4MS3B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the endogenous agonist gaba
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
418
structure length
408
Chain Sequence
PPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWECLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/agonist
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
total genus 146
structure length 408
sequence length 418
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms3B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms3B01
2X7XA 1BAPA 1DRKA 4DADA 4JAVC 5EWMB 1MIHA 3QEKA 4Q7EA 5KQGA 3CTPA 3MMNA 1M5TA 5C5EA 2M1ZA 4N76A 2GKGA 3CNBA 1ZDMA 2QV0A 4O5AA 3QLTA 5IUKC 2Q5CA 3FFXA 5EWJA 3Q7SA 2PUEA 1XHEA 1ZH2A 4DQDA 5IEJA 1QMPA 3FGZA 4YCSA 1OXKB 4RY0A 7ABPA 2E4XA 2HQRA 1YK1A 4F8JA 4FE7A 1U8TA 2FMKA 2LUOA 4YLEA 2IOYA 3C6QA 2MYTA 3N0RA 4W5RA 3OLZA 2GX6A 3H1GA 1D1QA 2J48A 3FDFA 4YWHA 4HNSA 2PUCA 1PUXA 1VPWA 3EAFA 1LK0A 3MF4A 1BDHA 4IF4A 3QEMB 4MR8A 1QP7A 4EVQA 4NV3A 2A9OA 4RZSA 1A0OA 2MSLA 4G0ZA 2HQBA 1WETA 4Z4FA 3C3WA 1D4ZA 4P1ZA 1J56A 3HJFA 1RXEA 2MYNA 1NXVA 4M88A 1PEYA 3I09A 2PKXA 5JS1A 3GYBA 3KLNA 4MS1A 4ETIA 1TVMA 1JF8A 2ID7A 3MQ4A 4RV5A 1AB6A 4JOQA 4KV7A 4YGXB 6ABPA 5C5CA 2QZJA 5KQMA 5TQJA 3SNKA 2PUFA 2E4UA 2F8TA 3TD9A 1Y1LA 3OLYA 3TO5A 3MYYA 2QW1A 3JY6A 3KS9A 4KK4A 5BRAA 3ROTA 4OLBA 1Z18A 3HUUA 1R8JA 4MQEA 1SD5A 3LMKA 3HCWA 2FEPA 4KQ9A 4O1HA 1QQBA 2MYUA 2NZVG 4Z0NA 3F6CA 2R4QA 4W5NA 4IMJB 4LE0A 5DTEA 1JBEA 2E4VA 3LKVA 3RVSA 1MB3A 5TE9A 1EFAA 4G0QA 3KTOA 5B3JA 4N47A 4EYKA 3KSMA 5JS2A 5D2CA 2FW0A 4JB0A 4G0XA 1D5WA 3T38A 2P9HA 3KJXA 2BGGA 4IMIB 5CNIA 2FVYA 2E4YA 4H3KB 1K68A 4TLLB 2O20A 1P6UA 5ABPA 1AB5A 2QR3A 3RVLA 2CHFA 4KZKA 1T34A 3A10A 1DBQA 5FWYA 2YHAA 5BR1A 5GQSA 3VNAA 3DLBA 4ZJPA 2KYRA 5KWSA 2ZAYA 1RXIA 4NICA 4H3HB 4RK6A 2FEKA 1M2EA 3M9WA 1YS7A 3RH0A 4WUTA 5IULC 1VLZA 3A0UA 2R25B 1QNLA 4PICA 4JP1A 4PEVA 4L4UA 2FKAA 2IKSA 4JA2A 3MM4A 1PEAA 4Z4CA 2R48A 1QQAA 3FFWA 5DGCA 2ID9A 2L2QA 4EGSA 3Q15C 4RY8A 4MR7A 1ISSA 1MB0A 3DGFC 1KRXA 4LDAA 1L5YA 4N0QA 4WZZA 2L19A 5DLEA 3L6UA 5TPWA 1YS6A 3H5OA 4UHKA 2GWRA 3QELB 1L5ZA 3RQIA 1QO0D 2LBPA 1MVOA 3EJWA 4RK0A 3HDVA 4Z9AA 4OLAA 1USGA 3N8IA 4W5QA 3SQNA 3H5VA 2OQRA 4GNRA 4MS4B 2MYPA 3RVMA 3OM1A 2JK1A 1NY5A 1GLGA 2JB9A 3O1JC 4MR8B 2WY2D 4Z4EA 2AYXA 3O21A 9ABPA 1C4WA 3FFTA 3KYIB 4GPAA 4XXHA 1NTRA 2A9RA 3Q9SA 4MS4A 1PNRA 3CS3A 4D6XA 3DZDA 4PE5B 1F4VA 1E6KA 1EWVA 3DBIA 1JYEA 4XAQA 1BVHA 5JNWA 4G0OA 5T3YA 1E6LA 1FFGA 3QLUA 3S99A 1JFSA 1Z15A 3URMA 3OMWA 5TPWB 3UKJA 1P8AA 1NXXA 1DC8A 1ZH4A 3N0WA 2HQOA 5HKOA 3EDCA 3H1FA 1VRVA 3EULA 5FWXB 3EQZA 4G0YA 2JVIA 5JNTA 3H1EA 4OATA 1SXGA 3NNNA 4N03A 2CHEA 3JTEA 3CG0A 4N0PA 2V0NA 3OLVA 3OQNA 5TQ2A 3JS5A 1ZHHA 1ABEA 1DCMA 3LUCA 2WB4A 4TMYA 4F11A 1GCGA 1ZY2A 1Z16A 4RDCA 4ETMA 5HM6A 3RVQA 4B09A 3HSYA 1KGSA 3GRCA 4Z99A 2WJAA 3D8UA 2VK2A 3H75A 1EWKA 2GI4A 3HVRA 4MRMB 3W9SA 1S8NA 4LRQA 1BDIA 3O2JA 4ZMRA 1U04A 2IDMA 5I4CA 3CHYA 3ILYA 4FB4A 5KQPA 3C97A 3I42A 1YK0A 3ILHA 2N9UA 2E4ZA 4QYWA 1ZGGA 4NCBA 1ZESA 4RXTA 5FBHA 3IPCA 5EWLA 3N53A 1NXPA 4RKQA 4RXMA 2PUGA 2IPLA 2RDMA 2CD7A 1IIBA 2LIVA 5T7BA 4MGEA 1M5UA 1JLKA 4S04A 3RVNA 2FN9A 1YVUA 2HJ9A 1PNTA 2L18A 3RVKA 4RY9A 2W42A 1RZRA 3GWGA 1DC7A 3GA5A 1RNLA 2IPNA 4QYMA 4RXUA 3HZHA 3F73A 4F3TA 4WXMA 2JCGA 2PL1A 4RK1A 1DG9A 1USKA 1TJYA 4D6YA 4EUKA 3C3KA 3OO1A 2GBPA 3OLWA 4RK7A 4MAAA 3GT7A 2PUBA 1W9HA 3QLVA 3H5IA 4Z9BA 1LJLA 4TN5A 3E61A 3LUDA 1U0SY 1DRJA 1K66A 5BRJA 1APBA 5BQ3A 1YMVA 1M2FA 4EVRA 2B1JA 3BRQA 3HXMA 3CFYA 3MIZA 4Q6WA 1W25A 5CNJA 1CYEA 3SM9A 3G85A 4MPTA 3OQMA 2PE5A 3LUKA 4E7OA 3LKBA 2ZWMA 2L17A 3JVIA 4RSMA 3OMXA 2IPMA 3QEMA 4DN6A 1ZAYA 4MS3A 4HYEA 2FTKE 3F7NA 4IGAA 3OO0A 1Z2DA 1DJMA 4XASA 1TMYA 5FWYB 3BILA 1ISRA 3L49A 3N6VA 5DKFA 3NBMA 1CHNA 3JVDA 4KNYA 3KYJB 3H6GA 2MSKA 5IBQA 4EY3A 3NNSA 2H3HA 3RVJA 1P6QA 1JDNA 2TMYA 3M9XA 3LUFA 3GBVA 2R47A 2JVKA 3Q7RA 1BA2A 5TPZA 4JASB 4EYQA 1XWWA 3I5AA 3HS3A 3KG2A 2FQWA 3CU5A 4Q6BA 3HV2A 2NT3A 4Z4GA 3H5WA 2NZUG 4MQEB 5CHYA 1VKRA 1FSPA 1USIA 3C3MA 5CNMA 2FQXA 1KMIY 5FWXA 4QICA 3O2QB 3GV0A 4HNRA 2F8SA 2IPAB 4Z4HA 1JDPA 4KPYA 2FEWB 3SAJA 2JBAA 1DBPA 4YRZA 1NXTA 4ZPJA 1F51E 1LJUA 4LE1A 4ZYLA 3IPAA 3A0RB 3HEBA 4EYGA 1FFWA 3CZ5A 4YS6A 1JFTA 4KQCA 2PL9A 2RJOA 1H9CA 3N0XA 3LFTA 1YMUA 2FMHA 3QX8A 1B00A 1SXIA 5ED4A 1ZVVA 4LE2A 3MA0A 3HM9A 1GUDA 4LDZA 4E7PA 1BDJA 3G1WA 3D02A 4H60A 2H0AA 3Q7TA 2JRLA 5GOTA 5HQJA 1EHCA 3HUTA 3O75A 3UUGA 5IUJC 3TMYA 4N41A 4ML3A 2A9QA 1GCAA 4L85A 4KK3A 1JX6A 1PHRA 2B4AA 4MYRA 2QXYA 4G86A 5B3JC 4MLCA 2DRIA 3QELA 1QO0A 5KC8A 1JL3A 1LBIA 4Y9TA 3SG0A 1YIOA 4MR9B 1E6MA 3H5LA 5F64A 1Z17A 3HO1A 1D1PA 4MR7B 1Z25A 3EODA 3KLOA 2VUHB 2RJNA 4MLDA 1ZITA 3A3KA 3IP5A 4CBVA 4W5TA 1QP4A 3LOPA 2WJWA 5EWMA 3GL9A 1FQWA 2FN8A 3KHTA 4JB2A 2FQYA 2PUDA 3TB6A 3EGCA 4F06A 2QSJA 2YHBA 3CG4A 3QLVC 4KRFA 4YP9A 4LZLA 1P2FA 3IP9A 3EQ2A 4D74A 3RVRA 2PUAA 5KC9A 4PYRA 3KKEA 2JVJA 2FMFA 1JH9A 4RU1A 1TLFA 1Z26A 3M6MD 1QPZA 2PLNA 3CLKA 4OG2A 4XARA 4EVSA 3HDGA 3IP7A 3LUAA 2PAFA 4TLMB 5TPZD 4Z4IA 2RGYA 