4MS3B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the endogenous agonist gaba
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
418
structure length
408
Chain Sequence
b'PPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWECLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/agonist
total genus 146
structure length 408
sequence length 418
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms3B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms3B01
1JX6A 3SY8A 2R4QA 2GKGA 3OM0A 5CHYA 2PL1A 3LUCA 4ZPJA 2A9RA 3VNAA 2NZVG 1QNLA 4EY3A 5JS1A 1I3CA 2DRIA 3SM9A 4ZMSA 4LZLA 3O2SB 5TQ0B 2FLKA 2I6FA 4W5TA 1ZVVA 3OO0A 5C5CA 3HDVA 4MS4B 3DLBA 1AB6A 1ABEA 1M5UA 1EAYA 2JCGA 3GRCA 3OQNA 1DCMA 3CZ5A 3H5TA 3CG4A 3FFTA 1USKA 2FEPA 1P6QA 2OQRA 3F7NA 4L85A 3O1JC 4EVSA 3HEBA 3Q9SA 5IUJC 2MSKA 1NXWA 2HQOA 3RVRA 4Z9AA 2FMFA 3H75A 1A04A 3N6VA 2QXYA 4YO7A 4F12A 1NY5A 4IILA 4WXMA 5TPZA 1D1PA 4ETMA 1P2FA 1YK1A 1Z16A 2E4ZA 2ID7A 3OLZA 3EDCA 2L18A 4M88A 3VNBA 2F8SA 3LUGA 1NTRA 4MR8B 1RXEA 3MYYA 5KC9A 1JDNA 1Z2DA 1ZGZA 2CHEA 3FFWA 4Z9BA 1C0EA 2FEKA 3HV2A 2FTKE 3UK0A 2CHFA 3JY6A 1MVOA 3DGEC 4F06A 3G1WA 4KK3A 4G86A 4KVFA 4MR9A 1R8JA 5GQSA 2E4WA 3MIZA 5KQGA 1U8TA 4W5OA 4LRQA 3KHTA 5IC5A 3O1IC 2E4XA 3RVNA 3EQ2A 1USIA 4DN6A 4S04A 2CD7A 4ZYLA 2LBPA 3NNDA 5EWLB 5TQJA 4QICA 3W9SA 4WUTA 3OQOA 4TMYA 1LJLA 4LX8A 1ZESA 3GL9A 1JWLA 4RSMA 3C3WA 1URPA 3SAJA 1KRWA 1DP4A 1QKKA 1Z18A 3N0XA 5DLEA 4FE4A 4HNQA 3CS3A 3C6QA 4YGXB 4HNRA 3ILHA 3RVSA 3T95A 3QLTA 5FBHA 4YS6A 4XASA 1DC8A 1SXHA 1T34A 4S05A 4G97A 4RY0A 3C97A 4D6YA 1M2FA 3KYIB 4D6XA 1EWKA 4G0PA 4Z4EA 3IP7A 3RH0A 1QQBA 1PNRA 4XFKA 1FQWA 4Z99A 5PNTA 4NCAA 1DRKA 4G0MA 1KGSA 1ZHHA 2PMCA 1ZITA 3H5VA 3RVKA 2FN8A 3KJXA 2WB4A 4YP9A 4OBBA 4MLCA 2WMYA 1EWTA 2JRLA 4MQFA 5DGCA 4JP1A 1XHFA 4RK0A 4JB2A 5B3JC 4KPYA 1UDRA 4GNRA 1YS7A 3LTEA 4KRFA 1CEYA 3JPYA 4NICA 4H3KB 3LKBA 2F8TA 3IP9A 3JVDA 1Z12A 1Z17A 4TN5A 3QX9A 4NV3A 4O1IA 1PUXA 1EFAA 3O2JA 2FQWA 4F3TA 2FQXA 3LKVA 3QEKA 1SXGA 3HJFA 2FKAA 1VLZA 3ILYA 3CTPA 5JS2A 4W5RA 4MR7A 4Q6BA 1CHNA 4RK7A 1M2EA 5TE9A 1GUDA 3DLHA 3Q7SA 3TMYA 2A9PA 4F8JA 1TJYA 3M6MD 4N47A 2J48A 3F73A 1JYEA 2PAFA 3N0WA 1MIHA 2PJUA 4H60A 3T8YA 1M5TA 1YMVA 4EGSA 4Z4IA 2MSLA 4JA2A 1TVMA 4IMIB 4LE2A 4MAAA 1ZAYA 1DBWA 4MYRA 4RS3A 1SD5A 4E7OA 2L19A 2JK1A 1JLKA 4N41A 3KYJB 4MLDA 2M98A 2QW1A 2A9QA 4Z0NA 5B3JA 5ABPA 1XHEA 4YCSA 3D02A 3M9WA 2E4UA 3N75A 4MS3A 5IEBA 4MR9B 4TLMB 4ZMRA 2LP4Y 3GV0A 3KG2A 3O1HB 3ROFA 3FDFA 3UUGA 4PEVA 1GUBA 4WZZA 1QO0A 3GWGA 4G0ZA 3NNNA 3QLVA 4PE5B 3RVQA 4EYOA 1J56A 5F64A 3QX8A 4QYWA 1VKRA 3CRNA 1BDHA 5TPWA 4H3HB 2P9HA 3SNKA 1JL3A 4NCBA 4IMJB 1ZN2A 4RXTA 4N76A 1TLFA 1NXXA 3OM1A 1ZH4A 5EWJA 5CNMA 1BDJA 2IOYA 1E6LA 5I4CA 1BVHA 1APBA 4Z4CA 1Y1LA 2FLWA 2PUBA 3HUUA 4EYGA 2PUFA 1MAVA 2FW0A 3N8IA 1LJUA 3QLUC 1XWWA 4IRXA 4OLAA 1JH9A 3FMVA 8ABPA 2VUIB 3OLXA 4FE7A 2QSJA 4KQ9A 4RKQA 3CFYA 1RZRA 2VK2A 4Q7EA 2E4YA 3KLNA 1QP0A 4P98A 2E4VA 3HZHA 3O2QB 1FFWA 1JF8A 2GI4A 2RJNA 3EJWA 3H5IA 3O21A 4NQRA 1YS6A 2PUCA 3MMNA 3OLVA 1YK0A 5T3YA 1K66A 4W5QA 3DZDA 1NXVA 4WT7A 5KQLA 4N0QA 5CNKA 5BQ3A 2MYPA 1RNLA 4RWEA 3SQNA 1EWVA 3QEMA 4MQEA 2CWDA 3URMA 4EUKA 5DTEA 2PUDA 2O20A 1PNTA 4YR7A 2VUHB 1U04A 2JVIA 1E6KA 1TMYA 2Q5CA 3HCWA 6ABPA 3H5LA 4MS1A 4GPAA 3CKMA 1QPZA 1VPWA 4LE0A 3H6GA 4TLLB 4RKRA 3QK7A 5IX8A 3HVRA 2XDYA 4PZ0A 1CYEA 2WJWA 4OTZA 4PICA 5BR1A 3JTEA 3DGFC 3IPCA 1MB3A 5T7BA 1PHRA 2FXIA 2WRZA 3QLUA 1U0SY 1DG9A 2H0AA 2RGYA 5KQMA 4JASB 4RK1A 1Z26A 2GX6A 3O75A 5FWYA 4ML3A 2IKSA 2JB9A 4MRMA 2L17A 3LMKA 3SG0A 1QP4A 3CLKA 3OLYA 4MR7B 4EYQA 3K9CA 3CG0A 1AB5A 5JNWA 4UHKA 3RVJA 2RDMA 5DKFA 3IPAA 4KFCA 1LK0A 2FN9A 3CU5A 2FEWB 2BGGA 5JNVA 1ZGGA 4P1ZA 3HSYA 4PYRA 5TQ2A 3TD9A 4HYEA 5HM6A 2W42A 1WETA 3LUJA 2IPMA 2QU7A 1FFSA 1U2PA 1RPJA 5EWMA 1JYFA 5KI6A 1JBEA 3CHYA 4MS3B 4Z4GA 4YLEA 1DBQA 3E61A 2QR3A 4XLTA 1BA2A 4RXMA 3H1GA 3BRSA 1GLGA 3GBVA 1D5WA 4OG2A 1DCFA 3Q15C 1Z25A 1PEYA 3JS5A 3EODA 3P9YA 3CNBA 1P6UA 3TO5A 4EVRA 5ED4A 4MPTA 4CBVA 5JNSA 3LUFA 1K68A 1SRRA 3NHMA 4HNSA 1E2BA 1YIOA 4KV7A 4XAQA 5JNTA 1E6MA 1ZDMA 2HPHA 3EAFA 3QELA 5TPWB 3D8UA 4FB4A 5KQPA 3LUKA 2M1ZA 2R48A 4RK4A 1F51E 4KK4A 2AYZA 2B1JA 2NT4A 1FSPA 2MYNA 1JFVA 5EWJB 4G0QA 2LPMA 3DBIA 4YV7A 1NXOA 2PUEA 3HUTA 3GT7A 3MQ4A 3HXMA 4LE1A 2JVKA 3B2NA 1Z13A 4W5NA 3OLWA 4L4UA 4RK5A 3G85A 4O5AA 1DRJA 4RXUA 2IYNA 1S8NA 3L6UA 1NXSA 1JDPA 3I45A 4Z4FA 2N9UA 3EGCA 5C5EA 2GBPA 4MGEA 4ETIA 2H3HA 4RU1A 5DCLA 2IDMA 2IPNA 3KCNA 3H6HA 3KKEA 4YRZA 1YTUA 4KZKA 2JBAA 1L5ZA 3N0RA 3BBLA 1YVUA 3OMWA 4UHJA 2PUAA 4KNYA 3HS3A 5FWXA 3HK2A 4KREA 5HKOA 2RJOA 2FQYA 2KYRA 3QEMB 4MQEB 3BILA 3FFXA 5D2CA 2QVGA 5BRAA 3HDGA 3LFTA 1ZH2A 1A0OA 3NBMA 4D74A 3I42A 3I09A 3GYBA 1ISSA 4MS1B 1MB0A 5JNRA 2V0NA 4KQCA 2FSPA 2FMKA 1LBIA 3NNSA 2FMHA 3N53A 3HO1A 1VRVA 3KSMA 3MA0A 2B4AA 1W25A 2HQRA 2WWVD 2PLNA 3F6CA 4YWHA 3KS9A 1QMPA 2NZUG 3JPWA 3T38A 1D1QA 4B09A 5KWSA 3HM9A 1QQAA 2TMYA 2FMIA 1QO0D 3Q41A 4XARA 2IPAB 3LUHA 2QV0A 5FWYB 4MRMB 3GBPA 2PKXA 2QZJA 2ZAYA 4O1HA 4JB0A 7ABPA 5TQ0A 1RXIA 