2FP4A

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
305
structure length
304
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
total genus 112
structure length 304
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fp4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fp4A01
2FOIA 3DAFA 1KBZA 1SEPA 1TT7A 2WJPA 4YR9A 2FN7A 2Q2VA 4HNHA 1L7EA 1TLTA 3GK3A 1LTHR 3T4EA 1BXKA 3RC2A 1FDSA 4FW8A 4GPD1 1PWZA 1NXQA 3VKUA 5GY7A 4I5GA 4KQXA 4O5OA 4PLPA 4BO0A 1N7HA 4MDHA 1U2DA 1X7HA 2FP4B 2WD7B 1NFQA 3EUWA 4D3FA 2WYVA 2DPHA 1TEHA 4N7RA 4KMSA 1N7GA 3AUAA 5C37A 4YRDA 1GU7A 4OAQA 1KVTA 4PVDA 4OO3A 3Q3CA 1PJ2A 4XQ9A 4K26A 3B6ZA 5EINA 1DFGA 3QSGA 3WTBA 4K6CA 4RQUA 3ABIA 3CXRA 3DOCA 4RVSA 4R3NA 2PNFA 4PCVA 3BMCB 3D4PA 4ZQBA 5JAMA 3ZI0A 3KRTA 2C59A 3HN2A 4JBGA 3JQAD 3U9LA 5BQFA 4J4BA 4W9NC 1YRLA 3DOJA 2PZMA 2FPGA 2XXJA 1HEUA 3VZPA 4JBIA 4OMUA 3IUSA 3H9QA 3GGGA 3W4IA 5KVSA 3CMCO 3NV9A 1HXHA 5KJEA 5T6BA 3U5TA 4MO2A 1EUCA 4L4RA 2QX7A 3A28A 5U9CA 2GSDA 1NFFA 5F1OA 1SCUB 1E3JA 2O48X 4NH4A 2IZ1A 4A03A 5JDIC 4P4LA 3JQBA 3OJOA 3VC7A 4D0RA 4W7HA 4OYRA 3FN4A 5ILOA 3NJ8A 4NQZA 5A03A 4DIFA 1ZO8A 2YDXA 2GDZA 4IDDA 4ALMA 1PGJA 2GGSA 3GGOA 2DKNA 3V1UA 3NGLA 2OUIA 2Q1SA 4R41A 2D3TA 1HE5A 3W8EA 3E48A 3L77A 3ENKA 1GCUA 1E1NA 3C1AA 4E3ZA 1R16A 4XGIA 3DZIA 1DOHA 1KERA 1JKIA 1U5AA 4GMGA 4H3VA 3DZFA 1YBVA 3V2HA 1Q0QA 5EQFA 3D5QA 4R1NA 2VZ9A 1HRDA 4TKLA 2NVUB 3ROQA 3H65A 1ONOA 4NJOA 1E3SA 2VWPA 1I32A 1A27A 4XQEA 1JA9A 1P1IA 2GLXA 2CF6A 2R6JA 3CEAA 1M75A 1H2HA 2OL4A 1LLCA 2WYWA 3TPCA 3QRWA 4CM4A 3OEWA 1LSUA 2QZZA 3JQDA 1X7GA 3DOOA 5ICMA 2EG9A 2PD4A 3DB2A 5JSFA 4WGGA 3HNPA 3ITDA 1FDVA 1ENYA 4ZD6A 3QA9A 4DPMA 4XA8A 2ZYGA 3SLGA 1P1KA 5HS6A 1LA2A 3GGPA 3EGOA 4ZGWA 2W2KA 3MWEB 2UV8A 4UVIA 4E6PA 1E1KA 1E7WA 4J7XA 1C0LA 1XGKA 1P1FA 3JQAA 4YQYA 3HQ4O 5J23A 3L6EA 3B70A 3OA0A 1XU7A 4OXYA 4NNJA 3H4VA 4MIEA 4RGBA 2YFQA 3PYXA 4D43A 2X5OA 1V3TA 3KYBA 2FZWA 1GDHA 3GZ4A 4LRSB 4CMIA 1K5HA 2X0RA 3AY7A 2HUNA 3MOIA 4GKBA 3ZU4A 4KWHA 5DCYA 2JHFA 1PX0A 2RH4A 2GASA 1PGOA 1ZK2A 4BVAA 3X2EA 5JYDA 3HUDA 2Y99A 3Q1LA 1FMCA 5EPOA 4RCVA 3TN7A 4Z9YA 3IKVA 1KVUA 4I5FA 3S55A 1GZ3A 1WP4A 4Z9XA 2DFDA 3ZWVA 1PQUA 5K9ZA 1MUUA 3FWZA 2GNAA 4IMPA 4AJOA 4BNZA 4DTIA 5F1KA 2QYSA 1NX6A 1FDWA 3KYCB 1MC5A 4W9NA 1WZIA 3L4BC 4WUVA 2A35A 1OAAA 2HJRA 2X58A 4J2HA 4JCOA 4BNHA 4E30A 4AJKA 1Y6JA 2W98A 2J3JA 3LK7A 5KCZA 4MP3A 2DQ4A 2Q45A 5A3VA 1NYTA 2AG8A 1T1SA 1GL3A 3VOSA 3ANMA 1EUDA 1GY8A 4PZEA 2HK7A 1TI7A 4RLHA 2WMDA 1MA0A 1OZAA 3BTSA 2A4KA 1NBOA 4XYLA 2BGKA 1D3AA 3DFUA 3L0DA 1RJWA 2AG5A 3JQ6A 4R68A 2OP0A 3RFXA 4E5KA 3GVIA 1JWBB 2I3GA 3U4IA 5TC4A 3VDQA 4DREA 1NPDA 4CM9A 4EEXA 3EVNA 1Z6ZA 1B0AA 3GEDA 3PQDA 4BMSA 3EYWA 3C7CB 1QSGA 3D7LA 3PJFA 1ZXLA 4OQYA 3TF5A 4CLHA 5ENDA 2Q2QA 3ST7A 2PKQO 3IMFA 3DMTC 3OA2A 2UYYA 4IPTA 1SNYA 4QO7A 4Q39A 3V2UA 2OOSA 4BNKA 4S3MA 3E18A 2OBYA 4ZN6A 1HDGO 1NP3A 3C1OA 3WGQA 1E3IA 4JX8A 3GA0A 2DC1A 3JQ9C 4DA9A 4KDEA 1EMDA 3TWOA 5BSHA 1B8VA 1N1EA 1C3VA 4NU6A 3SC4A 1DAOA 1E7SA 5U1PA 3WTCA 4IGFA 4Z0HO 1T2EA 1WVGA 1GUZA 4EYEA 3M6IA 4H15A 4PLWA 5CPBA 4NBUA 4A73A 1SPXA 3RBZA 5A1TA 3WWZA 1VL6A 4M8SA 2BMAA 3ZN2A 3TZKA 3BHJA 5C3MA 1EQUA 2ZATA 3FRJA 3TL2A 1V6AA 1EVIA 2NU9A 1XR3A 3DBHB 1YXMA 4MVJE 3UGKA 3CPSA 4J1SA 3KETA 1CQJA 2HO5A 2VYVD 5FEUA 1L1FA 4QO8A 5KKAA 3DQPA 4FFLA 4QEDA 4OJNA 3WWYA 2XPCA 3FCOA 1NQ5A 2BGMA 2CZCA 5DP1A 3GNSA 3WQQA 4UUOA 5GZ3A 1M67A 2DLDA 3O8QB 1I3NA 3L9WA 1U3UA 4LRTB 5L7YA 1SEVA 2UAGA 5BSGA 1SB8A 3GRKA 2Q49A 1P3DA 1K0UA 1UXJA 4RO0A 4YACA 1EFLA 4UEOA 1FDTA 3RAJA 3ZU5A 3FSRA 4J1NA 4WCFB 4W99A 1TXGA 3SVTA 2YW9A 3OJLA 4II3A 2IRWA 3CTMA 1UAGA 4FFMA 1HDXA 1PR9A 3E03A 3GVXA 3KYDA 4AJ1A 1BMDA 4AJIA 2PKRA 2C5EA 5L45A 3L6OO 4NIMA 4TRRA 3LC1O 3EHEA 2G0TA 3HZZA 5IXSA 1TVEA 5KTKA 1YBAA 2QQ5A 4AICA 4DBZA 5JDCC 3ZNQA 1LSSA 2Q50A 4E5YA 1PWXA 1TA4A 3BTUA 5CDUA 1I3MA 3L4BA 5CEEA 2C0CA 1IPEA 4PLHA 1ORRA 1JLLB 1P1RA 3WXBA 3H5AA 1YWGO 3KSUA 4BGEA 1QXSA 1JKFA 2X6TA 1CJCA 4BGIA 2O4UX 3AY3A 1PEDA 3KV3O 1VPDA 1TT5A 1DHTA 2QW8A 3C8MA 3I1JA 3CZRA 3ON5A 3UFXA 2CFCA 1H6AA 1JQBA 3GH3A 4TQGA 3TZHA 3PLNA 2VT2A 1BW9B 1C0PA 2EIHA 4Q3EA 2JFFA 2OFPA 4OXKA 5ENVA 3GNQA 3ROPA 3BTVA 2PGLA 2ZTUA 5ADHA 5KNLA 3MJTA 2GO1A 3PHHA 1HDRA 1K6JA 3RKRA 4YAEA 3DMTA 2VYVA 1KEPA 4MIYA 5BNTA 1X7DA 4ALKA 3P2OA 1LLQA 3MOGA 3IP1A 4MPDA 2D4AA 5K0ZA 3JQ9A 3FBGA 2ZQYA 2ZB4A 2AA3A 3JYQA 3DL2A 3MJVA 1MGOA 4IY1A 4RORA 1KETA 5JFOA 2FR0A 2VN8A 4PG5A 3O4RA 1Y8RB 3M2TA 1UXIA 1R4NB 2VOEA 1N92A 3R6DA 1T2FA 2AW5A 4ZQFA 3DZGA 1E7QA 4M55A 4J9UE 4U6QA 4A2CA 4IQ0A 5B1YA 2EKPA 3FPLA 4ILKA 3GG2A 2J6IA 4RVHA 2B36A 3WYCA 4D44A 1KY4A 3RFTA 5TLSA 4J2OA 2HMUA 1SO8A 2W90A 1GZ4A 1YDWA 3AK4A 4W82A 5DULA 3TZCA 3ZHXA 1HF3A 2ZYAA 1PJCA 3DTTA 1LSOA 1Z45A 2O7QA 2WSBA 2SCUB 3WFIA 3ZGYA 1ISMA 4CQLA 5A4DA 3WBBA 1QKIA 1GEGA 1RPNA 1VI2A 4KTVE 3I9MA 1Y8QB 2EKLA 4XQGA 4YCAA 2R00C 3OHSX 4TWRA 4PLTA 4B4VA 1NM5A 1NR7A 1GV1A 3F5QA 1C1DB 3WOHA 2EHDA 2VUSA 1IHYA 3IQDB 2FR1A 3DZBA 2G1UA 3ZHYA 1V3UA 1X14A 1YDEA 4QFCA 3QP9A 2HJSA 4GAEA 