2FP4A

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
305
structure length
304
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 112
structure length 304
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fp4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fp4A01
4FPXA 4E2ZA 4A26A 5F3RA 2AW5A 1NFRA 5I7VA 4YAEA 1PL6A 3S2EA 3IL2A 4H3VA 2EKPA 4LISA 4RF4A 4Z6KA 3FPLA 4BKPA 2GGSA 4AJ2A 1YDEA 1ORRA 3BMNA 4O63O 3SX2A 3AOEC 4NFSA 3UUWA 1OZAA 4GSLA 4RLHA 1R0LA 3ANNA 3JQ6A 1AXEA 1YL7A 3H9QA 3PTZA 3OM9A 2WD7B 4NJOA 5TSDA 3UFXB 5EIOA 3GVCA 4IJUA 2UDPA 2ZK7A 1E3SA 5B4VA 2CNBA 3KVOA 1UP4A 2GR9A 3H5RA 2CSUA 3B1JA 1LSSA 3JD0A 4RGBA 1KERA 2G82A 2C2YA 4EITA 2H9IA 3GNTA 3GQVA 1O9BA 1I2BA 3DAFA 4XGNA 1ZO8A 2Q50A 3JQAA 1WZEA 2YFHA 3SC6A 3GOHA 2ZYAA 3DBHA 4ESOA 3JQFC 1XWFA 3NT4A 2FZEA 2DVMA 4FGWA 5IF3A 5F5NA 4FW8A 3BYZA 4CM4B 4Y8VA 1R0SA 2VWQA 3H6KA 1AHIA 1XHLA 3Q2IA 3QWIA 2OP0A 3UW3A 1P33A 1CQIB 2VYNA 2BGMA 1BMDA 1LQUA 2V6BA 3AU9A 2J5KA 2HJRA 4U6SA 3WIEA 1KEUA 2RCYA 4IIUA 3T4XA 3E6AA 4YTEA 1Q7GA 2OBYA 1UXKA 3C3XA 3WJAA 4Z9FA 5IDXA 5G4KB 1NQAO 1YQGA 1GQ2A 4GX5A 3TZCA 2W2LA 2Y66A 3CZRA 1P1IA 2QW8A 1YQXA 3K96A 4XGIA 4JLWA 1Z7EA 5A05A 3TDKA 3TZQA 5L40A 1AE1A 1N9GB 4LCEA 4XB1A 4CM9D 5CEFA 5JAMA 3KLMX 5DP2A 1A27A 3WQRA 1EQ2A 3K8ZA 4J4HA 4IDGA 2G17A 4UVDA 3F1KA 4M86A 1I32A 2NUAB 1YS4A 1IL0A 1ZKMA 2CF6A 4XCVA 3KLPX 1QG6A 1LLQA 1NVGA 4RDIA 2QHXA 2B4RO 4D41A 1UDBA 1P1RA 4K6CA 5K6AA 5IZCA 2X9VA 3ADOA 4UEKA 2NWQA 1ZFNA 1B15A 2YUTA 4YQZA 1QKIA 1W73A 3ZWOA 4IBOA 3TOZA 5COBA 2ZTVA 1V3TA 2NVUB 4K1LA 4KTVE 4BNGA 1Y9AA 1D4FA 1GQQA 3RFXA 3ONDA 4E4YA 5JDCC 3RU7A 5CAEA 4FR5A 1WP4A 1MA0A 2GN8A 2VUUA 2VYVA 3RIHA 3TFQA 2PH3A 1VLLA 1LSOA 4J1QA 4J1NA 1MXFA 4YJGB 3F46A 4YWJA 3WWZA 3H3FA 4XYMA 1XQ1A 4J90A 3VPFA 2FPPA 4OH1A 1IZ9A 4XX0B 1DLJA 3AUSA 3VHRA 2CVQA 2FN7A 1EVJA 1K89A 3B1KA 3TZ6A 4Z3KA 3PYLA 4E32A 2PR2A 3KTDA 2QZ9A 2RAFA 3GAZA 4PG6A 1KY5A 3DL2A 3LLSA 4DMLA 1PQUA 1JW9B 1VC2A 4FFNA 2P5UA 5CDGA 1K6XA 3AWDA 1LA2A 4HXYA 3ZHBA 2C07A 4CR6A 4IDBA 2VHYA 1DRVA 5L4LA 3GVXA 1ZZEA 3Q0EA 4CMHA 3OBBA 3V1TC 3WGZA 1B8PA 4CMEC 3GG9A 1BVUA 2AE1A 3TOXA 1OC2A 2HMUA 4R1TA 5MGBA 1CQJA 4GLLA 4R3NA 3S1LA 3HUDA 5HBRA 1QLHA 1ML3A 2E37A 2O7SA 3QJ5A 4CM3A 5FEUA 1ISFA 3QVXA 1CETA 4JGBA 3U9LA 1I01A 1U3VA 2QYSA 3ICCA 3PXXA 2VRCA 1J4AA 4CODB 3L4BC 4ID9A 2EERA 3KM0A 2GZ2A 4YPOA 1MP0A 2YQ4A 2R2GA 3VZQA 2CF5A 4J1TA 4JCOA 1NWCA 3SLGA 3ZCXA 5MDHA 5B12A 1X0VA 4PGFA 4N54A 4CLOA 3E8XA 2NM0A 2EKQA 4JQCA 2WEKA 2WJPA 5B1YA 4Y67A 3FCOA 2YY7A 2HMVA 3QWFA 2I76A 4TROA 2D8AA 2HKIA 3WGGA 1Q0HA 4W9NC 2D0IA 4PLPA 4GAEA 4YA6A 1X14A 3RBXA 4M89A 3TSCA 1Z73A 3FR8A 4NDNE 3PQEA 4UEJA 1YBVA 4M54A 1K0UA 2Z1MA 3NAQA 2FPGA 5H82A 2X23A 1PR3A 3OJFA 3F4BA 1MLDA 3WR5A 3MWEB 3MJ4A 3V5NA 4ND4A 4O6VA 1NPDA 3WGOA 2HU2A 4UUMA 4RCVA 3EVTA 4J0FA 3HN7A 3U4IA 5TJ9A 4B79A 1P1HA 5HS4A 4MKRA 2FOIA 2Y99A 1DLIA 4I9UA 2ZJ0A 5IDQA 2GUGA 2JHFA 9LDTA 1ISMA 1F17A 3EDMA 1ZSYA 4JJFA 4BS9A 5KKAA 3I4FA 2HRZA 1DIGA 4HP8A 5BT9A 5COAA 2XOXA 1NVMB 2AHRA 2DBVO 2HDHA 5BNIA 5CDTA 2IZ0A 3UCXA 1YBMA 2DLDA 2XAAA 2FR1A 4RVFA 1Q7BA 4CLDA 3EC7A 2ZCUA 3H5NA 2FHSA 4IDEA 4E3ZA 1WMBA 3HQ4O 5ER6A 3SC4A 5HS6A 3VKUA 1R4MB 3LDHA 2OZPA 3M6IA 2HLPA 4R01A 4D42A 5DOVA 4XIJA 3W8FA 1E7SA 3KO8A 2QQ5A 2RH8A 3E18A 4FJ0A 3ROMA 3F5QA 1HKUA 1IB6A 3KYCA 3PGJA 3JYLA 2GCGA 4HWKA 3UXYA 3NDIA 1YL6A 2PGLA 4CL3A 3OJ0A 4XDZA 1EE9A 2NU7B 4E5PA 4R4JA 2OOSA 3OA2A 2AG8A 1DSSG 1O89A 4QO8A 1ZJYA 4AJLA 1K2WA 2W4QA 3WTCA 4AJPA 1ADGA 2NLOA 4I5FA 1H93A 1RM0A 3AI2A 4HV4A 1AN9A 1NX6A 3M1LA 2O48X 4UAGA 4FS3A 4DLBA 1JKJA 2PZKA 4E13A 3HDQA 2C82A 4WJZA 4EI2A 1DFGA 2XXJA 3S55A 3D3EA 2E48A 3W8EA 4CM9A 3GR6A 3H2SA 5G0UA 3RSHA 3JQGB 1Z82A 3R1IA 3MTJA 3F47A 4RPHA 4J3FA 1UXGA 1UXJA 2JFHA 5JLAA 2FRDA 4XIYA 2E6UX 3NUGA 4IZHA 2O4UX 1PQPA 1U8FO 2VCYA 2WE7A 4QFCA 4MPDA 3D3WA 3A28A 2C5AA 4PG5A 2YYYA 4K9DA 4BO3A 4KMSA 3L6DA 2NV6A 4CMAA 3GFBA 5FI5A 4MIYA 1ZK3A 4BL5A 2NVWA 2I3AA 3UGKA 1FDWA 1LRLA 1A7KA 4ZD6A 3A06A 1SMKA 2C29D 1ZK2A 3RUFA 3NJ4A 2DC1A 3RUIA 4A27A 2C7VA 2C59A 5JO9A 1JVBA 3WWYA 3GEGA 1DIBA 5DBIA 2EJVA 1VL0A 3G49A 3ZW8A 3K31A 3ZV4A 3PWZA 1LDNA 1B3BA 3RC7A 5JAQA 2IYOA 2J3KA 1HYGA 1XG5A 2NU8A 2CMDA 4Y6RA 4DQVA 1D8AA 5U4QA 4OM8A 4Q3CA 1KEVA 3L07A 3RUEA 2E49A 4R16A 2EW8A 2V6MA 4ZICA 1PZHA 3TRIA 3VZPA 4RVGA 2WD7A 1GFSA 3M1AA 4KUHA 5EN4A 4A2CA 4BO8A 4E2XA 1BVRA 3G0OA 3FI9A 4ILKA 2FSVA 3AOGA 3T4EA 4DIBA 1RJWA 2BFMA 3FD8A 2PD4A 2UUOA 2GDZA 4R54A 2YV2A 2EWMA 2HO5A 5JS6A 4BB5A 2X5JO 1N1GA 3KOUA 5JPIA 3W4IA 1I33A 4FJ1A 5GZ1A 4RV9A 3AI1A 3V2HA 5I7EA 3EK2A 3Q2KA 4DTIA 1C3VA 3JSAA 4P4NA 3S2FA 1HXHA 4FC6A 4QXMA 3GRPA 5JYDA 4ZVVA 1H6CA 3ITKA 3WB9A 4FCCA 1A9YA 4DVJA 1R4NB 4PLCA 4E5YA 5FFFA 4CMGA 3Q3CA 3DBLB 3LT4A 4Z0TA 3GH3A 1CQIA 2I9PA 1LXCA 2BF7A 5T5QA 1HDZA 4W4TA 1Z45A 3ZNPA 5U1PA 4JBGA 2I67A 3NT5A 4Y98A 4I5DA 4O0LA 1LDBA 1NAIA 4AJEA 2TMDA 5JDIC 2X86A 2J3IA 5JC1A 4A73A 3DTYA 1CYDA 2NVBA 1ZH8A 5EL0A 1GPDG 5G4KA 2RHCA 1E3WB 3ZH2A 4CM7A 4DL9A 5KCZA 2Q1WA 1LU9A 1LBEA 1PWXA 5A3VA 