NGMA 3QKUA 5K3DA 3WS7A 3FNFA 4AD8A 5BURA 5KX5B 4GLBA 5LQDA 1LI5A 3S68A 2ORYA 3S1LA 4PZCA 5K3FB 1I5RA 1KSFX 2CFSA 4CKCA 1QH8A 5BSKA 1XG5A 4YUZA 5BWBA 2PBRA 3C0KA 4M83A 1RQ7A 3AF2A 3F3SA 4CHGA 2YMLA 1NW3A 4DUPA 1N33B 3JATB 1UT6A 1X94A 1DOHA 1BD4A 1S2MA 2R00C 1HYBA 2REBA 5L45A 4JVLA 3DOHA 4WCFB 4UEOA 4MVJE 4MV3A 2Q6VA 4Z3KA 3ELBA 5I9MA 1U8FO 1WHTA 1NZDA 2J5BA 3H9JA 3O94A 4R7ZA 1L5WA 1QVVA 1X39A 2ZJ4A 1LB1B 1Y4AE 5K3FA 1PRYA 1T9KA 2PPVA 2WIAA 4XPIB 3A8TA 3IR7A 5EJGA 3L84A 4OMUA 1J1UA 4ZVLA 1JIKA 4TWRA 4J0IA 3JATA 3RTDA 4EYQA 1Z47A 2PD6A 3NHJA 3VPXA 5MFZA 5J2TB 3P8ZA 1YMQA 4JP1A 2WMOB 2YY5A 3NS7A 4FGSA 1CE8B 1U1IA 2P69A 4RMHA 4Y1EA 5IDQA 4YCNA 5J23A 2VOEA 1SHLA 2I9KA 3DZDA 1FP6A 3NYRA 2VF2A 1ZD3A 2JAXA 1N25A 2P4SA 5EWJB 3NFRA 2NVUB 4Q9JA 1DEOA 2VKTA 3MF4A 5MFPA 4RTOA 1GQSA 5FX2A 1LSJA 1N2CE 1JEYA 2UZ1B 1NMXA 2NG1A 1ZL0A 4MZDA 5KOYA 2QF7A 5LIPA 3RAPR 3DFZA 5J2TA 1E63A 3IX7A 4HDAA 4X7PA 1YZTA 5JRZA 4PYKA 5JSHA 4ARAA 5AXCA 4E13A 3H5VA 4IEIA 4OUKX 2HIHA 4Y6GB 5J2UB 3I04A 3NBFA 1UPCA 3ZH9B 4TX1A 4TRNA 3FHLA 4Z7QB 2QRGA 3K9GA 2JIZD 4QVGA 4WRRA 1PNRA 1HDCA 1S96A 4ZVOA 1N5KA 1XN4A 1L5QA 3S2EA 3H42B 3WRYC 3FJ1A 4YHHB 2H54A 1E6EA 3PR3A 2BR4A 3Q5GA 2DY0A 1KJWA 3GHYA 3ZWPA 2P2LA 3IB3A 4BKMA 5ILQA 1ATZA 4ASUA 3CNLA 2AJBA 5J2UA 2ZTUA 1Z0UA 4ER7A 1MRSA 3AP3A 3NTUA 3MPUA 1G2IA 4UM8B 3MJDA 4IO0A 1WNFA 3BTOA 3I8SA 5BWMA 1J2RA 1QIMA 4OYLA 5K8UA 1X13A 2O23A 3HS3A 2ICAA 2HSZA 3NWJA 4H7DA 5EP1A 2I29A 2NW6A 3Q98A 5E9QA 4QVIA 1ZS9A 4IWYA 5EXTA 1JJVA 1UKCA 2E49A 3E9CA 2NSLA 4E2YA 4OX9B 1CTQA 2YWRA 4ZKEA 3A7EA 3AP1A 1UODA 3IMEA 3NUZA 2I2BA 4WKBA 4YRRA 4EA8A 2QYOA 3OQHA 1FMFA 1PEYA 2N3ZA 2A1TS 5K0SA 2W2KB 1UF9A 1ZCAA 4U2BA 3DZGA 5LUBA 3UMCA 3NT2A 5JPIA 3FIJA 2V4ZA 5F21A 4ZOBA 4TOIA 3C7TA 3ZYZA 1E59A 1QQAA 2P2ZA 1O4VA 3LVRE 3SR0A 4ZANA 3LLVA 4F60A 3VH2A 1Q2XA 1TTHA 1U7ZA 1XZCA 5K0JA 3R6TA 5DYTA 4UEWA 3QWBA 2ROQA 1NT2A 3G9ZA 5JNLA 4WZ6A 3A6KA 5FUXA 1ZWLA 1PWZA 4KIGA 2QX9A 3LTEA 2NU9A 4LMBA 3SZRA 4PANA 1PS8A 4R9VA 1JPUA 1ZNWA 2HJSA 3R0JA 1QGOA 4X00A 5G0VA 3Q9UA 5A7FA 1JHMA 1VHQA 4RK5A 2JFYA 5A5GA 4H7KA 1U1GA 3M6AA 4RESA 3GJSA 4LHEA 3UFXA 1NUHA 1RYNA 3W5DA 5CD9A 1MC8A 2H4YA 3QTLA 3AF5A 1PFWA 4HTAA 2AMFA 2EWVA 2VDKB 4NCIA 2FK7A 1AB6A 2Z3WA 4DCVA 4EDFA 1IONA 4HDSB 2BFBB 3O03A 3OZFA 