2FP4A

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gtp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
305
structure length
304
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
total genus 112
structure length 304
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fp4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fp4A01
3ZWAA 2VWHA 1Q0HA 1GADO 4OSOA 2PA3A 4DC1A 4F6CA 4BNHA 3GVIA 2Y0DA 1GU7A 5BNTA 1I5RA 2BI8A 1Q0LA 3QHAA 3W6ZA 4CMJA 4IUYA 3TRIA 4F6LA 1IYZA 5G0VA 4WLOA 1ZSYA 5H82A 4DQXA 2YUTA 3AUUA 1I3NA 3VH2A 5FI3A 5KOIA 2X0JA 1GYQA 3KXDA 1U8FO 1LI4A 1B8UA 3AI1A 4GX2A 3IDSA 1HE3A 4RPKA 2WE8A 4AL4A 4JQCA 3GPDG 2E49A 3NTOA 1YDEA 4XYMA 5C7LO 2WYWA 4DXHA 3QVTA 1Q2XA 4M89A 1TB4A 2PGJA 4NDNE 4EITA 1GZ3A 5A5FA 1DSSG 1PWXA 4TRMA 4PG5A 3WX0A 4N18A 5JC8A 3WIEA 4PZEA 3LYLA 4UEJA 3ZV6A 4AVYA 1DIHA 3ZNNA 2ZIZA 1WXDA 3GPIA 3ZHZA 4FOOA 4TQGA 5DZSA 1E3WB 2FP4A 1R0KA 5F21A 3S2FA 2PH5A 5THQA 3AK4A 1EDOA 2Q50A 1MB4A 5COBA 3SX2A 1HETA 1XU7A 3KHUA 2PKQO 3LSYA 2BKAA 2GZ2A 1ADFA 4IQ0A 2AW5A 4WLFA 3KYDB 3MWEB 3AUTA 4E5YA 1VSUA 3U9LA 4ZHSA 1N1GA 5A3JA 4YB8A 5C7OO 4HY3A 1VE9A 2NU9A 2B0JA 5JMPA 4GAEA 1NQOA 1LLDA 5T57A 5CPBA 3ETDA 4J49A 5A3VA 2OXIA 3LQFA 3IL2A 2HAEA 1BVUA 3WGQA 3VVBA 4DTIA 3SC4A 1EMDA 3HDJA 3O03A 4XGNA 4QTZA 1JLLA 1YONA 2ZTLA 4LRTB 1Y8RB 3GG9A 4K26A 3UCEA 3BMCB 3QJ5A 1V8BA 4CMEC 5MGBA 1IOLA 3ZWCA 3ZU4A 1Y5MA 4X54A 3V8BA 2D2IA 2VOJA 3CXRA 4URFA 2I66A 3G1TA 1Y1PA 3DBVO 3RI3A 1E7RA 2VZ0A 5IZCC 4XWYA 1K89A 3FR8A 4NG5A 4RVUA 2Y1DA 1JKFA 2D5AA 4FPXA 4ZVVA 3FBGA 9LDBA 1PZGA 1IUKA 3ICPA 3IAHA 2HMWA 1H93A 2HQ1A 3VKUA 1XWFA 1ZBQA 1Z7EA 1ADBA 2CD9A 2OHXA 1LU9A 1NFRA 4WK6A 3Q0EA 4BV9A 1PS9A 2DAPA 1JVSA 4B4VA 1NWCA 3CTMA 4A26A 4XDYA 4MP3A 1HWYA 3D4PA 4XYEA 3EAGA 3LDHA 3ZU3A 3KLMX 1E6WA 3GGPA 4JIGA 1VKNA 4BNLA 2AE2A 4YT2A 4Y6SA 2VN8A 1HYGA 3AU8A 4GKVA 2WD7B 3T7EA 3DFZA 5F5NA 1GQ2A 3WLFA 3RC9A 1Z82A 1BDBA 3JD1A 5BSHA 1YDWA 3NTRA 2VRCD 3IOYA 1H2HA 3PHHA 1CDOA 3RWBA 1LEHA 3MJCA 1GEGA 1IPEA 1SOVA 2RBEA 3RD5A 1IZ9A 3PHGA 4IQ8A 1U3WA 4M54A 4MIEA 3U4HA 3W8DA 3PLNA 3BXXA 4IM7A 3FTPA 2AMFA 1H9AA 1QLJA 4ZRNA 4B7UA 5A9SA 3ANLA 3M6IA 3WJAA 2Y1EA 5EINA 4FFLA 5IZ4A 5DP1A 3JQ9A 1ZXBA 3GFGA 1PIWA 2CZCA 1EQUA 2CDCA 2I76A 1MLDA 2DPGA 2ZCVA 5CPFA 3UXYA 1OOEA 2AEJA 2GYYA 2P5UA 4ZQBA 4B3JA 4E6PA 5J23A 4CLDA 4DBZA 3UN1A 4H15A 3U62A 3JSAA 1E1NA 1HKUA 3VH4A 1SBYA 3CZMA 2EIHA 3QE3A 1PZFA 2VZ9A 4RQTA 4F3YA 3PHIA 2RCYA 4FBGA 1F17A 1PR9A 1C0LA 2AEFA 4ZRMA 2FR0A 1EUCB 4OQYA 4WOKA 3HG7A 4I9HA 2EKPA 5A5EA 3G49A 3AWDA 1U2DA 5G0TA 3SVTA 2UVDA 4BNJA 3ZNPA 1KYQA 1E1KA 2XPCA 1TT5B 4MVJG 2HJSA 4E13A 2CVOA 3B1JA 2V6BA 3EW7A 4XQEA 4CV0A 1O5IA 5LDHA 3STHA 1N9GB 1JAXA 3JYLA 1C0IA 1R4MB 4FFPA 2H1SA 3H8VA 4Y9DA 1Z74A 4UUPA 3H9UA 1WW8A 1WMAA 1SAYA 3SLGA 5I7SA 3L4BC 3OJEA 3S1LA 4FFMA 1OAAA 1NYTA 3KRTA 5DULA 3AW9A 1U5AA 5JAMA 2WJPA 5KJ6A 5JYEA 4YJFA 1UZNA 3GMDA 1Q7BA 1XQ6A 1W6UA 2IZZA 4LCEA 3ZV5A 2YV2A 2POQX 1IE3A 2UYYA 4CMCA 1G6KA 2X58A 8LDHA 2BFOA 3INGA 3OJFA 2BELA 1F0YA 3JQGB 4ZD6A 4XQ9A 3D7LA 3DONA 5AQ1A 2DLDA 1C0KA 4YEDA 1ISGA 4Z0TA 1ZK1A 2UAGA 2I3AA 3DZFA 1DO8A 3F4LA 4NJOA 2J6IA 4YAKA 1A9ZA 1KVSA 4UUOA 4TRNA 2HMTA 5AXCA 3K96A 1UAGA 4NFHA 4XJTA 3FTNA 1PJQA 1JKJA 5BR7A 1V6AA 3LVFO 3JQAB 2D4AA 2X0IA 1OI7A 2BHLA 4PG4A 1UDAA 2F1KA 2JL1A 3WGTA 1KEVA 2DTXA 4BUCA 4AJ2A 4CMGA 3LZ6A 4I5DA 1Z75A 1I3KA 2BFAA 2PKRA 1LRKA 4RVFA 1TT7A 3NKLA 3QWHA 3R0IA 3H5AA 3CH6A 1HZJA 3GOHA 4E12A 3ETGA 3GN2A 3GVXA 3A28A 1YOVA 1LJ8A 4YJGB 4R3WA 3QWBA 1QR6A 4MVJE 2ZK7A 3JD0A 1T26A 4L4RA 3GFBA 4LMPA 1JQBA 1ADCA 3I9OA 3EK2A 1PJTA 4TKLA 2CY0A 3KVOA 4RCVA 4QECA 1Q0QA 1U4SA 1YWGO 5AXDA 5F1KA 3O38A 1LDEA 4I5FA 3DAGA 1O9BA 4XX0A 4Q3CA 1T2FA 2QX7A 4XIYA 4ESOA 3OIGA 3IP1A 4XR4A 2V65A 4BKUA 3INTA 1PGQA 3PFWO 3MJVA 2C5AA 2QYSA 3B70A 3FNGA 3O4RA 3R3JA 2UUOA 1Y8QB 1KIFA 3DBLA 3DQPA 2VHVA 3DC2A 4G81A 3RC2A 3GRPA 4D7AA 5KKAA 1NQ5A 1O94A 2DBQA 3H4VA 3PDJA 1J0XO 1XHLA 1E92A 1VL8A 2SCUA 1H2BA 3HFGA 5EMHA 3UCFA 2YHUA 4UEOA 1MG5A 3TF5A 5JBIA 1I01A 2NTVA 2ZYGA 1LSJA 1QV7A 1NQAO 4GSLA 1S6YA 5CFZA 3KEQA 4IBOA 2YZ7A 1RM0A 3H3JA 1NXQA 2FN7A 3Q3CA 1ZO8A 1K5HA 1R16A 2IZ0A 4B4UA 1Z6ZA 4BQRA 5JAZA 1NNUA 4D46A 2JKVA 1L7DA 3AM5A 3N58A 4WOJA 2NU8A 4L73A 5A06A 1ZKMA 3T4XA 3DB2A 4MVJH 1WZEA 4R5MA 3FRJA 4NBUA 4BO2A 2AHRA 1ZIDA 4K1LA 4DMLA 1H0KA 4MVJA 4PLYA 1KOLA 2VUSA 2OO5A 4BNIA 4YR9A 3OA2A 3W1VA 1DC4A 2XOXA 3VHRA 1I3LA 4R9RA 4NBTA 5KKCA 4BNNA 3HN2A 2GN8A 1ONNA 3K8ZA 2BGMA 2Q1WA 4KQWA 3PGJA 1PJ4A 5DDIP 3PJEA 3RROA 3RU9A 2HU2A 3QVXA 3C7CB 3JYPA 2NVWA 4EI2A 3I9JA 3ABIA 1UZLA 2D0IA 4Q3EA 4S1VA 4YYZA 3L9WA 1ISIA 3NEPX 2OGUA 1X1TA 2WD8A 2YHIB 1M67A 5CEJA 1B26A 2C7GA 5JAIA 4O63O 3FR7A 1R66A 3ASVA 4OKIA 4QFDA 4PZDA 4ZU3A 1X13A 2Q2VA 4RO0A 4NK4A 2B4RO 4CMIA 3BTOA 2EERA 1DFHA 1RM3A 4II2A 4UVIA 3KYDA 3D3WB 4XJSA 3MWEA 3ZNQA 1D7OA 2QW8A 1RM4A 4RDHA 5CDGA 4YJDA 4YAJA 3ZHXA 3AOEA 1ENZA 4J1NA 3C7AA 2EGHA 2BD0A 3FNFA 1UDCA 5DCWA 1DHTA 1JKJB 4RPGA 3RUIA 1N1EA 5G0WA 5ENDA 1DXYA 1EK5A 5IXSA 4BO3A 4EUHA 5CDTA 5JYDA 1JU9A 