4D46A 3RQSA 1DBVO 1DJQA 1QYXA 3GAFA 3VPGA 4IXTA 4TVBA 4XGKA 3DB2A 4ZN6A 1LTHR 1YOVB 1E3JA 1U7TA 3D4PA 2ILTA 3PLRA 2QRJA 4TRJA 4EJ0A 4KOAA 5KJFA 4HUJA 2YDXA 1PL8A 5KVSA 3RAJA 4IM7A 1C1XB 1YVEI 4J91A 4BQRA 4OQZA 2NU6B 5EPOA 1L1FA 2YFQA 1DIRA 5KJ6A 3D1LA 1HLPA 2GN6A 1YJQA 1X1TA 6LDHA 5KKCA 2RIRA 1PIWA 1MC4A 4QO7A 3JQBA 4B3JA 2EGGA 3C85A 1CIVA 4BNYA 2NVUA 4ZGWA 3VKVA 2PFGA 4YJFA 3PHIA 1YKFA 4W82A 4IXWA 1KVTA 1QR6A 4QT0A 3PVZA 2B4QA 1F12A 3HE3A 1U5AA 3I9NA 2Q3EA 3C8MA 5TS3A 4DBZA 2JKVA 1LEHA 4IGFA 1VSVA 1F14A 4LSMA 4F6LA 4R3WA 3HADA 3GHYA 2AE2A 2EIHA 2JCVA 3PPIA 3VTZA 3TZHA 3KRTA 3N74A 1O6ZA 2QX7A 3FBTA 3N58A 3ZWCA 1B3RA 2OBNA 2DTDA 3PQFA 4NBRA 4DGSA 3DZIA 2YW9A 1B7GO 3H8VA 3VH4A 3GEDA 4K26A 5EESA 4P4GA 2HK9A 2DFVA 1PJSA 1NYTA 3ROQA 1R66A 1RYDA 1Q0QA 3G17A 4PCVA 1GD1O 3EY4A 1MGOA 2J6IA 5ITVA 1ENPA 4R9RA 1B8VA 1GZ3A 5CDUA 1H6DA 1PTJA 4YRAA 1XU7A 3O26A 4WEQA 3FTPA 3JQ7A 4RF3A 4R1UA 4ALLA 4RLSA 1H2BA 3FSRA 1G0NA 1ZK4A 1YGYA 3FR7A 3O9ZA 5CHEA 3RBVA 4M49A 8LDHA 5B4UA 1ZEMA 3BHJA 2DFDA 3HWRA 2VZ8A 4QFDA 4BMSA 1H6BA 2JAPA 3BAZA 4LVUA 4MVJD 2C20A 1VL8A 4OIMA 3DTTA 5BNTA 5GY7A 5JXWA 5TGDA 2AG5A 2PGJA 3JD2A 1X1EA 3D5QA 3WGIA 3MOIA 3PRJA 5TNXA 2BD0A 1BXGB 1V8BA 2NTVA 1BDMA 1U8XX 1UZLA 5F1KA 3I9OA 3PJGA 2GRAA 3AJRA 1U28A 2PKRA 3DWFA 5JNLA 3W4KA 1UXHA 3F5SA 5BSGA 2HK7A 2VTEA 4TWRA 1EVZA 3WJ7A 3DDNA 2WDZA 4QEDA 3K73O 5C3MA 5KTKA 2PGDA 3ZU3A 3UHAA 3O8QB 2O3JA 3LQFA 3PIDA 3JQ9A 3LLVA 3OJLA 1YE3A 3LC2O 1JA9A 5KNLA 2HMWA 1EUCB 1I3KA 4BNFA 2GD1O 4GWKA 2AEMA 4Q3NA 1F8GA 2DT5A 1ZW1A 5FF9A 3UN1A 3GGOA 3WDSA 1BSVA 4CUZA 2B4TO 4ZQGA 3F1LA 1E6EA 1C14A 4MP8A 4QSMA 2Y1FA 2BFPA 4O1MA 1QORA 1NVTA 1WWKA 2V65A 3CEAA 3R3SA 3U5TA 1JWBB 4QTZA 1I3MA 3QSGA 1HZZA 2C2XA 2ZTLA 5TC4A 5TT1A 2BI8A 3S2GA 3E48A 1EBFA 2I66A 3NV9A 2O7QA 1NQOA 5A04A 2W2KA 2DPHA 3LK7A 4CM5A 1PGNA 1QYVA 1TT5B 4JJGA 3L9WA 1EUZA 4BNTA 4J4BA 3EMKA 5L3ZA 3GF4A 4J7CA 1YQDA 2EXXA 1R37A 5L7TA 1P3DA 1U2DA 2ET6A 3UAGA 1FF9A 4L73A 1R4MA 3OQBA 1HDRA 2OL4A 4AFNA 1IULA 5TLSA 3PLNA 1H2HA 1GQYA 1QMGA 5ENVA 4P38A 2Y1OA 2C5EA 1ZJZA 3RCBA 1A71A 4GMFA 5CEJA 1I36A 3A4VA 5A1TA 2WTBA 3FWZA 4XB2A 7ADHA 1J6UA 3ZHZA 1Y8QB 1Y1PA 1NR1A 3DO5A 1JVSA 1I10A 3DZBA 2V6GA 3UKOA 4HFRA 3KEOA 1T2FA 1UH5A 2GZ1A 1DRUA 4RPJA 4Z0PA 1D7OA 4BNHA 1E7MA 1HE2A 4JROA 5LDHA 5FI3A 3IP3A 3MTGA 1GYPA 4E30A 4BKRA 3QIVA 2O3QA 2NQTA 4WE3A 4DIOA 4PLYA 3RUCA 4MVJM 1VI2A 2PZJA 1A5ZA 4M55A 5KJCA 5JAZA 5COQA 1QRRA 5THKA 4W7HA 4B4UA 3QWBA 3W6ZA 5H81A 5AVOA 5TJHA 1PEDA 2Y0CA 4LRTB 1I3LA 1G0OA 4EGFA 5BQFA 2ZQYA 3AUUA 3OHSX 1R15A 3ZV3A 4MVJE 4CM1A 4FJ2A 1A7AA 2NQ8A 1IHXA 1XGKA 1UAGA 3Q9NA 1PGOA 4XRGA 1DAOA 1EVYA 4QECA 1NWHA 2VZ0A 5AXDA 2Z95A 4QQRA 1BDBA 1PGPA 1GADO 1P1KA 4RZHA 4YT8A 2P91A 2B37A 3F3SA 1J5PA 5A9SB 3VAZA 1X0XA 2YDYA 1SB8A 4TRNA 1ADCA 1T26A 3STHA 4N5MA 1XYGA 3VPXA 1Y7TA 3GEMA 3ONFA 4XQ9A 3ZHXA 4YCAA 3KYDA 2F1KA 3TWOA 3FHLA 4YT2A 4CV2A 2ZTUA 4A03A 1V3VA 5I9LA 3RKUA 2WWRA 3MCVA 1ARZA 3QWAA 1X7HA 2J3HA 3K92A 2ZQZA 3Q9UA 1FDSA 1SO8A 3DOCA 3WYEA 1KVRA 5JE8A 4IUYA 2ZKLA 4U5QA 1TVEA 2AQKA 4OKNA 3AM5A 4JP2A 1Z74A 4J7XA 4RVDA 2PV7A 3F9IA 2NSDA 4MVJA 3GLQA 4BGEA 1U2GA 2DBZA 3GDGA 4PLZA 4B4OA 2DTEA 4K6FA 3ABIA 1OMOA 2CFCA 3GHHA 3SEFA 1W0CA 4G81A 2B5VA 4DREA 5LDGA 3WMWA 4RF2A 3E03A 4B4WA 3CINA 3NDJA 4YAJA 1FXSA 3PYXA 4QUKA 1PGQA 1ZK1A 4RQUA 4DMMA 5I9NA 2X4GA 2YHUA 1NPTO 2XF8A 1NP3A 3HDYA 4CLRB 5EQDA 5A3JA 1PX0A 4DQXA 2WYWA 4BIIA 2VUTA 3QWHA 4BNUA 3C24A 4CMEA 4N7RA 2IODA 4BO4A 2GO1A 1GCOA 3R3JA 4I08A 4BNIA 4ZRNA 3GFGA 3ICPA 4NIMA 5CG2A 3GNQA 4LW8A 3F4LA 1YOVA 2WYVA 3NYWA 2Q2VA 4D43A 1ADFA 2Q46A 1U1IA 1HDOA 3RKRA 4CR7A 1V3UA 1C1XA 3HB5X 4DQUA 2NU6A 2YHIA 4LMPA 4L4XA 1ENZA 1CWUA 1JKIA 4CMBA 3NKLA 3FBGA 1YXMA 3JD1A 2JD0A 1EE2A 5F1PA 3ETEA 4CUKA 3B1FA 3MJEA 2QYTA 3HNPA 3P2OA 4ALNA 4CV0A 2O3SA 2VNAA 1E1KA 3JYQA 4KQWA 2ZB4A 2VZ9A 4JIGA 2PNFA 4HKTA 3CE6A 2FWMX 3LYLA 1NAHA 4GKBA 1JAYA 4RVHA 4J1SA 1TEHA 5EJ2A 5B37A 2DAPA 4FBGA 5IG2A 1P0FA 1KVSA 4NI5A 2PWZA 3OQ1A 3BMCB 3A1NA 4I9NA 2Y0DA 3DZKA 2ZIZA 4O59O 4UUNA 5DCUA 1CERA 2X6TA 3OEYA 4LCJA 4YDRA 3MWDB 1LDMA 4J43A 1K3TA 2AMFA 3G1TA 4Q3DA 3AUTA 5K6AC 2CDBA 5IZCC 1QV7A 3VVBA 3CIFA 4PLGA 4RPLA 1E1LA 3PWKA 5K9ZA 3CZMA 3D5TA 2X1HA 3PHHA 4KWHA 3AI3A 5LC1A 1CDOA 3OA0A 1GEGA 4YJHB 1BTOA 2GZ3A 3ZWVA 1MG5A 1U7HA 4BNWA 4BNJA 3BZUA 3L77A 3MEQA 4G65A 3QE3A 4IIVA 1B8UA 3BMOB 4CLHA 4L74A 4BO1A 1JWAB 1W4ZA 5JCJD 2IEDA 4E5MA 4H15A 1BG6A 2ZATA 4AJNA 4ONEA 4I5GA 3ZNNA 2D2IA 1O0SA 2Y1CA 2NTJA 1V35A 3DZHA 4NJMB 4FFOA 3GG2A 3GDFA 3RU9A 3H9UA 4H7PA 3PGXA 3LVFO 3V2GA 4KDFA 1M2WA 1PSDA 1R12A 1BXGA 4ALJA 4D3FA 1AUPA 3JYNA 1NBOA 3H4VA 2DU8A 3H3JA 2VWPA 5JBIA 3BTUA 3VZRA 3TNLA 3P19A 1C1DA 2FSSA 3JQEA 1HDXA 1DHTA 5AOVA 1IYZA 2I6TA 3KHUA 4DPMA 1PJBA 1EUCA 3KSZO 3O38A 4Z9XA 3DZJA 4OSOA 4W6ZA 1N1EA 4LSWA 4GL4A 4XA8A 4MP6A 4TKLA 1DRWA 1VJ0A 4CR8A 1WMAA 5KIAA 1GR0A 4FGSA 1N7HA 5T8KA 4ND5A 3BMQA 4JBHA 2C54A 4BV9A 4NPCA 4WCFC 5L4SA 4D0SA 4BO9A 4M8SA 4YAIA 2VHVA 1DXYA 1OOEA 2B36A 4RO0A 3DEYX 2IDZA 3COSA 1XEAA 4MINA 1UUFA 