4OJMX 1JHDA 3BGOS 4WN3A 4DM3A 1D9XA 1DKOA 3EVBA 3M9LA 3SC6A 1JKXA 1P5JA 3NG1A 1NX9A 1A9TA 2POQX 5I7UA 4GNKA 4EEXA 2BC9A 1GDTA 3HXOA 1W5EA 3KTFA 2XGOA 1MJNA 4FTWA 2M1XA 3UUFA 1ODLA 4JYCA 2DTEA 1W5BA 2FQWA 5JAMA 2XEDA 2HTEA 3L1JA 3PEFA 4PFQA 3RUDA 3H5RA 3VR0A 2J7KA 4OM7A 5FPSA 3WLNA 4N7RA 5REQA 1N9KA 4HDSA 4PYLA 4P2GA 5E8JA 1LH0A 3NGXA 1U8AA 1FLNA 4QA9A 1K7EB 1CZOA 1U2GC 2X76A 3AZPA 1CQWA 1VKHA 3BJIC 3CLSC 3OOSA 3TCNA 2ODBA 4D80A 4F11A 5KOIA 4ENUA 3HWWA 2VRCA 4C1BA 5AW3A 1LVGA 3JSAA 5EZYF 1APBA 4ZOLF 3RNLA 4EY8A 1Y6RA 4XWWA 5CVCA 4DMFA 4BX9A 1J06A 1Q95A 3CLTC 2YFKA 3EN0A 3ER6A 4ZC8A 4N0EA 3SCZA 1IK4A 1Q84A 3E9EA 1KGDA 1OC4A 2VUUA 3CEAA 4KBGA 4Z9YA 4NOKA 1TE2A 2NU6A 3FPAA 4URWR 4JBHA 3LLUA 4WY5A 1Q0ZA 1QGAA 2YZMA 1G8GA 1TTQB 3U7RA 4FB5A 1DEKA 4I1VA 3UB4A 1VCNA 3L92A 1RT9A 4U9HS 4Z9FA 3VGPA 2JFNA 5IG2A 4I50F 1H2XA 1W29A 3QPVA 3OMWA 3FUXA 3KYIB 1LA2A 2CXRA 3CZPA 1K9SA 3LUGA 1PSWA 3WLPA 2EBFX 4YP7A 4L08A 1TCVA 4DIFA 1CWUA 2YL2A 4I81A 4EY3A 1BOFA 1NKTA 2D8MA 5AOCA 4V3BA 2GXAA 3QA3E 4F6RB 2VT2A 1YI8A 4IIDA 1M5UA 1YF3A 1A9PA 1RWNA 4LUCA 4J0EA 3CG4A 1RQGA 1XK7A 3OFNA 2WZBA 4R41A 1BWRA 1FBNA 3EDYA 1A5AB 1TL7C 4M1ZA 1GGJA 5AI8A 1F6BA 2QTLA 5EIAA 5EWMA 3CVUA 1VPWA 1HQDA 3FFBA 3V1TC 3EXAA 3WKCA 1RMYA 5ECDA 2QA5A 4ASUD 3BAFA 2CD7A 1YT5A 1H2HA 1KVSA 4I4CA 4Q1DA 4OMCA 3SEQA 1E3LA 1WU7A 4QFDA 5FBVB 2QPOA 4BQNA 3HO8A 1L7QA 3EBOA 3O8LA 2OBYA 1S9HA 4DPKA 2CE7A 2O3UA 3GXBA 1JQ5A 2EGUA 3SIWA 5EXPA 2LKDA 3NFYA 10MHA 3AVTA 2A2ZA 2JIQA 3L4JA 5KPJA 1R8SA 4U7WA 3E3OA 2P3LA 5B30A 4WNYA 1FVXA 1JMKC 1WB6A 3AFGA 3PGKA 1KIFA 1KZ9A 4BO6A 1AN0A 2DFPA 4EQ6A 1JIVA 4QOEA 1X70A 2UYQA 3FI0A 1E32A 2EJBA 2A9FA 3COYA 3OF3A 4QAJA 5JCOC 1MORA 3D4PA 4QFMA 4F3KA 5F23A 5I6DA 3PTAA 1XAJA 1TPYA 3PJGA 3HQ4O 1K0UA 3L6UA 5BRNA 5IULC 2HMYB 1AUOA 5TMPA 4IGAA 1KMMA 2Z2IA 3MT0A 1J7JA 3PLNA 4P0QB 4JUAA 2IGTA 1QQ6A 1I7NA 2Z9DA 3EFEA 5CM9C 1M1YA 2BKLA 3K92A 2Y1WA 1X74A 2PKRA 3C85A 4IGFA 1P6QA 4Y2VA 3VVMA 5KSOA 4QUDA 1P4JA 1CG6A 2DHCA 2JAHA 5IAOA 2EJVA 5FULA 3V7FA 4S35A 3AOGA 3I6BA 4LRUA 3SC2A 3KSRA 4OCZA 4XRRA 2OAGA 1XVTA 1FOEB 1XTJA 4N48A 5KPDA 1X7ZB 2W6NA 1GA6A 2ZYHA 2CHUA 4M98A 1QE3A 4OHXA 4K40A 5JTTA 4B3FX 2CFCA 3BGVA 1MX3A 2DG2A 1AIPA 1EU1A 2O7NA 3FYCA 3E4CA 4X95A 3TBHA 1DX9A 3U9LA 1XEAA 3FGOA 1EIZA 