2FOXA

Clostridium beijerinckii flavodoxin: semiquinone
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMGDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2foxA00
1D04A 1AKQA 1TIKA 4J8PA 2QMZA 3W7AA 1YRHA 4GR9A 1XYYA 2N1MA 4NLLA 3QE2A 1J8QA 3U7IA 5LBUA 5F12A 2OHIA 4C76A 1T5BA 2QX6A 3HR4A 1RCFA 1AZLA 3OX2A 3FNIA 4PTZA 3KAPA 4N65A 3NHSA 5BUCA 4YAFA 1J9EA 1CZHA 4XDGA 3TE7A 3GFSA 1RTTA 3GAMA 1BU5A 3ZHOA 1WSWA 4U7FA 1CZLA 2V9CA 2M6RA 4C0WA 2FLVA 1XI2A 4YQEA 4ZVKA 2FZ5A 3NLLA 2AMJA 4DY4A 2MWMA 4FGJA 2HNAA 3OWHA 2OHJA 2R97A 2ARKA 2RG1A 1DXQA 2MOKA 2QMYA 1OBVA 5EAIA 2XODA 3KEGA 1YOBA 4CETA 3KLBA 2B3DA 2FX2A 3F90A 4Y7CA 1KBOA 2BPOA 2OHHA 1WSBA 1J9ZA 2MTBA 5FUQA 1XYVA 3HLYA 2F1OA 1TLLA 4HEQA 4PTYA 2Q9UA 3S2YA 3GFRA 3OVMA 1CZKA 3B6IA 2QX9A 1FVXA 2GSWA 2HPVA 2BMVA 4ESEA 3NFRA 2FOXA 4GI5A 1KBQA 1D4AA 4YALA 6NULA 3P0RA 2QX4A 1FTGA 4YAOA 3ESYA 5F4BA 3F6RA 4QOEA 1J9GA 3F2VA 4XDHA 5LLDA 2KQUA 1E5DA 1FLDA 1QBGA 5LVAA 4LTDA 3R6WA 2HNBA 2Q62A 1I1OA 4BMPB 3L9XA 3FVWA 4N82A 1V4BA 1QHEA 1C7FA 1JA0A 2R96A 1YKGA 3NHRA 5FA6A 1DX9A 2QWXA 2WC1A 3N3BC 3N3AC 3L9WA 1NNI1 2XOEA 3D7NA 1BVYF 2V5VA 1AKWA 3EDOA 3K20A 1FLNA 1B1CA 4CF6A 3W77A 3EYWA 2MT9A 4H2DA 4M0CA 4D02A 4ZVNA 3W78A 3ES9A 2FCRA 1CZRA 4QOIA 3B6JA 3U7RA 1RLIA 4QOHA 3B6KA 1YCFA 5B3LA 2X2PA 1C7EA 1OBOA 5EA2A 4U7HA 3NHLA 1FX1A 1JA1A 1CZNA 1H66A 2Z9DA 4LA4A 2Z9CA 1H69A 5FX2A 4QOGA 3N39C 1YDGA 4ICIA 2BZSA 1VMEA 1AKUA 3W79A 1YCHA 2BN4A 3LT5A 2QR2A 2FVXA 4C14A 4OXXA 2W5UA 5LBTA 4LTNA 3JSXA 2Z98A 1OFVA 4Y9RA 1ZX1A 1YCGA 4FGLA 4U7GA 4PU0A 1AKRA 3K1YA 4H6PA 3GFQA 4BMOB 1GG5A 5A4KA 3KAQA 4NULA 2FAXA 2OYSA 2M6SA 4HS4A 2A5LA 5LJIA 3NHKA 4Y9UA 5TGZA 3FX2A 5F51A 4DILA 1AKTA 5LJLA 4FX2A 4R81A 5LMCA 1ZWKA 2FDXA 4N9QA 2ZKIA 4QODA 4LTMA 3ESZA 2D5IA 3NHYA 3ESXA 1FUEA 1CZUA 2KLBA 1D03A 1QRDA 3NHWA 1AKVA 3UXHA 3OWXA 5NULA 3LCMA 1SG0A 3OX3A 2X2OA 5JROA 4DIKA 1DXOA 1RLJA 5B3KA 3TZBA 4QOFA 3O2NA 4GQIA 1AMOA 1FLAA 3OJXA 1FLVA 3NHFA 4C0XA 5ULLA 3NHUA 4F8YA 1CZOA 5EMNA 4ZVMA 3G5MA 3O73A 5NLLA 3OX1A 3B6MA 4ZVLA 3OJWA 2FZVA 1AHNA 1QR2A 3QFCA 1F4PA 3FJOA 4YAWA 1X77A 2Z9BA 4FGKA 3UXEA 3NHPA 3NHJA 1AG9A 2V5UA 3F6SA 4QOJA 4YAUA 4LAFA 3TEMA 1XT6A 3QFRA 3HA2A 2QX8A 3SVLA 4S24A 2BF4A 1SQSA 1ZWLA 1T0IA 3FW1A 3RPEA
chains in the Genus database with same CATH superfamily
2O48X 1OKKD 2WINI 4OREX 1EXNA 1UT8A 3DMFA 2OD7A 1TJ4A 2HMUA 2AIRA 2PH3A 2V4ZA 3HKEB 3OTIA 4MMZB 4V0ME 5A3VA 1B15A 4ALKA 1CUZA 3UJNA 1QRRA 1GZUA 2OLJA 1XNGA 5BW8A 1U11A 5C8YF 5BWMA 4E4YA 3PRJA 2CSXA 4ZCPA 3VKUA 3LWZA 4JSRA 3WV5A 5B6PA 5LLSA 2O8FA 4HTFA 5EIOA 1TD9A 1XMXA 2P1RA 4O2RA 5KHAA 1E79A 3E8MA 3HWWA 1GTVA 2HCJB 1L5YA 1A4XA 1I9GA 2QN2A 3VRHA 3MWYW 5HPYB 4B46A 3QXCA 2Q5LA 1ZS9A 5H1YA 3BWYA 1WW8A 3QG5A 1E9SA 4UTOA 3T0GA 1RWNA 3IR6A 5BSMA 4WADA 2YV1A 3IP5A 2D0IA 3WI7A 5BV8A 1RCFA 3WGLA 4REQA 5EKTA 3G2IA 1NBEA 2BFPA 3GEPA 5FDFA 4HAZA 4HGYA 3S1AB 1WPQA 2D2EA 3LGXA 2JLVA 2IYXA 5KREA 1X7ZB 2UZ1A 4GQBA 4I08A 3M6FA 1P0CA 4EUHA 3IB3A 1ONSA 1J9EA 4RD6A 1ZMBA 3OFNA 3JQBA 3PEEA 2D8MA 1NJ5A 1WBDA 2B3TA 4Z51A 3QJYA 4O6VA 1MT3A 1YQUA 2JIDA 5C3UA 3U4AA 1HE1C 4Y8VA 3IKMB 1KYIA 2WD7B 3K9NA 2RAFA 3RYIB 3PTZA 4FMCF 5EGNA 4EZEA 3O8LA 4MWGA 1C1HA 1RACA 1S7GA 2JIZA 3MGAA 1GPWB 4RENA 1N5IA 2H7CA 2QL7A 3M82A 4A03A 3JALB 3JU3A 2AJCA 1U0HC 1K7YA 2PXHA 1JG7A 2VT6A 2ZIZA 4HYEA 2QMHA 4OGGA 2UYHA 1BEZA 1RC0A 4JSYA 3KTFA 4CMJA 1VE3A 4D3XA 2JS7A 3P7MA 5DCLA 1YB6A 2R62A 2GKGA 1G8HA 4HTAA 2PUJA 4Z9AA 1QJCA 1VLLA 2H31A 5AVKA 5FT9A 4OJTA 1BHSA 2I6TA 4FN5A 3GLIA 4EJ0A 8AT1A 1LRKA 1PFWA 2BEUB 1QUEA 2L0XA 2D74A 1H2ZA 2XNJA 2YYYA 2ZCUA 3L07A 4KH1A 4EUSA 2O7QA 2JCSA 2YCBA 3JAWB 2MWMA 5JNLA 2PUDA 1EDDA 4LOJA 2AFIE 2NNLD 1DB3A 4YYZA 2R97A 4WNAA 3TZKA 3L41A 2CJXA 1PJZA 2HF7A 1UJCA 1G8AA 4RU1A 3VZDA 3NBKA 4O8CA 5ALXA 2H65A 3LM8A 5I6DA 1E9BA 5I7SA 1QVAA 1P5HA 2O3SA 3DNMA 3NP9A 3R74A 1U81A 4UTXA 1MC8A 1QANA 2VQ3A 5EMMA 3DM9B 3D2AA 2ZDGA 4BQFA 2P0YA 3QZUA 4IIFA 2CD7A 2GO7A 3B51X 3KYBA 3RVNA 1T0PA 2N75A 2YJGA 1CY7A 2AMVA 1G21B 5EERA 1RWQA 2KBEA 4TMXA 2DM6A 3CJTA 3BEDA 2R5NA 1BG6A 1SXQA 2WJWA 4YT4A 2I3DA 4J1QA 1CHNA 3LVRE 3W8EA 1V71A 3PL1A 3TR0A 1WULS 4UTRA 1JXQA 5B1IA 1J9ZA 1QO7A 4LVNA 5LDGA 3P26A 3WOVA 4GPEA 1KWGA 3CUKA 4XKJA 5IULC 5DNDA 4JJ7A 4B31A 3H9CA 1XEWY 2C61A 3H7AA 1OVGA 3BGIA 4PS1A 2SCUB 3ROXA 2R8XA 4B7ZA 3TLXA 3T5BA 5DI3B 2XXBA 2F1OA 2P8SA 1U2GC 3I9MA 3LCUA 2YRFA 1WV1A 4LVOA 3UZUA 3WJ7A 5IFKA 3DAHA 1ZSYA 3VAZA 3KBBA 3V8QA 4EG5A 2ODTX 3BX1A 3S2YA 1FVOA 1NVKA 4UMFA 3RBXA 2NTYC 3QTBA 2VJPA 2BM9A 3KFLA 1JHDA 3FI9A 2BUAA 3SFTA 5EMJA 1LTQA 4OFZA 2QUAA 3HU1A 5KNDH 3ET4A 1JAXA 1P1CA 2DUMA 2BHLA 1R6XA 1NVBA 3FHTA 1FVXA 3OUUA 5EESA 2RC6A 1N6HA 2QRLA 1F0YA 4R2LA 5BN4B 2OTCA 1VJGA 2FSPA 2QW1A 3OZWA 5D1HA 4WOBA 2XQIA 4ZEVA 4LI3X 3WSTA 2WVJA 2HW8A 3FR8A 3O47A 5EZQA 4TV9B 4FWIB 2XNDA 1L2TA 3FIJA 4KR0A 4X1YA 4KPFC 4IINA 1JJ7A 1HG0A 1KZ6A 4Q01A 2A4KA 2XA9A 3ENNA 2VT7A 3ZNOA 2XYHA 1PR6A 1DCTA 1BXKA 2QX4A 2ERCA 3AFIA 3AXSA 2HY7A 1P81A 3NTXA 2OGTA 3OEED 2KM1A 1VIMA 3RYFA 1UOOA 