3PXXA 1NHWA 1R6DA 5EMHA 1HYEA 2GPTA 3JV7A 3AW9A 1I0ZA 3C7DB 1U9JA 4E13A 1K6IA 1ZXBA 2F1KA 3K31A 1R4MA 4IGEA 4PG6A 1ISGA 3AY6A 5DOVA 4AL4A 5JAIA 5JDCA 4BKRA 4JQCA 4PLZA 2FSSA 4AJNA 2PLAA 4HX5A 3FBTA 3A14A 3NAQA 4EJMA 5TJHA 1VRWA 4WOJA 4DGSA 3AU8A 1PL7A 2I5PO 5I8WA 3BMQB 4BNUA 1E3EA 3AUTA 2QIOA 1O0SA 3TZ6A 4M54A 1GFSA 4J16A 5AXAA 1R66A 3ZW8A 2X0NA 2JFHA 2YYYA 1Y9AA 4DWVA 2UVDA 4NR0A 2Y1OA 1NVTA 2HRBA 2NU7B 3DEYX 4GX2A 4YT8A 3PHIA 1F8FA 4J90A 5CDSA 1W8DA 2PY6A 2NU6A 2NLOA 1HSOA 1NQAO 4YJHB 2NU8B 1ARZA 4XRGA 4DC0A 3RUEA 1EK6A 3JYLA 3JQGB 4RVGA 5L51A 4GVXA 4ID9A 3K92A 1IHXA 4DQXA 4ND2A 3LF1A 4MVJI 4YJFB 2XXBA 1DDOA 1DBVO 1UZMA 3ZWMA 4E4YA 4YAGA 4JP3A 1QLJA 4JK3A 5FFFA 4DLAA 1P77A 4MIOA 5A9SB 1XA0A 5KWEA 1BGVA 4O59O 4E32A 1DC4A 4FFNA 5IDQA 3LYLA 1WZEA 2C29D 4FBGA 3ASUA 3JQ7B 1AXGA 1VM6A 4TKMA 4RVDA 3PK0A 4GGPA 5G0SA 4MVJF 5CAEB 3JD1A 4IDCA 3QWHA 4M49A 1UP7A 4GSKA 1RM4A 4XGKA 1HE2A 4ZICA 4ESOA 1P0FA 4WPGA 1E7RA 1E7YA 3IP3A 1QV7A 3RQSA 3QVWA 4F46A 4Y98A 3A4VA 1YQGA 4ONEA 4Y8VA 3CH6A 3NRCA 3GRPA 1ZVMA 2NUAB 4GLLA 4J91A 3ZHBA 4YPOA 4YT2A 3LU1A 1HZZA 4BNVA 1CYDA 4IJUA 1YH3A 3G1TA 5JY1A 5KKCA 1EVJA 5I7VA 4TVOA 4Q3BA 1VSVA 1ZEMA 2H9IA 4CUJA 2VHXA 4GWGA 1LU9A 5TT1A 4YEDA 2O3TA 4OXNA 1DRVA 4TRJA 5B37A 2YFHA 3KUXA 3NUGA 1ISJA 4PIVA 4JLWA 3DHNA 3QY9A 4YJGB 4C4OA 1LNQA 2O4CA 1S6YA 2R00A 3PWSA 4GMFA 2GZ3A 2DTXA 3Q2KA 4F6LA 1PGNA 2H5LA 5JNLA 2GRAA 2P68A 5HWSA 5HS4A 4E2ZA 2C5AA 3PFFA 1ADFA 4Q3DA 4D46A 1DLIA 4BKOA 5GZ1A 4WLUA 1X0VA 4R5HA 4CL3A 1DAPA 3KBOA 2XAAA 1K2WA 1RM0A 3RUFA 1PJQA 2Q99A 4EDFA 1KIFA 2AQHA 2JAHA 4DLBA 1I8TA 3LLSA 4CR8A 3BTOA 1PJ3A 4XKJA 4AJPA 1PJBA 3GEGA 4AJJA 4BNWA 1VLLA 1Z82A 2B5WA 3Q2IA 3RBXA 1EE9A 5C7IO 4ZU3A 3H2ZA 3ASVA 2HSDA 2O3QA 2Z5LA 3KEOA 4BUCA 4I1IA 3WGOA 2POQX 1YL7A 3PP8A 4YA6A 3ORFA 3VH3A 3VKVA 1WMBA 2AEFA 5L4LA 4TZKA 2VHVA 2O23A 4HFMA 4R16A 2VRCD 3RUCA 3UHAA 1E3LA 1R0LA 2WEKA 3ITKA 4UULA 5KVVA 2AHRA 4QSMA 5JW6A 2FPIB 3AM5A 3C85A 4Y67A 1DC3A 1T4BA 1B3BA 1E6UA 3RI3A 1U3TA 1ZMOA 2B4RO 1ZK0A 4G81A 5GMOA 1XIVA 4BHTA 3UAGA 1CQIB 3FPCA 2PK3A 3PPIA 4ZQEA 5U4QA 4CPDA 4E5PA 1E0DA 1I30A 3NX4A 1KEVA 5GZ6A 1KC3A 4W7IA 1EUZA 2CNBA 2WD8A 3QWIA 4MKRA 1ISFA 1JU9A 2OORA 4XYMA 2A9FA 2Q4EA 5G0WA 3H3JA 2YUTA 3OFSA 2EF1A 3D3WA 2TMGA 1WNTA 2W2LA 2Y05A 1A4UA 4NU5A 1HT0A 2EJWA 1K6XA 3G49A 1RM5A 4FGWA 4CMGA 5DZSA 2C20A 3HJAA 3SJUA 3WIEA 1QORA 2DTDA 5CEJA 1N9GA 1Z74A 3MJCA 1AXEA 1U4OA 5DDIP 1RKXA 2IEDA 4R51A 4TRNA 4E33A 1P0CA 1Z73A 5ER6A 3KOUA 3F4BA 3RC1A 5CDTA 3ONFA 3VH1A 1GUYA 1ULUA 3QVTA 4J49A 4LVCA 4P8RA 4HUJA 5HA5A 4B7UA 1OFGA 5JC1A 3NTRA 1GQYA 2YHIA 3GT0A 3JQEA 1T26A 4XYEA 3IAHA 1SC6A 1ZK3A 1Y9EA 1GQ2A 1Z7EA 3CE6A 4MKZA 3BAZA 2G17A 4D42A 1P1JA 4Q3CA 5IJZA 1D8AA 2VZ0A 4L74A 1U7HA 4I5DA 3QWBA 3HB4X 3FR7A 1MFPA 4AVYA 1E3WB 1YB5A 4OOEA 3WBFA 3WIDA 1HDYA 2P4HX 2Y1GA 3NTQA 3WNQA 3IL2A 4BNLA 3PIIA 1ZKMA 3ROKA 4CLRA 1FDUA 3OJ0A 3ZWWA 4B3IA 1OC2A 3AFMA 2VRCA 4QXMA 4PLYA 1J49A 3GAZA 3LZ6A 1PJTA 3H3FA 3ETDA 4YQZA 1GQQA 4OKIA 2RHCA 3I9NA 3VPGA 4A10A 4IDBA 4JROA 5COAA 1DRUA 3ZWCA 3GUCA 3A06A 5KJ6A 2WM3A 1QLHA 4CLOB 4YRAA 4DMLA 1LBEA 4IZIA 3NT2A 4F45A 3RU9A 4IJVA 1E5QA 5CEFA 1R37A 4I9NA 1WDLA 4L73A 5F5LA 3HFSA 3S2IA 3U3XA 3WSVA 4AG3A 4MVJM 1W0CA 3ONDA 1QMGA 3U4HA 1GADO 5I9NA 1LRKA 4ZA2A 3KVOA 5AYVA 3COSA 4MOWA 3H5RA 2J3HA 4QQRA 3QVSA 3WJAA 1U2GA 1ISIA 3MZ0A 5L9AA 2WDZA 2BKAA 4BKQA 3EK2A 4H16A 4K6FA 4RQTA 4ZVVA 4GBJA 2YV2A 4TVBA 5IDYA 1H6DA 5JLAA 4DUPA 4NBRA 4OHUA 3PJGA 4KUHA 4JIGA 2ZJ0A 3E82A 4YAIA 2PD6A 1JVBA 4R5MA 4S1VA 2VYND 5G4KB 4Z3KA 2YDYA 4L4XA 4WCDA 3JYOA 3GZNB 1XU9A 1CWUA 1T4DA 4L76A 5DP2A 1GYRA 4UVHA 1PS0A 1QYWA 4BKPA 3GVCA 2B4TO 3K5PA 1LLDA 2EW8A 1O6ZA 1M6HA 1NWHA 4HFRA 1BVUA 3ZH2A 5EIOA 3NYWA 1NR1A 4BNYA 5ITVA 1PQPA 3QVXA 4G2NA 4J4HA 4B4WA 3UUWA 1UAYA 3PWZA 5DCUA 5G2OA 1QYXA 2PGDA 4CQMB 2WWRA 3I4CA 4PLGA 5TSDA 4GH5A 5L4NA 1KEUA 1HSZA 5FYDA 2QHXA 3A9WA 5AXDA 5L53A 3UVEA 1UUFA 4HY3A 3WB9A 4D45A 1LQTA 4NK4A 1BRMA 4OH1A 4YXFA 3FNEA 1Y7TA 2WE8A 4RPKA 3WR5A 5CPFA 4YAKA 3BMQA 3QE3A 5TJ9A 3PQEA 4CUKA 4Q3NA 5BSEA 3G0OA 4XX0A 3GR6A 3IUPA 2E82A 4OIMA 2EGHA 1V0JA 1JVSA 2W8ZA 3N58A 3TOXA 1W6UA 1GPDG 1I01A 5IZ4A 4DC1A 3FNHA 4M87A 4XWYA 4Y6PA 1GYPA 4CV2A 1VJTA 1SB9A 3RU7A 5EESA 1GR0A 2FZEA 4IDGA 5THQA 3WMWA 2DAPA 1YB4A 2Z1MA 3E5MA 3BYZA 3GY0A 2PA3A 4YJHA 1YOVB 4ZHSA 3PYLA 3SC6A 3RJ5A 2X23A 1R0SA 2YY7A 1EZ4A 5L3ZA 4HFJA 3L9XA 2HKIA 1B15A 3H8VA 1KYQA 3MWDA 2UDPA 3LT1A 1B8PA 2GN9A 4EEZA 1Q0HA 3WSWA 1J5PA 1OOEA 1QP8A 2ZKLA 4FJ0A 4BMNA 3ZZNA 4UREA 3FF4A 4ZRNA 1HZJA 4CR7A 1ZFNA 3SBOA 3BMNB 4OOFA 1UDAA 5JC8A 5TRTA 3VVCA 3GHHA 2VYNA 4R1TA 3QQPA 4YT4A 2BD0A 5ILGA 1F17A 1IPFA 2BELA 4FPXA 1EK5A 1SAYA 1T2AA 8LDHA 3NEPX 3I23A 1BXGB 3OMLA 5IFLA 3KLMX 4DQVA 3D1LA 2V6GA 1DRWA 5BNIA 3AU9A 3Q0EA 2HLPA 5A05A 2ZK7A 4DPLA 4YBZA 4NFSA 3FD8A 3S8MA 1B8UA 1DO8A 3DO5A 1ADBA 4JN6B 5FI3A 5B4UA 3PVZA 2YQ4A 4XJTA 3ZCXA 2NQTA 4ZQGA 3ENNA 3K8ZA 9LDTA 2Q1WA 4YAJA 3GC6A 2BI7A 4WK6A 4WEOA 1ZUD1 2I76A 4N5NA 3WNVA 3HB5X 1DIHA 4KZPA 1TB4A 2BFPA 2NACA 1ENPA 