3ISTA 4TSFA 2C0CA 1ZUIA 1M0TA 3D02A 3VVLA 3LQFA 4B4OA 4BNFA 2WB4A 3BWYA 1LJUA 3IQZA 4ABYA 5DTQA 3X2FA 3AFMA 221PA 1ZUD1 2GEJA 2IGBA 4JGGA 3TF5A 2OHJA 2QXYA 4OX9Y 1CHDA 1IQ0A 1WW2A 1HQCA 2CUZA 4LRYA 1X7ZA 3TD6A 2O7QA 2NSYA 3WC4A 3GEIA 1G8MA 5T57A 3UXEA 1M83A 1PL7A 3IQXA 3PDUA 4X6LA 5T41A 4ESVA 2VJPA 4U8GA 2KBFA 2D5AA 2QGFA 4FX5A 4UVEA 4NATA 4EG1A 2QTRA 4OFXA 4EYSA 5KJCA 3PK0A 4L0DA 2VRCD 3MCVA 3D43A 2W5UA 2WVGA 1Y33E 2WHPB 2HHLA 2XVXA 3KS9A 1HDGO 3EZ6A 5E6SB 4D9BA 1IBRA 1SWWA 1ZJZA 1DE0A 2Z2JA 3URMA 4M8SA 1KI6B 2B0CA 4YAUA 2M6RA 2WPNA 3BIXA 1A97A 5TQVA 4EHKA 2BBOA 2OAP1 3J7TA 4Z9XA 2HV9A 4PQGA 3UMRA 5IX8A 4RTNA 2QTMA 5ALVA 4PICA 4F2HA 5FLKA 4L02A 2KW5A 3QBDA 1RKUA 2GZMA 4AN0A 1E0KA 2WHPA 5TGZA 3EVGA 2FWAA 1PYGA 1VCMA 2BFAA 1UBLS 1N2BA 2GT1A 2VDRB 2XMGA 4F3YA 4XTRA 1E9AA 1KI6A 1ZRMA 3HVKA 3PC8A 4FINA 4IDAA 1Q6YA 2CE2X 3VOBA 4C7KA 1SD5A 4R40A 3I52A 4ZI3A 4JU9A 1WZUA 1T6BY 4O2BF 1XRJA 3AL2A 1KYQA 1PTJA 3DLPX 3ZCTA 4ER0A 3O0DA 3QU7A 5JQWA 2VHCA 1JXOA 1TIKA 3LQ4A 3ZEAA 1V7CA 3MFQA 1C9YA 3L6OO 4LSMA 4LCEA 5G4KB 2G7MC 1E0JA 2GXQA 2ZBPA 5IBCA 2RG1A 4I99A 3VZRA 2G9RA 1E2FA 2LVBA 1OXKB 4YRJA 1X7WB 2FFJA 3PYLA 4P2BA 1QIFA 1RPJA 4KQXA 4PHTA 4RGBA 3PXGA 2RHCA 2L17A 5I4IA 1QSGA 2HRQA 1TTTA 1A7UA 2MSWA 2V5AA 3E22A 4CR6A 1ORDA 2HCRA 3AONB 4MJXA 5EE5B 3WV5A 5BVGB 4N5DA 1M2OB 2LPMA 2OQIA 4WVFA 3K70C 1PX0A 1QC5B 3CX7A 3H0EA 1T2FA 3QOXA 2WKQA 1C29B 3T7JA 1DFHA 5KSPA 3C4JA 1JAXA 3QXXA 5AYVA 2XMZA 2FOIA 3KXDA 4TKUB 3B60A 2QL5A 2P3OA 2BCEA 3CSSA 5GAJA 2Q7DA 2LCIA 3ZKWB 4MDFA 1NLFA 2FEKA 1L8QA 3BB1A 1ZAKA 3SKVA 1T3LA 2VPZA 3HC7A 3QE3A 4TQUS 5C9ZA 1OFUX 2DPLA 2GZHA 3DWIA 3QY9A 5DB4A 1XKQA 2ZSFA 4DW8A 5A2QA 2ZATA 2RAVA 3I23A 3BMNB 3ZQKA 5G0WA 3GP5A 1QC5A 4L5YA 2GOYA 4BATA 2X42A 4E2WA 3H7AA 1OPXA 2ZJ6A 1M67A 3PRKE 1BDIA 2QMZA 3PFGA 4KO8A 4BGIA 1F38A 3K32A 4FUQA 4IMJB 2VNHA 2C9OA 3AESB 4DA0A 2NSJA 4D4HA 4EL0A 2ZT7A 1CEXA 2VK1A 2QWXA 4OHRA 5BSWA 4B6OA 1QOPB 4HQ6A 4GOLD 3MK31 1F06A 4PHHA 5FL7A 3GMDA 5J5AA 1QGED 2OHVA 4RYDA 2TMKA 4D2IA 3E9YA 4JB3A 4WW0A 4JLOA 1WA5A 4P36A 4W8OA 1ZAYA 2BSXA 2RK6A 1BH2A 1WXWA 3ZQUA 3DWEX 1HK7A 1P29A 2C8JA 2EERA 1G8JA 1NVDA 2VO1A 5T8KA 3LHKA 3N2EA 5A5EA 3DE4X 3PHIA 3RS5A 2BTEA 4FWBA 2H9YA 5FQNA 5MN6A 2ZPAA 3JQAA 1ZPDA 4KUGA 1NX6A 2NO5A 1RHJA 4FGLA 