2IZ7A 2XW6A 4B17A 1D1TA 3GRPA 1E8MA 1JTVA 2NUAB 3ADDA 1A69A 2IBSA 2AC2A 1JU3A 1JEDA 1HQKA 2HFJA 2IP4A 4DJJA 4EMTA 1ODLA 3L6DA 2ETXA 1XXHE 2COEA 1KSGA 1IN6A 2VRCD 4B3FX 3KYCB 4NDAA 2YIDA 3PDJA 1U9YA 1RYFA 2C83A 2GZDA 3MD9A 6PFKA 3CEHA 4HVAA 2LV8A 3QA9A 1ECBA 1KVUA 1G6Q1 4KXUA 2BFDA 2NVOA 1WOMA 2CUZA 1I2MA 2OCXA 3PJGA 4MP3A 1TQ8A 2HNBA 1XZCA 4UUBA 4D2IA 9LDTA 1SXJD 1GV0A 1I1OA 1JH8A 2ENUA 5EWLA 3FBGA 3NJ8A 2FWJA 4KFRA 4LX0A 1GPMA 1CR2A 5TQ0A 4WNIA 1IJEA 5CEJA 1KMIY 3PQ3A 3D0KA 2YIVX 5CYGA 1G1AA 2CWDA 3EW7A 1YZFA 2XCRB 3ZY4A 2JFBA 1T2EA 4M1TA 4WOKA 4B8YA 4KL8S 2BKVA 1WUHS 1BQ3A 2H18A 1CUXA 1UJ4A 1WVGA 4IXNA 3LZ6A 4J2HA 1L5NA 2HDWA 2ZWPA 5AMXA 5K8VA 3VKHA 4DLTA 5DM2A 3HFRA 4NU0A 1D2GA 1KE1A 2FH5B 4LFCB 1LPOA 1DI0A 2VKQA 2QVGA 1B73A 5J43A 3A14A 1ST2A 4C30A 3KPVA 1XRNA 1LPBB 3ABQB 3L5OA 5F9MA 4PSCA 2IBMA 5I9SA 2C5HA 1H9CA 4K0KB 3ECSA 4ZOLB 3BA6A 1II9A 1XMJA 4RV9A 4LXQA 5FI0B 1ZGHA 3HEBA 4YECA 4BXOA 2AOUA 2R1TA 5HS4A 1T3SA 4W9NA 1GSAA 2NNWB 5EMLA 1GNRA 3M9WA 4YFYA 1LI5A 4CV2A 3EMDA 3NVMB 5FFFA 1EWKA 3TAUA 4DB2A 4XA8A 1Y37A 1QWSA 1U0BB 3GD7A 4S2EA 4JUIA 3K20A 4XWGA 421PA 1AKYA 4ND8B 3KD2A 3W77A 1G42A 4J16A 5L3QB 5I01A 2F3TA 1T2VA 3U9SA 4RAQA 2GXQA 3TL3A 2DH5A 3DZIA 1P1FA 1KRWA 1C5KA 3LOUA 1WD5A 1Z75A 1FP7A 2B37A 2P9GA 2PUWA 1X80A 4IIUA 3SGLA 2C31A 2Q0SA 1X7XB 1SQFA 4QUEA 1JDVA 4EX7A 5MGNA 4JYZA 2AC7A 3BXGA 1YF3A 1I1NA 3K9FC 1E2KA 4ZU3A 1PVVA 1YVDA 3B6JA 2ENWA 3H1PA 1ZH4A 1JHRA 4OXQA 4ACBA 1HWYA 5C5EA 3RJMA 1KZHA 4E13A 4RFLA 1CBUA 4GGMX 3FOCA 2EGHA 4P7KA 1XD2B 1TMYA 2E85A 2QN3A 1XAJA 2E5WA 5CVVA 2ZYHA 2NO6A 4GP9A 3F49S 1SZDA 2R1VB 2Y9PB 3NIDB 4GBMA 2ZIXA 3FMFA 3KWLA 3D8HA 4DKJA 3JYNA 2D06A 1C7QA 3ZXIA 1J0DA 4R0NA 4EENA 3EWSA 4B3BA 4HGRA 1LJLA 1Z07A 3TZCA 1Y5IA 2QPAA 2E4AA 3G13A 3QE0A 4HDRA 4EG7A 3RVDA 5EIHA 1L5HB 1PK9A 2DQ4A 2JARA 2ZE5A 3M4NA 3T0IA 4PF1A 4HOYA 2QTMA 5HUHA 5GGYA 2BI4A 2PQ6A 4MCHA 4E12A 3FYUC 2XKAA 2IIQA 3D8NA 3L8GA 5L4SA 2FP4B 3OY7A 1H69A 4BFZA 2B4QA 3FJYA 1QPBA 4JUDX 1X14A 2W2TA 1TNDA 1RQGA 3BC1A 4ZJYA 2LBPA 1R5JA 4NH4A 1M6NA 3R3HA 4D81A 5GIOE 4B84A 2PZLA 3KALA 2YZGA 4YJHB 4RD3A 2L17A 4KXVA 4BP9A 4HT3B 1T1GA 2VZEA 4EFDA 1AKUA 1UXIA 3WHKA 2I62A 2OENG 1CDEA 3JQ7B 2P6RA 1B1AA 5TLSA 2GGSA 5CD9A 4TYNA 2WYVA 5FPSA 4CMAA 1I7PA 1XFDA 2PH5A 1VXOA 3HYNA 2P41A 3A58B 3IUMA 5D7BA 4CIVA 3WYDA 1PJSA 3KWMA 5AK3A 1CJBA 2XCTB 3FDIA 3KKPA 2G70A 3MT9A 1NXOA 3ZDQA 3U4HA 4D3FA 2F3SA 3DCNA 5JC1A 2V7WA 3QSYA 4L5YA 4Z2YA 3CVYA 1UZMA 3PCXA 4F5DA 4Y9RA 4ISBA 1A5SB 1TLTA 2TMKA 3G1UA 4KP7A 5IDYA 4BNNA 5HOEA 2G06A 3GO4A 5KYWB 1YQEA 5IJAA 1EZZA 5BN3B 1F3OA 1P91A 2FFQA 2FW0A 1IM2A 1WDTA 4CIXA 3D4OA 1XN4A 2AD5A 4KPYA 1FTNA 4PZAA 1C1XB 3EQ8A 3UJHA 3D4BA 3PE6A 1I24A 5EQFA 1VYVA 3UB4A 4UHJA 3EC1A 4L51A 2B1GA 2Q0QA 3HI6A 4H7DA 1QR6A 1X8XA 2CC2A 3LUAA 4BO4A 4PIMA 4B87A 3BFPA 3CT6A 4ODIA 5F4ZA 1QF9A 3VZBA 2ZAYA 3NAZA 2VXBA 3S8YA 4M1WA 2XUJA 4BGUA 1MG5A 4QYMA 3HB4X 2SECE 4W5RA 4JL8A 3FRIA 1NMSA 4KR9A 4F21A 2IHZA 4WK0B 3K70C 4BNDB 4IJVA 5EE1A 4D4LA 1M54A 3NG1A 4AJ1A 5L45A 2QL6A 3N7TA 1Y9EA 3C0KA 4LF4B 3W90A 3N6VA 4Y2JA 4HKTA 1TTPB 1EWTA 4NZOA 1JIKA 2EP5A 1C8LA 3VR3D 3GGDA 1NNSA 2FDCA 4FX2A 1RLTA 1W29A 4GBED 4ZTBA 3V3TA 4EJ6A 3M2PA 1ZWKA 2GDJA 5IJ9B 3C97A 5HZMA 4B3GA 4UVDA 5B3AA 3LA8A 1BW9B 3QPVA 3MCZA 2PUTA 3W6NA 5HQ3B 4KUEA 4WA8A 3AKCA 1VM6A 3PC3A 1P6XA 3O93A 4L73A 3C1UA 1RBQA 2VATA 1M72A 2JHFA 2WUFA 3U7FB 1RPJA 5DVZA 1ORWA 5EUCA 2OBYA 3CTMA 4TKZA 4DQVA 5FOQA 6ADHA 4O4LF 4F45A 5MFZA 4Q93A 1WL8A 3S2IA 1SB9A 1U0NA 2IDMA 2HHAA 2NU7B 2HFKA 4GP7A 5ES3A 3IJEB 1V35A 3RB8A 4E2XA 5MN5A 2IZOA 4UNNA 4DCCA 1Z8NA 2EBHX 3ZWCA 3ACCA 3F8TA 1EFAA 1SXJE 1H1LA 1WZCA 3Q12A 1MAHA 2R44A 3WS7A 4WACA 3P94A 4IDDA 2W2KB 1UKEA 3SZGA 1T6BY 5ALZA 1QS0A 2CGEA 4RKEA 1B0ZA 1IXRC 2OECA 3THXA 3R5FA 3L7DA 1IBRA 3QF7A 1HX7A 4CTNA 3QLEA 1C9DB 5BSGA 3BS4A 2HH9A 3O8OB 2WR8A 3FRHA 4TUYA 1ZCJA 1ANKA 2YWRA 3DQQA 3IMGA 4KX3A 5B1SA 4BFYA 4ZEMA 4F9EA 3E8SA 1H5UA 4Y2GA 1NJ1A 2JVIA 3IODA 3P4XA 2TECE 5FNVA 3ZVKA 3TW8B 1SQ6A 2PUAA 4ZK6A 4PN3A 4K8OA 4JGBA 4L6IA 5ABPA 4DARA 6CHYA 1JSLA 3WLLA 3AZQA 3NCTA 4FN4A 2GM3A 2I67A 4MR7A 3OJLA 5AJTA 2J0UA 2WJZB 3OX1A 4IJWA 1E3QA 1BDMA 2IZ6A 1CUWA 2ZW9A 2QIOA 3WMRA 1D8AA 1FQOA 2AX3A 2HF2A 1H85A 2YZ2A 3NTQA 2GB4A 4F3RA 1ODFA 4ZMRA 2C4VA 2UYYA 1R27A 3MGKA 4DLSA 1C0IA 2W90A 2ZRNA 1JVBA 4W99A 5E7QA 1OFGA 3I6MA 4EPXA 1G291 1ZXBA 1SCQA 3TRIA 5CPBA 1HR0B 5GAJA 4LGVA 1Y3HA 3DEAA 2GEDA 2W8BB 3BREA 1Z35A 3NKFA 4PAGA 1NXVA 2GLXA 4PLPA 2OMEA 4TXMA 1QGED 3OOHA 2H17A 5DM60 2YMLA 3TNYA 1JEEA 2VT3A 4C29A 1GSHA 4P33A 1HG1A 1UJ5A 2WUDA 4OIFA 4NBRA 3LMKA 1Z63A 1SXIA 1T1IA 4XEUA 1GLNA 2SHKA 3IKLA 3WRVA 1YBHA 1SNYA 1E58A 2JFHA 5FPYA 3ZGZA 1R0RE 1NZJA 2QJFA 4B79A 1W4BA 3SVLA 4X1IB 1OXBB 3V33A 1NGSA 3MJRA 2ZUUA 3ETNA 5LQMA 3ZCUA 4OM8A 2ZAOA 3BFJA 4XJVA 3T5MA 5AH0A 4IUCS 1BHQ1 1C7IA 2ZUBA 4J4HA 2QEQA 4ZZ2A 2J8ZA 3VH3A 1ZM2A 2HA5A 4KFUA 4W9MC 4UQOA 3UPTA 1AKQA 4CEIB 1T5IA 4D46A 1MENA 2OG2A 4Z5XA 2FEKA 2IYNA 2AXQA 5CA1B 1RZRD 5F2KA 1ORTA 3ACBA 3AF1A 3LQ2A 