5IUKC 3F6PA 3H1FA 3RVLA 2MSWA 5TPZD 1Z15A 4QPJC 2GWRA 3E3MA 3LOPA 1JFTA 3JVIA 1IIBA 1FFGA 1PEAA 1TM2A 4MS4A 4QYMA 4EYKA 3IDOA 1U2QA 2AYXA 2LIVA 1JFSA 1F4VA 3IP6A 4MQFB 2HJ9A 4KMRA 4IF4A 2PE5A 1KRXA 3RQIA 5TQ2B 4XXHA 1BAPA 4DADA 3C3MA 3EQZA 3M9XA 1D4ZA 3LUAA 1Z2EA 3RVMA 5E3JA 4Q6WA 1YMUA 5EWMB 3EULA 1DJMA 3CZCA 2R25B 4WWHA 2WY2D 3S99A 4G0YA 1RZRD 1B00A 2PUGA 4DQDA 3KLOA 3H1EA 2MYTA 3TB6A 3GA5A 2YHBA 1EHCA 4ZJPA 1USGA 1C4WA 3UKJA 5HSGA 3A0RB 1ISRA 1OXBB 2VYCA 4OATA 4MR8A 4Z4HA 5KC8A 2L2QA 3RVOA 1DBPA 2YHAA 1A2OA 3LUDA 3Q7TA 3ROTA 4ETNA 3QELB 1NXTA 5BRJA 1DCKA 5IBQA 1ABFA 9ABPA 2HSGA 6CHYA 5HQJA 2MYUA 3IP5A 5GOTA 2HQBA 1OXKB 2X7XA 3C3KA 1P8AA 5CNJA 4WXEA 4IGAA 2IPLA 2A9OA 1KMIY 4JAVC 5CNIA 4JOQA 2LUOA 5FBKA 2FVYA 1NXPA 2P4UA 4G0XA 5IUNC 4G0OA 3FGZA 5IEJA 4LDZA 2ZWMA 2QVCA 5EWLA 3MM4A 3L49A 2OENG 1QP7A 3NHZA 4E7PA 3A0UA 1GCGA 3R0JA 2NUBA 1BDIA 3OO1A 1DZ3A 4LDAA 1SXIA 3A3KA 2PL9A 5IULC 5JNUA 4RV5A 2WJAA 3KTOA 4RK6A 2NT3A 2JBAB 4OLBA 3A10A 4RY8A 3K4HA 3Q7RA 4F11A 5FWXB 1H9CA 4RDCA 3MF4A 2JVJA 2ID9A 4N0PA 1JHZA 1L5YA 1DC7A 3BREA 4RY9A 4EVQA 4Y9TA 3QLVC 1W9HA 4N03A 1ZY2A 3O74A 3TX6A 3OQMA 3H5WA 1D2AA 3I5AA 3H5OA 3T6KA 1GCAA 1HEYA 3BRQA 3OMXA 4RZSA 3RVPA 2R47A 1LBHA 1NATA
chains in the Genus database with same CATH superfamily
3PXAA 1O9HA 3VYUB 1JX6A 2PMWB 3QU5A 2C0PA 3QKRB 4FFVA 4PQYA 5REQA 4L8YA 1M54A 3RC9A 1OF1A 3LUCA 1OXSC 1WHSB 2Y1WA 3DPUA 2YJ5A 3COYA 4EYEA 5JJIA 4RH0A 4ZCTA 1H6AA 2XTJA 4OMFG 4UE2A 1FRVA 1NGSA 5CFOA 4AMGA 1E1RA 4CNBA 2RHHA 2IXGA 1RQXA 4QYTA 3UAYA 3KFVA 1KWGA 1J06A 4Y8VA 1EEXB 3INGA 3GFVA 1V2GA 2GZ3A 3CZ5A 3LFUA 2OZPA 3UH1A 4DSUA 3FFTA 3DZHA 1C8KA 2KMLA 1ITZA 2F9FA 2HQSA 3FZYA 3LQ1A 4WH0A 5D8DA 5F2NA 2VHZA 2XKBA 3U4HA 2HMVA 4BGDA 4QFBA 3W2FA 3I23A 3KHUA 3IXQA 2DR0A 4QXQA 1HPLA 3ABSB 5D51S 3ZTYA 1JHQA 4AY3A 5I9LA 2CSUA 1C1YA 3NT4A 4I1RA 1OT3A 4ZQHA 3GEDA 4J0JA 5BOVA 5D3MB 3G2OA 4GOJA 2CV0A 5TGDA 3KUUA 4WK2B 4URVR 3NU1A 3L93A 3LX8A 4Q47A 1B1CA 3RIHA 1YR8A 2ZDHA 1E5XA 4P0PB 1VIVA 3LU1A 3L41A 2FEKA 2R8BA 1PG2A 1G38A 4QJ4A 1W5SA 5I7VA 2FDXA 4YALA 3TNFA 1E3TA 4C3ZA 5LUAA 5GQSA 2LIPA 2H4XA 1NZFA 5DSTA 1MF7A 4DJDC 3I8XA 1CY2A 1DTEA 2C4NA 4JQZA 2DUNA 4HYTA 4M55A 5IVIA 1CFZA 3WGYA 3A70A 4CT5A 3F5DA 3GK3A 1EWYA 4I1SA 2BHRA 3ZW8A 4P7FA 4B5KA 3S7TA 3NONA 3JQ7A 5EUCA 3BWBA 3ROEA 3WWZA 3G13A 2OGTA 4LXTA 1FVHA 1YRYE 4HGPA 1KR2A 1QYCA 4IIFA 4DVJA 4TL8A 4IJVA 1RYEA 3O82A 3RNOA 5JPDA 4KVAA 1OASA 5CXQA 1B8OA 1G6KA 1IXSB 4IFBA 1YI8A 2JFHA 3E9EA 3FDXA 2E2WA 3DXXA 5G1OA 2Q8PA 1BHJA 3WHKA 4AG5A 3C6MA 4JBYA 4P3KA 1OMOA 4AJ1A 1K4MA 4EIWA 4O4IB 2RFLA 221PA 1QZUA 4KMOA 2PCJA 5GMOA 2QAIA 2VBIA 5HKKD 3MCWA 3SCZA 2Y2VA 2GN0A 3C3AA 4Y2VA 2YN0A 1DC8A 3AJAA 1J9EA 1F4PA 3RANA 3DEFA 2IYZA 1GNLA 3HCRA 5AICA 4KPUB 1N2ZA 3CV3A 4IL5A 1M2FA 1TM1E 3KYIB 4NBNA 2VJQA 4OF4A 2OKCA 5KDLA 1G20E 2UYYA 4XIGS 1KYYA 3FDZB 1QP8A 3DV0A 2ZVJA 1D9XA 1G5IA 1AXEA 4MCJA 4NCNA 3OD1A 5DLDA 4YRNA 1IATA 3HN7A 2DYKA 5REQB 2G25A 2ZVDA 3I9V1 3UO8B 4B3CA 4OBBA 1EGAA 2Q6TA 2WEKA 3MG9A 2LKDA 2ZSEA 5GGYA 4M1EA 1MC1A 5K2MA 4UEJA 5TGTA 2QRUA 3C39A 3HB1A 3PFBA 3SBDA 4DILA 2XBLA 3N6RA 4QXPA 3PU6A 1MORA 3IBYA 3QBVA 3TTXA 4EG3A 2QM3A 3ABQB 4OI4A 1AQYA 1XEAA 3MD9A 4AIRA 5K0ZA 2N1BA 4HDMA 5CD1A 1GZ6A 2C04A 2CHVA 4RVDA 5AOBA 5NULA 3FWHA 1U94A 2YVQA 4BVGA 1JR3A 2HBYA 1LW7A 4AJ4A 1GNRA 3RC8A 2YCLA 4X3CA 2FJ0A 5K99A 4RTLA 3LKVA 4QVGA 1TKAA 1IN4A 1YVEI 2PO7A 3A1EA 4Z8YA 4UASA 4HG2A 1OH5A 1C8VB 3CTPA 3E9DA 1RACA 2O5EA 2B35A 3PR3A 1OFVA 5ALTA 2V4UA 3OTGA 2ATIA 1FYFA 4EG7A 3VR3A 3GAFA 3SQOA 3E9ZA 3WLPA 4TQAA 4RZHA 1U2SA 1H94A 1MJNA 1UBSB 1V11A 1WUJS 1Y9EA 2RIRA 4BJ1A 2IHYA 2RGWA 2EQ5A 2O59A 4KDFA 4JI8B 2EFEB 4BMSA 4G56A 4NEGA 4NBRA 1VKHA 2DEUA 3CF6R 1C7ZA 2ZXEA 3ABIA 4C89A 3KETA 1T1JA 3ZE8A 2HXYA 2H1LA 1KI7A 3K8ZA 4GPTA 1C81A 2OBBA 1BS1A 4FT4A 4KTVE 4ECEA 1IOZA 3OTOB 4JQSA 5EJ8A 1UKYA 1HLFA 1QTRA 3B82A 3HVJA 3NFYA 1NG1A 3WLLA 5CBPA 2BFDA 5MGNA 3U1BA 1XMQB 3PDUA 3QVTA 3PX3A 3KG2A 2VO1A 3E82A 4A0SA 3EIUA 1KIFA 1SZCA 2EYQA 2QI9C 4FYXA 3DONA 2EW8A 3E1KA 3R9IA 1R10A 5FQNA 4CDRA 2PXHA 1EXDA 3OE1A 1GZ3A 3GGGA 1L3BA 4EL5A 1MR3F 2BP7A 1YC5A 5EJ4A 3KZNA 1O94D 1TK3A 1ZN2A 1X8JA 1Z39A 2FWPA 3DYVA 2CCGA 4KOEC 4X3OA 4CIBA 4YTEA 1QVVA 3S29A 3WLTA 4H7KA 5L3QA 3BXOA 2GPWA 3VPCA 2RBEA 4X60A 4Q1AA 1O9GA 2PUBA 2RHJA 2DFVA 2FP4A 3ZZ1A 5DYGA 1MJHA 2YBEA 2IYXA 3AUUA 2ORED 4PRKA 3TRIA 4IRXA 2JHPA 4BNTA 1VP3A 3KKLA 3DE1X 1XJ5A 2PT7A 2Q0QA 3OP1A 1CFJA 2R751 3PBKA 2NNLD 4OHPA 4DIDA 1GZDA 1SUPA 4PLFA 5EPEA 3UAOA 4KNVA 1JPUA 1RZRA 2WWRA 5AHXA 3AGPA 3FZGA 2GNOA 4HQKA 4TT3D 5INTA 4Q4LA 3JAMA 2BY4A 1RAAA 2ZS8A 3FVVA 1HMPA 1U1GA 3O2QB 4JBNA 1Q6YA 5EIOA 3T0FA 4DAOA 3CM0A 3DMDA 3QUAA 5DNUA 1P18A 4F5WA 4X8MA 2W6MA 1EIWA 2J7KA 3DZDA 3MUEA 1QYRA 1OTYA 2QP4A 3DV0B 2Y4OA 4V2UA 2G70A 4L5AA 3LKZA 2ROQA 4LG1A 1EFRD 4EJSC 4NC9A 4BJHB 1H2AS 1N2XA 2GQ0A 2XMPA 5K3BA 4EBFA 4G5SA 4XSVA 3S1SA 1PNTA 4ZYTA 1E8DA 1SG0A 1U04A 4EOGA 3Q4GA 3UICA 1UH5A 3IBCA 5DM4A 2FK8A 1UZMA 1LDYA 1E4OA 2YV4A 4X1IA 4HDMB 1SUDA 1BJTA 3L04A 4BO5A 4MJXA 1N8TA 3ZQJA 