4MS3B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the endogenous agonist gaba
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
418
structure length
408
Chain Sequence
PPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWECLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/agonist
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
total genus 146
structure length 408
sequence length 418
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms3B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms3B01
4G97A 1EHCA 4TLMB 5CNJA 5TPWB 4ETNA 3BBLA 3GL9A 1W25A 3BRQA 3H5LA 2E4XA 2FMKA 4XLTA 3LUCA 2YHAA 4MQFA 3TX6A 4MS3B 1P6QA 5KQMA 4ZPJA 4HYEA 3B2NA 3NBMA 1JX6A 5ED4A 1ZN2A 1SD5A 2CHFA 1PNTA 5PNTA 1CHNA 1URPA 3L6UA 1DBQA 1M5UA 2GBPA 3OLVA 3EAFA 2B1JA 2LPMA 4MQEA 4PZ0A 3RVLA 5B3JC 1D4ZA 3ROFA 3SNKA 5B3JA 3GA5A 1USGA 3Q9SA 4G0YA 3URMA 2JB9A 4IMJB 4YCSA 4NV3A 3OO1A 4RWEA 3N8IA 5TE9A 3RVNA 1JFVA 3N0XA 2R4QA 5BR1A 1UDRA 4FB4A 5KC9A 2FXIA 3C3MA 2R48A 4Z4CA 4LE2A 2O20A 3O2JA 4F11A 4MR7B 4G0ZA 1JFSA 4NCAA 1W9HA 4OTZA 4KFCA 2E4YA 2QW1A 3KJXA 3RQIA 3L49A 1NATA 3TD9A 1VRVA 1A2OA 1VPWA 3IP9A 4Q7EA 5I4CA 3O75A 3O74A 3QELA 2LIVA 5KQPA 4N03A 3CG0A 5HSGA 1TJYA 4RXTA 4CBVA 5JNUA 1AB5A 2NZUG 1TVMA 3FDFA 3QX9A 4O1IA 2QZJA 4F06A 3GT7A 5TPWA 3RVMA 1TM2A 3P9YA 3O2QB 5GOTA 4MS4B 4MPTA 1YIOA 2P4UA 2WB4A 2FQWA 1QQAA 4YS6A 2I6FA 4MQFB 2NT3A 4YGXB 3TO5A 4MS3A 1U2PA 1DJMA 6ABPA 2PKXA 2FQYA 3O1HB 2BGGA 3Q15C 3TMYA 2HQOA 4WXMA 1ZGZA 2WWVD 3QLVA 4DADA 3FFWA 3JPWA 2ID9A 4DQDA 1Z15A 4KV7A 4Z0NA 5IUJC 4MR9B 5IBQA 3H5TA 1P8AA 1Z25A 4MLCA 5DKFA 2ZAYA 3M6MD 4RK7A 1KMIY 5HKOA 1S8NA 4RU1A 4O1HA 2WJAA 2P9HA 5JS2A 3G1WA 1K68A 3KSMA 1E6KA 3OMWA 2QVCA 1Z13A 3F6CA 4MLDA 3Q7SA 4Q6WA 2FTKE 3ILYA 2GWRA 3RVKA 3A3KA 4JP1A 4EYKA 3R0JA 4NCBA 1U8TA 4QYMA 3T6KA 2MSWA 4MRMB 3T8YA 2PUGA 3QLTA 2HQBA 2E4VA 4ETMA 4QICA 3KYJB 1ISSA 5FWYB 3SY8A 1NTRA 5DTEA 5BRAA 1H9CA 4ZMRA 1BAPA 5T3YA 2F8SA 3DLHA 4YO7A 3I09A 3O21A 1GUBA 4JAVC 1BDIA 2FQXA 1ZAYA 3QELB 8ABPA 3CLKA 3EDCA 4RKRA 4Z9AA 2AYXA 1KRXA 2PUFA 2FMHA 3N53A 4LDZA 4EYGA 4ML3A 6CHYA 1QPZA 1NXVA 1KRWA 1QP7A 3KG2A 3QLUC 3GBPA 4LE1A 4MS4A 3H5VA 4EY3A 2LBPA 1ABFA 4RK0A 3HJFA 1QMPA 5CNMA 3O1JC 3RVPA 3H6GA 3E61A 3H5IA 5T7BA 4W5QA 1GCGA 3VNAA 4MR8B 1ZVVA 1ABEA 3DBIA 1DCKA 1YS6A 2HPHA 5GQSA 2PUBA 1ZH2A 3NNSA 4EVSA 5KC8A 2E4UA 2L18A 4MR9A 4MGEA 1NY5A 5IEBA 1JF8A 5TQ2B 1QP0A 4F3TA 3RVOA 4ETIA 2H3HA 3H5OA 1PUXA 2FW0A 4HNRA 3QEMB 4RDCA 3VNBA 4Q6BA 4KREA 4S05A 3LUDA 1R8JA 3OLYA 3CFYA 3IPAA 3EGCA 3I5AA 1JFTA 3KS9A 4FE7A 3IPCA 3E3MA 1MIHA 1USKA 1OXKB 4G0MA 4MRMA 1B00A 4JB2A 2A9OA 5FWYA 1EFAA 4OLBA 1GCAA 3H1FA 3N0WA 3QLUA 4JASB 1RPJA 1A0OA 2H0AA 4RY0A 1PHRA 5HQJA 4ZJPA 1D1QA 1JYEA 4FE4A 1QKKA 3K9CA 1A04A 4EVRA 1MVOA 1ZITA 1DRJA 4RK1A 1GLGA 2VUIB 4Z9BA 5EWLB 3SQNA 3T95A 3MA0A 2IYNA 1C4WA 3K4HA 4OATA 5IC5A 1APBA 1E2BA 2R47A 4IMIB 4IGAA 3CG4A 4XASA 1J56A 3SAJA 1XHEA 1CYEA 4MR8A 3CNBA 1MAVA 2IOYA 2JCGA 3LUAA 5JNSA 1DC7A 3A10A 1VLZA 3JVDA 2PE5A 2IPNA 3HUUA 4KNYA 4YWHA 2HQRA 3D02A 2FN8A 4QYWA 2JBAB 4EYOA 4GNRA 1I3CA 4UHKA 3JY6A 2QSJA 5TQ2A 1E6LA 1MB0A 3QEMA 1JHZA 4RXMA 2CWDA 3RVSA 4EUKA 3I45A 4YV7A 4XFKA 3RVJA 4N0QA 3S99A 3F73A 3MQ4A 1ISRA 3FMVA 3N0RA 1QO0D 2RJOA 4D6XA 4RY8A 3OLXA 4MS1A 2LUOA 3MIZA 4D6YA 2GKGA 1RXIA 1TLFA 2JVKA 2E4ZA 4JOQA 5HM6A 3JPYA 2QU7A 3OQOA 1ZDMA 3CS3A 4KK3A 3C3KA 4OLAA 3O2SB 1RZRD 2M98A 2NT4A 3SM9A 4E7PA 2WJWA 4RV5A 4RXUA 3CU5A 4JA2A 4DN6A 4Z4FA 3C6QA 3LUHA 5EWLA 1CEYA 1BA2A 4KMRA 4NICA 4P1ZA 4KQ9A 5DLEA 5C5EA 2FLWA 4Y9TA 3LUFA 3OQMA 3KKEA 4PYRA 2R25B 4RK4A 1ZH4A 5TPZD 2MYTA 3LTEA 2PUAA 3BRSA 1YMVA 4JB0A 3CZCA 4UHJA 1DRKA 3FFXA 3KYIB 2OQRA 1LJUA 3H1EA 5DGCA 2IPMA 2MSKA 3HVRA 1PEAA 1M2FA 4L85A 4M88A 1QO0A 5KI6A 1OXBB 3D8UA 2JBAA 3H1GA 4QPJC 5C5CA 4E7OA 3OO0A 2E4WA 3QLVC 4H3KB 4H3HB 4PEVA 2FVYA 2GI4A 1JYFA 4NQRA 4RZSA 1FFWA 1AB6A 3GBVA 2PL9A 4RSMA 5D2CA 4MS1B 4IF4A 4IILA 3BREA 5EWMA 1U0SY 1M2EA 1EWTA 3EJWA 2HSGA 2A9RA 2J48A 3IDOA 4W5RA 4N41A 1F4VA 1E6MA 3H5WA 3NNNA 3LKVA 2Q5CA 1JBEA 3MM4A 5IUKC 3FFTA 3GV0A 4W5OA 3LUKA 3HK2A 1JWLA 3DGFC 2CD7A 5CNKA 2PUCA 1P6UA 4YRZA 4LZLA 3ROTA 4YR7A 5JNRA 3RVQA 3A0UA 5FBKA 1WETA 2M1ZA 4XAQA 1LBHA 2VUHB 1LBIA 3KLOA 4OBBA 4Z4IA 4B09A 1Z17A 3QEKA 5TQ0A 2WRZA 3HDVA 3Q41A 3HUTA 4Z4GA 4KK4A 2VYCA 3KCNA 1DBWA 4O5AA 3C3WA 2A9QA 5EWJA 1FFSA 3SG0A 4F8JA 2MYUA 3HCWA 1FQWA 4WT7A 2IKSA 4N0PA 3M9XA 2WMYA 3LFTA 5FBHA 1DC8A 4RK5A 1Z26A 1F51E 2HJ9A 4W5NA 3HV2A 1Z18A 4RY9A 3RH0A 4IRXA 1PNRA 1D1PA 1QNLA 1FFGA 1L5YA 2VK2A 4ZYLA 1QP4A 4S04A 2PUEA 4RKQA 3A0RB 3FGZA 4G86A 5JNVA 1HEYA 2JVIA 5EWMB 2QVGA 1Z16A 2FMFA 3IP7A 4WZZA 3JVIA 3C97A 5IULC 1DBPA 3UK0A 2JVJA 1EWVA 1RNLA 4N47A 3HZHA 3CTPA 1SXGA 1YK1A 3MF4A 2V0NA 1YMUA 4WXEA 3KLNA 3OMXA 3M9WA 5CHYA 2DRIA 1BVHA 2ZWMA 2GX6A 4WWHA 1RXEA 5JNWA 4F12A 4G0OA 3EQZA 1M5TA 4KRFA 1BDJA 1DZ3A 3QK7A 5FWXA 2L2QA 4H60A 1NXPA 5BQ3A 4TMYA 1FSPA 3I42A 5TQ0B 4LX8A 1NXOA 2CHEA 3CKMA 2NZVG 2XDYA 3LMKA 4MYRA 1JL3A 1DCMA 1T34A 3LUJA 4LDAA 4TLLB 3TB6A 4EYQA 1JH9A 5EWJB 2MYNA 3T38A 