3BMOA 4CR6A 1Q0LA 1NAIA 1DEHA 3EDMA 4CM5A 1P31A 1HE3A 5THKA 4DXHA 1IYZA 2FPPB 2PH3A 1ZH8A 2AQIA 1WAMA 1PL8A 4OGWA 3LF2A 1SBYA 4GX1A 1IY8A 3H6KA 3UOGA 1EBUA 4IXTA 1WWKA 1BVRA 2Y68A 1I2ZA 2B0JA 3PZRA 1V35A 1U1IA 1NFRA 3K73O 4M86A 3ZNPA 1VJ0A 2PR2A 3H7AA 2DU8A 3KZVA 1UXKA 2QRJA 3F46A 4EJ6A 4GSLA 3GEMA 4LN1A 1P74A 1ZEJA 2G76A 4FS3A 4WNIA 1DIBA 1SZJG 2GD1O 2Y1DA 4RZHA 1GV0A 4JGBA 3JQ8A 2Q3EA 1I10A 1DLJA 4KQWA 4AJ4A 4MJLA 1WW8A 4FFRA 4B7CA 4HWKA 4F3YA 2IEBA 4QECA 3E8XA 3PGJA 2GN8A 3C3XA 3UCEA 3RBVA 3P5SA 2I66A 4BO4A 3DBRA 4EUFA 1HE4A 3LC2O 3ZWNA 1ADCA 4B79A 4Y6SA 3DBLA 4FSHA 4ND3A 3MCVA 1ONNA 3C1TA 3W6UA 1BXZA 1E1LA 2FPIA 4U0KA 1M66A 1Q7CA 1M2WA 4U7WA 5JBIA 4L75A 4ND4A 1HYHA 1ID1A 3JYPA 3K6JA 3WGTA 5AQ1A 1PJ4A 5B4VA 2PWZA 2JCXA 1G0NA 1Q2XA 2BLLA 3PHGA 4DIBA 2HU2A 1YB1A 1DJNA 4R01A 2HK9A 4P4GA 2Q1UA 3GMSA 9LDBA 3ETGA 4I9HA 2C2XA 1EFKA 2UUPA 4U5QA 5TS3A 3T7EA 3OH8A 4HFNA 2AMFA 2C82A 5CFZA 2V7PA 4I5EA 2WTBA 1SMKA 1JTVA 2WD7A 3S2GA 2FP4A 3W4JA 5A5EA 4RPJA 3WS7A 5IN5A 4PG8A 1AUPA 2FPGB 2C7GA 1T2DA 4A26A 1C0KA 1C1XB 2DPGA 4BNJA 2VWGA 3ZWXA 4RL6A 1FF9A 3H9EO 1SOWA 2X9GA 5CDYA 1PL6A 1EUCB 3KEQA 3OSUA 3KM0A 5HRUA 2BI8A 5L7WA 4M89A 4WKGA 5DBFA 5A9RA 3ZWOA 4CM8B 1KVSA 1ZNQO 3WGZA 5T64A 1U7TA 5AOVA 3R1IA 4OM8A 3NKLA 1DHRA 2DUUA 3BMCA 4J6FA 2YQ5A 3DZHA 7MDHA 1H6BA 3RUDA 4OKNA 1BDMA 2GCGA 3AOEC 3ICCA 1XCBA 5EERA 2ZTMA 1U5CA 2VNAA 3F5SA 1IE3A 3OJEA 4XB1A 3WICA 3I5MA 1IUKA 3BIOA 4B4UA 3D3EA 1QYDA 4MVJG 1E6EA 2I6TA 4NZ9A 3TSCA 3ZHZA 4UUPA 4CUZA 2ET6A 1B26A 1SCUA 2Z1NA 2I67A 1YVEI 4CQMD 1EE2A 4CV1A 4YWJA 4A7PA 1O8CA 3GLQA 1UR5A 5A5FA 1VJ1A 4KDFA 2P9CA 3VZQA 2RH8A 5HBRA 4BMVA 5FWNA 3KSDO 1G1AA 3U09A 3OICA 3DZKA 1OI7A 4YRBA 2QRKA 1PS9A 1GYQA 5DCWA 4CM4B 3NDIA 2DT5A 1ULSA 4R1SA 4E12A 3ZWYA 4CMEC 4N5MA 2VUUA 3PZBA 1O9BA 1VKOA 1KY5A 1NQOA 4XR9A 4CLOA 1PGQA 2CVQA 3OQ6A 3BHIA 4PRLA 3VPHA 1NVMB 3K2BA 1XWFA 5ES3A 3OBBA 1F0YA 3GUYA 1N8KA 4IBOA 4UAGA 1MXFA 2W2KB 3VH4A 3DAGA 4EUHA 4LK3A 2NVUA 4BNIA 1V3VA 3QV1A 4IJWA 3IKTA 4ALJA 1C14A 1ZJZA 5TIIA 3S2FA 3GN2A 4O6VA 3I6IA 2GZ2A 3PGXA 4CMIB 1R12A 4YTEA 2DVMA 4CMHA 3G17A 2GERA 4QX6A 4BO6A 4AFNA 1P9LA 4EJ0A 1E1MA 1W73A 5L4SA 3INRA 3K30A 3MTJA 1JAYA 5G4KA 4D3SA 4L0QA 3LT4A 2V6BA 3MWEA 4KWIA 3GDFA 1OMOA 3B20A 4ND5A 4AJHA 2JHGA 2CDAA 1LDGA 1I2CA 4DIOA 1ML3A 2VTDA 4WECA 5ER9A 2G5CA 2Y66A 4J7UA 1AGNA 4URFA 1NQTA 2VWHA 2XF8A 1CDOA 2E4AA 3MJSA 7ADHA 2GR9A 3EVTA 1AN9A 3FI9A 5I9LA 4N5LA 2VT3A 4TSKA 4WASA 3PWKA 3W8FA 4I9UA 4WCFC 2FHSA 3CUKA 2NTNA 3SJ7A 2WYUA 4FCCA 5L7TA 1P45A 1QR6A 1ZCJA 3EZLA 3WQRA 2OHXA 4CQMA 5AXBA 4BO2A 2A94A 3AUUA 3ONEA 1GPJA 2J5KA 4JJGA 1J6UA 4FFPA 4IS3A 2PZLA 4GQAA 3WLFA 3X2FA 4EZBA 2DBQA 1MC4A 1MX3A 3F9IA 1Q1NA 3I3OA 3DWFA 3U4CA 3MJ4A 5A02A 1U3WA 3V2GA 1X15A 1EEHA 3KYCA 1PGPA 2B4QA 3GF4A 3GPIA 3W4KA 3GOHA 4XGNA 2FSVA 3WFJA 4A5OA 3AOEA 4Y9DA 4UVDA 3U49A 4Z0PA 4CM6A 4G5HA 3WJ7A 2Q2WA 5JPIA 4RF5A 1MXHA 1LC0A 3E9MA 4E5MA 3EW7A 2CF5A 4A27A 3TL3A 2PKQP 3KHUA 1UZLA 1ZBQA 1DIGA 4XYBA 3RASA 2AE2A 5H83A 1J4AA 1EDOA 5B4TA 3P7MA 1U4SA 1NAHA 3K9QO 4RVFA 4W6ZA 4PZCA 5KOIA 2H6EA 1BG6A 3DDNA 3AJRA 3KTDA 2BGLA 3E9QA 4LGVA 1LX6A 3UH1A 2C07A 1Y5MA 1F06A 1F14A 4J7CA 3RD5A 1JAXA 1H94A 4LMRA 1ISHA 1ZSNA 1BSVA 5AVOA 1YQDA 3GPDG 2BH9A 4UVGA 3AI3A 1DPGA 5I9MA 3UKOA 4J1TA 3BMNA 3MJEA 2NU9B 4CMEA 5DBIA 4J9VA 4PZDA 2P4QA 2B37A 2O7SA 1CQJB 3C7AA 1Z75A 1WPQA 4WJZA 3DFZA 2FRDA 2PZJA 3O9ZA 1CERA 1DB3A 3E6AA 4FC6A 4CM3A 2X7HA 2VWQA 2B35A 3VZSA 3TJRA 3GNTA 1HLDA 4BGVA 2X0JA 1ZW1A 5T57A 3KXDA 5BT9A 1H5QA 4NG5A 1X1TA 3VZRA 2EP7A 4FR5A 5HTOA 3H9GA 4HXYA 4K9DA 5HM8A 3H9UA 5CHEA 4ZJUA 4FDAA 2BRUA 2O3UA 3Q6IA 4R54A 4DLLA 1KOLA 1XYGA 3GMDA 3DBHA 1WDKA 3PJDA 1PTJA 2VNSA 5IAAA 2YZ7A 4IMRA 2V65A 1B3RA 3Q9UA 3EMKA 2J3IA 4K1LA 3KYDB 4RF4A 4XR4A 4L8VA 2X5KO 1YL5A 5B12A 5C7OO 3EAGA 3VTZA 4CM7A 5CG2A 4M1QA 1T24A 2GF2A 5ITWA 2FPPA 3O8QA 3PHLA 4EGFA 4IINA 5K6AC 1JKJB 2CMDA 1O95A 1XHLA 1KVQA 3F1KA 2Q4BA 1LJ8A 3QVOA 5IN4A 5L40A 2FWMX 5DBGA 3ZNNA 3ZV6A 4CODB 1MLDA 5TQVA 3I9OA 1KEWA 2GUGA 4WCFA 1YBMA 4C7JA 4EW6A 3BXXA 1YO6A 4CMCA 3M1LA 1DIAA 1C0IA 1I36A 6LDHA 5JE8A 2X22A 1DC5A 2JD1A 1LDMA 2NSDA 3OQBA 1TT5B 4LSMA 3FWNA 4ALLA 2O3JA 2JD2A 3UFXB 1W4ZA 1PZFA 1X13A 3CINA 3PFWO 1YS4A 3WX0A 4YYZA 2JJYA 3B1JA 4IQGA 4I08A 1NNUA 5F3RA 1FJHA 2EW2A 2GZ1A 2Y0CA 4P4NA 2HMWA 2E49A 4EI2A 2HMSA 2AEJA 4NMHA 4F6CA 2ZB7A 1LDYA 3KSZO 1HLPA 2W4QA 3E1KA 4DPKA 1JLLA 5JCJD 3OECA 3STHA 5JYEA 4FJ2A 4INAA 4NHEA 2EV9A 2NTVA 2HQ1A 2DM6A 1NWCA 2E6UX 2AQKA 4R4JA 3QW2A 1VKNA 4UUNA 3VH2A 3FNFA 5EJ2A 1YKFA 5G0TA 1CF2O 2X1HA 2NADA 1HL3A 3H2SA 4L9RA 4BO1A 4IXWA 2P5YA 1IL0A 2J5RA 3CKYA 1D1TA 3U62A 4J4TA 2Y67A 1BW9A 2NVBA 4IIUA 1QRRA 1RYEA 2X86A 3DTYA 3WLEA 4XDZA 3DHYA 1LRJA 1N2SA 2I3AA 1PZEA 3ZW9A 2RAFA 4BOYA 5KJFA 3ZWAA 4U0JA 2C7VA 2EGGA 1DSSG 2GN4A 2PGJA 4FJ1A 1GTMA 1NPTO 1QYCA 4OSOA 2NQ8A 4YJDA 2EJVA 1C1XA 2NWQA 3VVBA 4PRKA 5IXYA 5LDHA 2X5JO 1OBFO 3HN7A 4FOSA 4GWKA 3B1FA 3ADOA 3BA1A 4LISA 3RC7A 1LEHA 4E31A 2EEZA 1ADGA 4CM8A 3I9JA 2X9VA 4E2XA 3UXYA 5JO9A 1Y8RA 