3PLAE 1F8FA 1AK9A 2C3OA 4X60A 3IB6A 4F4HA 5A2QA 2AUMA 2P4QA 2RJNA 1IEQA 3ER8A 1QCZA 4YHBA 5F1OA 4AY6A 4IHKA 1QONA 1SQGA 5LXTB 1REQB 4GMGA 1VL1A 3I4CA 3BXFA 3G0BA 3DMHA 3R3SA 2PGXA 3EF3A 4B81A 5CDHA 4MZDA 1GTL1 1BAPA 2B61A 2Y67A 1NDHA 2OHIA 4FNAA 4KWTA 5F7XA 2VEDA 3OZVA 2FQ1A 3DF9A 3QF4B 3IT2A 3TD9A 1V16B 4QQFA 5AW7A 4TS4A 4F56A 4Z8YA 2PT6A 5CR9A 1TVMA 1YD7A 3IBCA 1A8PA 2XA1A 1ZW6A 2XUGA 4GOJA 3KKKA 2PGIA 2YWEA 3VOSA 3FNIA 1P4AA 1V8OA 5HQTA 1YI8A 4KPUB 2AHOA 3OESA 3AP2A 3NHSA 1TIPA 2JASA 4G9EA 2WHRA 4ZJZA 4ZGWA 4D0SA 3C70A 1PYOA 2OCGA 4HDMB 4TYQA 3TSOA 4B3IA 5E6RA 4RUKA 1DFGA 3KS9A 4DLXA 2YIJA 4PXSA 2OK7A 3BIWA 3ENZA 3BGWA 1W49A 1VE7A 3OU6A 4FHCA 5THKA 3STHA 3MK31 3DYBA 3QOXA 3ZOZA 3D0QA 4Q1AA 1FDWA 4HNSA 1J24A 2EHJA 4LMPA 4OHWA 1NBMD 1ZMOA 3RC7A 6Q21A 2VHZA 4GG1A 5DNYB 2IELA 4DAEA 3KR0A 3WBFA 4LG1A 1G8SA 3C1AA 1UXJA 1HE4A 3A9TA 1WHSB 1RJGA 5H7XA 4ZAWA 1N2ZA 1MQ8B 1HZJA 3ZHYA 4EBBA 4LZPA 4PYKA 1A0OA 4F8JA 1Z7BA 2C20A 4OKSA 4P3PA 2P8JA 1HMPA 2VL7A 2AOTA 3BXHA 4PG4A 1P29A 3F6YA 3K73O 4UXIA 1XI2A 3CW8X 1Z88A 1U8CB 4C4SA 5CVEA 4KO1S 1UEXC 4H35A 2NT4A 1CXZA 2AG5A 2G9ZA 3IILA 2HPZA 3M7IA 4F9GA 2OORA 5IXJA 3EDMA 4FEAA 4IMIB 3RC1A 3L43A 1SCDA 2YFKA 3G0HA 1G8PA 4FMBB 2RAVA 2V54A 2UUOA 1IG0A 3TXYA 2BEWB 5JQGB 3V48A 1PJTA 1WUKS 3TNFA 5LMZA 5BV7A 2TMYA 2CBXA 1EX9A 3WHIA 1TEXA 2QF7A 3A4VA 1SRQA 1Q1GA 4IIEA 5E3IA 4S35A 3M6AA 3R5TA 1S6YA 4OAPA 4AKEA 3OIUA 2BELA 1A95A 2P9TA 1TKCA 2G4CA 3OKFA 4DPLA 2VHYA 4CETA 4B3SB 3JASA 4ZCMA 1JKMA 2Q5QA 2Q6TA 4PLFA 3R09A 4HC4A 1O0CA 2J59A 2QRVA 5HQJA 1ZEJA 2AMYA 1DC7A 1KZ9A 2IZZA 4YJDA 3THOA 2E5LB 5E4JA 2IBTA 4TLEA 5FP0A 3EEOA 5IDQA 2GNAA 2MYPA 3W5AA 3ZVMA 1LS1A 4ZHQF 4LHYA 1YK1A 2C29D 3DLCA 1XYVA 3AO0B 3C4JA 4KGXA 1AQYA 3WWCA 3FRJA 5ALDA 3IV6A 5F5XA 4ACAA 4BP8A 3N2IA 3E9RA 1HURA 3ABOB 3GCGA 4J0CA 2GQ0A 4RPKA 3RBZA 1PQ4A 4LQ4A 4BVBA 1J20A 1WCV1 4Z6KA 3UAXA 1KAMA 3I23A 1GCIA 1W52X 2FY8A 3G2LA 3PZRA 2HRRA 4U5XA 2IV3A 4DMHA 4XYBA 4Y6OA 1W5SA 4FSHA 2X5OA 1ARZA 3D6NB 1D2HA 4IJQA 2G83A 4JUAA 5BQOA 2J4CA 3TW6A 1FJGB 2Q5OA 2AR7A 1M0TA 2KB0A 3OT5A 1A27A 1E89A 2YWDA 3PQ8A 4NONA 5IBQA 3NFYA 5KS2A 2IH2A 3ANYB 5CM9C 2PUBA 3UN1A 3RF6A 3RVOA 4Z4QA 1OJLA 5CH8A 1XRRA 4BFSA 1O6GA 2H1CA 2G82A 3WYEA 4B6SA 3FTDA 3ZW9A 1SXPA 3M49A 2IS6A 1YHZA 2WSSA 3GMDA 4RHFA 2FPMA 2FLWA 1C41A 1RZ3A 1CQPA 4N47A 1UPAA 2IU3A 2D2FA 3QXGA 5KQSA 4ED9A 4OQLA 2H4XA 2ZYUX 5TX7A 1DRJA 2ZG6A 3ZH9B 3NWPA 4UCQA 1MQSA 1P7ZA 1EVKA 3JVIA 2IYEA 4XWAA 4YRTA 3TUJC 2PX0A 2QUIA 3ZDDA 1H2YA 2IHUA 1E6UA 5AJUA 2WV9A 3BL8A 3DKRA 4A7PA 2ECKA 1JAZA 4ZREA 1MOZA 1T2FA 3SKXA 5CNKA 3HXQA 1Y5NA 3DBOB 1Y1KE 4RLFA 5KSWB 3DMTA 4D82A 3F2VA 5TSDA 3DUWA 1QG6A 3C7TA 4FYXA 3RABA 5C1IA 3M4JA 3K9BA 1R5OA 4MS4A 3TZQA 2A92A 1OFIA 1QBGA 4M9SA 5DOVA 4CJXA 4EHKA 2CV1A 1JRLA 1RPTA 3ZDZB 2FZ4A 2G0NA 4M98A 1SVIA 2VJAA 1SVUA 3BMXA 1B43A 3DZCA 3PKJA 3SC3A 5KYVA 3BK7A 5AW6A 3C1TA 4PICA 5DHAA 4HX5A 4IIVA 5DISB 3RR2A 4CCYA 2YNMC 2YHIA 4X5OA 3PEWA 1L4LA 1NBWB 3RSCA 4YRNA 3O3NB 4YCLA 4LOLA 5HFJA 1M2OA 3GG2A 4LDNA 3MJCA 1ZGGA 4LHWA 4OHOA 2W7TA 4MV3A 3RARA 1T5SA 3N1UA 3OCVA 4OPMA 1TU0A 2QZPA 3A2KA 1RABA 1ZQ9A 4EQ6B 2R3SA 2ZUTA 1LW6E 3BG5A 4HGPA 3EPPA 4ZV4A 4HNVA 2BYTA 1R18A 2ZSAA 4J75A 2B34A 4Q15A 1RKUA 3W2GA 4QUDA 3EA4A 1E4YA 1Z6PA 1O6ZA 4Y6GB 3LW7A 8ATCA 1Q84A 1ODSA 2XMZA 1CNFA 1U0TA 1RYEA 3MVEA 2DBZA 5JSZA 2VCYA 3HGQA 1PYGA 2A1UB 2M6KA 1O0BA 2O8EB 1IZZA 4PG5A 2GJ8A 2E0IA 1NQTA 3BMQA 1DAPA 1XXHB 5CBPB 4CEHB 2O5CA 2JZCA 5GVSA 2WC1A 3DO5A 3PSAA 4BX9A 4IXMA 5E0OA 3TLGA 3W8NA 4YTEA 5M29A 3VDXA 2VDRB 1XPUA 2CXRA 5KVAA 4PC2A 4ZDKA 4Y6LA 3G3EA 4CEJB 3TOXA 3H6KA 4N3AA 5KOJA 1PZHA 1GILA 1KPIA 1V11A 5H02A 4S1WA 1KOGA 4I7EA 1JHPA 4N76A 4HWGA 1P19A 5FLXA 3BT7A 1KYVA 2C42A 3I39X 4O4IF 4UQPA 3K8QA 1ZUNA 4JBGA 4KU4A 1DKRA 4FFNA 4B4WA 2DCMA 3NRCA 3GOHA 4C20A 1Q83A 2D5LA 2MT9A 2PX6A 4Q3OA 3BOSA 4FYHA 1Z34A 1W85A 2JEOA 4OP2A 3KU4A 1L4EA 1O94A 1USKA 3H3FA 3L18A 3W5JA 2OBLA 1Q50A 2GHRA 2J85A 2C97A 4L4RA 1XN1A 1VSUA 1YQQA 4XPIA 3RS3A 3TRJA 4WLFA 3N6RA 4G4SP 3KQMA 2ZSBA 3AP1A 4Q9IA 3LQ1A 3MELA 1UBJS 2P2GA 4LKRA 4EGQA 5KVSA 1QH1A 4E32A 3OO0A 4X90A 2VP0A 3TRFA 1NBME 3HRIA 1HOXA 1EVJA 2Q28A 3HDTA 4YIKA 1KWKA 4Z3OA 4M76B 1UFOA 1TTTA 2J7PD 2XKBA 2QAGA 1K7XB 2B1QA 1NW4A 4B2IA 4B4VA 2IPMA 3QFSA 1F06A 2IQIA 3JPYA 3ZE1B 2H63A 1FOEB 2ID4A 2VAPA 3WNVA 3ZHSA 5K0EA 3OICA 3PUKA 1H2RS 1ZN9A 1RHUA 3TTSA 4Q9AA 3WGUA 2XIQA 1Y3IA 5IT5A 3GP5A 5TVKA 2RG7A 4K6FA 4M60A 4FDMA 4LA4A 4ZQFA 1CNEA 1CY2A 1IAVA 2EKQA 2VR1A 3MS2A 3GUZA 3I1JA 1HQDA 5DNCA 3MWEA 1VGQA 2GX6A 2W2MA 5DLYA 4DNPA 2UXBB 1CR1A 2VAMA 3JZDA 4ZMSA 4NCBA 4LN1A 4OXYA 3H1AA 1Y4UA 3VPBA 5GTDA 2Z8ZA 1E4EB 4Q9KA 2HR1A 5IAAA 3E27A 5G3YA 1HM5A 2P9EA 5KYXB 4Y9DA 1AKEA 4QJ3A 3LU1A 2OEPA 4UBIA 2AH5A 4NS4A 3VU0A 2GPNA 3EFOB 2CY0A 1PGOA 4Q66C 2QYTA 3TTUA 1J0AA 2GCPA 2PPLA 4W5HA 1E5QA 5AHWA 1RWPA 2NUPA 4G0XA 1NBAA 2F1KA 4HWTA 5KYTA 2GM9A 3H17A 4DM3A 2YXNA 3MMPA 2Z8YA 3VSAA 1KC1A 2NXJA 3K9HA 1KFBB 2ZR0A 3LWBA 3PFKA 3ID6C 4B4KA 3K0CA 2QM0A 3CS3A 5I7UA 3K6JA 