3RC3A 2C42A 4DRXA 2J5KA 2XUJA 3I34X 5FFMA 4BNVA 2DRIA 4D0GA 4I9FA 4RA6B 1EP2B 1Q0UA 3O82A 1R74A 4RK6A 1S9DA 4MUHA 3UO8B 2Z98A 1EYZA 4HATA 3DMHA 2AQIA 4KR3A 5LNK6 2A4MA 4QLOA 2H5IA 3ZHUA 1UBJS 2QZJA 1XTRA 1WP9A 3GIWA 3TLGB 3RFFA 1EBUA 1IWPB 4IVQA 3PA8A 2REXB 4FNAA 2V1XA 2EFHB 1L5HA 4TWIA 3E0XA 4R0NA 3ULKA 2AHRA 1OI4A 1DAOA 1T8PA 3V1KA 2O2EA 4WDQA 5KC9A 1I2ZA 4O59O 1TJ3A 3DAFA 4TV9A 4FHCA 3IBSA 2HNAA 2VVTA 3FPKA 4D9CA 3TLGA 2WTMA 3KNZA 1CJVC 4C6RA 1V8PA 1KQ3A 4CQLA 3I73A 4HGYA 3K2EA 4KACA 5TVKA 3N0VA 1NDQA 3KTOA 1S2IA 4N6GA 1RKQA 3P9KA 5ADHA 2V5VA 2J5QA 4TROA 4Q5IA 1T3HA 1Y4UA 5H8WA 5D3KA 1ZH6A 1DAEA 2ZRQA 1XIVA 1DWPA 2B94A 3KSZO 4BO4A 1ZOSA 3RUHA 1N0VC 4DN6A 1I9GA 3NNSA 3Q0EA 5AP9A 3PKZA 1NRJB 3H1BA 1NYQA 4EB3A 3B13B 3D6FA 4BLRA 3OCWA 3U48A 4RTKA 1T3SA 1B15A 4GL4A 2D5BA 2QKYA 4EX7A 1TMGE 2PMBA 2QN1A 2XMQA 4N39A 1W48A 4LQLA 1JR3D 1T3ZA 4J1SA 4W1SA 3V8BA 5JO0A 4DIBA 2DKFA 3OIWA 3IUEA 1N2SA 1SKYE 3EIUA 3IMCA 4ENWA 2X77A 1XGKA 2C8LA 1ZKMA 3ZNNA 1RM3A 4LOJA 1DOAA 2ZE7A 3H65A 4HFNA 3HVUA 2AVDA 2TS1A 5CNMA 4MRAA 1G5FA 4B3MB 1USGA 1DAFA 1Q0RA 3MOSA 3OPMA 3KLPX 2P9QA 4MYTA 3PWZA 4RGYA 4D9KA 3WAGA 2V1UA 1DKQA 2AC4A 2I7VA 2FG6C 3GJTA 4MDYA 4DXHA 5ADUS 2I6TA 4P7KA 3DDOA 2CL6X 1UFOA 3LKBA 3RFCA 3VYWA 1TW3A 3I5YA 1CUJA 4JT8A 4N18A 1SKYB 2YVAA 4JOQA 4GX5A 4HYYA 4NNPA 5CT5A 3CMCO 4LFCB 3V97A 4H7FA 2BHNA 3EFOB 5B12A 3C5HA 5G1NA 1UDXA 1B0UA 1C4OA 4XVUA 2WRZA 3O8QA 2BMAA 4QYTA 2IV7A 4JGBA 5K3AA 4AJ4A 4OHMA 2EXXA 4WE3A 2FFQA 4DBVO 4KQEA 4N47A 3ED1A 3NPAA 4JQZA 3D1VA 3OZBA 4DT1B 3FNHA 4HNAB 2ECPA 1KMQA 4G1MB 2FLWA 5DK4A 3S6JA 5CAEA 2BUAA 2Y4OA 2IEZA 2J3HA 2VHZA 3Q7TA 3EFOA 4ALKA 4LF9B 2W0SA 4Z0TA 2JRLA 1P0FA 2EOAA 4WA8A 5D85A 1I5EA 3GLIE 3CINA 1Y8RA 4MPPA 4LSWA 1MC5A 3MQ4A 1RXYA 1C0PA 5JLAA 4G1UC 1P74A 1NE2A 1US8B 4IVNA 2XI4A 2VA9A 2RH8A 1N8SA 1R15A 4MUIA 3WGUA 4EJSA 3T9BA 1R2QA 2YX1A 4DT1A 4LJLA 2BWJA 3JQ9C 5AHKA 1DDIA 1VKZA 2EWMA 4B33A 2O8FB 4IDPA 4PLCA 1N1DA 1H0RA 2VK8A 4KFRA 3UT6A 5IJ0A 2MU1A 2IQIA 3QEBZ 3NASA 2Q9AA 3CLUC 3WL5A 2C9DA 2J4DA 4EYOA 5I7HA 2XBMA 3GLIB 1V35A 5B4TA 1K7CA 3HI4A 3JQAD 2GILA 2QRUA 1G8SA 2R6R1 2VDNB 4KBFA 2NPFA 4FZJA 3WP0A 1WPXA 2V7QD 4KMRA 2FKAA 4E70A 3TKLA 4M7WA 2ZT5A 4FOLA 1MABB 2YHBA 4B3SB 1ZYUA 2O0HA 5EXEA 4NTZA 3MYYA 1QZ3A 2C5SA 