1ZIDA 4CQLB 3F4LA 1WMAA 3GDOA 2YV3A 4E2YA 2PZKA 2JL1A 1R4NA 4TMFA 1M76A 5COBA 5A9TA 4CMJA 3Q9NA 1UXHA 4JJFA 1ZSVA 3CIFA 2HDHA 3NTOA 2YHUA 3OIFA 4TZTA 1I2BA 2HK8A 2ZTVA 3OEYA 3TQHA 4HP8A 3IS3A 4CLDA 1HKUA 4HADA 2O3SA 1BDBA 2EXXA 3LT0A 1XQ6A 1LRLA 3ZDFA 5F21A 3P2YA 1MFZA 3LT2A 1H0KA 1R4MB 4BB6A 2X8LA 5DT9A 2SCUA 3EZYA 3FTPA 2VQ3A 3OM9A 3RUHA 5MDHA 3KB6A 5K6AA 4FN4A 3DMYA 1Y8QA 2D2IA 4ND1A 5JCJA 1SOVA 3ANNA 2IZ0A 4HV4A 1C1DA 2H63A 2D1YA 4XEHA 4NBWA 1LXCA 2IXAA 4CM9D 4MKXA 3VTFA 4DYDA 1U28A 2IDZA 5L95A 3QIVA 3VHRA 4XQCA 4L4SA 1A71A 4MVJP 1A4IA 4XRRA 4GL4A 4G65A 1M6WA 1Y5RA 4IS2A 4LSWA 3RROA 4IJKA 1JN0A 4RPGA 2EKQA 1LDEA 2Y0EA 3W1VA 3AUSA 3UN1A 2O3RA 1IULA 1YL6A 1UP6A 1HYGA 2NU6B 2CD9A 3AM4A 4NK5A 4C7KA 4ROSA 4CMAA 1GZ6A 3IC5A 3ZU2A 1XELA 5JY6A 3GFBA 3SXPA 2D8AA 4B8ZA 3DXFA 1IZ9A 3B1KA 3GG9A 3WGGA 5KIAA 4N54A 2CVOA 2O50A 2ZB8A 3PHJA 3S1LA 2P2SA 1X1EA 1DXYA 3N7UA 2TMDA 2V6FA 1LC3A 4NBVA 4B3HA 1DFHA 2FR8A 2I99A 3JQFC 2GN6A 4ZRMA 4BB5A 1L7DA 2NU7A 4CJXA 2DUWA 3G1UA 2OMEA 1N5DA 4Q3AA 4E21A 3WQSB 1DIRA 2CVZA 2NVWA 2NU8A 4A0SA 4BNFA 5IG2A 3JQGA 3ANLA 4ZQHA 1NVGA 1BHSA 2E48A 1IOLA 2JD0A 3PEFA 1YE3A 2NM0A 3QWFA 3F3SA 2ZB3A 3OJFA 1U3VA 2BHLA 5KJCA 4YJFA 5TGDA 4DQUA 5KVQA 1RWBA 3OIGA 4KTTE 4NFHA 5A9SA 4PG7A 5I8ZA 1QYVA 1U8XX 4DYVA 3W8DA 3TRIA 1CETA 1T2CA 5JDIA 3JQ7A 1FXSA 1PQWA 1VC2A 2DBZA 4BV9A 4PG4A 4JP2A 2BFMA 2B83A 3HG7A 3JYNA 1H9BA 2Y1FA 3QHAA 2RIRA 5CAEA 2O2SA 3M2PA 5JCXA 1EVYA 1T25A 4KUGA 4O1MA 1I33A 1O94A 1D7OA 2VUTA 3FTNA 3NDJA 3AI2A 3D5TA 3I83A 5MGBA 2P5UA 3PLRA 4IUYA 3PJEA 1IB6A 2BF7A 4XJSA 2QRLA 5T5QA 3U0BA 1ZMTA 2NUAA 2A92A 4BQRA 2JFGA 1A9ZA 4AJEA 3LQFA 1I3KA 4XIJA 4EBFA 5I7FA 3DR3A 1NPYA 4R9SA 3V1YA 2C54A 4GVLA 4YT5A 3Q11A 3NT5A 5AXCA 3S2EA 4RDIA 5TT0A 2HMVA 2CDBA 3GVHA 2X4GA 4YJGA 2DBRA 4BO8A 5EN4A 4CL8A 1E7MA 3AFNA 3WDSA 1UDBA 5CDGA 3GHYA 5BR7A 3QJ5A 4ALIA 3T4XA 1BWSA 1XQ1A 3ZV5A 4BNTA 4QTZA 1QV6A 2HRZA 3BZUA 3DBVO 4DMMA 4W4TA 4XB2A 5TNXA 4Z9FA 3HSKA 3BHMA 4OL9A 3HE3A 1NHGA 4RF2A 2I65A 5LC1A 3VAZA 3I52A 3WYBA 3GFGA 4NJMB 4RV9A 4FD3A 1B16A 5T67A 3G3EA 4BNXA 5TF4A 1UP4A 3TOZA 1D1SA 4GX0A 3T7CA 3TNLA 1OC4A 3I6QA 4NPCA 1RYDA 1HTBA 1VL0A 2CUKA 5LDGA 5JXWA 4XIYA 1XLTA 2OZPA 1H2BA 2Q1TA 3JCZA 3D4OA 2OP1A 4WLVA 4P22A 1A9YA 4BS9A 2GYYA 6ADHA 1B7GO 3PIDA 5I7SA 1WDMA 5CP8A 3UF0A 4HBGA 3ICPA 2XOXA 3HDJA 5FF9A 3TFOA 3CSDA 2Y1CA 3INTA 1F12A 4BQPA 5KJ1A 1HDZA 3ZNOA 1O5IA 2B69A 1MV8A 2VHYA 3ZWBA 1IZ0A 3DHEA 1E77A 1WLYA 3D3WB 3FNGA 4WLOA 5A04A 1BTOA 5G4LA 4J3FA 3ZU3A 1LI4A 3JQFA 4UEJA 1I5RA 4RJTA 3WGHA 4CM1A 2YV1A 1P1HA 2HAEA 4GLOA 2VHZA 1JKJA 1CQIA 1JDJA 1EVZA 5F5NA 2O2YA 3MTGA 4WNCA 3VPXA 1H93A 4XDYA 4KP7A 1N9GB 3DONA 4BKUA 8ADHA 4RDHA 1P44A 1KVRA 1MG0A 4D7AA 1AE1A 3VDRA 3V8BA 5CG1A 2RBEA 4QUKA 2C2YA 3NGXA 1DC6A 1HDCA 1LQUA 1S7CA 4NDNE 2YHIB 4MP8A 1DFIA 3EC7A 5TX7A 4IZHA 5C7LO 2J8ZA 2V6MA 4PLCA 3CMMA 5JAZA 5FI5A 4LVUA 3RUAA 1PJSA 1P33A 5KVCA 3NT4A 2AXQA 4CMBA 1VE9A 1V9LA 1MB4A 4DVJA 4XD2A 4HNGA 3L07A 4CMKA 1H9AA 1XSEA 4NFYA 4R9RA 3DAPA 4IQ8A 4BO5A 3P19A 2ZJ1A 1KC1A 1Q7GA 3E5RA 4PLFA 1ZK1A 4YDRA 4CLRB 5IF3A 3MEQA 2OO5A 1B2LA 3FR8A 2Y1EA 4KOAA 5ICSA 3IIEA 4UUMA 1O89A 2EERA 4UEKA 2CSUA 1A72A 1AHHA 1I3LA 1RM3A 1YGYA 3D4NA 3PRJA 4R1UA 4MINA 3RCBA 5BSFA 3QWAA 3TDKA 1GAEO 1VSUA 1NTOA 2ILTA 4WOKA 5IZCC 5DN9A 1T1RA 1ZSYA 2NNLD 2D5AA 2ZYDA 2I9PA 4E0BA 4GI2A 4D41A 1LSJA 3O38A 3O26A 3SLKA 2F00A 3JSAA 3GDGA 1E3WA 4FIZA 4TRMA 4J0FA 3ADPA 4FFOA 3PQFA 4WLEA 4H7PA 4BO7A 3RJ9A 1GUFA 4GKVA 4BGUA 4BL5A 4FQ8A 4MVJD 1Z7BA 5EL0A 3KLPX 4IIVA 2FY8A 3PDJA 1Y81A 3RKUA 1UZNA 4XCVA 1E92A 1EDZA 2BFAA 4XYGA 1Y1PA 1PS8A 3RC9A 1PJLA 1F8GA 1GEEA 4FB5A 3H9JA 1UDCA 2JKVA 3H5NA 1I24A 2P91A 2P9GA 3HHPA 2VTEA 1GCOA 3KO8A 3IJPA 4IDAA 4MP6A 3WGYA 1K89A 3SX2A 1ZZEA 2QG4A 3HADA 3I4FA 2PD3A 4GX5A 1LLUA 5IDXA 3JQAB 4NI5A 2IODA 5DNAA 4CV0A 1CIVA 2X9NA 3D0OA 3K2EA 2JCVA 1ENZA 1JWAB 3UCXA 4OSPA 2X0IA 4PFJA 4EUEA 1LDBA 1PIWA 2G82A 2OXIA 1KS9A 4E5NA 1PR3A 2OBNA 1EBFA 2IYOA 1CEQA 1UJMA 3R3SA 4X54A 3LLVA 3HDYA 4BNNA 4LCEA 1WXDA 1YJQA 1CRWG 4B4OA 4BO3A 3OETA 2PTGA 2VOJA 3PDUA 1X0XA 4PVCA 5BNFA 3K96A 4TROA 4FC7A 4IM7A 1PU2A 4KUEA 3GZNA 5COQA 4B3JA 1NASA 1PZGA 3HWRA 4XZ3A 3OQ1A 3LC7O 2D0IA 1YJ8A 1D4FA 2NV6A 1LDNA 2VRBA 3GN1A 3JTMA 4Y6RA 5T8KC 4UVEA 4ALNA 3CZMA 5G0UA 3UW3A 3L6DA 4JXKA 1ZK4A 3SEFA 2FMUA 4ITUA 4J43A 5H81A 3ULKA 4XX0B 4AJ2A 4O63O 3F1LA 1J0XO 2PV7A 4CLXA 3PTZA 4K28A 2Q46A 1A7KA 2D59A 2AQ8A 2DBVO 1JW9B 5JAQA 1PZHA 2JAPA 3DC2A 1ZJYA 2ZCVA 2IE0A 3FHLA 4II2A 2AEMA 4JBHA 5JO0A 1EUDB 4WE3A 3LSYA 4DBVO 2QZ9A 2UUOA 3UICA 3O03A 2D5CA 4D0SA 5JMWA 1Q7BA 5DF1A 1UH5A 4MVJA 1V8BA 4D79A 5C5IA 4D3DA 3JQCA 2HCTA 5H82A 1N1GA 2PFGA 2Z95A 4I8XA 3MWDB 1AHIA 2VCYA 3C24A 4WLNA 1H6CA 3I9KA 5G0VA 4N18A 2PH5A 4BIIA 2IXBA 2NTJA 4U8GA 4BNMA 4P38A 1HDOA 4RVUA 4AJLA 4YVFA 3TZQA 3AM3A 3AI1A 4Q9NA 4O0LA 3EY4A 4R3WA 3GQVA 4RPLA 3RFVA 3AOGA 3A1NA 3F47A 5IDWA 5IZCA 2LDBA 3UCFA 4LMPA 1A5ZA 3GAFA 3ZV4A 4MVJH 1G0OA 4RLSA 4U6SA 3ROMA 1MG5A 3WGIA 2BFOA 4RPHA 3I9LA 3W6ZA 1YOVA 2P9EA 3GVPA 