1NHGA 1K6IA 2YJZA 4YAKA 3PWSA 3DBRB 1RM3A 4DUPA 1Y5RA 3JQ8B 4I1IA 2DUWA 2DUUA 1BW9A 4MVJF 5CP8A 1HETA 2PD6A 4DC1A 2B35A 3GY0A 4R1NA 5C7LO 2CDCA 1BHSA 2DTXA 3G1UA 4XRRA 3CUKA 5F21A 2Y93A 2P9EA 2GYYA 4C7JA 1LRKA 3L9XA 3I6IA 4ZQFA 2HCTA 2O2YA 1JLLB 1HEUA 1I8TA 3BHMA 4GX0A 3BHIA 4RVSA 1SCUB 4PZDA 5G0WA 1CJCA 2NU9B 2PD3A 3ZNQA 2QRLA 1WPQA 3IUSA 1Y8QA 3PHGA 1E7WA 1E5LA 5BR7A 4BGIA 3ROPA 1GEEA 1KIFA 4Y9DA 4BUCA 4OYRA 3H2ZA 3KETA 4BNKA 1MUUA 3PIIA 2TMGA 3WGYA 1D1SA 2GF2A 1B2LA 5GZ3A 2JFGA 2CY0A 2FR8A 1NXQA 1GUFA 4A5OA 4N18A 4FDAA 1OI7A 1ENOA 1HDYA 2Y1EA 4LGVA 3Q11A 2ZB3A 5DULA 2CVOA 2SCUB 2GSDA 1EZ4A 3NTQA 4GMGA 3FNEA 4HFMA 2X0IA 3L4SO 1NHWA 1NM5A 5DCYA 1TI7A 5KJ1A 5DP1A 1V6AA 1ISGA 1ADBA 2GNAA 5F5LA 1E5QA 1W8DA 3CMCO 4IS2A 4DPKA 4Q3BA 4AJJA 2I99A 4YBZA 4F45A 4WLVA 1PS8A 2O4CA 3GUCA 3IJPA 4W99A 1ONOA 2BRUA 1JAXA 4AJIA 3V1UA 2VT3A 3QVWA 5JY1A 3DMTA 5C37A 2VHZA 4Y6SA 3UFXA 2AQHA 1H94A 5FWNA 3W4JA 3FRJA 2PLAA 2D1YA 4PLWA 1I2CA 4E33A 5AXBA 1ZMTA 3JQAB 3JTMA 1JN0A 2C0CA 3I6QA 5JFOA 5DBGA 1SEPA 4J0EA 3DBHB 2EGHA 3KXDA 3ZZNA 1EFKA 1PR9A 5DZSA 5I8WA 3ST7A 2ZYGA 4KQXA 3K6JA 4CQMB 4K28A 3MOGA 1NASA 3PZRA 4LVCA 2EHDA 4XYBA 3MZ0A 1QV6A 4DWVA 1JTVA 3GPIA 5JW6A 2FP4B 4OMUA 2DQ4A 3ZGYA 4CM4A 1C0LA 1D1TA 3AFNA 1PJ3A 4MVJH 4TRMA 3HHPA 1LC3A 3LU1A 4BNLA 4J9UE 3U4CA 3WXBA 4EJ6A 5JMWA 4FOOA 4BKOA 2HAEA 2VTDA 3TL3A 4F46A 3R0IA 2BGKA 1KC3A 1EDOA 3ZHYA 4E2WA 2PH5A 5F1OA 3GZ4A 4OXKA 2EP5A 4PVCA 1AGNA 3RROA 2DM6A 4KUGA 4AG3A 4OAQA 1R0KA 3ETDA 2P2SA 5IAAA 5JCJA 4MDHA 4S1VA 4BO7A 1WLYA 1NPYA 2VT2A 1E3IA 3A14A 1YBAA 5LCXA 5BNFA 1HZJA 4YYZA 5JAIA 1NQTA 3G79A 3KUXA 1PQWA 3DZFA 1N9GA 2E4AA 4IQGA 3IP1A 4XYLA 3FTNA 3I9KA 3IJRA 3RUDA 5JO0A 4BOYA 3DAGA 4RORA 2G0TA 3WICA 3KB6A 5CDYA 4NQZA 1DDOA 2NUAA 4PIVA 2G5CA 5IN5A 5C5IA 3QV1A 2AEJA 3QVTA 3PHLA 1WDMA 4XZ3A 1N5DA 2OUIA 1WXDA 4O5OA 4YXFA 2JD1A 4AJKA 1E3EA 3FNHA 4CLRA 3RJ5A 3AFMA 2D5CA 2RHRA 4DBVO 5CDSA 3ETGA 3WGTA 4DIFA 3GGGA 1E7YA 1KEWA 5CAEB 2JCXA 1OAAA 3ENKA 1SEVA 5A5FA 2IXBA 4E5NA 2Q49A 1T1SA 4YQYA 3PK0A 3UCFA 4EUFA 5DNAA 5AXAA 5TQVA 1ONPA 4WLNA 4WNCA 1J49A 5L4NA 3LT2A 1YWGO 1YL5A 2A94A 1HE5A 3DQPA 2OGUA 4YJGA 1P31A 4E2YA 1VPDA 1KEPA 2X7HA 1YONA 4XX0A 3IUPA 2O3TA 4OSPA 3VDQA 3C1OA 3AY7A 3INGA 3SVTA 4NFHA 2H1SA 1EFLA 3DFUA 3GZNB 1ISIA 4II2A 4LN1A 3PQDA 4J16A 3VVCA 3CXRA 2OP1A 4AICA 2IZ1A 1PJCA 3H5AA 2J5RA 1BXKA 4GBJA 4XYEA 3GVIA 3ZU2A 4B7UA 5DDIP 4NBWA 2V7PA 3RJ9A 1LX6A 2QG4A 2ZJ1A 1VSUA 2GPTA 3BMCA 3V8BA 5L95A 2BH9A 1HDCA 4PVDA 3OMLA 1HT0A 4DPLA 4JP3A 2VHXA 3KSUA 1SZJG 4CQMD 4BMVA 1EQUA 3SBOA 1M76A 1Y8RB 5A4DA 4NK4A 4UREA 4F3YA 1ISJA 3ASUA 3UCEA 4DLLA 1O95A 4WCFB 1IUKA 4U7WA 3PHJA 1ZCJA 3OJEA 1Z7BA 4ND3A 2OORA 3OF2A 4KZPA 3ORFA 3LT0A 1M75A 1P0CA 3SLKA 1HE4A 3NT2A 4NMHA 4BNNA 4EYEA 2HK8A 3EZLA 4YJHA 3RFVA 3UICA 4CPDA 4DRYA 1E7QA 3EGOA 1BGVA 3RASA 2PTGA 8ADHA 4IDFA 2JHGA 3L6OO 3SJ7A 4NK5A 1RYEA 3BMOA 2FPGB 5B4TA 2HRBA 3FPCA 5BSEA 2D3TA 4ROSA 4JXKA 1IE3A 1DEHA 3ON5A 5HA5A 2C7GA 4BNMA 5K0ZA 1X13A 5FYDA 1T2EA 1ZVMA 5HRUA 2BKAA 1C0PA 3QVSA 3NEPX 3E1KA 4IJKA 3MWEA 1DIHA 3TZKA 5ICMA 4LRSB 1XKQA 4J49A 5GMOA 4Y6PA 2PKQP 3NRCA 1DAPA 4E6PA 5T67A 4FQ8A 3C1TA 1TA4A 3P7MA 1PWZA 2UAGA 1NNUA 1UAYA 3OH8A 5TT0A 3H7AA 1LJ8A 2G1UA 4PLVA 4ZRMA 3DZGA 4CLXA 2R00A 3GDOA 1O5IA 1ENYA 5THQA 4IMPA 4DYDA 2CZCA 3L6EA 4MKXA 3E5RA 4MO2A 1XA0A 1H9BA 4IY1A 1MC5A 1TT7A 3BTSA 4J7UA 2VWHA 3E82A 3FWNA 3OIFA 2Q2QA 3PJEA 3VPSA 3ZDFA 4CLEA 2X5OA 5KJEA 5J23A 1T4BA 3KV3O 1IZ0A 3DC2A 3E9NA 3HN2A 3WLFA 3KYCB 4WLOA 2BFOA 3AU8A 1M67A 1KVUA 4EBFA 3IDSA 1HSOA 3PEFA 4WGGA 2PY6A 5ADHA 2PZMA 2IZZA 2RH4A 1Z75A 2VN8A 2NU7A 1VJ1A 3IKVA 3GGPA 3U0BA 3MJCA 1JKFA 2IXAA 3AOEA 1SNYA 4TMFA 1LLUA 4Q9NA 3HDHA 3OECA 1QYCA 4UVEA 3DBRA 1VKNA 3JQ9C 5HTOA 2HJSA 3CSDA 3OIGA 3RWBA 5BSFA 3P5SA 4NR0A 4NZ9A 1EK5A 3WFIA 3EZYA 3JD4A 4L75A 5AYVA 3AY6A 3WBBA 5L9AA 2VWGA 4JBIA 3FNFA 5KVQA 4N5LA 3CTMA 4OQYA 3HG7A 2VRCD 3JQGA 3JQFA 2Q99A 4TVOA 2X58A 3U49A 3TN7A 4IJVA 4UEOA 1DC3A 2AQ8A 1UJMA 1HDGO 3KBOA 3WBFA 5A02A 2Q45A 4G2NA 3D3WB 2H6EA 3DHNA 1PJTA 1ZMOA 3HFSA 1TLTA 3ZWMA 4PZEA 1BWSA 4EDFA 4NU5A 3UVEA 3ZU4A 2X0RA 4WNIA 1UZMA 1LSJA 2JCYA 1A4UA 2A4KA 4CL8A 3C1AA 4I5EA 4PZCA 3RVDA 1JU9A 1L7EA 4PRLA 3RD5A 2A9FA 4PG7A 2YV1A 1TB4A 3IOYA 2Q1TA 3C7AA 1WVGA 1YB4A 1GUZA 1LLCA 2FMUA 4BHTA 1X15A 4A0SA 3RC2A 4FFMA 4ZU3A 4OGWA 1PJLA 5IN4A 3VOSA 2ZYDA 4MOWA 1WAMA 4R69A 2NU8B 4XEHA 4BQPA 4L9RA 2SCUA 5EMHA 2OFPA 3NX4A 4D44A 3WS7A 1XR3A 4AJ4A 1IPEA 2O3RA 2IEBA 1PS9A 3ASVA 1MFZA 1PZGA 4IJWA 2HQ1A 1LRJA 3E9QA 4UULA 5IXSA 1FDTA 5JCXA 1AXGA 1GZ4A 3ZV6A 4AJOA 1RPNA 5CG1A 1GL3A 5L7YA 4CQLB 4BB6A 1E1NA 4ZQHA 3B20A 1LDGA 2VHWA 2OXIA 3GRKA 3VH2A 2ZB7A 3NGLA 4YEDA 4JX8A 4XQGA 2J5QA 1FMCA 4EUEA 4EEXA 1ZUD1 1VL6A 4G5HA 4MJLA 5KVCA 1EK6A 4LK3A 4R9SA 5A06A 5JDCA 1YH3A 4Q39A 4R5HA 1M6HA 4B3HA 3C7DB 4CQMA 3NGXA 1PGJA 1F06A 2VOEA 3L0DA 4RPGA 1H6AA 2LDXA 5AQ1A 1ID1A 1IHYA 5DBFA 3U09A 5L7WA 2FP4A 3ZWBA 1DJNA 2A35A 3FF4A 1KOLA 5IJZA 3HDJA 3QY9A 4OXYA 1XELA 5TF4A 3ITDA 5ILGA 1R4NA 4GKVA 4YAGA 1GV1A 