1ZEMA 3L6DA 1DDOA 4AJHA 2F00A 3OA0A 5DT9A 3GEGA 2C2YA 4GVLA 2IDZA 1DC6A 1M6WA 1WLYA 2EWMA 2IE0A 4JP3A 1E7YA 3BA1A 5GZ1A 3UAGA 2BF7A 1X0VA 3OIDA 4HFMA 4PLVA 4FJ1A 5BNFA 4BV8A 2D59A 1B15A 3L6OO 4NFSA 1X14A 3KYBA 2FY8A 1MC4A 4YJGA 5KIAA 4YQYA 1FDVA 3C1OA 4GLOA 3CUKA 3KV3O 2NU7B 3QVWA 4PLZA 3RASA 5JFOA 1EVYA 4RVGA 4BGIA 5HS6A 4D43A 5CDSA 5IFLA 1ZK4A 3RFTA 2V7PA 3S8MA 2J5KA 3ONFA 3EC7A 2P2SA 3CZRA 1LLUA 1LSUA 1NPDA 3GNQA 2HK8A 3U49A 3NT2A 4JX8A 4ZICA 2W2LA 4FSHA 5KVQA 2EGGA 5DN9A 3F47A 3H6KA 5B4VA 2VTEA 4R1NA 4PVCA 4YJHB 2UDPA 1QG6A 1LRLA 1NR7A 4JP2A 4NHEA 3OMLA 4QQRA 3F4BA 2BRUA 3LK7A 1V3UA 2SCUB 3OECA 2J3IA 1KEPA 1XR3A 3QWIA 3MOGA 4W6ZA 3PTZA 5JDCC 4AJJA 1DJNA 4J4TA 4ALMA 5ITWA 3EHEA 1LXCA 2JJYA 5FFFA 4OSPA 1U3TA 1B14A 5KNLA 4CQLB 1FXSA 3X2EA 3W4JA 5DBFA 4GWKA 4PG6A 5IJZA 1RYDA 2OUIA 3FD8A 1I32A 3H5NA 4I5EA 1YQGA 1W0CA 5F1PA 3KSDO 4NI5A 4P38A 4E4YA 4XKJA 5EERA 5HTOA 2J3KA 2IYPA 1C0PA 1GPJA 4LW8A 4AG3A 3K9QO 1MXHA 4R1TA 1TI7A 5JY6A 4L9RA 4UVHA 5JDIA 5GZ6A 4R1SA 4PLPA 1GQQA 3GNTA 5IF3A 1YL5A 3G0OA 4BO1A 3EGOA 3ZWVA 1YO6A 2WWRA 3NAQA 2FSVA 3HDQA 4IDBA 1P1JA 3AY3A 1RJWA 1LX6A 3I9KA 3AU9A 3FPCA 2R2GA 4WCFA 4CQMA 4CUZA 1A9YA 3LC2O 4EEXA 5BT9A 1NVGA 2LDBA 1U9JA 2OBNA 3G79A 1ZK3A 3VPGA 4UREA 3OEYA 4C7JA 1PJLA 4WCFC 3RIHA 5TC4A 1N9GA 3S55A 4DBVO 3PQEA 4ZA2A 3WGZA 3INRA 4IXWA 1FF9A 3DOJA 1J49A 3OICA 4OM8A 4CMIB 3FHLA 4IDAA 4C7KA 3D3WA 5JO0A 4EGFA 4NR0A 1QKIA 3H5RA 3HDHA 1KEWA 4BO6A 3JD2A 4J7XA 1CJCA 3RUFA 1PS0A 3F3SA 1NBOA 4R54A 7ADHA 3WLEA 2B69A 2B83A 3DZKA 2B4TO 3OQBA 4B7XA 1F06A 1HYHA 1PGOA 1RPNA 2G17A 2EKLA 2Z95A 3DZHA 3RFXA 4BNVA 5EQDA 4YDRA 2JD2A 4IDEA 1D1SA 3KYCA 3WGYA 4B3IA 1CYDA 2GRAA 3E48A 3CKYA 2QIOA 1IPFA 1EE2A 1AE1A 1QORA 4TROA 1W4ZA 3KOUA 2CVZA 4KTTE 4ID9A 4E30A 3K73O 4WUVA 5ILGA 1QYXA 3AY6A 1D4FA 1FDUA 1GZ4A 3HHPA 3JQ9C 1AXGA 4XIJA 4L74A 4CM6A 5HS4A 5HRUA 3DEYX 3EY4A 4PVDA 1SO8A 3GMSA 3TL2A 4FCCA 2JCXA 2VOEA 4EJMA 1N7GA 4DA9A 3CIFA 3ZWPA 3E5MA 3E5RA 1P0CA 4RPHA 3VPHA 1ENYA 3ZDFA 1GV0A 4DQVA 3WB9A 2QQ5A 2NM0A 1LRJA 1ISHA 3GAZA 2X9GA 3M1LA 5ICMA 5I9NA 2PFGA 3JQBC 4BMNA 3ZU2A 1U3VA 4NMHA 3UW3A 4KDFA 1P9LA 4PLTA 3HJAA 2BI7A 3OJ0A 4ND3A 3UH1A 3WQRA 5IDXA 2GLXA 3VVCA 1KS9A 1LSOA 2X0NA 4IZHA 3JCZA 2PZMA 1JVBA 3ITKA 2ZTUA 2VUTA 3A14A 1LTHR 1BVRA 3ENKA 3P2OA 4IDDA 3PZRA 5HWSA 4IINA 1KY5A 4WKGA 3RC1A 2NU6A 1QYCA 2C82A 5TJHA 4N5LA 4WLVA 4RPJA 1K2WA 4HUJA 1FDWA 1KEUA 4WNCA 3CE6A 4NH4A 4WPGA 1LDMA 3AOEC 3ZHYA 4EEZA 2DC1A 2CUKA 3BMQA 5F5LA 2NVUA 2ET6A 4DPLA 4J9VA 4WNIA 1ADGA 2Z1NA 1SEPA 3LF1A 3OBBA 1QP8A 4IJUA 4MINA 1V9LA 4ZQHA 3DMTC 4XYBA 3VZRA 3ENNA 4YACA 3QP9A 4FDAA 2PD4A 1C1XA 1P1HA 2XXJA 3ZWXA 4ZQEA 3I6QA 4J43A 3GH3A 1NPYA 4XRGA 2DT5A 2GERA 1E7MA 3RQSA 4PIVA 5CDYA 3LF2A 2WYVA 1G0NA 5L7WA 2X5OA 3NT5A 3ZV4A 1E7WA 2WD7A 4YTEA 3GDFA 5FEUA 2VQ3A 1DHRA 3UFXB 3C3XA 1YKFA 1YS4A 2FPPA 4J4BA 5B37A 4D79A 1BXGB 3NGLA 1H6AA 4W4TA 2AXQA 3GDOA 4EUFA 1PJSA 2B37A 4RJTA 5CDUA 4IY1A 1D1TA 1RYEA 4CLRB 1N92A 3KB6A 4DPMA 3D5TA 4OJNA 2P5YA 3ZV3A 4EYEA 5CG1A 3WWYA 3NJ4A 4GWGA 5MDHA 4L4XA 1DJQA 4K28A 1HE5A 5TRTA 1ZMOA 3PPIA 1PQWA 4BNZA 4BMSA 4GGPA 2BFPA 3KUXA 2H63A 4PG8A 2GO1A 5L53A 3W8FA 1R0LA 4R16A 2FP4B 2FPGA 1L7EA 1XIVA 2GSDA 2PKQP 1H9BA 3OF2A 1XDWA 3O26A 3C1TA 5HBRA 1R12A 1DRUA 1VJ1A 3ZWMA 3VZSA 4FIZA 1DAPA 3I23A 2PZJA 4YPOA 1PGPA 2IEDA 2Y68A 3JQ7A 5TLSA 5G4KA 1NFFA 2Y67A 5B12A 2RH8A 2CF6A 4PG7A 1T4BA 4JXKA 2QG4A 1C1DB 2VRCA 4B3HA 1G1AA 4E5MA 3ASUA 3UKOA 3BTUA 4FGWA 2W2KA 3GVPA 4IGFA 3Q11A 4XDZA 3AFNA 2Z1MA 3TPCA 1E3JA 5A1TA 5GMOA 4BNXA 3OSUA 3UHAA 1VRWA 3O9ZA 1RWBA 4E5NA 1E6EA 1RKXA 3ROMA 1T25A 4RQUA 5FYDA 2RH4A 3UF0A 3WBBA 2QYTA 1P31A 1A71A 4L75A 4R51A 1FK8A 5LCXA 5AXAA 3SLKA 2DUWA 5TF4A 4JBGA 4E3ZA 3PEFA 3U3XA 3EVNA 3ZN2A 3ANMA 1HSZA 4H7PA 3UCXA 3WFIA 4FQ8A 1NAIA 4DREA 1YH3A 3K5PA 2O2SA 2JFHA 2E82A 2BH9A 1K6JA 2BGLA 4CUJA 1HLPA 1ONPA 4U8GA 4M8SA 1XGKA 1MX3A 1YB5A 3B20A 4ZQGA 3JD4A 4IDGA 3ZH2A 1T2AA 5CHEA 3GZNA 4TMFA 8ADHA 2G1UA 1DC5A 3WYBA 3MTJA 3GGOA 3Q1LA 3CEAA 1M2WA 1NHGA 4HWKA 4P4LA 4MVJD 1MFZA 5KJCA 1LSSA 3PYLA 2CDBA 3P2YA 2VT2A 5CP8A 5U4QA 4D42A 4DMMA 3JQAA 3NRCA 2CDAA 2FRDA 4Z9FA 1E77A 4L0QA 5L45A 2Q99A 3WQQA 1I24A 3RCBA 4A7PA 2PR2A 2X0RA 3E9NA 4LSWA 3PJFA 4OKNA 2VYVA 2ZB7A 4R01A 2DFVA 2DQ4A 4HP8A 4HX5A 5DBGA 4RV9A 4JNKA 2NTJA 1DIBA 1TEHA 2Z5LA 4O1MA 2VT3A 5B4UA 5IZCA 5TT0A 3KM0A 3QVSA 2ZTVA 5LDGA 4DGSA 4RF5A 5C7IO 2X22A 2V6MA 4J90A 2OL4A 3C8MA 5CAEA 2W90A 5A9SB 3ADPA 2JCYA 4IMPA 1ORRA 1R37A 4RZIA 4A27A 3HB4X 4YAGA 3U5TA 3OJLA 1EBFA 2X1HA 4H3VA 1E5LA 3EZLA 1MV8A 2O3QA 3MTGA 4UVGA 4BHTA 1P1RA 1YL7A 2CFCA 4XGIA 5JS6A 3U4CA 1E5QA 4P8RA 2FR8A 2FHSA 3L6EA 2J8ZA 4WASA 2GN4A 5IDWA 2O3TA 2P4HX 4I9NA 4ZJUA 1GPDG 1UXHA 5CG2A 4R3NA 4M87A 1QLHA 3AY7A 4Y98A 3WJ7A 1I10A 4RLHA 4Z6KA 2JD1A 4E32A 3IKVA 1P74A 4MIOA 5CEEA 1HL3A 1VL6A 3VPSA 1PJ2A 4J7UA 1UXGA 2P9EA 3R1IA 4YJHA 4ALIA 2VHWA 1ZW1A 3ITDA 4K9DA 5I8ZA 1T1SA 3BAZA 3E6AA 1OC2A 1K6XA 2NSDA 2PZLA 1DRVA 1YL6A 5ITVA 1EBUA 1J4AA 3VPFA 4I5GA 5TGDA 1QMGA 4OXYA 4UVDA 1JDJA 1HDGO 3HADA 