2EWMA 3TFQA 4HKTA 2Y0DA 3JD0A 4CV3A 2H1SA 4JJIA 3V1TC 1ENOA 4GGOA 3HDQA 2JCYA 4R69A 5JS6A 4JNKA 1EQ2A 2IYPA 4WEQA 3R0IA 4J1QA 2Y93A 4QT0A 4RF3A 5EQDA 3RWBA 3VPFA 4J0EA 4YB8A 1DJQA 2VHWA 3RVDA 3V5NA 3WYEA 3WMXA 3G79A 4IDEA 4DL9A 2AE1A 3LVFO 1ONPA 1MP0A 3L4SO 3HDHA 4PLVA 3LDHA 2B5VA 2W2LD 3BMOB 3OP4A 5A06A 4B7XA 1BXGA 3AWDA 2ZQZA 2ZTLA 2RHRA 4BNGA 5LCXA 3JQBC 2R2GA 1E6WA 2CY0A 3R3JA 1HETA 1U8FO 1HWYA 1UXGA 3IDSA 1G6KA 4BV8A 3RUIA 1XKQA 1YQXA 4EITA 2OGUA 1YONA 3QLJA 4BO9A 4CLEA 3OF2A 2WE7A 3ETEA 4NBTA 4Z0TA 3JD3A 2E37A 4LCJA 2LDXA 3OIDA 5JMPA 1XEAA 3NDRA 3PI7A 1XG5A 2CDCA 1VL8A 1E5LA 1K3TA 3DZJA 4Z3DA 1FK8A 2J5QA 3IJRA 3ZWPA 2YJZA 3RSHA 1R0KA 3IOYA 4IDFA 2QYTA 3NJ4A 4FOOA 2VZ8A 3JD2A 3JQ8B 4RZIA 5F1PA 5DOZA 3ZV3A 5A3JA 2EP5A 4LW8A 5T8KA 2ZCUA 4DRYA 3M1AA 3VPSA 4B8WA 1R15A 3RIHA 3JD4A 1A7AA 4QFDA 3F6YA 2IZZA 2DTEA 3DBRB 4FGSA 4PN3A 4PGFA 1QG6A 3U4DA 1GD1O 4NJMA 2ZIZA 4E2WA 3D64A 3DBLB 1PSDA 4Z6KA 1B14A 3INGA 3E9NA 1LUAA 4OQZA 4WLFA 2RCYA 3N74A 2HMTA 2J3KA 3PYMA 2DFVA 1XDWA 5I7EA 3HFGA 3WG9A
chains in the Genus database with same CATH superfamily
1W1IA 3DAFA 1SEPA 5ALEA 3UBMA 2WKSA 5HHTA 2FN7A 2Q2VA 1DX4A 1XZLA 1XB2A 2UZ0A 3MBKA 1Z37A 2HT1A 3QX9A 1NF9A 1IATA 1ZONA 4HLCA 1WCIA 4IEIA 4HF7A 3T4EA 1SM4A 2WKRA 1DRJA 3D6MA 1FDSA 3F4KA 2WAYA 1Z0DA 2XYHA 4GUAA 5KYWA 4GPD1 2FWJA 1NXQA 4N8DA 3DCYA 1EP9A 1GQSA 4W63A 4I5GA 3TDMA 1P9RA 4PZUA 2DQSA 1PCXA 4RESA 3OCCA 1GHTA 4MDHA 3VDMA 3QFTA 2FP4B 1C7JA 1NFQA 3NNSA 3PNLA 1GRQA 3QMPA 2AF4C 3HCEA 3P0RA 3QXJA 4KYTA 3TTTA 4D3FA 2EFGA 4G0QA 3DFIA 4WY2A 1QG2A 3ZXUB 4FYYA 1AU9A 1L4HA 2YN0A 3LUCA 4Y9UA 4PSAA 5KWVA 3TVTA 4YRDA 4OAQA 3L18A 1G2QA 5ALYA 1ORVA 1EAYA 2DPYA 2MSWA 2ZUCA 1FU4A 4K26A 3EA4A 4KI0A 1Z47A 1DFGA 4LDQA 5K0JA 4U6NA 4JGIA 2QD3A 3DM9B 1PF7E 4KPUA 3VKGA 4C7OA 1KBOA 4IHQA 1CVLA 3KZKA 2YNMA 3CXRA 3BRWA 1AGPA 1RXEA 2PNFA 3B13B 3HY6A 1SXJA 1UANA 1XP5A 4IXDA 5T4BA 4EB6A 3ZI0A 2C59A 4I2NA 4E88A 1R5OA 3EQ8A 3JQAD 3U9LA 1M0WA 2I55A 3DOJA 1XAHA 2FW8A 3IDQA 4MMYB 3D8BA 3AZOA 2FPGA 2XXJA 1HEUA 1E6LA 3L8HA 3PB3A 4U63A 4XUCA 3UC5A 1UBFA 3DE5X 1K7SN 4YQEA 3W4IA 2A9VA 3CMCO 3NV9A 5E3JA 2QF7A 3KPJA 1HXHA 2C1ZA 4XVCA 5BVGA 5KNBH 2HA6A 5CLIA 3WYAA 4I19A 3NP7A 1ODIA 1NFFA 2GSDA 5F1OA 3WLRA 4A4DA 2RC6A 3DTVD 4CF4A 2CNKA 1MJGA 5BN4B 3SEZA 3H6GA 4NH4A 4C4ZA 4DSUA 1U2TA 5JDIC 5C8YF 4ZRDA 4I1OA 1A5BB 1DWQA 1ZRMA 5ENZA 4W7HA 4OYRA 5FWXB 3L92A 7REQA 3TDNA 4DRXA 3ILVA 1U0FA 4KBYA 1W46A 3NATA 3ER6A 4E2FA 1UQRA 1WW3A 1LNSA 3WB1A 3NBMA 1XD2A 2JHAA 3CVWA 3GGOA 3TW6A 2CHFA 3H05A 4MGZR 3WWOA 2VJPA 4ZI2A 221PA 3AC0A 3DW3X 4N0DA 1XEXA 2LVBA 1BWQA 4QM6A 3CSSA 1FP7A 4MW0A 4PEVA 1A9TA 1GCUA 2QL6A 2D7CA 3AEKA 3C1AA 3FAKA 4E3ZA 5DLQC 1QFSA 5ECYA 1A9XB 3I5UA 4DTCA 3H2HA 1WCWA 5G53C 4QDXA 3TR0A 1U5AA 3QHQA 1CE8A 3REGA 1WA5A 2WV7A 3F96A 3AF1A 4H3VA 4HH0A 4D0SA 1H2AS 3H9BA 3HR4A 5HJ7A 1MOZA 4ZZIA 4R1NA 3M49A 1UKEA 2JIZD 2PXCA 2HNAA 4RA6B 3KJIA 1R3UA 1Z0IA 2NVUB 3UWMA 1LPAB 1TZMA 5C34B 1EGVB 4K87A 2EU8A 4Q1CA 4RV4A 4EPYA 1BMFD 1A27A 3G6WA 5CVCA 2Y0BA 2DCMA 2H06A 1JA9A 2CLIB 2Q28A 1Q0RA 5CLHA 2WK1A 4ZAYA 4LV5B 2CF6A 3CEAA 4TUYB 4CU2A 3TW0A 1H2HA 2ZUFA 1EM6A 1Y8ZA 4ZQIA 5IT5A 4FI3F 3V7NA 3CLHA 3KKKA 4DV0B 4C20A 4CM4A 3OEWA 4XE5A 3GA7A 3V8PA 3LECA 1FTNA 4F71A 2MYUA 3DOOA 5D6OA 5JSFA 4EHFA 3ITDA 2IV7A 1V48A 3O82A 3QA9A 1G2OA 1UC9A 2VDUE 4NE7A 3UATA 2EAUA 5IJ0B 4FFBB 3EXHC 1QYIA 2OWEA 2XCTB 3RSLA 4FLEA 1KGDA 4XM2A 1XXHB 4NONA 2W2KA 4ZGWA 5C8VA 2UV8A 4F2GA 1E1KA 3EEYA 3U37A 3QA3E 1RRMA 3W5CA 3MBIA 4O5AA 1PFUA 3ZD6A 2A9QA 2VH2A 3B70A 3A1DA 4OXYA 2EZ4A 3MJHA 3GAAA 4UU1A 2G07A 2ZFUA 3NPAA 4KH1A 1OAOA 3A9RA 3FYDA 3I37X 1GDHA 3KYBA 4O08A 4WDRA 1K5HA 2X0RA 1AF4A 2JCBA 5K5EA 1Y4DE 2DFLA 5HMLA 5DYTA 4GKBA 3IOEA 4FEGA 2RH4A 3O3OB 3OKAA 2GASA 4ENVA 4KE7A 2QQFA 3W5DA 4GOKA 4TXLA 4D57A 4AIRA 5JYDA 3HO8A 3R5HA 1ZU4A 3Q1LA 5H7XA 4MGKR 2UVQA 4JMPA 4RK0A 4KMRA 1T3LA 3CR3C 1YR9A 4F91B 2B21A 4Z9XA 1U1FA 2DFDA 2F67A 1IMJA 4DNQA 1E1RA 1SVOA 4RZUA 2X1VA 3D0RA 2ADMA 4AJOA 4W5HA 3OF5A 3KYCB 1FCJA 1N2ZA 4YYEA 5J4HA 3RAEC 2VZEA 1GG5A 4QOIA 4Y2JA 2WMNB 3K0KA 2XTJA 2A35A 4K86A 1SU4A 1E2HA 1OAAA 1N7JA 1UBOS 3O3NB 1AS3A 3MGCA 4BDTA 1JR3D 4E30A 4MYUA 5F12A 4ZXFA 1IOWA 4XVRA 3ZTWA 2EBFX 3F5DA 3GRUA 4BNDA 3LK7A 4DNOA 5KCZA 1ZL0A 3QOFA 5I3ZA 4BZZA 1S2OA 1PK9A 1TDJA 3VAAA 1DQRA 1YVDA 5LOVB 3FVQA 5C8ZA 3GD7A 1OZAA 2HJWA 4PHFA 4XYLA 2D3WA 3SQLA 3JQ6A 2Z30A 2OP0A 3ENQA 3KEMA 4PNHA 4R68A 3UYKA 2AX4A 1NBEA 1KAGA 4QEKA 3PX2A 3WL3A 1KO8A 1OH6A 1NPDA 3SC2A 3QZUA 5F77A 4CM9A 1BC5A 1IVYA 4JC5A 4ZV7A 4U02A 2QXUA 4OQYA 3QPCA 1KRWA 1R9MA 3TF5A 1QFXA 2IX3A 2F4VB 3N86A 4CW7A 1EM8B 3L3BA 3ST7A 3OLXA 3N6RA 1M34A 4R1OA 3OA2A 1G16A 3RS2A 2Z6AA 4JP1A 4MQMA 1PJ8A 4RJJA 4KQEA 3HCBA 1HDGO 2ZBEA 3WLSA 5JCOA 1E3IA 1G20E 4RD1A 1AK2A 2DC1A 4KDEA 4YPVA 2WM8A 3GLIE 1KMNA 1T0BA 3QKSB 5GJVC 1OKKA 1FVXA 1XZHA 2VSXA 3GEHA 4PN7A 5FT9A 4LJ9A 2XHEA 1NUAA 1DAOA 4R8SA 4R0NA 3FPSA 4JKYA 2GM5A 1T2EA 2I22A 4PLWA 5CPBA 2C9CA 3KNZA 1FQKA 2PQMA 2HX1A 4OA5A 1SZCA 3BHJA 1T9CA 3EE6A 3VPBA 