1YK0A 4RK6A 3CRNA 4KQCA 4TN5A 4D74A 1ZHHA 3H6HA 1JDNA 2W42A 3DZDA 3KTOA 5IX8A 3IP5A 3GYBA 3N75A 1ZESA 3EODA 3JS5A 3CZ5A 4EVQA 1EAYA 5E3JA 1SXHA 3HS3A 1P2FA 2FEWB 3OM0A 3Q7RA 1SXIA 3Q7TA 2PAFA 3CHYA 4G0XA 5F64A 2X7XA 1Z2EA 1K66A 1XWWA 3KHTA 3GWGA 2MYPA 4LE0A 1DP4A 1U04A 3QX8A 3EQ2A 3LOPA 3EULA 2IPAB 2N9UA 5KQGA 1GUDA 1EWKA 2L17A 3IP6A 3G85A 2F8TA 2JK1A 1U2QA 5TPZA 2KYRA 2TMYA 4Z99A 2IDMA 2FN9A 2MSLA 4MAAA 3HSYA 1SRRA 2NUBA 3UUGA 5IUNC 2RDMA 3NNDA 3W9SA 5JS1A 1DG9A 1JLKA 1KGSA 1YS7A 4KVFA 1LJLA 4GPAA 4G0PA 7ABPA 5KQLA 1MB3A 1ZY2A 5FWXB 3OQNA 4XARA 4G0QA 2JRLA 1RZRA 4XXHA 3HDGA 5DCLA 4PE5B 4PICA 2QXYA 2B4AA 2FLKA 3NHMA 2ID7A 2FSPA 4RS3A 1NXXA 3GRCA 4KZKA 4HNQA 4W5TA 2FMIA 3OM1A 3JTEA 4YLEA 3OLZA 2QR3A 1USIA 1LK0A 1L5ZA 4WUTA 5BRJA 3O1IC 3DLBA 3MMNA 3UKJA 3LUGA 2AYZA 4MQEB 4LRQA 2FKAA 2RJNA 1YVUA 2FEPA 2YHBA 3OLWA 4L4UA 9ABPA 2QV0A 3HM9A 3MYYA 2PL1A 3NHZA 5ABPA 1PEYA 4OG2A 1NXTA 3ILHA 1Z2DA 1D5WA 2OENG 4EGSA 2RGYA 5JNTA 1D2AA 3F6PA 2PUDA 3HXMA 4ZMSA 1DCFA 2PLNA 5KWSA 4YP9A 4Z4HA 4Z4EA 4MR7A 3F7NA 1XHFA 2A9PA 2PMCA 2L19A 3DGEC 1JDPA 1ZGGA 3BILA 3H75A 2WY2D 1Y1LA 1QQBA 2IPLA 4P98A 3HEBA 5IEJA 1BDHA 1Z12A 4N76A 5TQJA 2PJUA 1YTUA 4HNSA 3RVRA 4KPYA 1NXSA 2LP4Y 1IIBA 1NXWA 3HO1A 1TMYA 1C0EA 3N6VA 2FEKA 3LKBA 5CNIA 1VKRA
chains in the Genus database with same CATH superfamily
1CKEA 2CKDA 4HEA1 4HH4A 4W5TA 5ELLA 2NV0A 2RC5A 2H1FA 2QZ4A 3OZRA 5JROA 2XUGA 2G6BA 3F9IA 1EM8A 5LBTA 3HYSA 2DFKB 2KW5A 4D44A 1TF2A 3KLPX 1Z6YA 2OV3A 3EC1A 4FX2A 1EXNA 4HQ0A 1NURA 4NCJA 2IOFK 4XUGB 4ZEVA 4U7WA 1E2DA 4Z3KA 4PZAA 2ZRLA 3QZUA 1INLA 1QHEA 4WN9B 4UE2A 2AFIE 3MJRA 2I5PO 3NHSA 3RFFA 4A0QA 4KXXA 4J4TA 4M0CA 2FJ0A 4NEQA 5FR1A 4OI1A 3OE5A 1M0EA 4GQAA 4H1UA 3L8FA 1L4GA 4MUKA 3PGJA 3V4OA 5LMNB 5CM9C 3L0YA 1JR6A 1AN9A 3EXIA 4MVJP 4OQEA 3SX2A 1X7YB 3TPFA 4C6TB 1EFPB 2X7HA 2E5FA 2H2GA 4LDQA 1V25A 4BNUA 1JIJA 3Q8XB 4Q7QA 4H1WA 4EQ6A 4KIFA 3THWA 4O29A 2BMFA 2Q1UA 2HMSA 1UL1X 1V4NA 1E2NA 4TXJA 5JQGA 1CNFA 4QBKA 4CLDA 4YONB 1K4YA 4QARA 5JBNA 3ZVRA 4RHEA 1U0NA 1NATA 4L4SA 1U8XX 2V6FA 1FLAA 4HMOA 4M7WA 2EYUA 3HJHA 4BX3A 2AFHA 3IB3A 4J4HA 4N3CA 3AFGA 5DK6A 3OSUA 2IYEA 4QUJA 3QBEA 3TTTA 5KJCA 2MINA 3O74A 4FFPA 2G5TA 3IV9A 2IOHA 3UENA 3G6KA 4EEXA 1LNZA 1AXRA 4JB8A 5KAPA 2UUPA 4CBVA 5JNUA 3H1TA 3CMCO 4N48A 2BKXA 2ZWAA 4EH1A 5EP2A 3SX0A 4CYMA 4I2NA 3P9YA 4QGFA 2X22A 5GOTA 2ZXEA 3IHKA 1JDTA 3LPLA 4PC6A 4BLTA 4DB2A 4HDOB 2Q0QA 3FZGA 4A8HA 4WPGA 1W4ZA 1R4AA 1EFCA 2I6FA 1XF1A 3PXGA 5ICEA 1CUSA 2NT3A 2QJOA 3DTTA 3KJIA 1U2PA 1V7QA 3DJFA 4DDKA 5HOQA 3BFKA 1L7MA 1WHTB 4ABYA 2NTEA 4AJKA 1ECBA 1AS2A 4J0QA 1NWHA 1Q84A 4L51A 1RJ9A 3HKCB 1OU0A 3C4QA 1GDDA 5EIEA 5LKRA 5GIOE 2C3OA 5H0IA 3O8CA 4DUZB 4N9QA 2D4HA 4NENA 3ADDA 3S1AB 5CXUA 1KFCB 1JNYA 1E6KA 2Q5FA 5SZJA 4H9GA 3U7EB 4M9CA 1H1LB 1PR3A 3IVAA 3M8KA 4X6UA 1M2KA 4PYOA 2VJLA 5CG2A 5HKLA 2WHRA 2L0XA 3D5EA 2BMJA 2IITA 4OI2A 4JLKA 3TS1A 1KWGA 3V80A 1KOGA 2PT7A 2Q2OA 2BBSA 4KU4A 4P33A 3LXXA 5CAEB 3T6KA 4NCBA 4AY4A 2O2JA 3QTTA 1EB8A 1QS0B 1G5TA 1ZCFA 3QP9A 4IDGA 4GICA 4B2PA 5CCEA 3TSYA 3VO1A 4HUTA 3SQOA 4R84A 4MKXA 1FP2A 2F2TA 4O2RA 4AN4A 3KSRA 4FYYA 4YO7A 1RTTA 3DBRA 4REMA 2XXAB 1FYWA 4L28A 3GJ7A 4RMJA 3RSCA 1F14A 3UGTA 3SJUA 4CIYA 4JAVC 4M9SA 2HDNB 1Z0JA 2NPIA 5A1JA 3AR2A 1DEHA 1QX4A 2AX3A 3UIEA 4EKDA 3EPJA 3AERA 2J3MA 4DBVO 2FGJA 1YAJA 3HRIA 4JENA 4LN1A 5D00A 2PUFA 3PC6A 3ESAA 3QX3A 3F8WA 4MS4A 5DNAA 3PXUA 4MYTA 1G8GA 2XXJA 4ESVA 4YH1A 3HJFA 1X9HA 1Z7BA 4ZRDA 2VCHA 2R0QC 2DCUA 5BNIA 4P38A 3E22B 5K3DA 3QMWA 4DPMA 5JECA 1Z0IA 3AINA 1ST3A 2REXB 4LQ4A 3T9BA 4J0DA 3DHVA 1F8YA 4BFVA 3FPEA 3OAAA 2ZRBA 2DZDA 3ZHBA 4CKXA 1WP4A 1JF8A 1QP0A 3CUYA 1C4OA 3H5OA 5FQNA 3VZDA 2O8EA 1XRSB 1K4KA 4O4LB 5EKSA 4DC1A 2GFHA 4HPWA 4OHOA 3P4YA 1RE0A 4HQOA 1UDWA 3PGKA 4K26A 3CFYA 2IY8A 2F00A 3Q72A 5EHGA 3CEJA 2ORIA 3SHQA 4Z4QA 4FGLA 3QF4B 2Z5GA 1V16B 4MRMA 4R3UC 1VZ3A 2OFPA 5NLLA 1WKVA 2A9OA 3SYMA 3PFHA 2WSYB 2E18A 4MKHA 4NU8X 1EFAA 3A70A 1QRRA 2UU9B 2CNDA 2R1ZA 3OTIA 4MKFA 4RADA 4QECA 2I80A 3EFOB 5AM0A 3R74A 1HE2A 4Y2HA 1ADCA 3NO4A 2I4MA 2NP6A 3C4VA 2R6CA 1F0KA 1FUUA 1AQUA 4JGBA 3WB9A 5FEMA 4M60A 3GAMA 5LIRA 1RJEA 1TEHA 3HR4A 2QVYX 1DUVG 3UC5A 3IAFA 1YIAA 2IYNA 3W1VA 3K4HA 5IC5A 1BX3A 4DEYA 2FGKA 3ZDAA 2Y0EA 2FF5A 1L5RA 2ZYVX 2BFWA 4QAQA 2PU7A 1VKJA 1MAWA 5HGJA 3SAJA 4IEIA 1JSZA 4CMCA 3T4PA 1U7PA 3FKSA 5KTMA 4M0KA 4V2IA 1J2UA 2VNHA 4KO8A 4E11A 1YQ9A 2Z9DA 3P9RA 4RVFA 3SKYA 3PLRA 1G41A 2AOXA 4C4RA 2HDHA 4AIIA 3KB8A 1OAKA 1UAYA 3RCBA 4JXJA 4WERA 4EYOA 4HS9A 4IWXA 2VHQA 3E3NA 1W1UA 4MV9A 1Y6GA 3ESBA 3ZR4B 7MDHA 1V9LA 1PR6A 3H5NA 4XD2A 4BIIA 1FX0A 1RDFA 1XJQA 2BSQA 2OT3B 4H1HA 2AMLA 1VPEA 1G3IA 3JYHA 5TS2A 1L4YA 4V0KA 3H4TA 3K32A 5DM1A 2UZIR 2WI8A 2WYUA 3VFDA 1V6SA 2OHOA 3TTXA 5TMPA 4HEQA 2W2KB 4PZPA 3E8XA 5G0WA 4OJQA 2HDOA 1N5RA 4NCHA 3W4IA 3WJ7A 4PZ9A 3TDKA 4EL5A 3SR4A 5E6SB 1WDWB 3O38A 1UM9B 5E8RA 1OBOA 5KKNB 4IJQA 2NQ2C 3FUUA 1IY9A 4KRXA 3D4OA 2YN4A 2P9QA 3DVAB 3HBAA 3UYLA 4XGIA 2X2FA 4YJ2F 1JLSA 1I8TA 5CD9A 1VA4A 1SA0B 1GGJA 1G2PA 2X5JO 3VTZA 5LD2C 1SUAA 2QLLA 