3INTA 2GERA 3DBLA 2R6JA 1FDUA 4CMIB 5T57A 1CF2O 3NTOA 4PLTA 1YRLA 4FOSA 3SJUA 2PA3A 4WPGA 1N7GA 4WOJA 1EBUA 3FN4A 4F6CA 4AJHA 4BVAA 1DB3A 2WYUA 3MJVA 3EAGA 4WLFA 1E3WA 2NADA 3X2EA 1BXZA 3WYCA 3D4NA 1WW8A 2BELA 4BGVA 5A9RA 1EEHA 1C0KA 3WSVA 3DR3A 4WLUA 3VZSA 1EMDA 1ZIDA 2DBRA 4HFJA 4J2HA 5EINA 4YB8A 5KVVA 1DC6A 2QIOA 3ONEA 1QLJA 4JK3A 4UVGA 3H9GA 3EUWA 3L4BA 4GPD1 4NG5A 4P22A 4BO0A 4IQ0A 2FPIB 3I5MA 5EERA 3KSDO 5AXCA 2CDAA 1LDEA 5A9TA 5TX7A 1P9LA 4CMCA 1O8CA 4YJFB 3FNGA 2FY8A 3IKTA 2G76A 1E3LA 4HNHA 3GN2A 2X9GA 1SC6A 1VRWA 5G0TA 1YO6A 2P9CA 4TZTA 3WLEA 4TQGA 3F6YA 3G3EA 4W9NA 4D3SA 1DPGA 5T6BA 1KS9A 5C7OO 2YV3A 4ZHSA 2EJWA 4S3MA 4J2OA 4MIOA 3BIOA 2VOJA 4M87A 3QQPA 1I24A 4W7IA 1SBYA 3QA9A 3S2IA 2B83A 4J6FA 1T1RA 4DYVA 1DO8A 1J0XO 2WD8A 3RC1A 1JQBA 1GCUA 4U0KA 2UV8A 3HSKA 4FD3A 1U5CA 3GZNA 3DOOA 5IDWA 2Q1SA 3JCZA 1E6UA 4IS3A 5JC8A 2P5YA 1R16A 2VNSA 4JN6B 4RJTA 2X0JA 3DFZA 3DAPA 2DKNA 4DA9A 3WYBA 2Y0EA 2Q1UA 1N8KA 2EEZA 3JQ7B 4HX5A 1C0IA 1PZEA 2POQX 4XR9A 3I4CA 5A5EA 4Z9YA 4E5KA 3O4RA 1UP7A 2EG9A 3U4HA 3IQDB 6ADHA 1R6DA 1CEQA 2AXQA 4OXNA 5EQFA 3VPHA 4L0QA 3KZVA 4UVHA 2Z1NA 3WNQA 1ZXLA 4PG4A 4EJMA 3HJAA 4C7KA 1Y8RA 1QXSA 3O03A 3GT0A 1VJTA 2NTNA 4GLOA 4D79A 4GX1A 4WCFA 2P4QA 1ZXBA 3WTBA 4FB5A 1B26A 2Q4BA 3ENNA 1HL3A 1U3TA 2I3GA 2JFFA 1E92A 1EDZA 3JQCA 2BMAA 3H65A 4MP3A 4B8ZA 4CV3A 1G6KA 3I1JA 4YVFA 4FN4A 3WX0A 1Z6ZA 4CMJA 3EYWA 3QRWA 4B7CA 3AK4A 3K9QO 1P44A 4TSKA 3WGHA 3VH1A 2ZCVA 3OICA 3O8QA 1UZNA 4ZQEA 1H0KA 3GVHA 1E0DA 4PG8A 1JDJA 4Z3DA 4RVUA 5JSFA 4WK6A 4IPTA 1K5HA 4EEZA 3IMFA 1EUDB 1HYEA 1B14A 4N5NA 1GYRA 3ROKA 3ADPA 1KC1A 1TXGA 4YR9A 4GX2A 4WCDA 2JD2A 4GSKA 1Y81A 3BTVA 4A7PA 3PI7A 2HMSA 5I7FA 1RM5A 1T2CA 4CM8B 2O3UA 3PP8A 3ANLA 1E6WA 3LC1O 3NJ8A 4RF5A 4MVJP 4YRBA 1SPXA 3JD3A 4YT4A 5DOZA 1A9ZA 2I65A 1MXHA 2P4HX 4GGOA 2W2KB 1XDWA 3CPSA 4XJSA 4B7XA 1LUAA 3LF2A 1HRDA 4TZKA 3VH3A 3K30A 4L4RA 4WASA 3IS3A 3ZWAA 3GNSA 4KDEA 5U9CA 1TT5A 4MVJI 3LF1A 1GAEO 4PLHA 3TFOA 1U4SA 3K5PA 1Q1NA 2PK3A 3B70A 4IZIA 3DBVO 3QVOA 1ZEJA 3LC7O 1I0ZA 2NACA 4UUOA 3M2PA 5JYEA 5KWEA 4B3IA 5JY6A 1RM4A 4MIEA 4RL6A 2DBQA 4KTTE 3ZWNA 1XU9A 5ILOA 1DC5A 1F0YA 4CUJA 1LC0A 4CMKA 3M2TA 5DF1A 1XIVA 2OO5A 4XWYA 1PL7A 3EHEA 1NFQA 4OO3A 1U9JA 3ZU5A 1MG0A 3GMSA 3PYMA 5I8ZA 4EZBA 2X9NA 5DN9A 3R6DA 1M6WA 2QRKA 3A9WA 4U8GA 5ICSA 3I52A 2IRWA 5IDYA 2X0NA 4E21A 4H16A 2BGLA 2JJYA 2OMEA 1SB9A 1WNTA 3RI3A 3TJRA 4AL4A 4BO2A 1LDYA 5T8KC 4UUPA 4I8XA 4LMRA 4XYGA 3T7EA 1NR7A 1A4IA 2Y05A 3H9EO 3TF5A 4XD2A 2H63A 2X22A 3I3OA 1W6UA 4HNGA 4R68A 4IDAA 4HFNA 3ANMA 3HB4X 3WOHA 3RFTA 1SOVA 1FK8A 2QZZA 3BMNB 1Y9EA 3PZBA 1MV8A 1S7CA 2Q4EA 3BA1A 3OSUA 1GY8A 2UYYA 5ES3A 3JQDA 1GPJA 5ITWA 1IOLA 1Q7CA 4E31A 4J4TA 5CEEA 4IQ8A 3NDRA 4P8RA 4RDHA 5JDIA 4XQCA 3PJFA 1GU7A 5G2OA 4EW6A 1OBFO 1WDLA 1O94A 4URFA 1G1AA 1N92A 3JV7A 1I5RA 1XLTA 4ND2A 3AW9A 2EP7A 4IDDA 4L4SA 1NTOA 2B69A 3ZNOA 3WFJA 3V2UA 3ZWWA 4A10A 3TL2A 4GQAA 1Q0LA 3DXFA 3KEQA 1X7GA 3K2EA 5A9SA 1PJQA 2WMDA 3BXXA 1ZBQA 3D4OA 1PS0A 4GGPA 2ZB8A 5TRTA 4CV1A 2O23A 3I9JA 3QHAA 3CH6A 3KYDB 4I9HA 4KUEA 4CQLA 2DPGA 5DCWA 1NFFA 1GDHA 3WG9A 5I9MA 1ZSVA 4IINA 3OETA 2V6FA 2VUSA 1OFGA 1WDKA 1YB5A 1SAYA 3AM3A 1UDAA 1LLDA 3PFWO 4WLEA 2FR0A 1ZNQO 4KWIA 1QSGA 3W1VA 1PZFA 3U62A 1P77A 3VTFA 4AVYA 2X8LA 4ZA2A 4CJXA 1D3AA 4PN3A 3GPDG 3D64A 1PJ4A 1YB1A 4WKGA 4J9VA 2RBEA 3OIDA 1SOWA 4JJIA 3UOGA 3ZWYA 2XPCA 4R51A 3I83A 3EVNA 3I23A 3WSWA 4L8VA 3ZI0A 3D7LA 3I9LA 5IZ4A 4YJDA 3IAHA 2H5LA 4IMRA 4XR4A 2HMTA 1AHHA 4WUVA 1E77A 2BLLA 4TRRA 1QYWA 4RPKA 3CKYA 2J3JA 1V9LA 3OP4A 1VKOA 3RBZA 4CMIA 4YT5A 1NQ5A 1OC4A 4EUHA 2D5AA 2W90A 3DMTC 1DFHA 3C7CB 2Z5LA 4WOKA 3EW7A 3INRA 2AA3A 2JL1A 4BO6A 1CRWG 1GV0A 1HYHA 1Y6JA 2GN9A 3GMDA 2P9GA 1KYQA 3QW2A 3OJOA 5BSHA 2CUKA 5JMPA 3Q6IA 4OKIA 1DFIA 4NFYA 4TKMA 1DIAA 1K6JA 5IFLA 4R41A 4BNZA 3LT1A 4BO5A 9LDBA 4XJTA 2WM3A 2YHIB 2FPPB 4GH5A 2Y67A 1LNQA 4GVXA 3DONA 5ER9A 1H9AA 2HSDA 1Q2XA 3LSYA 4B8WA 2IYPA 3WQQA 2FPIA 4FC7A 4IGEA 3GN1A 1P45A 3QP9A 4IDCA 1KETA 4RQTA 4II3A 1ZK0A 1BRMA 2CVZA 3U3XA 3ZN2A 5IXYA 4BV8A 1L7DA 4ALKA 4PLFA 4U6QA 1KVQA 2Y1DA 3E5MA 4RZIA 1XQ6A 1M66A 2IE0A 1RWBA 4ZQBA 2Y1GA 2EKLA 3U4DA 3WQSB 4D7AA 3MJTA 1KY4A 2O2SA 2YQ5A 2EV9A 1B16A 1KBZA 1GUYA 1LI4A 3WMXA 4D45A 1CQJB 2B0JA 5A03A 3N7UA 3JQAD 4FFLA 1V0JA 3H9JA 3LZ6A 1T2AA 4BNXA 2Q2WA 3K2BA 1QP8A 3MWDA 1U4OA 4NNJA 5GZ6A 4B4VA 1GZ6A 3RUAA 2JAHA 2VYND 1S6YA 4L76A 1P74A 3OQ6A 4Q3EA 4NU6A 4CLOB 2GN4A 2FZWA 3GA0A 3JQBC 3P2YA 4Z0HO 3PDUA 1P1FA 1IY8A 5I7SA 1HTBA 4NH4A 2OHXA 4PRKA 2X5KO 5L51A 3GVPA 1LSUA 2GLXA 2P68A 5CPBA 4D3DA 4YRDA 2W2LD 5HM8A 1I2ZA 1EVIA 1FJHA 1DOHA 3RC9A 2XXBA 4NBUA 1X7DA 3GUYA 4D0RA 1UDCA 1B0AA 5G0VA 3IIEA 5HWSA 1PU2A 2EW2A 3SXPA 4ZJUA 1HSZA 4WECA 1LQTA 2ZTMA 3JYOA 1T4DA 2D59A 5CFZA 5KOIA 1MB4A 1MFPA 3AUAA 1P1JA 1DHRA 1DC4A 5CPFA 2PKQO 1HE3A 2HUNA 5TIIA 1RKXA 3BTOA 4DC0A 5L53A 4NJMA 3ZWXA 2GASA 3OEWA 1ONNA 1I30A 1YDWA 3B6ZA 3ZW9A 4JNKA 2BI7A 4NBTA 4R1SA 3QLJA 4U0JA 1C1DB 1MX3A 2I5PO 4QX6A 4BGUA 3MJSA 2D4AA 1F8FA 1H5QA 1U3WA 2VQ3A 4M1QA 