1KZ6A 5IJXA 5C3MA 1EQUA 5BUCA 2ZATA 3FRJA 2PMDA 4X62B 1E0AA 1OYWA 1EVIA 3O4IA 2H5EA 4LJ6A 3ND8A 3V8NA 1OX6A 3GRCA 3V1MA 4BLQA 4AAYA 3DBHB 2VTBA 4MVJE 1L5VA 4GXRA 4BCBA 4MKIA 3UGKA 2YQZA 3EEBA 3TAHA 3X1WA 4L8YA 5FEUA 3CJRA 1NJ8A 5JFTA 3DQPA 2Z43A 1A88A 2R7LA 3RYCA 4GLFA 3UJ8A 3Q88A 4R83A 1KFCB 4HVLA 4P3XA 2A9OA 3FCOA 1CDZA 1U6KA 5JAPA 2BGMA 3AUXA 4OQXA 5I01A 5JZ9A 1UQUA 3R4CA 3ZK9A 3ADBA 1NI3A 1T9AA 5HCIA 3GNSA 1NONA 3CNBA 3LW7A 4F6RA 4LF4B 3L9WA 4G23A 5EOVA 1BE0A 2GJ4A 1NM5C 1PBTA 4KGZA 4ZI3A 1K0UA 3BA6A 1JIKA 1G19A 2I2WA 2WTAA 4UEOA 5FUMA 1U0HC 3QKUA 3IVRA 2R751 2WB2A 1KE1A 2ACKA 2G9RA 1Z56C 1II9A 2WICA 2G0NA 3FZGA 5CA0A 3OJLA 1FQWA 3ZZ0A 4KWCA 3EFEA 4JUCA 4KAXA 2FKAA 1T0UA 4U7HA 1Y6RA 3E03A 1QMPA 4RK4A 1M54A 2PU7A 5EIBC 4AJ1A 1E2KA 4AJIA 1T3HA 1IQ0A 2JIOA 2GJAA 3B6JA 3EHEA 4B7ZA 1L5MA 1YBAA 2QQ5A 4AICA 4DBZA 4C03A 5JDCC 4B6RA 3JAKB 4NOLA 4O1IA 1LSSA 2LE0A 5D51S 5DNDA 3ZNQA 2NZ2A 4KYIB 1AQJA 1FS5A 4JJAA 1TA4A 1U02A 1XVUA 1YVRA 3SU8A 3HKDB 3THXA 4H4EA 4D9EA 3QPWA 2X3YA 2Z58A 2C0CA 4PLHA 4ZZ0A 5IULC 1NLMA 3QPDA 1RAGA 2NO4A 2QD1A 2ZRCA 2OE2A 3E3AA 2VJDA 4JSTA 1JKFA 4EFDA 3VYTB 1X77A 1AMNA 5B7QA 1CJCA 1O9HA 4Q47A 5D7NA 2O4UX 1DG9A 4CFYA 4G4IA 5E1BA 3LYHA 4IFEA 2IXGA 4WSOA 1TT5A 3RS0A 4H4DA 3C8MA 4AQYB 5DBEX 3P9KA 4L9SA 3ZCRA 2D5BA 4TQGA 4DDTA 4IWXA 4P82A 5EXDA 2EIHA 5IH7A 3T3DA 4Q3EA 2L17A 5KYUA 2GYUA 4OXKA 1D6SA 5ENVA 3GNQA 1L1EA 4ER7A 2FE1A 2PGLA 5A2QA 2GKSA 4MWEA 5DNYB 3E70C 1QYRA 1Y3DE 3COVA 3GJ0A 3KPYA 5KOJB 3AUYA 4BE9A 1IXZA 2DBYA 5LP6F 3JVVA 3O0DA 2ATVA 4L6AA 3DMTA 3DDSA 5EJAA 1KEPA 1Z4JA 4L8GA 4DCJA 1H2YA 2ZXUA 4N48A 3N0VA 4BFYA 1PZMA 3P2OA 4Y6OA 5LBIA 4E1VA 1LLQA 2QG9A 2IF2A 2OXCA 1JZTA 2WFLB 4F38A 3JQ9A 2O2XA 5LZ2A 2ZQYA 1Y80A 3I6ZA 4PYLA 4D0NA 1JWLA 2AA3A 2IGBA 4RORA 3ACCA 4V0NA 3OZIA 2HUPA 2ZULA 1TQ8A 2EZTA 1ULBA 4HZGA 4HDQB 5LQUA 2VN8A 1JXOA 1T5SA 1JTEA 4P81A 3CLUD 4N4AA 1ZPDA 1DX6A 1JEYB 3UMRA 4YR7A 3DKRA 3DMHA 1XMIA 1SVSA 1FFCA 4QFBA 3ZE1B 2YC4C 2VOEA 1K9SA 2C57A 3N07A 4KGXA 2OHJA 3O9VA 1T2FA 2WLTA 3JR7A 1J8MF 3R6DA 2AW5A 5ERXA 3CF0A 4M55A 2P1DA 1W34A 3IO3A 4U6QA 1XZPA 5B1YA 3KT0A 2FU5C 2H65A 2ON6A 2Z09A 1WDTA 4CIVA 3GPCA 2WHQA 3WYCA 3TGPA 3FYTA 1VA4A 2HC9A 4U8HA 1HZZC 2RK3A 1S2MA 1FNSA 1VMEA 3ED5A 5KAMA 2OXTA 4W82A 3ZHXA 4YMGA 3PFHA 4MWDA 4G56A 3NBZC 4M8LA 3ONVA 3WFIA 1YMQA 3WBBA 1QKIA 1F2TA 3REQB 2JKYA 2QE7D 1Y8QB 4HTFA 2WUFA 4P5PA 3IEXA 4D2IA 5JH7A 3OHSX 3FGNA 2BGRA 1R6VA 3GCXA 5IAEA 2X0DA 2XZTA 3F2IA 3L0CA 1GV1A 4ZO8A 3ZIDA 4ZYLA 4D6XA 1JSXA 3WOHA 2VDKB 2C84A 2CXTA 5B6PA 2BMJA 1Z4QA 3VZBA 1DUSA 1XC7A 3ILSA 4UTZA 3MUFA 1EFAA 4QFCA 2Z4RA 3QP9A 1SVIA 4LE0A 1T2NA 3W8RA 1EXDA 2A6PA 1TVCA 3QGMA 1GILA 1N8NA 4WZAA 5EHGA 1TZ2A 4KBFA 3UM9A 2NX2A 3JV7A 1I7PA 3AW9A 3BXOA 4ATNA 1QGAA 2JGFA 5CGQB 1O4VA 1K7XB 1U9JA 4FMBB 2Q3FA 3FDZB 3LX5A 1AQYA 1IIBA 1M7HA 1ZXBA 4JT8A 4UBOA 1R4MA 5CT8A 3GJ5A 1SUSA 3KHTA 4PG6A 2ZYUX 1ISGA 4B9AA 1OWNA 2H4WA 2ERCA 3CYFA 5JAIA 1NC1A 1P7WA 1YJ5A 1YZNA 2OUKA 3G8DA 4O4IA 4XOIA 2FW1A 2Y4OA 3DS8A 3VYRB 4DILA 4U1RA 3ZGLA 3E7DA 1SBZA 2C96A 3DHVA 1N3LA 3FBTA 4L85A 4Q12A 5K7SA 1LZLA 3BWCA 4WOJA 3IBCA 5E95A 3NXKA 1JILA 4O4JB 4C4SA 4HH4A 3C3AA 4Y1RB 3BMQB 3WLOA 3BHNA 5G40A 5KTNA 4YMHA 3D8UA 3DO8A 4UCQA 1L5HB 4RAQA 4C5CA 1Z5NA 4GICA 3TZ6A 5KQLA 4RETA 2XTZA 4GRAA 2XDQB 4J16A 2I7CA 1Q19A 4M3NA 3VVMA 4IW3B 4OGKA 5HJEA 2NZXA 3R9XB 1MZPA 1V25A 1Q0ZA 2AMVA 3KAQA 3GUHA 2OHIA 2XNSA 3ZW8A 1AKWA 2P11A 4KOEC 4CEHB 3IB6A 3ETNA 5E6RA 3NHJA 3BS4A 2CEAA 1PHRA 1W96A 1WRBA 1YK1A 3P9SA 4KR7A 2BR3A 1FYFA 1H1TA 1RHJA 1LW7A 3HVIA 4HN4B 1UMCA 2BEUA 4AZTA 4EJ2A 4JC4A 2OGTA 3U48A 4XRGA 5IYZF 2AIRA 1X7XB 2P4UA 3JYLA 4RVGA 2WJYA 4XFDA 4BMYA 4GVXA 4ID9A 5IC4A 2PGOA 1C9NA 2Y9PB 2GM9A 2J6CA 3DLAA 1KQFA 3N2IA 1ZHOA 1AUXA 1LGYA 2ONJA 1UZMA 1DBVO 1W44A 3CEHA 3ZWMA 4BAGA 4AULA 1Z0FA 2LZ0A 4JYMA 4I2VA 4MV5A 1N9ZA 3GJ8A 4GHWA 4JK3A 4Y2VA 5FFFA 5A9SB 5CA1F 3BKXA 4O59O 4DMCA 1DC4A 4MB2A 3NAZA 5I7RA 4OQQA 4TKVB 4J07A 3JQ7B 3UPDA 4QT4A 1KP2A 3NBKA 1MIOB 1Z2CA 4RVDA 3TQSA 4B31A 2WSSA 1ESDA 2AN5A 1EG7A 3ZDEA 4KIWA 5CAEB 5ALVA 1KDRA 2TSYB 3JD1A 3DDCA 4IIJB 4C2TA 5I7WA 3M34A 3QNUA 3KWFA 3H5VA 3RGWS 2OESA 4DB4A 1E7RA 1K3FA 1N2CE 1YV9A 2Q6KA 3A1FA 3IMEA 3IP3A 3MB8A 4GLBA 4H08A 1XRPA 4J0KA 4LXGA 4ZO7A 1O95D 3SHTA 2F90A 5JMOA 4ZHQB 3PQ5A 4U3JA 4S0XA 1F2UB 1YQGA 3NRCA 3P0IA 4J91A 3M6UA 4TKZA 3JALB 4A0QA 4YT2A 5AOAA 1CYDA 3FOFC 1N3BA 4B48A 5JY1A 1RI5A 1RKQA 1LBHA 5C80A 1TQ4A 2HZ7A 3ND9A 3PNKA 1AZTA 1XDBA 1SUAA 4Q3BA 3ZHVA 4GWGA 5TT1A 2ZRKA 2K2QB 1DRVA 1ABBA 4NOKA 4YK7A 2BM9A 3BGIA 4CIWA 4YJGB 1K2VN 1XK7A 5LZ9A 3SVLA 4DV1B 4K6OA 1LNQA 3VR4A 2LXNA 4XWGA 2R00A 2H1IA 3PWSA 3OQNA 3A6PC 1XUOA 1N5JA 1YR1A 1YQ9A 4YXWD 4XWAA 1OX5A 1MA3A 4WASA 1ODJA 3OPQA 4JR1A 5GPBA 4RTLA 5JNLA 1X42A 1QZXA 2GRAA 2VK4A 2XCIA 5CCDA 5HWSA 4EB3A 1L7NA 3LY5A 5C1PA 3AP1A 3N70A 1ADFA 1UJ6A 2HK6A 1QHGA 4Q3DA 4D46A 1Y1LA 4R5HA 1N8TA 2R8PA 3IULA 4ZC1A 2NUBA 3RVSA 3KBOA 2XAAA 1MABB 4P86A 3WRVA 5K20A 4QOHA 2JRCA 3VNUA 1PZXA 5I5GA 1F60A 2Q99A 5JZOA 3ER9A 1X7WB 