1AIPA 5LYJF 1HTBA 4BS9A 4OKSA 3SJCA 3EZYA 1K2WA 3PHIA 1GTL1 1MBZA 5FT9A 2UXBB 1UK6A 1FS4A 3FNHA 2O5EA 3ND5A 2ZSBA 1PWYE 4Y9TA 4ZT5A 1BD4A 3ORSA 4KBFA 1FFYA 1E0SA 1TCUA 2ZAGA 3HUDA 5BPHA 5FPQA 3ZCQA 3K8ZA 3ESQA 4LW8A 3VR4A 3HCRA 4EENA 1N32B 5B5SA 1LTHR 2CSXA 1PWHA 2XUDA 3E3OA 5EUBA 2YZGA 3OSZA 2G17A 1RKUA 3WBFA 2H4WA 1Z28A 2J5XA 4M88A 1PDWA 5I8ZA 3GPCA 1KO4A 4R2XA 2GVZC 2HA0A 1F5SA 3EG9A 1IXRC 2JL1A 4NHOA 4R6XA 4UMDA 1KJNA 3QIVA 1DJLA 4Z7QB 2C9BA 3ZKWB 1E6WA 1U8FO 3R7WA 1RXCA 2J9YB 2NG1A 4D4HA 2WHEA 1OBCA 1IVSA 5E95A 4M36A 1YR8A 3CPHA 2GLXA 2XUOA 2G72A 3CLUC 4LZJA 4Q3OA 4ENQA 3WYDA 3CRZA 1RIFA 1T9KA 3BREA 1SWVA 3CN9A 4JWTA 3TG2A 3PC2A 1Z06A 2GCNA 1N6LA 2OO3A 3AKEA 1N33B 1XKTA 1FNCA 5BSTA 4WNIA 2XTZA 2FK8A 1Z4KA 1KP3A 1PHPA 2VDKB 2W90A 3FX2A 3MUOA 1CQJB 3AVQA 5IUKC 2WD7A 3LUKA 3NVAA 5JCJD 3AF6A 4DUYB 1NNEA 2PR2A 3FCUB 5A05A 4DMMA 3JARA 4J2TA 1P6UA 4OK5A 4B48A 4RTMA 1RI3A 4E09A 4JR1A 4FOLA 4WNYA 3A0UA 1U9JA 3MOIA 4HGYA 4HJRA 3E0QA 5SICE 2HK6A 4TMXA 1FJ2A 4HO1X 4F46A 1N9KA 3QSYA 2QTHA 2K6GA 3G2QA 1NQ5A 1THMA 3HMKA 4NLLA 2PUVA 2NZXA 1YZNA 2GJ4A 3GGSA 1GG2A 3QEKA 3V2IA 2CYCA 3ZHYA 4YAKA 2ZXFA 4R7TA 4G1BA 3RC1A 3ZD9A 1QAQA 3ZTYA 2EZTA 2B4RO 4B17A 2YFHA 4F2GA 2RH9B 3H9CA 4DREA 1UBGA 4X8HA 5AK4A 3WB0A 2DM6A 3EYWA 1QIGA 3GLIE 1ZMXA 2FSSA 3DOCA 5AXAA 2ZM5A 2QP4A 2XA9A 4N0PA 3RADC 3K1ZA 2P75A 4P86A 1UPCA 4H18A 3BDAA 2W8BA 1ACLA 2BR4A 3FOWA 1JJ7A 1H6BA 3HV2A 4LWOA 4TRJA 1JI0A 4JR2A 1CZLA 1VQ1A 2HEIA 2XTAA 3RH0A 1FOEB 2FEOA 1DU4A 1FFGA 2NTVA 3I04A 4O4HA 3BGVA 3QV1A 2ZYSA 1OH7A 3GLKA 4QXAA 3F4BA 3FIJA 2XMDA 4GL2A 2VRWA 3NPMA 3Q40A 4WGGA 1ISGA 3I05A 4JQZA 2F7SA 1F2TB 4RVNA 1QK3A 2PA0A 4OL0A 2D54A 5JLAA 4LY9A 4ZYTA 3ZJVA 4IVNA 2ZVPX 2REBA 4NESA 3RIMA 2W58A 2CUTA 1U98A 1V1RA 2QROA 4BC1A 1F8GA 4HLCA 3PPVA 2V0NA 1YMUA 4PM4A 3SIXA 4EKYA 2H00A 4WZBB 4RFLA 3BE5A 1IB6A 1JG6A 3KJNA 3TJRA 1PYOA 1R9MA 2PNFA 3A1NA 3IBFA 4QTTB 4RVUA 2ONKA 4UDOA 4ZEOA 4PG8A 1M5TA 3L6EA 3ZXUB 1AUVA 2CKMA 2HAEA 3T4EA 1E3TA 4W1RA 5FWXA 4ZTZB 1PT7A 3GNLA 3PITA 5FQOA 2GXQA 4EOGA 4TMYA 3EIHA 3G7SA 4MWTA 1ZWKA 1E6EA 1T6XA 2DJ5A 4V0RA 1JHRA 4JBWA 4MWBA 4B8WA 2M1XA 5AVUA 3II6X 3R7AA 3WL5A 2WYHA 2VTBA 5KNBA 4K8RB 3A1DA 1U5BA 2YKGA 4NSNA 2VA8A 2B5WA 1C3LA 1U1CA 3ENQA 3EDOA 4NONA 4IJMA 2ZJ2A 1PTJA 3K15A 4FFMA 1REQA 3U60B 1V39A 3UBTA 2Z6UA 2OZKA 1IXKA 2J0EA 1IY8A 4G1FA 3ZCSA 3CVYA 3KLBA 1XVVA 3P2MA 5KSYA 3NGXA 4IHKA 5F3RA 1HF3A 3PA8A 1J24A 1SXIA 2OD7A 2MHCA 2R62A 5E0KB 3T7EA 4BYGA 5KYNA 4Y0VA 3C7CB 1QOZA 5CLHA 4I3FA 4ZVVA 1KC1A 1AKQA 4AO7A 4ETWA 1HXHA 1NWCA 2DMRA 4R0NA 3IPXA 4AJIA 2IPAB 4BBJA 4PQRA 1D6NA 1IWOA 1GRRA 3RSQA 3U3MA 3ZDQA 4EITA 4J3NA 1PVOA 1ADFA 1N4DA 2G5GX 2DQ4A 2O3JA 4ZOBA 1CU1A 2CF6A 2GWHA 3A7EA 4G5RA 4L08A 3ML1A 3MHPA 4ND8A 4Z99A 5TV2A 2XITA 2XUZA 3U3ZA 1UWCA 3WOVA 3CNLA 4DRXA 2KBFA 3UJBA 3MELA 1UEJA 3NUZA 3KRTA 4BAUA 1DG9A 4QJ3A 4FQ5A 2C2XA 1YAHA 4CI0B 1IDOA 5J5CA 1GAWA 4TQAA 4C7BA 1NVEA 1NKTA 4ZJUA 2JFUA 2ZI9A 2DPXA 1Z5GA 9ATCA 1EM8B 3CEMA 2WKSA 2PMFA 3EA5A 1QFXA 4PE5B 5KTPA 1NVBA 3VPDA 2HA6A 2PIDA 2C5AA 2ASVA 2JGIA 1IG0A 3AHDA 4LYYA 2EFYA 4OBEA 4DCOA 3IYLW 3GRCA 4AJLA 2P1DA 5COAA 2XE6A 1RQ7A 2FHPA 4Z51A 3A4YA 3T52A 1QYCA 1TQ4A 3BMXA 5J4KA 2IUYA 4BLPA 2QDXA 5B58T 1QM5A 1ZQ1A 2VCEA 4LRQA 3TZKA 2RJNA 3KPYA 4C4OA 2FEPA 2E4AA 1FU8A 1QZZA 2PS9A 3HU3A 4CMJA 3HM9A 4JBIA 3C24A 4MV0A 1G4UR 1KERA 1PEYA 3AP2A 1YS4A 2GF9A 2BRUC 2BM1A 2X15A 2YWDA 3KD2A 2X23A 1TRKA 2DWOA 2GJAA 1EFPA 3AUSA 4G07A 3LGXA 3ZWVA 2NM0A 4M89A 5KTSA 4QATA 1SAYA 1JKMA 1IN4A 1SHKA 2KJQA 1XA0A 2RGYA 2EKDA 2OO5A 3EZ9A 3WGZA 4O25A 4U0KA 1NOJA 3EIQA 1YBAA 5BMVF 1DKRA 3ZK7A 2A9PA 4ZOLF 5JQGB 4NBRA 1MOZA 5DTIA 4B6RA 2ZAOA 3QQ5A 5I8WA 2P9EA 3FFBA 4YV2A 1UOQA 3DLHA 5ENDA 2Q29A 3OOHA 2RH8A 2VYND 1UF9A 3C8UA 3L8HA 1HTWA 1ONPA 2AC4A 3LOQA 4RTLA 4RGQA 3OU7A 4NCIA 2HIMA 4CM7A 2O2GA 1TMYA 2WLTA 3JASA 1IC6A 1CV2A 3PJFA 4B4WA 2ECPA 1YJ5A 3AFOA 4ME6A 1R6AA 1BQ3A 2OB1A 3CF0A 3CINA 4G89A 1T9HA 1CQIB 1N6RA 1YDFA 5K09A 5F3WB 2Z0MA 4YT2A 1A9SA 3JQFA 2WT8A 1QR6A 1JHYA 3DAHA 3NP9A 3RREA 1F12A 1L8XA 4JDPA 1WNFA 3KAPA 2EYQA 4YQEA 2O2XA 4WV3A 1TPYA 1I6MA 4L3OA 4B34A 2D2IA 4ARUA 4EB8A 2CHFA 1IPHA 1TU4A 1QE3A 3DW3X 2ZRKA 3E53A 5C53B 1NMQA 4FB5A 2P3LA 2LPMA 3DL2A 3V4ZA 4HFJA 1BOFA 1GPNA 3ROFA 1JR2A 3BAZA 3PIDA 1G4HA 1VE3A 1CR1A 2WILA 5B53A 3WRYA 3VJMA 3UT5B 1PJRA 3GH1A 3LECA 2RGXA 5TE9A 3N0XA 2R4QA 4TLAA 1UDRA 2CJYA 4MP8A 4LE2A 2JZOA 5JFTA 3ILXA 5CFLA 1BG6A 1T1IA 2IXAA 1EPUA 3SZOA 2C5FA 1A72A 1QS0A 4K6HA 3TLBA 3TQRA 3MB5A 2I78A 3EIXA 2ZT8A 4CT4B 4LI0A 3FR7A 4EZEA 2ERYA 4YP7A 5JCXA 4YT4A 1SQ5A 3GIDA 3H4VA 3K53A 5JY6A 4LJ7A 3IP9A 1XQVA 1E9EA 3JQAA 4G85A 1QAMA 3G0CA 2R5WA 3SIPA 2QRUA 2W9XA 2DGDA 2ZSEA 1BKYA 4CEJA 2F1KA 4HSEA 3BXZA 4M49A 1P81A 2P2GA 5FPHA 3AERB 1KAQA 2CMDA 2V4MA 4XLZA 3GT7A 5CFZA 2H2IA 1E3SA 4C4SA 4J1TC 8ATCA 1QO7A 2PTGA 4MVJE 1X94A 3CT6A 1V2HE 2ECFA 4UREA 2JI7A 2WWGA 1DAEA 3EEFA 3P0IA 3PE3A 3VPHA 1GSIA 2O3RA 4BRUA 5I5EA 1KZYC 1O95D 3CZPA 4OQ4A 4XYBA 2JD1A 3KDAA 1V7ZA 3PLNA 2HU5A 2GBGA 5JYCA 2BDUA 2FAXA 2FQYA 3DOFA 1O77A 1F2UB 