1XHFA 3O1IC 1UDRA 3CKMA 1GUBA 1Z12A 3LUJA 3VNBA 1E2BA 1DCKA 1SRRA 2FXIA 4W5OA 1QKKA 3DGEC 1ZN2A 5JNSA 2QVGA 4G0MA 2P4UA 4MQFB 4ETNA 1JYFA 4PZ0A 2HSGA 4XLTA 4ZMSA 3BRSA 3BREA 4NQRA 5FBKA 5KQLA 5CNKA 4WT7A 1KRWA 1NXSA 3DLHA 3CZCA 5TQ0A 4NCAA 1LBHA 5PNTA 8ABPA 2QU7A 1D2AA 4MS3B 1HEYA 2NT4A 2WMYA 2WWVD 4KMRA 5HSGA 3T95A 3RVOA 2WRZA 3B2NA 1ABFA 1Z2EA 4UHJA 1ZGZA 3QX9A 5IEBA 1TM2A 2HPHA 5IC5A 3KCNA 2M98A 2PMCA 5JNRA 4EYOA 4FE4A 5IUNC 4O1IA 2NUBA 2FSPA 2QVCA 5IX8A 5JNUA 3NHMA 3RVPA 3UK0A 2IYNA 4YR7A 3HK2A 1FFSA 3Q41A 4MS1B 3CRNA 1JFVA 3E3MA 3O2SB 4KREA 5DCLA 3LUGA 4RK4A 3N75A 4RK5A 3O74A 4OTZA 3K9CA 3JPWA 4MR9A 4WWHA 4IRXA 2FLWA 3FMVA 4KFCA 1RPJA 3OLXA 1MAVA 3K4HA 2CWDA 3IP6A 4YO7A 1NXWA 1QP0A 2I6FA 1C0EA 1OXBB 4RWEA 3SY8A 1U2PA 3QLUC 3H5TA 4XFKA 1DBWA 4G97A 6CHYA 5TQ0B 5JNVA 1SXHA 4IILA 1NATA 1U2QA 3H6HA 3ROFA 4RS3A 1A2OA 4QPJC 3O1HB 3I45A 1RZRD 1NXOA 2XDYA 3QK7A 4HNQA 1DP4A 2LPMA 4S05A 1YTUA 4P98A 1CEYA 2VYCA 4MQFA 1URPA 5EWLB 1Z13A 3T6KA 5EWJB 3GBPA 1JWLA 4KVFA 5KI6A 3T8YA 1DCFA 4LX8A 3LTEA 3OM0A 2MSWA 2VUIB 3JPYA 2E4WA 2JBAB 4RKRA 4OBBA 3R0JA 3IDOA 4YV7A 3NNDA 4G0PA 1JHZA 4MRMA 1EWTA 4F12A 2A9PA 5E3JA 2AYZA 2OENG 1A04A 1I3CA 2FMIA 2PJUA 2LP4Y 3NHZA 2FLKA 4WXEA 3BBLA 1EAYA 3F6PA 3OQOA 3P9YA 3LUHA 1DZ3A 3TX6A 5TQ2B
chains in the Genus database with same CATH superfamily
1TW3A 2V6BA 1UK8A 2OR3A 1DT3A 1U28C 2A9FA 4K9RA 5E8RA 5A3JA 1MIHA 5FAKA 2HD4A 4NHOA 3TTVA 1NR5A 2GS9A 2BUBA 3FJ1A 1XRQA 3CNBA 1NLYA 4PPQA 1I2CA 2NM0A 3T7IA 1XPRA 4PRLA 5KOJA 4DFDA 4M1KA 4KDFA 2XZLA 1ARZA 3WLAA 3WRXA 3MWGA 4PPYA 4B34A 4Z5XA 2ZSHA 1FF9A 1NMZA 2E4XA 4FKBA 4LMRA 4MJLA 2PX5A 7ABPA 4N12A 2PWPA 4UQPA 2QAIA 4WQMA 3JU3A 5L7TA 2VH1A 5EQFA 4E4RA 3ZVNA 2X2OA 5KHAA 5CA0B 1FZQA 2CYCA 4NZPA 3T1TA 4HH3C 3EDYA 1GSAA 5C37A 1F6BA 1M1YB 5EZSA 3AEXA 4HQOA 5CU7A 5CFMA 3WKEA 4A0GA 1UJ6A 3DUFB 2VZ9A 4GOND 3U62A 3FUXA 4YRAA 2BFAA 4ON9A 3LF2A 3R6GA 2IEAA 2B6HA 2NU7B 4OU4A 2GZ3A 3U7FB 3VU9A 4G5HA 2MSLA 3H99A 4RO0A 1U0NA 4Q9KA 1QHXA 1H4SA 1U8UA 5E4YA 4X7BA 1RHRA 5EMNA 5C5IA 4EPXA 1OZGA 1W4BA 2IZ7A 1E3EA 4PLGA 3LPAA 1E3MA 3D2CA 5FYDA 5LZ7A 4AKGA 1XDDA 4DG9A 4CIDA 2DULA 4J75A 4DA9A 3KT6A 5FL7D 4HN2A 1VJ1A 2Q4RA 4YGXB 3UJ7A 3UH0A 5HIMA 1BOFA 1MPTA 5FPTA 4G5YA 1DO2A 4LY6A 2O8FB 1NT4A 2IPXA 4Q7LA 4Y18A 1JR4A 1RWOA 1SXJE 2DM6A 2HMYB 5BURA 5I7EA 1XCPA 4G81A 2D2VA 2OYCA 2YX1A 4OLBA 1Z18A 3WLMA 4L6IA 3DBRB 3MRVA 2DTXA 5DYTA 4Y1GA 1LPNA 3ZW9A 3GFOA 3D4NA 1PFYA 1YRAA 1ZCBA 2HBQA 1NUSA 5JMOA 2A1UA 2XNCA 4IMJB 3GVXA 1ES9A 5I7WA 2PWBA 2OFWA 5CIQA 2E4VA 4KIUA 4UE6A 3VTKA 1CEQA 1BSVA 1XNQB 3LK6A 2VRCD 4OK3A 1R9GA 1OLOA 1II9A 1HFJA 1PQYA 5EGSA 1V0JA 1MTOA 1MIOA 1RLMA 3E70C 1WXGA 3L7YA 5ALUA 2ZM6B 3O7WA 5EKXA 4MAMA 2W4IA 3GFBA 4B7AA 4AMBA 5JAPA 4M0UA 3W2IA 3KJXA 2ZJ3A 3LO5A 4ZVPA 5EZYB 1UQTA 3M1YA 3I9V6 1A2KC 1KY3A 1CRQA 1NW4A 3U13A 3AIIA 2VUUA 3TCNA 2BPOA 1ZD3A 1VE3A 1XU9A 3I73A 1OWPA 3DE7X 5A2QA 1T34A 4NMXB 4DCUA 4UMEA 4M6WA 4QG7A 2TSYB 4RC9A 1XK7A 3CX4A 3GFRA 2JGDB 1KR2A 1A88A 4JODA 2JZOA 4LCBA 3VU8A 3I62A 2NP7A 3E1KA 4RK6A 3G2PA 4KB5A 1NSTA 3NJ4A 4LN1A 4FJ0A 1IHPA 5LIRA 4Q4JB 2WICA 4MRSA 5E4JA 2PRIA 4DMMA 3IAS1 1XZEA 5DHFA 3W5BA 4QM6A 5BN1A 2BZ0A 1IZ7A 1ACJA 2D5CA 5DTMA 1SKBA 5HK8A 5JT1A 1BN6A 2HA0A 2YWDA 3PQFA 3R5FA 1QQAA 3B1YA 4LQ4A 5BUCA 1FFCA 3GRPA 3GRUA 3CNQS 4LMBA 1PO7A 3FYTA 5IAJA 3FD8A 3IIKA 3T5TA 4RTPA 3EEOA 3NXSA 4HAOA 2WFZA 2I3AA 5IK2A 1GNLA 4D3YA 1KEKA 1PSDA 4QPZA 1QCZA 1IHUA 1PZXA 2DQ4A 2Y2UA 3VV2A 5AVSA 1KEEB 1U8EA 1IBCA 3MEQA 3AIKA 3N28A 5JOQA 1EK2A 1MW9X 1QRSA 4Z9AA 3BIJA 2VYQA 2CVHA 2ICAA 4PFJA 5LKAA 2CT8A 1ZIYA 3AO0B 3FGOA 4WK0B 2I4IA 2YHIB 1TVKA 2OQRA 3LLSA 3V4OA 4YCCA 1PS0A 4L50A 4XCXA 4JUAA 4AJNA 1D2HA 2VHEA 3B82A 4O33A 3R8XA 4D9IA 4MYSA 4J1QA 4DCMA 1QXSA 1KMMA 1BGVA 2XCLA 4M1WA 4OI2A 1X13A 2YRFA 3KYIB 4XXHA 2AFIE 2XT0A 1Y3FE 1WCYA 5FX2A 3GEMA 2NVOA 3OF3A 2FWBA 3PUKA 1PDOA 4BQPA 3BCHA 4S1NA 1DAKA 1HDCA 3COZA 3CPHA 2D5BA 2P78A 5DYNA 3NTQA 1GA4A 5KTKA 1ZR4A 2G9VA 2QUAA 1OKKD 1J8DA 3UKJA 4OMDA 3DL2A 2JD1A 4BUCA 5BMVB 3HXOA 3LFHA 2CNNA 3U60B 2DKOA 3C7TA 1NU8A 5BOVA 1SZJG 1W59A 1KBZA 3SFZA 4CFZA 5HKOA 2MINB 3IKLA 3OC6A 4J16C 5B12A 1GNRA 3ZTWA 4CF4A 1TTTA 3IBGA 3ILVA 2KSQA 1B0ZA 4TKVB 1GZ3A 2FWMX 4G07A 3O8DA 1Y3BE 3EG9A 3SR4A 4W6ZA 2CZCA 4NK5A 3OLCX 3EYWA 4CMKA 3BGVA 1SC9A 1KZ4A 4L72A 1GCGA 4NFLA 2E5LB 1RBYA 2R8RA 4NFHA 1CB0A 4Z1OA 1VJTA 1RT9A 3PQ8A 5H3HA 3HMQA 4M0MA 3I9LA 3OKPA 4Q15A 1E1LA 4HGPA 3DW3X 5ERXA 1R16A 1H4VB 5DXFA 1ZH0A 3UAWA 1H5NA 2B7BA 1CDDA 2EERA 3G59A 5ITSA 1LBEA 2I2DA 4B4KA 2ZJBA 2FUCA 4R9VA 2PSEA 3H16A 1QHSA 2B83A 3OBIA 3LF1A 4JQCA 5DLYA 4DB4A 1QO9A 1UOEA 1JR3D 3AUJB 3OU6A 1WQ1R 1K4KA 1NXPA 1P2DA 3UJ9A 3GVIA 1L4GA 2WAMA 4YYEA 2CD7A 4U6NA 1YJBA 4CV0A 1G60A 1L5FA 4HWKA 4N9QA 3I0MA 4OB6A 3PV0A 2H17A 1W35A 1W46A 4ENPA 2R84A 2HJ9A 2VCEA 5BOSA 4DNXA 2HU8A 5CB4F 3ZCXA 1ZK0A 2IPNA 2LW7A 1BH2A 1NLZA 2GD2A 2WT4A 5JU6A 2WKWA 2IHUA 3IEXA 2O1EA 4ZU1X 4YUXA 1Q7TA 3F46A 3PEWA 2CFSA 3EGEA 3O8QB 4LRUA 4URWR 4GKBA 1PJ3A 2HL6A 3F5SA 5A03A 1GNQA 3G0BA 3HB5X 4MWTA 4C4TA 1YTLA 