1XEFA 5J63A 5C81A 2AQHA 2JAHA 3EJ6A 4U9UA 1I8TA 4URYR 1E61A 3LLSA 2BJHA 3N6XA 4AX4A 4TT8A 2F48A 1PJ3A 4S05A 2BTOA 2WTUA 2Q2OA 3IDAA 2IS2A 1A9PA 1FW8A 1HYQA 3Q7EA 2Q3LA 5FBRB 3X1XA 3RLIA 4BNWA 1YS1X 3E53A 3G13A 1SXIA 4MR8B 3RSGA 4G0WA 1G7TA 3A8TA 1HQDA 3W3AH 2CZQA 2PZBA 1SU6A 1R64A 2C4NA 3ASVA 2HSDA 3BG5A 3EULA 3B9QA 5EZQA 3B6EA 3WGOA 2POQX 3C0KA 4MAFA 3U2QA 3AXSA 5BRAA 2I7TA 3G2IA 3ORFA 4K40A 1WMBA 5LWHA 2W8BA 4IP0A 3KTOA 1P0PA 2OBMA 2QGZA 2QXTA 4IG4A 2AN1A 3IRUA 1S1CA 2P2CA 2CNDA 4IVQA 2HU5A 3GX1A 4NF2A 5KVVA 3DDZX 2AHRA 3Q2OA 4QSMA 2M6RA 4Y6LA 4CTJA 2WPNA 1Z8HA 3AM5A 4OQNA 4C4TA 1T4BA 1P2SA 1B3BA 3GYBA 4BTVA 1FDOA 2Q1YA 5I48A 3DVLA 3R7FA 4KO2S 1KK3A 1YHZA 2VJKA 5EQTA 3EA5A 3C43A 3PPIA 1H9CA 5U4QA 4N76A 1ZA2A 5CB4A 1E0DA 2I29A 2KS6A 3LBFA 2MMGA 1F3OA 3UNXA 3AVWA 1W2GA 2CK3D 2O06A 3NX4A 4P6VF 1YA8A 4TX1A 5GZ6A 1QU3A 3I2JA 4F9GA 1I3CA 1NG9A 2CNBA 2WD8A 3QWIA 3GFVA 4RVNA 2OORA 4QM7A 3TKLA 3ZS9A 4XIFA 2FFRA 3SICE 3K20A 4ER6A 1E9VA 5G0WA 2JFNA 4WNYA 1U2ZA 3OFSA 3D3WA 2O1WA 4QQKA 4YH1A 4BVGA 1A4UA 3UKDA 2D5IA 4GOLD 2VL7A 2OA0A 1UDWA 1URPA 5K4HA 2QVLA 1KYTA 3FLAA 3OLWA 4FGWA 4TT3D 2ZBFA 3E3OA 2PRJA 3DBOB 4PXYA 3E3NA 4Q03A 3HJAA 2RHGB 1WMSA 4I1RA 1QORA 1I9CA 1UPFA 5ALLA 5EWLB 2ZWIA 1ZUWA 2QSZA 1SUBA 3MJCA 1AXEA 5K0LA 4HXGA 5LNK6 3HBLA 3N8IA 2IEDA 1XNQB 4TRNA 1L4YA 4UHHA 1NURA 1W59A 2X2OA 3JRXA 2CUNA 1KP3A 1KJ9A 2XT0A 1AGRA 1X8XA 3VH1A 5CDTA 2H0AA 1ULUA 4TTQA 1NUPA 1RHQA 4IEEA 1DS6A 3C6BA 4AMGA 4IKEA 3WGKA 1YJBA 2IKQA 3SDZA 2XUOA 4X91A 4BFZA 1T26A 2HA5A 2QLLA 3SSMA 2REXB 2ECPA 1MVOA 1JPNA 5KO2A 1Z7EA 1RP7A 2ZG6A 2CMHA 3IILA 2PGIA 3BAZA 5CH8A 4DLZA 1P1JA 2CVHA 2ODAA 3GYGA 4QJIA 5ITSA 2V1UA 1D8AA 4W5NA 2ZT8A 3CLTC 4L74A 1U7HA 2PO5A 4GP7A 3PQ7A 4I5DA 3FR7A 3OX3A 5CYFA 2JKZA 1E3WB 1K5DA 3NOVA 1GJRA 3WIDA 3WNQA 5JS7A 3IL2A 3M6AA 4BNLA 3PQ8A 3QYAA 5DT2A 3ROKA 1RYMA 1TD1A 4E6EA 2RHOA 2QMEA 3AFMA 4QXMA 3H42B 4DA8A 3P9QA 1CUCA 3ZQJA 4QJ3A 3TXYA 4AM8A 5BVHA 1PJTA 3RTEA 3A0RB 5KZMB 3ETDA 1N6RA 1IWPB 1GQQA 1P5FA 1CNFA 4P32A 3SQXA 3I9NA 1HBJA 2J6BA 2ZROA 5A7HA 3H8SA 3K0SA 2CV0A 2EJUA 3P0FA 4WZBE 5FULA 4F5EA 3C6YA 2E4YA 2VDWA 4YRQA 3GUCA 3KG2A 1KS2A 3E9CA 4S1NA 1R6UA 3O47A 1RKBA 5KJ6A 1ID8A 4G5GA 4INJA 4KFTA 1LBEA 4DADA 5DHTA 1P80A 4V0SA 1L7QA 3LQYA 1XMPA 4RHEA 3R7SA 4IJVA 4RA9B 1N0VC 2Z9BA 1R37A 5HP4A 3TK1A 1E2IA 4L73A 3O8OA 5F5LA 3HFSA 3KL4A 3U3XA 4GXTA 1Q14A 4MVJM 4GF5A 4TYPA 3U4HA 2NW6A 1QMGA 3L7BA 1WM1A 1SUFA 5LYJB 1LRKA 1A7JA 2EDAA 2D54A 3TRFA 2HEIA 1TLFA 4F1WA 3C3MA 3L1VA 3HO1A 4X60A 3OZ7A 1G8AA 2V45A 5EWJA 4ZTZB 3REOA 1F1BA 1W0JD 3MZ0A 4NQRA 4CG3A 2XCQA 3T95A 3EK2A 3H5WA 4QNNA 4F84A 4F2WA 3HPQA 2IW3A 1AF7A 4QATA 1JJVA 2R1ZA 3KDPA 1XWIA 3OZXA 4NBRA 2EC5A 4QU0A 1SWVA 1YRYE 4LWQA 2A0UA 4C4XA 4JIGA 1QH1B 3E82A 3MCWA 4NMMA 3LQQA 1JVBA 4NMXB 4YAIA 4J0GA 2QLNA 1NV8A 2YDYA 2WWTA 4Z3KA 5HJ2A 1M83A 3W2FA 4YUZA 5CBKA 4BV3A 5J5CA 2FZVA 1FFDA 2VC2B 2WSLA 1ZJ6A 3E05A 5DPMA 3FSGA 1CWUA 1T4DA 5T4EA 1YQEA 3WHIA 1QRTA 1YUBA 1T5LA 4HWTA 5K0FA 4KRYA 3T34A 1G5RA 1XTUA 1NBIA 3ITNA 4K8OA 1NWHA 1NN0A 3G85A 1X80B 4UCWA 1OU4A 1XVVA 2XR1A 4UKDA 2CDRA 4CKCA 3IJ5A 1HK7A 5ITVA 3QSYA 1E1QA 3UUWA 4QL3A 2I6UA 1UAYA 2D2VA 1NW6A 2IYXA 2JGIA 2H2DA 3BKWA 3DTVA 3PWZA 4MMXB 4BAZA 5EJ6A 3MPUA 2PGDA 3Q3HA 1SQSA 1HTTA 2ZRBA 3MG9A 3KJEA 3IAS6 2QRVA 4OHVA 4B8YA 4XX1A 5BN1A 5FRDA 1HSZA 3SGLA 1CK4A 4A6DA 4PX9A 4FT2A 3B82A 1KDOA 2LR0A 5L53A 3G2JA 5ALTA 4HY3A 3PLAE 3BEDA 1D07A 1LQTA 5BV2P 1SUDA 4NK4A 1BRMA 1WHSB 1P4RA 4INOA 4XCQA 3FNEA 1EHIA 4GKJB 1LV7A 1MJFA 1WCYA 1M2OA 4P0TA 4YAKA 2Z5VA 2ZJ6A 1E58A 3VR2D 1FVFA 2Q3DA 1DAHA 1NBME 2OAQ1 5AMXA 3SX4A 4CN9A 4MW5A 3KR2A 3IUPA 4OGGA 3FJ1A 1CB0A 1Q11A 4XX0A 3NDBB 2JIPA 3HPRA 4UBNA 2O59A 1PW7A 1I01A 2BONA 3OZEA 4DC1A 1R0XA 2CVPA 1ZUNA 3D3JA 1JGTA 4DHWA 2OC9A 1UBRS 1O54A 5PNTA 1JVNA 2OQRA 1L5WA 3RU7A 4LVNA 2MINB 2AYYA 2DAPA 1YB4A 4FB4A 1M6NA 2DQYA 2WJZB 3BD9A 4MKFA 4YRMA 3DWEX 1BMFA 3ZVNA 1YOVB 1YBHA 3FFXA 4UNRA 4B3RB 3RJ5A 2X23A 4D9JA 1R0SA 1NUHA 4HC4A 2ISQA 5CFQA 4RAOA 1SHJA 3HDJA 1CY7A 5KSPA 4EHHA 3LT1A 4IO1A 2FZ5A 2PYIA 2QG6A 5K3DA 2NSJA 3LFHA 1P2TA 4D4IA 1QP8A 3TOCA 4BMNA 5JTUA 3L6CA 3L7IA 1P75A 2CE7A 1G21A 2H92A 4FCVA 3FF4A 1LK0A 1ZFNA 1QWOA 2Z3WA 2ZJFA 2ANBA 4FBLA 4JBNA 4C08A 5TRTA 4RSRA 1A50B 4EO7A 2VYNA 2WZQA 1COWD 1HNWB 4EW1A 4YT4A 4X90A 1HLGA 1NQXA 3RFTA 4BQEA 1F17A 5KQRA 3VRHA 4F1JA 3W5BA 1IMOA 2BELA 2Y8EA 2B0CA 1T2AA 4GWLA 4MUEA 1IXRC 4PZPA 5E6UB 2PL5A 4FUTA 4BQNA 4WMLA 1F20A 2FMFA 1R0WA 3CLRD 3IEVA 4RUKA 3ZY6A 5TGZA 4HNTA 5DLEA 2E5LB 1Z5PA 5A05A 2KLBA 4EKYA 4DPLA 4P83A 1IZYA 2QMHA 5AVXA 3OUUA 2A5GA 4PIMA 2C4TA 4URVR 5B4UA 4X92A 4HATA 5AUOB 1SBNE 2Y76A 1GO2A 2H85A 2P9YA 3K8ZA 4OLJA 4QTUB 2BE9A 2J85A 4JYCA 2HQRA 4QYSA 3QVLA 4YAJA 4OQ4A 1BMQA 3OJCA 4OHZA 1Y6GA 4WK6A 5BUQA 3H2GA 3FOEC 3WNVA 2EWWA 2PX4A 1Z2OX 2G25A 2ZBVA 3FRHA 4RVCA 4MYDA 1J70A 1TB4A 1D2NA 2BFPA 2GOYA 2XYGA 4YJ2A 4CR6A 3R9WA 4M7RA 2Q27A 3VMMA 1DEHA 3EDMA 4CM5A 1TC2A 3TQCA 2CFOA 4HDOB 1W7AA 1KYZA 4IQFA 1HE3A 3AYXB 4DXHA 1VI5A 4BE4A 2WB4A 