3UJHA 3HKBA 1FJ2A 3P52A 3EH2A 1YDEA 2O6HA 3AKYA 1F20A 4IIVA 1BCRA 2QM7A 1JFVA 2J31A 2VP6A 2OXEA 1NYLA 3UPDA 1KYZA 3F4KA 4OL9A 3B78A 1AV6A 4HN4B 4R7GA 3FOAA 4CT0A 1II8A 3KETA 2BDTA 3TLEA 2PZ8A 5DM70 3RE1A 1ST2A 1NN3A 4E22A 1Z8FA 3HXTA 2ZQYA 4Z4GA 3C8UA 4WCDA 1A95A 2CXSA 1EVIA 4NRDA 4PFKA 2ZYSA 4CFSA 4OLAA 2A4KA 2IXTA 3CA8A 4U1RA 3VQTA 3K9CA 2PGLA 1FMCA 1QBGA 2RC5A 3LHSA 4NEGA 4RL4A 2FN4A 2H59A 5LBIA 2QIPA 1A2QA 1DT3A 4B1FA 1K98A 3RSQA 5A4IS 3AM3A 3EK2A 2GN0A 4OSOA 4XA8A 1UBOS 4IJ5A 3GGSA 4ZMBA 6LDHA 2PSHA 1SD2A 5ILGA 3L7JA 5HS6A 3O26A 4BBAA 1CJSA 3W5HA 3VDXA 1T9HA 1ZCJA 3GUCA 3R24A 4JENA 5IBQA 3V1YA 3WLRA 3JVVA 5EGSA 5BSVA 2SHKA 4LF4B 1FP7A 1AT1A 1KMHA 1VL0A 2OXIA 3T1TA 1QRTA 4F3TA 4WGFA 4J07A 2YOHA 3JALB 2ZROA 1SXJB 3T5GA 1KL7A 4K6KA 4N82A 4E51A 2GEBA 4QE3A 1TZMA 2JF0A 3KJIA 3C8ZA 1W5SA 2R1TB 3D0RA 1O9GA 3P1JA 3VGJA 3TTXA 3KOYA 1L3CA 4FKZA 4C78A 1CV2A 1EFCA 2OB1A 3RPEA 3SKYA 4PFJA 3M81A 4C29A 1G21E 1T9BA 4TRJA 2CHEA 2C94A 3WHKA 2CBZA 2R8ZA 3DG9A 3JALA 4XX0A 1XSEA 2JAQA 2GAOA 4C5CA 1GN9A 1RJ9A 4JLPA 1FRFS 3BOSA 1GGEA 3C48A 1P72A 3MBIA 3PVZA 4ME6A 1VYTA 4Q6WA 4UD2A 5ALMA 3C3KA 3D81A 5LN1A 3F8WA 2WD9A 2H4WA 2NLOA 3VYTB 1Q3KA 1RCFA 2LWIA 2YWGA 1XZMA 2QR2A 5J40A 4L1KA 2CLFB 3TOXA 1Z0KA 2CBXA 3TVDA 3B5JA 4AAYA 3A6JA 3HE3A 1L1QA 1QP8A 4B40A 1QHHB 1R66A 2AKAB 3LCJA 4HBGA 4FFMA 1DWOA 3S4YA 1BJTA 4BB6A 1G21B 2M32A 3Q2IA 4OHBA 1HH4A 2ZIWB 1IB0A 4URYR 3TM5A 2D7CA 1YE8A 4CFZA 3RHTA 2E6KA 1OIWA 2I7XA 3M83A 3PU6A 3UYKA 2PZAA 1JIUA 1X86B 2FN9A 2PUJA 5JWRA 4QYSA 4PZDA 5THKA 5B58T 1K8ZB 2P4QA 4O2AA 2PS1A 2ONJA 4HDNB 3U9TA 2D74A 4BE7B 4X1YB 5LDHA 1KJIA 4OMDA 4U2DA 3LXXA 3D3EA 2AEEA 4MRVA 4IKPA 3UXYA 5GJVC 4Z2YA 4E31A 2H6EA 1X1TA 4RF2A 4WFQA 5MDHA 3FOEC 1PQUA 2JGFA 3N2GA 2WIBA 3PP8A 4H7PA 3D4NA 1WXGA 3P7MA 1OB5A 2P8JA 6REQA 5CHEA 2OBMA 5KAMA 1U8TA 5FAKA 3GJZA 3A2NA 3CBQA 1OHHA 1THZA 4D5EA 2NV0A 3AUXA 4KLAA 5EHXA 3K6SB 3Q1KA 1JJIA 2H16A 4LZZA 4XX1A 5C3UA 4NBNA 3I0MA 4LYAA 2AI2A 3H2JA 3BBPA 1TX4B 4XB6B 4XR9A 5AI5A 5KMGA 1W96A 1J2UA 3IOEA 3LI2A 4LRQA 2PAFA 4DCPA 2IYXA 3WB0A 1UZMA 2O0MA 3JQ7B 3NIGB 3IO5A 4RELA 3WLEA 3WMRA 3RRMA 3HO1A 2OSBA 3TW4A 1I4EB 2IYTA 2KHZA 1TB4A 4KVFA 4ENSA 1SG0A 1M8GA 2GMWA 3FF4A 4XM2A 3OPQA 3LFHA 3TUIC 5HTOA 1OF1A 1RLOA 3ZXYA 5IM4F 1QORA 3I61A 