1HDGO 2QTNA 4FMDF 4L0CA 3ZLVA 2YJNA 3SR0A 3EEIA 1W4RA 2F3SA 1M2FA 1UZNA 4O0LA 2KHZA 1WAMA 4MVJP 2Z9DA 4K40A 1N7GA 3WFZA 4GIBA 4MZDA 3M8KA 5BN3B 5LXTA 3F98A 4CEHA 2OXTA 2GZSA 4LHWA 2EKZA 3PXAA 5FOSA 4RVSA 5DVZA 2X4IA 2ZJAA 5K6AA 4R71A 2BIFA 3VOTA 3W4IA 3SOZA 2QQGA 4JB8A 2VYND 4DN6A 2P2LA 3N8DA 1HRKA 1BFDA 5A7FA 5IT0A 1K92A 1N0IA 4AF8A 3M4XA 1GZ6A 1H85A 3DUWA 2BJVA 1KTIA 3UMCA 1LLQA 3HUFA 1Y7HA 3RAGA 4EHDA 4ZDIA 1J8FA 4QDKA 5E0KB 4B43A 5JBQA 1EFVA 4MIEA 3Q2KA 4UTXA 3H6GA 4XEUA 1BEZA 1DL5A 1E9EA 1OUMA 2ZRDA 3UANA 3VTZA 3QUQA 4NCIA 2FK8A 2GXSA 1G0OA 1P6QA 2UAGA 3B7WA 1XMSA 4EGQA 2IITA 4C4ZA 4PGAA 1TZ2A 5K0ZA 1GGNA 3SJCA 1RI1A 3PPIA 2MWMA 1JR3E 1U3VA 2ZE5A 3RJ9A 4L8LA 5IJXA 1QE3A 4ETWA 4V0QA 2YTZA 1NUQA 4DYDA 5CBPB 4NFSA 2O1XA 1OH6A 3M2TA 1CW2B 3KEQA 4LDQA 1JAXA 4ALNA 4BU1A 5EMMA 4CV1A 4DCSA 3LXXA 1LRJA 2X0FA 1IVSA 1C1YA 1FTQA 1RWKA 1XKLA 1WV1A 3KZOA 5T41A 3SBEA 1VECA 5BWLA 1LDGA 2BGIA 4C6TA 3H2YA 4RVGA 4JLWA 2ZUVA 4I9NA 2I62A 2FUNB 4NBVA 5CNMA 1UAAA 1HYGA 2WZQA 1L1EA 4AW9A 2MCFA 1BXGB 2IYXA 1QS0B 2YOFA 3A9CA 3AU9A 1ZONA 4M86A 4WGFA 1RRPA 1TJ3A 1TK2A 4B6FA 1T4CA 1RRMA 5CT5A 4RTSA 4PSDA 3OT5A 5WRFA 4BASA 1ZU5A 1WSAA 4CIVA 4ONEA 1Q12A 4YJ2A 2B9VA 4ZO8A 3A0RB 4II2A 2GPJA 4BZZA 1T0UA 4YXFA 1PYGA 2JJ2D 4ER3A 5AR1A 4ZU3A 1ISGA 3CZ5A 5LMZA 2B4QA 3CEHA 4YS6A 4HDQB 5LZ9A 2PSFA 3JYOA 4KG7A 2V3CC 1C3XA 3DZ8A 1JT9A 3N0XA 1QANA 3BC1A 3FYCA 4CLEA 4JOSA 4R5MA 4RTOA 1Y6FA 3S29A 5CX1A 1T36A 4NBLA 1YB4A 5ENDA 1WHSA 2FPIA 4BNMA 2GTHA 4NNOA 5DBOA 3S6JA 5C18A 721PA 4PC6A 1BD4A 3TLEA 5DGIA 5E9JA 5ITZB 4DSOA 1E0AA 3PI7A 2JRLA 4U3JB 1VLHA 4O6VA 3QA3E 4MYRA 5A62A 4WLVA 2QXYA 1QAMA 2XKBA 2PDAA 1M2OB 2HWWA 4TMXA 2X8WA 3LYAA 5IANA 2A3NA 2ORVA 2QE6A 3AUSA 1YA8A 3UT0A 1D1PA 1SC1A 2YZMA 2PXAA 4QDTA 4WRRA 5SZKB 5J4LA 1TM5E 5HTOA 4F3RA 7AT1A 5LP6A 3WLIA 4EJSA 4EX6A 2IZ0A 4C7BA 1NBHA 1VZ2A 3EN0A 4F04A 4CODB 2GHIA 1PFQA 1DBVO 1IJEA 2JCBA 1AGRA 1O6GA 4MUIA 2ZRBA 2GCPA 4UUQA 4UHDA 3OBBA 1NX9A 3QA9A 4AWAA 5AI6A 3TSWA 3MJCA 4LWPA 1BE1A 4JX9A 4XX0B 2EQBA 4YP9A 4WXRA 1TYCA 3PR1A 1JG6A 3RKSA 2ATCA 2C31A 3AG6A 4MI1A 2GCOA 3ABIA 1XP5A 4JUFA 1Z2NX 3D8SA 5B1EA 5A6VA 2V5VA 1H4TA 2C7BA 3SPXA 1D7OA 1ZUHA 2R00A 1V9SA 5C1IA 3T3DA 5GJVC 1C50A 2EIHA 3NLLA 4TLMB 4DM4A 1Z2OX 2YZ7A 1JSRA 3BF8A 4MUHA 2I66A 4UNQA 5A9SA 1UBGA 4DUZB 1GUBA 1WVMA 2NXCA 4D1YA 2GN8A 3L05A 2JH8A 1OFUX 5HKLA 1PYOA 4IOMA 4KXLA 2WMOB 1LB1B 4KAXA 3RYTC 3ZWNA 1FYDA 3O8LA 4B4OA 3WXMA 1N36B 5F2KA 4CU5A 2Z3VA 3LCVB 3E81A 4ZGGA 1JA1A 2R79A 2QK4A 1Q74A 1W73A 2RHWA 1T3HA 3L7NA 4MP8A 3K5IA 4XLTA 3V1MA 3LDGA 5IXSA 1DCTA 1TMKA 4B3DA 1KAOA 3OP1A 1I32A 1WY5A 1RAAA 4B3GA 4HYQA 3WHKA 3ZE8A 4MVJH 4DV5B 4OO3A 2Q3JA 2WAXA 2Q3LA 5TB5A 5CDGA 4EHKA 2H11A 2QRZA 5COQA 4ZV4A 2JBWA 1WUYA 1GYRA 1G8GA 4J7UA 3WJ2A 1CB7A 1D2AA 3X3HA 5BWMA 2WMYA 4U7HA 1TYBE 2V7WA 3HYLA 4JC0A 1F38A 2IXFA 3OEEA 4GBJA 1KI6A 3TLMA 2O3UA 1GRRA 2XDQA 1N3IA 4JSYA 2HPHA 3GFTA 5ALYA 3RF6A 3TBHA 4K5QA 4KQ1A 4FEAA 2ZITA 4OOFA 1JR6A 2UUPA 1R4MB 1EKXA 2C61A 5FL7A 5I9SA 3AXSA 3NWEA 4C20A 2FSPA 3OEYA 5IX8A 1FP4B 5JVDB 1C7JA 1O2DA 5JNUA 1Z6ZA 3DXFA 4LJSA 5TT1A 4I99A 4JXXA 3J81k 3TW4A 3BQNB 1Z0DA 5ALDA 2LE0A 5DFAA 1VLLA 3CMMA 1NQOA 1N2GA 2HCTA 3A9TA 3HRKA 5ENZA 3K9CA 1ZI6A 4CMAA 3D0RA 1L6RA 3LX5A 2I6TA 5JSHA 4DIOA 1NR1A 1QWOA 5JMWA 5KS2A 1U5BB 4OHRA 1SKQA 3R41A 4YO7A 1T24A 4AY2A 3ESDA 2W6QA 1KKMA 3BWVA 1C0EA 5JYDA 3SMQA 1GITA 3JZIA 4PAMA 4X1YB 4EELA 5HQ3A 3ROFA 1NATA 3B78A 1A7UA 3DE5X 4IXTA 5ANRB 4MV0A 4R6XA 1A2OA 3ZU6A 1UM8A 5FO1A 2DXIA 1NSYA 1QK5A 4NCXA 1B6RA 3W8FA 1RZRD 2Q46A 4NJMB 3K32A 1GCUA 2N3ZA 3TSCA 4YT4A 3SFTA 1ATIA 2YXBA 1FRQA 1K75A 3DL4A 3Q9UA 4Z53A 2VYCA 3HJGA 4MQFA 5BQXA 1V5WA 4Q3LA 1SKUA 1VSBA 2AMLA 5IKMA 2FX2A 3QSYA 3GBPA 4FQ5A 4KDCA 4CEIA 3HDQA 1DGQA 3I3SR 1PLJA 4LX8A 1L5MA 1TRHA 2AEFA 1UOOA 3OQ6A 2CC2A 2ZTLA 4RKRA 1RQGA 4MGHA 1KZHA 2VHCA 4G0PA 3E22B 1TA4A 1IJBA 1RYYA 1ZIOA 3LT4A 4DYHA 4IV0A 3EY9A 3ERCA 4C2UA 2MSNA 1DG3A 3G5TA 5B1YA 3TF5A 4KYTA 1T1RA 3FVTA 1T6YA 2WLTA 3WGJA 2C95A 1A72A 2XBUA 1R6BX 1UJ4A 4TSFA 1E5DA 4BMCA 4HDKB 1OJ7A 3RIEA 2VRWA 3GJ5A 5A5GA 3GEDA 4FI3C 2DVMA 3ZU3A 3NANA 4NNPA 1IB0A 4YCBA 2X7XA 3COVA 4LJ4A 4LJ8A 3OG9A 1TF2A 4ED9A 4GZ6A 1QRRA 5KQGA 1QRTA 1V8PA 1B14A 2QY9A 2DT5A 4TMZA 1IZZA 4GS5A 2NO9A 2JIMA 1LNSA 1U98A 2VWGA 2Z1MA 3QTLA 4B7XA 3FFXA 4NYMQ 5E2IA 2C2WA 3VDRA 1HE2A 1ZH2A 2Q1TA 3MOGA 1PNQA 5JW6A 1B3RA 5M7EA 1Z29A 3L1UA 2OFOA 3KXLA 4WZBE 3GA0A 3MBKA 1RJ9B 1I01A 1YCDA 4KE9A 4PLPA 1QH8A 3NGLA 1O97D 4WX2B 1Z4IA 5ULLA 4GU5A 4OK6A 1G291 1RKUA 2VSQA 5CVJA 3OLZA 5JCXA 2GX6A 4G1MB 1DKPA 4PNPA 1JPUA 3IVCA 2CNKA 4HNSA 5FQOA 1AVTA 3DE6X 4CR7A 4F8YA 4I6JA 5KNBH 1LBQA 1ECFA 1R0WA 1ZL2A 1A9OA 3FUWA 5JSUA 5JCZA 1JXAA 4OX9B 1WMDA 3QEMB 1YACA 2FRXA 1PW7A 4TGLA 3RNOA 4EVQA 4MUAA 1Z0AA 4Y0NA 2PQ0A 2YHSA 2HQBA 1NW6A 2BCEA 1IRIA 2BGKA 3JAWA 3PLRA 2GNPA 2Q7OE 3CEPB 1EXMA 2O57A 4HVCA 3V1KA 2VRNA 5A6SA 4MMXB 4BRZA 3AHEA 2J3DA 4K0RA 3RJMA 1F0PA 2OXIA 1YU6A 2GRAA 3TRDA 3ORYA 2XAAA 3PFCA 5KAMA 3BF7A 2MJLA 4OXXA 3WLHA 1KWKA 1VKNA 1Y6QA 1YASA 2WG2A 3VH1A 2VDJA 4YAFA 