3WWZA 3JD3A 1VM6A 4MKZA 1ZSVA 4XQCA 4YRBA 3A06A 4NJMA 5G4KB 3JYQA 3IMFA 4KTVE 4E5KA 2O50A 2O3UA 5C5IA 1I33A 2OZPA 3O8QB 4MVJI 1KVUA 1Y7TA 1L1FA 1GYPA 2OOSA 3OQ1A 4EW6A 4PGFA 5KVCA 2EEZA 4F45A 1X15A 4M1QA 4IXTA 4YJFB 2YYYA 1Y81A 4BB5A 5KTKA 1RM5A 1AXEA 1PGJA 1A4UA 5DF1A 2VNSA 1LDBA 1CEQA 2D3TA 3W6UA 3FNEA 1GUZA 3OEWA 5A9TA 3BZUA 2Y0EA 1T2CA 4PN3A 3PWSA 1PJ3A 4N5NA 1ZJZA 1FDSA 3PJGA 4XEHA 1ZMTA 1PZHA 1T1RA 2FWMX 3NJ8A 3F1LA 4KWIA 2D8AA 4AJLA 3GY0A 3L07A 1UZMA 1ENOA 4AJNA 1KC1A 2BGKA 5U9CA 3K31A 5BSEA 1N8KA 3JYNA 1E3IA 1UP7A 1DRWA 3EDMA 3R3SA 5JCJA 4B7CA 5L9AA 4I8XA 3FN4A 5A02A 1YBVA 3ZWBA 4WEQA 1NHWA 2EP7A 4LVUA 4BO9A 3T7CA 1LDNA 1SNYA 3KEOA 3DL2A 4GPD1 3I52A 1JWAB 4YQZA 3WQSB 4CLEA 1DB3A 1P44A 4BO5A 1HYEA 2GZ3A 3HSKA 4FOSA 2HMVA 3TFQA 3WFJA 1ZK2A 4Z0HO 5L40A 2PLAA 3HZZA 4NFYA 4WJZA 4WE3A 2YDXA 3MWDA 1CRWG 5BSGA 4LGVA 4I9UA 2DFDA 4CMEA 5K9ZA 1W8DA 3T4EA 1A7AA 4OOFA 1LUAA 3LT2A 4DRYA 3P19A 1VJTA 3RBVA 4FJ2A 3AI2A 4YBZA 4BMVA 5IG2A 3W8EA 3ZWWA 4PLHA 5F3RA 5JDIC 1HDCA 4E31A 2EHDA 4BKQA 4RDIA 2Y99A 1GV1A 3BIOA 3TQHA 3CMCO 3KO8A 1B0AA 3WDSA 1Y6JA 3ULKA 1WP4A 3RUEA 4MP6A 5DP2A 3RAJA 1Q7CA 4YT4A 4Q3AA 4GGOA 2FPIA 4CQLA 4BNKA 1B3BA 1Q7GA 5KJFA 1HDXA 1MA0A 2FMUA 1PTJA 4I08A 3ROKA 4GH5A 3QV1A 4B79A 1UXJA 1YQDA 4S3MA 1BWSA 2AG5A 3PYMA 3VKVA 3IJRA 4E33A 2AEMA 2Y1OA 1I0ZA 4IPTA 4U5QA 1T24A 3RKUA 3P5SA 4CM8B 1ZZEA 4XA8A 3WR5A 3CMMA 5ER6A 4B4OA 4IMRA 4ND5A 1C1XB 4B8ZA 3TZKA 1EZ4A 3TL3A 3DTYA 2NUAB 2AG8A 2EF1A 2Y93A 3VDQA 4YT8A 4A5OA 1DAOA 5T67A 2I3GA 3NX4A 4BNWA 3ZU5A 1R4NB 3I9MA 4A2CA 1PX0A 3GQVA 4CQMB 4EBFA 5L4LA 5G0UA 2I67A 3OETA 1PS8A 3WMXA 2NU7A 2QHXA 4HBGA 5C3MA 3JQCA 4TRRA 4WEOA 3IUPA 4PRLA 3D64A 1WVGA 3OM9A 1SEVA 4HKTA 4WLNA 3TJRA 3WMWA 3JQFC 1DLJA 2NU6B 2V6FA 5AYVA 3DBHB 4LCJA 2TMGA 3FNHA 1ZCJA 2CF5A 3ONEA 1N2SA 4JN6B 2IXBA 3JQBA 3FI9A 3GGGA 4M49A 3BMQB 4DYDA 1WDLA 2B36A 1EUZA 1NR1A 4ND1A 4AJIA 4Y8VA 1CERA 3DBLB 1LNQA 4LRSB 1U28A 2EJWA 2VHXA 2ZJ1A 1PU2A 4D0SA 3MCVA 2YHIA 1PJCA 4W99A 2HK7A 4NQZA 3K30A 1F14A 5G2OA 3C24A 4MVJM 3HUDA 4NNJA 3Q9NA 5K0ZA 4J2OA 3BYZA 4Z3KA 1EVJA 3RJ9A 4ROSA 3QVOA 1DPGA 1GYRA 5JC1A 4LMRA 4BO7A 1T2DA 4MOWA 2NLOA 1P3DA 3GVHA 4NK5A 1M75A 1A4IA 4RGBA 4NPCA 4MPDA 5TJ9A 3QSGA 1LDYA 1ZNQO 2JHFA 2VRBA 1ZK0A 2H6EA 1HE4A 2FPPB 4CLHA 3WTCA 3WXBA 3RJ5A 2E6UX 1X0XA 4G5HA 4DQUA 3K2EA 4CM7A 2P9GA 3I3OA 4D41A 1WAMA 3GRKA 3MEQA 4BQPA 3DOOA 3RVDA 4XB2A 1M6HA 4XQGA 1HDYA 2ZATA 5JY1A 2OFPA 1AHHA 2BLLA 2DM6A 1ONOA 1WWKA 2J5QA 4GX0A 4HNHA 4KOAA 1ULSA 1SCUB 2FZEA 2X5JO 4YVFA 3PRJA 4RVSA 1H6BA 1E0DA 3HB5X 3D4OA 5L7YA 4ALKA 4FN4A 3PVZA 3JQ6A 3FF4A 5IDQA 4CV2A 3PHLA 1KERA 4N54A 4BKPA 1HEUA 4MVJP 4PLFA 1YXMA 4Y67A 3TNLA 4II3A 1AHIA 4BOYA 1J6UA 3I9NA 3DR3A 3OHSX 3PDUA 4J0FA 1U2GA 1NAHA 4Q39A 3JQ7B 5JPIA 2DBRA 4R41A 1P0FA 3HN7A 4C4OA 5DBIA 4PLCA 4Y6PA 3TOZA 2OP1A 4E21A 1H6DA 3RBZA 3ORFA 2GUGA 2W8ZA 4J7CA 3WOHA 2X6TA 2OP0A 1LLCA 4PCVA 3GC6A 4DWVA 1JAYA 3A9WA 2HMUA 4HADA 4XR9A 3QLJA 2GF2A 5FWNA 3GHHA 1HDZA 3V1TC 3DHEA 3GVCA 4IIVA 2GASA 2WDZA 1WPQA 3L9XA 1Z7BA 2YY7A 4QEDA 1LQTA 4CMBA 3DZJA 3Q2IA 2A9FA 4DC0A 3WNQA 1ID1A 3D5QA 5KJEA 5IXYA 4AICA 1EUDB 1X1EA 3NDJA 5ER9A 1LC0A 1BXKA 1YQXA 3H2ZA 5CAEB 3LT4A 5L7TA 5I7EA 1G0OA 2GN6A 1R4NA 2I65A 5IAAA 2GGSA 3U09A 2A4KA 4WLEA 2DPHA 2QZZA 2R6JA 2LDXA 3V2UA 1EVZA 2VHZA 2G82A 1LBEA 1X7DA 2VCYA 4YRAA 3GLQA 4MKRA 5JMWA 4U0KA 4XYLA 3F9IA 4CL3A 2FR1A 1O95A 2CMDA 3OJOA 4J6FA 3Q2KA 3L77A 5K6AC 4XGKA 3N7UA 4K6FA 4RZHA 4AJ4A 4BGEA 3MZ0A 2NVUB 3WIDA 3I6IA 4ALLA 2PV7A 4UUNA 4PZCA 4BNGA 4ALNA 3WSWA 5EPOA 5EQFA 3NV9A 3WS7A 3E1KA 4F46A 2X4GA 3DZBA 2NWQA 4J1SA 4QT0A 4UUMA 1DLIA 4A03A 1OBFO 2RIRA 1CQJB 3D0OA 4OH1A 2Q1TA 3ZHBA 1E6UA 2X7HA 1GL3A 3WYCA 3DHYA 3Q6IA 4MO2A 5KCZA 3TFOA 2WYUA 4R1UA 4RLSA 3ZW9A 2W2LD 1PQPA 3RUCA 4GVXA 3F1KA 4FW8A 4NJMB 2RHCA 3MJ4A 3UICA 2G0TA 4GL4A 4XCVA 3O8QA 2Y0CA 3ON5A 3B6ZA 4RORA 3DOCA 4FB5A 4UULA 4JJGA 1K6IA 2EP5A 3ONDA 1BGVA 3WYEA 5L4NA 4IIUA 2W2KB 4RF2A 3LC7O 2JAPA 2GN9A 3DFUA 4N7RA 3AM4A 2Q1SA 2YQ4A 2QZ9A 4E2XA 3PI7A 4D0RA 2BFMA 5CEFA 3E82A 1AGNA 4CLRA 2X23A 4NBWA 4YT5A 1O0SA 1QYVA 1KVQA 5T8KC 1BHSA 3BMNA 3DXFA 1I3MA 4LSMA 4KWHA 4XB1A 3I4CA 5C37A 4PFJA 4D3DA 5BSFA 2EV9A 3K92A 3VAZA 2ZQYA 5A4DA 1TXGA 1WNTA 2GR9A 4XZ3A 1P1IA 2NQ8A 2WSBA 3AI3A 3BMOB 2ZYAA 3SJ7A 3KTDA 5T5QA 3ADOA 4CM4B 1KVTA 3DHNA 1MFPA 1S7CA 1NQTA 3LU1A 1BTOA 1MGOA 1HDRA 3L0DA 2Y05A 1BG6A 3KLPX 4R5HA 4B8WA 3F46A 3NDIA 4CLOB 2FSSA 2PK3A 4KDEA 3A1NA 1HLDA 4G65A 4DYVA 5EN4A 5TIIA 4HV4A 2DBZA 1ZVMA 1P77A 2PH3A 3I83A 1TLTA 1F8GA 5THKA 4CM9A 2AQIA 3ZNOA 1CQIA 3NUGA 2UV8A 3TZQA 3ZCXA 2YJZA 3A4VA 6LDHA 2C07A 4O0LA 4MP8A 2OMEA 1ZH8A 3DTTA 4O6VA 2VWQA 3KZVA 1EE9A 1HE2A 2Q3EA 4CJXA 1C14A 5EJ2A 3IKTA 2PGLA 3GDGA 4BL5A 2PD6A 1HRDA 2XF8A 1IHYA 1HXHA 4PLWA 3IJPA 4YCAA 1Y9AA 4HFNA 2G76A 4BKRA 3PLRA 1BSVA 1ZSNA 1ZEJA 1A5ZA 4INAA 1SZJG 2PTGA 2VZ8A 3N74A 2YV3A 3UOGA 1DOHA 2DKNA 4N5MA 1UP4A 5JW6A 4OHUA 5FI5A 2Q2QA 3PWKA 3H65A 1KETA 3IIEA 4L8VA 1I8TA 2AQKA 2NNLD 3NYWA 2Q1UA 3S2IA 3HDYA 1JWBB 2ILTA 3EUWA 3KBOA 4IZIA 4KUEA 