4U7JA 1ZJYA 1NULA 2Q4BA 1A8SA 1E3DA 2I03A 2FDRA 3FB4A 4C3ZA 1GZ4A 3CSUA 3IPAA 3JQ7A 2GCOA 1D0IA 2QZ9A 3DH0A 3L8MA 4ZHSA 4G2NA 1YOVA 3SXUA 4RK0A 5CVVA 5CCBA 2CL0X 2H57A 3C3EA 3I2KA 3RYHA 2WTBA 1U3WA 1WP4A 2BFEB 3DOOA 3T3PB 1GGMA 1XLVA 2I55A 1A7KA 2WNIA 4RW0A 4UU0A 3CURA 3ZWKA 5E0KB 4X24A 4S05A 3GBVA 4BQIA 1W5FA 3IPCA 4YJFA 1FX1A 1N9GA 1QHNA 2H5JA 5CIQA 1IM5A 5COBA 4FE3A 1T4DA 4RV4A 3GAMA 2JG3A 2PLWA 4I5EA 1VL6A 3ZD8A 3CWCA 2AL7A 3FVWA 2ZBVA 4F8YA 4PS1A 3ZWMA 1Y8QB 5I8WA 2PT7A 1N5LA 1UPAA 1PI3A 3B53X 1SUPA 3EOZA 3KVVA 4GQAA 3BN3A 3FGNA 2ISSD 4CMCA 1FFGA 1UM8A 2AXNA 2C5GA 4WPGA 4PPNA 3UOGA 1TTPB 5AVZA 4EPXA 2LRHA 3QVKA 2Q8NA 4YV0A 3NQ41 3HA2A 3DT6A 5HGJA 3T5CA 2V58A 3REFA 4CLRA 2PXCA 1TZCA 5GIOE 4AF6A 2QE7A 1UAYA 3P20A 2E55A 3GUZA 3BH0A 1KEKA 3O7MA 2JA2A 5ITVA 1UAGA 1SC9A 4OHYA 1FRVA 1Y42X 1YBVA 3KV1A 1ZH0A 4OYYA 4Q6BA 3OT1A 4LOLA 4E5KA 1A9OA 3HRHA 5JZ9A 4D8TA 4C4SA 4G5OA 4ZGBA 4ZAZA 4ZT5A 2FZWA 2WAAA 1VBMA 1LNSA 1UBSB 2XT9A 1YRHA 4MGYR 1S2NA 3V4VB 3TEMA 3ZV3A 1GD1O 1G64A 1WEKA 4OM8A 4AWXA 2BEKA 3QLVA 1EE2A 3VJMA 1HRKA 2Y6VA 1AH2A 5A06A 2QLFA 1XVVA 4RVCA 4DHWA 1GCOA 4LOHA 5I7SA 1WCXA 3TZEA 3CZAA 3KKEA 3BSFA 4GRAA 4YPFA 3HUUA 2DE0X 3ROZA 2ZTMA 3SE0A 3UMVA 1G5PA 2MR5A 5A02A 5JAUA 1A1SA 4O2RA 3INGA 4YRKA 5CDHA 3FWKA 1Z4OA 3C4QA 3RYTC 4CF7A 1WDKA 1B6TA 2F3PA 1O95C 4K5QA 4QELA 2V6FA 2BCGY 1BFUA 5KI6A 3S70A 4LFAB 3OX1A 4LGCA 1SBZA 1AMUA 1JKIA 3RC9A 1KQPA 2IF0A 3BRWD 4HVTA 4LF6B 1AHHA 3TZBA 4ZHQB 2VJKA 1HYEA 2DHRA 4IQFA 4MKIA 4N5HX 5LMZA 1QYDA 2DB3A 4FYIA 4DL9A 1SUWA 1HT1E 3W06A 3B1KA 3D6TB 4YR7A 2FUCA 3H5IA 1FYWA 2ON6A 3UMSA 4A3SA 1PD0A 1GAXA 4CKWA 3I6ZA 3GNLA 3SXJA 1DJPA 2J0EA 4PO8A 3PUXA 1MO5A 1JKMA 3GJRA 1AMOA 4FR2A 5DRTA 4L22A 1X38A 3CPEA 4CM6A 1R9MA 1W88A 3A9CA 1YASA 2FPMA 1YNSA 1Y98A 5IVIA 2IDMA 4KGVA 5DLDA 3JARB 5SYNA 3U16A 2EKPA 2I4NA 4IIFA 3OKCA 4QJ4A 2IOFK 3TTYA 4D25A 4Z2AA 3CLRD 1LBQA 3NXKA 4HQ0A 3JTEA 1Y7HA 1NL3A 2C2GA 3VH3A 3GGDA 3TG8A 2AOWA 2OV4A 4LPSA 1C3OA 3AM1A 2CWWA 5AW7A 5DHPA 4LXQA 4M8NE 4YT5A 4NG5A 5EQJB 3UEOA 4EI7A 4OQDA 3KXKA 4KGZA 4MH0R 4L2IB 4ZO9A 3W5UA 5GM1A 3H2YA 2DQYA 2FUG1 3IAS1 1IUNA 1L5KA 1UOEA 4Q4CA 3FGZA 3TK1A 4RMGA 3I2FA 2RHRA 3ABRB 1ZJ6A 2CV1A 3N3AC 3ILVA 2AOXA 1MH1A 4KW7A 4F72A 2JLXA 3AEZA 1V3VA 3B3QA 3UB2A 1J2YA 3OQMA 