2AQIA 2VJNA 1XTBA 3OE7D 3PPYA 4IVPA 6YASA 4OGWA 2BMVA 1N8SA 4MS3B 2JVKA 4BEWA 3L7KA 1GVNB 4GX1A 2ASVA 1FNDA 4HLDA 1IC6A 2WJVA 1JJIA 3PUHA 4MEBA 4Z99A 4D8WA 1KI2A 3H2KA 2NTYC 1BU8A 3TRKA 2QIPA 3DQQA 3RLFA 4YP0A 1P61B 1JYEA 3PZRA 4DLNA 5JI2E 3CEMA 3K73O 4M86A 4ZVKA 3HR7A 1T3SA 1SCNE 2QD2A 2B8NA 2YJTD 4MWTA 2V5AA 4EJ6A 1MKYA 3W5VA 4LN1A 1A82A 1NVAA 1P74A 1QOZA 5EWMB 4UQLA 5KYGA 4QVIA 1KI8A 3MN1A 2JBWA 3ZY5A 3TM5A 2JFOA 1JHRA 2Y1DA 1GV0A 2YX1A 4JGBA 4TN1A 1U8EA 1I10A 2W0SA 3OIWA 1PKXA 1RIFA 4KQWA 4AJ4A 1T1JA 3LA6A 1KY2A 4PHGA 2H1OA 4B7CA 3H84A 4QECA 2QT0A 3G0DA 3PGJA 3U7RA 2GN8A 5C4MA 5FO0A 3U7QB 2QRNA 3FOCA 5DGTA 3CF4G 4D3ZA 3K0AB 3HCWA 1P7PA 4X66B 1Y1QA 3TEJA 2IYYA 2LCIA 4L07A 1LWOA 3GJXC 3P8ZA 4U0KA 2HA4A 1VRVA 4U7WA 3NVMB 3CRQA 4NYIQ 4OFWA 5C32A 2J0SA 3PUIA 2G4LA 5ICEA 5FEMA 3JYPA 1NTRA 2WVJA 1PJ4A 3WBKA 3I8XA 3HBJA 4DIBA 2B1GA 2FMXA 2F8SA 1OWPA 2HU2A 4O8ZA 4P4GA 4XJXA 2A8YA 2CHUA 2JA2A 4CQJA 1B93A 4US2R 2ZBUA 4PBTA 4I9HA 1D2RA 4YUVA 5IMBA 3W5UA 2HXGA 3FZNA 2I3BA 3RF7A 3WRYC 3GJSA 3ZDCA 1TYDE 1EFVB 3PU6A 4HFNA 2WJAA 3NPMA 2C82A 4LAFA 5EKDA 3AEZA 5EE3A 5IARA 2JGAA 2V7PA 3DTNA 3NEYA 5FUYA 3AF3A 1PG5A 4F2DA 4KLNA 2VSOA 1D04A 2CBZA 5J2TF 3W6PA 5IN5A 4DANA 1AK9A 1ZNYA 3NIBA 3S70A 2LNDA 4DV5B 2RGGA 3HRIA 2CBGA 5LZ8A 3ZHTA 3DKVA 1U65A 5EG5A 2R6DA 2VWGA 4M2LA 1V43A 3QE2A 4FHDA 4PR0A 2J7KA 3AR2A 2YRFA 3KR1A 3UMSA 3UV3A 4R1QA 3WDLA 1T6XA 4UU8A 2JS7A 3HKBA 4WFQA 1ZD3A 4BCCA 5L6MB 5FWYA 4UZFA 2PGAA 2VBIA 5K2MA 5L7WA 3K6SA 4KJXA 5JEEA 5DBFA 2DFNA 3OZSA 1XZKA 2H9AA 4FX2A 3U40A 4CKWA 3HFJA 2FF7A 1UKCA 2NPFA 3MIZA 3Q1KA 1A9QA 1U7TA 3U5ZB 3H1TA 2YZKA 4D3XA 3DKPA 2UUBB 1DGQA 1QGUB 5I51A 5K09A 1MR3F 5DWQA 2DUUA 4D80A 3BMCA 4FBMA 4J6FA 2H16A 3D4BA 3DZHA 2YJNA 3OM1A 1H6BA 2G5TA 7MDHA 4LRYA 3RRFA 4YI3A 1I7SB 1Q7RA 2BOVA 3O2QB 4Y7DA 5DLYA 3CCFA 4X20B 1XCBA 4PGAA 3EGEA 2ZTMA 5EC8A 2Q7XA 3TBHA 1IE3A 4M7WA 1GKYA 1HMPA 3QXSA 3I5MA 5CLLA 4N0QA 5JSQA 1PWHA 4UEWA 1E98A 2A30A 2JAQA 2EBWA 3HMQA 4QOSA 2PUJA 4UUPA 3ZHZA 2YHBA 4CUZA 1SCUA 2JFBA 3SYRA 4D6PA 2DWCA 2P3QA 2ACEA 4A16A 4QYTA 3BL6A 1S4MA 4YWJA 3OQIB 5EMJA 4DSTA 5A5FA 1UCFA 4UFOA 1ATZA 1Y9JA 2X2PA 3VZQA 2RH8A 3M5PA 1BA3A 1NQWA 1JIVA 3DVRX 3KVYA 7AT1A 3PXEA 2RGBA 5TGTA 3PL1A 3V6LA 2FSPA 1XTQA 1P3JA 1G1AA 1M2KA 3R7BA 3VV3A 5FWNA 1AIPA 3RODA 1RCTE 3U09A 1NBAA 3USCS 1OI7A 4YRBA 1VIMA 2QRKA 1DKPA 1UM8A 1A8IA 5EP1A 3HXQA 4C4RA 1Z5ZA 3QJGA 5BV1A 4G67A 1ULSA 4R1SA 2IIBA 4CMEC 3ASYA 3DUFB 4RIGA 3OT1B 5AWFC 5J4KA 1VKOA 2QZPA 2EATA 2PLFA 1OZHA 2CVQA 1WBDA 4OIFA 2HJGA 2ZYSA 4BAUA 1L8QA 1ZCAA 3BHIA 4PRLA 1XT6A 3T5PA 1NVMB 3K2BA 3X0DA 5K0EA 2C7PA 2IUYA 1CY6A 3GUYA 2IOFA 3I64A 4MV7A 3VH4A 2MJLA 3DAGA 1IFXA 3A0UA 1C2YA 5AKZA 1L0BA 1PFKA 3PTLA 3QV1A 4M4SA 4AXXA 1GPH1 4ALJA 3QK7A 1ZJZA 3ZXIA 4G5SA 2X76A 5J2UB 3GN2A 1BAPA 5DSXA 5AVWA 4MUHA 2W6CX 1JG2A 2O6HA 1OA0A 4QTXA 1EB8A 2XYQA 4B2LA 2FPOA 4GYJA 2BRUC 2A9RA 3P9XA 3UUGA 5JZSA 4M38A 1USUA 3GFFA 4BO6A 3I2GA 5GV7A 4E5VA 4FCTA 3WWCA 3L1JA 2YWRA 2YIJA 3LFUA 4LNUA 1ZJJA 5F9HA 5JZMA 1E79D 3ZK7A 3OPVA 3HH8A 4LXTA 1WL8A 5G4KA 3PE4A 1AT1A 4D3SA 4D9BA 1FNNA 3LT4A 1IY1A 2EDCA 2ID7A 5AW4A 1KSFX 2JGDA 3B20A 4DARA 4FILA 4DLWA 4U2FA 1OIXA 2JHGA 3GARA 2CDAA 1LDGA 2FPRA 1T34A 2OECA 1MGPA 2PLRA 1BQ3A 3NXSA 3VHXA 4CN8A 2VTDA 5CX1B 1XMVA 2A0KA 5ER9A 1SVWA 2G5CA 2VRWA 1AGNA 4J7UA 3G5UA 1SWWA 5B3JC 1MX9A 1QJCA 3PC8A 1DKLA 1NVVQ 2E4AA 1E4OA 2F8MA 2VJBA 7YASA 2ZSUA 1YA6A 4LI3X 1KJIA 3U1TA 2CT8A 2IEGA 3HXLA 2CXRA 5I9LA 4JC0A 4N5LA 1UBKS 3WYDA 3W8FA 1XN1A 4WCFC 3N0RA 2NZ8A 4MMZB 5L7TA 3L1HA 4DWOA 5JD3A 2CNWD 4G0ZA 3HCOA 4UBKA 4CQMA 1CJMA 2I91A 5KSZA 4EMBA 1J6UA 4BVBA 3SZ3A 2A59A 3R8CA 4MLZA 3WLFA 1Z62A 2HHJA 4Q4JB 3FSJX 4NY1A 1XPJA 2QE7A 3X2FA 3RS8A 2MSDB 3KT8A 1FDRA 2XADA 1OSNA 3FYUB 4A8JB 1NSFA 4TSRA 1X15A 4C01A 1EA5A 1PGPA 2B4QA 1CUAA 2FSVA 3Q7QA 4A5OA 5J4VA 4NOJA 1F8UA 4KL8S 3O4HA 5JQGF 3DL7A 3F90A 1CUHA 3K0CC 2XIQA 1YZLA 4TS3A 3NHFA 2NUTA 2BUCA 3ROZA 4DFDA 2AL7A 3HVJA 2RKBA 2FEWB 1IJBA 2DHEA 2F1JA 1DTWB 4KH0A 4KLRA 4EP1A 4BECA 4E5MA 2GJKA 3EW7A 2CF5A 3QW4B 4I50B 3SEAA 3TL3A 4A5SA 1E9DA 3KHUA 4MA4A 1Z7WA 2YH2A 3EGWA 5EIAA 5ARBA 1FSSA 2UZ1B 2W6ZA 2A3RA 3NRBA 4HUQA 3RASA 3S29A 1Z4MA 1GUAA 2RIPA 4N6OA 4YMVA 5M29A 1C9JA 2VR1A 1Z15A 3LDAA 4JR2A 2W2MA 4DR5B 4OJQA 4UTOA 2HPVA 2OBXA 3DJFA 3K9QO 4W6ZA 5DV9A 1MOQA 3L7AA 3LQRA 3EIHA 1NW4A 3S0JA 1MC8A 1AO0A 2IBTA 5JXHA 1LX6A 1V6CA 4BQOA 5F35A 1F06A 2WUVA 1ZH6A 4NV0A 4CCYA 1ZSNA 4G1MB 3L8YA 1H3EA 1CNEA 5FBQB 3JAMA 3GPDG 3MMXA 5AW9A 2EKBA 3AI3A 1WXIA 3B1VA 1TOAA 1NI5A 3OQPA 5I9MA 4RL4A 2NU9B 4W5TA 1SQ6A 1Z6TA 4J9VA 4NAVA 5ARDA 4LXHA 3CXUA 5DISB 3HKCA 3ZIUA 1S89A 2A7XA 3IP8A 2O7SA 1CQJB 3L79A 4LC9A 4EOGA 1FXUA 5I6DA 3DFZA 1FMTA 4BXOB 2J30A 2O52A 3ZE2B 1DB3A 2I7XA 5ICFA 4W8OA 4CM3A 1QB8A 1U8ZA 4C6TB 3KC2A 1C9YA 1WE2A 1THMA 5F33A 4OUDB 5BW8A 1ZR4A 1RPZA 2VWQA 2X4DA 5EJIA 4QBFA 3GNTA 1U0LA 1ZW1A 3KYIB 4EFNA 3C6QA 3KXDA 6REQA 3AFIA 1BX3A 2VPYA 5KNBD 3AF0A 2WUWE 5F98A 1DBRA 5HTOA 4K9DA 1G3IA 2HU8A 2QN6A 3K1YA 5CHEA 4YROA 5FFMA