3KB2A 4JZYA 4UCWA 5JXGA 2JZNA 1C9NA 1SEPA 4KJZA 3ITNA 1T9KA 5G4LA 4UEWA 1YE8A 4JT9A 1BEEA 2C0QA 1P2TA 4K40A 3MERA 4JOSA 4RTRA 5HILA 4TM7A 5FOVA 1G55A 1X7HA 5A6SB 2PL5A 3ISJA 3L7MA 4Z0NA 4PU0A 3JARB 1KEZA 4LXUA 3HK2A 3K1YA 2HCBA 1KVTA 1FTYA 3B8EA 3QVJA 4M6WB 1R4NA 3WO1A 5C35A 1BA2A 2VSFA 3COWA 4W7SA 4BQEA 4OMUA 2EERA 3ETLA 3K30A 4IHQA 4EOGA 1OU4A 2NSJA 1BMFD 3AJEA 4IRUB 2JGEA 3BKWA 1GQSA 1JV2B 3VPCA 3JZIA 2YMPA 5GONB 4FOLA 4ARZA 3PJDA 5FOXA 3UH0A 3MTQA 1J7KA 5KCMA 4EWLA 2Y1CA 3GMTA 1CULC 3X1DA 4IDEA 1IJKA 3TPFA 3EIUA 4M1KA 1X3SA 2ZAMA 4HEHA 4JYBA 4XYMA 3JQ8A 1SUSA 1SWWA 1YR7A 3VC7A 5JVDA 3MFYA 4AG3A 1E6WA 5F51A 3VU9A 3H2HA 4GMKA 1PTJC 2CJPA 2V1XA 1KETA 5ALSA 3RJ9A 3NBFA 3T5TA 4UBJA 1P4JA 4XTCS 2GPJA 3RHSA 3BFVA 5C5DA 5IJ0A 2LXNA 3ZDBA 1WVMA 1MABA 2HJRA 3IGFA 1WMFA 2A1TR 3PG5A 1ORIA 4LZLA 3LC0A 1V1RB 3K9WA 3OIVA 5JFGA 4KOAA 5LJLA 5FTJA 3ZZUA 3X44A 1VJ1A 1WCWA 3EEFA 3DA8A 3HJUA 4LQLA 4MA4A 3H83A 1YV9A 2ZKIA 5FBZA 2XEXA 2VJQA 3ZWNA 4OQMA 3HE3A 1KJQA 2RIRA 4J0DA 5LA6B 4G0YA 2N1BA 5DWVA 2BJWA 4ZA2A 4JZKA 4Q4AB 3K15A 2IODA 3DE4X 3EUWA 1QG2A 1Z4IA 4G1UC 4V0RA 4AZ3B 1QH0A 5EJAA 2IZ5A 1KTVA 2VN8A 4IL5A 4BGDA 5JH7A 4BYGA 2NVBA 4KO2S 4JXZA 4Z4CA 2Q46A 3QIAA 1XVIA 1P73A 3EGXB 3HO1A 4URFA 3JATA 3MWGA 1TM5E 3HYSA 1AHIA 2NWQA 2PA0A 3ZU2A 3ZV6A 2KLHA 3IJ5A 3IUJA 3OX3A 5TGTA 4H59A 1QHHB 4RKFA 4C01A 3QNMA 3H16A 5T67A 2QRPA 3H18A 3L1UA 1OC4A 3RTAA 2FFHA 5CDUA 1UIMA 4OJQA 3G7UA 4YUZA 4TTJA 4QXMA 3ICWA 1M7HA 1LPAB 1QLHA 3KPYA 2MYUA 4GSKA 4KCGA 4RANA 4NXNB 5LM3A 4MGEA 4EGJA 3E0QA 4UCXA 3ITDA 3Q7IA 4FE3A 5BOVA 1SVSA 3WP1B 1E98A 5LP6A 1A9ZA 1GNPA 1GN8A 2QYHA 3OJXA 1GCUA 1U5BA 3IP8A 1ZK1A 3I9OA 2PFSA 3KWJA 4ARSA 5HJ7A 1UBOS 1BKDR 2GCGA 3L77A 2GTHA 4FLFA 4F8YA 3H11A 4ALNA 3AJ9A 3KKEA 1A8QA 4DIEA 4ZN6A 4WN3A 2NVUB 2JFFA 2DQKA 4RJ2A 3WK7A 1L6IA 1MO2A 3I83A 2CHFA 4NHOA 2Q29A 1T4CB 1HBJA 4MUXA 1J5EB 3DXFA 4H3VA 2WRZA 5FHQA 1GDTA 1I5EA 2FXIA 2ZXFA 1RXSA 4ZZ3A 1QR2A 4CFSA 4PZLA 4G89A 1KH1A 2PHZA 1N57A 1MJNA 3DSRA 1Z5GA 4QO7A 4W7IA 1QG4A 4WJKB 1PZFA 1K4KA 2QPOA 4FLMA 1AUPA 3N2EA 3GLHA 5HF9A 4C4ZA 4AURA 1QFXA 4F6RA 3FPBA 4ZI2A 4G5QA 5JFOA 1H4QA 4U1RA 3GCXA 1CWUA 1OMOA 3ZJYA 5HZKA 2CYBA 3FPJA 1WDWB 2JBHA 1UMKA 1SURA 2VUSA 3TXAA 3K4PA 5JO9A 3U40A 3KDPA 4BKOA 5LIRA 1SCKA 3W34A 3IESA 4KXMA 4Z0HO 4YR9A 1E7WA 1AK2A 5K45A 1UANA 3PC8C 3T1TA 5AESA 3NIBA 4A82A 2XNKA 1GKKA 4NS1A 2F67A 1BOOA 4G5OA 4YCBA 3SS8A 3FSRA 1HK7A 1E79D 1W8IA 2WSYB 4G37A 4D79A 3R7SA 3MMZA 4LOIA 5AR1A 4E2YA 4BP1A 1GA1A 4HEJA 1PF7E 3C24A 1FNDA 1SQSA 1ISFA 1M2KA 2CNLA 2W6PA 4NABA 3UUEA 621PA 4L72A 4AKSA 1DRUA 5I4KA 3IAAA 2X23A 3L4BC 4P86A 4EKNB 2ON6A 5AW5A 3Q7SA 1PZGA 2IEAA 4L4UA 3MBIA 3GU3A 1RFLA 1UKBA 5EWMA 2JLRA 1K3FA 3HBNA 3F4LA 2Q7XA 4G8BA 5AK6A 5A03A 4JC8A 1GL9B 4QPNA 3ANXA 3NHZA 2OCDA 2PVPA 3I6YA 5AKLA 2YY5A 3GLVA 4BBAA 1VLVA 3GMIA 4OSPA 3TVYA 1RXIA 1BU8A 4RSRA 3OFND 5E8RA 2CZGA 4EHHA 4IVPA 4DQUA 4CM3A 4GVPA 3ED5A 2EDCA 1MEOA 1EFTA 2VDNB 3D5QA 4Y9SA 4YJ3B 5U1PA 3G89A 4LQDA 1YTLA 4JI6B 5BMVA 4FBLA 4Q4JA 2P78A 2FP3A 4KMMA 4N7JA 3VZCA 1L4UA 2VXOA 1RBMA 2IH5A 2I80A 3DEIA 4N5MA 1U7HA 1ZVMA 2AXPA 3IC5A 3QKSB 3WYCA 3MWFA 4J0GA 2JIZD 4AY5A 2DLCX 2WTMA 1OIVA 1M6VA 4B7XA 4ZKDA 1AZLA 1VFNA 4XIYA 1DINA 4YJGA 5KB3A 4RH0A 3WC4A 5K6AA 2DFKB 4DYHA 3FNHA 3F5FA 4INOA 4N12A 1WMSA 2DPLA 4TGLA 4ESOA 4W5OA 1GQFA 1G4UR 1L8QA 1OXXK 2ZYIA 3LHKA 2C4WA 1OY1A 3NJ4A 3PQEA 5FI1B 4CM5A 4RS4A 4O4HB 1H2AS 3ZXSA 1WLSA 3WMEA 1Q1BA 4H7IA 2XGGA 3QEKA 4AN1A 4MINA 1QYXA 4MW7A 4YFVA 2BHNA 3GH1A 2OXTA 5BN5A 3AL0C 2RC5A 2FWNA 1SHLA 1L4NA 1Z8DA 1XJWA 2HAEA 2BVNA 1X1BA 1X7WB 2RK4A 3PBKA 4L4YA 4BLTA 4YUXA 2YWGA 2IXEA 1B2RA 2ZWAA 3I4LA 2VF2A 4X7BA 4AMUA 1EGMB 1ORVA 4AWXA 3OCJA 1Y3DE 1TEZA 2QJOA 1PTKA 3QVMA 4Z1OA 3PWTA 4D4GA 1U31A 1X7GA 4Y2SA 2ATXA 3DL0A 4HPJB 1AN0A 2ANCA 1DBPA 4BNZA 4HVCA 1M8KA 5BSWA 3U09A 1P5RA 5H3HA 1K6XA 1U4OA 2I1WA 1U3FA 1R9JA 5EP2A 5JAMA 3TINA 4LV6A 1RM5A 2XDQB 4RZQA 4DLPA 3N8KA 3MW8A 1E9DA 2FRVA 4TYMA 5LMNB 2YUTA 1GWNA 2PMBA 1IK4A 5KYUA 3S2ZA 2NYRA 4UDNA 3FB4A 2D4AA 3HVUA 3CZCA 4YP9A 4DCTA 4JVOA 1AF7A 1U28A 3AFGA 3HCPA 5AYVA 1G38A 1NIPA 1ISMA 1GKLA 1HFEL 1NMZA 1CJKC 3GGJA 3IMCA 2W42A 1O97C 3B1YA 4Q6WA 4NMWA 4CCAA 2QMYA 2Y05A 1EMDA 1U8TA 1K68A 4QUBA 2ZJ6A 4XASA 1EWYA 1SQ0A 4QDUA 2P7IA 1DC4A 2ZJ8A 2G0AA 3NWOA 1UUFA 4IUDS 4WKBA 5AKXA 1PK7A 2WM2A 4OBEA 2D3TA 3TLAA 3AETA 3BBLA 4YMSA 1KDRA 3W1VA 1QDLB 1XKXA 1JYEA 3WAKA 1ZJJA 1PL8A 3ABSB 5L3RA 5DU2A 5LKRA 1DTWB 3EODA 4I55F 4ZYUA 2H06A 4OQYA 3FJ1A 2Y68A 2G6TA 4QKQA 1R8JA 2B83A 3EIHA 3NB0A 4DXAA 4FK8A 3GF4A 1CUFA 4FUTA 1JHAA 3J80A 1EUYA 4YR7A 5JADA 3UB2A 4QLBA 3LQRA 2WW8A 4C2AA 3BGOS 5J4LA 3W2TA 3NBXX 4WVLA 1HGXA 1N5MA 2BDUA 2CMFA 1U8AA 1MDBA 2XNDD 3GRAA 1I4LD 3IMKA 1TLLA 2PKWA 4AY2A 1G8KA 1A50B 2XVAA 4PTYA 3Q3HA 4OB8A 1DOHA 2J5XA 3FZEA 4H6WA 1G5RA 2QT9A 4JU9A 4ZQIA 3SG0A 2BHRA 4Z86A 4P4SA 3U60B 1RLOA 2DHQA 4RVHA 5BV2P 1JFFA 1TVCA 2IEZA 2ROQA 2HRDA 1NONA 1EG2A 2D13A 4HO1X 3PTAA 5L3VA 1I0IA 1WS6A 4EPRA 4NMXB 2J9ZB 3IVRA 2GS9A 3I76A 4QJ4A 