2IP4A 2JJMA 4HWRA 1M2OA 3PD0A 1TLLA 4JODA 4PY2A 5AO9A 4TT3D 4RV4A 4WXMA 1SQ0A 1VB3A 5DGIA 3VH4A 3THRA 1ICIA 1QIEA 2Q21A 4WACA 3JPWA 3ZW9A 4EPWA 4ZCTA 1NPYA 1SMKA 5DXJA 5K8LA 1D8TA 3OTGA 1ZRMA 3DOOA 3M6MD 2FF7A 1ZK2A 1T9GR 2XOKA 4HAOA 5F35A 3RKUA 3ZDXB 2AR0A 3KKKA 3P2YA 4O1HA 4D98A 5C8XA 3HXQA 4ASUA 1K3FA 4U00A 4B4VA 2Q99A 2XOKD 3TAUA 1EUZA 5BWNA 5F7OA 2YVQA 2IXBA 4EEZA 1KETA 1AXEA 2GM5A 2XNDA 1SU7A 1RPTA 1XUOA 2P2YA 4FYHA 2AZMA 3R0JA 4GPZA 2GCOB 1RP1A 2XH8A 4Y9RA 4MRMB 2WKQA 5GJVC 1C30A 2W6OA 3ITNA 4HP8A 4ETMA 1JJFA 5CJ2A 3K6KA 4ZAYA 2ZJ0A 4EVIA 3QG5A 3MK31 5HE9A 1R5NA 4B6OA 4JYBA 3EFOA 3GUYA 3GDFA 3M4JA 2VKTA 3KTAA 2W83A 1UBRS 5FAKA 3SBDA 4P4UA 2I8AA 2PJZA 1OH6A 4BFWA 4ADSG 2ZS7A 1ZLYA 3QEJA 4F4UA 2XNJA 3M6LA 2AUTA 2Q6TA 4JL5A 1T29A 1KSHA 4WNCA 2BT4A 3ZS8A 4KUEA 4XFJA 3DEJA 3HXLA 4KAAA 1BFUA 2XOXA 2YXEA 1BCRA 3HY6A 1RFLA 1MW8X 2CVHA 3O1JC 1KOJA 2XZTA 5MN4A 3V4RA 4W5QA 4Z2AA 1C14A 1Y1SA 1NUUA 1WCWA 4QTUB 2PX3A 1YU6A 3DF9A 1ZH2A 4WK2B 3QY9A 4R7ZA 2FUG1 3S40A 4NOLA 3R5KA 3PG5A 1DAKA 4CEHA 1I32A 5ENZA 3RC2A 1FFDA 5CXQA 3I1IA 4GI7A 1K8ZB 4TXMA 3N8GA 5K4GA 1FEZA 3U31A 2ZRCA 1NVVQ 4EWLA 3OLYA 2JAPA 4PCVA 3CTMA 1U9ZA 5IVIA 1YZUA 1BTOA 1K2VN 3HY4A 5AW7A 1ZIDA 3PFNA 5I5GA 1IM2A 2FPIA 3QW4B 3V1NA 2GRUA 3KS9A 1DV2A 4TTIA 2Q5HA 3B7GA 4PRLA 1OLOA 3TD2A 4HDSB 3ONVA 5GOZA 5KAMA 3IL2A 2GYYA 5JISA 4A15A 4E1BA 1NW9B 2HF9A 2R6AA 1RWXA 3DE7X 3OX3A 2X0KA 3Q87B 4MKGA 2V6MA 1E8MA 4N40A 3VVCA 1XVTA 1JAIA 1JDBB 1UPBA 1E3IA 2ACVA 1FTSA 1TUIA 2E37A 3QMPA 4IH1A 3FROA 1TGVA 3O8DA 2WK1A 4M6WB 4N3NA 2NZ2A 1DRJA 1II8A 1ZZGA 1SNYA 2JFZA 1VJ1A 5MFZA 1QGDA 2AOVA 2BONA 5DULA 1Z6AA 3AF1A 1P18A 3M6AA 5E4TA 1J2RA 2G1PA 3LO8A 4EKIA 4U39A 4HH0A 5I47A 1JIQA 1V43A 2J4FA 4IGAA 5CT4A 4D0RA 1R0WA 3GX1A 2NU8B 4F7DA 1CR0A 3O8BA 4FHEA 1PG0A 3B6MA 2X6RA 1BDBA 1SUCA 2YWCA 3PC8A 3RFUA 1PYDA 1DUSA 5AKEA 2OHHA 3JZMA 4FCVA 3AC0A 2GPJA 3FDJA 2FN8A 1B8NA 4P92A 1U99A 4KH1A 4L4XA 3SVZA 3TL2A 4UHKA 4AMBA 4YRGA 5LUAA 3D2BA 1NLMA 1QGED 3EAGA 1MB0A 4WVLA 4F4HA 4QIHA 1XAGA 5CVVA 3JALA 4N3GA 4MLZA 4D0NA 2QV7A 1LLFA 4FK8A 4I4NA 4JP5A 4XX0A 4W5WA 5T64A 1JFRA 1T0IA 1YBMA 4RESA 2GZDA 1PK9A 3W3AA 5AVOA 3RLIA 2IJGX 3A6PC 1E9FA 2C61A 4ZQGA 1EBBA 4K6OA 1RHUA 1Z4JA 2CL0X 2Q4EA 3GCWA 4PONA 5G1OA 5AVZA 3LWNA 3KWMA 4FZ3A 1FRNA 2RHOA 1S2IA 1CQJA 1JDVA 1KMNA 2WZCA 2QD3A 1Q20A 1WR8A 3DR3A 2D3WA 4IGKA 3S27A 3ZU6A 5HFNA 4EHDA 3D4IA 3H11A 3I0NA 4EPRA 3BQNB 2JHCA 3CEAA 5CLLA 3CZAA 4NH0A 1ZMTA 2IEZA 3AIOA 5F23A 3UMFA 5BSWA 5BV2P 2P4EA 4DNXA 3EOBI 3H2BA 3CU5A 5CW1A 1OOEA 6Q21A 1MPTA 1D6MA 4XR4A 3KKQA 3WOHA 5JQWA 4GP9A 3LGAA 1QU2A 1BA2A 2QG4A 3TCKA 5SYNA 5DLEA 4R05A 3ZI0A 2RAVA 1IK4A 5C8VA 2BGIA 4NZOA 1Y34E 4JA0A 3OQMA 1T9ZA 4HAVA 4NU0A 4OXYA 4TTQA 1KEVA 2AJCA 1TYDE 1L7AA 4ATNA 3M3HA 1DAOA 4YRMA 2JCXA 4F4FA 2CJWB 2RG7A 1KAGA 1X38A 1MNAA 3M9LA 3GFRA 5JD4A 5I7UA 2P40A 3HVRA 1COZA 4DMFA 5BV8A 5DMXA 3U7QA 2EV9A 1JAXA 1FFBA 1S89A 1OFGA 1W0JD 2IEGA 2JBAA 2R4TA 3H1GA 1IXSB 5DX8A 1SBYA 3RVKA 1PGNA 1CTQA 4BV2A 3HZOA 4DG9A 4NZMA 3UPTA 4RENA 4DCGA 3R0QA 2Q6VA 2ZBEA 3ZQKA 3BHJA 1BVRA 1P91A 3H0KA 4TS9A 7AT1A 3ZU3A 3W3ZB 3FSGD 2PL9A 3RT7A 4U5QA 3PXAA 1GNPA 4X24A 1G38A 1OTYA 2AEJA 5HK8A 3EJWA 1M2EA 1XZMA 2DPGA 4N41A 1F4VA 3O73A 1MZPA 2WJ6A 2Z3ZA 2ZK7A 2BKAA 1M10A 1DC5A 2I34A 3OH8A 5EJAA 2XSZA 5D7NA 2FPOA 2R00C 2ZREA 3LT5A 2UUAB 4BO2A 5HK9A 3VOAA 1UFOA 4LXHA 5G4LA 3FDZA 1DV1A 1RWOA 3HI4A 3N59A 4HVTA 1SXJA 1WMAA 5AUQA 2JIOA 3N76A 4Y9SA 3ZH2A 4ZDKA 3RS0A 4XGQA 2PZ8A 4TYWA 4QOIA 4B09A 2R3SA 2H9YA 3KOXA 4X84A 4MUGA 4J03A 1H65A 2P11A 5T8KA 1X7ZB 1DTWA 3C7AA 2VYCA 3IXMA 3RIYA 5FTWA 2Q9UA 4IM7A 4O5AA 1U5BB 1FFSA 5CA0B 5JVDB 2AEFA 4NXMB 1QCCA 1TQHA 4B6FA 1BXRB 1ML3A 3G5MA 2WMYA 3KYDA 1ZGBA 2P67A 3AYXB 3LFTA 2H59A 1AUQA 2QS9A 4ROTA 5EQFA 2CCJA 2B8JA 3KB6A 1G21B 1OT5A 1J90A 3NRCA 2X2PA 4ON9A 3R09A 2Q6IA 4H08A 3UMGA 1C8VB 1K3TA 5EVCA 4AS2A 1V96A 1OFHA 1T1RA 2J3DA 3DOUA 3ZJYA 4B79A 4BO4A 3FGZA 1D2GA 4MRSA 4L07A 2FFRA 4HQRA 4XFDA 5FUBA 3OZTA 2P41A 1CF4A 1Q15A 2PXHA 3ELYA 1OVMA 4DC9A 2B82A 1HMPA 4QFDA 3D8NA 1YOVA 1IQ0A 3LSYA 4MULA 2EQBA 3LVBA 4IXWA 2M6SA 3MJFA 1MDBA 1JP7A 3ODGA 4GI2A 4II7A 3IBGA 1OJ7A 1VE6A 3HZHA 5KREA 4GZ3A 3L7JA 4YRAA 3HJGA 3DO5A 5KWJA 2TMGA 2B21A 2C84A 1QRDA 2BLNA 4W9RA 5DLPA 1XVUA 5H83A 3WLMA 4A03A 2AV6A 3A6LA 4DAOA 1O57A 4XIJA 2D1TA 2VSXA 5THKA 1U5AA 2AR9A 3TE6A 1N5LA 4GBMA 3X1KA 4JT2A 3CUTA 2VF7A 3EQZA 1VP9A 1AM4D 1BDJA 3EMKA 1WQ3A 1LPAB 4HEHA 1ZX1A 1UCFA 1UC9A 2QK4A 1UBFA 1E3WA 1X7WB 3H2SA 3PFIA 4G23A 4Q1CA 4YI3A 1MO3A 3PCXA 4JP8A 3I42A 1TT5B 2B3DA 2FG7C 4OLHA 4ZQEA 2ATXA 1H23A 1K9SA 5DYNA 3LUPA 3SEZA 1OLUB 4HH1A 4LJKA 5COQA 2CB0A 3TJZA 5KYTA 3C3JA 3GMIA 1JLLA 1Z75A 1T3ZA 3MCUA 4GEKA 4UZFA 5AVWA 2BJVA 4RMIA 4WDQA 5BXYA 2DR0A 2NU9A 4RDHA 3CPEA 5D5PA 4D74A 3AZOA 4Q3LA 3HXTA 1V5GA 1PT8A 1LA2A 2RC6A 1L5NA 4OXIA 3EF3A 4W9NA 2AZDA 4UZEA 1U1EA 2CK3D 1XZ8A 4BMZA 2XZDA 3GUHA 3ZQJA 4DDWA 4LXUA 3VSDA 3C5VA 2WYIA 5BXQC 3CLHA 5EPUA 1O95A 2Z2IA 3U4IA 3KO8A 5COBA 3RE1A 4AUMA 4I1UA 2GEVA 4FWBA 3DYBA 2YWJA 3KQPA 5IKMA 3IGFA 1FL9A 