1E64A 4JVOA 1XI2A 4QLOA 3SEFA 1ANKA 2CW5A 3D9QX 3ACDA 3KS9A 3OLQA 1M5RA 1DELA 3MSCA 4HWTA 3IV9A 1PZMA 3FBTA 4D8VA 1K8RA 2IHBA 2BONA 2V0GA 4BO8A 4KHPB 2D7DA 2X14A 3E3AA 1INLA 2QI9C 4GC9A 4LPSA 3KQQA 3RW9A 1BCSA 3JWPA 2HF7A 1BRMA 4TTVA 5L7WA 3VR4H 5LLDA 4QC2A 3GJ8A 1EFAA 2G71A 4H1TA 3X2SA 4E2XA 2M6SA 2EJCA 2QJWA 3R3XA 2VP9A 5A7GA 4E1BA 4K86A 1KAMA 3UOWA 4MKRA 2I5PO 3LQYA 1ZBQA 1HYEA 3M2PA 1PWHA 1HDZA 1K7YA 3KUDA 3P2EA 1Z4JA 2EZUA 3AK4A 3FPCA 4JB0A 3TN7A 3RT1A 5FI5A 4D5GA 2XWBF 3DZKA 3FVQA 3FNEA 4PINA 1P6UA 1UBUS 3KAQA 5EMJA 3UKDA 2OSVA 1JNYA 1S89A 2OCXA 3GLUA 2J9RA 4DDHA 1T0IA 3GAMA 1C30A 1RYEA 1DBQA 5B7PA 3GLFE 3LW8A 2IIVA 2PZMA 3U4QB 4WFKA 2GK7A 4HBZA 4NICA 3COPA 1P0QA 5I48A 3MUEA 2Z83A 2F67A 3LC0A 1E0KA 2O6LA 4WUTA 1IBRA 4MGKR 5FADA 1O89A 1PT5A 1WSWA 1JJ7A 1LDBA 1HE4A 4W5JA 1RQNA 1UMBA 4IGFA 2JJ1A 5ALQA 1QH9A 5DEOA 1KHTA 4JA2A 4NMHA 2OCYC 3AUAA 1T15A 4WOPA 4O4JA 3CF0A 2R48A 1KOFA 1FTWA 4Z4CA 1LRLA 1MXFA 1UPCA 2ID9A 2NYAA 4FSHA 4Z8XA 2PKYX 5K3AA 3H9JA 4C06A 2BBWA 1KRXA 1M6EX 4YQEA 1R8QA 2H1RA 3I83A 3WP1B 4HDAA 4FU0A 4IIHA 2IWRA 4F2HA 1U9ZA 2GWRA 3SXJA 2G9ZA 4JUBA 1N8KA 1JIJA 1MEEA 2W2MA 3CTMA 4FW8A 4GPD1 4AN0A 4F4JA 3NASA 1A71A 3OIWA 1NE7A 3LVQE 2EZ9A 1OLUA 5IAGA 3IXLA 4QSMA 4RZXA 1H2EA 1N6RA 3K3PA 2DH5A 3IJPA 5C4GB 4BJ3A 1WU8A 4MI3A 3TQQA 4DCOA 2JK1A 2L0XA 3GAAA 3SLGA 4LJ5A 2NIPA 2ONJA 3U3RA 4A2QA 2V4ZA 5DDIP 4FCVA 1YVPA 3U4CA 1OY1A 2CXRA 1Q22A 4O4HB 2OFPA 3PR3A 1MNAA 1Z15A 1MB9A 1JNXX 1ZLYA 5L3RA 3T9BA 3OMWA 2Y67A 3CZMA 3PYXA 4FC7A 1J23A 1Z5GA 4OL9A 2QMYA 1GL7A 3PUVA 1A8SA 3GCDA 1RIIA 4IJQA 2JVIA 2H16A 2PGJA 5B4TA 4KLRA 4KUHA 2Z43A 3NS7A 1Y89A 3V4PB 4PXAA 5IJ9A 4U63A 4FUTA 2BN4A 5F5XA 2VNKA 1B93A 2OPBA 5BW4A 1RYZA 4Q12A 3JS5A 2IV7A 1JMVA 2FR0A 4YK7A 3THXA 2LDXA 3QXGA 1YZNA 3RODA 4QGAA 1DX9A 4OQNA 4BLRA 3VV3A 4PC2A 4QNMA 4B73A 1QIDA 1RYMA 1SEPA 1EJBA 1YDMA 4Z4FA 2JCXA 4HXYA 3MBIA 3T1OA 1G2QA 4ZYYA 3TTSA 3RUEA 4DJAA 4MPPA 3CSDA 2JS7A 2PX8A 4KKXB 1NUAA 2AJBA 3CHYA 2IXDA 5LQAA 3OKAA 3CO5A 4RGVA 4BBPA 4JLMA 1ZGGA 3GOHA 2J67A 1VTKA 4NCBA 3A28A 4BFWA 1F2DA 3QVJA 1N33B 3PHJA 4LZPA 5AKYA 1XA3A 1E3WA 2IYAA 4OQZA 3WLNA 4MIOA 3SX2A 1UZMA 2RDMA 4UZFA 3IHWA 1E9BA 3CSUA 5J4HA 1K6IA 4FMDB 4HLQB 2XWPA 4KWEA 3VDNB 3T1HB 4GOLD 4C4OA 2BSQA 5E8JA 1YVUA 2HCFA 3GRVA 4BV2A 4HQ0A 1WP9A 2Q4EA 3IUEA 4G9GA 4J2TA 4RY9A 3R3JA 3DB1A 2IXGA 1M8FA 4GRDA 4UOZA 4QYMA 2VTKA 5I9LA 2Q1UA 3F3SA 5ALPA 1S02A 2PL1A 5IC4A 1DG9A 1LC0A 1USKA 4P9NA 5C8DA 2O2IA 2WFMA 2ILTA 3P9CA 2BFFB 5ALZA 4U1RA 3RROA 1ZGCA 1I7NA 5KHLB 1CCWA 3BFJA 4QQKA 2PUBA 1WU7A 2E85A 3VR5D 4EKEA 1ZH8A 1WDWB 1AGYA 2JAUA 2Q4BA 2X23A 2ZRKA 3JQQA 3LP8A 1NC1A 4K1XA 4PRYA 3B1VA 4MW9A 2FPMA 4ARZA 2GOYA 4EVRA 4B6EA 2A5DA 3A25A 5B1SA 3SEZA 3VYVA 4QD3A 4CT4B 1JLMA 1QGUA 5AUQA 2WQ7A 1G8AA 4Z86A 1YC2A 3KHUA 1D4OA 2QKYA 4QU8A 3F9CA 2ILVA 2QP4A 2ZROA 1UMBB 3K9LA 1XZFA 1Q5PA 3JAWB 4WZAB 1CDZA 4F9GA 3AKCA 5I47A 4DR6B 1PT6A 1OI3A 4ZYZA 1BWSA 4BP9A 1JEOA 1M7HA 4PYLA 4BX8A 3GDHA 5JAMA 1VLMA 3O5AA 4NZMA 3S2ZA 3U5ZB 3F7NA 3HLKA 3MXOA 4R1UA 4OYHA 3GGJA 4K3VA 4L6AA 4LC0A 3WB9A 4BVHA 3L04A 5LXTF 1T8WA 2WF8A 1C3JA 3EXG1 4ND4A 2NZYA 4I4TF 2A58A 4S0XA 2IUYA 5LYJF 3NC4A 4Y2TA 3TGWA 5BW8A 1L7NA 5EN4A 3JZDA 1QKJA 4LI0A 4NC9A 1OI4A 4G0WA 2JIBA 2OLKA 3IIEA 3IR7A 2C5AA 2H5EA 3I30X 3OZEA 3EX7C 1U0HC 4FYIA 5C7IO 1T3LA 4MEJA 4MYUA 1SG9A 2VCHA 1J25A 1XTJA 2UXDB 2XUAA 4GRAA 4HDCA 2BGJA 2YIJA 1XWWA 4E4TA 2HHAA 1OWLA 2FQWA 2GUWA 3I61A 1ZMOA 2R60A 3O91A 4HJXA 1A4IA 5F3DA 3VISA 1NNLA 1J7KA 1VMKA 2X19A 1NVDA 3PE6A 4O4HF 3AR6A 4HEA6 5J43A 3FZQA 1BKDR 4QATA 4DCNA 1YFLA 4J8PA 2I4NA 3BGWA 4KOEC 3MTQA 1WKCA 2FQ1A 3MWYW 3C5VA 4NS1A 2IQ5A 4TWAA 4RETA 2BR5A 4KX3A 2EIXA 2VSNA 4UNRA 3KDPA 3OZ7A 3UW1A 3RTEA 1QR2A 1ST3A 1EE1A 4PZUA 2QQ5A 1PV4A 4Q3OA 4QXAA 1EFPB 3N70A 3Q72A 4F1KA 1BMTA 1DZIA 3K71B 3I3OA 1PSWA 4RHXA 1QYRA 4B6SA 1ZOSA 3EZ9A 2FDCA 2NSDA 1SCDA 3CJRA 3NATA 4MJ7A 5CH5A 1H2ZA 2CSUA 4JBNA 2FSGA 1SKAA 2MHCA 3DAFA 4AIRA 4MDHA 1LSSA 4EKDA 4TMWA 3CUWA 4IQFA 1YUNA 3IXQA 5H4GA 1Q7CA 2DPGA 1GU0A 1C2TA 2G6BA 2WTEA 1OWNA 1ZMRA 4G5FA 2XVYA 1X8KA 4BNUA 2RHCA 1LZKA 3TMYA 1NVVR 5ICCA 3A4IA 2P0YA 3ZE9A 3KZCA 4RKEA 3UXEA 3KSAC 3OJOA 2XB6A 3VPFA 3P4YA 1FDWA 3ON5A 1YQQA 4LF9B 5GGXA 1WB4A 2CUNA 4RFVA 1UEIA 5DNUA 5HFJA 2J6IA 1X3LA 3CR8A 3LM8A 3RM3A 5EJ8A 2BGRA 4DKXA 1PFVA 4H6WA 3QY0A 4AF6A 3GPIA 4HDNB 4KGVA 4HDSB 4BYGA 4CFSA 1JAIA 5DCWA 2RE8A 1UWKA 2KE5A 2ZATA 2BEUB 3SD7A 1LFDB 5C8YA 3MCZA 3PF9A 3PLAE 3KLMX 4JBLA 2HPVA 4WESB 3VI3B 2PBLA 4D74A 3GLGA 1YB1A 2GAFA 2ORYA 4ZO4A 5HVNA 1IE3A 5EIOA 5FOQA 3EPKA 1R8YA 1LX6A 1SQ0A 2AJCA 2D2IA 4P33A 4YCJA 4CTNA 1DOAA 4NIMA 4EH1A 1BDBA 5KNCA 2GD0A 3Q9LA 1GVHA 3WGQA 2BFCB 1SOAA 3UGKA 3RS0A 1K89A 1VJ0A 3KTAB 4RFSB 4FR2A 4H9GA 4Z4IA 3PUHA 5G41A 4C76A 2ROQA 1XHFA 3LY8A 4DBLC 4GSYA 1UDRA 3K35A 2BT4A 3GUVA 4KQIA 3V8QA 2PY6A 1G41A 5DNWA 1XALA 2ZYDA 5CPFA 3HKDB 5BR8B 4UMVA 1ZN2A 5EIHA 2G80A 4OUDB 1DTEA 2UZIR 3DM5A 3GAFA 3ZGNA 2NZXA 4JKIA 1UJBA 2JFQA 3VHQA 2UZAA 2WYVA 3NP7A 4PZ0A 4QHTA 1G8YA 5REQB 3HP7A 4BYMA 1I1QB 3IRUA 1BS9A 2AB0A 