2GS9A 3BD8A 2HDNB 3HVJA 4KIUA 5BYBA 4YMLA 2CDRA 3TW6A 5ERGB 2LCQA 2IYWA 1E1RA 2B37A 3KPJA 5B6PA 2V7VA 3JQEA 5ALFA 3RSHA 1TVEA 4AJNA 3DL0A 5AUQA 3BWMA 5CNIA 5F98A 1K5HA 1II9A 1OFUA 4PZAA 4L7QA 1I14A 3KZCA 2C92A 1CERA 1PDWA 2WU3A 3H87A 3THYB 2HT6A 4LNUB 1YB1A 2P9BA 2L82A 1KEZA 3IDAA 5HZGA 4KTVE 4Z4EA 3GYGA 4X93A 4TWAA 5ITSA 4CQMB 3PL1A 2YZNA 1KO7A 1LNQA 2CFIA 1NXVA 1U6JA 1RPNA 1R8JA 3M4ZA 5JU6A 4DNOA 2X7JA 2OVFA 4XKJA 2WHYA 1QF7A 3GRFA 1AKVA 1JBKA 4MIOA 1YQQA 5EMNA 1N6IA 3NV9A 3FY4A 5GQSA 1CF4A 4K3VA 3THYA 2D1SA 1TM5E 5KNCH 4HNHA 1SO8A 3AR5A 1QIDA 5JH7F 2V9ZA 3FROA 1ODJA 4NBWA 1NIJA 1NP7A 3I3OA 3MRVA 4Q39A 3EZXA 4HFMA 4BCBA 3MRSA 1AQ6A 1P8AA 4U2EA 2FOXA 1WUTA 2PD3A 3O4VA 2NO4A 3MAAC 4LDZA 4BE4A 3H9EO 2NM0A 1G8YA 1N6KA 2OA0A 1LDEA 4KYVA 2ZR7A 5L95A 2R9VA 4NV1A 2RGDA 2XUKA 3CLHA 3ADCA 1UQTA 1R64A 2P6NA 3GA7A 3KQKA 1J5XA 1NOJA 1CRWG 1ZVMA 2XA9A 3HBNA 4XCVA 1EFHA 2J48A 5JS2A 4BJ5A 1RXUA 3QENA 2DSTA 1YBFA 1MCZA 1B00A 4KWIA 2HCTA 2Q3MA 3QE0A 2OMEA 4KJXA 4R54A 2JGLA 2BFPA 1R6VA 1H6BA 1KOGA 5ELXA 1O0CA 1QIIA 1QV6A 1S0UA 4FOSA 2QD1A 3A7DA 3V8NA 2WFLB 1G42A 2BEJA 2XWBF 3EW7A 3QW4B 3VZPA 1BRTA 1U0NA 1EM8A 3CNQS 4EAQA 2R86A 2WLSA 3D2BA 4IY1A 1U0HC 1EFLA 2H29A 2H1WA 1HURA 2IFTA 1N2ZA 4CL2A 3J81k 5G1OA 4XDZA 2OM6A 4HFJA 2FX3A 3UN1A 4EBBA 3I62A 1R8YA 5B1YA 1M8KA 2BFCA 4Q3CA 3TEFA 3TRDA 1RM4A 3CLVA 5E6UA 4BVJA 4ABTA 1TM2A 3DWFA 4UDYX 5CG1A 4UFOA 3SC3A 1S8AA 2E82A 5CFOA 4E6EA 1BEUB 3ENQA 4F71A 1Q3HA 4PNPA 4NPCA 5LD2B 3OX4A 1Y3DE 1LC3A 4PZLA 1RJFA 4AJHA 4X60A 4PM4A 4BVGA 4HLUA 3S27A 4AO8A 2OAEA 3D9QX 4TYYA 3AHIA 4M2LA 1H1DA 2OORA 2X2PA 4HDRB 4OKIA 4P5EA 4CXMA 1KI8A 1EK6A 1MJFA 3KL2A 3ZI7A 3EF0A 3BVPA 4JBNA 3P45A 2VNIA 5EXSA 4A0FA 5CB8A 3MLAA 5I4KA 3GP3A 3RG2A 4DLNA 2VPIA 4DQUA 2WWYA 1CIVA 1SC1A 4ZAWA 2CXXA 1ETHA 1OR8A 3EASA 5EIHA 2R1VB 4BEJA 1PFYA 1WIWA 1RP1A 2WM3A 4FYXA 4Y9RA 2CLMB 1AX9A 2MTBA 3IAHA 1JEQB 3DR3A 1GRNA 3ZK9A 3AR3A 1B8VA 4QGSA 2HKIA 3AHDA 1LDGA 3CVYA 1JVNA 2JVKA 2XNDD 1RBMA 3FXAA 3ORRA 2HZBA 3CB4A 1QE0A 2OO3A 3OY2A 4H3KB 4TTSA 4OBWA 5FOUA 5FWYB 3ZWQA 1TMOA 3GLGA 4FS8A 2MYPA 4J75A 4GGMX 1W6UA 3K0SA 5FADA 3TAXA 3UA4A 1UAAA 3GRVA 3M5CA 4KOEC 4DMCA 1XPOA 2OGZA 4IXMA 3NHMA 4X94A 3UCFA 2ZB7A 2BI7A 3G1TA 1TRHA 3EX7C 2NYRA 1K8RA 4CV3A 2DZDA 3H17A 4PCVA 3FDFA 