3R6DA 2X9VA 3LLVA 4R9SA 3JQ8B 4D3SA 5ILOA 1GAEO 3VTFA 2J5RA 2JCVA 3B1KA 4GKBA 5HM8A 1ISMA 1UJMA 3ZI0A 2PY6A 1YBAA 4ONEA 2PGDA 4OQZA 3DBRA 4FR5A 4WCDA 3K2BA 1DBVO 5JSFA 4ITUA 2YFQA 3GZNB 5A05A 4O5OA 3H9GA 4CR7A 1QXSA 4KZPA 4BNTA 5A03A 5COQA 3LC1O 3V2HA 1PWZA 1XLTA 2HSDA 3H7AA 4IJWA 3JYOA 1GCUA 2HDHA 3TZCA 4CQMD 1A72A 5ES3A 2O3SA 3NTQA 2GZ1A 2HRBA 3NGXA 4W7IA 1X7GA 2IYOA 3ROPA 3NDRA 3U4DA 3E18A 2HKIA 1GUFA 4OAQA 4W7HA 2DU8A 1IL0A 3RC7A 1KY4A 1U1IA 5I9MA 4CMKA 4IQGA 4OYRA 1U7HA 2NADA 2X5KO 1PQUA 4KP7A 5KJ1A 3VZQA 4BNFA 2E48A 2C59A 1ZJYA 1EVIA 1EUCA 4W82A 3KETA 1YBMA 4CV1A 1BRMA 3FWNA 4GX1A 4BO0A 1IB6A 4Q9NA 3TZHA 1UUFA 2DTDA 1IHXA 4BO4A 2J3HA 4DVJA 4EZBA 2A94A 4IS3A 3U4IA 5L51A 4OXKA 3UFXA 1UAYA 4JK3A 1E1MA 1E3WA 1GDHA 3I4FA 3RU7A 4MIYA 2PZKA 2WMDA 3VDRA 3W4IA 1F8FA 1GR0A 3G1UA 2B5VA 3WGIA 2GPTA 1H94A 2WM3A 1WDKA 4GMGA 1ISJA 4TZTA 1MC5A 4M55A 4UVEA 4W9NC 1IY8A 1YB1A 3IP3A 2HLPA 3GK3A 3AJRA 1VC2A 3E8XA 2NU9B 1JKIA 2ZTMA 3IQDB 3MWDB 1KVRA 1VKOA 5L3ZA 1A7KA 1GTMA 1B8PA 5T8KA 5KWEA 2C29D 3BHIA 1D3AA 3L4BA 3EVTA 3F5QA 1NP3A 4R69A 5DOVA 1DEHA 2J3JA 4RVHA 2C0CA 4O59O 3RFVA 1KBZA 2EW8A 4J0EA 5JCJD 2D1YA 4QFCA 3BHJA 1XELA 1CF2O 3EZYA 1PSDA 2WEKA 3WGOA 1NFQA 2O7QA 5AVOA 2PNFA 1C1DA 3F5SA 2PWZA 4EJ0A 2JFGA 2QRKA 2EW2A 4J16A 1BW9B 2CSUA 4P4GA 1LQUA 1DIAA 2C5EA 3S2EA 3PHJA 1VSVA 1EEHA 4CM8A 3SJUA 3H9QA 1EDZA 3I1JA 4YA6A 5U1PA 3CPSA 1PL6A 1MG0A 1UDBA 2HMSA 3UVEA 1PGNA 4MVJF 1JA9A 1UH5A 1XEAA 4KQXA 5I7FA 3QRWA 4GMFA 1OMOA 1EK6A 2Q4BA 4QSMA 1YB4A 3M2TA 4A73A 1SCUA 3PIIA 5EL0A 3ZWOA 4DL9A 2Y1CA 1DFIA 2VYND 1LDGA 4ND2A 3SEFA 2JD0A 1HZZA 4E2ZA 3D1LA 1GCOA 3GHYA 3IS3A 4U6QA 1FDTA 1T4DA 4NU5A 2ZKLA 3FCOA 3PWZA 1ZUD1 3GUCA 3WBFA 3V1UA 3DAFA 4IDCA 1I2BA 3P7MA 1MP0A 1P33A 1Z73A 2W4QA 4ZN6A 3HQ4O 1JTVA 4NIMA 1V35A 1ENPA 3SXPA 3DMYA 2VUUA 5JCXA 3ZWNA 2GNAA 3DBHA 3C7DB 4CR6A 4J1QA 2O7SA 3OIFA 3ROQA 5AXBA 3LT0A 4QO8A 1H6CA 4CMHA 1U4OA 3B1FA 3AM3A 3D3EA 2E4AA 4P22A 4RF3A 1VL0A 4YAEA 2GCGA 2HCTA 1I2CA 1UXKA 4J9UE 1GUYA 1WZIA 2YDYA 1FJHA 3VOSA 3DAPA 1ISFA 2Q2WA 5JE8A 3ZGYA 4G2NA 4RVDA 4DLLA 3JQAD 5G0SA 4E5PA 2O23A 3G17A 3WG9A 4BKOA 3H9JA 2NV6A 5JXWA 3UUWA 2DBVO 1K3TA 2C54A 1JN0A 4OOEA 3V1YA 3Q9UA 3TOXA 3DZGA 4CLXA 4GSKA 4QUKA 3PK0A 5ADHA 1Y9EA 4KUGA 4L76A 2W98A 1ZFNA 2A35A 2VWPA 1A27A 6ADHA 4JJIA 4RL6A 1TVEA 1VI2A 5JDCA 3GG2A 3TN7A 1HT0A 3MOIA 2NU8B 2P91A 4BVAA 3GA0A 4L4SA 1QRRA 4ZGWA 1B7GO 2E37A 4E2YA 1CWUA 4BNMA 2C7VA 3G3EA 4LN1A 4J91A 3E9QA 4TVOA 2DTEA 4JBIA 4AFNA 2ZJ0A 1R0SA 4ZQFA 4CM9D 4DIFA 4U0JA 3GAFA 4BO8A 3QQPA 1UP6A 4ILKA 4HXYA 2FOIA 2WTBA 4NBRA 4E0BA 1XU9A 2YQ5A 4E2WA 2P9CA 1O8CA 3RUHA 5B4TA 1NVMB 3GF4A 4EJ6A 2NQTA 1TT5A 3AOGA 4U6SA 1WMBA 2VYNA 4PRKA 5LC1A 1QV6A 2IEBA 1CQJA 4Q3BA 5TT1A 4YXFA 4M86A 1E3EA 3VH1A 1U5CA 3BTSA 3PZBA 5I9LA 2RHRA 1OZAA 3NT4A 4WLUA 5L95A 1BMDA 3JQEA 3LT1A 2C20A 4ALJA 2OORA 1SB9A 3LLSA 3ETEA 2EJVA 3PGXA 1LLQA 4FFOA 2XAAA 3MJTA 7MDHA 4HNGA 5DCYA 1K0UA 2Y1FA 3C85A 3ZW8A 2IODA 2O4UX 3TZ6A 2C2XA 1V0JA 3JQGA 3E9MA 4KUHA 1UR5A 3BMCA 3F6YA 5DNAA 2NVBA 4AJKA 4DPKA 3ANNA 3PIDA 2VHYA 1HTBA 3QIVA 3H3FA 5DCUA 5JLAA 3RUDA 4DLBA 3MJSA 2FPIB 3FBTA 9LDTA 1XKQA 5T64A 3OH8A 4IS2A 4FFRA 3W4KA 4AJEA 3MJEA 4IJVA 3TDKA 5ICSA 3GNSA 2O4CA 4CR8A 1VJ0A 3S2GA 1YRLA 1PR3A 3CSDA 2EKQA 1R4MA 5TS3A 1CIVA 4CODB 2EXXA 4WGGA 1HDOA 1NVTA 2X9NA 4FFNA 1TA4A 4JROA 3RUAA 3GT0A 5T6BA 5COAA 4FC7A 1ARZA 4IGEA 4A10A 4CM5A 4GX5A 4XD2A 4UAGA 4CL8A 3V2GA 4FJ0A 4EDFA 3GUYA 4CLOA 3OP4A 2VNAA 1U3UA 1NPTO 1B16A 3OFSA 3HFSA 4FC6A 4OGWA 1W73A 4GLLA 2ZB8A 5G4LA 3AUSA 3DDNA 5BNIA 4Z9XA 2HJRA 2NTNA 1P1KA 1SMKA 2DVMA 1NTOA 2B35A 4K6CA 4QX6A 1Y5RA 4AJOA 4CM1A 2YFHA 2JAHA 4HFJA 1PL7A 4LISA 3QWAA 2ZYDA 3HNPA 1B8VA 2I99A 1EUDA 4CUKA 1BDMA 2EG9A 4RF4A 2O3JA 3WSVA 3GN1A 3PXXA 2O3RA 5EIOA 4CPDA 1VLLA 2JFFA 3DO5A 3QY9A 4BB6A 5A9RA 4JJFA 4GQAA 4GI2A 1I36A 3HE3A 1P1FA 3FWZA 3DWFA 4BGUA 1XA0A 4OIMA 1XQ1A 4XYGA 4AJ1A 1SC6A 2TMDA 5JNLA 5F1OA 3V5NA 1GQYA 1ML3A 4IDFA 4B4WA 1M66A 3KSZO 5GZ3A 1PJBA 4TVBA 3TWOA 4I1IA 2H5LA 2BMAA 1QSGA 3VPXA 5BQFA 2NUAA 2UUPA 1ZXLA 4DIOA 1DFGA 1YVEI 2P68A 3D4NA 1EFLA 1Q1NA 1EFKA 4JLWA 4DIBA 3DMTA 3X2FA 3JQFA 1KC3A 4LVCA 5EESA 3UGKA 4OL9A 4PLGA 2B5WA 2D5CA 3ZWYA 1R6DA 4WECA 5TX7A 1VPDA 1YGYA 3KSUA 4XRRA 2FZWA 2WE7A 1R15A 2GD1O 1NX6A 4JGBA 1E3LA 3U0BA 2AA3A 2CNBA 5FF9A 3PQDA 4Z0PA 1E1LA 4CM4A 3AUAA 1GY8A 1GEEA 3GR6A 5I7VA 1PL8A 3VC7A 1U7TA 3GEDA 4XX0B 2P4QA 1XSEA 3VZPA 1SOWA 4Q3NA 1BXZA 3E03A 4OXNA 2HK9A 1SB8A 1V3TA 4HFRA 4TRJA 1GFSA 2VTDA 4YAIA 3C1AA 2V6GA 4Q3DA 1V3VA 1NM5A 2O48X 2RAFA 1CQIB 4W9NA 3CINA 5AOVA 5IN4A 2Q49A 1B2LA 3AFMA 4NZ9A 3KYCB 1AN9A 3SC6A 2H9IA 4R68A 3FSRA 4MKXA 4QO7A 4OMUA 2AQHA 3ST7A 1YJ8A 1DIRA 3JQDA 5GY7A 4BS9A 5I8WA 3PYXA 1QYDA 2R00C 3WTBA 3H2SA 4AJPA 2AQ8A 1YJQA 4WCFB 5K6AA 1XG5A 4D45A 2AE1A 2B4QA 4TWRA 4P4NA 5KVVA 3PQFA 1MXFA 3OQ6A 1HSOA 4MJLA 4QXMA 1JW9B 1F12A 1QYWA 1SPXA 2Q46A 3PJDA 1X7HA 4J3FA 2IRWA 4TZKA 3ZZNA 2I5PO 4D3FA 1IZ0A 5H83A 4TSKA 5HA5A 4BIIA 2Q45A 3BMNB 2CVQA 1DC3A 3WGHA 2HRZA 2JHGA 3RKRA 5L4SA 1LC3A 