1BCSA 1MJGA 2V6BA 4LE2A 4EKDA 3JSAA 2PWPA 1DBWA 4CM9A 2YH2A 4A8HA 1WB4A 5JNWA 1BDHA 3RSQA 5EXSA 2DEUA 4HHEA 1Q19A 4MRMB 4H15A 4DVJA 1GGKA 3C3WA 4N3GA 3WGZA 4XOIA 4EF5A 2HUNA 4PQFA 2VOEA 1J1UA 1ZINA 4E2ZA 2GKSA 2XUKA 3L4EA 2C0PA 2YZNA 3NATA 2ZYDA 3DV0A 2G8NA 3GAFA 4K0RA 4JI8B 1G8FA 2I71A 5LZ7A 2PX2A 4C7BA 1KMQA 4YAOA 4E22A 4AG5A 1JSCA 4BAZA 4LJ4A 3AC0A 3N8HA 2HX1A 4YPOA 1NASA 4MQLA 4L4ZA 1DJOA 1E7YA 2PUHA 3F7NA 5ERGB 3FAKA 1SCJA 4NV0A 2OHFA 4KRGA 5H4HA 3T61A 5C80A 1PHRA 3UT6A 2HV8A 3AOGA 5DRYA 4CMIA 1X9HA 3LSTA 4JY7A 3JYHA 1LVHA 1FP4B 4B6OA 3CEPB 1DXHA 4BUCA 3ZBPA 5AVSA 2CHVA 2R6AA 4BTEA 1T0HB 3SM9A 2QVXX 3A9VA 4E7PA 2QBYA 1QV9A 1XEFA 3D3WB 4JKYA 4RVOA 4NBKA 1M0SA 2AA3A 4XVCA 5F21A 1NN5A 1CQJA 2F59A 4M0FA 5P8WA 4YDRA 3M6IA 1TO6A 1G59A 1TCVA 2WHEA 3DAOA 4KFTA 4FT2A 1K2VN 2A1TS 4OKIA 4TTTS 3TW4A 3DZDA 3QQ5A 4EO7A 1CIJA 4RELA 4Y1FA 3NUQA 4NCJA 3BWMA 3ELUA 3C3KA 1N4AA 4OVKA 1F17A 2AEJA 4MUMA 3GNQA 1NW3A 3R0XA 2P91A 1JEAA 2LVBA 2UVPA 2VNKA 1HF3A 3JQDA 3WDSA 4CKBA 1NPDA 3U4QA 3R9IA 2IEBA 4OGFA 3WRYC 3PWZA 5JJIA 5ENVA 2WAMA 5L40A 4B73A 2H7XA 2X1VA 5JSUA 3G7NA 2IF2A 5EZYA 3TO5A 4HV4A 1T8PA 4FCCA 1NKSA 4KLZA 3AEXA 4FNOA 4GP6A 2YR0A 1NAIA 4IVRA 4JOCA 3WLPA 2VZ0A 4WXRA 2V1UA 4R84A 4MLDA 4MARA 3D31A 4ZMBA 4EHIA 4CV3A 1I6MA 4CHTA 2C7GA 3O03A 1EK2A 2NZ2A 1NLMA 3F3KA 1XJQA 2BFFB 2IU4A 2HQSA 3T12A 4IJUA 4LRSB 3JX9A 1PJ3A 1LTKA 1RVV1 1Y1SA 4QBGB 2VHJA 3HB1A 4RVGA 4TLAA 1BVUA 2PUEA 3LPMA 3HGMA 3STVA 5JXJA 4F1WA 2A59A 4KLNA 2NGRA 1JKJB 3LP8A 121PA 2J9RA 5JTTA 1X13A 5EJ4A 2YHUA 4QE3A 3LBNA 3JYOA 5L53A 2UXCB 2ZBVA 1WETA 2QMOA 5KWSA 2GHTA 4RGVA 1ZAYA 3KLPX 4KQWA 3GHYA 1IVNA 4XW2A 3M6WA 3IQIX 1CU1A 1WXQA 2JLWA 3ZZMA 1ADGA 1CUVA 3ZS8A 4MUFA 3IA7A 4PRZA 4Y98A 1WKVA 2AJDA 5EG5A 1YBAA 2XNHA 3IUPA 5E38A 2IWHA 1XTPA 5CYPA 1P45A 1U8EA 1USIA 2H4FA 1HL7A 2HBYA 4KDFA 5AI5A 3DTTA 3T5GA 4O2LA 4UNQA 3T7CA 2PT7A 2J32A 3OQBA 5BVGB 5EA2A 4DZRA 2L69A 1AXGA 3PD7A 1VTKA 2JLSA 2WJGA 3E5NA 3ZXYA 1L7RA 3AIKA 4YV2A 4Y1RA 4XQEA 1KQPA 1F12A 2HCTA 3E03A 1MB2A 2DPYA 4HBZA 1QOPB 2VK1A 3O1HB 4LK2A 5ARBA 1ULUA 1JMYA 4D6YA 2VSXA 3GXBA 4NNOA 2JRCA 4PBRA 4EMBA 3EBOA 1UQUA 4BRWA 1IZ9A 4P3KA 1EK6A 5AXAA 3IPYA 1U94A 3R6DA 4QHSA 2QP3A 2C03A 1FNCA 4JH0A 4O2AB 4EL0A 3ISTA 1GQOA 3Q11A 5JR3A 2WTAA 3N86A 5I45A 3UTCA 1OWNA 3D7KA 3RBAA 1T5HX 3KVRA 4R83A 3AQIA 4U2KA 4NF2A 4L8YA 1X9GA 5AQ1A 5DGIA 3UANA 4U2BA 2OOKA 2OAGA 1UC5B 4Q9NA 4WBNF 3PXAA 2R6CA 1UADA 2YS6A 3MOGA 1GYPA 1XD9A 3U4GA 3ZHBA 4P1ZA 3SSOA 5FADA 3SYRA 3M6UA 1YULA 3SS7X 3PS9A 3NV9A 3R6TA 1PIWA 1RZVA 5H9VA 3L3BA 3N2KA 4QIHA 1HSOA 2IXAA 4L4SA 5FHRA 1WPRA 1OB5A 3K7EA 1Y48E 3PDIA 5FLKA 4BVKA 4F2WA 4CU5A 1Z36A 1U0JA 3U37A 4CL8A 5DFAA 5TQVA 1PGQA 2CCGA 1CUSA 1RCUA 1GSIA 3B1ZA 3QMWA 3CNEA 5ALKA 4GHWA 4QU9A 1ZW1A 4A0HA 4FINA 5CFZA 2C2HA 2NZXA 2WKPA 4UVIA 3FUWA 4EP1A 2ZFUA 3ILVA 3IAM1 4ZXFA 3RIYA 4F5ZA 3AL2A 3H05A 1TL7C 1PE0A 1XVUA 1CF4A 4RPCA 4IO1A 3WIVA 1YHNA 2Z2XA 1Q0SA 1XU9A 5CB6A 5JYEA 1E5VA 2QZSA 4OBBA 4LY3A 1GYQA 1ODCA 4EB8A 3EDCA 3NHKA 2CB0A 2UZ4A 1QVVA 1USWA 3GBSA 4A91A 2JFYA 3KXDA 1GNSA 1KYQA 5AM1A 5ALUA 4EB6A 3VKFA 2RH9B 3AWDA 3JYLA 4DILA 2GTPA 3ANNA 2EGGA 1TAHA 5KTYA 4JI4B 4G1VA 1JG1A 4J1TC 5KBYA 4N8DA 1RQLA 4M4SA 4BOYA 5DO9A 2WF8A 2E6KA 2FXVA 2HD4A 3QFFA 1XQVA 1GAJA 3FIUA 4CXMA 3EISA 4TXLA 3HMQA 3KG2A 1E66A 1LFDB 1TAGA 2EW2A 3O8DA 1L5KA 2FPPA 1ZHFA 3NT5A 1S2GA 4EZBA 2REQA 3OH8A 4Q4LA 3CM0A 3AF2A 2BEKA 1O9HA 2W37A 4QWWA 4Q7JB 3E3AA 5FFMA 5JNVA 2Y8EA 3HEMA 1E3IA 5T4EA 3E3NA 4GOMD 4GX5A 2RHRA 2OLEA 1YVUA 1YBMA 3EHDA 2C9BA 3NHWA 2R6FA 4FPXA 5CT6A 2J6BA 4MUBA 1MJ5A 5HIIA 4ERXA 4C7OA 2MSWA 1SVKA 3PT5A 2F43A 2SKDA 2VCHA 5A3RA 1E8DA 1LF5A 4DIKA 1G3QA 4CLDA 3GEIA 5B3JA 1QO0D 2ZYTX 1M2HA 4DSAA 2FLKA 4X20A 3TCNA 1JQAA 3MA0A 4O02B 3IE1A 3IO5A 4KR2A 1KS2A 1XZPA 4C5CA 3HTXA 1V2GA 2FZWA 4I19A 3FNQA 2O07A 1FFXB 2PA3A 1SAYA 3WKBA 5SY4A 3HDVA 1FLVA 2ZI6A 3NHFA 3RJ5A 4DV0B 2EFDB 4LHSA 1NVAA 1YZ3A 2PU7A 4B6JA 4BECA 3N8IA 4WBNB 4IMPA 4KGDA 3OPYB 2X9GA 1DX4A 3PGXA 3EZXA 4FHEA 2BGKA 5A7GA 1VCMA 3QWAA 3Q85A 1GUDA 3KXIA 3LG2A 2OZLA 3QUSA 3HSYA 5EHZA 4F7WA 4DDTA 2EJUA 1MJFA 2H2WA 3FMIA 1KJNA 1R4ZA 4KYIB 4NG4A 3AEQB 5REQA 3SJAA 4BFUA 3WAGA 1QIKA 3IUEA 3ZGLA 1I5OA 1QB8A 2WLTA 3CPJB 2MYTA 5J58A 5LQJA 3F97A 4DN6A 4AYWA 1MBZA 1BHJA 1CY8A 3CWCA 1SRRA 5ICEA 4WW0A 4UOZA 4GKJB 4JROA 3SDSA 3FY4A 5K3FA 1QKKA 2JBAA 3F3MA 4RAOA 1EFRA 4HUQB 3OOSA 1SKBA 2CF6A 4HWRA 4WNCA 1FEZA 2E3JA 4ZANA 3ZCPA 3LT1A 4QYIB 4HQKA 2VA8A 2WVGA 1G19A 3DHWC 4TMVA 5AUOB 1FA9A 1KSHA 3HV2A 1J0BA 3L0ZA 3Q0IA 4GVLA 4R9NA 2L18A 5J47A 1EQUA 2JATA 3BQMB 4G01B 4QDTA 2VTVA 3T54A 4BFCA 2WTXA 1UWCA 2IYSA 2PS9A 3K53A 3SXJA 5CCBA 1CJUC 1S2IA 2HI0A 2OP1A 4L28A 4LW8A 4CRWB 4M0LA 1GFZA 1Z17A 2C5SA 3P0HA 4LZNA 5LZ5A 4EFKA 2WD9A 4MGKR 3R9XB 5SICE 2IYQA 4YT2A 2HSEA 2W6NA 3R77A 4BQNA 3U4IA 1Q20A 4NAVA 3NPAA 4UAGA 3ZJVA 4HLNA 1M1YA 4HBGA 4OL9A 4S1TA 1IVYA 1TVKA 4MJLA 1NBIA 3ER6A 2I4OA 1L7MA 1OW3B 4ENRA 2N42A 2V7EA 4G23A 4WL0A 1BNCA 1K97A 4FOPA 4BV8A 3W5HA 1A88A 3D5EA 4FR2A 