4RA6B 3DF7A 5BWLA 4RKYA 3HN7A 3FBGA 4JI3B 3ZX4A 5FWNA 4RTPA 4DJAA 1NC3A 1GUDA 2RGRA 3W7BA 1O7JA 2WE7A 5EHQA 4OHXA 5TMEA 4AU1A 4CG1A 4ZO9A 5HJ7A 4JJEA 5KUTA 4F5YA 1XGKA 1CUAA 3CH6A 2J4CA 3NATA 2YW2A 5ALUA 1MW9X 1SRRA 3KAKA 2V7PA 3R20A 4BUZA 5AKHA 3NB0A 2A0WA 3EIFA 3DZHA 5CB8A 4Q1FA 3UANA 2YOGA 4A0FA 5JTTA 5JS1A 3QUAA 4NAVA 1EXWA 2AQKA 4LBZA 3HB5X 1T13A 4S1VA 2O23A 2DKOA 4HK4A 2Q07A 4GSLA 5ALHA 2RD2A 1RZRA 1X7XB 3KKNA 4AS1A 2PBZA 3RBXA 2NSLA 4MVJH 1I1HA 1AK9A 3FCEA 1K4MA 1RJGA 1HE1C 2HSDA 1BD3A 2Q1SA 3N0VA 2A57A 4I66A 2D1FA 1FMJA 3WIVA 5E9QA 1O9GA 2VXBA 3EWIA 3G9XA 3TX2A 5JARA 2YYAA 2OYCA 1H0SA 2PRIA 1A7JA 7MHTA 4FXOA 4XYLA 3VTFA 5SZKB 4LZOA 3HJAA 3UKJA 4QVGA 2HF7A 2C0PA 1QH0A 2H31A 3SHVA 4TXNA 1IHOA 1YVUA 2OBXA 3D6NB 2ANBA 3OLWA 4PINA 2AEMA 1S4QA 3VO8A 1AQYA 1PLKA 4G5FA 4J1QA 3ABOB 1H22A 3ADKA 3DUWA 2ZJ5A 3ILHA 1PEKE 1PJ8A 4GRDA 3ZCUA 3R3YA 1H2RS 1VLMA 1SQSA 5AI5A 4UAUA 2I62A 2GHQA 3PJEA 4HLUA 2FDCA 1ZD8A 3KJQA 5BQOA 4TLCA 2A78A 4YGYA 3F7NA 3PR3A 3CJRA 3GRRA 3P8ZA 4D57A 2JFHA 4JYCA 1TYBE 3KP1A 4JEUA 4OQPA 3UA3A 3S2SA 3K6SA 2H65A 3F47A 5C31A 5DNEA 3ZNNA 3E18A 1UKEA 4XVUA 3VO2A 5HFAA 4P98A 3WGGA 3O9MA 1CR6A 4V1CA 2VHEA 3W79A 2OBFA 2PJUA 4ND3A 1NVDA 5ALQA 1N5DA 3BXGA 4ND5A 3BSWA 5FXMA 5EJ5A 3GRYA 5HBRA 2AG6A 3EPRA 5EXTA 1IIBA 3O93A 3RNLA 5IAJA 4DGQA 1GVNB 1JR3D 1VKRA 1VP3A 1H42A 5C1DA 4A6PA 3R0ZA 4LJ8A 1L3CA 3HFSA 4WNAB 4YREA 1G42A 1OFUX 3SHFA 4AZTA 4D9FA 2HEGA 3PD1A 3OQHA 4DUGA 2QL6A 3HU2A 1U6IA 4HRXA 1XV5A 3PCRB 3W9UA 2VQEB 3FYUC 4Y8VA 2N0SA 4B6SA 3AJ8A 4JI1B 3BCRA 1K86A 3LBFA 3JQ8B 4UOZA 5AUNB 5JQGF 5ARDA 5LWQA 1TM4E 4JYAB 2HK9A 2CXSA 4QBTA 3AR5A 3U6BA 4I5DA 3UH1A 2XRYA 4Q05A 2NAFA 2O6LA 5A04A 2UZ4A 1Z4QA 2QNIA 3KQMA 4JELA 2OO5C 3TLGA 3TSCA 1CNMA 3BD9A 2NV2B 3L1KA 4D9CA 2CBZA 3STVA 5B3JC 3WYNA 1U2DA 1KNXA 1P5ZB 1QF7A 2FZGA 4N5IX 1SG0A 5GV8A 3IBTA 5K8IA 4RWZA 1KI9A 1S8AA 4L6AA 1NFFA 3HKBB 2XGJA 4I1SA 3GUCA 3IT2A 1JFVA 2JZNA 2QQ5A 4CJXA 2JGNA 4R1LA 1VE5A 2Y76A 3FPHA 1U2TA 3WNCA 5BVHA 1WIWA 4OQFA 5DSTA 5IS2A 1XTKA 1ZU5A 1WSWA 3M6XA 3QPAA 4G5SA 4H0FA 1L9KA 2PO7A 1E1CA 4YAIA 4N82A 3MT8A 2QW1A 3SWWA 1V6AA 3TPZA 2IY7A 5HF5A 2VCYA 2GHRA 3D3NA 3FZNA 3P0FA 1S9DA 2XMQA 5BYJA 3OIVA 4J7AA 3WWPA 3TGLA 1FJHA 3ZN2A 1KJ8A 1YCGA 3AG6A 3ZCRA 4IWYA 2NUTA 4PLFA 2DY0A 5EZQA 3TNLA 3G9ZA 2ZIWB 2PKYX 1OFTA 3BWYA 5C1PA 2GCIA 2O57A 3T7KA 2R6DA 4Q0MA 1FXSA 2VG8A 1UQRA 4IRMA 1TM2A 3BH0A 1KZ7B 1MG0A 3HNRA 3R2JA 1ORRA 3CLVA 4ZEXA 1CC1S 2IPOA 3FUWA 4KO3S 5BN4A 2H1HA 2P27A 4LZNA 3PWTA 3ED5A 4POAA 2J32A 3F7MA 1K8QA 4YGXB 2GXAA 2PTHA 2VPTA 2QE6A 4PV7A 4R2MA 3R7BA 1Z5PA 2RK3A 1XL0A 3HLYA 4Y6LA 1C9EA 3K8YA 1E2EA 1DQNA 1YT5A 4NULA 4D97A 3FFWA 4DPKA 5AIBA 4UEWA 1B0AA 5GZ6A 1L4MA 4YT5A 4XIIA 3IR5A 4NH4A 3FMGA 1NM5A 2ZAYA 3G88A 4FYXA 5KOIA 4IHQA 2JGEA 3K1TA 2O4CA 2YL2A 3T3DA 1WY5A 3W5JA 3ZGXA 3OMWA 5ULLA 2WP0A 4WH0A 4BRSA 5BORA 5JAIA 4LYFA 5A6VA 4IQGA 3TF5A 1NVGA 4KKVA 2GWRA 5FTKA 4UQPA 3VMFA 3D3EA 2ZIVB 2WFAA 4Q4AA 1M8GA 4COKA 3NV9A 2PWAA 4U6NA 2AN1A 3L0CA 5CLIA 4YO8A 3U3XA 1FTWA 5K6AA 2FG6C 3FVRA 3SI7A 1OTHA 4F5DA 3ESYA 4NNJA 3T1YB 3HWSA 4ZGGA 3VUEA 2B37A 2B4YA 2JLZA 3IA7A 3D3KA 4JNCA 3TLXA 4J1NA 5AVYA 4D6PA 1M5RA 3M1LA 1NPDA 1ESNA 5DWQA 1X13A 4CR8A 4RANA 2CW5A 2CEAA 5LDHA 4DIFA 4YPVA 1NQUA 3BJMA 4M1OA 2G28A 3JQBC 4MHSA 3UY4A 2H5EA 3ZWPA 4ZO6A 4BO5A 1H0KA 1NSYA 4EW3A 4RHFA 4U7DA 5HIKA 2HSZA 3KG2A 4AAYA 3H5VA 2PVCA 3R8CA 1YHNA 4XTRA 4KFRA 1XZEA 1MJGM 1WMDA 4ZDIA 2PUJA 4WLEA 2Q3MA 1KEWA 3BIFA 4DR5B 3F2VA 2QT1A 4ERNA 1XWFA 5FFMA 3KXKA 4NWIA 4DV7B 2HUNA 1B8PA 2HU7A 3I4FA 3MINA 621PA 1P80A 1E7SA 1NY5A 4MV3A 3B6IA 1CERA 5FTLA 4MEAA 1GQOA 1RU3A 3VNBA 1U0RA 3M3PA 4N0DA 5DYGA 3W5BA 4KREA 5IKPA 3W8NA 1U7WA 2C1ZA 4OK3A 3MS7A 1WZIA 5IJXA 4LRWA 1QVVA 2JHAA 1OXVA 2WF5A 3S68A 1XP8A 3NH6A 3UMVA 1WDMA 3KJFA 4BQOA 1JFTA 1SQFA 1GQSA 3ZWBA 1XMIA 4MZDA 4MRAA 2B6NA 4YQZA 5EXSA 2OGZA 2XZLA 4C7JA 1GKKA 2FU5C 4AFNA 4I9NA 4UAVA 1T3GA 4BQIA 3IIIA 3HFRA 5G40A 3REOA 2WU4A 2PHZA 1RBYA 3DVRX 2XPCA 4RF2A 3GLHE 5HQJA 4GXQA 2VP2A 4NS4A 5ARCA 3MD0A 3I5UA 4LF6B 2QLNA 3KOZA 3FKQA 2XTMA 2BUBA 2OG1A 1BHO1 1SC4A 3G2IA 2FG5A 5AKXA 4C78A 2VNAA 1YKGA 2R7AA 1UBMS 1ETUA 3PPYA 2JJ1A 5JSYA 3SQNA 4QPPA 3I01A 1GRNA 4HWOA 1RWKA 1L9XA 1Q77A 4INAA 3X43A 5IWAB 4QGSA 2R47A 4PZEA 4V24A 4ENVA 1RC8A 4JVMA 4FFBA 4OX9Y 4CMKA 2W6JA 5JALA 2IIVA 2HLHA 3IHLA 5A3QA 1K7YA 3P1JA 3IRVA 1IZ9A 3IJEB 3X2FA 4GE3A 2GF0A 4GOMD 4FOPA 3E9EA 3ITEA 4EI2A 1GGVA 1V8OA 1ISFA 3D02A 2GBCA 4AXXA 5AHRA 4DSTA 1KC3A 3RYHA 2DLDA 1OYOA 3HACA 3BZWA 4QG7A 2JBAB 4A92A 2Z5FA 1PZHA 4PC1A 3V4VB 5IXJA 3R0XA 1T0JB 1J97A 4I4CA 1MB4A 4XR9A 1NQVA 2GAJA 3WYEA 2NPFA 3UXEA 3B6KA 3UJAA 3QH4A 1YA6A 1PR0A 4N0QA 4YFYA 4M1SA 3MQ4A 1ISRA 3FMVA 4UHFA 3TI9A 4UU0A 4AXBA 4E5DA 3OZFA 2XQGA 2HLPA 4FLFA 3GLFE 1JA1A 4CMIA 1Z7WA 2LXNA 4FS8A 3LFHA 3MIZA 4XLLA 4XWYA 1WSDA 2F9LA 3JYOA 2Z95A 3NG1A 4V02A 2ZSJA 3WTBA 3CVWA 1KOFA 2J59A 3DQZA 4WN3A 2YJNA 1XF9A 4JUFA 3D4LA 4EPYA 5A4DA 5A9SA 5M3BA 2YXNA 3DMYA 4FSXA 4C1NA 1D2EA 2BEWB 2IZ7A 2O2CA 3C3AA 3FFAA 2BL4A 2Q8PA 1IOWA 3G2JA 4P3NA 5EGSA 