4XQEA 5ENDA 3TPCA 2AQIA 2O50A 4BNVA 3DHYA 3PJDA 4E0BA 4OOFA 3E9MA 4UVIA 1ISHA 2BFAA 2VYVD 2J8ZA 3ZV5A 3I9MA 4HADA 4BKQA 1EUDA 1UR5A 4INAA 3WGQA 3UF0A 3BMQB 1WZIA 2YZ7A 3W6UA 2VRBA 2PZLA 3GC6A 3HZZA 4XKJA 3UH1A 3JYPA 2NNLD 1HWYA 1E7RA 3HFGA 4CM8A 4KP7A 3DOJA 3GK3A 1Y5MA 3VC7A 4Q3AA 3D0OA 1FDVA 4C4OA 2EF1A 4R5MA 1PJ2A 4MVJG 4FFPA 2A92A 4XDYA 4HY3A 3PFFA 1E1MA 1HLDA 2CD9A 3OFSA 4BMNA 1BW9B 3Q1LA 3W8DA 1JKJB 1IPFA 1XSEA 4HBGA 1GYQA 3V1YA 3KYBA 4GVLA 2WE8A 3JQ8A 4OHUA 1HF3A 4OJNA 2UVDA 3IC5A 4ND1A 1T25A 2E82A 4FIZA 3CMMA 3DMYA 4GI2A 2BHLA 3ZWPA 1U3UA 2LDBA 2AEFA 5DT9A 5T64A 4DLAA 1YJ8A 3NTRA 4DXHA 1T2DA 4OL9A 7MDHA 5C7IO 4WEOA 1A72A 1GTMA 1I3NA 1ULSA 3RUHA 4ALIA 1T24A 3WNVA 4ALMA 4NHEA 4PFJA 3WIDA 3ULKA 2W8ZA 4E12A 1ZSNA 3T7CA 4GWGA 5L45A 4CM6A 1JLLA 5G4LA 4P4LA 1SCUA 2F00A 2R00C 4NBVA 4OOEA 2NU9A 2UUPA 1UXIA 1UP6A 1VM6A 1N2SA 3AM4A 4MKZA 2B5WA 3AY3A 4ITUA 4BKUA 2W98A 4YACA 2WSBA 5H83A 1VE9A 4AJ1A 1XCBA 3DHEA 4FFRA 4FSHA 1QYDA 4X54A 3VDRA 5G0SA 2Y68A 3X2FA 3TQHA 3PDJA 3S8MA 1ULUA
chains in the Genus database with same CATH superfamily
1LPAB 2FU5C 4E2ZA 5CT8A 2AW5A 1UKZA 1NFRA 2A7XA 3QLEA 1JSLA 4M6WA 1JECA 4MSUA 3GEPA 4V0LA 4WESB 4RKFA 1XL0A 1QGUB 2EU8A 1JLMA 4IHJB 4M37A 4DM4A 3IL2A 1NGSA 2EKPA 3MA0A 2WW8A 1JI3A 3KJQA 4LISA 3RTGA 2J41A 1VSQA 1U8TA 3AW8A 3FPLA 3GCZA 4AJ2A 3OX2A 3BMNA 3DG9A 4N0DA 1ZP6A 2A8YA 3PDWA 4HX2A 4B6SA 1LD3A 4CXMA 4RLHA 4DNOA 1QPBA 3ANNA 1RMTA 1Z4OA 1RXEA 3D6VA 3OM9A 4V0KA 2QR3A 1W6RA 2WD7B 3TRKA 3UFXB 3UENA 3T1NA 4MUAA 1Z47A 2ZK7A 5C8VA 2EJUA 1E3SA 4YJKA 3W9SA 4JT9A 2E87A 1US8B 2PSHA 3AUXA 1UP4A 2GR9A 4G01B 2WP8J 4WBSA 1RNLA 1FNNA 1HK7A 3Q0IA 2R66A 2YYAA 1TCVA 4YP7A 2CUNA 4HDNA 3FNQA 1JRLA 1VE6A 2WWHA 1I2BA 3GQVA 4MGZR 1VE7A 3SC6A 2R6AA 4QC2A 2ZYAA 3JQFC 3RSQA 4BWVA 4LXIA 1IJFA 4JOSA 2DVMA 2Q4TA 1PD1A 3IAAA 5ALXA 3WLIA 1AXRA 4LHVA 4WN9B 4BYMA 4GDFA 3V32A 1SXJE 1LI5A 4JZYA 1UMDA 4F7DA 1AHIA 3QWIA 3WB2A 2OP0A 3SBXA 3UW3A 2V45A 4S1TA 2WQZA 2BL4A 3PV0A 4E15A 4NDAA 1A98A 1LQUA 3AU9A 1W93A 4K8OA 4KE6A 1KI6A 1D5CA 1Y98A 4LJ6A 4EL5A 5KSOA 1AHPA 4IIUA 2R8BA 3E6AA 3NHKA 1Q7RA 3CXUA 1AKEA 1O2DA 2OBYA 4YECA 1WW3A 5FI0B 3U9SA 4L27A 3W9YA 2EJBA 3C3XA 5LYYA 3L7OA 3AVTA 2H4XA 5D87A 2WHEA 1C9MA 5IDXA 3MHTA 4DBLC 1OU4A 2UVPB 1W5TA 1GQ2A 1YQGA 2PWAA 2WT8A 1V45E 4JC5A 5AKJA 1XRJA 3U81A 2J7KA 1JFSA 3D8UA 1UJNA 3W5DA 1H4VB 3TLEA 1YQXA 1KEEB 1Z3IX 2AH5A 5SYNA 1AE1A 3QFFA 4JR0A 1W4LA 1SULA 3GEIA 4LCEA 3GRRA 3HCWA 4BGDA 3KLMX 1O6BA 1WV1A 1SVLA 3BWYA 3C5VA 6REQB 1DXOA 4G4GA 5HF9A 4J4HA 3T06B 3WQRA 3QEBZ 4CEHB 1XMVA 1E6MA 2H17A 2IYUA 4M86A 3CPHA 4U9HS 5AJXA 4UOEA 1NUHA 1ZKMA 2P78A 4K9KA 4UDNA 1MPTA 4BCCA 2ZSBA 3FYCA 2WAYA 3H7IA 1LLQA 1NF8A 3MTIA 4HWTA 3EEQA 4NICA 4HT3B 1FZTA 1QNFA 3IAM1 1G63A 1P1RA 4IEFB 1DCMA 4K2HA 4GE3A 4K6CA 4PC7A 4D41A 5C4MA 2WV9A 4CMBA 1QE0A 2NWQA 4UEKA 1B15A 1UBHS 4KQ2A 1QKIA 4TLAA 2PU7A 4IBOA 4YQZA 4YRRA 2XF2A 2QU8A 4YUWA 4K6OA 5EIBC 3V8QA 1E64A 2CHVA 3M9WA 1UWKA 3F7NA 3QFTA 4WZZA 4OFZA 3HLTA 2AC2A 1VIMA 2JVJA 1GQQA 4Z9BA 3ZDQA 4E3WA 4PIPA 1CTQA 1BMFD 1TQ6A 1KI8A 1WP4A 1CHNA 2GN8A 2N42A 3L01A 4HYEA 4MI1A 4Q4AA 1SCDA 1WHSA 3M89A 4GG1A 4X85A 3GPCA 3RIHA 3TFQA 6PFKA 1G8KA 1LSOA 1VLLA 5MN4A 3N05A 2QVCA 2X6QA 3CH7A 5K0TA 3VUFA 3H3FA 1NG9A 1YE8A 3WMEA 3VPFA 4GQBA 1DVRA 1O96A 1IZ9A 3QU9A 3CO5A 4KPUA 1RP7A 4N49A 5REQA 4HSGA 1AMOA 4MQEA 1ZM4A 3S2ZA 5BMVB 3E8MA 1L5OA 4Z3KA 3PYLA 4YRMA 3KTDA 2QTZA 3GAZA 3D6JA 3G8DA 5EFOA 1NVEA 1YE5A 4IRUB 1ECBA 2R6FA 1E4EA 1VC2A 1JW9B 4FFNA 4KCGA 8MHTA 4IEIA 4G1BA 3MVEA 4HXYA 1SXPA 4TOIA 5H02A 3R7FA 5AHRA 2ECKA 1DTWA 3KZCA 3VNSA 3BH7A 2QZPA 2X19A 2Q5EA 3ZCQA 1BVUA 1BS1A 4Y2VA 4PRZA 4BRZA 1OPXA 4ASUA 2V0GA 1QLHA 2G8NA 1WUYA 2E5WA 2I4IA 1JDVA 2E37A 2O7SA 3AFOA 4MI6A 1ISFA 1CETA 3U9LA 2QYSA 4HEJA 4EKDA 3QKRB 2FMHA 1PBTA 4MS4A 1RTTA 1J4AA 1QGYA 2VRCA 3KHSA 4U2BA 4CTNA 3GLIE 1M8PA 2A0FA 2FQQA 3N2GA 4AQYB 4L0DA 2L0XA 4ZO8A 5EMLA 1KAHA 2R2GA 1JL3A 5I51A 5CCXA 2CF5A 4JCOA 1NWCA 1DQSA 1X0VA 3AG6A 3DWEX 1QAQA 1UPTA 4N54A 5IJXA 2HWKA 1W34A 2ASEA 3WE7A 3WGJA 4HAWA 2EKQA 4AZ0A 3IESA 4QNRA 4LXQA 1CEYA 2MT9A 4G8BA 2HBZA 3PUHA 1W36B 1TO2E 3KTOA 3L2OB 4WK4B 3R7LA 5LSAA 2YRWA 4UTZA 3ZHRA 5JYBA 5FBZA 1BEUB 2YJ6A 3E4DA 3LY8A 4YA6A 3N1UA 4GAEA 1X14A 1EP9A 3R3VA 5DM0A 1WZ2A 3PA8A 1GL6A 3AEKB 1OXTA 1LV8A 2HNKA 2NUBA 4QUAA 5FDFA 1OZ0A 3AP3A 1YBVA 3KZXA 4UEJA 4PAGA 4FNOA 4XI9A 3TG8A 1K8ZB 4M54A 2CHGA 2QGFA 1PR2A 4Z0NA 3QE4A 1JIKA 3R5JA 5J2UA 2O8CB 3F4BA 5FBRB 1G8AA 3R44A 3WR5A 4BFWA 3WLRA 3V5NA 2JAQA 1CY4A 1QIHA 5FOSA 3HVUA 3L8DA 1JPJA 4U63A 1G38A 3NC0C 5GJVC 1Z36A 4KQ6A 1R4ZA 4DY4A 3EVTA 1LGYA 4J0FA 2VJBA 5TJ9A 1Z4KA 1WTCA 2X2PA 3IDZA 4L5CA 4X84A 1N6HA 2FOIA 1DLIA 4IWYA 2A1TR 5AK5A 2GJSA 5A4KA 1DO2A 5IDQA 4RU1A 5JFTA 9LDTA 1G6Q1 3NIWA 4ZEMA 2H11A 2WAXA 5HDQA 4EH1A 3OD5A 1F8XA 1L4MA 5H7XA 4PE5B 2J07A 1W0JD 3ESQA 2MDTA 3ZBTA 2XOXA 4B6PA 1NVMB 4D0LB 2RGNC 1N5IA 4CHGA 2HV8A 5BNIA 1RVDA 2H2IA 4A8JC 2IZ0A 5CDTA 1W47A 2JGDA 3QOWA 1EVKA 3FVTA 3X44A 1UWVA 1Q74A 6AT1A 3EC1A 4PGHA 1MR3F 