1HF3A 1FMCA 1ULUA 1OC4A 3QW2A 4DUPA 5IDYA 2GDZA 4BNYA 2VYVD 2OBYA 2I9PA 3BMOA 4GBJA 3TSCA 3VH3A 1GZ6A 4NU6A 1IULA 3HWRA 1CETA 1PEDA 1O6ZA 3L4SO 4Z3DA 2Y66A 4OO3A 4CMAA 4J4HA 3RBXA 1C3VA 1LA2A 3WNVA 2QRLA 4H16A 1DIGA 4FS3A 4Y6RA 3WGGA 1Z45A 1E3SA 2X86A 1GD1O 3IC5A 4KMSA 4MDHA 2Y1GA 3ICCA 2IZ1A 1YE3A 4FD3A 1H5QA 2ZB3A 5DOZA 3RSHA 1NWHA 1BW9A 1Y8QA 2NACA 1PZEA 2IXAA 4Z9YA 1N7HA 1JLLB 5KVSA 2ZQZA 4R4JA 3M1AA 3QA9A 2A92A 1Y8RA 1D8AA 4LK3A 4U7WA 3BHMA 5JO9A 5TQVA 3WICA 1I30A 2X8LA 4JBHA 5H81A 4UEKA 3I5MA 4YRDA 3COSA 1B3RA 4RPLA 4IJKA 4JCOA 1O89A 1M76A 2R00A 4NBVA 4BNUA 4CM3A 4A0SA 3JTMA 1J5PA 2DUUA 1YOVB 2HO5A 1NASA 3SBOA 3VTZA 1MUUA 3H9EO 3GZ4A 1EQ2A 2ZCUA 5A04A 2PD3A 4DLAA 4J1TA 2ZB4A 3DBRB 3QWFA 2QRJA 1XCBA 2XXBA 3JV7A 3PFFA 1BXGA 4YWJA 1UXIA 3DZIA 1N5DA 1AUPA 1U8XX 2YW9A 1E7SA 3M2PA 2G5CA 3PP8A 1WDMA 4J2HA 5JAQA 4BGVA 4CV3A 1P45A 3I9LA 3GEMA 1XYGA 4ND4A 5TNXA 1I2ZA 4EUEA 2VWGA 2O2YA 5B1YA 3IUSA 3FPLA 4D44A 2YV1A 1E7QA 2Q4EA 3JQ8A 4TKMA 3EMKA 4FGSA 2HUNA 1OFGA 5IN5A 5TSDA 2I6TA 1T2EA 3BTVA 5ENVA 3K6JA 3EYWA 2FPGB
chains in the Genus database with same CATH superfamily
4B6RA 1M1YE 1GRRA 1YQWA 4E15A 4D8YA 4DC1A 4F6CA 5JAPA 4F4JA 2NUPB 1X80B 3NEAA 5HGXA 4BNHA 1DAMA 3NNDA 1TK9A 1L7RA 4OFWA 1I5RA 3E2MA 4GSYA 4JHLA 4ZREA 3WWDA 3GJ6A 4JI7B 3EEOA 1YZYA 2IYYA 3O9MA 5LR6A 2Q9CA 4KR2A 1JKXA 3OCZA 4QTYA 2RKBA 4DQXA 3N3BC 3P8ZA 3T9CA 5KOIA 1GYQA 3TZLA 4GX2A 1B8UA 2YJTD 3AI1A 3IDSA 1HE3A 3M82A 3Q7IA 4RPKA 3ORQA 4YP5A 4IIJF 4QYXA 1AMOA 1E5TA 2Z6AA 3ZZ1A 2E49A 4I36A 3E61A 4HWGA 1SQ0A 3DL0A 2WJWA 2WYWA 2QJTA 4DKXA 4J0GA 3Q8MA 1CRLA 2WVGA 4M89A 2BBOA 1Q7RA 5BWLA 3ZBQA 1RACA 4OHWA 4V0LA 1E1DA 1MVLA 4WZAE 4X41A 3GD5A 1UJNA 5A71A 5A5FA 1PWXA 3KL4A 3AVQA 4N18A 3NPAA 3CX7A 1EXVA 3ZDXB 1L5NA 4KLNA 3R5FA 4PZ9A 4M1SA 3SZLA 4B17A 2HA5A 5KMGA 1DIHA 3C1UA 3NWBA 1I4WA 1SKYB 4Z8XA 1WXDA 1XFDA 3GJQA 1UXOA 1QCYA 2Z2JA 2HA0A 4FOOA 1CJUC 4TQGA 5DZSA 4J3NA 1XDGA 3QUTA 4EG8A 2LIPA 5AK0A 3AX6A 2FWJA 1BDJA 3FUUA 4CFYA 2MJLA 1HETA 3EAFA 3PFHA 2JLSA 1YB2A 5LMZA 3AKZA 1KDOA 3LSYA 3MB5A 3NV7A 4ZC1A 1A5SB 1U1DA 4IQ0A 4XSVA 1G9SA 2PQ0A 2QTCA 3KYDB 1R0RE 1B73A 5SYMA 5A0FA 4HDMA 1L4HA 3L1KA 4LYAA 3R3HA 4FUQA 4CEJB 3FPGA 1NI4B 1GO2A 4FXPA 2GX6A 4NCNA 3GLRA 3N59A 5CDFA 5A3JA 5C7OO 1TQ2A 3I0ZA 1ZGAA 3JARA 4HY3A 3WJ7A 3QKSB 2F3PA 1NUHA 1LLDA 5T57A 2F9LA 3ETDA 5CPBA 5JSKA 3HYLA 3LQFA 2FG7C 4O4HA 4N9WA 2ANBA 3DF9A 2MSLA 4K9LA 2DECA 1DEXA 2FPOA 3E58A 1TNDA 2GZSA 2PKYX 3VVBA 2F8LA 1WOMA 3DF7A 4FI3F 1NW9B 1VSBA 2YN4A 4MYCA 2UXCB 1JLLA 1G5TA 2Q62A 4D4JA 4EX7A 3D3NA 4IIHA 4K26A 1IDOA 3UCEA 3BFVA 2GEDA 2WVHA 4UDNA 1IOLA 3EXHB 3K72B 3KNZA 4KQGA 2CXQA 2ECOA 5T4HA 2VOJA 1CVLA 3K9HA 3GCZA 4RTOA 3G1TA 3AKCA 1ZOSA 1L5QA 1PL0A 2OCPA 3C3YA 3DQQA 3SQNA 2ZEJA 2A5YB 1T10A 3IQFA 1PNVA 1W85A 3DBVO 4HDKB 1Q50A 1E7RA 4HXFB 3TZBA 4RNCA 4RVUA 4LXUA 2VBFA 2Y1DA 1JKFA 1GPUA 1VMKA 4FPXA 4LRYA 5EVJA 1SKYE 9LDBA 1PWEA 2JI8A 4KWCA 1SBNE 1DKOA 3IAHA 2HADA 3RARA 5DMHA 1UK6A 1NW6A 5LOVB 4CHTA 2GJ8A 4H7JA 5E2IA 1X87A 2HPHA 4GO1A 2FOLA 2ORED 4FR2A 2C88A 3Q0EA 1K3UB 2DAPA 1JVSA 2AC4A 2WFLA 3B48A 1WUJS 1NWCA 4FZVA 3CTMA 4B4VA 4B40A 2P2YA 1HNNA 4PGMA 1P81A 3D4PA 5J59A 3RNLA 1UAAA 4ARCA 5B7NA 4MLZA 1E0KA 2XB4A 1ZUNB 5FUVA 3ZU3A 4CN8A 1D9XA 3K1AB 3ZXSA 4BNLA 3G6KA 1QIFA 3GLUA 1KR5A 2OLJA 2WD7B 3EOZA 2QP9X 3NIFB 5L3RA 5F5NA 3T7EA 1TYBE 3MMSA 3NBAA 4EEKA 1BDBA 2ZJYA 3C4JA 3NP9A 3TQIA 5K8UA 2I9KA 3IOYA 1RS0A 4MTLA 1LEHA 3JWJA 3MJCA 1T9GS 4CBVA 1IPEA 2VFAA 4DOMA 4IQ8A 3N28A 3JVUA 4M54A 3VX4A 4BASA 3PLNA 2W48A 1FP4A 3ICVA 1H9AA 2WK1A 4TOIA 4XIIA 5F9MA 1CJVC 2V4UA 2FEMA 3ANLA 3MTAA 3ROFA 1PWHA 2R66A 5DP1A 3JQ9A 1ZXBA 3GFGA 5CH3A 2CZCA 1PIWA 1YJXA 2CDCA 4IIFA 3TEFA 1M1YB 3FLBA 5CPFA 1KJ9A 2B78A 3QHQA 3UXYA 3VKGA 4KQCA 3C3PA 2AEJA 2P5UA 5IUJC 2F55A 4UCFA 2PRZA 4B3JA 5J23A 2O8NA 1JR3D 2JATA 4DBZA 1UZAA 1QFZA 4LQLA 3UN1A 4H15A 3URMA 3V4ZA 3JSAA 4D8TA 1RLTA 3O1LA 1PJ8A 2PH1A 3RSZA 2QAIA 5LA6A 1UEJA 3KUKA 1IHUA 3EQ9A 3SSMA 1PUXA 2ZE5A 3A9UA 2QRMA 4G5YA 2VZ9A 4TM8A 3BREA 1N5IA 3HC7A 2RCYA 3JVEA 3PHIA 1OD6A 1PR9A 1C0LA 3UK7A 4ZRMA 4D80A 4UTPA 1X8LA 1I7LA 1WKVA 1XZNA 4WOKA 2I34A 4CKYA 4XIGS 3KELA 1JIJA 4FKBA 5BY2A 4TZ6A 1KO7A 4JBNA 4D8XA 1AG9A 2N9UA 3NU1A 4GE3A 1D07A 3AWDA 5B12A 1U2DA 1Y3DE 3K0HA 2R6FA 1ZOLA 4BNJA 1FFXA 2SHKA 2VC2B 1N8NA 4WQMA 5KTMA 1TT5B 2J48A 2JI9A 2PUTA 3OPNA 3B1JA 3EW7A 3AETA 3IAS1 4CV0A 1O5IA 3GP5A 4BVBA 3STHA 2F43A 3WHPA 1N9GB 4QLBA 3FRIA 5KTTA 1RLMA 4ZAGA 4Y9DA 1FFYA 1OWPA 1Z74A 3ANYB 4AKTA 4DG9A 2HSGA 2JFNA 4UUPA 3H9UA 5A4JA 2HXSA 4TLEA 5FWYB 3WYFA 3M9LA 3PD1A 1EAMA 1OAAA 3KZMA 4YAOA 3KRTA 2W9XA 4KO3S 5BSKA 5F7JA 1FIUA 2OV2A 2WJPA 4JS0A 5JYEA 2ZJAA 4M0PA 4HVCA 2ZPAA 5FJIA 3FOFC 1X77A 1E9SA 5TF0A 1U2GC 3T5PA 1MA3A 1ECFA 1SHLA 1W6UA 4C1BA 4J1TC 2BGWA 3FNIA 5DGTA 4CMCA 2POQX 2UYYA 1G6KA 1TM2A 1XQVA 2X58A 3OJFA 4DNXA 2W8BA 4ECAA 1F0YA 1Z28A 1KEKA 3IAEA 3UMGA 1JFLA 4LTDA 5AQ1A 2ZCJA 4R81A 4PM4A 4JXZA 1MOSA 2MR5A 4YEDA 4DAOA 1ORDA 2NZ8A 2WWTA 3HMKA 2YCBA 2E4YA 3HJGA 2KWIA 4IDQA 4QG3A 4V1CI 