2XWQA 5HMLA 2AFHB 3SJUA 3NIGB 2WY2D 2F3RA 1GV1A 2ZVDA 1YIAA 1D04A 1OLUB 1PR1A 1VE1A 1WTAA 2VTKA 3INTA 4J7UA 4RF4A 4RVUA 1K88A 1YK0A 2FQQA 1T5LA 4J8PA 1UKVY 1ZJ6A 3TG2A 4HJXA 5ERXA 5ELLA 1QTIA 2H52A 5JRZA 5T8KA 3U7GA 1JJBA 3G5TA 3IH5A 2GK4A 4EPVA 4DR7B 1G2PA 1Z13A 1PS9A 2VWQA 3OMWA 1FYVA 2NO4A 4FKZA 1DOZA 4EDHA 1K3UB 3T8YA 4RY2A 1UBMS 3ASVA 5C8ZA 5C9ZA 1CRPA 2V6GA 2JLBA 3LY5A 3LYHA 2C07A 4YP6A 3QE3A 4X6YA 3C41J 2CLFB 2IQ5A 2WZBA 1C4OA 4NESA 5BUZA 3O6VA 5LBUA 3MINA 3B6ZA 3MRSA 4QUGA 2TMGA 4ZIRA 2QX6A 3U0BA 1L3CA 1FMLA 3LCJA 5G2OA 3WBJA 1HDOA 3KEQA 3TTYA 4TMYA 5EJ2A 1O5TA 1IN7A 2ZSUA 1J25A 1Y8QA 4P7GA 1A1VA 3IVGA 1ZOPA 2DUWA 4JN6B 1GKYA 1NWCA 1M73E 1RIIA 2IUYA 4LOHA 1EESA 3L4JA 1P3JA 2XBLA 3KAPA 1LNSA 4Z9XA 2UZAA 1DTSA 2JCXA 2X4GA 5K3EA 4OI1A 1OFTA 3P2KA 5FUMA 1DFIA 5KYYA 3ZI7A 1Z0SA 1B3BA 4I5GA 1DKQA 4RFSA 1TA9A 3ZD9A 3BH0A 3CVXA 4A27A 4MPJA 1XX6A 2EF0A 4UBMA 3VHXB 1SVWA 2UYGA 4B2YA 1SUEA 3VHQA 4F3CA 3EGOA 3RM3A 4QHTA 4GM0A 4O1IA 3KOZA 4JBXA 1TYEB 5ESRA 4A26A 3EDRA 4RQAA 1RPAA 2REBA 2AZ4A 4LXGA 4MAAA 2HU7A 4CL3A 3RVBA 3I53A 4MV7A 5EL0A 4WJLA 1ADCA 1WNFA 2R66A 1CUAA 4BB0A 3CRMA 4EUFA 5F23A 1A1SA 5EI5A 1AMUA 4TKUB 1HZZA 2HIGA 2XUQA 3VC2A 3V4RA 2VDPB 3LQFA 5FTKA 4F11A 3TNLA 3IMFA 1ULSA 1UF9A 1IE3A 3TLCA 3J81k 4MUIA 4H0NA 4NDNE 5DASA 3NAMA 2CUTA 4RA6A 4NECA 4XUGB 4ZOQI 2OHJA 4ZDJA 1AQUA 3T3MB 2Y1GA 1C0KA 3U0VA 2VT2A 1LTHR 3NOQA 3HV0A 5DM4A 4F72A 5FLYA 5TMEA 3D54D 2X3FA 2HF9A 4C08A 4WINA 2Y1LA 2FZKA 2QJTA 5AHOA 1OC2A 2CLIB 2ZK7A 4GRAA 4PHCA 3GQBA 4OGLA 4FMDF 4FIDA 5DHRA 2AWOA 2EDAA 5FD8A 3TW0A 2XODA 2YXLA 1L5ZA 1FU7A 1R2QA 1KS9A 4RLSA 4RV4A 3ACDA 2PGLA 3UHFA 2OQIA 3ZYCA 2ID7A 5C8XA 4UASA 3F90A 3HKEA 1YZLA 2FPGB 2PSJA 3ON5A 4PCAA 1Q92A 2VPQA 3H2YA 2ZRBA 1QFYA 3LUHA 1WPXA 3PYLA 4XGRA 4X97A 4EARA 4DR3B 4LWQA 1EP1B 2Z95A 3CSUA 2ZQ5A 1ESMA 1WSBA 3JTMA 5I3ZA 1VJCA 3OM0A 4PONA 3ROQA 4PANA 1VDZA 4M7WA 3IEUA 4WJZA 3TD6A 1XRJA 4QL3A 4QM7A 2PUFA 3LGAA 4BE9A 2WSSD 4I8DA 4TQ9A 5ENDA 3CINA 4BNHA 1A9QA 2HIAA 1YRYE 2HJVA 1FJ2A 1UP4A 4ITRC 4IV0A 4NK4A 4CDGA 4FGUA 1Z56C 1H0KA 1X38A 1XDSA 3K0EA 5TIIA 1YZHA 4TMWA 3CRQA 2EGUA 3O9VA 3U61B 3ASUA 5IVKA 2V6MA 4R7GA 3CRNA 1J97A 1SC9A 2WP0A 2FEPA 3L7LA 5CFPA 5JJLA 3INRA 3S1AA 1G17A 3AUJB 3MWDB 4JIMA 3QX7A 1X7ZA 3B6IA 3FMVA 4ZYZA 3LHSA 1DV2A 2ERXA 1JN0A 1GYRA 2IDZA 1IH8A 1U9IC 1G6OA 2O2JA 2VAVA 3AF5A 3G5AA 3LE8A 3P2OA 2VK4A 2ZJ3A 3CLUD 2VJKA 1SULA 2P6MA 3DAFA 3KZKA 4A92A 4DDKA 2ZRHA 3S1SA 4FYKA 4K88A 1EWQA 3QELB 4UNPA 1L8LA 2WD7A 2H2IA 3RYIA 1UIRA 1X7DA 1CT9A 1XB2A 2Q6IA 3PWKA 2C5LA 3QG1A 3B5JA 1D4AA 3H0CA 4HR7A 3TOCA 4D6PA 3L8CA 5TMBA 5A4FS 2VQFB 1EXDA 3I2KA 4GZ3A 3LV8A 1T6YA 4HQNA 2RGDA 3JALA 3RUEA 1SBQA 2Z4SA 4QUIA 2DT5A 4K2HA 3RREA 5D5PA 2P3OA 2M1ZA 3OPQA 3PD0A 3U26A 4BS9A 2VYFA 4OQ4A 2PZMA 4YMLA 1EUCB 3OMXA 3ZTTA 3JQAB 5LLDA 2BEUA 1NLFA 2Q8QA 4UFPA 3BL5A 1L5QA 1VL6A 2O52A 3ND9A 1FLDA 2R8EA 2BE7A 4XPZA 4HL6A 4AKGA 3JAWA 1NE2A 2P6NA 2QQ0A 2H57A 1DIAA 4LIPD 2A5FA 1FUIA 3OZAA 4L8FA 1OLOA 2E1PA 3LUJA 4XLZA 3SLKA 1R88A 3NKVA 1W36D 4B8WA 4OD0A 2WVAA 4HZUB 2YJ4A 2V7VA 5DHSA 1MRZA 4B9EA 3EVAA 3ZW8A 3GK3A 1VL0A 2TSYB 1K5HA 3O75A 4UVHA 3SF8B 4DDMA 1DSSG 3INNA 5IN5A 2KW5A 1GNQA 1VYTA 4DBLC 2R9VA 4HFNA 2QQFA 4WCVA 3AI3A 3B70A 3BXPA 4BQOA 5KTRA 3F74A 2QE7A 1R4MB 2V4MA 1ATIA 2Q7DA 2FMKA 2IY9A 4EABA 1G21A 1IEWA 1AF4A 4LZZA 4G1EB 4UM9D 2ZB8A 4US0R 1N2OA 1JA0A 3FYHA 3NRJA 1XCBA 3OE7A 1V5GA 1LRLA 1UH5A 1UK9A 2PJDA 5CJPA 1NVEA 2WJVA 1RADA 3LC7O 2DHCA 1S2MA 1DC3A 2CLSA 2GUWA 1KFJB 3S1LA 2PKQP 3KYJB 2RMKA 3ROKA 4C2BA 3OEHA 1O94D 5F33A 2SCUA 4J1NA 1N8NA 5K3AA 5DI3A 3Q9UA 4CG2A 1PAUA 1QX4A 3L0PA 5IDWA 3ADKA 5G40A 1KK3A 1UMDB 3RIEA 4OO3A 1PJ2A 4LBYA 3SYKA 1E20A 4HNUA 4D9KA 3IBYA 3GXOA 1C0LA 2A78A 2DSNA 2ZRDA 2WF7A 4N03A 3KT3A 4YMUA 1BN6A 3ZHQA 3EGIA 4H3KB 3T6KA 1FLNA 3EIWA 1C9JA 3N2ZB 4GKBA 3IAFA 1IBLB 1KZ4A 2XCUA 4Q3EA 2R4UA 2R00C 1HDZA 3PLRA 5EFOA 3DXZA 2WAYA 5BN4A 1Y8ZA 5EMHA 1H8HA 1B16A 3AQ4A 1IQ0A 2WWFA 1KNQA 1T13A 2IS2A 1B7GO 3KETA 4YASA 2R11A 2A8YA 4FGZA 2IXGA 4CTJA 4TV9A 3TQQA 4ND3A 3AF6A 3NDRA 2QVZX 5BR7A 1O9BA 1GU1A 1CF2O 1CJMA 2CDAA 4BVFA 5KNLA 5EHXA 4LVCA 3JR3A 4LJSA 1NSYA 3K0SA 2W6MA 3CIFA 3Q8KA 3AM4A 1WF3A 2NQ2C 3D43A 3FMPB 1DMSA 1Y6ZA 3WWOA 2QM7A 2JANA 4TS3A 1Y5RA 4KQ1A 3QLTA 3UC5A 5A4IS 1C7EA 3HZOA 3ER9A 3K3PA 5KKCA 3QHPA 5D2CA 1GPJA 1W5FA 2LR0A 2W83A 1GG8A 4NFYA 1J99A 3VHLB 4CDMA 2RGAA 4Z49A 5AVQA 2N46A 2X1HA 5LB2A 3RVJA 2PD4A 3KYCA 1YDMA 5AW0A 2Q8NA 4DLWA 2ZJOA 3PR3A 1N2CB 2N0SA 4W82A 3GI1A 3HKBA 3OD1A 2HMYB 4O1MA 3I28A 3HG7A 1ZXLA 2ST1A 5AXCA 1WQ1R 4QGHA 2VQ6A 3OZUA 1QQBA 1FMFA 3ICPA 4YAGA 4H3SA 4CTOA 5FPQA 1SK9A 1PEDA 3EY4A 2DMRA 1PW5A 4YRKA 3KSZO 1N0IA 1ZYUA 2YY6A 2XYVA 4JWTA 3M4YA 4CODB 1H8EA 4PGFA 1QVWA 1DCKA 3NT4A 3Q1LA 4WMLA 4XD7A 3I0MA 2ISQA 2Q2NA 2GILA 2ZSIA 4G85A 4WKOA 4BLPA 4F5WA 4BBPA 5AW4A 1VA5A 1JLRA 2QS9A 1TPZA 1PT7A 2EWMA 3DCJA 3MQFA 1E3WB 3CGGA 3IPAA 1G5FA 5KQMA 1QGUB 1GZ6A 2B2XA 4INJA 3AVQA 2FWIA 4PHTA 4A2WA 4URWR 1BJKA 2J09A 3ILHA 3WBBA 3GARA 2WF5A 3HR7A 