4LYDA 2ZCUA 3BSSA 2FHSA 4AX8A 4C4PA 4LBWA 2OXFA 4KQKA 5AW7A 1N0IA 4Y2HA 3TBKA 1C9NA 1PDWA 1WMBA 4AYXA 1UMKA 3HYTA 4I50B 2DHCA 1SC9A 3IQWA 3SC4A 5HS6A 4EX7A 3VKUA 3ZJUA 4XIJA 3W8FA 1E7SA 4KDRA 2P0AA 4EO7A 3ROMA 4YMGA 5DYWA 4D6PA 1AKUA 2AMYA 1UIMA 1IZ8A 1NRWA 2HZ7A 3JYLA 3KYCA 4MV4A 2QT1A 4QBKA 4CG2A 2PGLA 1RAHA 3OJ0A 1S0UA 2NU7B 4M83A 4AWBA 4E5PA 5KX5A 3DMGA 3QY0A 4QO8A 2O9JA 4GSYA 1V8OA 4E14A 5BVGA 4PZYA 4JI0B 1H4QA 2RAVA 4ZT7A 2G9UA 1FE8A 3AI2A 2IA5A 5LQNA 3OEHD 5I7UA 1XCLA 1CS0A 4AQ7A 5TGZA 3U4AA 1ESCA 3GT3A 2O48X 4OAPA 3E84A 5SY6A 5EJ4A 1WXFA 2G71A 2RI0A 5KYNA 2C82A 1JAHA 4KX3A 1XTSA 3Q7IA 5K8TA 1II8B 4B74A 4CI0B 3RGGA 1DFGA 5IH3A 4JI7B 1DWUA 2HJ9A 2PCLA 4QRDA 3K0SA 4CEIB 2E48A 1UBLS 4JFRA 4DUGD 4K0KB 2E1PA 1CJUC 1I6KA 3H2SA 3RSHA 3JQGB 3RAGA 5M7EA 1CRPA 1TECE 1XRSB 1JHRA 2TECE 3W5BA 1J70A 4JBYA 4F4UA 5LPNA 4C2UA 4ZQCB 4RPHA 4U2FA 1WU7A 1UXJA 2O8DB 2WIFA 5B36A 4AZVA 3DGEC 5KBYA 4HQ0A 3NTVA 3KDAA 1CUVA 1X3SA 2E6UX 4IZHA 2YC4C 4UM7A 4EHKA 1PQPA 3QTBA 5ALVA 1RMYA 2W2XA 3D3WA 1P5FA 3UM9A 1JSZA 3RG2A 2YYYA 4BO3A 4LQCA 3L6DA 2QL6A 1G3MA 4CMAA 4MRNA 3GFBA 3REGA 4LJ5A 1AKMA 5E4FA 3SF8B 2DERA 4AC9A 4I4LA 4JLSA 2J9FA 1FDWA 3NWPA 1LRLA 3AF5A 3LWNA 4ZD6A 1FVXA 3NDBB 2XVZA 1KR5A 1M5UA 2C29D 1P60A 3SC3A 2W6CX 2BONA 2W37A 5FUQA 4R6XA 3TLAA 1JVBA 4FEAA 1DIBA 1X8XA 5DBIA 3PX3A 2EJVA 3PDIA 3AR9A 2BFNA 4N76A 5C32A 3WNDA 4KQFA 1VJGA 1M0WA 3EGEA 3G49A 1L4FA 2V3CC 3ZV4A 4UTOA 3PWZA 4K86A 1CVRA 3ER9A 1Z17A 2J4CA 1I1HA 4RHEA 1XG5A 3HY6A 4M9SA 2P8SA 2JLRA 4HZGA 4N5DA 2VSQA 5U4QA 4F3RA 3INNA 2VJAA 5J5VA 3FVVA 3A6KA 2GEFA 2Z98A 4FDLA 2AN4A 4LDQA 3WK7A 4EZEA 5LZ9A 2EW8A 3HKBB 2Z2ZA 3HY4A 1ISRA 4ZCPA 4PXYA 1BJTA 1T6ZA 3MUNA 3TRIA 4RKWA 1E1QD 2REQA 4V24A 5HBRA 4E2XA 2PQ6A 3CLSC 3LYHA 2ATIA 4A2CA 4BN4A 3AR4A 3EE6A 1BQ4A 2FSVA 3FI9A 3E9RA 1A2KC 3QELB 4K40A 3I0NA 2FEKA 2HDNB 3T4EA 2CL5A 2XGSA 2JK0A 2V55B 5DHSA 5EOVA 4Z4CA 4CKCB 4UPVA 3F97A 2GDZA 3RVSA 4M8KA 2AG6A 3A4MA 1IQRA 1N1GA 5JPIA 3B52X 1I33A 4FJ1A 3OQPA 4CNBA 1JWLA 4RV9A 1C81A 1Y1RA 3IURA 3V2HA 3VX4A 3SIWA 3VISA 2DJIA 4ZI5A 4AXXA 4LYEA 5E2AA 1KDOA 5EZYA 3CIOA 1F6BA 4L4ZA 1KO8A 2I91A 1HXHA 3LQYA 4QXMA 4ZVMA 4OJYA 4HQLA 5AM0A 3RTEA 1SUDA 1HG0A 3RU2A 3ILYA 5CD9A 4RHCA 5CH3A 4UNRA 4CRWB 1VMIA 4TXLA 1A9YA 5DMHA 3EA4A 3P9KA 2BM0A 1NM5C 3DE7X 3PRHA 1OXBB 2EP8A 4LZPA 3IUEA 3DBLB 4Z0TA 3L92A 5AKEA 1E69A 1KHHA 2D2VA 3OTQA 3VNUA 5T5QA 4UTXA 3WWDA 1A3CA 2B1GA 2CL6X 3TNFA 1YJXA 1Z83A 2Z30A 4I5DA 4JELA 3N6RA 4AJEA 1PZMA 4XSVA 3X1JA 2J3IA 3DMHA 4A73A 1YT5A 4HXGA 4DSOA 2CFOA 1GVNB 2XE6A 4L5IA 2IWHA 2NVBA 1RHQA 1E6KA 2ZIXB 4OPMA 3OOWA 1GPDG 2NAPA 2Q29A 1X7ZB 1XX6A 2FFAA 2R25B 1E3WB 5J40A 5U4XA 1FP4A 2W2VA 4GWLA 3ZH2A 3UMSA 1YIDA 1EXNA 4EG5A 1J25A 1IFXA 4B6GA 4YO8A 2GYVA 5J2UF 4RNDB 5CNIA 3RQSA 4D46A 1DBVO 4DUZB 2ZLBA 4FYVA 1QYXA 3RNLA 1GO2A 1YFLA 3G0HA 2A2ZA 3RANA 2RH5A 4XGKA 3DB2A 4YDHB 5KNCH 3GB9A 3AEUB 5FP0A 2ZJ3A 1NDQA 3BREA 3D4PA 2ILTA 3I0MA 1J97A 3PLRA 4OA8A 4RZUA 5DX0A 5ANRB 5AP9A 3AJ9A 1SXHA 2VJDA 3TNDA 5KVSA 5D1NA 4BQRA 5EXSA 2F8LA 5JCPA 1UPFA 2H4JA 2YFQA 4QLAA 1DIRA 2RGEA 4Y2GA 2OSVA 4DLWA 4HN4B 3HCCA 2BKXA 1HLPA 5KKCA 1X1TA 1JE0A 2RIRA 1HL7A 1PIWA 3B38A 3WY9A 3U37A 1DEOA 3JWGA 3JQBA 3QVLA 4CGYA 3C85A 1CIVA 3K6SB 2D00A 2NVUA 4OB7A 2R87A 1DC7A 2PMKA 2V3VA 4JI8B 2G0AA 1UOPA 3KXIA 2PT5A 2IUUA 3PHIA 2BTQB 2VYQA 2EYUA 4MKGA 5CGZA 4NENB 3SVTA 2QGZA 3MUOA 1JNXX 1AKVA 1UFQA 1SD2A 3FMFA 1M1UA 3OEED 1TE2A 4HDKA 2B4QA 5KYXB 2F1JA 4DV4B 2V7TA 3ZQ4A 2D5IA 3E2IA 5TS3A 3RSCA 2VK4A 2YMQA 1LEHA 2GRJA 3F2IA 4ISBA 2IEZA 3NC1C 4IGFA 3W3AH 4LSMA 3BB4A 4R3WA 4F6LA 8GPBA 3GHYA 1JIIA 4UD2A 3L0SA 4X00A 3OQIA 1GG8A 3VTZA 3ESXA 2QX7A 5KX5F 3FBTA 5SICE 4EG8A 1B3RA 3GFQA 3GCDA 2BHRA 3IT0A 1OX6A 1WHTB 4H27A 4QQ8A 5CUQA 5AI5A 3QUQA 5LXTA 2XCTB 3SM3A 4N3GA 1V5WA 3DDCA 5IVDA 3B3AA 2PPLA 3ONVA 1OFVA 2R1UA 3H16A 1RYDA 1Q0QA 2WM2A 4O2AB 2O06A 3OEHA 1TAQA 3WHIA 2GXAA 4ESEA 1MGOA 1N0UA 3ENWA 3LHFA 1ENPA 3LQ2A 2FW6A 5EIBD 1DX6A 5LZ7A 1B8VA 3COYA 4F9FA 4O4LF 2JGLA 4LA4A 4C87A 2EDAA 1OFUA 4DLRA 1XU7A 4IRXA 2HSWA 4RLSA 2IHKA 2O8FB 4KLZA 4B75A 4DUGA 5ABPA 2QE6A 4BMPB 4NE2A 4AKIA 2CXXA 4QFDA 3UJ3X 1E2DA 4EI8A 4IV8A 1H6BA 4PFKA 3BAZA 4RIFA 1V7PC 5J2TA 3ZLVA 1PDOA 3KCQA 4OUKX 5CXUA 3E7WA 2AFVA 4AUKA 2FF5A 5BNTA 3HO6A 4LX0A 3DE0X 2QKYA 3ROZA 5BMOA 4UFOA 1TUBA 3B7GA 1X1EA 2RIPA 3D5QA 5FWXA 2Q8NA 1RAGA 1TUEA 1C9KA 3WGIA 1BH6A 5TNXA 3OWHA 3RAEC 5BN3B 2H3HA 5BV8A 1V8BA 2NTVA 4J16C 1BDMA 5BQPA 1UZLA 3IEIA 2HMYB 1GNLA 1Z06A 1QYRA 4RY2A 3T9FA 4B8YA 4F4JA 4AZ3A 6NULA 3K73O 2WVJA 3UYLA 2PGDA 4HTFB 3UJ9A 1TZKA 3WIVA 3ZCTA 4I1PA 2O3JA 3PIDA 1KDTA 5CMLA 3HXLA 3KAKA 3LC2O 5K2MA 3RSGA 2PXCA 4MHTA 3B13B 4F21A 1I3KA 2VPWA 3SFVA 4A4DA 2AEMA 5D3KA 4Q3NA 3HPRA 1TC2A 1EAYA 1NN5A 1OASA 4X8OA 1GCAA 2E4VA 3G0CA 3L7JA 5FPYA 4PYKA 5J5CA 1AUVA 3BX1A 5I4CA 1C8LA 2BHSA 2V5AA 5JTTA 2I9KA 1FB5A 1FUUA 1SCAA 2HFJA 1YBHA 3GX1A 3FVWA 2PYDA 4JCCA 2CCGA 4WZAA 4ZQGA 2JZCA 2L18A 5JQGA 1LPBB 1C14A 3H1GA 3QEMA 1RLIA 3ACCA 3V8MA 1QOPB 1XTJA 3OUTA 4UCFA 3IPAA 