2WJWA 3CVYA 2R87A 3JTEA 1BQ3A 2GHTA 3H5AA 4P7JA 5FTWA 4ZCQA 1PHRA 3WYEA 3I64A 4E2YA 2HHHB 5E2AA 4ACAA 1TDJA 4RQAA 2G1UA 2YMQA 4G63A 3ZBPA 2QG6A 4FZ3A 4ML3A 4QUEA 3FNIA 2FPPA 3B8EA 3HBNA 4R3UC 3REQA 3ZJ5A 1TD1A 2HRRA 1CWUA 5KPJA 2YZGA 1RKUA 1CZLA 4O4HA 1Y3FE 3DOIA 4IIHA 4B76A 2PS0A 4UTXA 3TINA 4ATNA 1FYEA 1KGDA 2R65A 2IK8A 4IMRA 3C15C 2RDMA 4DCTA 1V11B 2PVCA 2B0JA 3IPAA 2ILVA 3NOOA 4D9BA 1OWPA 1Y1SA 1Z7BA 4F1WA 3CU5A 2RH4A 8MHTA 4UJ3A 1X1CA 2VDVE 3VC7A 1VKJA 3OKFA 2W6QA 1LTQA 3ZQ4A 2G4LA 4ZJZA 2J8ZA 5FA6A 1I7SB 3AVXA 4B7UA 4Y2RA 3HHPA 1SVUA 1HE4A 4YQZA 3HYLA 4EENA 4G0UA 1RRFA 1AA6A 2ZI6A 1E94E 3W79A 1U7WA 5CBPB 4Q9JA 2BFDB 2WZCA 5TARA 6PFKA 3U7IA 4K9QA 2P5TB 2ZR8A 3MQ2A 4J2OA 1RWQA 3GBVA 1II0A 1PEYA 3M4XA 1MN6A 4W8OA 3WMFA 4CKXA 5JNLA 4CBVA 4B7AA 2VZ8A 3VDNB 5JNSA 4BY9E 3FTQA 1TAQA 1XZCA 3WWEA 1CB7A 1G6HA 2QY6A 3EAFA 4NENA 1QDUA 4GX1A 4YLGA 4OI0A 2P3OA 4LJ9A 1YACA 1U2EA 4F2DA 1FBNA 2RD2A 1G6OA 2PV7A 3LIIA 3ERCA 3DE7X 3V9PA 5BW4A 2VHVA 1ZMRA 4WK4B 3UK2A 4EKGA 5L3QB 5TF0A 1YOVA 1SKAA 2CYAA 2QK4A 2MYNA 4GUDA 3TQIA 2EWVA 2LPMA 2FZKA 1U7OA 3C7TA 3DBIA 3OG9A 5FOTA 1L5WA 1W44A 4OO3A 3FMIA 3V2UA 5A7GA 5JRDS 2FP4B 1W4CA 3LPMA 2J9YB 4V0ME 3B2NA 2JJ8A 2QUJA 3L0DA 3ZWMA 4Q7QA 1OFUX 2B5WA 3EIWA 4L4UA 4RK5A 4RFSA 2AKYA 1NUAA 3LNCA 3PLNA 1NVEA 1CZRA 5TGZA 2W0MA 1GFWA 2IYNA 2QP3A 4CE6A 1TMGE 2V9ZA 5F5LA 4Z4FA 3HXKA 2N9UA 3W4IA 1VSUA 1QE0A 2FZ5A 3W6ZA 1XTQA 4D4JA 1GNTA 2P77A 1AHHA 3MT7A 2IA5A 3PIIA 4QBKA 2Y27A 5BSRA 5M3BA 4QLAA 5HZHA 4K0KB 5HOEA 3SR4A 3DDZX 3TCKA 4MTLA 3EY9A 3C5VA 3WXMA 4AFNA 2ACWA 1OFIA 1P2BA 2O8CB 2PSDA 3VJLA 2XIQA 2Y1EA 3PX2A 4EK9A 1PQUA 2P4EA 1STOA 1WDLA 3EEBA 5EQFA 4K3UA 5DSXA 2W48A 1LUAA 2W11A 3HU3A 1UP4A 3NIBA 1SD2A 4I46A 1IXZA 4QEZA 2DQ4A 1U3FA 1N1GA 3IMEA 2XECA 2FDRA 3GLKA 2XCTB 3R3HA 4YJGA 5H4GA 4MV1A 4G5QA 1LBIA 1WCXA 5ALEA 3WNZA 3RT1A 1BS2A 1SBYA 3K53A 4I4NA 4AWBA 4KFTA 1VB3A 2B4AA 4RHFA 1X7HA 1U98A 2WWVD 4HLUC 1AGXA 4LJ7A 1FFYA 1VE9A 2NQ2C 5FPPA 2VSNA 4C43A 4URFA 2ECQA 1K86A 2N75A 4NG5A 1RMQA 2FX5A 5EIFA 2ZLBA 3REQB 1U9IA 2FPPB 3IT2A 4D9JA 5K0SA 4LN1A 1S8AA 5DHTA 4A8HA 2C84A 4O4HB 3JWHA 1ZM7A 5E95A 1T3GA 2H4JA 2HU7A 2PX6A 2XNCA 3SHVA 4D44A 4MS4A 3PEWA 3JR7A 5LMNB 3CF0A 2B9VA 4G5HA 4MA0A 3VR5H 1JDSA 3PHGA 3L06A 1NMXA 2WIFA 3LBAA 5HA5A 3OTIA 1B6SA 1FE8A 8LDHA 4KYUA 2GM4A 3V1YA 1VGQA 4I3HA 1IU9A 1ZNYA 1GQFA 3C3MA 4JXKA 1I0LA 1X6VA 2Q6LA 3O9MA 1EK6A 3LOUA 4P9NA 4PZCA 4J03A 4BC0A 3HC7A 1RI4A 3FDIA 4AZWA 4X62B 3LE8A 2QQ5A 3ICPA 5CDTA 2ECOA 3MMZA 2RC5A 3DO8A 4WWHA 4S1TA 2OZLA 3FTFA 3PGJA 5CDYA 2I6XA 3PJGA 3SZOA 3X1XA 2G67A 4U6SA 3TB6A 1FXSA 3B3AA 5JAQA 4UQOA 4GMXA 4BMZA 1RHRA 1ZK4A 5AD1A 5LN1A 1JJ7A 2QM7A 4P3XA 4OATA 4HLUA 4DMCA 5G4KA 3L0PA 5J43A 4FXOA 4JP8A 1W9MA 4NENB 1SU8A 4HVCA 4ME6A 1F3LA 4QO7A 4G0WA 5F51A 3DKVA 2IU6A 3W0LB 3GROA 4KQHA 1W0CA 2OMEA 2AG6A 4YR9A 3IVGA 2JAXA 1YOVB 4I5IA 2FF7A 2OCXA 3G2HA 4G5OA 4OSOA 5CNJA 2IPLA 5FRDA 3EA5A 4JAVC 3UZUA 4JOQA 4JUIA 1CE8B 4OXXA 2J33A 3RSHA 4KXXA 4HAWA 3ZY2A 4YBZA 3MWKA 4ZYVA 4GSKA 4MKGA 4XDGA 4RFSB 2HWYA 3PFHA 1NTOA 4E7PA 5LDDC 1Z5GA 2H2WA 1H4TA 1JALA 3D6VA 3I58A 2VYVD 3WGNA 1AKEA 4DDKA 4IEIA 4BFTA 2FG6C 1JA1A 4BKUA 3PDHA 1RM5A 5DHFA 1E9FA 5C1DA 2ZUBA 2HF7A 3CJRA 5EJAA 2GBGA 2KI5A 4IDPA 4QQKA 4RXTA 4BJ5A 4UM9D 4EP1A 4FOLA 5EE0A 4LJYA 2CYBA 3O7MA 2AG1A 3Q7RA 1W4BA 5KU7A 5HZMA 2FSGA 3DB2A 1XJWA 4Q19A 1P7PA 1QR6A 5EPUA 1X8LA 1VFPA 1ZS9A 1PDOA 2AX4A 2OO3A 3DD1A 1J0XO 5BMOA 4MWZA 1ZY2A 1QFSA 1DAMA 2XCUA 2XWBF 5ALWA 2BGIA 1D2AA 2BI8A 1NVMB 1T13A 2VYQA 4RX1A 4C0AC 5CJPA 5DGXA 4YJGB 4BO8A 2IZOA 3VMFA 3EGWA 4EDHA 3DZGA 1YI1A 4ESOA 1ZK2A 1LPAB 2Q6IA 3K8YA 4R41A 2JGNA 4LHYA 4BMPB 5TC4A 3ZGXA 4S2EA 3EH1A 5KB3A 4I3GA 3P9SA 4DIKA 4PZAA 3EXIA 5BQFA 1IBRA 2OXCA 3FCSB 4QBIA 4CM1A 3QPCA 1ISFA 5M5BA 4DPMA 3AFHA 5AJUA 5FUWA 5K4HA 5FWNA 3PUKA 4Q15A 3L1UA 4WPGA 4CF6A 3DCYA 3A9RA 3IRUA 4LY3A 5A0FA 1M2HA 2AUTA 1Z35A 4C3UA 3RUDA 1UBTS 1JIKA 3NIGB 4JCCA 5ER6A 4MS4B 3SE7A 3W2HA 2OWDA 2R7AA 3K9FC 1B3RA 2YV1A 2NXNA 1GT6A 3ZCSA 1Y6ZA 3DAFA 4P7BA 4PLTA 3TL6A 3CG4A 2CVOA 4J3JA 3LBHA 1QFJA 4RTNA 1I0IA 1DV2A 4F38A 3A3OA 1V5IA 3H9JA 3DZ8A 3SC6A 1A04A 3TTVA 1VYHA 3SVLA 3VO9A 2OZLB 2X3UA 2VUTA 1JT9A 3KWFA 5IJXA 2NVOA 3UOGA 3VR0A 4E08A 2XGJA 1DX6A 1E6UA 1XRMA 4WK0B 1E59A 5TPZA 1OGIA 3VNRA 3HZZA 1AHNA 1OQAA 4IUYA 2Y3IA 5AM1A 3SSMA 3EGIA 5CPFA 3F49S 3KEMA 1GCUA 3OTHA 4QDTA 1S3SA 2XAAA 1PX0A 2YV2A 2TMGA 3MYYA 5G4KB 4D41A 3WGGA 3ZDAA 3PC6A 1NW3A 4UNSA 3KZVA 1M8PA 2FTKE 4NHOA 1EBFA 3G2LA 2GDZA 3SIXA 2YY7A 4JLBA 1H8EA 2RI1A 2DBQA 3BWDD 3IPXA 4M86A 3HDJA 4B4VA 5BWLA 1QVAA 1EDOA 1QAMA 1WDWB 1AKWA 2FMXA 4LDNA 2E4XA 3WNCA 1O08A 2P69A 3DVSX 4WCFC 1D5CA 1J00A 4BQRA 4NP6A 4AO8A 4C14A 1B73A 3SVTA 4ZYUA 4MRNA 2NUTA 1T2UA 2BONA 4PWYA 2AMLA 2JJ2D 3NQ41 4LWQA 2IH5A 2CMHA 3KLPX 1E1YA 2QV7A 4P31A 4BE9A 3DLIA 1LTHR 2B94A 2BHLA 1N3LA 4JT9A 1NRXA 4WZ6A 4JI5B 5IABA 1URPA 2GFQA 2QGFA 3HJBA 4Y9RA 4YK7A 5H16A 5JV5A 4OAQA 2UYCA 2QTCA 3M6IA 1OHHA 4FYWA 4AU1A 4NDAA 4MI9A 6Q21A 4YGXB 1OBOA 1T6XA 3ILHA 1A8UA 1BU5A 3GNSA 1Y7HA 1E0SA 