4LG1A 2O5EA 4KSCA 1WNFA 4WT7A 1H1LB 4LBYA 1HZJA 4JP8A 1Z4QA 5TQ0A 1ZW6A 1N6HA 3JSAA 4LQLA 5LQNA 3X44A 2JI9A 3W5DA 4I1YA 3T0GA 3GLSA 3ND6A 2ZKLA 5IWCA 3E18A 2XKJE 2EP5A 4LJRA 1Z2EA 2GLXA 5K51A 4OKIA 3X0DA 3WHPA 1PD1A 4AYXA 1CYDA 4FT4A 1DTWB 4JL8A 3WSTA 1JR3A 1L7EA 3L2OB 4LZJA 4OQLA 3ZKWB 2BI7A 4EW2A 4ANFA 3AF2A 3UK0A 1PN3A 3HK2A 3NWOA 4M8IA 3GRAA 2XQVA 4D9BA 4QJ3A 1FVOA 2PZKA 4XWWA 3QVGB 4PRKA 3ZWOA 5CCBA 4RD6A 3UG6A 1G2OA 3T06B 3SJUA 4GRIA 3IV7A 2CJWA 2EV9A 2PKWA 1GCOA 1KXJA 1U0TA 2QD3A 4KLZA 4RAQA 1K6JA 5DI3A 4EB6B 1A9RA 2AOXA 4MKHA 1OXBB 5JCPA 3P96A 4BQFA 3FDZA 1H9BA 2WQ6A 5TEWA 5EUMA 1NFRA 1RC1A 1OYYA 1CUAA 1SXHA 1U2QA 1KO1A 1P44A 2W43A 1A77A 3A70A 3AEUB 2GPAA 3K0AA 5E6UA 4KVGA 4EPVA 4PN3A 3H11B 4BAUA 2HWUA 1VOTA 1ENOA 1EVEA 2D6FA 4QPDA 2EBHX 3WTBA 5E1MA 3FKSD 3H8WA 1SOWA 1WLSA 4AWXA 1V3TA 4X7RA 3BDVA 2ZBQA 1PT9A 1PVDA 1RI5A 2O7VA 5E1BA 3SS7X 5FOTA 2QSZA 3K1JA 1NUPA 4ZT3A 1G21A 4PLWA 5I8ZA 3LTEA 3OM0A 4YCLA 3E9YA 1U99A 1ULSA 2EGUA 1NQ5A 3DAPA 5DNCA 4JVSB 2GN0A 2CDNA 3RYFB 1E1KA 1NE2A 1JHZA 2PZEA 2W93A 1NF8A 5JMPA 4EQ6B 4F12A 1Y5IA 2A9PA 2GYVA 3DM9B 3JQGB 4D26A 2P41A 2W22A 3ROQA 1F2VA 2H63A 3IQZA 2WWYA 1GRVA 2HLHA 1UKAA 4FDMA 1PJCA 3GB9A 2YJGA 3H65A 1W48A 2X0JA 3QWBA 4F2PA 4IZHA 4G8BA 6NULA 3IQFA 1TC2A 4WCFB 5LMNB 1AKVA 1ZN7A 2ASVA 4NEGA 1CY6A 3RSCA 2Y6UA 4XIFA 1UEXC 3DMGA 1YOBA 1NW5A 4Q7EA 4ZREA 2AC2A 2JFFA 2IZ6A 3IDFA 1WY7A 1K7FB 2GKGA 2P6MA 1O3YA 5CLLA 2C2MA 1QHEA 2WVAA 3PIIA 4MW7A 5EKSA 4ZAVA 3U7IA 1WJGA 5FPQA 3ABQB 5JSZB 5EQJB 4UHCA 4DQUA 4BUJA 3QBVA 1QMGA 3PT9A 3ZY4A 5FORA 4PHTA 4RF4A 3RFXA 3ZX5A 1J9EA 3YASA 4CTKA 1C0KA 3CGGA 3FWYA 5E6UB 4WBXC 4H4DA 2RI6A 2C2HA 3B1XA 3Q0TA 1U7UA 2GBLA 3D6JA 2PKQO 3HJAA 4DANA 2XUHA 3KDSE 1D5CA 3ROGA 3GUZA 4BMDA 4WKBA 2QD4A 1E3QA 1NVBA 2F1IA 2OT3B 3CBQA 2M2IA 2IZ1A 3NGMA 3PA8A 4L9RA 3DJFA 2XMQA 4QASA 4V2UA 3WGMA 1CF4A 2C0QA 4R1TA 2YY5A 1HDOA 4A8JA 5CITA 5C51B 3S55A 4NH0A 3WYAA 4XJVA 4ER0A 4OAQA 4URHA 1ORHA 3DBLB 3MGGA 5B58T 4C29A 4DABA 4E6PA 3NORA 4RHCA 2AQIA 1E2HA 1VHDA 4JOQA 1O77A 6ABPA 1KZGB 1IEVA 3UOAB 4LHZA 5DMHA 3QKWA 3TEFA 3HA5A 1T4CB 1UC4B 4ZJYA 4EA6A 4R1NA 2DPYA 5BNZA 3RYHA 3BPSA 4MH0R 4HEJA 5JFTA 2FMTA 2KM1A 1YIAA 1PQPA 5T67A 3SK0A 2BLLA 1G5HA 1EZ1A 4G4IA 1V5EA 1XD2B 1ZP6A 4TYYA 1FRVA 1H8HD 3JRXA 3I9FA 1WXFA 2JHAA 1BVUA 5HQTA 2G5PA 3GO4A 4JQSA 3FAZA 2H1IA 1H1LA 2QL9A 3JQCA 4Z0NA 3SYMA 4HAZA 3WAGA 4DQ0A 2V1UA 1KNXA 4LE0A 5CBPA 5D6OA 4RKFA 3VR3A 2UZ1A 2BF7A 1MB3A 2WJPA 3HY3A 3I1FA 3W7VA 2QJFA 3WQRA 4FD2A 4RVUA 4AK9A 4RPGA 1ZJWA 1YDWA 2X9NA 2HNKA 4RJ2A 4OUDA 4GLBA 3RS4A 3RYFA 3PI6A 3HCDA 4OH1A 4XX1A 5IZCC 3GGSA 2NUAB 4P3XA 5DX1A 3L6EA 1G38A 2H8GA 4RSRA 1ND6A 2VR1A 2VBGA 3IYLW 1YKSA 3AJRA 2GBLC 2C77A 3OESA 5AKHA 4AJ2A 1KETA 1QIJA 2BL4A 4IH1A 3SHWA 2VNSA 2B3DA 1QP8A 5BR1A 1A76A 1E5QA 5GQSA 2ORWA 5I8PA 1E9VA 2ZAYA 4Z7QB 1ISPA 3H5RA 1H9AA 1TM7E 2JL1A 4WESA 1P81A 5CAEA 1M8JA 2RI1A 4DLLA 3UJHA 3B85A 3BXGA 3QFSA 2WM8A 1NM5A 3C7KA 3IIJA 3X1YA 4ER6A 2UXBB 4LYDA 1FFXA 2WSMA 1OFVA 1X1CA 3HBLA 1ZD4A 3FOCA 3P0HA 4OHXA 3OJXA 1YZLA 5BN3A 4URXR 1MABA 2KW5A 2R7NA 3DZJA 1SUAA 5ERGB 2C4UA 4YBZA 4EGSA 1N4DA 3NBFA 4RY8A 2JHFA 1DOHA 3B48A 3DGFC 2VJCA 4L8VA 4JQYA 2HTFA 1TQDA 4LPKA 4FXOA 5BMVA 1ICEA 4TV9F 2OBMA 2Q9UA 5EEGA 3OPXA 5THXA 3AL0C 4FFBA 4ZP1A 3MAJA 1DXYA 5JZVA 3GARA 3GZ4A 3PJEA 2LBPA 1Z37A 3OJLA 3WSWA 3CWQA 3EXIB 1N2ZA 1L1QA 3QJYA 4RK0A 4XB6B 1R7RA 1VI6A 2QTAA 1Y9JA 3CNLA 4PVDA 2P9QA 5KNCD 5DRTA 1Z0KA 4XM0A 3HJBA 3H7IA 2YY6A 4YRMA 3OPVA 3UB2A 5L6LB 1C9DB 4I1VA 4MRPA 2IGTA 1XPJA 1DHRA 5IRCD 4XUDA 3T3PB 4LDNA 4DCPA 2J9FA 1TVKB 2Z8YA 3CS3A 4K03A 3SMVA 2P9ZA 1BFKA 1KVUA 4DV7B 4AUNA 1JHYA 1SBNE 3ZHBA 4EL0A 2A33A 3SHTA 4EBFA 2XRZA 4JJ8A 1G2IA 3NM6B 3ULKA 1A9XA 2B3TA 1L4HA 1T13A 1RKQA 4GOJA 5KYXA 2B9EA 4E21A 4MPJA 3HWSA 5JCOA 1XJQA 2GPSA 2H0RA 2G07A 2LTAA 2W4QA 1SD1A 2ZB8A 3LG2A 3WV5A 3U39A 5LOVA 3HLTA 3FOEC 1RC8A 3EULA 1OVGA 2PGDA 2AG8A 1Z28A 4N7JA 5JNTA 1GAJA 3EMBA 3LLMA 1JHMA 4QDZA 2WV9A 1YH3A 3NX4A 2JLUA 1JI0A 5J5VA 5CG2A 2X0NA 1K3FA 1EBFA 2IHZA 3E0XA 4BNTA 4F4HA 1ZHHA 4QJ5A 1KJWA 5DSXA 4RMJA 5EJ2A 4UM9B 3VKUA 3E4DA 5KX5B 1Z16A 2A78A 2JGDA 1HZZC 4L95C 5CURA 4B09A 4M0KA 1JIIA 2MR5A 4HNAB 1SB9A 2BJWA 4C6RA 1RQ2A 1X7YB 2PMWB 4HAUA 3U3DA 1O94C 1XEAA 2CLCX 2GK6A 3UIEA 4CI0B 4DMFA 1CU1A 3O0TA 4ENSA 4DSUA 5H8WA 1A69A 5KOYA 3OZTA 1YQTA 3STWA 1ZC3A 2ZBPA 4A0SA 2OD2A 1GXSB 2BAGA 2I6UA 2N9UA 4HNVA 4MWOA 2R1VA 3PNVA 4B48A 2RGDA 4L8GA 5ITWA 1V9CA 3ROZA 1AJEA 3KOYA 1ICIA 1TA0A 3TKLA 3IMGA 4MDEA 3CH5A 3DFUA 4H0CA 1JQBA 4P4TA 2QRGA 3WGHA 1X38A 2QVZX 2VYNA 4Y2RA 4MVJG 1Q21A 1JLKA 1P17A 2NUTB 1M6VB 1C2YA 3O1LA 4XQ9A 1P61B 4J07A 2XTNA 4PIMA 2KB0A 2CK3A 2CKDA 4UATA 4FX5A 4ZT2A 2HK8A 3NKLA 1FIUA 1N92A 1H93A 4F3TA 4TTIA 5JSFA 4ZTBA 2N1BA 2PL3A 4RLFA 3ROPA 3PP8A 3R3VA 4HUJA 4D6YA 2BKLA 3PWSA 1YAHA 2DZDA 5CJ2A 5DLPA 3EGDA 2EJUA 3GZNB 1TZMA 4N01A 4RK7A 3ZNPA 4E1AA 2Z5VA 2IXBA 2F17A 2D59A 1JLLB 2CVQA 4AP5A 5C32A 3A05A 1P0IA 4ENWA 1KDVA 3LUPA 4PX9A 1FC0A 1ZKDA 2N47A 3AVXA 3FTCA 4WZ6A 2O0KA 1G3QA 3TRKA 4HLDA 1QHIA 1CUWA 1Y9AA 