3TIFA 4MUIA 3UB3A 2H48A 1BKDR 1C1YA 3FDZB 4HMPA 3M4ZA 4X94A 1SXJB 1OHHD 4P34A 3OPQA 2ADMA 2HO4A 2J9GA 4FZJA 2YTZA 3K70D 4BVFA 1PQ4A 1MR3F 1Z0SA 1I51A 1MB9A 2CLHB 2H9AA 2Q4BA 3NHYA 1LX6A 2AOTB 4RF5A 4TZTA 2YYZA 5AJHA 2ZJAA 2DWUA 5I7OA 1NLFA 3W1EA 5JLJA 1NAHA 3LQ2A 1B0PA 1DTWB 4Q3CA 3ZGOA 1F0NA 1E1QA 1UODA 2FDXA 2C4TA 3E7WA 3EMBA 3EVCA 2IF0A 4RYLA 3V8PA 3KQWA 4CQLB 2UVPA 4AQYB 2GN2A 1PJ2A 3PK0A 4U3JA 2AFIA 5EPOA 3IUPA 5C1IA 3ZX5A 3LK6A 3UJ8A 4B7XA 2CVPA 1E99A 4D9GA 1QO0A 1XDGA 4HS4A 3D8UA 3JYLA 3INGA 4RLSA 5KCMA 4JCCA 3ZWDA 2XVXA 1G21A 2HNBA 1Z4PX 4D82A 4RM3A 3TOSA 4HR7A 2O6HA 3IUMA 1QIIA 5B6IA 4LY3A 1FS6A 2I29A 1RR6A 2OFFA 4K9MA 1DTSA 2P7IA 4KRYA 4MV8A 3LNTA 1GN8A 3SP1A 1F38A 4IILA 4TMTA 4X41A 4YECA 3ROKA 4KGXA 1IRIA 3FTFA 3IDOA 2A9RA 4CGZA 5DVZA 2G0NA 3E1KA 3GZJA 1I3KA 1YQEA 3GHHA 4HWPA 3TQIA 4PC7A 2O0LA 2R2AA 2Z8ZA 1EFDN 3GV0A 4Q4HA 3SQDA 1Z2NX 3GLQA 1P2BA 3INRA 4MWOA 4MX8A 1NQAO 3BUSA 3JD1A 3MXOA 4L5AA 1MFZA 4W5JA 4KDFA 1PU2A 1HNWB 1KWKA 5DISB 4GDFA 1MJGA 1C7FA 1ORTA 1U3FA 2BV3A 3NC0C 4E46A 1GVHA 3JWGA 3OEHD 5LD2B 3DB2A 1H4SA 3IEXA 1U2EA 4ZGBA 3JD0A 5IU6A 2VUHB 1C50A 1J1UA 1BMFA 2H2AA 3AY6A 5LOVB 4XEUA 5B12A 2DR2A 1QHFA 1H93A 3IP1A 4RD4A 5CXSA 2AZTA 1ECPA 1C4XA 2HKIA 3DQQA 3WY9A 2V74B 4E5NA 2C83A 2Z8XA 5BQXA 3U49A 1X7GA 3P52A 1DBWA 2DAPA 3HZRA 2BBOA 5ERYA 3TRIA 2SHKA 1KOLA 2F59A 5KDDA 1HBJA 4C2AA 4HT3B 1OLXA 1KI6B 4E33A 1V3UA 2P2NA 4IDEA 5DTRA 1SIBE 3C3EA 2XEDA 1XWIA 2GZ1A 4KJXA 4ZXPA 1Z26A 4OUDB 4CL0A 3L1UA 2PT9A 4AT1A 1GYQA 5ICFA 1KBQA 4X0EA 3NHJA 3CC8A 5C8YA 4RTQA 3K1AB 3R9KA 2QTZA 1OFUA 3DDNA 3N1UA 3GMDA 2WJJA 5DDIP 2QLJA 3GJTA 5A3VA 1RCFA 2Q0SA 2JDIA 3H1BA 3DMGA 1UBHS 4GXNA 4LXYA 4RA6A 2DPMA 1LDGA 2A14A 3UWPA 1VL0A 1DBPA 2EFCB 4MDHA 1NX9A 5CA0F 2GLUA 3CPJB 1MPXA 3PEVA 3QXJA 3TQFA 2QRZA 1YK1A 8LDHA 4GM0A 4WXEA 1HG0A 5KOJB 1SU6A 2EGUA 2C31A 2XHZA 2EFHB 1PFQA 2CNKA 4XQCA 5E6UB 1R0BA 3NDIA 4DIUA 3JAKB 4C05A 2GCPA 4AMVA 2W11A 3WBBA 1UAGA 1QR2A 2NADA 5JPIA 5JCOA 1WPQA 3V7FA 4BGDA 2P5SA 2ZBDA 2VRCD 3H18A 4P6VF 5D85A 3KUDA 5CHEA 4EIWA 3RFXA 2I6UA 3D6JA 4OYHA 1EWQA 1Y4AE 3O47A 2V0GA 1T2VA 1U90A 2OHIA 4OCZA 2G7MC 4BNZA 2J5KA 4JBLA 4CRWB 4LFAB 3V48A 4C0JA 3NEYA 5K3BA 2X6TA 3CRNA 3DKIA 1R6BX 4YI5A 4TM7A 3OQJA 2YJGA 4XJSA 3GYBA 4EABA 2H0QA 2Z1DA 4Z6KA 1QGOA 5JJIA 2YICA 4LHYA 1EAYA 3FAKA 3G0DA 4K9OA 4D9NA 3CX3A 4HWSA 1C3EA 2X6QA 3CUKA 3H2IA 3MLEA 1MJFA 2FEWB 4LQCA 2A9FA 4CLOB 4DA6A 4HXYA 1QE5A 2C96A 1RPAA 1U0GA 2I66A 3IAUA 3FZYA 3QQPA 4Q12A 1JA9A 4A8JB 5FR2A 3KZMA 4RW0A 5DV9A 3TAXA 4BFSA 4E5KA 3GNTA 1C9NA 2HRRA 4OMCA 5GGXA 3H16A 3K2QA 4DSZA 5A4JA 3HA3A 2L17A 2Q3DA 4I1PA 3SVLA 1NW8A 1UDXA 3BK7A 4CM9A 3NI2A 4KR2A 2KYRA 1A5AB 2IDMA 1V8DA 3C39A 1NVAA 1L3IA 3DT8A 3T7SA 3TINA 3X2EA 2GBFA 2Y68A 4QHTA 3PF8A 2DKNA 1CUUA 4S0XA 1LJLA 1NSTA 2BTEA 3TEMA 3NDBB 3EW7A 4BMXA 3DHEA 1P0FA 4WNAA 3PGLA 5A4FS 2HV9A 4B73A 3HEAA 3RJMA 1QQ5A 5I9MA 3DSRA 1KE1A 1DZIA 2OK7A 1FNDA 2FPGB 1T8YA 3I58A 5JOQA 3B7WA 1FFCA 5KNBD 4KR3A 3F5QA 1DC6A 5HJ5A 4GR4A 1YA4A 4ZALA 3AV0B 3UMRA 4QT4A 2PYDA 1B26A 1WMFA 3PYLA 1Z29A 1LK0A 3CEPB 3NTXA 4WUTA 1XZQA 3LRXA 4GX0A 4U1RA 5REQA 2P2CA 2H0RA 2WQ6A 4R2HA 1YA8A 2F9FA 3HVJA 1MEEA 4OA8A 9ABPA 1Y6JA 2QL7A 4NBNA 3LJKA 1P9WA 2G3YA 1UJ6A 5B6JA 1GDHA 2AOWA 2X8AA 3OZBA 2QVLA 2V1XA 5EP1A 3IMKA 3AHJA 5CD1A 3B36A 2OENG 3I2KA 1GEGA 5F9MA 4M3NA 2X40A 5EIWA 2DFTA 1MC8A 2P78A 1VLQA 3ND6A 1ZD4A 2CXHA 2I67A 3I8OA 3ORRA 4I55F 2B2NA 4K9SA 4Q4JA 5AHOA 1JQDA 5JDCC 1B0UA 3IAHA 2VDJA 3U1TA 4PYIA 4WVFA 3H97A 4ZK6A 2J5BA 2ONYA 3WICA 1E1CB 4EMBA 5T67A 5JSZB 1JR3A 1NNI1 4YUYA 3WAGA 3MJ4A 2WY2D 1MNQA 2IIQA 1GV1A 2JGJA 1LSJA 3CX7A 2D5CA 2EHDA 3HBNA 2EJCA 3M6WA 3QUBA 4I19A 2ZUEA 1IM8A 1V6CA 1XRMA 3ZNOA 2XWPA 4AX4A 4V0LA 1IUOA 1D2HA 5AIAA 4BVAA 4ZKDA 5EC8A 4M86A 1F60A 3TL6A 4NCAA 4L02A 5DEIA 5H81A 1FXWF 1ZOPA 5TPWB 3AH8A 5HMMA 2Z56A 1EB9A 4N6OA 3SQLA 4P32A 1HE4A 4BXOA 1X6VA 4ER3A 2FP4B 2O7VA 4L8LA 4UUAA 3LUCA 4ZVPA 3UN1A 3HXOA 3QPUA 4CV3A 2FPKA 4ISBA 3CKYA 1J70A 2DUWA 3O31A 1R4MB 3PDUA 3V7UA 4R69A 1PJTA 1LPMA 4A8JC 1FXWA 3L6UA 3MN1A 5LP1A 4Y7CA 1EQ2A 1R15A 5BUSA 1ISMA 1UADA 2PX8A 2XWQA 3JWHA 3GC6A 1F4PA 1GU7A 2F1JA 4O59O 2CMFA 1ZU4A 3CW8X 1WVMA 4CU5A 3H0CA 4KIUA 3AR3A 2PSDA 3VDXA 3LDHA 4EMSA 3DEZA 1DLIA 4IIGA 1UXOA 4NYMQ 4TRMA 1ENZA 2FETA 2OGUA 3DG9A 4AN0A 4BJ3A 2O2EA 1NAIA 1F4LA 4UD6A 4Q3EA 2B1RA 4L78A 4BVBA 4FD3A 3KJEA 5CURA 2GEBA 4KZPA 4DXHA 3AONB 4PGMA 4D9JA 1JXAA 4FINA 2QTMA 1TCAA 2I6GA 2VK1A 2QENA 1BEEA 1W5EA 1HRDA 2WU0A 2IYVA 1B2RA 2VDMB 4MQMA 2PPLA 4RM2A 3SKVA 1ZC4A 3TIXB 3KEFA 4CUKA 1AO0A 5IWCA 1M76A 3WIDA 2FMUA 3I92A 3CXUA 4MHTA 2JCBA 4PFKA 1BYIA 4Z9FA 2HWXA 3AK4A 2FSHA 2NZUG 2W6QA 2YQ4A 2ZJZA 3KUCA 1S3FA 1DAIA 4FN5A 4O1IA 1TQ6A 1UKZA 1NJ8A 4LQDA 4WASA 2FVXA 4RIIA 3AVWA 3RJ9A 2C4UA 2A67A 1ZI9A 3BE8A 3HDYA 3NCHA 1OXMA 4L8WB 3UMMA 1XPOA 1O89A 3E7PA 4B7CA 4NZYA 1DUIA 4YJHB 4HDAA 4DCCA 4FW8A 3G1TA 5KKCA 1KAOA 3O3NB 3KT8A 2IGBA 1O8BA 1QBKC 3V5NA 3WGQA 3FI0A 2HZ7A 1ZGZA 2CE7A 2QRVB 2ZSUA 1KQNA 2X58A 1L4EA 3T5AA 1TEZA 1TYCA 3SC6A 3K9WA 4UVIA 4CKEB 4F85A 