3P2MA 2AYYA 4J3JA 4R05A 1B93A 4RHUA 4WOCA 1PV1A 2RKWA 5HEKA 2H9IA 4ZOLA 3WGMA 1YQDA 4BLRA 3AEZA 5TR9A 2DKNA 1KK1A 1NBOA 1T3HA 2O2GA 2XWPA 4ZVPA 5HIAA 3QEAZ 3M5WA 3Q72A 3RS4A 3W8FA 2ACEA 5JJCA 5K99A 4DR2B 1PG2A 2MDTA 4FM9A 4WUTA 5JU6A 2A7QA 4QVKA 3L6OO 1P33A 2AN3A 4JLKA 3U49A 2AN9A 4AUKA 5C8DA 3VH1A 4ND8A 2FHPA 4KQHA 4A4DA 4D1YA 4KQ6A 4KZKA 1I32A 5L3QA 4OMDA 4IDPA 4BC1A 1VG0B 2XVZA 1Y6RA 1UQRA 1FDSA 2MSCB 1GEEA 2EG5A 2FMIA 2QXYA 3A1DA 5DM70 4UHBA 1KFCB 1UKAA 1X7XA 3KZCA 4U3JB 5HXAA 2FEAA 3BPSA 2BTQB 2FUG1 3IEXA 4LHXA 4ZXPA 1YMVA 3PXBA 1X19A 5E2BA 3SYTA 3IIMA 4K9OA 3EWNA 2ZAIA 1FBTA 5HP4A 2D6FA 4D5GA 1GXSB 3G9ZA 4XVRA 4J2OA 4MV8A 3KDAA 2R8PA 2CZCA 1Z8FA 1XD2A 5DB4A 1FZTA 4XI9A 1XJ5A 1NQWA 1JP7A 3IOCA 2UXDB 2R1VA 1EP9A 1SBZA 1WCXA 3PF9A 3SQXA 2AN5A 3H97A 2ZUFA 3ROTA 3PGKA 3LT4A 3N2LA 3RK1A 2VHXA 1PFKA 3IBSA 2P30A 4BKUA 3E58A 4LJRA 2Q99A 3Q9NA 4IGAA 4RY0A 4ND1A 4JWKA 2XKKA 3IJPA 3PYMA 4GMDA 2QLNA 3S2GA 1U2PA 2RGUA 1L5HA 3FHOA 3MPUA 3RWOA 4JBIA 3ESXA 4FYPA 1CZUA 1FUEA 3VYRB 5KX5B 5JCPA 1PJCA 3R7NA 1DQZA 2ZUVA 3CR3C 3PX7A 1Z2CA 4CLRB 3DONA 2NMVA 1K1EA 2G63A 2FP4A 2QQGA 2B78A 2Z6UA 4H3HB 1PGNA 2XUZA 3CXUA 1FCJA 3K72B 4EVQA 4IIGA 1M2EA 2GYUA 3OLXA 2CJFA 2YDYA 4DQ0A 2GF9A 3LYUA 3IOMA 1N5KA 1VYHA 5CFOA 5IMBA 1CFZA 4N8EA 4YJHA 5DLDA 1LKZA 4X3PA 2VG8A 1L7XA 3ET5A 3CJRA 4G25A 4GQIA 4KGVA 1KBZA 4B45A 3EA0A 5AIBA 3DOEA 3JQ7A 3W5VA 3K2EA 1YU9A 4C1BA 5AP9A 1X1TA 2D62A 3KO8A 5K0SA 1M5RA 1LEHA 1S8FA 2XMQA 3CT4A 1FF9A 4XEHA 4I5FA 2QTGA 5A06A 1OGJA 1VE9A 4KTVE 1QE3A 2D1RA 3PQ5A 1ZJYA 3E9EA 3G49A 4RPHA 3L6CA 1E5TA 2OYCA 2CXHA 2ZYSA 4CF7A 5KYWA 1SPBS 3HSKA 1IEXA 4LMRA 4KQMA 3H65A 1UCFA 3KPUA 1DRKA 2ZJ7A 5BN3A 3D6UA 3IMEA 4ZU6X 1I8TA 4DV6B 3P52A 2ZAGA 1Z4KA 1CRQA 4V39A 4YWHA 5AVZA 2BJHA 2E82A 5IKOA 1HT3A 3FSEA 1C1XA 2H0AA 1TGYA 3D6TB 3M33A 1A04A 4HAVA 3HU5A 2G67A 1TU3A 4UZFA 3BMNB 4Q12A 5AWFC 2ZIGA 2AXEA 2Q9CA 2AV6A 1MT0A 3U7JA 1N0UA 2CFTA 3KAJA 4JYCA 4RKYA 4EJFA 3E15A 1MX5A 1CQIB 2NO0A 3IQXA 1M66A 2UZ3A 1VSBA 3GNSA 1IJBA 2IZ1A 4P58A 5DLEA 4OGKA 3HVKA 3LT2A 4DEVA 4D44A 1P4HA 1NF2A 4I9HA 3RS2A 4KWCA 3A6HA 5CT9A 3LUGA 1MEEA 4BLWA 4BNDA 4Q1CA 2C7BA 3IP1A 4YAUA 2W2OA 1XT6A 3NAQA 1K89A 2HHLA 3RT1A 5CT8A 1X1CA 3G2KA 2VF7A 2PH1A 4ENWA 4M1YA 1QOZA 2X9NA 4HN4B 3AVUA 1YZKA 3A2LA 3CTPA 3ESBA 2HJWA 2QN6A 3FGOA 4OOEA 3WGHA 2EWVA 3COYA 2H0QA 1X1EA 3AUAA 3TR6A 5JS7A 1W4LA 5E0KB 4GYYA 4G5FA 3T7RA 5C81A 5IJ9A 1Z22A 5K8LA 4LHVA 1NI3A 3GEGA 2XRYA 3FW1A 1BW9A 5K0TA 5HQ3A 3IO3A 5EHQA 3V4FA 3IL2A 4RTNA 4Q3BA 5EYPB 3SHQA 3GLSA 2J6HA 5T64A 2G40A 2P2YA 4KNYA 2CV0A 1JZQA 3C6KA 4WVFA 3VUFA 5C4IA 4DREA 3TPCA 3UWDA 1J8VA 3SZRA 3TSCA 3RQIA 3CG0A 2VBGA 2M1XA 2NU7A 2BAGA 3VSBA 3NASA 3FBWA 1KAHA 2C2KA 1BFUA 2J4DA 1YJ8A 3ECCA 1YVEI 4RSHA 4HDNB 2DB3A 2XWBF 2QROA 1YUMA 1NL3A 2HWKA 2VO1A 16PKA 5E3JA 4X7MA 3TZLA 1NLUA 3IAXA 3ITEA 2X8LA 5AOAA 4S1NA 1TGVA 5F3RA 2W2KA 3JQFA 3L7BA 2JFPA 1Q0RA 1SM4A 4DCNA 1E4VA 1AS3A 1XRQA 3UT5B 3TSZA 5IFLA 4I1IA 3SIXA 1S4QA 3G8DA 3KBOA 4I1PA 1TAUA 1SB8A 5ETJA 2C54A 2I55A 3O8OA 4FLEA 2VSNA 2HPHA 3AFHA 3FWNA 3L04A 4IFBA 1VB5A 1TYDE 1GKUB 1WM1A 2WYIA 3ZDFA 2G25A 4V03A 3QE9Y 2VHEA 3TW8A 4E3ZA 2E6UX 2ONZA 2WIDA 5EHGA 1F48A 2BBTA 3A05A 4EW3A 2QUJA 1F9EA 3AR8A 4JT8A 4OBWA 1EWRA 3T06B 3U80A 4PNEA 4AQDA 3B9RA 3HB0A 2ZTHA 3QPWA 4TUYF 2KX7A 2IYOA 3WLTA 5EZSA 5FNVF 3FN4A 3C6MA 1BX1A 1DLJA 1NU6A 4W63A 4OLBA 3CPHA 1ENYA 2Y92A 3CGWA 4HWOA 5E6SB 4EY4A 4W5NA 4KN5A 4PPYA 1MAUA 4IZOA 4O0LA 5ER6A 3QUBA 1EE2A 4EG6A 1Q7EA 4BC0A 1Z2PX 2YW9A 1GGHA 4DMKA 2XWSA 5B2ZA 2W8BA 4OUDB 3I8SA 3LS2A 1LQ2A 4E4RA 5JAIA 1NLYA 2DYKA 2E4YA 4J07A 4BYMA 4M1OA 3WHPA 3ONFA 1KJZA 1RRMA 1H2BA 4MKRA 2PRKA 5JPCA 1VG9B 1WMBA 3LUDA 4AX4A 2WB2A 1NT4A 3FWZA 1EUQA 2WMOB 3UNXA 1X92A 2B69A 4NQZA 4XDYA 3R2JA 1ZRHA 2OM6A 5KWEA 4LC1A 1BKSB 3IP7A 721PA 3OFSA 1R10A 2VQEB 2JAWA 1FDVA 4HX9A 5BOSB 1PEYA 1ZY2A 4X1IA 3TZEA 1I9CA 1ZOOA 1RQNA 3OEYA 1A3CA 1U63A 3ZZ0A 2K7ZA 3UHAA 5ADVA 2ZU6A 3DZJA 1IL0A 2NZUG 2QTRA 2FG6C 2X1MA 4BMXA 2VYVA 1MF7A 1YOBA 2IYUA 3IRVA 4CEIA 1U2RA 3I05A 2B3DA 4Q1VA 5LUBA 4LRTB 2H3HA 4L1KA 1BFKA 3G8YA 3DFUA 3OF2A 4RK4A 3ZGOA 1T1EA 4KDRA 5CA1A 3QW2A 5IWAB 1OH7A 3BDAA 1Z2EA 1RC1A 4MITA 1MW9X 3QENA 3F4BA 3KL4A 3CNNA 2IITA 2NPOA 3BB1A 2ODQA 3EHEA 1REQA 3P9YA 3A70A 2EZ8A 2OWEA 3VVCA 2ZB4A 2GASA 2PLAA 1NYQA 3CX4A 1P8AA 1RKBA 4TWBA 3FUXA 3HLYA 2F64A 4MKFA 4CM9D 1T25A 3C6XA 4X1OA 3EF0A 4ZGGA 3PQ2A 1DZ3A 1N1MA 3QF4A 4DIDA 1V16A 5JSFA 2VTBB 3DP9A 1OI7A 1GAQA 5FBQB 3B7GA 1G9SA 2EC5A 1G66A 1WF6A 2GVZC 2IYRA 3BCUA 3CN9A 3GJRA 3LSYA 2GVNA 4WK6A 2I66A 5TQ2B 4ECAA 1IBKB 4I9GA 4KPUA 3GVIA 4MV9A 4KN6A 2QRUA 1LK7A 3GLHE 4JSTA 1WY5A 5AW9A 4HDMA 2FF7A 2OM2A 4WCFC 5DWQA 4AJKA 2WJ4A 1B0AA 5CX1B 4C7XA 2BFCB 5BSKA 3RFXA 1JLLB 2GN1A 2ZU0C 1YKFA 3C43A 3DEZA 4RK1A 5T4BA 4M7PA 3NBAA 3KKZA 3V2UA 2WFLB 3TRDA 2QLTA 4L22A 3T3DA 1B74A 5F9HA 4KAAA 4Q3LA 3URMA 1P9WA 3X1KA 2DPHA 1GDHA 1YVPA 2JBWA 1WHSA 3ZI4A 3L0IB 5KC9A 1MNAA 3O8CA 2WKWA 4UU8A 2IP1A 4ZAVA 3L6BA 3GWZA 1VCIA 3P27A 3OF3A 1KKMA 4MR9B 