1HH4A 2H4FA 2YZ2A 3ZDRA 4Y2PA 2L17A 1TO6A 2O23A 3ITDA 4ID9A 1QF9A 1Y48E 1XZAA 1JG2A 2IPMA 3OMXA 4L02A 3UY4A 1W2WB 2X0KA 3AWDA 4GO1A 2ZRFA 5GV8A 4DSNA 2G08A 3TKAA 1CZLA 3FZNA 2WTUA 1M83A 3JR3A 4HUTA 1TKBA 3VHXB 2OXEA 3LT5A 3ZDDA 1IBKB 5HOQA 3QPWA 4RTRA 1KI4A 2ZEJA 2O5CA 2X2PA 4IOKA 2P2DA 1NRIA 1O0CA 3AI3A 3IIIA 3SZRA 3LBNA 3NUQA 3VU0A 3ZE6A 2AOTA 3KZMA 1RE0A 1ZICA 4HRYA 5EHIA 4BNFA 3C6BA 5F12A 4ZCMA 2VH2A 2BW0A 4ZQFA 1XL1A 3JD1A 3QGMA 3QXJA 1XLTC 1JAHA 1H3EA 3Q7RA 4IRUB 3WMWA 4AMZA 3FW1A 3E58A 3F8TA 4O4LA 2ISCA 1M3SA 1ZCAA 2WU3A 3JVUA 1NW7A 3HB4X 4MJXA 2PNFA 2E6KA 1BE8A 1RVDA 5K20A 1TJ4A 2ISQA 1U0BB 2C2OA 4QPPA 1XRNA 2H4HA 1W581 3Q6MA 4DRXB 4G67A 5FIUA 4H1HA 2PQMA 5CMLA 2HEGA 4NMWA 4DMHA 1ZXLA 3G8DA 2E7ZA 4FFSA 4OJYA 1LEHA 4MHOA 3E9RA 2FQXA 2FDRA 2QIPA 3D3QA 1F2TB 1LLCA 2C96A 2HK9A 4MW5A 4BZQA 1JDPA 2EFDB 4M1QA 1P33A 2B2NA 3KALA 3MGBA 4NBRA 3UAGA 3VSAA 4EARA 3RU2A 2GJ8A 1U2ZA 4D9MA 1GQSA 3HU2A 5DWQA 5KVVA 1PU2A 4FNOA 2DH6A 4JZKA 3PVCA 2FG7C 4L0QA 4UCXA 4JVMA 4O4IA 4HX5A 1ZJYA 4W1QA 4WLUA 3NFRA 1BX3A 3BX1A 2TS1A 4P7BA 3DV0A 1VCOA 2CN1A 4ZAZA 1ZGAA 3C7CB 1HG0A 3WYEA 1LKZA 3VOSA 2PSJA 4NU0A 1I36A 1NY6A 1UXGA 2ZDGA 4GZMA 4CKYA 4DPMA 2EHDA 4C7XA 2J59A 4ZRNA 3TZ6A 3ZHOA 3S7ZA 4D4LA 2C78A 4ZZ2A 4C01A 4H60A 4J4TA 1RKBA 4BQEA 3ETHA 3IAM1 1CTQA 1QZXA 1GCAA 2JGLA 1QQ6A 3EVNA 4GOMD 5DBGA 3TQCA 3MMPA 4LNUA 4KWIA 1QO0A 2ZJ1A 1EJ0A 4QJIA 5AHXA 5BNWA 1GT6A 2O14A 3SZ3A 2RGAA 2DF8A 2VDWA 2WIBA 2HJRA 4PANA 5F64A 3HB9A 4G5RA 2D3TA 4A2PA 3IP3A 4YMUA 4JP3A 1I0ZA 1U7ZA 1IN4A 3EODA 2R2GA 1FJGB 4O4JB 1XU7A 3ZKAA 1GNSA 3OFNA 1QC5A 2CFOA 1JEYA 4S2UA 1GQQA 4V38A 1KJJA 3K92A 2ON6A 4B46A 3WK6A 4D92A 3I4LA 4EY8A 5GJBA 3CF6R 5JDCC 3RASA 3WLRA 4DHWA 3U9TA 1G55A 1NX6A 5F9FA 4YTEA 1U1GA 1BEUB 1Q3TA 1IWOA 1JIXA 3A4MA 3R3SA 3DO8A 3NGXA 4EHBA 2B0JA 3BXZA 4LVUA 4PYRA 3KKEA 4AG3A 2QI9F 5KC9A 2X0IA 1CR6A 1T3ZA 1JH9A 3QM1A 1TLFA 4REMA 5AVYA 2H1VA 1V3VA 2WWXA 3BMXA 4ND7A 4LVOA 4OFXA 5AIAA 1XQYA 1XFDA 4XSVA 4BO7A 3A1EA 3HDGA 3B3GA 3T7JA 1FDOA 1HFWA 1BHQ1 2FZEA 3ADOA 2G0AA 3T35A 1V16B 3TDKA 2R5WA 1YQXA 2C99A 3ZYZA 1AXEA 2IELA 3UC9A 3V8MA 3AINA 3KTDA 3WYDA 4B4VA 5JNSA 5LQKA 4DW8A 4JI2B 2BE9A 1ZU4A 2BMAA 2YIDA 1JYFA 1RCTE 1ZUIA 3OCUA 5HIJA 4IG4A 5BRNA 1XNJA 1PSZA 1OAAA 1CUGA 4IIXA 5FBQB 4B82A 1HTTA 3BH7A 2V9ZA 4FDLA 3EXHC 4CJXA 2KPOA 2XWQA 3T9EA 4GGPA 2ZYAA 3D8NA 4M46A 2XEXA 3UT5A 2R6JA 2V98A 4FTWA 2P75A 3T95A 3BXPA 4LRSB 3OCZA 5DW3A 2BEVA 4A8TA 5IEBA 2HB6A 2ZUWA 5HUQA 1FNDA 3BK7A 1RZ3A 3OFJA 4TZ0A 2ZB4A 4O1IA 1KIFA 4NJEA 1R1DA 3O4JA 2QJTA 4BTEA 4IKOA 3PJRA 4PAQA 1EFKA 3STUA 4W7IA 1WULS 2H31A 2NOAA 2R1UA 4HNUA 3O2SB 2HC9A 4EA8A 1BWQA 4E1VA 3UJ8A 3UK1A 5KNCH 3P4UA 2AOUA 1H0HA 4XLZA 2O7QA 3F2VA 1KZ6A 3WIBA 2PH5A 1NXWA 3P52A 2G4LA 5L95A 4JHXA 2IBTA 1SBHA 2JHCA 2QUIA 4DKJA 1LVUA 1JEQA 1MJHA 1U80A 2DQKA 1U2PA 1FMTA 1XXLA 4MP6A 2WJ3A 1L8OA 3NIFB 3TQIA 1RWVA 1N9KA 4FKMA 3ZWYA 2F6RA 3X43A 3RC8A 5DTRA 3OC0A 1X9HA 1NOJA 1CULC 2A9JA 2JZCA 4I66A 4OAOA 4HB4A 4BE4A 2OORC 5IKPA 1RLUA 1M2WA 5BNTA 2LPMA 4R7TA 1YTUA 5KVSA 4P98A 2OORA 2A9KA 3B89A 3MW8A 3N7TA 1E98A 4KO8A 1T9GR 2NTVA 5F1KA 4UQLA 2VXBA 4MARA 1JWLA 2KS6A 1SZCA 1EA5A 5CFQA 3J7TA 2NUPA 2WJGA 3BICA 4KQHA 2CXXA 3P0EA 3AJ8A 2Z2IA 4OBBA 3V1NA 1FS5A 3BSSA 3CKYA 3T4UA 1M6HA 2R6CA 3AW8A 3SYNA 3D6TB 4D82A 5IU6A 4FHGA 3NC0C 4EAQA 1R66A 1WX1A 2PXCA 2AYZA 3B53X 1A04A 3ZV3A 2Q45A 3WAKA 5BV7A 1XTBA 3DL0A 3LY7A 1WXXA 5GIPE 3PQCA 3EGIA 4CG1A 2PJUA 3NHZA 3CE6A 3ORFA 3V8VA 4EPRA 4AXBA 4QVKA 2XMGA 2Y1EA 1DAOA 2YJ5A 1DJLA 3F6PA 3CF4G 1P0CA 1THZA 3ROXA 1DZ3A 3EZ6A 1BU8A 2EKDA 4U9IS 2FMUA 1DRKA 4DADA 3SJ7A 2FSVC 1VPVA 2H48A 2EKQA 4KDEA 3G1TA 1GUAA 2IYLD 4IHJB 5D3QA 3S4YA 4MP3A 5K0FA 1CDEA 4PLCA 5GY7A 1LDYA 4KR0A 1ODJA 3QE9Y 2ZG6A 2AI2A 1DAIA 3RE1A 5HJ5A 4CEIB 2PUEA 2GQ0A 1UFKA 4AXXA 2PUWA 2JZNA 1GZHB 1QKIA 1WW2A 1W52X 1XZJA 2OZEA 1OXKB 2F55A 3PEYA 4MHSA 2Z8YM 3CCCA 1K5DA 5JV5A 4YFYA 4H27A 3W5SA 5FXMA 1M0WA 3LT0A 4NJMA 3ZW8A 3EA4A 3EOZA 3GP3A 7GPBA 2DFVA 4ZVRA 1H5QA 1GGJA 1RRKA 1SIWA 2GPNA 1AF7A 3H2BA 3L7JA 3KETA 4DLBA 2I2FA 4Q1FA 3RV4A 3UA4A 1XIVA 1PK7A 4KEAA 4YHBA 1TT7A 3QXXA 1ZCFA 3U0VA 3IEMA 3G82C 3UCXA 1NI5A 4G5QA 1P7WA 4NJOA 4RULA 1G5RA 4HG2A 3VNRA 1Q92A 2G17A 2CUZA 3WL4A 4PCVA 2OBNA 4P1ZA 1NVUQ 3SDSA 2MYNA 1T1GA 1L7PA 3GXOA 1EX6A 3I09A 4JLNA 3RJZA 4US0R 4C7OA 3FIUA 2NVWA 2I3DA 1UAGA 1BRTA 4XWYA 1RM0A 2O2JA 3R8FA 3TTWA 1CR2A 1DI0A 2DE0X 2Y0PA 4BMNA 4AAYA 4J6EA 4V3BA 1ZH6A 1NBMA 3TD9A 4CNBA 1QG4A 2V1XA 1WDMA 2QNBA 3BXEA 3E7FA 3OLYA 4CF7A 5D3MB 4R8MA 1PTJA 2YQZA 4R3WA 3QVVA 3RYCA 2W6ZA 4QWMA 1GARA 4RZHA 2H18A 1PDWA 1VYHA 2BHNA 2QS9A 4Q1AA 1UXOA 3TG2A 5DTQA 1RWQA 1OX5A 2Q3MA 3DQZA 1Z4OA 4Q19A 4AX4A 1II0A 1ZMBA 3RREA 1OZHA 3QU9A 4DA0A 3MGAA 4CV2A 1VKZA 3C2QA 1KARA 3L7OA 3PC2A 1ADGA 4HUQB 4UAUA 2OHJA 1GGEA 4XYBA 4BLOA 1TCUA 2VJBA 3UFXB 2V7GA 1S2DA 4MKFA 5G4KA 1RYBA 3RUFA 3ADCA 1II8A 2JDIA 5CG1A 3T38A 1YQEA 2V7XA 5EJFA 3AW9A 1NMQA 1YS4A 5JUWA 3MTDA 3GC6A 4UTRA 2FVYA 4FB5A 1AO0A 1AMOA 4PYOA 4ERNA 2W6IA 3VNQA 5ABPA 3C39A 3BEOA 4P2BA 4TL6A 2QX4A 3FBGA 