4XIIA 2BFPA 3BGIA 1QH9A 1NVTA 3H1PA 1SG0A 3CEAA 1II9A 3U5TA 1E1QA 5JRZA 2FFJA 3GJ3A 4QTZA 2BDUA 1MENA 2XZTA 1KQ3A 4UBOA 3UGJA 1WBJB 5CX1B 1B6RA 1U2SA 3L7IA 2KLBA 4RS4A 5TT1A 1A4RA 5DK4A 1ULAA 1EBFA 2R7LA 4DNQA 5HYVA 1C7RA 2O7QA 3U60B 4Y3UA 1KMHB 3OCCA 1HLFA 1EZ1A 1TJ5A 1EJBA 3OX3A 4TYPA 5EZYF 4CM5A 3AJAA 2CXQA 3EPRA 3ZK9A 4MUYA 3T1QA 2MMGA 3A4TA 4JAVC 1ZN8A 1T6NA 3LI2A 1B1CA 2FG7C 5DTRA 4IKOA 5L7TA 1P3DA 1U2DA 1X7YA 3KXKA 4MCHA 2OL4A 1IULA 1L4YA 1XHEA 3CRQA 3WAJA 2W83A 2ZFUA 1Z22A 1E79D 2C57A 3KG2A 4Q34A 3O91A 3AGPA 5ENVA 1ZW6A 1ZJZA 3F8WA 4TLEA 1A71A 2OYRA 4XSHA 1NUTA 3QXXA 5CW1A 3RIXA 3CE9A 1SZCA 1UK7A 3ZXSA 3A4VA 5B3AA 3QKTA 2WTBA 3FWZA 5FTJA 2WFLA 4PAWA 1ZD9A 3CW9A 4CF5A 4KO1S 3ZHZA 3JQRA 4L4UA 1F9EA 3KJIA 5F3DA 4WZ6A 2DQSA 4N3AA 2AN1A 2COUA 3EIEA 4NU0A 1JLHA 3LK6A 2B8WA 1C4XA 1JVSA 3KKZA 4W5HA 3DZBA 4L02A 4QTYA 5GINE 3G5MA 3IUNA 3I04M 3RS5A 3KEOA 1T2FA 4JB0A 4LJ4A 1JR2A 4MRAA 4PV7A 2AOTB 5IP5A 4WY2A 4D8YA 4EY3A 3NANA 4KIWA 4C6HA 2G09A 1HQDA 4MW2A 3FZYA 4MGHA 4K9NA 2OZEA 4BNHA 2QX9A 5KEIA 3CVWA 4KWEA 4TL6A 5LOVF 3T3NA 4MRMB 1GYPA 4EK9A 4F5WA 2F43B 3AF2A 2AF3C 3P0FA 3KCNA 5CRIA 1SM4A 2HOQA 4DSTA 1TGYA 2QPAA 3THXB 4WE3A 1R3UA 4J6EA 3N2EA 1Q15A 1VI2A 3T3EA 1FFSA 1A5ZA 1H2ZA 1NMSA 2PL1A 5KJCA 3DV9A 1L2TA 5ERYA 2FWJA 2C9ZA 2R1TA 1JX6A 3CF6R 1G8MA 1QBGA 4XAQA 3EF3A 3G9ZA 3EXEA 2C9YA 3W6ZA 4UTVA 1IN1A 3V9AA 4WN3A 1YS1X 2ZVJA 1JZQA 1TMOA 1L3IA 3IQFA 1JH9A 4LFAB 4BLOA 2AFHB 3LT5A 3K53A 3I2GA 2ZWIA 4M7OA 4PW0A 3Q6NA 1R15A 4RK7A 1Z8DA 1L5VA 3F4KA 3KD3A 4MVJE 3ZV3A 4HGPA 5CW2A 3OHPA 2W6OA 4RULA 1QG2A 2EW1A 4N0EA 3UANA 3EXHB 3KQTA 4XRGA 2JAOA 1DAOA 1GQOA 1VLZA 3F2VA 3HMKA 3JTEA 1OLOA 3NIDB 5EWJB 2BEVA 2XE4A 4RMGA 1J8MF 1EVYA 1NWHA 2VZ0A 2B0CA 2PKWA 4MPTA 4QECA 3HVKA 3R7WB 2D4HA 2OV1A 5CBPB 5LXTF 1NVUQ 5FL7A 1A9SA 4G9EA 1BA3A 4JI1B 3EG9B 2FJUA 2YDYA 2FDXA 5FB3A 2G28A 4IF6A 2ST1A 1IBLB 2G08A 1K7CA 2XDQB 3M6WA 2CK3A 3K8QA 4N5MA 3JS5A 3ZGXA 1OFHA 1KYZA 1FX1A 4TWIA 3RWMB 3UO8B 3WA7A 1DNPA 2ECFA 5ADVA 4XQ9A 1OIWA 3ZHXA 2VIIA 4YCAA 1IN5A 3AX6A 1KY3A 3KYDA 2YS7A 2OWDA 5E38A 1N2GA 3H1EA 4D8WA 2CVHA 5JS2A 4G4JA 5I9LA 3AHHA 3RKUA 1YS7A 3OIWA 1ETHA 1ARZA 2BFFB 3VYWA 1X7HA 1XBTA 5HVNA 1XRLA 1CZLA 4F4IA 4NULA 2ZQZA 3KR1A 3NNNA 4KK4A 4OSEA 1DKNA 1R0WA 1LQ2A 4R2KA 4G0VA 2OCIA 1DO0A 4LCBA 1TVEA 2AQKA 4B09A 4C3VA 1MO3A 3DAOA 3VTAA 2XUQA 2XNCA 1D2MA 3LC0A 1SC3A 1ULBA 2AOVA 3RRBA 1HFJA 5K01A 3GLQA 2D5BA 1O5TA 4PLZA 2DBZA 1XAGA 2W7TA 3GDGA 4GKAA 4ODIA 3DMDA 3EIQA 3NORA 3ZHCA 4EUNA 3V55A 4K6FA 4BVFA 4D9GA 2WP0A 3SNKA 1S4QA 4G09A 2CBXA 3BIWA 1X94A 3CZCA 3NDJA 4ZTUB 3PYXA 2C96A 4QUKA 1PGQA 1ZK1A 1NW7A 1PV2A 2SKEA 1VIVA 4LJRA 1QO0D 4UXHA 3A7DA 1WUHS 2XF8A 3BRWD 3CLSD 4OBBA 3HXQA 5ALOA 1RYZA 4LDNA 3IMKA 4LZLA 2FLWA 3VNAA 2Q4OA 3TH5A 2I7CA 4I4IA 2G1JA 5IH7A 3C24A 1L7RA 4N6GA 5KYVA 4CTKA 1E0JA 5FAKA 4HVTA 4ESVA 4HZIA 5MGNA 1NP6A 2GO1A 2B20A 4FYHA 1QE3A 2P4UA 3CTPA 4BNIA 4ZRNA 2Q6IA 5HOQA 1XYYA 2Q3JA 3F9RA 3ICPA 3GNQA 1Y1TA 1S3SA 2YWJA 4NIMA 5JQGF 5KOJA 1KYYA 1SKBA 1YOVA 3RBAA 1DAIA 2Q2VA 2FKNA 3GBPA 1R8YA 1FU8A 1HDOA 3R5KA 4BBPA 1RYFA 1C1XA 1MAWA 4HVCA 1SUCA 4PY2A 3S68A 1CWUA 1JKIA 3UHOA 4ETNA 3QLTA 3UBMA 5IJ9A 4AP6A 2FW8A 1UOOA 1OFUX 3ETEA 4CUKA 5HP4A 3MJEA 3HNPA 4FTWA 1U8YA 5IDVA 2VNAA 3SJZA 1EUQA 1E1KA 2VDQB 1YDGA 2OV6A 3JYQA 3HV2A 3LGAA 1CP3A 3G5TA 1L4GA 4BZQA 4JI4B 3SS8A 4J75A 1H2FA 3K0FA 1NBAA 2EQAA 1P4AA 3FNIA 4HEHA 3GCGA 4HKTA 4IOMA 1KH1A 2FWMX 5EJIA 4GZMA 2HSJA 1NAHA 1U11A 1A9TA 3H5OA 4GKBA 1NV9A 4WDRA 1A8HA 4J1SA 2YWRA 3JR3A 4INZA 4FBGA 5T4EA 2XNKA 4N03A 1V25A 2GJ9A 2WU0A 2MOKA 3D81A 3PHBE 2PWZA 1YGPA 2CC2A 5HOEA 3PNQA 3UG6A 3HCRA 3OMXA 1L8QA 2QSYA 4CDMA 3CNLA 2HXGA 4UUNA 4PHTA 5DCUA 1IZZA 4DCJA 1ZOOA 1RIIA 4J43A 2QW1A 4FHFA 4C29A 3G82C 4G23A 1NMZA 2OHJA 4Q3DA 3AUTA 1BKYA 2C3YA 3EZ7A 3NLLA 4FS8A 3IP6A 4MUKA 5K3FB 4GBMA 5GVSA 3QG1A 2CE2X 1EGMB 1RXSA 2VBCA 4TXHA 4DADA 4NNOA 2YVQA 1E1LA 5D84A 5FTMA 5K9ZA 1FMTA 3D5TA 2X1HA 4I0WB 4WW0A 1PNOA 1QB7A 3NUQA 3REQA 2QL7A 3BIJA 2O7NA 1Z0ZA 1NQWA 3BDVA 2FUCA 3OA0A 3RYHA 3TO5A 2Q07A 3DXZA 3RG8A 3OZ7A 5I7WA 4YJHB 1SBZA 2ZTSA 5KYYA 1MG5A 5A2QA 4BNWA 4DLTA 2Z2YA 1P6QA 1NC1A 1GL9B 4CQNA 1QU3A 3NHRA 2GBGA 5F35A 4TYWA 3HN6A 3VKWA 2CEKA 3KEGA 1FS4A 2VAVA 1JWAB 3PQ8A 5AFSA 4KR2A 5LFAA 3AETB 2PSFA 4ECAA 3DF9A 4EDHA 5GWXA 2Q3LA 1V16A 4ONEA 1SUIA 2A9QA 3PC7A 4I2NA 2LBPA 2D2IA 5CYOA 1O0SA 1S2DA 2D3WA 3K8OE 1ZCAA 3L46A 4NJMB 4RXTA 1DU4A 4FFOA 3GG2A 2FPKA 4KQCA 3JQQA 4ZVNA 3BVPA 3U7QA 2FWBA 4H7PA 3N87A 2GLUA 1JFVA 4JUDX 1KPHA 3U1TA 1PSDA 1R12A 2HPVA 3S5UA 3SSOA 3SWWA 1Z4MA 4ALJA 4LF9B 2X41A 2E89A 2DSTA 4OHOA 1U7UA 5LBUA 1NA5A 2QVBA 3H3JA 2IBSA 3K1YA 3BTUA 1GT91 1E9CA 2JH8A 3VZRA 3I8SA 3TNLA 1C1DA 1GNVA 1EDEA 1LBHA 3HYLA 1PJBA 2D1RA 2ZAGA 1TTQB 5DLDA 3EMVA 4ML3A 3SZUA 5D7BA 5E6UB 1DG3A 1OA1A 4D4GA 3MCAA 3KUCA 3TW0A 2BI4A 3I53A 4TKLA 3NYRA 1FYXA 1UZAA 5FWYA 1H3NA 3T6KA 3PNKA 3KHKA 2COKA 2DUJA 2OEPA 1F2UA 1LPOA 3GGCA 3BCHA 4ND5A 4HVAA 1GTL1 5CR9A 4EKEA 3D4LA 3HWSA 1DOZA 4J1TC 1DQYA 1I2DA 1R2QA 1VTKA 