1JFLA 5B4VA 2WAAA 3JD0A 2IZ7A 2XF8A 4X92A 5AXAA 5DHPA 4ZVUA 1XKXA 4I2VA 4J0KA 5DULA 4A2CA 3K05A 1I3LA 4BVKA 1KIAA 4C6HA 4ZT2A 1KXZA 3C97A 1FC0A 1WUKS 3TZEA 4QXMA 4K6CA 5ARBA 1RHUA 3KT0A 1E9AA 1OZFA 2C4UA 1KVSA 3IPYA 1OA1A 3IP7A 4RAOA 4JK3A 4B8YA 1M8JA 3TIIA 4W6ZA 1EFUA 3GLRA 1R37A 4TTSA 3PP8A 1K0UA 2XE6A 2O8EB 2PY6A 4WCFA 2PMCA 1T3LA 2OD2A 3VZPA 2WIKA 5CB8A 3EXIB 2CHQA 1U6KA 2BDTA 3O4JA 4BV3A 3N0VA 1BHO1 4J0IA 3SX2A 3QHAA 4R8VA 1LI7A 2FFJA 3CF4G 4RVHA 4W9MC 3P2IA 4NCXA 5JHHB 5L40A 4I08A 2AYYA 3IQIX 4QLOA 4BGEA 2WJJA 5L4SA 1L5NA 2W2LA 3IP9A 2R6CA 1YQDA 1NULA 2XMGA 5F3DA 1E5QA 5CX1A 2WD7A 4E6EA 2DLCX 4OXIA 1QHXA 2RBGA 4KRYA 3GA7A 2KSQA 3DEJA 3HWSA 3IIMA 4E2FA 3L02A 3QEKA 5HKAA 4DLPA 1QX3A 3QFHA 3HJFA 3BA6A 3UA4A 3V4FA 3X2EA 2Q8QA 2ZSUA 3H2JA 3RJZA 1KK0A 4P4NA 4JITA 4MR7A 1KU0A 1CHNA 2C9ZA 3OA0A 4RESA 3KHSA 3VNVA 3C6YA 4UHDA 4ZOBA 2J48A 2XE4A 4EF5A 4H60A 5EZ6B 1JMKC 2PL3A 1ONPA 1YVDA 3WMGA 2CFTA 4GP6A 1H2XA 1T4DA 5MN6A 2GCIA 1JAYA 3CMMA 3L7JA 5E7JA 4M38A 4ZGGA 4CMGA 4OQNA 2L19A 3P7MA 3R8XA 5LPNA 2HYIC 3R4VA 4CLHA 4WBNA 1T4MA 3KYJB 3ZLBA 1XKLA 3DBRA 4LY6A 4DT1A 2HIAA 3NYRA 4PN7A 3COJA 1XV5A 1YUNA 3LPAA 5IFKA 3TNDA 1Z0JA 1T9CA 2FPLA 2E4UA 5JAZA 4EHLA 1VTKA 1XX6A 1QRDA 2XQKA 1GARA 3NJ4A 5CJJA 4FCWA 1PDVA 1FP4B 4X00A 4FN4A 5TR9A 2CXQA 3GMIA 5I9MA 3NPMA 5K3SA 3PLRA 2BJWA 4C22A 5B3LA 3EEYA 4H7PA 4PY2A 1LK5A 3PIRA 2HT6A 2G7MC 3T9BA 3G5AA 4EYOA 1Y48E 5H70A 5BV0A 2ZUVA 5F64A 1DADA 1WXIA 2NUTB 4UW9A 3RBXA 1VKRA 4LPSA 1L1EA 4LQCA 1XTJA 1QBKC 5ENZA 4M36A 1RP1A 4ND5A 2C4VA 3K32A 2ZT8A 4XDHA 4HYYA 4XJSA 5FA8A 3GARA 4HLNA 4XGQA 3GRFA 1A95A 4ZA2A 5FNVF 3DZCA 3T94A 4G5RA 4FPXA 4NL4H 4ZVKA 2EX1A 2OBNA 4K87A 3G0CA 4WLEA 1KQPA 1T25A 2CLDX 1PFKA 1ES9A 4S1NA 4BO6A 4JGIA 4P81A 4YWJA 4TUYA 4DR5B 2DB3A 4MQMA 1RAGA 2FJUA 2HWXA 2DLDA 3T9FA 2ZB2A 2C4HA 3WICA 2P5SA 2XGMA 3AOEC 5EE1A 3TE6A 4I4LA 4KN8A 5A2GA 4XSGA 2FR1A 2QMOA 1TYCA 1BE0A 1M10A 1YRAA 2PMKA 5TT1A 2RH8A 3KLNA 5DNCA 4QT4A 2WIJA 3VRHA 1OXTA 1U65A 2QG4A 3QWIA 4HSEA 2OBFA 2FPWA 2R00C 4Q1FA 3QEOA 1JHVA 1F9AA 4QEDA 3INYA 3W5BA 1M2KA 4U00A 2HO5A 1Z9BA 3HCFA 1JS1X 5K0LA 4S0ZA 2V7TA 5IK2A 1WM1A 1WXFA 4U5XA 3WS7A 5CNKA 4NBSA 1A2BA 1F14A 2VSYA 3IVXA 5ESRA 3DNPA 4MQEA 4EUKA 2A5JA 4B48A 2W0SA 3E22A 5C7OO 2CVZA 3USES 5K8JB 2GA9A 1DTWA 1HI9A 2VUHB 5DHRA 5AVKA 4CM5A 4JROA 4Q7KA 1W47A 5JYDA 4S0XA 4UNNA 4JJKA 3S3TA 2A1UA 2CXNA 2WQZA 4CFZA 3ZWAA 2I2AA 3HH8A 4PF1A 4QYXA 3Q5EA 3VR5A 1IY1A 1GGFA 1Y8QA 2NU9A 3F3MA 1TCUA 3OF5A 4HF7A 4PLWA 3VUFA 4AX4A 1F0PA 5CX1B 2WD7B 4FW8A 4MHSA 2GEDA 1CZNA 2BMJA 3M4YA 1K5DA 2QRGA 1KJIA 1N32B 5HGXA 3O75A 2R4UA 3PTAA 1C9EA 2V7PA 5I01A 1QP4A 2XNDA 1EH5A 5DZSA 4IINA 4MR7B 2LXNA 1K75A 3ZS8A 3MTQA 2R00A 1YZGA 2ZFUA 3OZBA 1QO9A 3HJCA 3AEQA 1C7JA 1JZSA 1XTVA 1J49A 4NK4A 2H31A 2P67A 4ZQEA 1R0WA 4GX5A 5JU6A 2JG3A 2EU8A 2AHRA 4TMTA 1R6XA 5JXGA 4IH9A 3M89A 1JU3A 3JWEA 4BQPA 4PYRA 5D5HA 3N3BC 3ADCA 1D2CA 1GZSA 1G8SA 4J75A 4M21A 4RD3A 5KOYA 1EFCA 3KT3A 3BIFA 4KQFA 3TTWA 4B17A 4WBNB 2H16A 1BOFA 2RARA 1FFSA 4WMLA 4WTOA 4NAHA 2WZBA 3F3SA 1UAYA 4JJ8A 5HIIA 3A9VA 4U39A 2JASA 2CJYA 3UW3A 3ZWVA 2R8YA 2PZEA 3SIPA 5KI6A 1P9LA 2BBSA 3BXGA 5AXDA 2PT9A 4WZAE 1GDTA 3MTBA 5DI9A 2R62A 2XCLA 4PO1A 5ALIA 4BNWA 3S8MA 1L7RA 2ZIXA 3FHOA 1T10A 4HH0A 2Z6AA 1D5WA 3CB4A 3PQEA 1HBJA 3N58A 5M29A 2DTEA 4WOBA 1EG2A 3ZD6A 1P6UA 2DUMA 3VR4H 2QVBA 4TMXA 4XVCA 3ZGLA 1XSEA 2FV8A 3V42A 1G20A 2D1QA 1AQLA 2WJHA 2IWHA 1I6KA 1XF9A 4Q4JA 3M5CA 3RFUA 5AW2A 4KK4A 4KTTE 4ID9A 3OCWA 4BFYA 3RTEA 4RAQA 4GKJB 4YV7A 4NE9A 5JZMA 3KE8A 3GCGA 3I2YX 1OXMA 1DMRA 3LLUA 3NHBA 3OQJA 4TUYB 1FLNA 5BXYA 1XK6A 3G2JA 2O1XA 4N5LA 2OMKA 3UYKA 2Q62A 3KSUA 3A3YA 3KVYA 3WLMA 2V6BA 3GF4A 1K7FB 2P75A 2Z2IA 3OLWA 3WLJA 5HTOA 2OCAA 4L8LA 3DKRA 1N4DA 3DP7A 4WLUA 3ZY3A 1NJGA 3VXKA 4A82A 1XXHE 4WACA 1HT2E 3PQCA 1UPXA 4FLMA 5EERA 3C7CB 3KHKA 1R5BA 4FEEA 5H83A 2CNBA 4RPKA 3ZHTA 5JMOA 2ZI3A 1P1CA 4U2EA 2RHCA 4FX5A 1T29A 1U4NA 2O1WA 2X0DA 4F72A 3KB8A 1E7YA 1CKEA 2FCRA 1K2VN 2FETA 2X42A 3HN6A 3M83A 1QF9A 4KAFA 4A0HA 1P0IA 5IH7A 3CH6A 3L07A 4CMIA 1J07A 3VZSA 2W6NA 3Q12A 5FWXA 1SVLA 3AR9A 4MUBA 3KAQA 3A8TA 4BLUA 1XQ1A 2NP6A 4MQEB 2A0YA 3DS8A 3SX4A 2X9LA 2QVGA 2FK7A 2C2WA 3E22B 1MEOA 3USZA 2QPLA 4KYVA 5AI8A 1DTWB 3NBMA 3FPKA 5LQRA 3GWZA 1MVLA 2XVAA 1O97D 3FVTA 1Z83A 2GVNA 3KR2A 1NFQA 2FFRA 4ID3A 4JMLA 2GYVA 2J0QA 5A9RA 2A1UB 2WU8A 3GFPA 3BXHA 2FMHA 1X39A 4L27A 4BBPA 3HPRA 4J07A 1NKSA 4FJ0A 4QTTB 4ZXFA 2NU9B 1Y8QB 2VPQA 3QOYA 5DBHX 4EABA 2D00A 2HQRA 4V1CI 3DFKA 4ZP1A 3EA4A 5ICEA 1SC6A 2GF9A 2FXVA 4L16A 1X92A 4ND7A 2TMYA 3T1TA 4KIUA 2XUAA 3D9QX 4RKYA 3HNPA 3WFJA 1TTTA 1TO1E 1OILA 3DQPA 1HSZA 4US0R 4TV8F 1MX3A 2I4RA 4QPJC 3Q8KA 2GWRA 1A96A 4N6NA 3BMXA 3DHWC 2Q1TA 1IEVA 2WJVA 3AEQB 3LG2A 4M2LA 5CGZA 1SQSA 4QPCA 3TSYA 1ZEMA 3GHHA 2PX5A 3H2ZA 1L5QA 4L3WA 5F4ZA 4PG4A 1JFSA 3IQDB 4XKJA 2R96A 2FE1A 3ZHCA 4XXHA 5KNDH 3OQHA 4ESEA 4JIMA 1KRWA 2Z3VA 1EX1A 1OY1A 2AUMA 2O7RA 3W7AA 5E3JA 3KVVA 1FU7A 3MXOA 1KDVA 1Y9JA 3USCS 3DWFA 5GONA 4KAJA 5LOVF 3RHFA 3PV0A 2XEXA 4II7A 4U7FA 3KM0A 