1KBQA 1GEEA 2PEZA 1RXSA 1L8AA 2PD6A 3ONDA 3T52A 1O1YA 3WX0A 1JJAA 2KYRA 3CA8A 1TADA 3K20A 3FPBA 3OZVA 3DE2X 5EJ6A 2G04A 2SHKA 3QITA 5A4AA 3D1LA 4IIFA 1HA3A 3EQ9A 2NGRA 3ORQA 3ZDZB 1ZNWA 5C52B 3PQDA 1FUKA 1QIKA 3EDMA 4LGVA 4XB2A 5AM4A 2C3UA 4NOLA 3WG9A 2VXCA 3QZUA 4EVIA 5KX5F 4JLVA 3N76A 2HPZA 2GFHA 2Q5JA 3AERB 1XP8A 2W58A 1EG2A 2R2AA 3DC2A 3OQBA 4U00A 2WSSA 5CEJA 2HSDA 2FJUA 1GPKA 2JKYA 3DH0A 1OC2A 2QB5A 3B1KA 1AXGA 1LQ2A 3ABRB 3ACBA 3AFNA 5TY0A 1FLNA 1XVLA 1QDEA 3HNRA 3ISVA 4YCAA 4KR9A 4K28A 3MCUA 4QU9A 3RQIA 4YNBA 3IUMA 4UAGA 4XH9B 4X85A 1XRJA 3TOCA 3OX2A 4J94A 4K26A 4I4TA 3WRYC 5KKNB 2UU9B 5THQA 3MQFA 4H6PA 4W5QA 1TZJA 3L1KA 1WZEA 1U0JA 1A1VA 1XN1A 1UXKA 2ETVA 4PZEA 4PX5A 5L4NA 3SQXA 2FN7A 3RB8A 1T8RA 3N3AC 4GKKB 4YJKA 3O1JC 4Z4EA 1ZK4A 3O21A 3FVRA 3C48A 1M6VA 3FFTA 3OEHA 1CY0A 3BCUA 3D4PA 3INYA 2AE2A 2GCGA 4QA9A 3VH3A 3VUFA 1XZQA 1E5XA 4G4JA 1EVIA 2A0UA 2UUOA 3QVXA 4FZJA 1QIIA 4WZBA 3N5KA 4D6XA 1PNRA 5K3OA 1P91A 4Q4CA 1DMRA 4G6ZA 2XXAA 4YJHB 2LCQA 3FF4A 3I6ZA 1FFGA 2E48A 2O7NA 1G1AA 3JQBC 2X3YA 1KU6A 2JATA 1YRYE 4BLSA 1GD1O 3IH5A 4WKCA 2WAOA 5FL3A 4Z7NB 4Q1CA 3VZRA 4F96A 1EGQA 5JO9A 2C7VA 1P0PA 2XA2A 3GR6A 1VPDA 2HMVA 3BORA 4G0YA 1VCNA 2Q7DA 3QXHA 1UBHS 4PQFA 3MN1A 5JPDA 3DT9A 3TH5A 1YFKA 3M4JA 3MAAC 3QX7A 4FPXA 2VF4X 5HTKA 1YRBA 1Z0UA 4BNWA 3OLVA 4B47A 1YZVA 1LJ8A 3MGCA 1F06A 1WVIA 4A0FA 2L82A 1W85B 3L6DA 4PTLA 1IG0A 5HIAA 1C7IA 2FE1A 3AKEA 4K6FA 4PLYA 5BQOA 2IDZA 5HM6A 1B0PA 2X77A 1E4YA 3PC6A 3FTEA 4L27A 4CM4A 1KXZA 3AUXA 2GI4A 4K2HA 1CJCA 1FOEB 4MYDA 4Y0VA 1E6EA 4ZMRA 3DT6A 2ANBA 2OV1A 2HT1A 4FB4A 5L45A 4FYPA 1C9KA 3GQBA 2OYRA 1US8B 3VPGA 4CL3A 2WVGA 1UMDA 5F23A 3SC2B 3AUFA 4Y6RA 4HEA1 3B1WA 3W8EA 5DP1A 1LPMA 1S2MA 4DAEA 5BW6B 2GEVA 4S04A 3TIIA 1M2HA 3DOIA 5FUMA 3H8VA 2W42A 3IAEA 4QDUA 3GWGA 1DPFA 2AZTA 3FYDA 4HTFA 4PWYA 1I4LD 2VHQA 1G8HA 1E79D 1LRKA 2C1ZA 2D1TA 3DAYA 4K6KA 2OV4A 4HD8A 5AI9A 4BTVA 1ZEMA 1I3MA 2I4MA 3G5AA 2CSXA 3H2ZA 5GM1A 3Q3IA 1V45E 3GUUA 4JT4A 5JWRA 4D98A 1QCYA 2XR1A 1O5OA 1WCIB 4MIYA 1O5TA 4POOA 1F9EA 2QUJA 1W5SA 1JE1A 2GNOA 2ZJ5A 3FCSB 3G68A 4FYYA 5ALSA 1E6CA 2BKAA 5I9IA 2IYQA 4D0NA 5CH3A 1Z5ZA 1C41A 1POXA 2B1JA 3HXMA 2WM9B 1X1TA 2QTBA 1B8OA 2Q5LA 3SKYA 1KMHB 2WFAA 1E6UA 4Q82A 4B2LA 3LFUA 2O5RA 2QX9A 3G85A 1UBNA 5I4BA 3KPYA 4MPRA 3A6HA 3DZBA 5KMGA 4YPFA 5JAUA 3THYA 1DE0A 1IEXA 1EBBA 3QW2A 4OX9Y 3OE7D 1E79A 3FR8A 1MO6A 5HDBB 1ZAYA 1TU3A 3W5AA 1XCJA 1LNQA 2OECA 1WW8A 5EEHA 3MNFA 5HRUA 3Q0EA 1CJTC 1N2BA 1NN0A 3LD9A 4YI3A 2Z8ZA 3FZEA 1T9DA 2PX3A 4A6PA 5LLTA 2BFMA 3RFTA 3PUZA 3VJMA 4M8SA 3X1MA 1P1HA 3IMFA 4PPFA 1XTKA 3IE1A 5A0FA 4MO9A 1J06A 4QELA 4PM4A 4K8OA 4EY3A 5J2UB 5AQ1A 3VPCA 2C0PA 9LDBA 2ZREA 3OM8A 3P5BA 3RTGA 1K9SA 1L8LA 2XRMA 5ER6A 4LGCA 5F1OA 1P0MA 4BN0A 1VE1A 2DBQA 4W7HA 2R47A 4BFYA 2BM1A 3DDWA 1PZEA 2WHQA 3QW4B 3L8FA 4HH4A 4N5DA 4K9SA 4EHHA 1Y0BA 5DXAA 3I32A 3FCYA 5AUNB 3O26A 2OM6A 1YUBA 2UZ1B 3AUUA 1NNSA 4OQFA 3RK4A 4MVYA 1Z5OA 3FI0A 1DEKA 1Q19A 2H1SA 3OJFA 4MQEB 3RYIB 4F0JA 2LKDA 3GGPA 3EZGA 4GNKA 4YP5A 3QWHA 4H17A 4IFIA 2NQ8A 2P91A 2QV7A 2ZYUX 4DXAA 1VLQA 1Z7BA 1SXQA 1HNNA 3TMKA 1P2GA 2IPAB 4Z4HA 2AZXA 3G2MA 3IKVA 2FEWB 3AM3A 4IIEA 3RS9A 2B82A 3SAJA 5KIAA 3WL8A 1KK1A 2E49A 2YZGA 4RQAA 3SIPA 3G79A 1UJNA 1LJUA 4IQGA 3UFBA 4D45A 2QRJA 3FN4A 5EUBA 4KR3A 4QUDA 4J0CA 1OILA 2V7EA 2ZW9A 3PXBA 4HQ6A 1LA2A 3DBLA 4YJHA 3IQEA 1QIGA 1OKKA 2QG9A 2XTAA 4JS0A 4LMPA 4D9HA 4A0HA 1A9SA 3B1JA 2ZPUA 5IASA 3R2JA 4DLUA 3LFTA 3R0VA 5DZSA 2QWXA 4TTQA 1SXIA 3OIUA 3L6BA 2Z9BA 3TDNA 3FTNA 4DM3A 1LY1A 1ZVVA 2AIRA 1T3GA 5BORA 1R0CA 5HMMA 2YR0A 1G3MA 1EE9A 1E4EA 2WKQA 2FW6A 4EDFA 4FEGA 1TIKA 1Q0LA 1XDZA 4WKNA 3REQA 2UYOA 4N41A 3N1UA 1CZOA 3KD3A 5CD1A 1JGTA 2Q6IA 3AC0A 4ND8B 5DNAA 1TVCA 2Q3CA 4B6PA 4ITRC 2FUKA 1MO5A 5IW8A 4MR9B 4F4DA 5JVDA 3NDJA 3IAHA 4O4IB 2HA3A 3AESB 2FPUA 1WEHA 2VRBA 2ZJOA 4TRMA 4HZUB 4Q9AA 5GJCA 4WSOA 5H59A 3RCBA 4E5DA 1ATZA 1LS1A 2GYUA 1Z25A 4HFMA 1ESNA 4P5EA 4RKWA 3TLXA 2IJGX 4ZEWA 3FZYA 3U1BA 3ZH9B 3O84A 1QU3A 3A26A 5F33A 3GL9A 1DIBA 2EX4A 2FQYA 5DOVA 4F9TA 4PX2A 4UC0A 1MX9A 4UEOA 3IHKA 1TLLA 1GRCA 4FDTA 1U1CA 1ZSYA 4U7TB 1N2JA 2WD9A 5GOZA 4MUBA 4BP8A 2WNSA 1HQKA 4L4RA 1ODKA 3WGUA 5ICEA 5K3EA 3EEFA 5CVCA 4IYJA 2PUAA 2ECQA 4JELA 3OPYI 3OZCA 3HCFA 3B6EA 1CUUA 1XTSA 1NWHA 2HLDA 3OWHA 4IIYA 1M6WA 2PGOA 4M6WB 1M1NB 1TAQA 1YZ3A 3VNVA 4RH3A 3ZBUA 2C03A 3JQAB 4UCQA 1EVZA 1N25A 1NBAA 3ANMA 5A0TA 2HTEA 2WIFA 3TK1A 2BV3A 3TCXB 3H18A 2G3YA 4EEZA 1GZ4A 4PONA 1Z6TA 2ECOA 3CLTC 5AVTA 1JDTA 2BF4A 3NHKA 4QE3A 4FMBB 1G8KA 1II8B 2G70A 4QRDA 5GAJA 2NNWB 1EUQA 2ZTMA 1LUAA 2VHWA 1ODFA 1IN7A 4TS9A 2AOTB 4K9PA 2O2DA 3FCAA 3EHEA 3BRWD 3F3KA 1UXHA 3QH4A 5B7NA 1KZ9A 2I7TA 4PBRA 5FBKA 1IXYA 1O94D 3INRA 5KQLA 2GAIA 4JI6B 2RSLA 4CL2A 3B36A 3FRHA 5DF1A 5IHPA 3BMQA 4OPMA 3AEUA 5IT5A 4C89A 2XODA 1W5EA 3DZIA 1Y63A 4KBFA 4CXMA 2C8KA 3DQQA 3G17A 4NAVA 4KMRA 1U6IA 4JCOA 1SO8A 3WGLA 2H9AA 2P79A 4KZPA 2A30A 4GC5A 2QBYB 3LBIA 1V6AA 1BO6A 3IDQA 1QIFA 3N6XA 4HY3A 4R98A 4DIDA 1N2CA 2NUBA 3HXLA 4GLJA 3NRBA 2DWCA 3J80A 2ZS7A 1FP7A 1FFSA 