1UDXA 5ALFA 5DNAA 5A5GA 1JBQA 1HUQA 2G7ZA 1XCOA 4KQKA 2IUTA 4NENB 1J1ZA 5EJ9A 4ZQCB 3M9XA 4JYMA 2PJZA 4PQEA 1E5DA 4MLZA 2ADFA 3N0VA 1TT7A 4RK5A 3OZDA 3ZKWB 5LVAA 4IR7A 1ISGA 3ROPA 4OI0A 2GYVA 2O19A 1UPXA 3D4LA 4TXNA 5GWXA 5BQFA 5MFPA 1HDYA 4ZEOA 5TEWA 5TEVA 2BCJQ 3K9QO 1ESZA 2BEWA 3TTTA 5JQGA 2I1VB 4INAA 3T9BA 2D2IA 5EFZA 3N0XA 2WT9A 3AEKB 2EKZA 3NBUA 1JZTA 4B5KA 1J39A 3MZ0A 5JNUA 2CJYA 1KI6B 4AKTA 2P0EA 3HKCB 1R0YA 2AW3A 3ST7A 5JCJA 4B6FA 1KI3A 1WA5A 2DVMA 4ENTA 4TRMA 2EKBA 1NN0A 1Y9ZA 2ZIVB 5DP1A 3CCCA 2Q1TA 1T26A 5E7MA 1DOAA 4GW3A 1S2NA 5JDCA 1U6KA 1L7EA 4GSYA 3BJEA 2HTEA 2QG4A 1FFBA 4PR0A 1XC7A 1U0FA 4GGOA 3VVLA 4KR6A 4JQSA 1CFJA 1BWQA 2NTVA 3GJQA 2ZRAA 3ZH2A 2QY6A 2YXDA 4GM4A 4CIDA 3BA1A 3INGA 3R5HA 1W7AA 4EI8A 2RCNA 4REOA 4H60A 4TTQA 4Y1EA 3TSWA 2HU8A 1DBVO 1FY2A 5JALA 1KPHA 1MFZA 4NBVA 2GXSA 3SKVA 4F5YA 4D9HA 4DNOA 1I14A 1ZGBA 2XOEA 2AB0A 3DVAB 3ISVA 2RDMA 4FHGA 5DTMA 3WO0A 1YO6A 1F5SA 3GLTA 4R8KA 4NL4H 2OV3A 3SSNA 4O4JB 1ZITA 2JGDB 3NRBA 1SGWA 1N0VC 3CUEF 2H5LA 4IH4A 1HYBA 1YB4A 3T5AA 2CBZA 5SZHB 1SUPA 4O5AA 5AVXA 3CW2A 1JFLA 1T1RA 4RZSA 3A37A 1XUOA 3H1FA 1V96A 3P9RA 1H05A 3QU5A 1ISRA 4JJ4A 3FPKA 2ESRA 5TE9A 5MF6A 1WBBA 3DO8A 2INGX 1E3SA 2I34A 2FKNA 4WEOA 4E2WA 1PFYA 3RVLA 2OV2A 2GJ9A 4RK6A 4G5GA 4M8SA 3RC9A 3KSDO 4R69A 1N92A 1KJ8A 3H9JA 3KEMA 4DWVA 3PNSA 5M04A 3P9QA 4TTSA 2E4WA 3G0IA 2QK4A 3QM1A 1DIHA 3S6JA 5ERYA 1AMNA 1N4DA 1YCFA 2C92A 1I2AA 3DDHA 3UMBA 3ZYZA 2JG3A 3CLKA 4IKOA 3WK6A 5G0SA 1N32B 1OBOA 3A0UA 4BTVA 3LA6A 1VJ0A 3SSAA 2WPNA 2MR5A 3DV2A 4Y9TA 2YOGA 3BMCB 1NAHA 4I6EA 4DUYB 1X2EA 5H9WA 2VA9A 1PJRA 1GITA 2VWHA 3HO8A 3QJ5A 2FW9A 1QIDA 3DZ8A 3OY2A 2O1SA 3WNZA 4F4JA 1SCUB 3LBFA 3D02A 4TZ0A 3LHDA 3TOSA 2AFRA 1MQAA 1ZUWA 4HS9A 4IZIA 1VRCA 2WIBA 3AUTA 3KJXA 4RE6A 2VDVE 4F96A 1V41E 4LC9A 5CLQA 4L75A 3R9WA 5HKAA 2P9YA 4G0NA 1GUAA 1XA3A 3LC1O 1ND6A 3HR8A 3VR2A 2CEKA 2Y71A 2IYAA 2Z2YA 4BV3A 2W6QA 4QM6A 4C0AC 4CKCB 1F1BA 3FAZA 3T7KA 1G5PA 4FYVA 4EQ6A 2VZ9A 3TN7A 1DKPA 2CDBA 3GUHA 4GE3A 1C1DB 4I1OA 4L0CA 4OU5A 2X1LA 4R9VA 5DXAA 4D56A 1TE2A 2EU8A 4NRDA 3RE1A 4PIPA 1QBKC 4MVJM 3VHRA 1ZQ1A 1V48A 2RHWA 3EJWA 5E4TA 2NT3A 2O8EA 2Y2UA 1WXXA 3DXYA 3FWPA 2A1UA 1KYZA 3I9FA 2Y9MB 4HUJA 2Z04A 2H1OA 4OI4A 4Q24A 4TQUS 4IHJB 1ETUA 1XXHA 5P21A 3KTAB 5CBPA 3GJYA 5KTOA 2F4NA 2QTVB 2VEOA 5LL6P 3CNLA 1MVLA 1YCGA 3KXPA 3UM9A 3IHKA 2F1RA 5AD1A 4U7GA 1E9CA 4RDIA 4D9IA 4GDFA 4WN9A 3Q41A 4C0JA 3ZY2A 1NUPA 2FUKA 3UMCA 1F8XA 1AKRA 4CEJA 2CKMA 3OLVA 2Z1MA 3GFVA 5GGXA 4BFLA 4XOUA 4M0MA 4B6RA 4RBNA 4AJHA 3G0CA 5IHPA 2VUTA 4HFJA 3E3LA 5CFQA 2P4EA 1R6UA 1O5OA 2DAPA 5HDQA 3QEOA 1Q15A 3RUPA 2FAXA 1LFAA 3SIRA 1GR0A 1JPVA 3LUBA 5HJEA 4QPJC 4XLTA 3HJBA 4RTQA 1YA6A 2IVZA 5DK6A 1XELA 1FDRA 3VYVA 2Q4TA 1PS0A 3TCKA 4KX5A 1O08A 1ZC4A 1NXSA 1YONA 2GTIA 4NBNA 4R2JA 3WYBA 10MHA 1TD1A 2H3EA 2RGBA 3FYCA 2J3LA 1Z0UA 3PNOA 1WW2A 4HP8A 4C6RA 4TKMA 1XTJA 3MT0A 4MW5A 4L2IB 3DVLA 4NC9A 4FFDA 2YL2A 3FZYA 3A4MA 1R9NA 2A9PA 1C14A 1XF1A 5CLFA 1JXOA 2EJBA 1G8GA 2DFTA 3L46A 3O3MB 1L9KA 2YBEA 4N48A 4J94A 2V74B 2J0SA 2C58A 3EXFB 2FG7C 3PJRA 4AJPA 1Q6ZA 5FTNA 3UK6A 4EYKA 1XMVA 3VV3A 3AHEA 5IAJA 3CLRC 3D81A 2LCIA 4C1NA 2A6PA 1KGDA 2ZB2A 1ZFNA 3ZV7A 2Q9BA 3JQQA 2PSHA 3UJDA 3ZZ1A 4X1KB 4AJNA 8ABPA 3AKYA 2CMGA 4YRMA 2FGJA 5SV2A 4RTOA 1YA8A 1ICIA 3DP7A 1E64A 2EXXA 2PG3A 4X44A 1JDSA 5JMPA 1TA0A 4FW8A 3I9V6 3LW8A 5DLPA 4MQFB 1T0UA 1TEVA 1D03A 1JGTA 1AKVA 2B35A 1O03A 3V8NA 5NULA 3WL8A 2EQAA 2BBWA 3MS4A 4F4DA 1UZUA 2DUJA 4HK4A 2VBCA 2XTNA 2G1PA 5EKDA 4YRAA 1G98A 1WQ4A 1E4EA 1G63A 1YUNA 1RAEA 3UUFA 3VSEA 4B3RB 5KYXA 4ERNA 4Q7EA 5D1NA 1QP8A 4CVNA 4HCJA 5E1BA 3EFOA 2VJLA 1N6PA 1DUSA 2JK0A 3VMFA 3NH6A 5IHXA 4BHTA 1S4MA 2PIAA 2BRUA 2E1RA 4HX2A 2X0EA 4AWBA 1UZAA 1EFRD 1BYIA 4M36A 1PBNA 1P5JA 2QTBA 1XR3A 5JAZA 5ULLA 5MHTA 5F9FA 4AZTA 1M75A 1V3UA 2O20A 3D9QX 4G67A 4UAVA 2HQBA 3N2NA 3TAXA 3K0BA 5JZBA 3O5AA 5IN4A 2W4QA 4G0UA 4ZVMA 1D1PA 2ATIA 2YVKA 1ZOIA 3LECA 3O4HA 3DM5A 3PJFA 1L7QA 2GJAA 2G1UA 4G24A 4U8GA 3DC2A 3ESRA 1RU3A 3CLVA 3WXBA 1I3OA 2YOHA 2MSKA 2R4QA 2G9NA 4G1FA 1JS1X 3RNLA 4BZWA 1L5VA 3JARA 1G7TA 1Z6TA 2I7TA 4DRZA 2YC4C 3NIFB 4M6WA 3CLSD 3QSGA 1QHNA 2A30A 2I6UA 1VYUA 2ZI3A 4KOEC 1R8XA 4X66B 3PUYA 1YQ9A 4J7CA 1U0RA 1KYXA 4QPZA 1SUIA 2PAFA 1LNQA 1K0UA 2DRIA 4D74A 1ZD9A 3OECA 5JATA 5IVDA 4OHUA 4COKA 3VR6A 1PQYA 5GONA 5IT9A 4E6EA 3AB3A 1T4MA 4BMYA 1BH2A 1P60A 3FKSA 3I1YA 3OFKA 1ZM3A 1U1DA 5DHPA 3M5PA 1A9SA 3FCYA 4FEYA 2ORWA 2V7QA 4NCNA 3PGA1 5ALMA 3RS9A 1FTWA 2J41A 3R3WA 4G4SO 1C7ZA 4LAFA 4BDSA 5IP5A 2CBGA 4BMDA 4YACA 1U2DC 3R3YA 4QATA 3K71B 3SEZA 4LNAA 5GOZA 2IV2X 1OLXB 2XCSB 3C6ZA 3RUFA 3G23A 1V1RA 5A02A 1C3XA 1NFRA 3CMCO 3FDFA 4R8LA 3TG8A 2I5PO 2AJTA 1OXKB 1T0IA 2G6BA 4QAJA 5JVDF 3W9UA 3FCAA 4PE5B 5EJFA 3WV4A 1QORA 3AHIA 4V0SA 1RHJA 5LA6A 1KRHA 3QP9A 3JS5A 4D8YA 3AM3A 5K6RA 3PHIA 4PYNA 4Q4AA 1MA3A 3ZIAA 4LJKA 4AZ3A 4JXKA 1HPLA 5G4KB 3WLMA 3QBEA 5E9AA 1UL1X 1UZNA 1JYFA 3IT0A 4HDQB 3WXMA 1TVEA 2TYSB 3W2HA 1UAGA 3A1FA 3EGXA 3H04A 1EFKA 1AUXA 3P0JA 4QFDA