1DO8A 1USGA 3F4LA 2J6IA 1A9ZA 1LPBB 3PNQA 1AQUA 2HIGA 3KPVA 3UJ6A 2GK4A 4RE5A 3K96A 4ZQCB 5HQ3A 1PJQA 1MJHA 2P35A 1V6AA 3O8DA 1GZUA 4FDUA 5F23A 2X40A 3B5EA 3T7DA 3KJIA 1K7XB 1T2NA 2IIQA 2X0IA 3I5AA 4PG4A 5HKOA 1H66A 1IEQA 4FDTA 3UWPA 3RS9A 3A4TA 5IH7A 2XCSB 3AEYA 5E8RA 1JB1A 2EDCA 2OG1A 4HDRB 1EFPA 1KARA 2OO5C 2I7XA 3BVPA 2H2AA 4CMGA 3B1ZA 3LPNA 4EA6A 4Z9AA 2WJVA 4H6WA 4KAXA 4B5LA 2MOKA 2BFAA 1LRKA 2RGYA 2Y9MB 1ZNYA 2RKOA 1G9TA 2NPFA 2JFBA 5HDQA 1SUPA 2QD1A 1X7ZA 3O9VA 4QTUB 4CWAA 5C9ZA 5JSHA 1N1DA 3QWHA 3K05A 1V39A 3IUNA 4DV0B 2GPJA 2O8DB 3Q9SA 1I7NA 4HAOA 3ETGA 2FPUA 2AXNA 3GN2A 5FBHA 2E4ZA 4PXYA 3ZH9B 2YWXA 1N9ZA 2CLDX 5K0JA 1LJ8A 1IBSA 4R3WA 2IX3A 3QWBA 1I4LD 3FPEA 1AV7A 2VLIA 3K94A 2K2QB 5A4AA 4MVJE 4RWEA 1E2KA 1P1CA 2ZK7A 4L4RA 1I94B 4LMPA 1PUIA 1JQBA 1NVDA 3BCRA 3BERA 1HBJA 1MEOA 1OX4B 4L72A 4TKLA 4B71A 1F1BA 4UTRA 5JCOA 4N0QA 3AP3A 1YWGO 5F1KA 4AJ9A 1Q14A 5B1EA 2BHSA 3O38A 3UAOA 1Q83A 5C8XA 4MHTA 1A5TA 1ZN2A 3AILA 2VS1A 2YWEA 4YBRA 1WXIA 2VRNA 4ZDJA 1WW3A 2V65A 1M0EA 1Q1GA 1PGQA 2OTCA 2WSSD 1BS2A 1QC5B 1QVRA 2G7MC 3FNGA 3O4RA 5K4AA 2V3CC 3UMMA 4QNMA 1DKRA 2VHVA 3C8DA 4QELA 4XFKA 3RC2A 4D7AA 1W0KA 1NQ5A 4J16C 4NQRA 4U8HA 3LTNC 4IDHA 3TTXA 4H4DA 1E92A 1J9EA 1H2BA 2SCUA 1D2NA 1ZNWA 1E2MA 2OZLA 3DTVA 3HFGA 3PTLA 3NWPA 4UEOA 1M7BA 4G4SP 4UFOA 1MG5A 4YCSA 1XMOB 2ZYGA 3L7YA 1LSJA 3PDHA 4FR0A 4JT4A 4YY3B 1HFWA 1Z0FA 1IAVA 4OMCA 1P9WA 3H86A 3HY3A 3H3JA 3BN3A 2P40A 1E3DA 1NXQA 3OLXA 1TJ3A 4M9CA 3LCRA 3ND9A 3DWEX 4K6KA 1A7JA 3V8VA 1ZKDA 1O5TA 2ID8A 1L7DA 3DLTA 4WOJA 1NUQA 1VYVA 4RTNA 3BIJA 3CPEA 1ZKMA 5JOQA 2COEA 2GBLC 1EBBA 1BN6A 1WZEA 1ZHOA 3QBDA 2WF5A 1WLSA 4NBUA 4PO8A 2AHRA 1ZIDA 4K1LA 4NEHB 3IQWA 1G7TA 2R85A 4MVJA 4G5GA 3LDFA 1A1SA 4UKDA 4YRJA 2YS7A 4ZDKA 1XRPA 1W5TA 1JDBC 4MUEA 4JI1B 3OZXA 3VHRA 3FPSA 5JWOA 5KKCA 1U0RA 2XGGA 2IYUA 5AKLA 4BNNA 1PJAA 4A2PA 1ONNA 1Z68A 1XZFA 2Q1WA 3NORA 3D6TB 3PGJA 4PFQA 3RIXA 3RROA 3PJEA 3FPAA 4AMVA 3RU9A 5AW2A 3FHJA 1ZJJA 1JDSA 1PE0A 5EVCA 3EOBI 4MXDA 3GGDA 4M36A 1N5MA 4W7SA 4EI2A 1UZLA 5DI3B 3U7GA 3AIIA 3W5UA 3DA8A 4PNEA 3WIVA 2IYXA 1UWKA 4Y2TA 3L6CA 3W9UA 2O05A 4R71A 5IT0A 5CVDA 2NZJA 5CW2A 2CV2A 1DC7A 2YHIB 5BSMA 3E3OA 3L04A 3D6HA 1BMTA 4CZ2A 4YCJA 2FYTA 2C7GA 2XUGA 3C4VA 4MS1A 1A4XA 4LY6A 4O63O 4ZMSA 5DH9A 5DM2A 4DLZA 5JAIA 3KV1A 3OFJA 1ABEA 5JI2E 1OZHA 1FNCA 3VR2A 1JGTA 2IU0A 3PVCA 2ECPA 3U4GA 4LJRA 1K2VN 4NK4A 1JU4A 4CMIA 4O33A 3DVAA 1YTLA 2I4IA 1RM4A 5CDGA 1UINA 1ZVQA 1E60A 1Z07A 2K6GA 1XD2A 2ODTX 2EGHA 2JF0A 2QJWA 2VPIA 3C7AA 2C3UA 1SCBA 4H60A 4PRYA 4Q9LA 4I7EA 3HVIA 4AG5A 5DCWA 1JJBA 3TLJA 4D3ZA 4UU0A 2DERA 2D1SA 2QN1A 1DXYA 1WE2A 4EUHA 1U28C 2ZVPX 2W00A 3O31A 4B2IA 2A9RA 1ZEMA 3L6DA 4YIKA 5SV2A 1D2RA 3ZG6A 4AJHA 4B9EA 2BYTA 3OA0A 2R6ZA 4EOGA 1KZ1A 4PSDA 3AF4A 4L2IB 1HI9A 3BA1A 5F2OA 5GZ1A 2O5EA 4KV7A 4HC4A 5L8VA 3QX3A 1Z0ZA 2BF7A 1UPUA 1X0VA 2HIHA 4MJXA 2JJ2A 4MYUA 4BEBA 4DXAA 2J41A 2CLKB 3RTGA 4URWR 2Q9BA 1WV1A 3EVCA 5JTTA 1K75A 2O5VA 2XKJE 3B9QA 3VUEA 2XQVA 4S1WA 2W2TA 8AT1A 1X14A 2CGEA 2HCRA 2N42A 4GLJA 2FY8A 3R7NA 1YRWA 3R0ZA 4LDAA 3MPUA 3A6ZA 2XCIA 4S35A 1MC4A 4UQOA 2FEKA 2BR4A 3CX4A 1NUUA 1L1QA 4RW0A 5EG5A 3JZMA 4YQYA 3INNA 1YZ3A 4GLOA 5H9WA 2HW8A 1BWQA 3CKKA 4Z4QA 1W44A 1DAIA 3LOUA 4GZ3A 2QTMA 1C4XA 3RASA 1SG6A 3HA3A 3TI7A 1JG4A 3C3DA 1JEOA 3LUPA 5HS6A 4BGIA 4JT8A 3IBFA 5AM3A 5CDSA 3TX6A 1JSXA 2XWJI 3TTVA 4KR3A 1ZK4A 3S8MA 3ONFA 3GJZA 2A5DA 4TXJA 2P2SA 2CEKA 5BQ3A 5FLXA 5LSAA 3GNQA 2E5WA 3HCOA 1L7PA 1LVUA 3AF1A 1TJYA 4F38A 2ZE6A 3RBAA 5KVQA 2QN2A 2ZAYA 4KBYA 1IBLB 4HMQA 5DN9A 4JR2A 1OBCA 5HOQA 1M10A 5B4VA 2A33A 4EY8A 4R1NA 4ZCRA 1QPBA 4HOYA 3OLVA 2BM9A 1NR7A 2JFZA 2GEVA 4JP2A 1TOAA 2B30A 2VSFA 3DXXA 3OMLA 4FDMA 3F4BA 2R87A 2BRUA 4WFQA 2J3IA 4KE6A 4WOCA 3O8RA 1KEPA 2D3WA 3K6RA 1XR3A 3EEFA 2VP3A 1U6IA 3LMKA 3PTZA 4KXXA 4AJJA 3O6VA 4FOPA 1G2PA 2VXYA 4Y2SA 1GRNA 1YKSA 4X45A 1GRCA 4JXJA 3WK6A 2IUTA 1KPIA 5KNLA 1FXSA 2WDPA 3DVQX 3GROA 5FYQA 3W4JA 5DBFA 1W5EA 5A7GA 2H1IA 3SIPA 4OTZA 3QUCA 3R75A 2NSLA 3FD8A 2L2QA 1PD0A 2Z56A 5TE9A 3JWIA 3WRWA 3T7JA 1P4GA 5FT9A 5DYIA 2QQEA 5EJ9A 5ALHA 3C6XA 4KPFC 1SN7A 2R7AA 1Z4LA 5LQAA 1TI7A 5DHUA 5JY6A 1D03A 1DWQA 3BRWD 4UVHA 2P6OA 2CB9A 3QA3E 4PLPA 4CU2A 3N5KA 2FJ0A 1N36B 1BJTA 3WZMA 3G0OA 5EIEA 2FN3A 1YO6A 3IODA 1B42A 3SPXA 4R8MA 3AY3A 1IVYA 2DLNA 3N0RA 1FFSA 3NHKA 4NDAA 5DN6A 4C08A 3T6KA 4EG6A 1KBOA 2ZRNA 2QR2A 2R2GA 4CTKA 4CQMA 4V03A 1Z63A 2KPOA 4I55A 2H31A 3LC2O 4EEXA 1RWNA 1NVGA 1XLWA 3LXRA 5JMTA 1UQTA 5EE0A 1N3IA 4UM7A 5LZ5A 3EGIA 1PJLA 5K3AA 3ECCA 3N8KA 3C5VA 2RBGA 2ACVA 2A59A 1WOYA 2X2OA 4HLUA 1E8DA 1OILA 1WP9A 3QITA 4QUIA 4ZA2A 3GJ0A 4OI1A 3S55A 4BYMA 3INRA 1EG7A 3I72A 3C3BA 4RY8A 2RIPA 1FF9A 2XQFA 5D1NA 1Z9BA 4P93A 4IF4A 221PA 2C92A 1AIPA 3DVAB 3NR2A 5BVGB 1L5VA 1KEWA 4BO6A 3IXLA 3NHZA 1CJCA 2OHJA 1PS0A 1QMPA 3AHIA 3C5EA 3WLEA 3L6RA 5L3VA 3AQIA 1I9GA 1T1JA 2Q5FA 2IGTA 2W2PA 2B25A 2WC1A 1GQSA 2WWVD 2COKA 4NOMA 4EPWA 4JI0B 3OQNA 5BN4A 3VNUA 5B6PA 1BYIA 1ZS9A 5EQDA 1B6RA 2QORA 4OU5A 1L4KA 4JJ8A 3K0SA 2MT9A 5BYJA 