1YVUA 1DAMA 4NPCA 1WEKA 1CNEA 3AJEA 5DNEA 1OIVA 2SICE 4HUTA 1EB8A 3O95A 1WABA 4QU5A 1KFCB 4ZZ3A 3Q98A 4R2XA 4U9IS 4JB8A 1E9EA 2GPBA 1ZR4A 3TZBA 1OWOA 3HXTA 2DT8A 2YASA 3OTGA 3ZG6A 1OOEA 2DPYA 4J0JA 3DEYX 3S7ZA 3LHSA 2XTJA 1O6FA 3I1IA 4HH0A 4PC1A 5DLEA 2PMDA 3WRXC 3ZJ5A 2QY6A 1NVFA 2B99A 3P2KA 3BA6A 3EIUA 3L8EA 1RJGA 2CUTA 1E59A 3AONB 4MQMA 3PCRB 3BOSA 3FBWA 1CY7A 2B35A 1PLJA 1HTWA 2VHTA 2CDCA 5KYUA 1J2YA 2ZAYA 2JIZD 4DLUA 3T35A 1M8GA 5M34A 5F2EA 4EUKA 3CUKA 3C8HA 2P9EA 2CXNA 3BFJA 2GO7A 4F8EA 4GOJA 4P5PA 3E7XA 3N5KA 5JYCA 2WM8A 5LD2C 2XLCA 4ZQFA 5SYAA 2NSHA 2N75A 4CG3A 3NBUA 5IC5A 1XJQA 1YR2A 3FRIA 2AFHE 4H4EA 1MCZA 3C2QA 5AVZA 1HEUA 1WSBA 1I8TA 3AKDA 4P86A 4RVSA 1K6EA 2B7LA 3RYFA 1XDGA 1RP1A 4NWIA 4UZEA 3REFA 5BN4B 4OHCA 3VUEA 3IUSA 1XDBA 3BRWA 3G9XA 4M7PA 1TUGA 4BGIA 1XJCA 2IX3A 2ANCA 3BK7A 3L7KA 1UC8A 3EUAA 2R2AA 2HA4A 4Y9DA 3OUZA 4OYRA 4EW3A 4RYDA 4BNKA 1MUUA 2IOFK 5IVKA 5A7GA 1VDZA 3MWFA 3WAKA 3IFSA 3K3PA 1E2BA 1GCIA 5IBPA 1C30B 3UK1A 3DYVA 2WYHA 2CY0A 3BS4A 1L1RA 4JFAA 4A5OA 5ECYA 1A8QA 4I1UA 4MYHA 4CKBB 3SNHA 2WF7A 1EHYA 2A4MA 2ODPA 2CCJA 2ZBPA 1K8YB 1XQWA 4HUQA 2C5FA 3WOVA 2CVOA 2GSDA 2SCUB 4DCSA 3M70A 1DKLA 3G2QA 2FF7A 4KR3A 1QOQB 2X0IA 1NM5A 2B2CA 5KJ1A 1E5XA 4WSOA 2GNAA 4PO3X 4F85A 2XCIA 1AKRA 3QEKA 1CDDA 4NYJQ 3K9WA 4BU0A 5IPFA 1ZITA 3IUMA 5ITZB 4ND8A 2M6KA 1P9RA 3RRFA 4YBZA 2HC9A 2I3ZA 2J9ZB 3QUBA 4W99A 3ZD7A 3O8NA 3R5HA 1XNJA 3QVWA 4OHPA 3LFUA 4DV5B 3GWZA 4OHXA 1IN8A 1KJZA 1N2BA 1H94A 1YD7A 4H3KB 2K2QB 2NZUG 3V00A 3I42A 2B9EA 4PLWA 3PR1A 4M0MA 1JSRA 1ZCFA 4F06A 3F8SA 1EHCA 4E33A 1E2QA 1R0RE 3ZHUA 2Z9CA 4GI3A 1O58A 1OFIA 1Z5VA 1SEPA 1Y82A 4J0EA 2EGHA 3QKUA 2XA1A 3NEAA 4XIFA 2JFZA 4ZOLB 3OZIA 5EI5A 3U3MA 4HNTA 5I8WA 2WJ3A 5DXAA 4CF3A 1Q0UA 4OMDA 3IAS1 4DS3A 4XVHA 3DR5A 3GQBA 5FFNA 5CLJA 5JW6A 1KAQA 3GPIA 3QOYA 5JROA 3UJ8A 4J07A 3A9RA 1GU1A 1Z4LA 1TQ2A 2I3BA 1G8SA 3HHPA 2VA9A 3R24A 3ZHSA 3LU1A 4DDKA 4B1FA 2YWFA 3SR4A 1A8IA 2QRZA 3HCNA 3T0FA 3EGXB 2PO7A 5FWAA 2HAEA 4M9UA 4OG2A 3TL3A 3W8NA 1DMRA 4EELA 2ZXFA 5HGJA 3C8DA 4G4IA 4M36A 4MUMA 3OFKA 1OBCA 1WVMA 2BGKA 2F3PA 1AUQA 2PH5A 4ZP1A 2HJHA 3SE7A 2ZJBA 4KE9A 5TPZD 2M1ZA 2YV5A 4PSCA 5EGNA 4AG3A 4OAQA 2OV4A 4O4IB 3ETDA 4S1NA 5EXDA 3MM4A 1NPYA 1XMPA 2VT2A 3V3TA 3WL5A 2R8OA 5LCXA 5BNFA 3NG1A 1VLHA 2LR0A 2VSFA 1M6EX 1PQWA 1ZLYA 1N9GA 2E4AA 3AB3A 3DZFA 1LVHA 2PX3A 3IP1A 4CLRA 1E9DA 3E22A 4BOYA 3PTAA 2WV7A 4RORA 5ERGB 1XMOB 3C97A 3CZAA 2GCOB 2AOWA 1EINA 1N7JA 2XEXA 1MRNA 2DR0A 3HMQA 5FRDA 4PIVA 4CKEB 4Z4EA 3AVWA 3JWEA 1NOJA 1WKVA 3QVTA 2H1FA 3HGTA 3KJNA 1WDMA 1IG3A 2BMFA 2QTMA 4EYOA 4XZ3A 5KDOA 4O5OA 1WXDA 3C43A 4YXFA 4HYTA 4MGYR 4TM7A 3FMVA 2QD2A 1P3Y1 4YJ2B 4EG6A 4YRFA 3RJ5A 3TIFA 4DBVO 4B5LA 2RHRA 2MIIA 2LKCA 4RJKA 2NO4A 1PNTA 1J7JA 1KEWA 3VTKA 2J0UA 3AIIA 3EPLA 4LF7B 4NARA 3BE5A 1IHDA 1JG4A 3PK0A 2ORED 1V37A 1WSDA 1MJFA 2JJQA 2WK1A 1ZCBA 5AXAA 1SA0B 4DVGA 4E88A 1MNAA 1J49A 3LT2A 2QM7A 2FDRA 3FLAA 4OHKA 3FLEA 2A94A 4A36A 1HE5A 3HYNA 3AIMA 4FYKA 4DDMA 2EWVA 2PGXA 3L0OA 3ZJVA 3K05A 1TTHA 4ZC8A 3STWA 2IS2A 3BGVA 3O6VA 2XYVA 1VPDA 3NNDA 4GOOD 4JT2A 4WNAA 1Z2NX 2J30A 2X7HA 4N01A 3N8GA 1HQKA 3IUPA 2O3TA 3AO0B 3I8OA 3DOIA 4JMLA 3HCAA 3TLBA 5KUTA 1AOXA 1C80A 4X7RA 1WXXA 4NCAA 1Y9ZA 2QD1A 2ZJ4A 1RBYA 2H1SA 3DFUA 3GZNB 2LRHA 1OWNA 3I30X 4HNAB 3VVCA 3HFRA 4J16A 5DGIA 2WKWA 3ODPA 4NFLA 3NPMA 4FDMA 2NZWA 1E60A 1XZGA 4IIJA 2EJTA 3OZSA 3GLRA 3BWBA 3H5AA 1SUSA 1VP3A 2OXTA 2RAUA 3GVIA 3SVLA 4P3NA 1VRVA 1YU6A 3IXMA 3L1IA 5DDIP 1XRMA 3RJ9A 4EHBA 4C21A 5B7PA 2QG4A 4PAOA 2F3SA 1TJ3A 5ALLA 5F73A 1VSUA 2GPTA 4LC0A 4MV7A 3C5HA 3U7EB 4HNVA 5L95A 3OCWA 5AIBA 4R7TA 2QN1A 2WB4A 3GRCA 3LLUA 1VHLA 4U5XA 2GYUA 4BMXA 4ZYWA 3R0XA 3I2YX 3QBDA 4RA9A 2JFBA 4CQMD 1SZJG 3NBAA 3OZBA 3VRHA 1B0UA 3HI6A 5JNVA 1E8DA 4PPGA 1Z18A 4UREA 5CHYA 1ISJA 4F3YA 2KI5A 5LKAA 2PZ8A 4LOIA 5B1IA 1O95A 1TU4A 4EKNB 4ZI2A 4U7WA 4Q4LA 2X6RA 1CD5A 3CCFA 3PHJA 4TT3D 5EIWA 5KSZA 2VNKA 2WJ6A 3LZCA 4WMLA 4KZPA 1N2IA 4PU0A 5DLYA 1Y6ZA 3KSRA 1U8EA 3ORFA 4L2IB 5BPFA 3SYTA 3N6XA 2XCSB 1M75A 4ERXA 3L18A 3GLHB 2HXYA 4MV0A 1HE4A 2BBOA 4EYEA 3KK0A 3QM1A 4RHTA 3EZLA 3KZKA 3KQOA 3EQ2A 4QOEA 1DADA 4IH4A 4OQ4A 5JH7B 1W75A 3RASA 4ND6A 3SM9A 4B2IA 3L05A 3FMGA 4IDFA 5WRFA 4ZVLA 2I8CA 3L6OO 3Q85A 4NK5A 1RYEA 4ZALA 5FTKA 3BMOA 4M9RA 1I7DA 3A26A 4ZIRA 5TB5A 2A14A 4R1LA 2BVNA 5AVUA 1M1YA 4DGQA 1AY0A 3LRXA 4G1UC 1QKJA 2C7GA 1JIVA 2QA5A 3NW9A 3MGGA 1K9SA 4XWAA 4K6HA 5FYDA 3U39A 3H13A 4CU5A 1Z13A 1X3LA 4KXLA 2NW6A 1C0PA 1C3LA 3LBAA 3VFDA 1XPOA 1UM8A 3DOHA 1WPRA 4IJKA 4XPIA 3DLBA 1T5TA 1A95A 4IIBA 4MYDA 1YB7A 5LZ2A 3ZJ4A 5LUAA 4Y6PA 1XRPA 2OZVA 2PKQP 4I4TB 1LWNA 4UE3S 1RPAA 4BCBA 2BN4A 4D02A 5D3MB 4BEJA 3TSZA 2VDMB 1WUKS 1JLKA 2ENUA 1UAYA 1DC8A 3BCSA 3LBHA 1VMAA 4KYVA 1CRLA 1LJ8A 2FSUA 3A7EA 3NM6B 3DDHA 2X3UA 4GI7A 2LZ0A 4GPIB 4R98A 4EKGA 5ISMA 1QH1A 1BN6A 1W44A 4CIXA 1L9KA 1PTJC 3D8TA 3HHEA 4G07A 4MUGA 3IMEA 2ATXA 4ZOQI 1OGJA 2GHRA 2PRIA 4MTLA 4PO8A 2YBDA 4MKXA 1U0JA 1XA0A 1E66A 3ELYA 4XWTA 2BCEA 4Y1RB 1D9XA 1R6XA 3HP4A 4ERNA