3PZBA 1SCUA 2HNAA 2WMNB 2XMSA 4DIUA 3E23A 3O73A 4FN5A 3VV3A 5JD4A 5TLSA 4HLCA 4JYPA 2ZIXB 3K1TA 5JW6A 1QB8A 5HSGA 2JLBA 1QR2A 5KKNB 3EA0A 3ONDA 1E5VA 4R8SA 3CE6A 3EYAA 2ZJ1A 2GEKA 2DAPA 7REQA 5EGSA 3ON5A 5KTYA 2Q1YA 2WT9A 1SCAA 1G20B 1CHDA 4NE7A 1JH8A 3WRXA 5DBOA 3ESBA 3TSCA 4Q4JB 3CVXA 3OE4A 1J5PA 4CEJA 2H29A 3ZOKA 4PGAA 3QY0A 2C99A 4Q4DA 4L0MA 1FUEA 2BDEA 1T1EA 3NFRA 1BQ4A 3Q3GE 2E87A 1IAVA 1NXPA 2D2XA 2F64A 2WVJA 4I5GA 4UDNA 5AR1A 2XIJA 1TLTA 3RUCA 1AUXA 3RK0A 2Z4TA 1PFGA 3RGGA 4AQYB 3M3HA 1GRVA 2A5LA 3R2JA 1BFKA 3C3BA 1YCFA 3COWA 2GXQA 3DVRX 3Q0TA 4PGMA 2NTEA 4CG1A 4BE7B 3D3KA 1HZZC 3EMDA 3MVEA 4H4DA 5E4JA 3ZLJA 1PR4A 1E3QA 3P20A 1X86B 3GRRA 2OLKA 1OH7A 4DQUA 3WJ1A 3OURA 4OXKA 3E5HA 3EGXB 3MAGA 3TNLA 6NULA 4NCKA 2BGRA 2H2IA 2QDXA 3N8HA 1PD0A 1NASA 2C1ZA 3L0IB 3F6BX 1PUJA 4W4TA 2GARA 4CMIB 1DU4A 2H18A 3LC2O 4WX2B 5FWXB 3AUAA 2WSSA 3EZ6A 3F78A 1KEUA 2VXYA 3ED5A 5ETJA 4D3XA 3SEZA 4TMFA 1F0NA 1LDGA 3LBNA 2Y1GA 2QL6A 2ZAOA 2Y6VA 1DC7A 1N4AA 3WQQA 1EESA 2CLKB 2PZKA 1VM6A 2WYUA 1AV7A 5J9FA 1HGXA 5K0EA 1RQ7A 1YQWA 2E49A 5EZ5A 4EPXA 3GT3A 1XPRA 3FRIA 1B93A 4JKOA 2A0XA 1LBHA 1JVSA 1PJLA 2ZAIA 4DV5B 1RYZA 3FPGA 1LLFA 3KQPA 1S2DA 1T2AA 2FP3A 3PKJA 4LMRA 1VJ0A 1YBMA 1Z73A 2C7GA 2CL7X 2A88A 2R4QA 4RO0A 4WVLA 2XXBA 4INAA 4Q3BA 1KOGA 2IFTA 3LCRA 4EY4A 5M2QA 3TDMA 1CETA 4A10A 3A6EA 3PYXA 1R9JA 3OLCX 1GPKA 3PNQA 4GEGA 4E5MA 1XBTA 4B6OA 1WPRA 1PSWA 2GEBA 2IHZA 4JSYA 3ZOZA 3I9V6 2PZLA 2JIZA 3JYOA 4FDTA 2I6FA 4ENPA 1TZCA 1UMBB 4WKPA 4KUHA 2ZSAA 4OHCA 5KVAA 1J8FA 1H5UA 3UF0A 4A2WA 3QXCA 4GD3Q 2KHZA 1M1ZA 3FCYA 2BKUA 4GDMA 4MHTA 1UQRA 1UUFA 2XUDA 5T41A 3J7AC 2FWBA 1LSUA 4AN1A 3UWPA 4FYIA 4JP5A 1QU3A 1UP6A 1M72A 1V7CA 1QF6A 4L2IA 4XUEA 2WHPB 3R75A 1OH6A 2HQOA 1PZNA 4XM2A 5GONB 2YS6A 2EKZA 2CFRA 1OB2A 3PE3A 3MYRA 1L7NA 4GOND 4MVJD 4KPEC 1SCUB 4V0MA 3KOOA 4ECAA 1S2LA 2VUUA 1DQZA 2H0QA 2HIMA 2HIGA 2Q5QA 3H8WA 5ILGA 1TF5A 4ZWNA 4M88A 5CLIA 4LOHA 4C01A 3L43A 1JLLA 3EY4A 2ZWAA 4KQMA 2YWRA 1Y3HA 4WFJA 4K9MA 1E3WA 4RZIA 2MCFA 2I71A 4NVRA 4BE4A 2F62A 3FRJA 7REQB 5I7FA 4WEOA 3HEAA 3DAGA 1LNZA 2C3YA 1RYYA 3V1NA 3U7JA 2XTAA 3A6LA 3KCQA 1IJKA 3KQOA 1NVXQ 2IP4A 2QSUA 2QVZX 1RJEA 3GFGA 2R8OA 1MT3A 3RV4A 4LZWA 4EGFA 4CEJB 3LS2A 4AW9A 3H3FA 4W5OA 4S1PA 4COOA 2ODTX 2C2KA 1PTKA 1N6KA 4UD2A 3IHLA 4ZI7B 1HC7A 1V9LA 3C0KA 3GH1A 3B2EA 2X2FA 4HGNA 4P83A 5AW4A 1U2GA 1UJNA 4WHMA 4IHKA 3W05A 2FFAA 2Q0HA 4ERNA 3VI4B 2HR1A 3L0YA 3PGLA 1VL2A 4I36A 4UTZA 1IL0A 4PS1A 2HY7A 1NOKA 3HY3A 1P5FA 3Q5GA 1ZXLA 2AL7A 2X9VA 4JBLA 4DARA 1QIGA 1FDOA 3QRWA 4RVFA 4N0MA 3ZBUA 5K09A 3QFSA 3SXPA 1BC5A 4MWTA 4FDLA 4WBXC 2WA1A 3C3WA 2JEYA 4AROA 3TQQA 2JCVA 4EWLA 2HF2A 4QFCA 2JC3A 3BMCA 1HNZB 1QKKA 3ODGA 4YJHA 3FJYA 5C4MA 3UHPA 3KLBA 3NHSA 5IVKA 5LWHA 2YIJA 4EFNA 2VEDA 1SCKA 2G88A 1IZ0A 3N6XA 4YS6A 4YV2A 1A2KC 1P6XA 2ADMA 3PB3A 1LSJA 2YOFA 1F4LA 3OH8A 4JLOA 1T6BY 4POAA 1JDBB 1NYRA 2BEUA 1RFLA 4Z2YA 2AMVA 4DCGA 5CA1F 1G3RA 2AX3A 5JZSA 2EVWX 4D6XA 4G0PA 2F2TA 2GPSA 3RAPR 3U37A 1ZCJA 3TECE 4LFAB 1L4KA 5H0IA 2IEIA 2XYGA 3TDNA 1M0EA 3N07A 4JIGA 5EIBC 1ANKA 1DRKA 2IW3A 4G0MA 2ZI5A 4PAGA 4IIXA 4AURA 1NBME 1O4VA 2FPKA 3ROQA 4KGVA 3Q40A 3BD9A 1W46A 1VZ2A 2H7VA 2X4DA 6GPBA 2QLTA 5JWHA 1A9ZA 4L7QA 1UDAA 1E6EA 2GEVA 4O08A 1YS9A 1H2BA 2HNBA 2J5KA 2ZR0A 4EARA 1UPUA 2IUFA 4OLJA 3BGVA 4EPTA 5FJJA 4DJEC 4H7EA 1OXXK 4UJ5A 2ZRQA 1L5RA 5E6UB 5EGNA 1X1DA 1KO7A 3HP4A 4EO9A 3BWYA 4DLWA 4DA7A 2MU1A 3RO7A 3OPMA 3VM6A 4DJTA 1JHRA 2I54A 1LQTA 3ZHZA 2E0IA 1NJFA 5HXAA 4LKOA 3DTVB 5LLSA 1JI3A 1G60A 4L4YA 1NI4B 5FHQA 2IUTA 2QN9A 5CXUA 4LYDA 4OY3A 2UUBB 1QKIA 1KY5A 2Q2OA 4K8RB 1JEYA 1JLHA 1M2EA 3GFRA 1NC3A 1CCWA 1L1QA 2YV5A 4Q4HA 1OJ7A 1GGKA 3HRIA 2HDNB 1FMLA 4O4LB 3X44A 4BO0A 3QV1A 4KWHA 1MA0A 1TK2A 5AK6A 2LZ0A 4G5FA 3GPLA 1ULBA 3RWBA 1JLLB 1S4MA 5LBUA 3VR4A 4FD2A 2ANBA 1E3WB 4QSHA 2D7JA 2X1VA 4E7OA 1HLGA 2P6UA 1IOWA 1W4LA 1JLKA 1GKIA 1ORRA 3TLAA 1UZUA 5AVRA 1SIOA 4J0QA 4DSOA 4CXMA 2OK8A 4YXWA 4YCSA 3IBSA 1Z4LA 3BTUA 1MGPA 1EK2A 4O8ZA 1SVWA 2QL9A 5FWAA 4QOHA 4BEWA 5JQGA 3PEVA 2ZS9A 3M6UA 5K01A 3WG9A 1JSLA 3I2HA 1T6YA 3GV0A 1Q0LA 1XELA 4BQNA 2DCUA 2ODWA 3LC0A 4PCLA 4YT8A 4CETA 2PMBA 5GJWC 1M6NA 3RVQA 1COWA 1R66A 3DCNA 3P5BA 4W9RA 1O8CA 5F7ZA 4JI3B 3D59A 5ADVA 3NGXA 3BTOA 4L9RA 4CR6A 2NZ2A 4HQ0A 2CV2A 3HCEA 4TSFA 4OFZA 4OB8A 1J24A 3DZKA 5BR7A 5LIPA 3TJMA 3ZE7A 4PNEA 1NVVR 4YQEA 5K0TA 4J76A 4O2AF 5BVHA 1XEWY 1E66A 1TAGA 1ZMXA 3I6QA 5CNMA 5G0SA 1UFQA 1BDJA 5AQ1A 2BLLA 3HG7A 5BYBA 3BMCB 1T6NA 4Y2XA 3BRWA 3O92A 4DLXA 1WXGA 5HNKA 3LP6A 5B6IA 1ZM4A 3GN1A 3VHXA 1DINA 2PS9A 3KALA 2QORA 2HXSA 4BBJA 1BGXT 5JXJA 4KKVA 4JSTA 4K28A 1HORA 3BXZA 1Z28A 3HL0A 4KO1S 2IHTA 1SN7A 3EWAA 1GYQA 2YRXA 1P3DA 4WQMA 4HB4A 2BEUB 1OVMA 1SULA 3WYNA 3JZMA 1F0YA 3V8NA 1GNVA 3A3PA 10MHA 4AVYA 1JF8A 2CMDA 2GI4A 1XTIA 2V7BA 5HRCA 4NMXB 2XUQA 1NR5A 3A4NA 3M6FA 1YK0A 1NDHA 1Z2NX 3FIUA 4L4ZA 1NR7A 3RVBA 1SWWA 2BEVA 4N0QA 2I8LA 1UBOS 3FVRA 3OE7D 1Y3DE 1XFDA 4UUNA 1ZCFA 2CWDA 2YZMA 1JZQA 5JZVA 4UARA 3OOEA 4O0LA 4ER3A 3KJIA 3ETHA 3PS9A 3BMOA 3FB1A 4HP8A 1FUIA 4J2HA 