4MS1B 3B3AA 2Y0EA 4DG5A 1JFVA 2QX6A 1OXSC 3M5PA 3Q87B 4NZNA 3EQ8A 4BBAA 5J1TB 5C1OA 4A8HA 2WFLA 2GBFA 4ZVVA 2JLSA 3A2NA 3PA6A 4FK8A 3QFRA 1VGVA 4EI2A 3OLXA 1Z45A 1KH3A 5F9HA 4RTJA 5ELLA 1GR1A 4AO7A 1RWBA 4OCZA 4NPCA 3MOSA 5TMEA 1KBOA 1Y8QA 4DR1B 1UPXA 1FFAA 4YLGA 2IU0A 1A8PA 3QFHA 1E4EB 1YI0A 3QI2A 4ZT5A 3U3ZA 3T12A 4ENQA 5B7QA 1JVSA 5F78A 1GZDA 2IGBA 3I45A 4D9EA 5I8WA 1LLDA 2NPIA 1V26A 4WFIA 1ZCJA 4F45A 1PQUA 1RRVA 3A6FA 4MRAA 4PYMA 1RRCA 3OURA 2O8DB 3K0FA 3VR5H 5JD6A 1Y5RA 2QXTA 1UADA 2B8JA 1PFKA 3DKPA 1Q16A 4V2IA 1ND5A 2C3YA 4X63A 5KI6A 3D6NB 2M9MA 3AUYA 3KBBA 3OFND 4LVCA 1YBFA 5TS3A 4CMBA 2QUKA 2RGEA 2FF7A 2R62A 7MDHA 1I6MA 4WOKA 2G6TA 2VDNB 3ET5A 3NI2A 1TE2A 3O38A 4TN1A 2P5UA 2WHYA 4XDHA 4D3XA 5DTIA 1QFJA 3G02A 1DAGA 3AYZB 3TRJA 3VTFA 2Z6QA 1PLKA 2ODPA 3A04A 1OXXK 3U5TA 1EAYA 1GZSA 3M6FA 2NN3C 1X9GA 3LA8A 3AYXB 3AGQA 2X2FA 5MN6A 2V58A 1B43A 2DUUA 4FXPA 4O4IF 4QRIA 1B74A 3GHYA 2H1OA 3DL7A 1SWWA 4LJKA 4OLHA 1OBFO 5K8LA 1PFGA 3GD5A 4OL0A 2HQSA 5LQRA 2AKAB 1ZHOA 2J46A 4O2BF 1AHNA 2ATVA 3IRVA 1XHEA 1S4MA 4BFSA 1BW9A 2DY1A 1RE1A 1W2GA 4FYWA 3VR2A 1DHTA 4BNXA 4F97A 3NQ41 3TL3A 1GAWA 1WXHA 1Z8DA 4OSEA 2OGZA 1BJRE 2NVBA 4JI0B 1JXOA 1F60A 3H3XA 1FU8A 3MJHA 1RHQA 4LXIA 3AI7A 4EJFA 2P9FA 1S3SA 3JQRA 4D81A 2PUCA 2ZUEA 4FI3F 5KKCA 1NUUA 2IYUA 2Q8NA 3ND8A 3PVSA 4IF4A 5I7UA 2XKAA 2OCLA 3SZUA 1U8XX 3IQWA 3LHSA 5BMVF 3FLAA 2RHOA 2CB0A 3QTBA 1K7SN 1Y1TA 3JQFA 4KXWA 5CT8A 4FFRA 5CM9C 1STOA 3F1LA 1DIAA 2IT1A 2J0UA 3GYBA 3ZU2A 2NU8A 4QRHA 3HA7A 1FXSA 1P7VA 1RMQA 3IL2A 4YROA 4N3BA 8ADHA 1RMYA 1L8XA 3ZWDA 1R0SA 1XQWA 2XOKD 5A5FA 5AJXA 5TQJA 8MHTA 4YQFA 1JFRA 1SUEA 2G4VA 3MCAA 5KKAA 3TLYA 1BMFA 1JKIA 2ZIAA 4JLSA 4QT4A 3UQZA 3N59A 5EP3A 5FOUA 5JQGB 2G82A 2Q0XA 1MABB 3FMGA 1SR8A 5JS8A 2FX3A 1G20E 1PL8A 3G2QA 3QKSA 4GP7A 1ORVA 1R8JA 4LA4A 3T4XA 2PKQP 5BWCA 4Q9HA 1PQ4A 2FEPA 2AFVA 2JAXA 2NZVG 1B4DA 3A4TA 3LPCA 3QIVA 2IDJA 3FRJA 4A73A 4JV5B 5I5EA 5LWQA 1B15A 2W2OA 3V4LA 5I7RA 3VU3A 2O2CA 4HDRA 5H9VA 3RVSA 2FCRA 1QBGA 1C3EA 1VLJA 4QECA 1ZPDA 1SXJC 3BHJA 3SIXA 2B98A 2DU8A 2G0NA 3ONEA 4MA5A 3G23A 1GADO 4IICA 3ITNA 5EUQB 5KCZA 4X54A 1ZOPA 4UBLA 3C16C 1GG9A 2ZI7A 3GQBB 1YR6A 2R8EA 2P9HA 3TLGA 3I72A 3IFSA 521PA 1Y1RA 4OHOA 3VJKA 2II6A 3AV0B 4LWZA 9MHTA 4XM2A 1NT2A 2O20A 4GUAA 4JDPA 3X1KA 1PJBA 1FXWF 1XEXA 1RKVA 1OT5A 2OBFA 1X7ZA 4DXHA 1VRCA 4YP6A 2YHAA 2DUMA 1XTTA 2GTPA 4JEUA 1KQPA 3K5WA 5CTJA 3VNAA 4KN6A 2ZIGA 3VZPA 4BVFA 1G6Q1 3D3WB 1P4RA 4A82A 2BMVA 1SUWA 3HSKA 1Y3IA 1GRNA 3M9WA 4EL5A 1EZ4A 1QVAA 4JN6B 3FCUB 1RXUA 2VZLA 2DWQA 2VDOB 3AF1A 4JH0A 3P9PA 3NKFA 3GT3A 5C0OE 3MLBA 1A1SA 3FCXA 4JP1A 4NONA 1OHHA 2FE4A 2RGBA 1SVOA 4U7GA 5J58A 1L3BA 3CXRA 3PNOA 4RJIA 4A26A 5EJIA 4HWPA 2ZGVA 5KSPA 3D6MA 2QRLA 4BXOA 3TDMA 1UM9A 2YJ6A 4BX3A 5KYNA 5K0SA 2ALJA 1AKNA 1KH1A 1VJDA 4IFEA 4JR2A 1J20A 3ZXIA 4EKIA 2AI3A 1RI2A 2JHPA 4JMPA 4LDRA 2X6TA 2WIKA 2Q6LA 2Z6AA 2AK3A 4YRNA 5C80A 3AFHA 1L7XA 2Q3DA 3L7AA 2GUGA 4QDXA 3QELB 1RP1A 4F6RA 4CKZA 4PHFA 1SCIA 2CXNA 2Y1KA 2DP4E 3H83A 3IMEA 3K2BA 3U44A 3RJTA 1F4LA 3IQIX 3ENVA 5DN6A 1MKYA 2FPKA 1F3OA 1Z7YA 2N0SA 4D25A 1ZRNA 1TC1A 2QTZA 1PS9A 1CERA 4D5EA 2C2XA 3K09C 3I92A 2OHFA 3GJQA 4FYHA 4RNCA 3OQIA 1EUDB 4MR8B 3VVCA 2UZ4A 4JROA 3RUPA 1LV8A 1T43A 3ZJ5A 1NTRA 3DV0B 5KCMA 3VO9A 1UBSB 2RI0A 4HX2A 1TM3E 2J1LA 4M21A 3DFMA 3CUEF 4XIJA 5AW4A 4RTNA 1WTCA 3IESA 5DMXA 1IWPB 1P2TA 2VAPA 2B37A 2B2CA 4TQGA 1GL6A 1ZD5A 2PX6A 1V1JA 3S99A 4AVYA 4JJ7A 1FA9A 4NQZA 5LDGA 2WKPA 5TPWB 2X9GA 4WVLA 4XVQA 4BV3A 2Q5HA 4UPDA 1TF5A 1MPXA 4CCWA 1G20B 4J0DA 3CIOA 5AW0A 2VNJA 4QXOA 3AKZA 2BKUA 1YBVA 2Q49A 2P3OA 3TR6A 1AK2A 2Y3IA 3T5BA 3RS2A 1M54A 5HZHA 3VPDA 2FPGB 5BP7A 1LPSA 3JTEA 5SY6A 2EDCA 3V6MA 4J16A 3DKIA 3HJTA 3C5WP 3I5MA 4IQ0A 4X97A 1J24A 1V7PC 2DUNA 4DTIA 2DFKB 5H9WA 5LYJB 1TDJA 4BFZA 3P45A 2D8AA 1NI4A 1EXNA 2KLHA 2SCUA 3SFVA 3JRWA 4I3HA 2PGAA 3C3XA 3EK2A 1WCXA 5U9CA 3FMIA 1YB2A 4RV9A 4LXXA 5H1YA 5IJ9B 3ME5A 5M29A 4ZOQI 5DHPA 2GHTA 4YT8A 4WLOA 4F91B 2BRUC 1ZS9A 1I0IA 2V55B 1BTOA 3COYA 3R3UA 4NU8X 1YB5A 3EVEA 3DKKA 3JQ9A 3T5DA 4ZWNA 1VIAA 4M7OA 2RCYA 4QYWA 4H1WA 2QDXA 4Z0TA 2AMVA 4M0PA 4AICA 4EB0A 4M9RA 2QEQA 5ECGC 5FBHA 1LVHA 1OLXB 1UK7A 4ZO9A 3N53A 2X0RA 1RJFA 3KOMA 5F4BA 3T1NA 1V43A 3VHXA 3SQOA 2OZKA 4Y6QA 5LQSA 4PY2A 4LFAB 5T7BA 2IXAA 1LD3A 1AOXA 5K1ZA 5JJIA 1TIBA 2JLBA 2WOOA 2XUJA 3IJRA 2CXPA 3H0EA 3KHSA 5LOVF 3K0AB 3C0KA 5LKRA 3I5XA 4MDYA 4HJRA 1N78A 4BU0A 1QZZA 3PQ5A 2O2HA 5F7JA 4K2AA 2A4MA 4WXMA 4YJ2F 1E9DA 3SU8A 1AQIA 1R0XA 3INNA 1YZHA 1YT5A 1JHUA 1D6MA 3DONA 3DVRX 4FJ2A 3ZWVA 2HNAA 3WK8A 3ZBTA 4OVKA 2FV8A 1LJLA 1QWSA 3R3WA 1ZBDA 4MSUA 1U0SY 4L51A 1GLNA 3UO8B 2AUMA 2XGMA 3PEEA 5E0OA 1U7OA 4DAOA 3D43A 2P6UA 3RUAA 3WGKA 4ZHQA 1SIBE 3H6KA 5ARDA 2P2NA 3QF4B 4ZZ0A 2ODNA 5KWIA 4QHSA 4KODA 4EKGA 2AG5A 3NCTA 1YDGA 1QE0A 3K5PA 4MPTA 1Z36A 1R5BA 4WDRA 2V4UA 2VZ8A 3HKCB 2B7CA 2CY0A 2IHKA 3HV0A 3Q40A 4TROA 4XJSA 1F7VA 2XA1A 1XRRA 5CW1A 4C4YA 1I2DA 2ADFA 3B7PA 4BUZA 5LN1A 4TV9A 1DEOA 2DSNA 4NV1A 5E2AA 2B4KA 1EDZA 3QMPA 3WMXA 3OTHA 4B4DA 1YE5A 3ZI0A 2JD0A 3AL2A