2V1UA 2YJ6A 3V9AA 1ZICA 3UMBA 3UG7A 4H77A 1Z7GA 4RU1A 2AJLI 2NYRA 5JS2A 4QUGA 3WJAA 3N3BC 4D9KA 5BMVB 4ALNA 1RLJA 5JYBA 1J8YF 2JZCA 4GWGA 5D3KA 5K01A 5IAGA 1Q21A 2H5JA 5C8YF 5F76A 1Q1ZA 1M83A 3Q1LA 4EYKA 4UD2A 3EY9A 1U8TA 1G8JA 3HNOA 2HQBA 4AMUA 2QVZX 1BDMA 4YC7A 4YRQA 5K3FA 1ISSA 1OWLA 1IN6A 1WG8A 4BLRA 1EU1A 4LWQA 3I37X 1BAPA 3L7CA 4H7HA 2EGGA 4B35A 4K1XA 4WJLA 1OV4A 2O0HA 4CLRB 4EAAA 4XUCA 2CLDX 3HUEA 3V8MA 3LH5A 4IOKA 3ZWYA 4MDFA 4MYDA 3QELB 4EFLA 4Z7OB 2EWVA 3M1AA 2HN9A 1NW7A 4GKAA 1KO8A 5DP1A 3KK0A 4HV4A 5KWIA 2DHCA 3I1JA 4RFSB 2OOSA 3SE7A 1HMYA 3DEYX 5EKDA 2P1ZA 3WHPA 2VVTA 2BCEA 1D0IA 3ZGNA 3C70A 3B3JA 4OQMA 4TKVB 3T7JA 3VZCA 5CEFA 2WSLA 2O8DB 5ALOA 1GD1O 3PQ7A 10MHA 4BVKA 5DP2A 5EQDA 4C89A 4RA9B 3O8QA 3DPUA 4KE9A 3ZWAA 3KQVA 4AURA 2QMUA 5YASA 1E1RD 2GN4A 3AUTA 1D0VA 1XEWX 3G8BA 1CY1A 3OPNA 3GO4A 3IPLA 4KGVA 5CDUA 4LBYA 2H1RA 1PLJA 2A88A 5GONF 2OZLA 2ORED 3HLTA 4DIOA 4DLLA 2FR8A 5DBIA 4BAGA 2W2NA 2XB2A 1Q1AA 3HVKA 4OSEA 2FW8A 2A1TR 1WZ2A 3JD4A 2ZP1A 4L57A 4MR9A 1UC8A 1HY3A 1XXHE 1IDN1 4IDQA 1SBHA 4OMFG 2NX2A 3R7DA 4HAWA 4UHDA 2XGGA 5TQ2B 5ITWA 3B89A 1PUXA 2HU2A 5BYBA 5CEJA 3MGKA 1FYEA 3C85A 3H99A 1TMOA 2OCLA 3B85A 4GPIB 1JR4A 2W2LD 4RAQA 2CHVA 1I7DA 1T4GA 1PUIA 1RS0A 3W2IA 1OIXA 1T9DA 1VE7A 4NABA 3I5AA 3ZTWA 4BRWA 3GLFB 3AHHA 4EG3A 2O59A 3TSOA 5BWMA 2ESRA 1GUZA 3D7RA 5F5XA 2R66A 3GLIA 1PLLA 3TN7A 3WYFA 4CKBA 1YRLA 3H1FA 5F4ZA 4JASB 1A0OA 2BFFA 4X1OA 5KSOA 3U4MA 2P2ZA 3V1LA 3DVQX 2AK3A 3S5UA 2A5DA 3IXQA 3Q3IA 4Q1AA 1XZJA 3P0JA 3E35A 4EVRA 2UVDA 2NUAA 5BSEA 3QHAA 1H3EA 3IOYA 4FHCA 3F97A 3RABA 1E32A 5BT9A 4Q4DA 1NVKA 1MGPA 1U7OA 4HUQA 3O0DA 4EA9A 3TJMA 3NTVA 1ZD5A 4PR0A 3I0ZA 1GG9A 2DBQA 1SEVA 2HM7A 2ZJ4A 4KG7A 3U61B 1LGYA 1VZ2A 2QAGC 4IMIB 2VTEA 4LXTA 3JQ9A 4U9UA 2VXYA 4IR7A 1C41A 4TKLA 4IQFA 4U7GA 4V0OA 2XB9A 1CYEA 2BFEB 4DQKA 1B6TA 1L7EA 2VAWA 2OLKA 1L8QA 3DKVA 1W2HA 5FP0A 1LXCA 2FWPA 2XW6A 3JVDA 4OHMA 3RAJA 1Q12A 4IEFB 4NS1A 3FCYA 4IV0A 4PZCA 5HKAA 1ZOSA 2C8LA 2YCLA 4ALIA 2JBHA 3E9MA 1QZ3A 1L4KA 4PX5A 3VHRA 4EDHA 1QTRA 1HYEA 4RPKA 4W63A 4JJ7A 5AM5A 3MTQA 3RYCA 3P9PA 3DFUA 4ZRMA 3EVBA 4Y67A 4E14A 2E48A 1J21A 1OI4A 2GAOA 4F04A 1XQWA 2ZBRA 3K2IA 1H9AA 2V7XA 1UIRA 1PEDA 1WBBA 2E21A 4JHXA 5HRAA 4PRYA 4PX2A 4OJMX 4KQ6A 2HK8A 2JVKA 3AILA 4KOAA 3AIMA 4W6QA 3TRJA 4POOA 3WL4A 1XJ0A 3TQOA 2I0FA 1A4IA 1EJBA 3C3KA 3DUFA 3RRXA 2G07A 1N2CE 4IH4A 5EHNA 1WHSB 3MAJA 1XAJA 5G0TA 2O7NA 1KY5A 3LC2O 4LS3A 1OXXK 4ZC8A 5IT5A 5HZKA 1BE0A 4DCJA 3QKRB 2I9PA 4TSFD 4V38A 5EZ6B 5F9HA 3GJZA 1FQKA 3B48A 3D4PA 4LSWA 3Q2KA 2QE7A 4MKIA 2P6OA 3T9EA 2YMLA 5B1HA 4KLAA 1WM1A 1DIRA 3VPAA 2QMQA 1DVRA 2VP9A 1KFJB 4H1TA 4YCJA 3V4LA 2VJYA 4YCLA 3LUFA 4QYIB 2PQ0A 2VJMB 1J7JA 1E89A 1G5QA 4L50A 3MNFA 4LSZA 1JR3E 1P4GA 2H7VA 1CWUA 4GOXA 5FFFA 4DW8A 4X1YA 3ZE7A 4L9RA 3S8YA 1FJGB 4EKNB 2Q46A 4MA0A 1J2TA 1KQGA 1TTPB 3BTVA 1FFHA 5KU7A 3W34A 2Z30A 4JUBA 5KJEA 1A9ZA 2Z1NA 3DB1A 3B13B 3QEOA 4PPGA 4MUJA 4ZREA 2PSSA 2QRMA 4URVR 2IXTA 4OUDA 2GZAA 5HUHA 3T3IA 2X9QA 1F7UA 4YN3A 3ER6A 2OECA 1NFQA 3ZWWA 4IHJB 3RO7A 4QTXA 4BNNA 5HXAA 4AWBA 2Q7DA 3QVTA 1WCYA 3WLIA 5B57C 1KMMA 1R6XA 2ZUUA 4FGJA 1FDOA 1I1OA 3GN1A 4Y6RA 2B1QA 4CCWA 1EVLA 4M54A 3V33A 4BOYA 2FRVA 2ZS8A 2EATA 1P1RA 2I6TA 5F51A 4DV0B 1VL2A 3K0AA 5AXDA 2OORC 1EWTA 4LI3X 3F5DA 3CISA 1X7DA 1U1FA 4FGSA 4YJ3A 2JFFA 3NNNA 3GHYA 4BGEA 4BN5A 1ZNQO 3OESA 3ZE0B 3Q0EA 1P5JA 1SOVA 3JZAA 4CVNA 1GARA 4FLEA 1JWLA 1BXGB 5ADVA 1CZNA 4EGFA 1I3OA 3QYFA 1ZJWA 1ONOA 1L5HA 3QVMA 3QXSA 3NXKA 4KDEA 2H4JA 2PBFA 1R0CA 1TCCA 2LKCA 1SCQA 2PRZA 4LUCA 3FNIA 5FBKA 5JG7A 3UHFA 5J58A 1S2OA 1Y4UA 1T4CA 3OPMA 4KB5A 4RULA 1XL1A 2X41A 1UDBA 2QX4A 3CNOA 3Q3CA 4P93A 5EJFA 1GITA 1BJKA 1R0SA 4IGEA 1V37A 4GWLA 4H1VA 4R7GA 1MRSA 4JXKA 1UKCA 4MW1A 3DE4X 3WLQA 1V41E 2C94A 4TSFA 1PD1A 3TUZC 1U2ZA 4WGFA 4GXTA 4ITVA 4COOA 3SYKA 3HCWA 5G41A 4C2BA 4IY1A 1K5HA 4A5OA 3CX4A 1JZQA 3AP1A 3UMJA 3C5EA 3OU6A 1STOA 4BKOA 4F45A 1BRMA 1DWOA 3BD8A 1DAHA 1LK7A 4S0ZA 3FNGA 4J0CA 5AK0A 3VYWA 4D4GA 3AKZA 3KTFA 1V9CA 3LP6A 4QDZA 2HHHB 2II6A 2R8RA 4M87A 4ZQHA 3BULA 2RHDA 3U7GA 3H0EA 4AP5A 4DDVA 4B76A 3NHAA 5HM8A 4MWZA 1HT3A 2ZT5A 3R3HA 2P6NA 2CFOA 4PLPA 1EK6A 2HD4A 3OZXA 1QU3A 5ESXA 16PKA 1K08A 1P72A 1G9SA 2X4IA 3PFGA 3H84A 5IULC 4XJTA 3VNRA 4EHLA 1SUIA 1ZXLA 1Q0QA 1ZUD1 3QU7A 5A6SA 3BXFA 3CUEF 3PUHA 1G63A 3PQ8A 1FC0A 4XQGA 1DKPA 1N0WA 3GK3A 1EDOA 1M6VB 2A1UB 3RQSA 1MENA 2APJA 2OL4A 1M75A 4JH0A 1YE8A 4UE6A 4K9DA 3TLYA 4DY4A 4N0MA 2ZPUA 1T3LA 4ONEA 3F4LA 3O1LA 2GPWA 1K88A 4G4GA 2HNKA 3RASA 2PN1A 3NT4A 3FXAA 3KZCA 3FPGA 4GQIA 3VI3B 1C7QA 3CUUA 3PGVA 3PNOA 4FBGA 1FUIA 4S2EA 3V6LA 2Z04A 4ALLA 3LQ1A 1NBEA 3NKFA 1HLDA 4QBGB 4ARBA 3EOZA 1WXDA 2UZ3A 3C3BA 4KO1S 3L6RA 4M0FA 2ZEJA 4Q93A 4UBNA 2WTNA 5FWAA 5HOEA 3UWDA 1D09A 2LR0A 2BEUB 1V95A 3TB6A 1SC1A 4BGIA 2HYIC 3N6RA 3RRFA 5IT4A 1FSZA 3NX4A 3U81A 3B60A 4CF5A 3FCXA 2PEZA 3G8DA 3O4VA 1C1DB 4KQCA 1GCIA 1JDNA 1E8NA 3DZDA 4TXLA 1RRMA 2XIJA 1ZCZA 2H4HA 1Y6RA 3GAAA 3SKXA 4OKNA 4BWFB 5KS2A 2EP8A 4H16A 3VOSA 4HXFB 1TB4A 3T06B 2H8KA 4QOJA 3AI7A 3BG5A 