2FB9A 1MGOA 3CLUC 1WE2A 1G6Q1 3A6JA 1VA5A 2IYTA 3CKMA 3PA8A 4NYJQ 3W2EA 5CIWA 5G1NA 4C1BA 4FWIB 1U31A 1RS0A 2QMZA 1S9DA 4DT1B 1JXMA 2NG1A 4C2AA 1MHPA 1Y9DA 2A86A 4DIFA 2CCKA 2NU7A 3EUAA 3WJ2A 3Q87B 4H7HA 3GDHA 1IJEA 4BLTA 4WLNA 2N3ZA 1NVTA 2A58A 2GCNA 4BECA 2DQSA 5KNDA 1Z0FA 2QX7A 1V4NA 3FKSD 3P9PA 4GZ5A 3KB1A 1Z26A 1RYBA 4GYKA 2XWSA 4HDKA 4XD7A 1KMQA 1YOBA 2IKSA 3C3YA 3WKEA 4C08A 3LMKA 5CLFA 3VJRA 1CUEA 3D5EA 1RTTA 2I55A 1FVOA 2PLRA 3FZNA 3MHPA 4MYHA 4PC2A 3TYXA 3NDPA 1QGUB 3HCCA 3UA3A 3LLCA 3HU5A 3TLEA 4F46A 4L9AA 4KDCA 4Q4HB 5AT1A 1JLSA 2Z6UA 1OIWA 4C2TA 2PX8A 3LA6A 4IUBS 1HQKA 3WWDA 1G19A 1KZGB 1THTA 4V0SA 2FEWB 1GTG1 4HUTA 3PL5A 3TD9A 1ID8A 2PIDA 2JGMA 2G8LA 2NP7A 4OQZA 1D2NA 4RGQA 4Y1EA 5CUQA 3NO4A 5E6RB 1ZMBA 2WWGA 4JJ7A 4Q1DA 2IYAA 5I7UA 4Y6RA 3I30X 1RVV1 1TIKA 1TOAA 3HCDA 5ALDA 1PG5A 1GTRA 3UMSA 3E61A 2EP5A 2FEMA 1TRHA 2JCSA 1C7RA 1P80A 2CXSA 4RXMA 1J5XA 1JA0A 3IPRA 1Q3KA 4Q3AA 3SKYA 2HRQA 3AHHA 2GHRA 3I6ZA 2BRUA 3VVBA 4RMJA 3CNBA 2R1TA 3ENQA 1F1BA 4J43A 3NHMA 3O4FA 4KH1A 3VSBA 1TGVA 2IZ5A 4MUGA 3HCNA 3N05A 2C7RA 3QELA 3F1LA 1B1AA 4ASUA 4ZCIA 2F43A 1Q0UA 1X80B 2WUGA 4AECA 1DEKA 4FUTA 5B12A 5KTRA 2I3GA 3WX0A 3ZJUA 1QYDA 1J1UA 2LTAA 4LQLA 1FSPA 2UU9B 3TFWA 1E0DA 1II8A 2DFTA 3BDVA 4QBGB 4WGGA 1MT0A 3GT7A 3DULA 4FEGA 2P1DA 1EUDA 2WD8A 5DFAA 5TEVA 2VDMB 3VHXB 3EFBA 3Q2KA 1CUFA 3IAAA 1QTNA 4UBNA 5LB4A 4V1CB 4GSYA 4CL2A 1PR1A 1HL3A 5IVPA 1NQVA 2CCJA 5EP4A 4JGBA 1PR2A 4I0WB 3RV3A 4YAUA 2BGJA 1AKNA 2FPXA 3EAQA 1XZQA 2ZVQX 2DFPA 1GXSA 4W9NC 4AK9A 1Q44A 3HWWA 1BVUA 4I1OA 2OGUA 3FYHA 5EMKA 4EGCB 2JFQA 1XZDA 3P8ZA 3I34X 3S5JA 1O0SA 2EKBA 3H7IA 3CZQA 3OOWA 4ZEOA 4CUJA 1J90A 2PUAA 2BEVB 3HS3A 4MWOA 5K7SA 3QNWA 1OLOA 3B20A 3PJRA 1NF3A 2Q49A 1AV6A 3CNQS 4LXIA 3D3WA 5D2CA 3DMYA 4RNDB 4HQLA 2J6CA 2AFHE 4R5MA 2WSLA 3P2JA 4RHCA 3WO1A 2YW2A 4L4XA 2Q6VA 3I42A 4BX3A 1FDVA 3BMOB 1SQ0A 2FX2A 5DYTA 1AUPA 4M76B 3A6DA 4M7OA 2R7LA 3EN0A 2FEXA 1EDDA 1PD1A 3D6TB 3H9QA 4KSBA 1ESDA 4B34A 3C5CA 3OF3A 5C8VA 1ZR2A 5F9FA 3U0VA 5KX5F 1I3KA 1T0UA 1OV4A 3AY3A 1G3UA 1UFKA 3T5AA 1RLIA 1QMPA 2NU7B 1DDIA 3K72B 4RKFA 2I22A 4TN1A 5EYPA 4E21A 3FNQA 4PHFA 2QTZA 4S12A 1EFKA 1Y7PA 2P2YA 1MAWA 2JGAA 3E4DA 4HDKB 3A1NA 2NUAA 4D9MA 3VR2A 1Q91A 3O31A 3NP7A 1RXIA 4ZZIA 3B13B 3PDCA 3FOCA 3MS7A 1YCHA 4FOSA 1GVHA 3WLKX 3G5MA 1ZD9A 4B81A 2ORIA 3IQXA 2XSZA 2Q2VA 4Q9DA 1V9CA 2V7VA 1YJQA 2XF2A 2QTTA 4KODA 2FUKA 2ZUSA 4H4EA 2EOAA 4RQBA 4NZMA 5BSTA 3IPLA 1BFDA 1N2CE 2VJNA 1PZFA 1R9MA 1P45A 4OHZA 3RVMA 1E1QA 2JJMA 5U1PA 1UC8A 4RVCA 5HFAA 5AVTA 3L46A 5CD9A 4QTZA 1RZRD 1HDIA 3U4MA 4CCYA 5HCNA 1QPBA 5C81A 4QU9A 4B4DA 1L8XA 1A5ZA 2VR1A 3EFOB 5FUVA 2WIBA 1PV4A 1FS5A 3VU8A 2VYCA 4WXRA 2R1TB 2IY7A 3DFIA 4JZYA 3LXRA 1ZZGA 4GF5A 1G8MA 2SCUA 1A9RA 1ONNA 4PV7A 2YWXA 1P77A 3Q7TA 4L6AA 2B3DA 3QELB 1L8LA 4RJKA 2HU5A 2F43B 2C8JA 1Q1BA 3SS9X 3VO2A 3WGMA 4U2CA 3ZN2A 2HQBA 4XM0A 4BNIA 2G04A 2HSZA 2X7XA 3HKEA 2QN7A 3CVOA 2P5YA 2YKGA 3WL7A 1UPBA 1XEXB 5K3DA 1TA4A 1EUDB 1Z6XA 3AV0B 4C4YA 1VYTA 5IEJA 1ONBA 4X64B 1J2TA 3MM4A 3Q7QA 1XJQA 4M1YA 4NONA 3WADA 1JA9A 3ASUA 3NHZA 3IQZA 3M82A 2A9FA 3DMPA 4DDUA 2DX7A 1J97A 2IXTA 2XXJA 1ATZA 1W75A 1GQ2A 1KZ4A 1ZN8A 4L0QA 1GXSB 3HP1A 3OO1A 4BMNA 1I7DA 2EJTA 2I87A 3IKTA 2REQA 3QMPA 4OI2A 4JJIA 4WKBA 3BJZA 3DL7A 2WF6A 5LXTF 3MJEA 1K9SA 1ZI6A 3TLYA 3L7BA 5FLXA 2IIVA 4XCXA 2BELA 1MEJA 1S02A 1PN3A 1VMKA 3T4XA 1GDHA 3DFMA 2B4RO 4J1SA 3A6FA 3THSA 1Z6GA 2PR2A 3CW8X 4QOIA 2DBZA 2VK8A 3PCTA 4MRPA 3E70C 4YT2A 1BW9A 3D3WB 4PAQA 4FHEA 3WXBA 2Y9PB 1WD7A 3UPUA 5DBFA 1BU8A 3OHSX 3OJFA 2JHAA 2HU8A 2O3UA 4UOQA 3S7ZA 3TR5A 3BIJA 1RBZA 2WUWE 4PGHA 1E2LA 2ZYAA 4IUCS 4AP9A 4A2QA 5AESA 1GQOA 3PLAE 4LWZA 4C0HA 2R47A 3AR4A 4UVEA 1MXFA 3F96A 1HM5A 2JIPA 4R1PA 1LVGA 1RPTA 3LK7A 2CNLA 4R1QA 4Z4QA 1W36B 1Y8RA 1XI2A 2DPYA 1E64A 3B89A 3BXFA 4QULA 1RLMA 3IXMA 2P79A 5EE3A 5EYPB 2R8PA 4CEHB 4AJEA 1ADGA 2A9RA 4G5GA 3OQIA 2GO1A 4WAUA 2ZATA 2OCPA 3A7EA 3BCUA 4ZOAA 4CKWA 4IEEA 3NRJA 3AI1A 1VKOA 4WZAA 2DRIA 2EJBA 1NVVQ 5H3HA 1P19A 2VDUE 2GK6A 4GT1A 2NUAB 1YRHA 3ELWA 1AKYA 3D7NA 2H1RA 4X6YA 4QOSA 4X8OA 3SEFA 4X3PA 2EBWA 3PF8A 2DECA 4X0EA 1MDBA 4XCQA 3TZQA 1ABBA 2XW6A 3L0SA 1EAYA 2HMWA 4D4LA 3ND9A 5IW8A 3JQBC 3WFZA 4C4OA 1TU4A 3SC2A 2FN4A 2X8LA 4AJKA 4UDYX 2FEPA 1QG0A 3L4BC 1OYWA 2IY9A 1E69A 5E4YA 3DLPX 3O1JC 1YB1A 2OOKA 2P6NA 3LVRE 3TRKA 1RBQA 2FRDC 3PPXA 2OHIA 4ZDKA 3F2VA 3HVKA 2VRNA 4AB1A 3NAZA 5F12A 3QHQA 3AXSA 2O0LA 4B7CA 4CWAA 3GLUA 4OX9B 4CCYB 4YYZA 5KWEA 1RXUA 1BJRE 1GTVA 4ZZ2A 5L7WA 3EPHA 2A3NA 2OYSA 1XMXA 5DWDA 5D3KA 4Z9FA 4LBZA 1ONOA 2I1QA 3F5QA 1MO3A 1YUMA 2ABWA 1NNI1 3AF6A 3O6VA 3EVEA 2H1FA 1RXEA 4YP6A 1Z4NA 2SCUB 4C0LA 4BRWA 3HY4A 4R2HA 1FDUA 1NL3A 3B9QA 4WFKA 4CCWA 4CU5A 2CHFA 4Q3NA 3UAZA 5EP1A 2ZU0C 3VO8A 3SEQA 3G1WA 2VYNA 5AFSA 3D81A 2VJOA 4NOMA 3K96A 1PYGA 3ZV4A 1NSYA 3C4JA 2PUVA 1R88A 2LE0A 4FMDF 2WHEA 4Z0PA 4DLZA 3QW4B 3TLMA 3JQBA 2JLVA 2GNAA 3ZG6A 3ZKAA 4ZYLA 3OKCA 1I2CA 3H65A 4D4KA 4PANA 1UXJA 2A5DA 5C7LO 3VYRB 3L4BA 4TMYA 2H54A 2ON6A 5AKZA 1AVTA 4RE5A 1VL6A 3O9VA 3U9SA 1XZHA 