3VR1A 5FX2A 4F4UA 1K7YA 4PBTA 3KYCA 4L2IA 2RGCA 2OD7A 4CTNA 4LV6A 1CYDA 2ZAMA 3E48A 1MIHA 1CY7A 2FPRA 1IPFA 2PZ8A 5GAJA 1Y6GA 3VGJA 2WU4A 5I47A 2IF0A 2CFSA 2FPSA 4LZNA 3R7WA 4KTTE 1X9IA 3H99A 2BJVA 3AZPA 4HWOA 3VSEA 1QYXA 1RABA 1D4FA 1E2IA 1FDUA 4AULA 1XMSA 4XIJA 4KPEC 4MV9A 3MOSA 5HS4A 1A2KC 3LGSA 1G2OA 5KINB 2BJHA 2GAFA 1A8PA 3CX8A 1KZGB 5HRUA 1KKLA 1R50A 2PX6A 2NP7A 2IA5A 4BJ1A 4HAIA 1RWWA 4JA0A 2VOEA 4EJMA 4BCCA 2VAVA 3DKPA 2WICA 3CIFA 1DS6A 3ET4A 4G0NA 3ZWPA 3E5MA 1KRHA 3E5RA 2BY4A 3AHHA 3GGCA 3MLAA 4II7A 4JJ6A 4KQMA 4N82A 3BXOA 4JLBA 4NOJA 5K01A 2O8EA 5KQMA 1F4VA 5LOVA 4FE7A 3HA5A 4MARA 5ICMA 1O94D 3IVAA 5I9NA 4IIBA 3U9TA 1EJBA 4YP0A 4ADSG 4JX9A 5A5GA 3HO8A 3KOXA 3P5BA 1KKUA 3QPBA 4KDFA 4TMYA 3EA5A 1U8UA 5CJ2A 1YASA 2O2EA 3HKCA 4H7DA 3BFJA 1KDZA 3USES 3K9BA 3WQRA 2H4FA 1O8BA 4DABA 3NHMA 4EA7A 1I7DA 2VDUE 2PZMA 1V7CA 5CFMA 1RFGE 3UAZA 2XQIA 4QAJA 1V96A 2VUTA 3A14A 3WLLA 4ENQA 4P2BA 1ZISA 5BOVA 4IDDA 5EXPA 3L0BA 3MD9A 3U80A 3D31A 4C2UA 3CKMA 1BS1A 1YMQA 2Y1WA 3DE3X 3K0FB 3KKKA 4J03A 3V46A 4TZ0A 1DTSA 2DUJA 3BIXA 5IJ0B 3AHDA 3BRWA 1CUBA 3E70C 2QQFA 3DDWA 3GRRA 4RPJA 4AKGA 4HUJA 1FDWA 4ZOEA 2NXJA 2GPAA 4MUXA 3ZHYA 3ORYA 2CUKA 9ATCA 1QTNA 1GU1A 2H1FA 4QVKA 3AR8A 1KTVA 3FMIA 4O4HB 1XNHA 1EFDN 3AY0A 4Q7EA 5D85A 4NCAA 4MQUA 1ADGA 1UEIA 4W1PA 1R9GA 5AO9A 5IABA 3HVRA 4DRZA 1A2BA 2QUBA 4UPVA 1V9LA 4QD3A 4DNFA 5IK2A 3WP1B 3SR4A 4EMBA 4FDAA 4OFBA 5CB0A 1C1XA 2ZSAA 3OQIA 2VF5X 5C32A 3ZWXA 2WMYA 2JGEA 4BCBA 3KG2A 1GGFA 2DPYA 3IQHX 5DYGA 4L07A 4MYTA 1ZICA 3A36A 3PL1A 4A0QA 7REQA 4GUAA 4J43A 1IWOA 1JXQA 2V9CA 3GH3A 2QTFA 3GLVA 4O4JB 3B9PA 1FS5A 4PIVA 3RQSA 1HDIA 1ICIA 1LBTA 3NEJA 3G89A 5K0GA 3X0DA 3KZXA 5KYUB 4YRLA 5GM2A 3SHWA 1AKEA 1MAVA 4YCMA 2J9XB 4D79A 3FUVA 2QK4A 5HKKD 2PKXA 4JBYA 3KU4A 5JNVA 3HB7A 1T8WA 3LUAA 1D1TA 1Q57A 1KRWA 1GTJ1 4GLFA 4ARZA 4CLRB 2JIPA 1N92A 1NBHA 3LD9A 4BZZA 2TS1A 3D5TA 3ZV3A 3NP7A 4CI0B 3LKBA 5C1PA 2QN8A 3A32A 3KEMA 3NCTA 1DJQA 4ITVA 4UATA 1ZMOA 4CKBB 2LRHA 1ZR4A 3BF7A 1DXHA 2P9ZA 3ECAA 1Q0SA 4WCVA 1UMCB 3NBYC 4PG8A 2H63A 4BV2A 1JSZA 4EB6A 2QZSA 2VHUA 3IFSA 1S02A 2FP3A 4JU8A 4UXHA 1WHSB 2D62A 1SBCA 2PRKA 2GSDA 2PKWA 1H9BA 4JUAA 1XDWA 3ADKA 5HBRA 3W6NA 5E9WA 1R12A 1VJ1A 1XZEA 3OPQA 2BT4A 5ALKA 4QICA 3F71A 3I23A 3HL4A 2NAPA 3OZVA 4EW3A 2Y68A 1AURA 3BXZA 5TLSA 1ZMRA 1VL1A 5G4KA 3A6JA 4C0WA 3M81A 3DR5A 3MJFA 3EXG1 4PG7A 4YJ3A 5J2UA 1R8XA 1W7AA 4L6IA 1E2PA 1GTG1 2P9BA 2Z3WA 3M6VA 1MQ9A 1UWCA 2ZRGA 1C1DB 2Y4OA 3HCPA 4K8RB 2X13A 1G1AA 1L5HB 3PEVA 5C81A 5DXAA 1KYXA 1YD7A 3ASUA 1AHNA 4MEAA 3EPKA 3BTUA 1KNXA 2YFKA 2ZIFA 3NHYA 4FGWA 4PYIA 2Y4NA 4JDPA 2W2KA 4Q3LA 4TYMA 3DFKA 3Q11A 3KQLA 4XDZA 3LY7A 2Z1MA 3BXGA 2Q8QA 2RHDA 4GKJB 1GPAA 1Q77A 1NG1A 3TPCA 1XZIA 3CX6A 4ARAA 4D9HA 5H0IA 3P94A 3UHAA 3O9ZA 3TOSA 1RLOA 2WAXA 1UBRS 3UK0A 4HK4A 1XZPA 3ROMA 2WSIA 3EXEA 2VTBB 2V7XA 1T25A 4LXXA 3UJHA 4JYCA 4WAUA 3HUEA 1QG2A 4PYQA 2C9DA 1C9DB 1AZLA 4KAAA 5CYOA 1A71A 1WF6A 2AI2A 5H02A 4NV1A 2BM8A 5LBIA 2Z6QA 3H2BA 4LHXA 2BKLA 2ECQA 2DUWA 3OZGA 2FETA 3D8SA 3PNMA 3QELB 3CNHA 4RBNA 3UIEA 3U3XA 3MTBA 1Z6GA 3WB0A 1HSZA 1IHDA 3MGKA 1XTVA 2J1LA 1NBEA 1O97D 5DISB 1TKAA 2R8ZA 3W7BA 2BH9A 1K6JA 2C9YA 3UY4A 1BD4A 1C7ZA 1THGA 4U8GA 3T1TA 4LBZA 5DB4A 3BRSA 2YNMD 4DC9A 1GL6A 4EY4A 1ZD2P 5ESRA 1WVIA 2QP4A 5IMSA 1MX3A 3CCBA 2X3UA 3B20A 2J59A 3F0TA 4IDGA 3B13B 1W94A 1YMUA 2WHQA 4LJ8A 5CHEA 5KYYA 4TMFA 2X2EA 1DAGA 1GNVA 2JBAA 3FCEA 4L5YA 4UAUA 3WYBA 1DC5A 4UNIA 1RYBA 3B51X 2XZDA 2CXOA 3CB2A 5DWVA 4FLFA 1R4ZA 1KGDA 5DM1A 2KJQA 3PYLA 3ZV7A 2CDBA 1OLSA 3NHWA 3P2YA 5CP8A 2O2JA 5KUTA 4YCCA 4S24A 1CEXA 2CDAA 2CHGA 1E77A 2O06A 3ASYA 4Z9FA 5JARA 3SYKA 1JT2A 1R6BX 4BNDA 2UVPA 2Q99A 2Q28A 4I1SA 3WQQA 1WS6A 1EDEA 2VF7A 1WW2A 2PR2A 4DUGD 3X1XA 2WFZA 1W30A 1SIUA 2OV3A 4JQSA 4UM8B 2YXLA 2XCLA 4LSWA 2VYVA 1IIRA 2F2TA 1C80A 4R01A 4WGFA 1W36B 2ZZNA 3OF5A 4RV9A 1OGIA 2NTJA 1OYYA 2QE7A 4D0LB 1AA9A 1DIBA 2JJ1A 2Z5LA 2VT3A 3GFFA 4O1MA 1VSQA 1DWPA 4W5HA 3X1JA 4JI6B 3SS9X 3QIAA 2QT9A 1QF6A 3QVSA 4JC4A 4F9EA 1ONSA 2M6RA 4FN5A 4J90A 2V6MA 3ZD8A 2OL4A 1U7PA 2IKQA 3HRIA 1J23A 4H7EA 4OAPA 3IIKA 3EGDA 1ORRA 1R37A 3NIWA 2YXEA 4A27A 2QT0A 3H1PA 3SP1A 4UU1A 5EJ6A 1P3JA 4BX2A 1P62B 4DB4A 1N78A 1WMDA 4K9MA 1J8YF 4TXLA 4LJ5A 1OJLA 1GPH1 3MTGA 4QL3A 5EKTA 3TUIC 2O7RA 1WTCA 4JL8A 2ZM6B 4R1OA 3U4CA 4HUTA 1XPJA 4TKVA 2FHSA 2PX8A 3DAHA 2OQ2A 3L6EA 5CCEA 1AUOA 3GAAA 3TG8A 1Y7PA 4DV4B 2O3TA 4ARIA 2X1MA 3I9V1 1M5UA 3AP2A 2XUKA 5GOZA 3C6KA 1SVKA 1FEZA 5CFOA 2C1XA 4A16A 1GGEA 1I10A 1NL3A 4EHHA 1HY3A 4Z6KA 4HLCA 4P35A 2R9VA 1FYXA 3KQPA 2CLIB 2ZZMA 2BDUA 3CV3A 3O0DA 4CKEA 1P74A 3KL2A 5TGTA 5LLDA 1KAHA 1GPYA 1UKAA 2R6AA 1UBOS 2P9EA 4TXNA 4GLBA 3RW9A 5DLDA 1AK9A 2IEAA 5CK4A 1TO2E 1ZITA 4ZU6X 4K9DA 1T1SA 4YGYA 2WJHA 3E6AA 1T8RA 4L15A 4A1OA 5I7AA 3DTVB 3T5GA 2Q6IA 3F67A 1EBUA 4KIFA 2X6QA 1MT3A 3ESAA 3PPXA 3I30X 1BC5A 2HSZA 5FOQA 4C30A 3HEAA 2ZUSA 1QKKA 1QMGA 2ZU6A 4OXYA 1HDGO 4AYTA 4AKSA 3HADA 2IH5A 3JD3A 3ASZA 1S1CA 4YRBA 5D1HA 3IMFA 5C8VA 2O3UA 5JCZA 1DRJA 1WSWA 3NGMA 1JHXA 1Y7TA 