4IXMA 3JQPA 4JLSA 4KLZA 3OOYA 5EJMA 3EZ6A 1E3MA 4C7KA 4IHJF 4Q9DA 2FN4A 2GF2A 2JH9A 1G9TA 2ZLBA 4FU0A 2XT9A 1KO1A 3BTUA 1OUMA 3ACCA 3EMVA 4IWNA 1HQKA 3ZW8A 3U56A 1U2GA 1K27A 3KT6A 2J6IA 1AKRA 1PWXA 4QSMA 4RTRA 1JWBB 3IP6A 3RJZA 3I8XA 3GLGA 2JK1A 1J0DA 2ON6A 4MI1A 5CT6A 5FULA 1OWMA 2AIRA 3IKJA 4KL8S 4P5DA 4QDXA 2NTYC 3RUPA 5IFLA 2QTVB 5JUWA 3FTEA 3JRXA 4TYNA 4DRZA 2H1IA 1I2MA 1Z8HA 3GLRA 3OM8A 3VHLB 2KI5A 2J3KA 1ORHA 4XI9A 4B7AA 1FNSA 4G0QA 3THYA 4CIAA 3KJHA 1YL6A 2QY9A 4OP1A 1JHPA 5AJUA 5CBKA 1IZ7A 2FP4A 3R7LA 4ZCPA 4KW7A 2XDQB 4NX2A 2VYVD 5KX5F 2E2WA 1KEEA 4UXIA 2VL7A 4FMDF 5EFOA 4DJTA 4W82A 3LX8A 1R4MA 5KJ1A 3DL7A 2Y67A 3E58A 4KXFB 3WWZA 5IC6A 2HQSA 4C4AA 3B1FA 3HR7A 5FTNA 4PLZA 3R7SA 4HDQB 3LUGA 2Q2NA 1H5QA 2FX2A 2OP1A 4Q4CA 1TKAA 5FH9A 4JI0B 3GEEA 1Y8QB 2XRFA 3I8SA 3NORA 1KBZA 4F72A 4A36A 13PKA 2WJVA 3IMGA 3DFIA 3LT1A 1YQUA 5JNTA 3ZGYA 2NXWA 1PFWA 1RAAA 4PLYA 5KBYA 4YYEA 4MR7A 2OPHA 4UNSA 2OXEA 2IGTA 4CM3A 5ADUS 3RB8A 3VYTB 4MWSA 4ZVSA 4ZVRA 1UOPA 1DO2A 3LDFA 4BMNA 3H9EO 1MOSA 3AUUA 4UVEA 2Y4NA 3LP5A 4KO2S 3WMWA 1XAHA 4JI5B 1YULA 1Q7TA 3RVRA 3WK6A 1E6UA 2HHCA 4FYVA 3T3MB 3RM3A 4OYLA 1A2BA 4F5EA 2X5XA 2JAWA 4L9AA 4G0VA 1ZSNA 2WA1A 1A4UA 4TLMB 4RQAA 2IZ1A 1G7RA 1VB5A 5ETJA 4ZVQA 3TRKA 4DJ5X 3CUSA 1Q0ZA 3LLVA 2MWMA 4L3VA 3UOGA 3L8EA 2G25A 4CM4A 2VT2A 4ARIA 1ZOLA 3RARA 4LFCB 4LF5B 3OT5A 2FK7A 3ZV3A 4J3JA 4ZPJA 1PZEA 3VR4D 3ADCA 4TL8A 2HF8A 2WT4A 3HFGA 1RYEA 1SD5A 1U5CA 1PNTA 2QRKA 2Y0PA 2QRVA 3L4BA 2QUIA 1Q1NA 4Y1RB 5IH3A 3NHLA 4OIMA 4CUJA 4EG0A 4EG8A 3SQWA 1RJ9B 2Q50A 3HKCA 3SJAA 3FSGA 2HYDA 3R5SA 5C7LO 2O3UA 2AXNA 4EG1A 1YDWA 4L27A 4YHHB 1P29A 3SIRA 4NYMR 4KSCA 4B3TB 4RPGA 4NV3A 2RHTA 3CLRC 5F52A 1E9AA 2DHEA 2XMCA 2I1QA 1K6IA 2JH8A 3EIUA 3EPPA 4FB4A 5H8WA 3C3MA 4ROSA 3HNPA 4J7XA 4EA8A 5FPPA 3CGGA 2O20A 5CAEA 4KIGA 5SYAA 2XAUA 3LF2A 5AWFC 3VNVA 2Y2UA 5K3FB 5BOVA 1A9XB 4OHCA 3TMKA 3NHBA 3RSLA 4HBZA 3OJLA 1LW6E 4KHZA 4ZU1X 4G1EB 2XXAA 2IHTA 2WM8A 2RCNA 2HCTA 5T41A 3U3OA 3U1BA 3NYWA 3TLKA 3ZIAD 2PLFA 1DQRA 2AF4C 2YRWA 3F74A 3QELA 3QKUA 3GLSA 3CF4A 3IKLA 1TJYA 4FKMA 4JJKA 1PJBA 4RFSA 1TC2A 1TLTA 3EDMA 1USVA 1UM8A 1JXMA 2DWCA 1J8DA 5JXHA 1EXDA 3ORHA 1TM7E 3RTBA 1W76A 3HFJA 4C4PA 3O2QB 2CN1A 3DO6A 1Q1QA 4MS4B 3IVRA 1YIOA 2P4UA 1SGWA 1TC1A 4LDRA 1QQAA 4YBRA 2HWWA 1CRLA 4NBVA 1RYHA 5K0TA 4FS3A 1KH2A 4FI3C 4ITUA 1BGXT 5CPBA 2F4NA 1L4HA 1ZM7A 3NJ8A 4TWZA 3KQTA 1S3GA 2RHLA 1RI1A 2VKQA 2Q4RA 3A2KA 1QZUA 5IUJC 5KTKA 5AVSA 1Z25A 4DLUA 1ZNWA 3D6VA 2O8BA 3IULA 3JATB 4I1OA 4KEAA 1Z5VA 5E4FA 1EIZA 5ERXA 3KSMA 1DKMA 1TO2E 3BHIA 5G4KA 1KAEA 2FN7A 4M1MA 3VV3A 2E85A 2RI0A 4A6XA 1Y4SA 2J08A 1R00A 3WMRA 2OXIA 2ZIZA 4MAFA 2NVUB 2H52A 1YZFA 1E1YA 2IEYA 2JLXA 3EN0A 3N39C 5EIBC 5G53C 5UKDA 3T4UA 4XB2A 1DWPA 3PNBA 3TSWA 3W8EA 4AJ2A 5LQDA 6AT1A 1Y5RA 1VGRA 4U2BA 3ABIA 4TYPA 5EKUA 1M1NB 3U48A 1GAXA 1AX9A 5BVGA 2POQX 1DFHA 2QDKA 3WWCA 1VM6A 1B73A 1QJ4A 2XLBA 5I45A 1Y5IA 2BM8A 4B3BA 2HOQA 3AM4A 1XTVA 4NI5A 4NYJQ 5TARA 2C8JA 2CLOB 3CLKA 4YRPA 5AKJA 3V55A 3G2PA 2OWDA 1YJCA 3GUVA 1HL3A 2Y66A 2ZKLA 2CL5A 4WW0A 2XMBA 2XA2A 2O19A 4RJTA 2H85A 2IHZA 4GGPA 1NXVA 1QPZA 2C1XA 3WNQA 4OBWA 2JLWA 3NVMB 1DJOA 4P84A 3EIWA 4PAWA 4RVGA 3FYDA 3MGBA 4NY1A 2IZ0A 5CDTA 2WFMA 4P83A 2OD9A 2I2DA 1TM5E 4QUHA 3NHWA 1EVEA 1VG1A 1Y3DE 4QDTA 1QFZA 2A4KA 4J16C 2IYTA 5AI9A 3WXBA 1EG2A 1R10A 2YXPX 3EIOA 4RS4A 3OFJA 2ATIA 2Y8EA 3LA8A 1EFKA 3RTDA 3ZY3A 1VKNA 4BTVA 4OXNA 4RF4A 4D46A 4QEZA 1BCSA 2NQTA 2ODPA 3LUDA 1JWAB 4S05A 1BX0A 1PJ3A 3BC1A 2IEBA 5DGDA 1AKTA 2W6NA 2I54A 3N2YA 5LCXA 4TWRA 1FYXA 3CVJA 1E2HA 3BPSA 3ENVA 4ZKEA 3S70A 2H54A 2JFQA 3CIOA 2BCGY 5F4BA 4TKZA 5DXAA 1USKA 1D9ZA 1MKYA 2GUGA 3PPWA 5EZSA 1L1QA 5FUXA 3WIOA 5LU9A 4QM6A 3SR0A 4Q9IA 4QOSA 2YFQA 3TR6A 1DGQA 5FWYA 1YTLA 2I3BA 1P1FA 3AHFA 1GCAA 4P4SB 2GT1A 2Y1CA 3DAOA 1ZD2P 3CLSD 4H7DA 1M2GA 4UUBA 4Y1EA 1P3Y1 5EESA 3DA8A 1PHRA 3SDSA 4ZJPA 1WHSA 3AJ9A 3I34X 2PMEA 1BE8A 1UZUA 3OX4A 4G0NA 1QKKA 4OREX 4ZZ2A 2JAOA 1LTQA 1DAPA 2FEXA 2OHFA 2D5LA 3NUGA 4FKBA 3C41J 5HZMA 2JW5A 2CLSA 3WGMA 4F9GA 2MT9A 2VUIB 3M5WA 4WE3A 4E08A 1Q17A 5AVRA 3PHBE 2BHRA 1KK3A 2Y1XA 3E6AA 3ONNA 4OHYA 4TRNA 2CLFB 3AB7A 3DDHA 2YASA 3CZ9A 3D7KA 3TNDA 2QTNA 4BNGA 1C4WA 1LKZA 3H7IA 1E2BA 2VRCA 4HQKA 4KNVA 1O6BA 5BSKA 3TR0A 3DNMA 1W7AA 2VJMA 1ESCA 4OGFA 1NONA 1SC3A 1DL5A 2JGDA 3COPA 3WC4A 1T15A 1PJQA 4YTEA 3WRWA 3WLSA 5EUMA 2XNHA 3ZDFA 3BFPA 3G3EA 2V7BA 1XTBA 4JN6B 2G5PA 4AWAA 3K73O 3JY6A 3U5ZB 1X2EA 1IUNA 1U31A 5EMLA 1E6LA 3QEMA 4I5EA 1HI9A 1AK1A 3A31A 1UJBA 3R23A 4QUAA 5DN6A 4AJOA 3HQ4O 3OC0A 3S99A 1T5BA 5CFNA 3B3FA 1WZNA 3NW9A 3SD7A 4B2IA 5LWHA 4MS1A 3KSAC 2W70A 3C7KA 4HNVA 4AF8A 5FO0A 3SX4A 4FPXA 2FUCA 1WKBA 3RUHA 3TW8B 3T12A 1L7QA 3A6HA 3UEOA 2WWWA 4UOEA 5JO0A 2RGDA 4IJWA 4DEVA 5ES4B 4AZ0B 2A86A 2UKDA 4D0SA 3PV0A 2YDXA 2AH5A 1XX6A 3KOOA 1GA6A 2XA1A 4AYWA 1EP3B 2Q0XA 2WJWA 3ZGZA 1ZN8A 2FPXA 4RV5A 3C2QA 1ST2A 2DWPA 6REQA 5KTRA 3VU3A 5LNK6 3CVVA 4A6EA 3LSTA 5EWLA 1T4CB 2CXOA 1HH4A 5E8JA 4CXMA 1AE1A 5EMKA 3H6KA 4BAZA 5KU1A 1EBFA 1E2GA 1EDBA 5H4GA 3U26A 1OY1A 2TMDA 3ORFA