4DIOA 2C8VA 4UZSA 2J0UA 2VEOA 4C4ZA 2PM8A 5ITZA 2LCQA 1B8VA 1P7VA 1Y8CA 2REQB 1HK7A 2W8ZA 4KXFB 4X8LA 4EHBA 1ZWLA 1Q84A 1T5LA 3GQBA 1N3BA 3R5KA 4KJXA 3DG9A 3QYAA 2YX1A 3N0XA 2MR6A 2ODPA 1X0VA 1KBOA 3PITA 1I4TD 2W2NA 4NLLA 3JQAD 4BBAA 4JYAB 1CQIA 2FR0A 4DMMA 1CQJA 1BW9B 4X7RA 5KYGA 1XN4A 1Q0PA 1Q14A 4NPCA 1C4OA 3FN4A 1EXNA 1P4JA 2WT8A 3KL2A 3LKDA 4KFUA 2X0EA 5KZMB 5IWCA 4BXOA 1H42A 5FORA 1RKVA 2VSFA 4HDAA 5JCOA 2IE0A 2ZIWB 4MPRA 1CDZA 5BO5A 4JOBA 1AKMA 1Y8RB 4LA4A 4Q9KA 3CA8A 3VQTA 2QMEA 4YI5A 3UT6A 4MRVA 3T15A 5BN3A 3OQIB 4QDKA 4CKWB 1N8SA 4U3JA 1BKYA 1I2AA 1P5HA 1QBGA 1C7FA 4B4WA 1LFDB 4DSTA 3L77A 3C98A 1XHFA 4QTUB 4WZAB 2XD4A 1SKQA 1SCDA 5ARDA 3DDNA 1PK8A 2PQ0A 2Y77A 2NVBA 1MA3A 1CDDA 4MJLA 2O48X 4PR3A 3ZGYA 3DUFA 3BICA 2FA9A 1L6IA 1H0SA 1NYTA 1S3GA 3EF0A 3OBBA 4RANA 2HJRA 1KZ9A 5DYNA 3HBLA 1XZAA 2C2YA 1GEGA 3G0IA 5KVQA 1POWA 5DLPA 4NV3A 3SC2B 1PUXA 1KMCA 5BQOA 2PVPA 1ISGA 1MB2A 1A2QA 3X0DA 1X14A 2HLHA 1SM4A 4B80A 4DL9A 3ACCA 1BMQA 2VWQA 3G17A 2QTMA 4GYWA 2IS2A 1A72A 4LGMA 1FX1A 1N1MA 1UWLA 2Z58A 3U7EB 2FMUA 1BKDR 3L8EA 1OI3A 5AM0A 2IQIA 1TJYA 3F73A 4UC0A 2PAFA 2FCAA 4NARA 4LJ5A 4BBZA 2PWBA 5EMJA 3EVBA 3HA5A 5AW8A 2GMWA 3Q10A 1V25A 2PLAA 1NJ6A 1IE3A 3GMTA 1QIDA 3S44A 1XXHB 4LE2A 5KREA 2JAUA 2XNHA 4TZ6A 4LWPA 3EC7A 2QUKA 3CLTD 3MSCA 1I36A 5THXA 1HRDA 3TLGA 3P45A 1COZA 4CM3A 3HCAA 1U3WA 2HI0A 1AXRA 3G5UA 3L6CA 1O6FA 1C50A 4YUXA 4PHTA 4AKSA 3NBYC 5BOSB 1UJ4A 4NCHA 2BHNA 1J20A 3B52X 2J67A 5B4UA 3EBPA 1PUIA 3BE8A 3HFSA 4I5FA 3BAZA 3OECA 2B1IA 4ISBA 4B46A 2GM9A 1QO0A 3CH4B 3JW8A 2REXB 5DTMA 1M1XB 3G7SA 5FL3A 1YULA 2P9HA 3T7RA 2NO0A 4PQEA 3UGKA 3BKXA 2PKWA 2R11A 4OL0A 1Y33E 2J0UB 2VRWA 1TLFA 5BSKA 5F7XA 3B1FA 5ITZB 1KI8A 2PCLA 2QTWB 4REMA 4N0EA 1TGYA 3U17A 3W5JA 3GQBB 4XX0A 3B1ZA 4IKOA 1XT6A 3UJDA 3RDPA 4MULA 3G2PA 4AWXA 5CDSA 3VTAA 4ER7A 3E84A 5FH9A 4Y9DA 2AVDA 4TKLA 2Q3JA 1NRIA 2ZYTX 2VHEA 1CQIB 5HF5A 2QMHA 1CQJB 2Y0PA 5IC6A 5FTJA 1WR8A 1WUIS 4QU8A 3PC7A 3T5MA 3W7VA 4MWGA 3T7EA 4ZZ0A 4P98A 2OECA 1OR8A 5E6SA 2PK3A 2CDRA 2Z4RA 3D5QA 3HJAA 1DG3A 4PLCA 1DJNA 5FBRB 1GL6A 3O7WA 5IU6A 4MX8A 3TTUA 3IYLW 5KYWA 5DLYA 1JXOA 1NW9B 1PX2A 1R00A 1GQRA 3SLKA 2PGAA 3UMJA 4DPKA 2Y99A 5KTTA 3DDWA 3GJXC 4MXDA 4AI6A 2W2VA 5KQLA 3VNSA 1T35A 2G72A 2YN2A 2W2PA 2NPOA 4CMCA 4CIWA 2IXBA 1GGNA 3ETGA 4C78A 3NALA 3HXPA 3R5HA 5BN3B 2SKDA 4ZAVA 3ODPA 2WF5A 3CEJA 2P78A 4MDEA 1ZI9A 2XT6A 2JI9A 1JIUA 2H8KA 4GLBA 4N3NA 4EPRA 1H8HA 5LQDA 1Z08A 5IYZF 2NAFA 2XNSA 4FR5A 4L3VA 3V46A 1DKPA 3DUFB 4M3NA 5D1NA 5L3VA 1E2FA 2CYCA 4OYLA 4TYMA 3ZVLA 2DR3A 1H8ED 4LHZA 3W5DA 2CLMB 4ENWA 1A9SA 2R1VA 4R2JA 3K6KA 2ZT7A 4EG5A 5FV4A 1IIRA 2GN2A 5IDVA 4F5EA 4PCUA 1PVVA 4JS0A 3WRVA 2P3QA 4JASB 1FLAA 5FNVA 4BFSA 2B78A 3AUSA 1IBSA 2GX6A 3SFZA 4YMLA 2C7PA 4P0QB 2JLWA 2Z8YA 3L5OA 1ECGA 2ZG6A 3SQLA 1Q7GA 1H9BA 3KOYA 3TM5A 4U2BA 1OFHA 3LWBA 2AXEA 3ROGA 4C7MA 5JADA 1ND5A 2Q4BA 3JQEA 5FL7A 3PHCA 3QVVA 1NVFA 3AUTA 3SXUA 3H11A 3QQPA 1DKQA 2IE8A 4NNPA 3VHQA 1AO3A 4TV9F 3R9KA 4CHGA 1TJ3A 1CUVA 4CIYA 1GR0A 2G9QA 2VHQA 3F3KA 1SJ9A 2D2IA 2QU7A 3UQYS 4TRJA 3Q3IA 4CM9D 2B4KA 5IVDA 3S2YA 2XZOA 2ZYSA 1QU2A 1RPJA 1T6ZA 4JBXA 1JBEA 1CB0A 1VZ3A 3O38A 1DOHA 2C7OA 1XDGA 2IKQA 2O9JA 3SYTA 1D6JA 2B69A 4WGFA 4B3JA 2VTEA 2Z9DA 1NVWQ 2IYWA 2OM2A 5LBIA 4EFMA 3IV6A 1U8UA 8OHMA 3U44A 1G21E 1QLHA 1R4NB 2R6ZA 4ZJPA 3LBYA 4R1MA 3FNGA 2P1ZA 3AXTA 2GVDC 2B8TA 5I9SA 4AS2A 2ZCVA 2CUNA 1VB5A 4AUEA 4FYPA 3FZQA 1PJZA 5CA0A 2GEFA 4KGXA 1NW5A 4QHSA 3GDWA 3QEJA 3QVGA 2WHXA 4PYLA 4ND4A 2J3MA 1F6DA 5DIFA 1D1TA 5LIRA 3WY9A 4AG3A 5SICE 4UCFA 1HH4A 2GILA 1ZVQA 3M4ZA 3UVEA 1GRNA 1HLPA 3ZLTA 1I14A 1NBMA 4K9RA 4XX0B 1UADA 3UMVA 2SKCA 2XUIA 3KZOA 5BUZA 4XIIA 1H2YA 3F7OA 3FUXA 4XB1A 3E4CA 4KWIA 4LE1A 3TXAA 2W2LD 1K8QA 4ZEVA 3TG2A 4F8EA 2QXUA 1E2QA 1JJVA 1ZGCA 1ZJYA 2XUPA 1NXSA 3ZWWA 1GVNB 3DSRA 3A1WA 1SHLA 1N57A 4B2PA 3I5YA 2Q4TA 4IXWA 1PT9A 1BDMA 2TECE 3AM5A 2K2WA 3M8KA 5E6SB 4D8TA 5DCLA 3SWWA 3QVWA 1FJGB 5AJHA 3KCNA 5KYWB 2XE7A 3H6HA 1C7QA 1JB1A 3OEHA 4JC0A 5A0VA 4LRTB 4M0UA 4QUAA 4TT8A 3L8DA 3LHSA 5IM5A 3ENVA 3R6DA 4YY3B 4KREA 2H9IA 1P17A 4O5OA 4B9EA 4DDVA 1UAAA 4E46A 3FFXA 3MMSA 3QBTA 3DAOA 4N3GA 3LFTA 1PQ4A 1SAYA 5EP2A 4DUZB 2UUPA 3TW0A 3MHTA 3F8TA 4AP5A 1JB9A 2F6RA 4HFMA 3AZPA 4Q3DA 4EX7A 2Z3ZA 1K6IA 4AULA 2RCYA 1F48A 2FSPA 3PXEA 2ZEJA 1JHOA 2DT8A 2B4YA 4NS1A 2DY1A 3CNNA 4LSZA 1Z75A 3PXGA 2R1VB 3MC1A 4Y98A 3VZDA 5B4TA 2PLNA 3ULKA 2WKRA 1EWRA 1SUSA 2FMIA 1R0SA 3LXMA 1KP9A 3TI7A 1P2SA 5FNVB 2X40A 2ZZNA 4W6QA 5FDFA 3UYLA 4JB8A 3B38A 4DB2A 4JB0A 4LCBA 1X70A 4PRYA 5EXPA 1EU1A 3C5EA 4MP8A 4X6XA 3V4VB 5JDIC 1H2HA 1Z7YA 3CRRA 3JVVA 4RPLA 1CR1A 1DO2A 3ORFA 1XCLA 1LD3A 4U2GA 2P6OA 5AXCA 4DLUA 3SXUB 1T43A 2E48A 4MIKA 4C5CA 4FI3C 5JH7A 2BSAA 3G9ZA 4B3RB 3FR7A 3H11B 3QE2A 4TLAA 5F35A 4WKNA 3L8YA 2NVWA 3JQPA 1QE3A 4GYYA 1KR5A 2G83A 4GPIB 2GAAA 3R7FA 1C7IA 4PXYA 4MUNA 4WA8A 4CL0A 1YZFA 1AKQA 5FFFA 2HJWA 4CFYA 3CRZA 1IJFA 1E32A 4BGIA 1B00A 3UHFA 4F92B 2G77B 4YRMA 1Z74A 1YBHA 1D4FA 4DMGA 4EZBA 4Z51A 3NS7A 4DA9A 5BW8A 2Z2KA 5AVXA 4R3WA 2XBUA 