2BF4A 2PZFA 4Q18A 2PRYA 2BP7A 2OOSA 4PGFA 4RZ2A 4B31A 1QH9A 3DD5A 4GOND 4M1QA 4IXTA 5DNCA 4JYAB 3RS0A 4LJSA 2WG1A 2WM8A 2JAOA 1PGJA 3OOEA 4L3OA 5JI3E 5EMKA 1RXEA 5SY6A 2VNSA 3UC9A 3W6UA 4ZGBA 2QDXA 3L4JA 3ISVA 5A9TA 2VNIA 3VTAA 4AUNA 4C0BA 5MFPA 2Y0EA 3RYCA 5EJ8A 3IT2A 5EKXA 1CVRA 1XDBA 3L1JA 1D4AA 4G8DA 2ZR7A 4O4LA 4R2XA 5E6SA 1NM5C 2M98A 5JJIA 4HH0A 4J0JA 1PZHA 1QHNA 1T1RA 1XN4A 3NJ8A 3L7OA 5K0TA 4KWIA 3WLPA 1M0WA 1X19A 4M1WA 3LXMA 1AZWA 3GJXC 1N8KA 3HR8A 3ILVA 3JYNA 4DV5B 4ZT6A 2AMJA 5LDDC 1UP7A 2Z2ZA 1G20B 2J33A 4MRMA 3UTCA 2ON6A 4KQKA 1Z5OA 2D54A 5A02A 4YYEA 3QXJA 4FEGA 4HB4A 2W6NA 5AFSA 5T7BA 3TW4A 2EP7A 3GJ4A 2HX1A 2KLBA 2R1VA 3KR2A 1ABFA 2OECA 3PUXA 4G4GA 4MYRA 3T7CA 2G1PA 1WPRA 3H42B 1JWAB 3I52A 3OTGA 1MB0A 3EZNA 4BO5A 2JCSA 3HVKA 4YR7A 4WACA 2HMVA 3E9EA 1C3OB 4U2CA 2MSDB 4LYGA 5DI3A 3RSSA 5D8DA 3I04M 2P6NA 4WJZA 4QNRA 4ZYXA 4KHPB 2YDXA 3A1WA 5B3KA 2JK1A 1Z0UA 1RHMA 3LWNA 4ZO4A 4CDNA 2Q3FA 4JLPA 2DFDA 3QV2A 4PIMA 4FNMA 1P2SA 1W8DA 2C2GA 1A7AA 2BVNA 2RGNC 4OOFA 4AKEA 4EF6A 5CB4A 3ZJUA 2SECE 1VJTA 3U1TA 2QG6A 5AHRA 4EAQA 5IW8A 5IEBA 5C8YF 3W8EA 3ZWWA 1DJLA 9GPBA 5F3RA 5JDIC 1HDCA 1M2KA 2BEVB 3QTLA 3MILA 1GV1A 3Q87B 3MBKA 4D9CA 3CMCO 3IILA 3WDSA 4CM8A 1QONA 1Z0AA 3IE0A 3ILHA 4CTOA 1NZDA 5E4YA 3A7DA 2WZQA 1T3TA 4XGQA 1H2RS 5AVSA 5JRDS 4C03A 1J00A 3IPLA 4YT4A 1DX4A 4GGOA 4KFCA 5AI0A 2RHBA 4BVKA 1B3BA 3UA3A 1U1GA 2VH5R 5KJFA 4HRAA 2QF7A 5ANRB 5EIHA 1HDXA 1MA0A 2QY6A 3OPMA 5FR1A 1PTJA 4IOKA 3QKUA 5ESDA 1RKUA 3NYRA 5ALSA 3QV1A 3ROKA 3ZX4A 2YWFA 3GEHA 4S3MA 3IJRA 2G0NA 3L7NA 4IPTA 1TAGA 4MR9B 3EZGA 2WAYA 2H07A 4GF5A 4OBBA 3RKUA 4D97A 4F04A 1NF9A 5IT4A 1OAOA 3RFUA 2X19A 4BDTA 1LPNA 1LLFA 3B9RA 5A3QA 1RXIA 5F35A 2BHTA 5FPHA 2H18A 5K0LA 4UOQA 2YYZA 1ODCA 2NUAB 2XH8A 4YT8A 3UPUA 2I3GA 2YWRA 3NX4A 2Z98A 1L5LA 3ROXA 1D5CA 1FZQA 2X5NA 3FBWA 4A2CA 1PX0A 4G07A 4MQBA 2DR0A 3GAMA 4X91A 3TR6A 4B74A 2XRMA 2B1IA 1ZRNA 4FGKA 3HKBA 2P67A 3OD1A 2OFXA 2W2QA 3QENA 5ECWA 1FRZA 3IUBA 5JJ5A 5REQA 2F48A 1A9XA 3J81A 2ZYSA 3D64A 1T5BA 4ARBA 5E7IA 4WLNA 2P69A 3QVJA 3WMWA 3ZHQA 1NV9A 1RU3A 2VJCA 5EP3A 5AYVA 3O2NA 3FJ1A 5KYVA 2NZXA 3U6BA 1Z5WA 2TMGA 3CN7A 4DQ0A 1J06A 1PG0A 1LF5A 3GJSA 4LZAA 1ZINA 3ZEIA 2IXBA 2Y6UA 1XC7A 2ZRDA 3U7FB 2B3TA 3HFRA 3T3OA 4PX3A 3RRFA 1XAIA 1SC4A 2B99A 2PLFA 2ZJOA 3D7KA 4PYMA 3Q9LA 4ND1A 5FCDA 3VR5D 4EY6A 1LNQA 3GRCA 1U28A 2EJWA 2VHXA 3M6LA 1X92A 2IU3A 3QF4B 4D0SA 4EMTA 2YHIA 8ABPA 1VFPA 4IRXA 3OWXA 2FDXA 4B6GA 3VKHA 1YULA 3GGSA 1CY2A 2QN6A 3CF0A 5JFTA 4OI4A 5IHXA 3K30A 4K9QA 2EKBA 3C24A 3B52X 3C41J 3Q9NA 3R0QA 5H1YA 3F97A 4EH1A 9ABPA 2QW1A 2IW3A 3KWJA 4JUDX 1EVJA 3F74A 1NLFA 3RJ9A 3GT4A 4ZOQI 4AY2A 1GYRA 2BDTA 5FOWA 2VPQA 4BO7A 3OY7A 1PVDA 1UIMA 1INLA 2NLOA 3GVHA 2QPAA 4XSHA 2C5FA 4BWFB 4TV9F 2P1ZA 3W2EA 4JP1A 4Y2JA 3TAUA 3RAFC 4RFVA 2HNBA 4OP3A 3JAKA 1KI4A 1RZUA 1SXJA 2H6EA 3K70D 3DUFA 3FY4A 2WYOA 2EFEB 4NFLA 1TQHA 1NP6A 2DQSA 3EVFA 1ZUIA 3QBTA 5IVDA 3OZEA 4B3TB 5JU6A 2WJGA 1QF7A 2LR0A 2AI1A 4X8LA 2EC5A 5KNBH 4BV3A 5KREA 4GX0A 2C7QA 3MUNA 2J5QA 3O75A 4X20B 1XZCA 2QX8A 3IULA 4FMDB 4B3DA 1E66A 1SCUB 5F77A 4YVFA 4WN9B 1SIBE 1H6BA 1E0DA 1R74A 1DAHA 4LHEA 5H3CA 3BK2A 3FMFA 3D4OA 2PS0A 3G8AA 1IXKA 1DTEA 1SQSA 1NF2A 4ZODA 5K20A 1G8KA 2OK7A 1OTHA 1LPAB 1QK5A 3LCCA 4ID3A 4J0HA 4CV2A 3AF0A 4E3WA 3UA4A 4L0MA 3L06A 4XVUA 3DW1X 2FUG1 1G20E 1CR1A 3BDAA 1YXMA 2PPVA 1I9CA 1QVWA 2AXPA 4GRDA 1SKAA 3KZCA 3HCBA 4IHJF 4X6UA 2XKBA 4CDRA 1IFXA 1J6UA 3I9NA 4L9SA 1YV9A 2WP8J 3DR3A 4N01A 5LQMA 2WILA 1NAHA 3H19A 1J5EB 2E2WA 2RGDA 3JQ7B 5JPIA 5MFZA 3DT6A 4GWLA 3QE9Y 2V7GA 3G2LA 4H0CA 4F2WA 3VNBA 3TOZA 1TCAA 4BJ6A 4K7JA 5K3FA 2GUGA 3IEUA 4LSGA 1P5ZB 4J7CA 4PCVA 2VSYA 3GC6A 3I92A 4I4LA 5I9TA 4AKHA 3PNPA 4CF6A 4P31A 3X1DA 1YR9A 2HMUA 4XR9A 4Z51A 1YQTA 5F51A 5I5EA 3DM5A 3GHHA 5ALRA 5MN6A 3DHEA 3GT3A 3CJQA 1Y9DA 4FLEA 5CYPA 1XE3A 4QEDA 4U9HS 1QIHA 1Z7BA 2WOOA 2LCIA 1V3QE 2ZSBA 3ER6A 1JG1A 2WYHA 4MYDA 1WBJB 4ND7A 5KJEA 4BXOB 2QV7A 5IXYA 3IBYA 3U48A 2N1MA 4OH7A 1P2GA 3ICWA 3PC8A 3WLQA 4PAOA 3PTAA 4G8BA 2ODAA 5ER9A 4MR7A 1QE3A 5FOUA 4KRFA 1JR6A 1I2MA 3GLIE 3WLHA 2CE2X 1YQXA 3M6AA 3MT0A 4DSTA 5I4IA 5F5XA 4M88A 1F2UB 4EGSA 5JZBA 5L7TA 4LJ6A 1SUFA 1PFGA 1UFRA 2WYIA 4YNBA 2XVYA 5D5HA 4DJEC 2PUEA 3G85A 2C31A 3PC8C 5JXGA 4WLEA 4JYZA 2PKEA 2IKSA 2G83A 3AESB 4U7HA 2HWUA 1WQ1R 3G0DA 2G82A 3B38A 1X7DA 2VCYA 2B8EA 3COPA 1IQUA 3I2YX 4BEVA 2C84A 3KQMA 1ZRHA 3G9ZA 4O2LA 1DJMA 3BKWA 5EE1A 2R0QC 1E6MA 4UM9D 2FR1A 3MRSA 4TL7A 2CMDA 5E2AA 4C20A 4CL3A 4YCNA 4J6FA 1UM8A 3IRVA 2FPWA 1PP4A 4A9AA 3GRAA 2L0XA 4ER0A 3N7UA 2CHQA 3JXEA 4LE1A 2AV6A 3EXIB 4K6FA 3THXB 3LSTA 2DHCA 2V6JA 3BIWA 3N2LA 2NVUB 2FR8C 4QDXA 4REQA 3RS3A 4CT0A 3D6VA 3QXHA 4ALLA 2PV7A 1TW2A 2CHFA 3ZJVA 1J90A 5EHNA 5EPOA 5BV2P 4X93A 3VNVA 4N3BA 2ETVA 5FQOA 3V4SA 4PO9A 4B6OA 2QX6A 1GCAA 2NWQA 4Q0MA 4QT0A 2FWPA 2O1SA 3GXBA 1OBFO 5ALVA 3UXEA 1AA6A 4RZXA 3L8EA 4L8GA 3FKJA 2IF2A 4NRDA 1UFOA 4KMRA 3ICQB 3MN1A 3ZGXA 3WYCA 1FTQA 1JSLA 3Q6IA 2CLEB 4ARSA 5KCZA 5DWDA 2WYUA 5FA8A 1TTHA 4J0DA 4RLSA 5HOEA