4ZTUB 4EG0A 2DLNA 1BDMA 3OCJA 2VBIA 4JI7B 2QN9A 1MOQA 1E7QA 4YCBA 5IPFA 4QD3A 3UXHA 3Q4GA 4UAJA 3R74A 1L1EA 3U4DA 5KWVA 5JS7A 3GLSA 5EYPA 5JLJA 3R6GA 1PR6A 1NQ5A 2A88A 4UBKA 1A2BA 5E7MA 1YRAA 3EVAA 3FTDA 4CMEA 2P9CA 2C97A 2P0YA 4B4UA 3MERA 4YJGA 2J8ZA 3IE0A 1KJ8A 1GLGA 5E3IA 4DZTA 1T34A 3CUYA 3B89A 1J8DA 1MAAA 4UQOA 2JLZA 1C9DB 2GTPA 2BD0A 3QEMB 5JVDF 4B0OA 1NI3A 1IE3A 3G0GA 4LYDA 4TZ0A 3WK7A 1GFSA 3L9WA 2BZGA 2CVHA 2YHSA 4DV3B 1IZ9A 3W2HA 4DIDA 2OYSA 1Y6JA 3CG0A 4H27A 4OF4A 4UPDA 2H2IA 3A32A 5DTEA 1VM6A 4O5AA 2JGKA 3ONDA 1Z75A 3FHCB 3S1SA 4RTSA 1E7MA 4B3TB 1FDRA 4REQB 1W59A 4E1VA 4EF5A 4F2WA 4G0YA 2Z3ZA 5D7BA 3AR9A 2BDEA 2FG5A 4FC7A 4P4SA 2KI5A 2G28A 3IIIA 4TKZA 3WKDA 4DLXA 5I3ZA 1F2TB 1TM3E 3PNOA 3MBKA 2I3DA 4R83A 4BO9A 1DI0A 1H1LB 4QYMA 1EFAA 2XBLA 1V26A 5EXXA 4A0SA 1JPJA 4UFPA 2AYXA 4A0QA 1N6RA 1N2XA 4IOJA 3VYRB 3WIBA 5C3MA 5CBPA 4BVFA 5HJ2A 4REQA 3O2QB 2GZDA 1NBMD 3I9KA 2ILTA 1MGOA 1PX2A 3V8VA 4UDNA 3DXYA 4IS2A 1B26A 1FSFA 1KI7A 3AOEC 4UBMA 4NAUA 3AUYA 1QGUB 1F2TA 1ZD1A 3FVRA 3MQFA 4FYWA 4MWBA 1QRSA 4QTYA 2ANBA 2C95A 1KFKB 2C00A 3LUAA 1SHZA 3O2JA 4DBZA 2JB9A 1B6RA 4PNZA 1G38A 4BNJA 4CF3A 3ET5A 3X1MA 2C7BA 2FAXA 4HDKB 2NO9A 3OU2A 2BJHA 1PS0A 4WOBA 5AKLA 1U0TA 2OV6A 3HP4A 5K51A 3JVIA 2IXGA 1XX6A 2GPWA 1R1DA 4KO4S 5CLIA 4MQUA 2DKNA 2NXCA 2ZJ8A 5DYYA 2F8MA 2IE8A 1VSQA 3A9TA 2AC2A 1L4NA 2LP4Y 3Q9NA 3W8FA 1LW7A 3PENA 3KWMA 4D9MA 4DR4B 3RCBA 5KJ1A 2XGGA 3EAQA 2DUNA 3V3KA 1QHSA 1DAGA 1GG9A 3E1GA 1HOTA 1OV6A 2N0SA 1ST3A 4NI5A 2P4HX 4QEDA 2DFKB 3RU3A 1N1GA 4TTQA 2GJ9A 3I9LA 4FSDA 4TMZA 2PRKA 4AW9A 1RQPA 1VZ3A 1D07A 4XIFA 1FSSA 1J4AA 1XMSA 3FLMA 1EQ2A 1WXEA 1DGQA 3MFYA 5DYWA 1C8BA 2IPOA 4XASA 1GNRA 1LRJA 2GZSA 2YICA 3L49A 2VQ6A 4ONEA 4WBSA 4C0LA 3KUUA 3VSEA 5INTA 3LVBA 2IDJA 2C31A 4M9SA 4CMGA 5LYYA 2YVUA 4KIFA 4W1PA 5AJXA 3UK2A 3AI1A 421PA 2RHTA 1W85B 4URXR 3QBJA 3WYNA 4RHTA 1BHQ1 2JJQA 3QHAA 4JS0A 5HRUA 4PAMA 1X1EA 1VPVA 1TM4E 2BFFA 2NTNA 3ZOZA 2IDKA 2IP4A 4YUXA 4EHJA 1AGRA 1SRQA 1OROA 2I6GA 2J5XA 5CYGA 1NV9A 1ISIA 2J3EA 1LV8A 5EIBD 1RXEA 5JD5A 3SS7X 3V7NA 4JIMA 2INGX 3DVRX 2WUDA 3HY4A 1IB6A 4ILKA 4MVWA 5I01A 2PR7A 4JCCA 4X44A 5IJZA 4E5NA 2H18A 5LCXA 1YQ9A 1H85A 5SY6A 3K9FC 5LZ5A 4GVLA 4CTMA 1ZRHA 2YUTA 2WU1A 2AE2A 3EQ9A 3MUOA 1JQBA 1M2HA 1E3WA 5LLSA