1GGVA 2ZBFA 1Z82A 1E3EA 2IEAA 1JQBA 1OYVA 3BMNA 3U44B 3A0RB 4YN3A 4DCVA 1L4EA 3OAAD 3R3SA 5E9AA 3UKOA 1ECCA 1HE2A 3RRZA 2PKRA 4MVJP 3OX3A 3U1VA 4UTRA 2EJWA 3ZZUA 4F21A 2AQHA 3N7AA 5CA0B 1K5HA 1ZD2P 1AC5A 3EK2A 4BS9A 1ABFA 3QVGB 4MVJM 3ZK7A 4NPHA 3Q88A 2OUIA 1KP3A 2GXSA 3K9GA 4Q12A 2RC6A 4V39A 4YCJA 2BL4A 2COEA 4IKPA 4O29A 2HHAA 5JBQA 3NAGA 1MX5A 5CJ2A 2ZDQA 2QNBA 1IY8A 1NJ1A 3L5KA 4DCUA 2DUWA 2VHUA 3VR5D 2X5NA 4LDZA 4C05A 2ZWMA 2OYCA 1T9BA 1Z62A 5FFMA 2M6LA 3ZIDA 1SQFA 1T36A 4TZKA 3R6LA 3RJTA 1QUEA 2NUBA 5J59A 1OXUA 2MMCA 4EITA 1HYGA 5JAIA 4ES6A 5JCJA 2FLVA 1KEEB 3TS1A 1GR1A 4E6PA 3BC1A 4ZVVA 2I0FA 2XNDD 3HMKA 3AHEA 1UEXC 3W9BA 1VBMA 4LDPA 2BSQA 1YCDA 4K6GA 3QU2A 4TX1A 4NFHA 5EESA 5TS3A 2C31A 5E3IA 2EGHA 2ID9A 4OHBA 1RPAA 1Z6YA 2AJCA 2HC9A 5CITA 4DB4A 3OIVA 1PQPA 3R7DA 3COPA 3V7FA 5K8TA 4ZOCA 3I5AA 5SZIA 1QG6A 4GXRA 4CMEC 2K5UA 5A4MS 3U3OA 3NR2A 5HE8A 2PNJA 2GCOA 1T5HX 5MHTA 4A8JA 5LZ5A 1N2IA 3AIIA 2ZZMA 4RYLA 2YIVX 1KMNA 3JQ9A 4AMUA 2HBZA 1OV6A 3ZGNA 4BQEA 1UBJS 3MAAC 3Q6NA 1QX4A 4JX8A 4GPEA 1WQ3A 4RTQA 3AEZA 4PYIA 5B7NA 5BWMA 4QC2A 5EKTA 3QMVA 1OVGA 3PZRA 3A6ZA 3DM9B 3R74A 1KDOA 3ZXYA 3H8JA 2FLKA 5KCMA 4G09A 3S68A 2WR8A 1A71A 1Z5PA 1U3CA 4RVUA 5EVCA 1C7EA 5C1IA 4BMYA 1V41E 3CTMA 3R0IA 5WRFA 1P3Y1 3NRBA 2QR5A 3HGQA 4J3NA 3HQ4O 3WLHA 4PLYA 3ZHBA 4A4DA 4ZCSA 1NONA 3VR6H 2O6LA 1VSQA 4WASA 4Y9SA 3KVNA 3HXOA 2JJQA 3IAXA 3MJDA 1RWPA 2I7VA 2MSKA 3IAM1 3JD1A 1LWNA 4OHWA 5IN4A 4DR4B 3QXXA 4DAEA 1KY2A 3V33A 1ODKA 2IODA 3MJTA 3EOAI 3JYQA 2H2GA 1WMBA 2BN4A 1L6RA 1NNUA 4DBVO 2Q8NA 1DB3A 2XMDA 3E0QA 5KJ6A 4C30A 2L18A 3AQIA 5HRUA 4QOJA 5JY1A 3BMNB 3LF2A 1KQFA 3A6KA 1ZZEA 3SD7A 1TUGA 5EXXA 3EPJA 1YDFA 1Y4DE 4A9AA 2CHEA 4NULA 1KEKA 5IAJA 2VI5A 5L95A 2YNMA 3HKBB 2ZDGA 4DUGD 1MJGM 1ZIPA 4K1XA 5DCUA 5DRYA 2XMCA 3WTBA 4BVFA 1AQJA 4A23A 5KOIA 3GZNA 1XLVA 4LJ6A 1IY9A 1EDZA 1TUEA 4M1KA 1H0KA 3AKCA 2HDWA 3MAJA 4D0GA 1LLQA 1GV0A 2PSHA 5A5FA 2O3QA 1WUYA 2B8JA 3PR2B 2RKWA 1FOEB 4FE3A 3ER8A 3ZWKA 1YIDA 3NV7A 4G26A 3EMVA 2OA0A 1BYUA 2HJSA 3BGWA 4X61A 3LZ6A 4JODA 4IDNA 3Q9UA 4LHWA 1DAFA 1G2QA 1CNEA 3PGVA 3EZXA 4JJGA 5GIOE 1IWOA 1T36B 4LMAA 4X7BA 5CM8B 2ZRDA 4L5YA 3WI7A 2ZJOA 2FOXA 2V7GA 1A8QA 5HP4A 1TEZA 1LPPA 1L4GA 3IJ5A 4AQ7A 2M9MA 3EZ2A 4TLBA 3CUUA 4E1BA 2VZ0A 3EIEA 5A03A 1YRWA 1LSOA 4LYGA 2PVSA 3G89A 3MUOA 5K51A 2YHIA 2W7TA 3RS8A 4PYNA 3SMQA 1DRUA 4ADSG 2MSEB 1NNSA 4CL8A 4V02A 3WLOA 4IZIA 3FF4A 1ZMTA 2O07A 3KPWA 4KC0A 5KINB 2JLUA 1JSRA 5A7HA 1GRQA 2H5JA 3RSLA 4O33A 5I7WA 4TROA 3H9EO 2PTHA 1FDTA 4G97A 4MPDA 3L6EA 3LSTA 1KF0A 5ELXA 2BUBA 3JD4A 1G8FA 1RCTE 1YB7A 1B0UA 1UXKA 5G0WA 4UAGA 3V97A 4BEVA 3ZCXA 1P1JA 1WKBA 4TS3A 4XPIA 3RH0A 1RFGE 3O03A 2HF8A 1QRTA 1TQHA 1U2TA 3B7PA 4UBOA 5YASA 2XMRA 2GCOB 1FDRA 1GQQA 3LTNC 1TCVA 3UK1A 1N2CA 4A8JB 1RI3A 2R1ZA 3U26A 1ZHHA 4K26A 4HTFA 5F73A 1MO6A 1EFVA 1VE1A 5HBGA 4DZTA 3I0ZA 4R4JA 2ZBEA 3WSWA 1W4RA 1UQTA 4HWPA 4BEJA 5BVGA 1ORTA 2IEYA 4LOIA 1NE2A 1XRJA 3P2EA 2P9FA 3I1IA 2C2XA 3LL7A 3MTEA 4JJ6A 1H2ZA 4FZRA 4QPDA 5C3UA 3UWDA 2J9ZB 1HDEA 3MBIA 821PA 1KJQA 4BTLA 4I6GA 3MT8A 1QCZA 3EZLA 2ZKIA 1T2VA 4L75A 3OC6A 1B0PA 5FQOA 4D5GA 5KJCA 1TEXA 4GGMX 3ZV5A 3OZCA 4TMVA 3KSRA 5JSQA 5DK6A 4RULA 1ZOOA 2PGJA 2C9OA 1TM3E 4FIZA 4HB3A 4AC9A 3OIYA 2GKOA 2UAGA 2YMPA 3U4QA 2H1OA 2FQWA 3FA2A 4ARBA 2AXQA 4MARA 5CYOA 1CLUA 4B6QA 3VDRA 1B26A 4HQ6A 1VLZA 4B75A 3U16A 1ADCA 5JISA 1NF2A 5HS6A 4F2HA 2FZVA 2JFUA 4IIVA 1WB6A 2H11A 5F4BA 1PDWA 2A9PA 5E2IA 3LAWA 1NX6A 3RFXA 1DKUA 1YB6A 5DW0A 4AYXA 4ER5A 1VLMA 2K4MA 4OYYA 3U80A 1GCIA 3OU7A 3TPZA 2H4WA 3C43A 3TEFA 2I2XB 1ZAYA 2AS0A 1U7DA 2BH9A 2C77A 4GGPA 4WOJA 3DJYA 3M70A 3T35A 5CA1A 2JZNA 1T1SA 2WSSD 2CW5A 4WY2A 3TCNA 4Z5XA 5LNK6 4POOA 4HRVA 4OLHA 4XYMA 3WFIA 4LXXA 3L7OA 3V1TC 4F9GA 1TEHA 2ERYA 2OHOA 3GZNB 4F2GA 2OGZA 2X14A 2XNKA 3L9WA 5CGQB 3FOAA 5HM8A 4MB0A 1XD2B 4DFDA 2CXHA 1NNLA 1LA2A 1UBCA 2VP2A 4BVBA 2IOQA 3D7MA 4KRGA 1R64A 3TVDA 5J23A 4J94A 2YWGA 1NW6A 1PZXA 4R8KA 1UOQA 5AOVA 3A1CA 2CNWD 1TC2A 5BSVA 3AIKA 4RABA 2PNFA 2X77A 1VI2A 2Y93A 4HGOA 4BX8A 3KKOA 1JL3A 4BFXA 1ESMA 2QRKA 1NFRA 3K1AA 3CO0S 1OB5A 1MH1A 1JEAA 1JIVA 1NXXA 2UVQA 3IQHX 3NHLA 4JJFA 5H02A 1ZEJA 2W58A 4WIAA 3SJAA 4PIMA 1B74A 1E6LA 4DY6A 1E2EA 3EGDA 1OI4A 1JYSA 1U3UA 3KSDO 2YHIB 2Z95A 4GOLD 1O8BA 4TQ9A 1ND6A 4BP9A 5HEKA 3OFKA 3A9SA 4QHYA 4TMZA 5D85A 5LUBA 2O8FA 4I55F 2AOWA 2N1MA 3QLUC 1XWWA 1QOZA 3ZZTA 2A0FA 3U39A 2DFLA 4OIFA 1ISJA 4DQVA 3LCVB 4B83A 2GXAA 1VKNA 2QSJA 3DTVD 4HNVA 3NWEA 4IG4A 3ONFA 3WB1A 4KIFA 1NLYA 1NT2A 3ABOB 5BSMA 2PJRA 3G9TA 2E4VA 1WULS 3CPSA 1WCIB 4RPIA 3GN2A 1MB9A 4LXGA 4XPIB 1S2IA 5AW0A 3BD8A 4IHJF 2ISQA 1BXKA 5GM1A 4B8WA 2I2CA 4DG5A 2V3VA 5J58A 2FN3A 3U40A 1N2CB 4WT7A 3LC7O 3ZI4A 1RD4A 1HY3A 4HTFB 1EFVB 1NN5A 1Z5OA 2O8NA 3ZE6A 4AF8A 2R79A 5LP6C 2AUNA 2AD5A 1UODA 3D2CA 4B74A 4EW2A 3THXA 5BVGB 5HKKA 4UVGA 2ZRLA 2H7YA 1WLYA 1YZKA 2QLFA 2GBLA 4K9NA 5K4AA 5BSGA 2C03A 1YJ8A 1G9TA 2H4YA 3IUSA 3WGQA 5E1DA 4ZT3A 2Z2JA 1UKCA 2CNNA 3TGLA 2UUOA 3T61A 4BPBA 1W1UA 2IP1A 4GZLA 3H6GA 2QIOA 3GNTA 2RKBA 4KQKA 1KI6A 1T0IA